1EE6A

Crystal structure of pectate lyase from bacillus sp. strain ksm-p15.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
197
structure length
197
Chain Sequence
APTVVHETIRVPAGQTFDGKGQTYVANPNTLGDGSQAENQKPIFRLEAGASLKNVVIGAPAADGVHCYGDCTITNVIWEDVGEDALTLKSSGTVNISGGAAYKAYDKVFQINAAGTINIRNFRADDIGKLVRQNGGTTYKVVMNVENCNISRVKDAILRTDSSTSTGRIVNTRYSNVPTLFKGFKSGNTTASGNTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PECTATE LYASE
publication title The first structure of pectate lyase belonging to polysaccharide lyase family 3.
pubmed doi rcsb
molecule tags Lyase
total genus 78
structure length 197
sequence length 197
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2000-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1ee6A00
2UVEA 1AIRA 4OJOA 1X0CA 4U49A 2NSPA 2O04A 1DBOA 2QXZA 1O8KA 1KTWA 3GQ8A 1QCXA 2ODLA 3B90A 2X85A 4MXNA 1O8DA 1OGOX 1DBGA 1PE9A 1QJVA 3VMWA 3VSTA 4YZAA 2QY1A 1O8MA 4W8SA 1PXZA 3EQNA 4YEJA 4PMHA 3KRGA 4XLFA 3WWGA 2NT9A 1HG8A 5C1EA 1O8LA 2X6WA 3JURA 4XM3A 4YZQA 2O1DA 4XKVA 1CZFA 1WMRA 4XOPA 1OGMX 4MR0A 1GQ8A 2QX3A 1BN8A 4W8QA 1OOCA 4XQFA 4EW9A 2X6YA 1IDJA 2X6XA 4XN3A 4XONA 2X3HA 1O8IA 1RWRA 1RU4A 2Z8GA 4OJ6A 3GQ7A 2NSTA 2VBKA 4XL9A 5AMVA 2O17A 1O8JA 3ZSCA 4XKWA 1NHCA 5C1CA 4OZYA 4I84A 3GQ9A 4HWVA 1KCCA 2UVFA 1H80A 1O8GA 2VBMA 4W8RA 3B8YA 4Z03A 3GRHA 1IA5A 2NZMA 3UW0A 3B4NA 4U4BA 2BSPA 3EQOA 4YZ0A 4YELA 1O8EA 2INVA 1PLUA 2VBEA 4YZXA 4AVZA 1KCDA 3T9GA 2VJJA 3FY3A 3SUCA 2O0VA 2PYHA 1EE6A 2NT6A 4Z06A 4W8TA 2NTQA 4XORA 2NTBA 3GQAA 4NK8A 1OFMA 1O88A 4OJLA 2EWEA 2INUA 4XMYA 2PYGA 4XN0A 3VSUA 3ZPPA 4XR6A 4OJPA 1XG2A 1OFLA 1IB4A 1RMGA 4URRA 1IDKA 4XLEA 4XLCA 4NK6A 3LMWA 4XNFA 4Z05A 4XLAA 1VBLA 1JRGA 1O8HA 4XOTA 1O8FA 3VSVA 4OZZA 1BHEA 2NTPA 4OJ5A 2PECA 2O0WA 2VJIA 4XLHA 1K5CA 1JTAA 3VMVA 2IQ7A 4C2LA
chains in the Genus database with same CATH superfamily
1QRBA 2UVEA 1KQ5A 2BM4A 1AIRA 4OPWA 4OJOA 1X0CA 2W7ZA 4U49A 2NSPA 2O04A 2QYUA 4YFOA 1DBOA 2QXZA 2V5IA 1O8KA 3P4GA 1KTWA 3GQ8A 1QCXA 2ODLA 3B90A 1TYUA 2X85A 4MXNA 1O8DA 1OGOX 2BM7A 3DU1X 3SZEA 1DBGA 1PE9A 1QJVA 1TYVA 2VFQA 2VFPA 3VMWA 2G0YA 3TH0A 3VSTA 5JLVC 4YZAA 2QY1A 1O8MA 2VFNA 4W8SA 2J8KA 4KH3A 1PXZA 3EQNA 1EA0A 1CLWA 1TYXA 4YEJA 1WXRA 1LLZA 3KRGA 4PMHA 4XLFA 4YDTA 3WWGA 1QA3A 2NT9A 1HG8A 5C1EA 1O8LA 2X6WA 3JURA 4XM3A 4YZQA 2O1DA 4XKVA 1CZFA 1WMRA 4XOPA 1OGMX 4MR0A 1GQ8A 3NB2A 2XTWA 3PETA 2QX3A 1BN8A 1K4ZA 4W8QA 1OOCA 4XQFA 1TYWA 4EW9A 1K8FA 2X6YA 3LJYA 1IDJA 2X6XA 4XN3A 4XONA 2X3HA 1O8IA 4V02C 3AK5A 2YUHA 1RWRA 1RU4A 3BH6B 2Z8GA 4OJ6A 2VFOA 3GQ7A 1HF2A 2NSTA 2VBKA 4XL9A 5AMVA 2O17A 1O8JA 3H09A 3ZSCA 2BM5A 1QA1A 4XKWA 1NHCA 2XC1A 3RIQA 3PSZA 3SYJA 5C1CA 4OZYA 4I84A 3GQ9A 4HWVA 1KCCA 2UVFA 1H80A 1O8GA 2VFMA 2VBMA 2XTXA 4W8RA 1TSPA 3B8YA 3JX8A 4Z03A 3BH7B 3GRHA 1OFEA 2IOUG 2NZMA 1IA5A 3UW0A 3PSSA 3B4NA 4U4BA 1EZGA 2BSPA 3EQOA 4YZ0A 4YELA 1O8EA 2INVA 1PLUA 2VBEA 4YZXA 4AVZA 2XTYA 1KCDA 3T9GA 2VJJA 4JRAC 3FY3A 1LM1A 3SUCA 2J8IA 3SQVA 2O0VA 4YC5A 2PYHA 4YCQA 1EE6A 4OM9A 2NT6A 4Z06A 4W8TA 2NTQA 4XORA 5JMCB 2NTBA 3GQAA 4NK8A 3SY2A 1OFMA 1O88A 1LLWA 2BX6A 4OJLA 1QQ1A 2EWEA 2B0RA 2INUA 2QZAA 2XT2A 2PYGA 3NAWA 4XMYA 4XN0A 3VSUA 3ZPPA 4XR6A 4OJPA 1XG2A 1OFLA 2O6WA 1IB4A 1RMGA 3ML3A 1IDKA 4URRA 3N90A 4XLEA 5DNSA 1OFDA 4XLCA 4NK6A 3LMWA 4XNFA 4Z05A 1QRCA 1DABA 2BM6A 1QA2A 1L1IA 3LYCA 4XLAA 1VBLA 1JRGA 1O8HA 4XOTA 1O8FA 2F3LA 4OZZA 3VSVA 1BHEA 3N6ZA 2NTPA 2XT4A 4OJ5A 2PECA 2O0WA 2VJIA 4XLHA 1K5CA 1JTAA 3VMVA 2IQ7A 4YEIA 4C2LA
chains in the Genus database with same CATH topology
2UVEA 1AIRA 4OJOA 1X0CA 4U49A 2NSPA 2O04A 1DBOA 2QXZA 1O8KA 1KTWA 3GQ8A 1QCXA 2ODLA 3B90A 2X85A 4MXNA 1O8DA 1OGOX 1DBGA 1PE9A 1QJVA 3VMWA 3VSTA 4YZAA 2QY1A 1O8MA 4W8SA 1PXZA 3EQNA 4YEJA 4PMHA 3KRGA 4XLFA 3WWGA 2NT9A 1HG8A 5C1EA 1O8LA 2X6WA 3JURA 4XM3A 4YZQA 2O1DA 4XKVA 1CZFA 1WMRA 4XOPA 1OGMX 4MR0A 1GQ8A 2QX3A 1BN8A 4W8QA 1OOCA 4XQFA 4EW9A 2X6YA 1IDJA 2X6XA 4XN3A 4XONA 2X3HA 1O8IA 1RWRA 1RU4A 2Z8GA 4OJ6A 3GQ7A 2NSTA 2VBKA 4XL9A 5AMVA 2O17A 1O8JA 3ZSCA 4XKWA 1NHCA 5C1CA 4OZYA 4I84A 3GQ9A 4HWVA 1KCCA 2UVFA 1H80A 1O8GA 2VBMA 4W8RA 3B8YA 4Z03A 3GRHA 1IA5A 2NZMA 3UW0A 3B4NA 4U4BA 2BSPA 3EQOA 4YZ0A 4YELA 1O8EA 2INVA 1PLUA 2VBEA 4YZXA 4AVZA 1KCDA 3T9GA 2VJJA 3FY3A 3SUCA 2O0VA 2PYHA 1EE6A 2NT6A 4Z06A 4W8TA 2NTQA 4XORA 2NTBA 3GQAA 4NK8A 1OFMA 1O88A 4OJLA 2EWEA 2INUA 4XMYA 2PYGA 4XN0A 3VSUA 3ZPPA 4XR6A 4OJPA 1XG2A 1OFLA 1IB4A 1RMGA 4URRA 1IDKA 4XLEA 4XLCA 4NK6A 3LMWA 4XNFA 4Z05A 4XLAA 1VBLA 1JRGA 1O8HA 4XOTA 1O8FA 3VSVA 4OZZA 1BHEA 2NTPA 4OJ5A 2PECA 2O0WA 2VJIA 4XLHA 1K5CA 1JTAA 3VMVA 2IQ7A 4C2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVE A;  1AIR A;  4OJO A;  1X0C A;  4U49 A;  2NSP A;  2O04 A;  1DBO A;  2QXZ A;  1O8K A;  1KTW A;  3GQ8 A;  1QCX A;  2ODL A;  3B90 A;  2X85 A;  4MXN A;  1O8D A;  1OGO X;  1DBG A;  1PE9 A;  1QJV A;  3VMW A;  3VST A;  4YZA A;  2QY1 A;  1O8M A;  4W8S A;  1PXZ A;  3EQN A;  4YEJ A;  4PMH A;  3KRG A;  4XLF A;  3WWG A;  2NT9 A;  1HG8 A;  5C1E A;  1O8L A;  2X6W A;  3JUR A;  4XM3 A;  4YZQ A;  2O1D A;  4XKV A;  1CZF A;  1WMR A;  4XOP A;  1OGM X;  4MR0 A;  1GQ8 A;  2QX3 A;  1BN8 A;  4W8Q A;  1OOC A;  4XQF A;  4EW9 A;  2X6Y A;  1IDJ A;  2X6X A;  4XN3 A;  4XON A;  2X3H A;  1O8I A;  1RWR A;  1RU4 A;  2Z8G A;  4OJ6 A;  3GQ7 A;  2NST A;  2VBK A;  4XL9 A;  5AMV A;  2O17 A;  1O8J A;  3ZSC A;  4XKW A;  1NHC A;  5C1C A;  4OZY A;  4I84 A;  3GQ9 A;  4HWV A;  1KCC A;  2UVF A;  1H80 A;  1O8G A;  2VBM A;  4W8R A;  3B8Y A;  4Z03 A;  3GRH A;  1IA5 A;  2NZM A;  3UW0 A;  3B4N A;  4U4B A;  2BSP A;  3EQO A;  4YZ0 A;  4YEL A;  1O8E A;  2INV A;  1PLU A;  2VBE A;  4YZX A;  4AVZ A;  1KCD A;  3T9G A;  2VJJ A;  3FY3 A;  3SUC A;  2O0V A;  2PYH A;  1EE6 A;  2NT6 A;  4Z06 A;  4W8T A;  2NTQ A;  4XOR A;  2NTB A;  3GQA A;  4NK8 A;  1OFM A;  1O88 A;  4OJL A;  2EWE A;  2INU A;  4XMY A;  2PYG A;  4XN0 A;  3VSU A;  3ZPP A;  4XR6 A;  4OJP A;  1XG2 A;  1OFL A;  1IB4 A;  1RMG A;  4URR A;  1IDK A;  4XLE A;  4XLC A;  4NK6 A;  3LMW A;  4XNF A;  4Z05 A;  4XLA A;  1VBL A;  1JRG A;  1O8H A;  4XOT A;  1O8F A;  3VSV A;  4OZZ A;  1BHE A;  2NTP A;  4OJ5 A;  2PEC A;  2O0W A;  2VJI A;  4XLH A;  1K5C A;  1JTA A;  3VMV A;  2IQ7 A;  4C2L A; 
#chains in the Genus database with same CATH topology
 1QRB A;  2UVE A;  1KQ5 A;  2BM4 A;  1AIR A;  4OPW A;  4OJO A;  1X0C A;  2W7Z A;  4U49 A;  2NSP A;  2O04 A;  2QYU A;  4YFO A;  1DBO A;  2QXZ A;  2V5I A;  1O8K A;  3P4G A;  1KTW A;  3GQ8 A;  1QCX A;  2ODL A;  3B90 A;  1TYU A;  2X85 A;  4MXN A;  1O8D A;  1OGO X;  2BM7 A;  3DU1 X;  3SZE A;  1DBG A;  1PE9 A;  1QJV A;  1TYV A;  2VFQ A;  2VFP A;  3VMW A;  2G0Y A;  3TH0 A;  3VST A;  5JLV C;  4YZA A;  2QY1 A;  1O8M A;  2VFN A;  4W8S A;  2J8K A;  4KH3 A;  1PXZ A;  3EQN A;  1EA0 A;  1CLW A;  1TYX A;  4YEJ A;  1WXR A;  1LLZ A;  3KRG A;  4PMH A;  4XLF A;  4YDT A;  3WWG A;  1QA3 A;  2NT9 A;  1HG8 A;  5C1E A;  1O8L A;  2X6W A;  3JUR A;  4XM3 A;  4YZQ A;  2O1D A;  4XKV A;  1CZF A;  1WMR A;  4XOP A;  1OGM X;  4MR0 A;  1GQ8 A;  3NB2 A;  2XTW A;  3PET A;  2QX3 A;  1BN8 A;  1K4Z A;  4W8Q A;  1OOC A;  4XQF A;  1TYW A;  4EW9 A;  1K8F A;  2X6Y A;  3LJY A;  1IDJ A;  2X6X A;  4XN3 A;  4XON A;  2X3H A;  1O8I A;  4V02 C;  3AK5 A;  2YUH A;  1RWR A;  1RU4 A;  3BH6 B;  2Z8G A;  4OJ6 A;  2VFO A;  3GQ7 A;  1HF2 A;  2NST A;  2VBK A;  4XL9 A;  5AMV A;  2O17 A;  1O8J A;  3H09 A;  3ZSC A;  2BM5 A;  1QA1 A;  4XKW A;  1NHC A;  2XC1 A;  3RIQ A;  3PSZ A;  3SYJ A;  5C1C A;  4OZY A;  4I84 A;  3GQ9 A;  4HWV A;  1KCC A;  2UVF A;  1H80 A;  1O8G A;  2VFM A;  2VBM A;  2XTX A;  4W8R A;  1TSP A;  3B8Y A;  3JX8 A;  4Z03 A;  3BH7 B;  3GRH A;  1OFE A;  2IOU G;  2NZM A;  1IA5 A;  3UW0 A;  3PSS A;  3B4N A;  4U4B A;  1EZG A;  2BSP A;  3EQO A;  4YZ0 A;  4YEL A;  1O8E A;  2INV A;  1PLU A;  2VBE A;  4YZX A;  4AVZ A;  2XTY A;  1KCD A;  3T9G A;  2VJJ A;  4JRA C;  3FY3 A;  1LM1 A;  3SUC A;  2J8I A;  3SQV A;  2O0V A;  4YC5 A;  2PYH A;  4YCQ A;  1EE6 A;  4OM9 A;  2NT6 A;  4Z06 A;  4W8T A;  2NTQ A;  4XOR A;  5JMC B;  2NTB A;  3GQA A;  4NK8 A;  3SY2 A;  1OFM A;  1O88 A;  1LLW A;  2BX6 A;  4OJL A;  1QQ1 A;  2EWE A;  2B0R A;  2INU A;  2QZA A;  2XT2 A;  2PYG A;  3NAW A;  4XMY A;  4XN0 A;  3VSU A;  3ZPP A;  4XR6 A;  4OJP A;  1XG2 A;  1OFL A;  2O6W A;  1IB4 A;  1RMG A;  3ML3 A;  1IDK A;  4URR A;  3N90 A;  4XLE A;  5DNS A;  1OFD A;  4XLC A;  4NK6 A;  3LMW A;  4XNF A;  4Z05 A;  1QRC A;  1DAB A;  2BM6 A;  1QA2 A;  1L1I A;  3LYC A;  4XLA A;  1VBL A;  1JRG A;  1O8H A;  4XOT A;  1O8F A;  2F3L A;  4OZZ A;  3VSV A;  1BHE A;  3N6Z A;  2NTP A;  2XT4 A;  4OJ5 A;  2PEC A;  2O0W A;  2VJI A;  4XLH A;  1K5C A;  1JTA A;  3VMV A;  2IQ7 A;  4YEI A;  4C2L A; 
#chains in the Genus database with same CATH homology
 2UVE A;  1AIR A;  4OJO A;  1X0C A;  4U49 A;  2NSP A;  2O04 A;  1DBO A;  2QXZ A;  1O8K A;  1KTW A;  3GQ8 A;  1QCX A;  2ODL A;  3B90 A;  2X85 A;  4MXN A;  1O8D A;  1OGO X;  1DBG A;  1PE9 A;  1QJV A;  3VMW A;  3VST A;  4YZA A;  2QY1 A;  1O8M A;  4W8S A;  1PXZ A;  3EQN A;  4YEJ A;  4PMH A;  3KRG A;  4XLF A;  3WWG A;  2NT9 A;  1HG8 A;  5C1E A;  1O8L A;  2X6W A;  3JUR A;  4XM3 A;  4YZQ A;  2O1D A;  4XKV A;  1CZF A;  1WMR A;  4XOP A;  1OGM X;  4MR0 A;  1GQ8 A;  2QX3 A;  1BN8 A;  4W8Q A;  1OOC A;  4XQF A;  4EW9 A;  2X6Y A;  1IDJ A;  2X6X A;  4XN3 A;  4XON A;  2X3H A;  1O8I A;  1RWR A;  1RU4 A;  2Z8G A;  4OJ6 A;  3GQ7 A;  2NST A;  2VBK A;  4XL9 A;  5AMV A;  2O17 A;  1O8J A;  3ZSC A;  4XKW A;  1NHC A;  5C1C A;  4OZY A;  4I84 A;  3GQ9 A;  4HWV A;  1KCC A;  2UVF A;  1H80 A;  1O8G A;  2VBM A;  4W8R A;  3B8Y A;  4Z03 A;  3GRH A;  1IA5 A;  2NZM A;  3UW0 A;  3B4N A;  4U4B A;  2BSP A;  3EQO A;  4YZ0 A;  4YEL A;  1O8E A;  2INV A;  1PLU A;  2VBE A;  4YZX A;  4AVZ A;  1KCD A;  3T9G A;  2VJJ A;  3FY3 A;  3SUC A;  2O0V A;  2PYH A;  1EE6 A;  2NT6 A;  4Z06 A;  4W8T A;  2NTQ A;  4XOR A;  2NTB A;  3GQA A;  4NK8 A;  1OFM A;  1O88 A;  4OJL A;  2EWE A;  2INU A;  4XMY A;  2PYG A;  4XN0 A;  3VSU A;  3ZPP A;  4XR6 A;  4OJP A;  1XG2 A;  1OFL A;  1IB4 A;  1RMG A;  4URR A;  1IDK A;  4XLE A;  4XLC A;  4NK6 A;  3LMW A;  4XNF A;  4Z05 A;  4XLA A;  1VBL A;  1JRG A;  1O8H A;  4XOT A;  1O8F A;  3VSV A;  4OZZ A;  1BHE A;  2NTP A;  4OJ5 A;  2PEC A;  2O0W A;  2VJI A;  4XLH A;  1K5C A;  1JTA A;  3VMV A;  2IQ7 A;  4C2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...