4AEIA

Crystal structure of the aahii-fab4c1 complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/toxin
molecule keywords ALPHA-MAMMAL TOXIN AAH2
publication title Structural Insights Into Antibody Sequestering and Neutralizing of Na+-Channel & [Alpha]-Type Modulator from Old-World Scorpion Venom
pubmed doi rcsb
total genus 19
structure length 64
sequence length 64
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4aeiA00
1NRAA 1MR4A 2KBJA 1P00A 1GPSA 1SNBA 1SEGA 1ICAA 2YEOA 2LR3A 2LY5A 2KBHA 2KYQA 2SN3A 1WWNA 5CY0A 1LQQA 4UJ0A 1T7BA 5KK4A 1PTXA 2A7TA 2NY8X 1DQ7A 2LJMA 2LT8A 1T0ZA 1ZVGA 1ZVEA 1BCGA 1JZAA 1SN1A 1NPIA 1T1TA 1FH3A 1C56A 1BK8A 1PX9A 2E3GA 2GL1A 2KSKA 1JZBA 1I6GA 4V1DC 1BMRA 2N66A 2NY9X 1GPTA 1CN2A 4AB0A 1LQHA 2MZ0A 1I6FA 4CQKA 1PE4A 2KPYA 2LI7A 2YC1C 1ZYVA 1JKZA 1WT7A 2N2RA 1NE5A 2B68A 2BRZA 2LKBA 2YBRC 2LJ7A 1N4NA 1SN4A 1NRBA 1OMYA 1I2UA 1VNAA 2KBKA 1I2VA 2KJAA 1ZU3A 1JXCA 1CHZA 4HE7A 3E7UX 3E7RL 3PSMA 1P0AA 2N2QA 2ATBA 1NH5A 2B3CA 1WMTA 1ZUTA 2LY6A 1KV0A 2E0HA 1C55A 4AEIA 1TI5A 1ZYWA 2I61A 1BRZA 2E3FA 1T7AA 2KGQA 1AYJA 4HHFA 1LQIA 1T7EA 2ASCA 1B3CA 1DJTA 1B7DA 1MYNA 2N69A 1OZZA 1AHOA 1L4VA 1ZFUA 1VNBA 4KYPA 4AAZA 2M8BB
chains in the Genus database with same CATH superfamily
3LDNA 1NRAA 1MR4A 2KBJA 1P00A 4UAFE 5AQTA 1GPSA 1SNBA 5AQGA 2QWPA 5AQQA 1SEGA 1BUPA 1UGLA 5AQKA 5AQRA 4H5RA 5F0XA 1ICAA 2YEOA 2LR3A 2LY5A 1KAZA 2KBHA 3GKUA 2KYQA 2SN3A 1WWNA 1NGBA 2E2FA 3L6QA 5EX5A 3R2VA 5CY0A 3CW4A 1LQQA 3I33A 4UADE 4UJ0A 1T7BA 5KK4A 1PTXA 2A7TA 3FE1A 2NY8X 1K8BA 1DQ7A 2LJMA 2LT8A 5AQIA 2MBKA 1T0ZA 3LDLA 1ZVGA 1ZVEA 2KHOA 3IUCA 2QWNA 1BCGA 1JZAA 1SN1A 1NPIA 5AQWA 3HSCA 3AY9A 3KOYA 1T1TA 2VY6A 1C56A 1NGJA 5BPLA 1BK8A 1PX9A 2YIPA 2E3GA 1FH3A 2GL1A 1NGCA 4H5TA 5EVZA 2KSKA 1JZBA 1I6GA 3QI7A 5BPMA 4V1DC 3LDQA 2N66A 2NY9X 3CQXA 3FZMA 4H5VA 3FZHA 4AB0A 4KBOA 1LQHA 5AQVA 5AQUA 5BPNA 2BUPA 2MZ0A 5AQPA 3FZKA 3KVGA 1I6FA 4CQKA 1PE4A 2KPYA 2LI7A 2V7ZA 2YC1C 1ZYVA 1JKZA 1WT7A 2N2RA 1NE5A 3KP1A 2B68A 2BRZA 2G2KA 2LKBA 2YBRC 3D2FB 3KOXA 1KAYA 4FSVA 1BA1A 2MN5A 1QQMA 2LJ7A 1N4NA 3JXUA 1SN4A 1NRBA 1OMYA 5AQXA 2QWRA 3LDPA 5BN8A 5EY4A 1ATRA 1I2UA 3KP0A 5AQHA 1VNAA 1NGEA 5F1XA 2E8AA 3KOZA 1S3XA 2QWQA 1CN2A 3QFPA 2KBKA 1I2VA 1BA0A 2KJAA 3L56A 1ZU3A 1JXCA 1CHZA 3M3ZA 1NGHA 2GMOA 2QW9A 3L4IA 1NGGA 1HPMA 3GDQA 5BN9A 1POIA 3C7NB 1NGFA 2QWOA 2YIOA 3E7UX 4HE7A 5AQOA 5AQNA 3SF4D 3LDOA 4IO8A 3E7RL 2E88A 3FZFA 3PSMA 4GNIA 1P0AA 2N2QA 4HWIA 2ATBA 1NH5A 3QMLA 2B3CA 4H5WA 5AQFA 1WMTA 3D2EB 5EXWA 1ZUTA 1BMRA 3KOWA 1GPTA 3BK3C 3FZLA 3KC6A 5AQYA 1NGIA 1DKGD 2LY6A 1KV0A 2E0HA 1C55A 5AR0A 4AEIA 3D2FA 1TI5A 1HX1A 1ZYWA 5AQJA 2I61A 1BRZA 1ATSA 2E3FA 5AQSA 1NGAA 3QFUA 1HJOA 1T7AA 3A8YA 1QQNA 2KGQA 3ATUA 3ATVA 1AYJA 4HHFA 3KHWA 5FPEA 2QWMA 5FPDA 1KAXA 1LQIA 1T7EA 2D56A 2ASCA 2QWLA 1B3CA 1DJTA 1B7DA 1XRSB 1NGDA 1MYNA 1QQOA 3GL1A 2LN8A 2YILA 1YUWA 2JDQD 2N69A 3C7NA 5AQMA 1OZZA 5FPNA 1AHOA 4UAEF 4FL9A 1L4VA 2QXLA 4H5NA 1ZFUA 5F2RA 1VNBA 5AQLA 4KYPA 5AQZA 4AAZA 2K35A 5FPMA 2M8BB 3D2EA
chains in the Genus database with same CATH topology
1NRAA 1MR4A 2KBJA 1P00A 1GPSA 1SNBA 1SEGA 1ICAA 2YEOA 2LR3A 2LY5A 2KBHA 2KYQA 2SN3A 1WWNA 5CY0A 1LQQA 4UJ0A 1T7BA 5KK4A 1PTXA 2A7TA 2NY8X 1DQ7A 2LJMA 2LT8A 1T0ZA 1ZVGA 1ZVEA 1BCGA 1JZAA 1SN1A 1NPIA 1T1TA 1FH3A 1C56A 1BK8A 1PX9A 2E3GA 2GL1A 2KSKA 1JZBA 1I6GA 4V1DC 1BMRA 2N66A 2NY9X 1GPTA 1CN2A 4AB0A 1LQHA 2MZ0A 1I6FA 4CQKA 1PE4A 2KPYA 2LI7A 2YC1C 1ZYVA 1JKZA 1WT7A 2N2RA 1NE5A 2B68A 2BRZA 2LKBA 2YBRC 2LJ7A 1N4NA 1SN4A 1NRBA 1OMYA 1I2UA 1VNAA 2KBKA 1I2VA 2KJAA 1ZU3A 1JXCA 1CHZA 4HE7A 3E7UX 3E7RL 3PSMA 1P0AA 2N2QA 2ATBA 1NH5A 2B3CA 1WMTA 1ZUTA 2LY6A 1KV0A 2E0HA 1C55A 4AEIA 1TI5A 1ZYWA 2I61A 1BRZA 2E3FA 1T7AA 2KGQA 1AYJA 4HHFA 1LQIA 1T7EA 2ASCA 1B3CA 1DJTA 1B7DA 1MYNA 2N69A 1OZZA 1AHOA 1L4VA 1ZFUA 1VNBA 4KYPA 4AAZA 2M8BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NRA A;  1MR4 A;  2KBJ A;  1P00 A;  1GPS A;  1SNB A;  1SEG A;  1ICA A;  2YEO A;  2LR3 A;  2LY5 A;  2KBH A;  2KYQ A;  2SN3 A;  1WWN A;  5CY0 A;  1LQQ A;  4UJ0 A;  1T7B A;  5KK4 A;  1PTX A;  2A7T A;  2NY8 X;  1DQ7 A;  2LJM A;  2LT8 A;  1T0Z A;  1ZVG A;  1ZVE A;  1BCG A;  1JZA A;  1SN1 A;  1NPI A;  1T1T A;  1FH3 A;  1C56 A;  1BK8 A;  1PX9 A;  2E3G A;  2GL1 A;  2KSK A;  1JZB A;  1I6G A;  4V1D C;  1BMR A;  2N66 A;  2NY9 X;  1GPT A;  1CN2 A;  4AB0 A;  1LQH A;  2MZ0 A;  1I6F A;  4CQK A;  1PE4 A;  2KPY A;  2LI7 A;  2YC1 C;  1ZYV A;  1JKZ A;  1WT7 A;  2N2R A;  1NE5 A;  2B68 A;  2BRZ A;  2LKB A;  2YBR C;  2LJ7 A;  1N4N A;  1SN4 A;  1NRB A;  1OMY A;  1I2U A;  1VNA A;  2KBK A;  1I2V A;  2KJA A;  1ZU3 A;  1JXC A;  1CHZ A;  4HE7 A;  3E7U X;  3E7R L;  3PSM A;  1P0A A;  2N2Q A;  2ATB A;  1NH5 A;  2B3C A;  1WMT A;  1ZUT A;  2LY6 A;  1KV0 A;  2E0H A;  1C55 A;  4AEI A;  1TI5 A;  1ZYW A;  2I61 A;  1BRZ A;  2E3F A;  1T7A A;  2KGQ A;  1AYJ A;  4HHF A;  1LQI A;  1T7E A;  2ASC A;  1B3C A;  1DJT A;  1B7D A;  1MYN A;  2N69 A;  1OZZ A;  1AHO A;  1L4V A;  1ZFU A;  1VNB A;  4KYP A;  4AAZ A;  2M8B B; 
#chains in the Genus database with same CATH topology
 3LDN A;  1NRA A;  1MR4 A;  2KBJ A;  1P00 A;  4UAF E;  5AQT A;  1GPS A;  1SNB A;  5AQG A;  2QWP A;  5AQQ A;  1SEG A;  1BUP A;  1UGL A;  5AQK A;  5AQR A;  4H5R A;  5F0X A;  1ICA A;  2YEO A;  2LR3 A;  2LY5 A;  1KAZ A;  2KBH A;  3GKU A;  2KYQ A;  2SN3 A;  1WWN A;  1NGB A;  2E2F A;  3L6Q A;  5EX5 A;  3R2V A;  5CY0 A;  3CW4 A;  1LQQ A;  3I33 A;  4UAD E;  4UJ0 A;  1T7B A;  5KK4 A;  1PTX A;  2A7T A;  3FE1 A;  2NY8 X;  1K8B A;  1DQ7 A;  2LJM A;  2LT8 A;  5AQI A;  2MBK A;  1T0Z A;  3LDL A;  1ZVG A;  1ZVE A;  2KHO A;  3IUC A;  2QWN A;  1BCG A;  1JZA A;  1SN1 A;  1NPI A;  5AQW A;  3HSC A;  3AY9 A;  3KOY A;  1T1T A;  2VY6 A;  1C56 A;  1NGJ A;  5BPL A;  1BK8 A;  1PX9 A;  2YIP A;  2E3G A;  1FH3 A;  2GL1 A;  1NGC A;  4H5T A;  5EVZ A;  2KSK A;  1JZB A;  1I6G A;  3QI7 A;  5BPM A;  4V1D C;  3LDQ A;  2N66 A;  2NY9 X;  3CQX A;  3FZM A;  4H5V A;  3FZH A;  4AB0 A;  4KBO A;  1LQH A;  5AQV A;  5AQU A;  5BPN A;  2BUP A;  2MZ0 A;  5AQP A;  3FZK A;  3KVG A;  1I6F A;  4CQK A;  1PE4 A;  2KPY A;  2LI7 A;  2V7Z A;  2YC1 C;  1ZYV A;  1JKZ A;  1WT7 A;  2N2R A;  1NE5 A;  3KP1 A;  2B68 A;  2BRZ A;  2G2K A;  2LKB A;  2YBR C;  3D2F B;  3KOX A;  1KAY A;  4FSV A;  1BA1 A;  2MN5 A;  1QQM A;  2LJ7 A;  1N4N A;  3JXU A;  1SN4 A;  1NRB A;  1OMY A;  5AQX A;  2QWR A;  3LDP A;  5BN8 A;  5EY4 A;  1ATR A;  1I2U A;  3KP0 A;  5AQH A;  1VNA A;  1NGE A;  5F1X A;  2E8A A;  3KOZ A;  1S3X A;  2QWQ A;  1CN2 A;  3QFP A;  2KBK A;  1I2V A;  1BA0 A;  2KJA A;  3L56 A;  1ZU3 A;  1JXC A;  1CHZ A;  3M3Z A;  1NGH A;  2GMO A;  2QW9 A;  3L4I A;  1NGG A;  1HPM A;  3GDQ A;  5BN9 A;  1POI A;  3C7N B;  1NGF A;  2QWO A;  2YIO A;  3E7U X;  4HE7 A;  5AQO A;  5AQN A;  3SF4 D;  3LDO A;  4IO8 A;  3E7R L;  2E88 A;  3FZF A;  3PSM A;  4GNI A;  1P0A A;  2N2Q A;  4HWI A;  2ATB A;  1NH5 A;  3QML A;  2B3C A;  4H5W A;  5AQF A;  1WMT A;  3D2E B;  5EXW A;  1ZUT A;  1BMR A;  3KOW A;  1GPT A;  3BK3 C;  3FZL A;  3KC6 A;  5AQY A;  1NGI A;  1DKG D;  2LY6 A;  1KV0 A;  2E0H A;  1C55 A;  5AR0 A;  4AEI A;  3D2F A;  1TI5 A;  1HX1 A;  1ZYW A;  5AQJ A;  2I61 A;  1BRZ A;  1ATS A;  2E3F A;  5AQS A;  1NGA A;  3QFU A;  1HJO A;  1T7A A;  3A8Y A;  1QQN A;  2KGQ A;  3ATU A;  3ATV A;  1AYJ A;  4HHF A;  3KHW A;  5FPE A;  2QWM A;  5FPD A;  1KAX A;  1LQI A;  1T7E A;  2D56 A;  2ASC A;  2QWL A;  1B3C A;  1DJT A;  1B7D A;  1XRS B;  1NGD A;  1MYN A;  1QQO A;  3GL1 A;  2LN8 A;  2YIL A;  1YUW A;  2JDQ D;  2N69 A;  3C7N A;  5AQM A;  1OZZ A;  5FPN A;  1AHO A;  4UAE F;  4FL9 A;  1L4V A;  2QXL A;  4H5N A;  1ZFU A;  5F2R A;  1VNB A;  5AQL A;  4KYP A;  5AQZ A;  4AAZ A;  2K35 A;  5FPM A;  2M8B B;  3D2E A; 
#chains in the Genus database with same CATH homology
 1NRA A;  1MR4 A;  2KBJ A;  1P00 A;  1GPS A;  1SNB A;  1SEG A;  1ICA A;  2YEO A;  2LR3 A;  2LY5 A;  2KBH A;  2KYQ A;  2SN3 A;  1WWN A;  5CY0 A;  1LQQ A;  4UJ0 A;  1T7B A;  5KK4 A;  1PTX A;  2A7T A;  2NY8 X;  1DQ7 A;  2LJM A;  2LT8 A;  1T0Z A;  1ZVG A;  1ZVE A;  1BCG A;  1JZA A;  1SN1 A;  1NPI A;  1T1T A;  1FH3 A;  1C56 A;  1BK8 A;  1PX9 A;  2E3G A;  2GL1 A;  2KSK A;  1JZB A;  1I6G A;  4V1D C;  1BMR A;  2N66 A;  2NY9 X;  1GPT A;  1CN2 A;  4AB0 A;  1LQH A;  2MZ0 A;  1I6F A;  4CQK A;  1PE4 A;  2KPY A;  2LI7 A;  2YC1 C;  1ZYV A;  1JKZ A;  1WT7 A;  2N2R A;  1NE5 A;  2B68 A;  2BRZ A;  2LKB A;  2YBR C;  2LJ7 A;  1N4N A;  1SN4 A;  1NRB A;  1OMY A;  1I2U A;  1VNA A;  2KBK A;  1I2V A;  2KJA A;  1ZU3 A;  1JXC A;  1CHZ A;  4HE7 A;  3E7U X;  3E7R L;  3PSM A;  1P0A A;  2N2Q A;  2ATB A;  1NH5 A;  2B3C A;  1WMT A;  1ZUT A;  2LY6 A;  1KV0 A;  2E0H A;  1C55 A;  4AEI A;  1TI5 A;  1ZYW A;  2I61 A;  1BRZ A;  2E3F A;  1T7A A;  2KGQ A;  1AYJ A;  4HHF A;  1LQI A;  1T7E A;  2ASC A;  1B3C A;  1DJT A;  1B7D A;  1MYN A;  2N69 A;  1OZZ A;  1AHO A;  1L4V A;  1ZFU A;  1VNB A;  4KYP A;  4AAZ A;  2M8B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...