5CY0A

Total chemical synthesis, covalent structure verification, and x-ray structure of bioactive ts3 toxin by racemic protein crystallography
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
63
structure length
63
Chain Sequence
KKDGYPVEYDNCAYICWNYDNAYCDKLCKDKKADSGYCYWVHILCYCYGLPDSEPTKTNGKCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Ts3 Toxin
publication title Elucidation of the Covalent and Tertiary Structures of Biologically Active Ts3 Toxin.
pubmed doi rcsb
total genus 16
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 5cy0A00
2E3GA 1JXCA 2KGQA 1ZU3A 1GPSA 4AB0A 2LY6A 4V1DC 1NH5A 1LQIA 2KBHA 1BRZA 2N69A 2KBKA 2LJMA 1NE5A 2KBJA 1BK8A 1C55A 1BMRA 1PE4A 2YEOA 3E7UX 1WMTA 2NY9X 1GPTA 2SN3A 1T1TA 1SN4A 4UJ0A 5CY0A 2KPYA 2I61A 1PTXA 1ZVGA 2YBRC 2LR3A 1I6GA 2N66A 1AYJA 1ZUTA 3E7RL 3PSMA 1LQQA 1T0ZA 2GL1A 1ZYVA 2LT8A 1DJTA 2B68A 1I2UA 2KJAA 1SN1A 1N4NA 5KK4A 4AAZA 2B3CA 1VNAA 2N2RA 1I2VA 1AHOA 1C56A 1SNBA 1T7BA 2E3FA 1L4VA 1TI5A 1VNBA 2MZ0A 2LJ7A 4AEIA 1MYNA 1KV0A 1T7EA 1WWNA 4CQKA 1OZZA 4HHFA 1P0AA 1OMYA 1FH3A 2KSKA 2LY5A 2N2QA 1JZBA 1B7DA 4KYPA 1JZAA 1MR4A 1NRAA 1CHZA 1P00A 1CN2A 2M8BB 1JKZA 2BRZA 1ZVEA 1NPIA 2NY8X 2E0HA 2A7TA 2KYQA 4HE7A 1B3CA 1ICAA 1SEGA 1ZYWA 2ATBA 1BCGA 2LKBA 2YC1C 1PX9A 2LI7A 1I6FA 1ZFUA 1WT7A 1DQ7A 1T7AA 1NRBA 1LQHA 2ASCA
chains in the Genus database with same CATH superfamily
4H5WA 3CQXA 3L4IA 5AQMA 3CW4A 2E3GA 1JXCA 2KGQA 1ZU3A 1GPSA 3D2FB 4AB0A 3ATVA 2E88A 2LY6A 3QFPA 3KHWA 4V1DC 2E8AA 5EX5A 4UADE 3ATUA 1NH5A 4H5VA 1LQIA 2KBHA 1BRZA 1ATRA 2BUPA 5BPLA 2N69A 2KBKA 2LJMA 1ATSA 1NE5A 2KBJA 5FPNA 1BK8A 1C55A 3LDOA 1BUPA 4UAFE 5BPNA 1BMRA 1PE4A 5AQPA 2YEOA 3D2EB 1YUWA 3E7UX 3KOYA 4IO8A 5FPMA 1HX1A 1WMTA 2NY9X 2JDQD 5AQQA 3GL1A 2MBKA 2SN3A 5AQOA 1T1TA 2VY6A 1GPTA 1SN4A 1QQOA 4UJ0A 5FPDA 5FPEA 5CY0A 2KPYA 2I61A 5AQFA 1PTXA 1ZVGA 2YBRC 2LR3A 3D2FA 1I6GA 2N66A 1AYJA 1ZUTA 1NGFA 1NGEA 3E7RL 5F2RA 3PSMA 1LQQA 4FSVA 5EY4A 3KVGA 1POIA 1KAZA 5AQLA 1T0ZA 2GL1A 1BA1A 3GKUA 1ZYVA 5EVZA 1QQMA 3L6QA 3C7NA 2LT8A 1DJTA 1S3XA 2B68A 1NGDA 3KC6A 3IUCA 3I33A 2K35A 5BN9A 1I2UA 2KJAA 1SN1A 1N4NA 5KK4A 4AAZA 2QWPA 2B3CA 1VNAA 2YILA 5BN8A 2KHOA 5AQJA 2N2RA 2QWQA 3KP1A 3QI7A 1I2VA 4H5RA 1AHOA 1C56A 1HPMA 1NGIA 1SNBA 1T7BA 2E3FA 2QXLA 3R2VA 1L4VA 3A8YA 1TI5A 1VNBA 5BPMA 2MZ0A 3L56A 2LJ7A 4AEIA 1MYNA 1KV0A 5AQGA 5AQRA 1T7EA 1WWNA 2YIPA 2QW9A 3FE1A 5F0XA 4CQKA 1OZZA 3KP0A 5AQZA 1NGHA 5AQXA 5AQUA 2MN5A 1DKGD 2QWOA 2E2FA 1QQNA 3FZFA 1KAXA 4HHFA 1P0AA 3LDLA 1OMYA 1NGCA 3AY9A 5F1XA 2KSKA 2LY5A 2N2QA 4H5TA 5EXWA 1FH3A 1JZBA 1B7DA 1NGGA 2V7ZA 1JZAA 3D2EA 3KOWA 1HJOA 1MR4A 1NRAA 3QFUA 4H5NA 4KYPA 1CHZA 2G2KA 1NGBA 3FZHA 1P00A 2D56A 1CN2A 2M8BB 4HWIA 3GDQA 5AQIA 1JKZA 2BRZA 3LDNA 1ZVEA 3FZMA 1NPIA 4UAEF 5AR0A 2LN8A 2NY8X 1BA0A 3QMLA 2E0HA 4KBOA 2A7TA 3M3ZA 3BK3C 5AQYA 3FZLA 3FZKA 3LDPA 2KYQA 2QWNA 4HE7A 5AQWA 5AQVA 5AQKA 4FL9A 1K8BA 2QWMA 1B3CA 1ICAA 1NGJA 1SEGA 1XRSB 3LDQA 1ZYWA 3JXUA 1KAYA 2ATBA 4GNIA 3KOZA 1BCGA 2LKBA 2YC1C 1PX9A 2LI7A 3KOXA 3HSCA 3C7NB 5AQNA 1I6FA 1ZFUA 2QWRA 3SF4D 1WT7A 2YIOA 2GMOA 1DQ7A 5AQSA 1UGLA 5AQHA 2QWLA 1NGAA 1T7AA 1NRBA 1LQHA 5AQTA 2ASCA
chains in the Genus database with same CATH topology
2E3GA 1JXCA 2KGQA 1ZU3A 1GPSA 4AB0A 2LY6A 4V1DC 1NH5A 1LQIA 2KBHA 1BRZA 2N69A 2KBKA 2LJMA 1NE5A 2KBJA 1BK8A 1C55A 1BMRA 1PE4A 2YEOA 3E7UX 1WMTA 2NY9X 1GPTA 2SN3A 1T1TA 1SN4A 4UJ0A 5CY0A 2KPYA 2I61A 1PTXA 1ZVGA 2YBRC 2LR3A 1I6GA 2N66A 1AYJA 1ZUTA 3E7RL 3PSMA 1LQQA 1T0ZA 2GL1A 1ZYVA 2LT8A 1DJTA 2B68A 1I2UA 2KJAA 1SN1A 1N4NA 5KK4A 4AAZA 2B3CA 1VNAA 2N2RA 1I2VA 1AHOA 1C56A 1SNBA 1T7BA 2E3FA 1L4VA 1TI5A 1VNBA 2MZ0A 2LJ7A 4AEIA 1MYNA 1KV0A 1T7EA 1WWNA 4CQKA 1OZZA 4HHFA 1P0AA 1OMYA 1FH3A 2KSKA 2LY5A 2N2QA 1JZBA 1B7DA 4KYPA 1JZAA 1MR4A 1NRAA 1CHZA 1P00A 1CN2A 2M8BB 1JKZA 2BRZA 1ZVEA 1NPIA 2NY8X 2E0HA 2A7TA 2KYQA 4HE7A 1B3CA 1ICAA 1SEGA 1ZYWA 2ATBA 1BCGA 2LKBA 2YC1C 1PX9A 2LI7A 1I6FA 1ZFUA 1WT7A 1DQ7A 1T7AA 1NRBA 1LQHA 2ASCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3G A;  1JXC A;  2KGQ A;  1ZU3 A;  1GPS A;  4AB0 A;  2LY6 A;  4V1D C;  1NH5 A;  1LQI A;  2KBH A;  1BRZ A;  2N69 A;  2KBK A;  2LJM A;  1NE5 A;  2KBJ A;  1BK8 A;  1C55 A;  1BMR A;  1PE4 A;  2YEO A;  3E7U X;  1WMT A;  2NY9 X;  1GPT A;  2SN3 A;  1T1T A;  1SN4 A;  4UJ0 A;  5CY0 A;  2KPY A;  2I61 A;  1PTX A;  1ZVG A;  2YBR C;  2LR3 A;  1I6G A;  2N66 A;  1AYJ A;  1ZUT A;  3E7R L;  3PSM A;  1LQQ A;  1T0Z A;  2GL1 A;  1ZYV A;  2LT8 A;  1DJT A;  2B68 A;  1I2U A;  2KJA A;  1SN1 A;  1N4N A;  5KK4 A;  4AAZ A;  2B3C A;  1VNA A;  2N2R A;  1I2V A;  1AHO A;  1C56 A;  1SNB A;  1T7B A;  2E3F A;  1L4V A;  1TI5 A;  1VNB A;  2MZ0 A;  2LJ7 A;  4AEI A;  1MYN A;  1KV0 A;  1T7E A;  1WWN A;  4CQK A;  1OZZ A;  4HHF A;  1P0A A;  1OMY A;  1FH3 A;  2KSK A;  2LY5 A;  2N2Q A;  1JZB A;  1B7D A;  4KYP A;  1JZA A;  1MR4 A;  1NRA A;  1CHZ A;  1P00 A;  1CN2 A;  2M8B B;  1JKZ A;  2BRZ A;  1ZVE A;  1NPI A;  2NY8 X;  2E0H A;  2A7T A;  2KYQ A;  4HE7 A;  1B3C A;  1ICA A;  1SEG A;  1ZYW A;  2ATB A;  1BCG A;  2LKB A;  2YC1 C;  1PX9 A;  2LI7 A;  1I6F A;  1ZFU A;  1WT7 A;  1DQ7 A;  1T7A A;  1NRB A;  1LQH A;  2ASC A; 
#chains in the Genus database with same CATH topology
 4H5W A;  3CQX A;  3L4I A;  5AQM A;  3CW4 A;  2E3G A;  1JXC A;  2KGQ A;  1ZU3 A;  1GPS A;  3D2F B;  4AB0 A;  3ATV A;  2E88 A;  2LY6 A;  3QFP A;  3KHW A;  4V1D C;  2E8A A;  5EX5 A;  4UAD E;  3ATU A;  1NH5 A;  4H5V A;  1LQI A;  2KBH A;  1BRZ A;  1ATR A;  2BUP A;  5BPL A;  2N69 A;  2KBK A;  2LJM A;  1ATS A;  1NE5 A;  2KBJ A;  5FPN A;  1BK8 A;  1C55 A;  3LDO A;  1BUP A;  4UAF E;  5BPN A;  1BMR A;  1PE4 A;  5AQP A;  2YEO A;  3D2E B;  1YUW A;  3E7U X;  3KOY A;  4IO8 A;  5FPM A;  1HX1 A;  1WMT A;  2NY9 X;  2JDQ D;  5AQQ A;  3GL1 A;  2MBK A;  2SN3 A;  5AQO A;  1T1T A;  2VY6 A;  1GPT A;  1SN4 A;  1QQO A;  4UJ0 A;  5FPD A;  5FPE A;  5CY0 A;  2KPY A;  2I61 A;  5AQF A;  1PTX A;  1ZVG A;  2YBR C;  2LR3 A;  3D2F A;  1I6G A;  2N66 A;  1AYJ A;  1ZUT A;  1NGF A;  1NGE A;  3E7R L;  5F2R A;  3PSM A;  1LQQ A;  4FSV A;  5EY4 A;  3KVG A;  1POI A;  1KAZ A;  5AQL A;  1T0Z A;  2GL1 A;  1BA1 A;  3GKU A;  1ZYV A;  5EVZ A;  1QQM A;  3L6Q A;  3C7N A;  2LT8 A;  1DJT A;  1S3X A;  2B68 A;  1NGD A;  3KC6 A;  3IUC A;  3I33 A;  2K35 A;  5BN9 A;  1I2U A;  2KJA A;  1SN1 A;  1N4N A;  5KK4 A;  4AAZ A;  2QWP A;  2B3C A;  1VNA A;  2YIL A;  5BN8 A;  2KHO A;  5AQJ A;  2N2R A;  2QWQ A;  3KP1 A;  3QI7 A;  1I2V A;  4H5R A;  1AHO A;  1C56 A;  1HPM A;  1NGI A;  1SNB A;  1T7B A;  2E3F A;  2QXL A;  3R2V A;  1L4V A;  3A8Y A;  1TI5 A;  1VNB A;  5BPM A;  2MZ0 A;  3L56 A;  2LJ7 A;  4AEI A;  1MYN A;  1KV0 A;  5AQG A;  5AQR A;  1T7E A;  1WWN A;  2YIP A;  2QW9 A;  3FE1 A;  5F0X A;  4CQK A;  1OZZ A;  3KP0 A;  5AQZ A;  1NGH A;  5AQX A;  5AQU A;  2MN5 A;  1DKG D;  2QWO A;  2E2F A;  1QQN A;  3FZF A;  1KAX A;  4HHF A;  1P0A A;  3LDL A;  1OMY A;  1NGC A;  3AY9 A;  5F1X A;  2KSK A;  2LY5 A;  2N2Q A;  4H5T A;  5EXW A;  1FH3 A;  1JZB A;  1B7D A;  1NGG A;  2V7Z A;  1JZA A;  3D2E A;  3KOW A;  1HJO A;  1MR4 A;  1NRA A;  3QFU A;  4H5N A;  4KYP A;  1CHZ A;  2G2K A;  1NGB A;  3FZH A;  1P00 A;  2D56 A;  1CN2 A;  2M8B B;  4HWI A;  3GDQ A;  5AQI A;  1JKZ A;  2BRZ A;  3LDN A;  1ZVE A;  3FZM A;  1NPI A;  4UAE F;  5AR0 A;  2LN8 A;  2NY8 X;  1BA0 A;  3QML A;  2E0H A;  4KBO A;  2A7T A;  3M3Z A;  3BK3 C;  5AQY A;  3FZL A;  3FZK A;  3LDP A;  2KYQ A;  2QWN A;  4HE7 A;  5AQW A;  5AQV A;  5AQK A;  4FL9 A;  1K8B A;  2QWM A;  1B3C A;  1ICA A;  1NGJ A;  1SEG A;  1XRS B;  3LDQ A;  1ZYW A;  3JXU A;  1KAY A;  2ATB A;  4GNI A;  3KOZ A;  1BCG A;  2LKB A;  2YC1 C;  1PX9 A;  2LI7 A;  3KOX A;  3HSC A;  3C7N B;  5AQN A;  1I6F A;  1ZFU A;  2QWR A;  3SF4 D;  1WT7 A;  2YIO A;  2GMO A;  1DQ7 A;  5AQS A;  1UGL A;  5AQH A;  2QWL A;  1NGA A;  1T7A A;  1NRB A;  1LQH A;  5AQT A;  2ASC A; 
#chains in the Genus database with same CATH homology
 2E3G A;  1JXC A;  2KGQ A;  1ZU3 A;  1GPS A;  4AB0 A;  2LY6 A;  4V1D C;  1NH5 A;  1LQI A;  2KBH A;  1BRZ A;  2N69 A;  2KBK A;  2LJM A;  1NE5 A;  2KBJ A;  1BK8 A;  1C55 A;  1BMR A;  1PE4 A;  2YEO A;  3E7U X;  1WMT A;  2NY9 X;  1GPT A;  2SN3 A;  1T1T A;  1SN4 A;  4UJ0 A;  5CY0 A;  2KPY A;  2I61 A;  1PTX A;  1ZVG A;  2YBR C;  2LR3 A;  1I6G A;  2N66 A;  1AYJ A;  1ZUT A;  3E7R L;  3PSM A;  1LQQ A;  1T0Z A;  2GL1 A;  1ZYV A;  2LT8 A;  1DJT A;  2B68 A;  1I2U A;  2KJA A;  1SN1 A;  1N4N A;  5KK4 A;  4AAZ A;  2B3C A;  1VNA A;  2N2R A;  1I2V A;  1AHO A;  1C56 A;  1SNB A;  1T7B A;  2E3F A;  1L4V A;  1TI5 A;  1VNB A;  2MZ0 A;  2LJ7 A;  4AEI A;  1MYN A;  1KV0 A;  1T7E A;  1WWN A;  4CQK A;  1OZZ A;  4HHF A;  1P0A A;  1OMY A;  1FH3 A;  2KSK A;  2LY5 A;  2N2Q A;  1JZB A;  1B7D A;  4KYP A;  1JZA A;  1MR4 A;  1NRA A;  1CHZ A;  1P00 A;  1CN2 A;  2M8B B;  1JKZ A;  2BRZ A;  1ZVE A;  1NPI A;  2NY8 X;  2E0H A;  2A7T A;  2KYQ A;  4HE7 A;  1B3C A;  1ICA A;  1SEG A;  1ZYW A;  2ATB A;  1BCG A;  2LKB A;  2YC1 C;  1PX9 A;  2LI7 A;  1I6F A;  1ZFU A;  1WT7 A;  1DQ7 A;  1T7A A;  1NRB A;  1LQH A;  2ASC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...