4UJ0A

Crystal structure of the tomato defensin tpp3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
48
structure length
48
Chain Sequence
QQICKAPSQTFPGLCFMDSSCRKYCIKEKFTGGHCSKLQRKCLCTKPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords FLOWER-SPECIFIC GAMMA-THIONIN-LIKE PROTEIN/ACIDIC PROTEIN
publication title The Tomato Defensin Tpp3 Binds Phosphatidylinositol (4,5)-Bisphosphate Via a Conserved Dimeric Cationic Grip Conformation to Mediate Cell Lysis.
pubmed doi rcsb
source organism Solanum lycopersicum
total genus 11
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4uj0A00
1NE5A 2N69A 1KV0A 1GPTA 1PX9A 1GPSA 3E7UX 2LJ7A 2KPYA 1VNAA 1N4NA 4V1DC 1OZZA 1JXCA 1B7DA 1JZAA 2A7TA 2B3CA 1MR4A 1ZU3A 1I6FA 2LY6A 5CY0A 1LQIA 1DJTA 2M8BB 2B68A 1T7AA 1AHOA 1ICAA 1C56A 1LQHA 2ASCA 1T1TA 3E7RL 1CN2A 5KK4A 1BMRA 2KBJA 1T7EA 1MYNA 1TI5A 1I6GA 1NRAA 1L4VA 1BRZA 4AEIA 1SEGA 1SN1A 1ZFUA 1ZYWA 2E0HA 3PSMA 1ZYVA 2YEOA 2KBKA 2E3GA 2KGQA 1C55A 2NY9X 2N66A 2LR3A 1BCGA 1T7BA 4HHFA 2KSKA 1JZBA 4AAZA 1NRBA 1PTXA 1ZVGA 1JKZA 1WMTA 1P0AA 1SNBA 2YBRC 1VNBA 2NY8X 1ZUTA 2LY5A 1PE4A 2GL1A 1LQQA 1NH5A 4AB0A 4HE7A 2KBHA 2LKBA 1CHZA 4KYPA 1ZVEA 1P00A 2LI7A 2E3FA 1B3CA 2LJMA 2LT8A 1AYJA 2KJAA 1WWNA 2ATBA 4CQKA 2SN3A 1SN4A 1DQ7A 2MZ0A 4UJ0A 1I2UA 1FH3A 2N2RA 1I2VA 1WT7A 2KYQA 2I61A 2N2QA 2YC1C 1T0ZA 2BRZA 1BK8A 1NPIA 1OMYA
chains in the Genus database with same CATH superfamily
4HWIA 1NE5A 4UAFE 3KOZA 1POIA 1QQOA 2N69A 1KV0A 4H5WA 1GPTA 1PX9A 4UADE 5AQJA 3D2FB 3C7NB 1GPSA 3LDLA 3E7UX 2LJ7A 2KPYA 2E8AA 3QI7A 1VNAA 1N4NA 2D56A 4V1DC 5AQVA 5EVZA 1NGEA 5BPLA 3KOXA 1BA1A 1OZZA 1JXCA 1B7DA 1JZAA 2E2FA 2QW9A 2A7TA 3M3ZA 2B3CA 3CQXA 3I33A 3LDOA 1MR4A 1ZU3A 1I6FA 2LY6A 3A8YA 1LQIA 1NGDA 3QMLA 1DJTA 2M8BB 5AQSA 2B68A 4KBOA 5AQHA 3KVGA 1K8BA 2GMOA 3FZHA 3FZFA 5EXWA 2YIPA 3L4IA 1T7AA 1AHOA 1ICAA 1C56A 1LQHA 2ASCA 1T1TA 3E7RL 5AQPA 1CN2A 3AY9A 3KHWA 1UGLA 5BN9A 1ATRA 5AQGA 5BN8A 3BK3C 5KK4A 1BMRA 2BUPA 2KBJA 5AQKA 1T7EA 1MYNA 1TI5A 1ATSA 1YUWA 2QWRA 3L56A 1NGAA 5FPNA 5AQUA 3GL1A 5AQIA 1I6GA 1NRAA 1HPMA 1L4VA 1BRZA 4FL9A 4AEIA 1NGBA 1SEGA 1SN1A 1KAXA 1ZFUA 4GNIA 5AQNA 3FZLA 1NGCA 1ZYWA 3KC6A 3LDNA 3SF4D 2YIOA 2E0HA 3LDQA 3KP1A 3PSMA 1ZYVA 2YEOA 3CW4A 2LN8A 2KBKA 2E3GA 1NGGA 2YILA 2KGQA 2MN5A 2KHOA 3HSCA 5AQQA 1C55A 5AQWA 2NY9X 2MBKA 5AQRA 2N66A 2LR3A 1BCGA 1DKGD 3C7NA 3D2FA 5AQMA 1T7BA 4HHFA 2KSKA 1HJOA 3KOWA 3L6QA 3ATVA 1KAYA 3QFUA 5CY0A 5FPEA 1JZBA 1QQNA 4AAZA 5AQLA 1NRBA 1PTXA 1ZVGA 3FZMA 1WMTA 2QWQA 1P0AA 3R2VA 5AQFA 1SNBA 5BPMA 2YBRC 1VNBA 2NY8X 4FSVA 3IUCA 1QQMA 1KAZA 1ZUTA 3KP0A 2LY5A 1PE4A 2GL1A 1LQQA 1NH5A 3D2EA 2QWPA 3FE1A 5FPDA 1S3XA 4AB0A 4HE7A 2KBHA 2LKBA 5AQXA 2E88A 1CHZA 5F1XA 5AQYA 1HX1A 3JXUA 4KYPA 1ZVEA 5AQOA 1P00A 2LI7A 2E3FA 2VY6A 1B3CA 4UAEF 4H5TA 3ATUA 5BPNA 4H5NA 1NGIA 2LJMA 2LT8A 5F2RA 5F0XA 2QWNA 2QWLA 1AYJA 4IO8A 1XRSB 2G2KA 2KJAA 3FZKA 3GKUA 4H5VA 1WWNA 1NGFA 2ATBA 5FPMA 4CQKA 3KOYA 2SN3A 1SN4A 1DQ7A 2MZ0A 2K35A 3LDPA 5EY4A 4UJ0A 1BA0A 5AQTA 3QFPA 1I2UA 5EX5A 3GDQA 1FH3A 1NGJA 3D2EB 5AR0A 2QWOA 2N2RA 2QXLA 1WT7A 1I2VA 2KYQA 2I61A 2N2QA 2V7ZA 2YC1C 1T0ZA 2BRZA 2JDQD 4H5RA 1BK8A 1JKZA 1BUPA 5AQZA 1NPIA 1NGHA 2QWMA 1OMYA
chains in the Genus database with same CATH topology
1NE5A 2N69A 1KV0A 1GPTA 1PX9A 1GPSA 3E7UX 2LJ7A 2KPYA 1VNAA 1N4NA 4V1DC 1OZZA 1JXCA 1B7DA 1JZAA 2A7TA 2B3CA 1MR4A 1ZU3A 1I6FA 2LY6A 5CY0A 1LQIA 1DJTA 2M8BB 2B68A 1T7AA 1AHOA 1ICAA 1C56A 1LQHA 2ASCA 1T1TA 3E7RL 1CN2A 5KK4A 1BMRA 2KBJA 1T7EA 1MYNA 1TI5A 1I6GA 1NRAA 1L4VA 1BRZA 4AEIA 1SEGA 1SN1A 1ZFUA 1ZYWA 2E0HA 3PSMA 1ZYVA 2YEOA 2KBKA 2E3GA 2KGQA 1C55A 2NY9X 2N66A 2LR3A 1BCGA 1T7BA 4HHFA 2KSKA 1JZBA 4AAZA 1NRBA 1PTXA 1ZVGA 1JKZA 1WMTA 1P0AA 1SNBA 2YBRC 1VNBA 2NY8X 1ZUTA 2LY5A 1PE4A 2GL1A 1LQQA 1NH5A 4AB0A 4HE7A 2KBHA 2LKBA 1CHZA 4KYPA 1ZVEA 1P00A 2LI7A 2E3FA 1B3CA 2LJMA 2LT8A 1AYJA 2KJAA 1WWNA 2ATBA 4CQKA 2SN3A 1SN4A 1DQ7A 2MZ0A 4UJ0A 1I2UA 1FH3A 2N2RA 1I2VA 1WT7A 2KYQA 2I61A 2N2QA 2YC1C 1T0ZA 2BRZA 1BK8A 1NPIA 1OMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NE5 A;  2N69 A;  1KV0 A;  1GPT A;  1PX9 A;  1GPS A;  3E7U X;  2LJ7 A;  2KPY A;  1VNA A;  1N4N A;  4V1D C;  1OZZ A;  1JXC A;  1B7D A;  1JZA A;  2A7T A;  2B3C A;  1MR4 A;  1ZU3 A;  1I6F A;  2LY6 A;  5CY0 A;  1LQI A;  1DJT A;  2M8B B;  2B68 A;  1T7A A;  1AHO A;  1ICA A;  1C56 A;  1LQH A;  2ASC A;  1T1T A;  3E7R L;  1CN2 A;  5KK4 A;  1BMR A;  2KBJ A;  1T7E A;  1MYN A;  1TI5 A;  1I6G A;  1NRA A;  1L4V A;  1BRZ A;  4AEI A;  1SEG A;  1SN1 A;  1ZFU A;  1ZYW A;  2E0H A;  3PSM A;  1ZYV A;  2YEO A;  2KBK A;  2E3G A;  2KGQ A;  1C55 A;  2NY9 X;  2N66 A;  2LR3 A;  1BCG A;  1T7B A;  4HHF A;  2KSK A;  1JZB A;  4AAZ A;  1NRB A;  1PTX A;  1ZVG A;  1JKZ A;  1WMT A;  1P0A A;  1SNB A;  2YBR C;  1VNB A;  2NY8 X;  1ZUT A;  2LY5 A;  1PE4 A;  2GL1 A;  1LQQ A;  1NH5 A;  4AB0 A;  4HE7 A;  2KBH A;  2LKB A;  1CHZ A;  4KYP A;  1ZVE A;  1P00 A;  2LI7 A;  2E3F A;  1B3C A;  2LJM A;  2LT8 A;  1AYJ A;  2KJA A;  1WWN A;  2ATB A;  4CQK A;  2SN3 A;  1SN4 A;  1DQ7 A;  2MZ0 A;  4UJ0 A;  1I2U A;  1FH3 A;  2N2R A;  1I2V A;  1WT7 A;  2KYQ A;  2I61 A;  2N2Q A;  2YC1 C;  1T0Z A;  2BRZ A;  1BK8 A;  1NPI A;  1OMY A; 
#chains in the Genus database with same CATH topology
 4HWI A;  1NE5 A;  4UAF E;  3KOZ A;  1POI A;  1QQO A;  2N69 A;  1KV0 A;  4H5W A;  1GPT A;  1PX9 A;  4UAD E;  5AQJ A;  3D2F B;  3C7N B;  1GPS A;  3LDL A;  3E7U X;  2LJ7 A;  2KPY A;  2E8A A;  3QI7 A;  1VNA A;  1N4N A;  2D56 A;  4V1D C;  5AQV A;  5EVZ A;  1NGE A;  5BPL A;  3KOX A;  1BA1 A;  1OZZ A;  1JXC A;  1B7D A;  1JZA A;  2E2F A;  2QW9 A;  2A7T A;  3M3Z A;  2B3C A;  3CQX A;  3I33 A;  3LDO A;  1MR4 A;  1ZU3 A;  1I6F A;  2LY6 A;  3A8Y A;  1LQI A;  1NGD A;  3QML A;  1DJT A;  2M8B B;  5AQS A;  2B68 A;  4KBO A;  5AQH A;  3KVG A;  1K8B A;  2GMO A;  3FZH A;  3FZF A;  5EXW A;  2YIP A;  3L4I A;  1T7A A;  1AHO A;  1ICA A;  1C56 A;  1LQH A;  2ASC A;  1T1T A;  3E7R L;  5AQP A;  1CN2 A;  3AY9 A;  3KHW A;  1UGL A;  5BN9 A;  1ATR A;  5AQG A;  5BN8 A;  3BK3 C;  5KK4 A;  1BMR A;  2BUP A;  2KBJ A;  5AQK A;  1T7E A;  1MYN A;  1TI5 A;  1ATS A;  1YUW A;  2QWR A;  3L56 A;  1NGA A;  5FPN A;  5AQU A;  3GL1 A;  5AQI A;  1I6G A;  1NRA A;  1HPM A;  1L4V A;  1BRZ A;  4FL9 A;  4AEI A;  1NGB A;  1SEG A;  1SN1 A;  1KAX A;  1ZFU A;  4GNI A;  5AQN A;  3FZL A;  1NGC A;  1ZYW A;  3KC6 A;  3LDN A;  3SF4 D;  2YIO A;  2E0H A;  3LDQ A;  3KP1 A;  3PSM A;  1ZYV A;  2YEO A;  3CW4 A;  2LN8 A;  2KBK A;  2E3G A;  1NGG A;  2YIL A;  2KGQ A;  2MN5 A;  2KHO A;  3HSC A;  5AQQ A;  1C55 A;  5AQW A;  2NY9 X;  2MBK A;  5AQR A;  2N66 A;  2LR3 A;  1BCG A;  1DKG D;  3C7N A;  3D2F A;  5AQM A;  1T7B A;  4HHF A;  2KSK A;  1HJO A;  3KOW A;  3L6Q A;  3ATV A;  1KAY A;  3QFU A;  5CY0 A;  5FPE A;  1JZB A;  1QQN A;  4AAZ A;  5AQL A;  1NRB A;  1PTX A;  1ZVG A;  3FZM A;  1WMT A;  2QWQ A;  1P0A A;  3R2V A;  5AQF A;  1SNB A;  5BPM A;  2YBR C;  1VNB A;  2NY8 X;  4FSV A;  3IUC A;  1QQM A;  1KAZ A;  1ZUT A;  3KP0 A;  2LY5 A;  1PE4 A;  2GL1 A;  1LQQ A;  1NH5 A;  3D2E A;  2QWP A;  3FE1 A;  5FPD A;  1S3X A;  4AB0 A;  4HE7 A;  2KBH A;  2LKB A;  5AQX A;  2E88 A;  1CHZ A;  5F1X A;  5AQY A;  1HX1 A;  3JXU A;  4KYP A;  1ZVE A;  5AQO A;  1P00 A;  2LI7 A;  2E3F A;  2VY6 A;  1B3C A;  4UAE F;  4H5T A;  3ATU A;  5BPN A;  4H5N A;  1NGI A;  2LJM A;  2LT8 A;  5F2R A;  5F0X A;  2QWN A;  2QWL A;  1AYJ A;  4IO8 A;  1XRS B;  2G2K A;  2KJA A;  3FZK A;  3GKU A;  4H5V A;  1WWN A;  1NGF A;  2ATB A;  5FPM A;  4CQK A;  3KOY A;  2SN3 A;  1SN4 A;  1DQ7 A;  2MZ0 A;  2K35 A;  3LDP A;  5EY4 A;  4UJ0 A;  1BA0 A;  5AQT A;  3QFP A;  1I2U A;  5EX5 A;  3GDQ A;  1FH3 A;  1NGJ A;  3D2E B;  5AR0 A;  2QWO A;  2N2R A;  2QXL A;  1WT7 A;  1I2V A;  2KYQ A;  2I61 A;  2N2Q A;  2V7Z A;  2YC1 C;  1T0Z A;  2BRZ A;  2JDQ D;  4H5R A;  1BK8 A;  1JKZ A;  1BUP A;  5AQZ A;  1NPI A;  1NGH A;  2QWM A;  1OMY A; 
#chains in the Genus database with same CATH homology
 1NE5 A;  2N69 A;  1KV0 A;  1GPT A;  1PX9 A;  1GPS A;  3E7U X;  2LJ7 A;  2KPY A;  1VNA A;  1N4N A;  4V1D C;  1OZZ A;  1JXC A;  1B7D A;  1JZA A;  2A7T A;  2B3C A;  1MR4 A;  1ZU3 A;  1I6F A;  2LY6 A;  5CY0 A;  1LQI A;  1DJT A;  2M8B B;  2B68 A;  1T7A A;  1AHO A;  1ICA A;  1C56 A;  1LQH A;  2ASC A;  1T1T A;  3E7R L;  1CN2 A;  5KK4 A;  1BMR A;  2KBJ A;  1T7E A;  1MYN A;  1TI5 A;  1I6G A;  1NRA A;  1L4V A;  1BRZ A;  4AEI A;  1SEG A;  1SN1 A;  1ZFU A;  1ZYW A;  2E0H A;  3PSM A;  1ZYV A;  2YEO A;  2KBK A;  2E3G A;  2KGQ A;  1C55 A;  2NY9 X;  2N66 A;  2LR3 A;  1BCG A;  1T7B A;  4HHF A;  2KSK A;  1JZB A;  4AAZ A;  1NRB A;  1PTX A;  1ZVG A;  1JKZ A;  1WMT A;  1P0A A;  1SNB A;  2YBR C;  1VNB A;  2NY8 X;  1ZUT A;  2LY5 A;  1PE4 A;  2GL1 A;  1LQQ A;  1NH5 A;  4AB0 A;  4HE7 A;  2KBH A;  2LKB A;  1CHZ A;  4KYP A;  1ZVE A;  1P00 A;  2LI7 A;  2E3F A;  1B3C A;  2LJM A;  2LT8 A;  1AYJ A;  2KJA A;  1WWN A;  2ATB A;  4CQK A;  2SN3 A;  1SN4 A;  1DQ7 A;  2MZ0 A;  4UJ0 A;  1I2U A;  1FH3 A;  2N2R A;  1I2V A;  1WT7 A;  2KYQ A;  2I61 A;  2N2Q A;  2YC1 C;  1T0Z A;  2BRZ A;  1BK8 A;  1NPI A;  1OMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...