1JKZA

Nmr solution structure of pisum sativum defensin 1 (psd1)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifungal protein
molecule keywords DEFENSE-RELATED PEPTIDE 1
publication title Solution structure of Pisum sativum defensin 1 by high resolution NMR: plant defensins, identical backbone with different mechanisms of action.
pubmed doi rcsb
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1jkzA00
1TI5A 1LQQA 1SN4A 1OMYA 1PX9A 1T0ZA 2MZ0A 1JZAA 1NPIA 3PSMA 1BRZA 2KJAA 1I2VA 2E3FA 2LR3A 1CHZA 1CN2A 2N69A 1BMRA 3E7UX 2YC1C 1ZU3A 1SEGA 1VNBA 4AEIA 1ZVGA 1JKZA 2LJMA 1BCGA 1ZUTA 1T7AA 2B3CA 2LI7A 1VNAA 1ZYWA 2YBRC 1LQHA 1JZBA 1T7EA 2GL1A 2E3GA 2B68A 1I6GA 1ZFUA 2KPYA 2LKBA 1T1TA 1WWNA 1SN1A 5KK4A 1T7BA 4UJ0A 2N66A 2LT8A 1I6FA 1WMTA 1NRAA 2ATBA 1AHOA 1P00A 2N2QA 1GPSA 1KV0A 1JXCA 1B3CA 1NH5A 1B7DA 2YEOA 4CQKA 4HHFA 2KGQA 1MYNA 4AB0A 1GPTA 2I61A 2KBKA 2M8BB 4HE7A 1ZVEA 1BK8A 1P0AA 2ASCA 2KSKA 2SN3A 3E7RL 1SNBA 1PTXA 2KBJA 1DQ7A 4KYPA 1NE5A 4V1DC 1AYJA 2KYQA 2KBHA 1ZYVA 1C56A 1MR4A 1I2UA 1L4VA 2E0HA 1N4NA 1NRBA 2LJ7A 1FH3A 1LQIA 5CY0A 2NY9X 2LY5A 1PE4A 4AAZA 1C55A 2A7TA 2LY6A 2BRZA 2N2RA 1DJTA 1OZZA 1WT7A 2NY8X 1ICAA
chains in the Genus database with same CATH superfamily
1TI5A 3ATUA 1LQQA 1SN4A 1NGCA 1OMYA 4H5WA 1PX9A 1T0ZA 3FE1A 2G2KA 4GNIA 5AQNA 1NGDA 2YIOA 2MZ0A 1JZAA 1NPIA 3PSMA 5FPNA 1BUPA 2D56A 1BRZA 4HWIA 2KJAA 1I2VA 3L56A 5AQJA 2E3FA 1KAZA 2LN8A 5F2RA 3KOYA 2LR3A 1UGLA 1NGGA 1CHZA 1NGEA 1CN2A 2N69A 5AQMA 1BMRA 1BA0A 3C7NA 5AQUA 4IO8A 3KP0A 4UADE 4H5NA 5EXWA 3E7UX 3CQXA 2YC1C 4FSVA 1ZU3A 5EX5A 3ATVA 1SEGA 3GL1A 3QMLA 1VNBA 4AEIA 1ZVGA 2E88A 1JKZA 3CW4A 5BN8A 1NGJA 1DKGD 2LJMA 1BCGA 3C7NB 1ZUTA 3IUCA 1HJOA 2K35A 2QWRA 5AQGA 1T7AA 3SF4D 2B3CA 2LI7A 5AQZA 2MBKA 1VNAA 1ZYWA 2YBRC 1LQHA 3KVGA 2QWMA 1JZBA 5BPLA 4H5VA 1T7EA 1XRSB 2E3GA 2GL1A 2QXLA 2B68A 3LDPA 5AQRA 2QWNA 1I6GA 1ZFUA 2KPYA 2LKBA 1NGBA 1T1TA 3KP1A 5AQOA 4KBOA 1WWNA 1SN1A 2YILA 5KK4A 5AQTA 1T7BA 4UJ0A 2N66A 2LT8A 1I6FA 1WMTA 1NRAA 3M3ZA 2ATBA 3JXUA 1NGAA 1QQOA 1AHOA 5BN9A 3FZFA 1QQMA 1P00A 5BPMA 2MN5A 2N2QA 4H5RA 1GPSA 1JXCA 1KV0A 3FZMA 1B3CA 3QI7A 1NGHA 1K8BA 5AQIA 2GMOA 1NH5A 1B7DA 2E2FA 3L6QA 2YEOA 4CQKA 4HHFA 5AQKA 2KGQA 1MYNA 4AB0A 1QQNA 5EVZA 3FZHA 5FPMA 1GPTA 2BUPA 5FPEA 2JDQD 1KAXA 2I61A 2KBKA 5AQSA 3D2FB 3D2EB 2M8BB 4HE7A 1S3XA 1ZVEA 2E8AA 1ATSA 1P0AA 3GDQA 3LDNA 4H5TA 1BK8A 2ASCA 2KSKA 3L4IA 5F1XA 1NGIA 1POIA 2SN3A 2V7ZA 5EY4A 3E7RL 2QWQA 3FZLA 3I33A 3LDQA 1SNBA 2VY6A 3GKUA 3BK3C 5BPNA 2QW9A 3LDLA 4UAFE 1PTXA 2KBJA 1DQ7A 5AR0A 4KYPA 2YIPA 3FZKA 5AQHA 1HX1A 1NE5A 3KOZA 2QWPA 3QFUA 4V1DC 3D2FA 1HPMA 2KYQA 3D2EA 2KBHA 3KOWA 3KOXA 5AQVA 1AYJA 1NGFA 5F0XA 1ZYVA 5AQWA 4FL9A 1C56A 1MR4A 2QWOA 1I2UA 1L4VA 3HSCA 1BA1A 1YUWA 2E0HA 1N4NA 1ATRA 1NRBA 2LJ7A 2KHOA 3R2VA 5AQLA 5FPDA 5AQPA 1FH3A 1LQIA 5CY0A 2NY9X 3AY9A 2LY5A 1PE4A 3A8YA 3QFPA 4AAZA 1C55A 2A7TA 2LY6A 1KAYA 2BRZA 2N2RA 1DJTA 1OZZA 1WT7A 2NY8X 3KC6A 3KHWA 3LDOA 5AQYA 1ICAA 5AQFA 5AQXA 2QWLA 4UAEF 5AQQA
chains in the Genus database with same CATH topology
1TI5A 1LQQA 1SN4A 1OMYA 1PX9A 1T0ZA 2MZ0A 1JZAA 1NPIA 3PSMA 1BRZA 2KJAA 1I2VA 2E3FA 2LR3A 1CHZA 1CN2A 2N69A 1BMRA 3E7UX 2YC1C 1ZU3A 1SEGA 1VNBA 4AEIA 1ZVGA 1JKZA 2LJMA 1BCGA 1ZUTA 1T7AA 2B3CA 2LI7A 1VNAA 1ZYWA 2YBRC 1LQHA 1JZBA 1T7EA 2GL1A 2E3GA 2B68A 1I6GA 1ZFUA 2KPYA 2LKBA 1T1TA 1WWNA 1SN1A 5KK4A 1T7BA 4UJ0A 2N66A 2LT8A 1I6FA 1WMTA 1NRAA 2ATBA 1AHOA 1P00A 2N2QA 1GPSA 1KV0A 1JXCA 1B3CA 1NH5A 1B7DA 2YEOA 4CQKA 4HHFA 2KGQA 1MYNA 4AB0A 1GPTA 2I61A 2KBKA 2M8BB 4HE7A 1ZVEA 1BK8A 1P0AA 2ASCA 2KSKA 2SN3A 3E7RL 1SNBA 1PTXA 2KBJA 1DQ7A 4KYPA 1NE5A 4V1DC 1AYJA 2KYQA 2KBHA 1ZYVA 1C56A 1MR4A 1I2UA 1L4VA 2E0HA 1N4NA 1NRBA 2LJ7A 1FH3A 1LQIA 5CY0A 2NY9X 2LY5A 1PE4A 4AAZA 1C55A 2A7TA 2LY6A 2BRZA 2N2RA 1DJTA 1OZZA 1WT7A 2NY8X 1ICAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TI5 A;  1LQQ A;  1SN4 A;  1OMY A;  1PX9 A;  1T0Z A;  2MZ0 A;  1JZA A;  1NPI A;  3PSM A;  1BRZ A;  2KJA A;  1I2V A;  2E3F A;  2LR3 A;  1CHZ A;  1CN2 A;  2N69 A;  1BMR A;  3E7U X;  2YC1 C;  1ZU3 A;  1SEG A;  1VNB A;  4AEI A;  1ZVG A;  1JKZ A;  2LJM A;  1BCG A;  1ZUT A;  1T7A A;  2B3C A;  2LI7 A;  1VNA A;  1ZYW A;  2YBR C;  1LQH A;  1JZB A;  1T7E A;  2GL1 A;  2E3G A;  2B68 A;  1I6G A;  1ZFU A;  2KPY A;  2LKB A;  1T1T A;  1WWN A;  1SN1 A;  5KK4 A;  1T7B A;  4UJ0 A;  2N66 A;  2LT8 A;  1I6F A;  1WMT A;  1NRA A;  2ATB A;  1AHO A;  1P00 A;  2N2Q A;  1GPS A;  1KV0 A;  1JXC A;  1B3C A;  1NH5 A;  1B7D A;  2YEO A;  4CQK A;  4HHF A;  2KGQ A;  1MYN A;  4AB0 A;  1GPT A;  2I61 A;  2KBK A;  2M8B B;  4HE7 A;  1ZVE A;  1BK8 A;  1P0A A;  2ASC A;  2KSK A;  2SN3 A;  3E7R L;  1SNB A;  1PTX A;  2KBJ A;  1DQ7 A;  4KYP A;  1NE5 A;  4V1D C;  1AYJ A;  2KYQ A;  2KBH A;  1ZYV A;  1C56 A;  1MR4 A;  1I2U A;  1L4V A;  2E0H A;  1N4N A;  1NRB A;  2LJ7 A;  1FH3 A;  1LQI A;  5CY0 A;  2NY9 X;  2LY5 A;  1PE4 A;  4AAZ A;  1C55 A;  2A7T A;  2LY6 A;  2BRZ A;  2N2R A;  1DJT A;  1OZZ A;  1WT7 A;  2NY8 X;  1ICA A; 
#chains in the Genus database with same CATH topology
 1TI5 A;  3ATU A;  1LQQ A;  1SN4 A;  1NGC A;  1OMY A;  4H5W A;  1PX9 A;  1T0Z A;  3FE1 A;  2G2K A;  4GNI A;  5AQN A;  1NGD A;  2YIO A;  2MZ0 A;  1JZA A;  1NPI A;  3PSM A;  5FPN A;  1BUP A;  2D56 A;  1BRZ A;  4HWI A;  2KJA A;  1I2V A;  3L56 A;  5AQJ A;  2E3F A;  1KAZ A;  2LN8 A;  5F2R A;  3KOY A;  2LR3 A;  1UGL A;  1NGG A;  1CHZ A;  1NGE A;  1CN2 A;  2N69 A;  5AQM A;  1BMR A;  1BA0 A;  3C7N A;  5AQU A;  4IO8 A;  3KP0 A;  4UAD E;  4H5N A;  5EXW A;  3E7U X;  3CQX A;  2YC1 C;  4FSV A;  1ZU3 A;  5EX5 A;  3ATV A;  1SEG A;  3GL1 A;  3QML A;  1VNB A;  4AEI A;  1ZVG A;  2E88 A;  1JKZ A;  3CW4 A;  5BN8 A;  1NGJ A;  1DKG D;  2LJM A;  1BCG A;  3C7N B;  1ZUT A;  3IUC A;  1HJO A;  2K35 A;  2QWR A;  5AQG A;  1T7A A;  3SF4 D;  2B3C A;  2LI7 A;  5AQZ A;  2MBK A;  1VNA A;  1ZYW A;  2YBR C;  1LQH A;  3KVG A;  2QWM A;  1JZB A;  5BPL A;  4H5V A;  1T7E A;  1XRS B;  2E3G A;  2GL1 A;  2QXL A;  2B68 A;  3LDP A;  5AQR A;  2QWN A;  1I6G A;  1ZFU A;  2KPY A;  2LKB A;  1NGB A;  1T1T A;  3KP1 A;  5AQO A;  4KBO A;  1WWN A;  1SN1 A;  2YIL A;  5KK4 A;  5AQT A;  1T7B A;  4UJ0 A;  2N66 A;  2LT8 A;  1I6F A;  1WMT A;  1NRA A;  3M3Z A;  2ATB A;  3JXU A;  1NGA A;  1QQO A;  1AHO A;  5BN9 A;  3FZF A;  1QQM A;  1P00 A;  5BPM A;  2MN5 A;  2N2Q A;  4H5R A;  1GPS A;  1JXC A;  1KV0 A;  3FZM A;  1B3C A;  3QI7 A;  1NGH A;  1K8B A;  5AQI A;  2GMO A;  1NH5 A;  1B7D A;  2E2F A;  3L6Q A;  2YEO A;  4CQK A;  4HHF A;  5AQK A;  2KGQ A;  1MYN A;  4AB0 A;  1QQN A;  5EVZ A;  3FZH A;  5FPM A;  1GPT A;  2BUP A;  5FPE A;  2JDQ D;  1KAX A;  2I61 A;  2KBK A;  5AQS A;  3D2F B;  3D2E B;  2M8B B;  4HE7 A;  1S3X A;  1ZVE A;  2E8A A;  1ATS A;  1P0A A;  3GDQ A;  3LDN A;  4H5T A;  1BK8 A;  2ASC A;  2KSK A;  3L4I A;  5F1X A;  1NGI A;  1POI A;  2SN3 A;  2V7Z A;  5EY4 A;  3E7R L;  2QWQ A;  3FZL A;  3I33 A;  3LDQ A;  1SNB A;  2VY6 A;  3GKU A;  3BK3 C;  5BPN A;  2QW9 A;  3LDL A;  4UAF E;  1PTX A;  2KBJ A;  1DQ7 A;  5AR0 A;  4KYP A;  2YIP A;  3FZK A;  5AQH A;  1HX1 A;  1NE5 A;  3KOZ A;  2QWP A;  3QFU A;  4V1D C;  3D2F A;  1HPM A;  2KYQ A;  3D2E A;  2KBH A;  3KOW A;  3KOX A;  5AQV A;  1AYJ A;  1NGF A;  5F0X A;  1ZYV A;  5AQW A;  4FL9 A;  1C56 A;  1MR4 A;  2QWO A;  1I2U A;  1L4V A;  3HSC A;  1BA1 A;  1YUW A;  2E0H A;  1N4N A;  1ATR A;  1NRB A;  2LJ7 A;  2KHO A;  3R2V A;  5AQL A;  5FPD A;  5AQP A;  1FH3 A;  1LQI A;  5CY0 A;  2NY9 X;  3AY9 A;  2LY5 A;  1PE4 A;  3A8Y A;  3QFP A;  4AAZ A;  1C55 A;  2A7T A;  2LY6 A;  1KAY A;  2BRZ A;  2N2R A;  1DJT A;  1OZZ A;  1WT7 A;  2NY8 X;  3KC6 A;  3KHW A;  3LDO A;  5AQY A;  1ICA A;  5AQF A;  5AQX A;  2QWL A;  4UAE F;  5AQQ A; 
#chains in the Genus database with same CATH homology
 1TI5 A;  1LQQ A;  1SN4 A;  1OMY A;  1PX9 A;  1T0Z A;  2MZ0 A;  1JZA A;  1NPI A;  3PSM A;  1BRZ A;  2KJA A;  1I2V A;  2E3F A;  2LR3 A;  1CHZ A;  1CN2 A;  2N69 A;  1BMR A;  3E7U X;  2YC1 C;  1ZU3 A;  1SEG A;  1VNB A;  4AEI A;  1ZVG A;  1JKZ A;  2LJM A;  1BCG A;  1ZUT A;  1T7A A;  2B3C A;  2LI7 A;  1VNA A;  1ZYW A;  2YBR C;  1LQH A;  1JZB A;  1T7E A;  2GL1 A;  2E3G A;  2B68 A;  1I6G A;  1ZFU A;  2KPY A;  2LKB A;  1T1T A;  1WWN A;  1SN1 A;  5KK4 A;  1T7B A;  4UJ0 A;  2N66 A;  2LT8 A;  1I6F A;  1WMT A;  1NRA A;  2ATB A;  1AHO A;  1P00 A;  2N2Q A;  1GPS A;  1KV0 A;  1JXC A;  1B3C A;  1NH5 A;  1B7D A;  2YEO A;  4CQK A;  4HHF A;  2KGQ A;  1MYN A;  4AB0 A;  1GPT A;  2I61 A;  2KBK A;  2M8B B;  4HE7 A;  1ZVE A;  1BK8 A;  1P0A A;  2ASC A;  2KSK A;  2SN3 A;  3E7R L;  1SNB A;  1PTX A;  2KBJ A;  1DQ7 A;  4KYP A;  1NE5 A;  4V1D C;  1AYJ A;  2KYQ A;  2KBH A;  1ZYV A;  1C56 A;  1MR4 A;  1I2U A;  1L4V A;  2E0H A;  1N4N A;  1NRB A;  2LJ7 A;  1FH3 A;  1LQI A;  5CY0 A;  2NY9 X;  2LY5 A;  1PE4 A;  4AAZ A;  1C55 A;  2A7T A;  2LY6 A;  2BRZ A;  2N2R A;  1DJT A;  1OZZ A;  1WT7 A;  2NY8 X;  1ICA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...