1EE6A

Crystal structure of pectate lyase from bacillus sp. strain ksm-p15.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
197
structure length
197
Chain Sequence
APTVVHETIRVPAGQTFDGKGQTYVANPNTLGDGSQAENQKPIFRLEAGASLKNVVIGAPAADGVHCYGDCTITNVIWEDVGEDALTLKSSGTVNISGGAAYKAYDKVFQINAAGTINIRNFRADDIGKLVRQNGGTTYKVVMNVENCNISRVKDAILRTDSSTSTGRIVNTRYSNVPTLFKGFKSGNTTASGNTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PECTATE LYASE
publication title The first structure of pectate lyase belonging to polysaccharide lyase family 3.
pubmed doi rcsb
molecule tags Lyase
total genus 78
structure length 197
sequence length 197
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2000-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1ee6A00
5C1EA 4W8TA 3FY3A 4XLHA 4C2LA 1OFLA 1DBGA 2NT9A 4OJOA 4XKWA 1IB4A 1O8JA 4XOTA 2NTQA 3T9GA 2O0WA 4OJPA 4XLFA 1O8FA 2QY1A 4OJ5A 2ODLA 1WMRA 1O8GA 2O04A 2EWEA 2VBEA 2UVEA 4XKVA 1KTWA 4XOPA 1GQ8A 3GRHA 4XORA 3EQNA 3B4NA 1EE6A 3EQOA 4YZXA 1RU4A 2NSPA 2X6WA 3JURA 1CZFA 3GQ9A 2X85A 1OGMX 1PXZA 2VJIA 3VSTA 4XNFA 1NHCA 1OFMA 2NT6A 4W8QA 1BHEA 1DBOA 2QXZA 3VSUA 4MXNA 4YZ0A 3GQAA 2Z8GA 1O8KA 1X0CA 1KCCA 4XMYA 1KCDA 2NTBA 2PYHA 1IDJA 2X3HA 4XR6A 3GQ8A 4XLEA 1RWRA 4HWVA 4YZAA 4YELA 1O8MA 3LMWA 3KRGA 2VJJA 1OOCA 1QCXA 4XQFA 3SUCA 1O8EA 2X6XA 4I84A 4YZQA 4Z05A 2NTPA 1AIRA 4URRA 4NK8A 4XLAA 4Z03A 1BN8A 4XLCA 4XN0A 4AVZA 1IDKA 4W8SA 2QX3A 4OJLA 2UVFA 3VMVA 4EW9A 1O88A 4XONA 1IA5A 2BSPA 3UW0A 1O8HA 1JTAA 2X6YA 4NK6A 2IQ7A 4U4BA 2VBKA 2O17A 4OZZA 2INVA 4U49A 1XG2A 2O1DA 1PE9A 3VSVA 2NZMA 2PECA 1QJVA 1HG8A 1O8DA 4W8RA 1VBLA 1RMGA 3B8YA 1PLUA 4PMHA 1JRGA 1H80A 4OJ6A 4XL9A 3ZPPA 3GQ7A 4OZYA 1OGOX 2VBMA 3B90A 1O8IA 4MR0A 4YEJA 3VMWA 5C1CA 2NSTA 3ZSCA 4XM3A 1K5CA 4XN3A 1O8LA 2O0VA 2INUA 4Z06A 5AMVA 2PYGA 3WWGA
chains in the Genus database with same CATH superfamily
5C1EA 3SQVA 2VFNA 1LLWA 3FY3A 2V5IA 4W8TA 4XLHA 1OFLA 4C2LA 1DBGA 2NT9A 4OJOA 2XTYA 4XKWA 1IB4A 1O8JA 2XT4A 2NTQA 4XOTA 1DABA 3T9GA 1TYVA 2O0WA 4OJPA 4OPWA 4YFOA 2BM6A 2XT2A 4XLFA 3PETA 5JLVC 1O8FA 1TYXA 2QY1A 1L1IA 4OJ5A 2ODLA 2VFMA 3ML3A 3RIQA 3NAWA 1WMRA 1O8GA 2O04A 1K4ZA 3H09A 4JRAC 2EWEA 1TYWA 2VBEA 2UVEA 4XKVA 1KTWA 4XOPA 1GQ8A 3GRHA 1CLWA 4XORA 3EQNA 1EA0A 3B4NA 1EE6A 3EQOA 4YZXA 1RU4A 2NSPA 2X6WA 3JURA 1CZFA 2B0RA 2VFQA 2X85A 2BM5A 3GQ9A 1QA2A 4YC5A 1OGMX 1PXZA 2VJIA 3VSTA 4XNFA 1K8FA 1NHCA 2O6WA 2BX6A 1OFMA 2NT6A 4W8QA 1BHEA 1DBOA 2G0YA 2QXZA 3SY2A 3VSUA 4MXNA 4YCQA 2VFPA 4YZ0A 3BH7B 2Z8GA 2IOUG 3GQAA 1O8KA 1X0CA 3NB2A 4YEIA 1KCCA 4XMYA 2XTWA 1KCDA 2NTBA 2PYHA 1IDJA 2BM7A 2X3HA 4XR6A 2F3LA 2BM4A 3GQ8A 4XLEA 1RWRA 4HWVA 2J8KA 3LJYA 4YZAA 4YELA 1O8MA 1QA1A 3LMWA 3KRGA 1TSPA 1LM1A 3P4GA 1OFDA 1OOCA 2QYUA 1QCXA 2VJJA 1KQ5A 4XQFA 3SUCA 1O8EA 3PSSA 2X6XA 1QQ1A 4YDTA 4I84A 4YZQA 4Z05A 2NTPA 1AIRA 4URRA 4NK8A 2W7ZA 4KH3A 4XLAA 4Z03A 1BN8A 1OFEA 4XLCA 4XN0A 4AVZA 1IDKA 1TYUA 4W8SA 2QX3A 1QRCA 2UVFA 4OJLA 3VMVA 1O88A 4EW9A 3PSZA 1LLZA 3N90A 4XONA 5DNSA 1IA5A 2BSPA 3N6ZA 3UW0A 1O8HA 1JTAA 2X6YA 1QA3A 4NK6A 2IQ7A 4U4BA 3BH6B 5JMCB 2VBKA 2O17A 4OZZA 2YUHA 4V02C 2INVA 4U49A 1XG2A 2O1DA 2XC1A 1PE9A 3VSVA 2NZMA 3JX8A 1EZGA 2PECA 1QJVA 2J8IA 3SZEA 1HG8A 1O8DA 4W8RA 1VBLA 1RMGA 3B8YA 3SYJA 1WXRA 1PLUA 3LYCA 4PMHA 1JRGA 1H80A 2XTXA 4OJ6A 4XL9A 3ZPPA 3AK5A 3GQ7A 4OZYA 1OGOX 1HF2A 1QRBA 2QZAA 2VBMA 1O8IA 3B90A 3DU1X 4MR0A 4OM9A 2NSTA 4YEJA 3VMWA 4XM3A 3ZSCA 5C1CA 1K5CA 4XN3A 1O8LA 2O0VA 3TH0A 2INUA 4Z06A 5AMVA 2PYGA 2VFOA 3WWGA
chains in the Genus database with same CATH topology
5C1EA 4W8TA 3FY3A 4XLHA 4C2LA 1OFLA 1DBGA 2NT9A 4OJOA 4XKWA 1IB4A 1O8JA 4XOTA 2NTQA 3T9GA 2O0WA 4OJPA 4XLFA 1O8FA 2QY1A 4OJ5A 2ODLA 1WMRA 1O8GA 2O04A 2EWEA 2VBEA 2UVEA 4XKVA 1KTWA 4XOPA 1GQ8A 3GRHA 4XORA 3EQNA 3B4NA 1EE6A 3EQOA 4YZXA 1RU4A 2NSPA 2X6WA 3JURA 1CZFA 3GQ9A 2X85A 1OGMX 1PXZA 2VJIA 3VSTA 4XNFA 1NHCA 1OFMA 2NT6A 4W8QA 1BHEA 1DBOA 2QXZA 3VSUA 4MXNA 4YZ0A 3GQAA 2Z8GA 1O8KA 1X0CA 1KCCA 4XMYA 1KCDA 2NTBA 2PYHA 1IDJA 2X3HA 4XR6A 3GQ8A 4XLEA 1RWRA 4HWVA 4YZAA 4YELA 1O8MA 3LMWA 3KRGA 2VJJA 1OOCA 1QCXA 4XQFA 3SUCA 1O8EA 2X6XA 4I84A 4YZQA 4Z05A 2NTPA 1AIRA 4URRA 4NK8A 4XLAA 4Z03A 1BN8A 4XLCA 4XN0A 4AVZA 1IDKA 4W8SA 2QX3A 4OJLA 2UVFA 3VMVA 4EW9A 1O88A 4XONA 1IA5A 2BSPA 3UW0A 1O8HA 1JTAA 2X6YA 4NK6A 2IQ7A 4U4BA 2VBKA 2O17A 4OZZA 2INVA 4U49A 1XG2A 2O1DA 1PE9A 3VSVA 2NZMA 2PECA 1QJVA 1HG8A 1O8DA 4W8RA 1VBLA 1RMGA 3B8YA 1PLUA 4PMHA 1JRGA 1H80A 4OJ6A 4XL9A 3ZPPA 3GQ7A 4OZYA 1OGOX 2VBMA 3B90A 1O8IA 4MR0A 4YEJA 3VMWA 5C1CA 2NSTA 3ZSCA 4XM3A 1K5CA 4XN3A 1O8LA 2O0VA 2INUA 4Z06A 5AMVA 2PYGA 3WWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1E A;  4W8T A;  3FY3 A;  4XLH A;  4C2L A;  1OFL A;  1DBG A;  2NT9 A;  4OJO A;  4XKW A;  1IB4 A;  1O8J A;  4XOT A;  2NTQ A;  3T9G A;  2O0W A;  4OJP A;  4XLF A;  1O8F A;  2QY1 A;  4OJ5 A;  2ODL A;  1WMR A;  1O8G A;  2O04 A;  2EWE A;  2VBE A;  2UVE A;  4XKV A;  1KTW A;  4XOP A;  1GQ8 A;  3GRH A;  4XOR A;  3EQN A;  3B4N A;  1EE6 A;  3EQO A;  4YZX A;  1RU4 A;  2NSP A;  2X6W A;  3JUR A;  1CZF A;  3GQ9 A;  2X85 A;  1OGM X;  1PXZ A;  2VJI A;  3VST A;  4XNF A;  1NHC A;  1OFM A;  2NT6 A;  4W8Q A;  1BHE A;  1DBO A;  2QXZ A;  3VSU A;  4MXN A;  4YZ0 A;  3GQA A;  2Z8G A;  1O8K A;  1X0C A;  1KCC A;  4XMY A;  1KCD A;  2NTB A;  2PYH A;  1IDJ A;  2X3H A;  4XR6 A;  3GQ8 A;  4XLE A;  1RWR A;  4HWV A;  4YZA A;  4YEL A;  1O8M A;  3LMW A;  3KRG A;  2VJJ A;  1OOC A;  1QCX A;  4XQF A;  3SUC A;  1O8E A;  2X6X A;  4I84 A;  4YZQ A;  4Z05 A;  2NTP A;  1AIR A;  4URR A;  4NK8 A;  4XLA A;  4Z03 A;  1BN8 A;  4XLC A;  4XN0 A;  4AVZ A;  1IDK A;  4W8S A;  2QX3 A;  4OJL A;  2UVF A;  3VMV A;  4EW9 A;  1O88 A;  4XON A;  1IA5 A;  2BSP A;  3UW0 A;  1O8H A;  1JTA A;  2X6Y A;  4NK6 A;  2IQ7 A;  4U4B A;  2VBK A;  2O17 A;  4OZZ A;  2INV A;  4U49 A;  1XG2 A;  2O1D A;  1PE9 A;  3VSV A;  2NZM A;  2PEC A;  1QJV A;  1HG8 A;  1O8D A;  4W8R A;  1VBL A;  1RMG A;  3B8Y A;  1PLU A;  4PMH A;  1JRG A;  1H80 A;  4OJ6 A;  4XL9 A;  3ZPP A;  3GQ7 A;  4OZY A;  1OGO X;  2VBM A;  3B90 A;  1O8I A;  4MR0 A;  4YEJ A;  3VMW A;  5C1C A;  2NST A;  3ZSC A;  4XM3 A;  1K5C A;  4XN3 A;  1O8L A;  2O0V A;  2INU A;  4Z06 A;  5AMV A;  2PYG A;  3WWG A; 
#chains in the Genus database with same CATH topology
 5C1E A;  3SQV A;  2VFN A;  1LLW A;  3FY3 A;  2V5I A;  4W8T A;  4XLH A;  1OFL A;  4C2L A;  1DBG A;  2NT9 A;  4OJO A;  2XTY A;  4XKW A;  1IB4 A;  1O8J A;  2XT4 A;  2NTQ A;  4XOT A;  1DAB A;  3T9G A;  1TYV A;  2O0W A;  4OJP A;  4OPW A;  4YFO A;  2BM6 A;  2XT2 A;  4XLF A;  3PET A;  5JLV C;  1O8F A;  1TYX A;  2QY1 A;  1L1I A;  4OJ5 A;  2ODL A;  2VFM A;  3ML3 A;  3RIQ A;  3NAW A;  1WMR A;  1O8G A;  2O04 A;  1K4Z A;  3H09 A;  4JRA C;  2EWE A;  1TYW A;  2VBE A;  2UVE A;  4XKV A;  1KTW A;  4XOP A;  1GQ8 A;  3GRH A;  1CLW A;  4XOR A;  3EQN A;  1EA0 A;  3B4N A;  1EE6 A;  3EQO A;  4YZX A;  1RU4 A;  2NSP A;  2X6W A;  3JUR A;  1CZF A;  2B0R A;  2VFQ A;  2X85 A;  2BM5 A;  3GQ9 A;  1QA2 A;  4YC5 A;  1OGM X;  1PXZ A;  2VJI A;  3VST A;  4XNF A;  1K8F A;  1NHC A;  2O6W A;  2BX6 A;  1OFM A;  2NT6 A;  4W8Q A;  1BHE A;  1DBO A;  2G0Y A;  2QXZ A;  3SY2 A;  3VSU A;  4MXN A;  4YCQ A;  2VFP A;  4YZ0 A;  3BH7 B;  2Z8G A;  2IOU G;  3GQA A;  1O8K A;  1X0C A;  3NB2 A;  4YEI A;  1KCC A;  4XMY A;  2XTW A;  1KCD A;  2NTB A;  2PYH A;  1IDJ A;  2BM7 A;  2X3H A;  4XR6 A;  2F3L A;  2BM4 A;  3GQ8 A;  4XLE A;  1RWR A;  4HWV A;  2J8K A;  3LJY A;  4YZA A;  4YEL A;  1O8M A;  1QA1 A;  3LMW A;  3KRG A;  1TSP A;  1LM1 A;  3P4G A;  1OFD A;  1OOC A;  2QYU A;  1QCX A;  2VJJ A;  1KQ5 A;  4XQF A;  3SUC A;  1O8E A;  3PSS A;  2X6X A;  1QQ1 A;  4YDT A;  4I84 A;  4YZQ A;  4Z05 A;  2NTP A;  1AIR A;  4URR A;  4NK8 A;  2W7Z A;  4KH3 A;  4XLA A;  4Z03 A;  1BN8 A;  1OFE A;  4XLC A;  4XN0 A;  4AVZ A;  1IDK A;  1TYU A;  4W8S A;  2QX3 A;  1QRC A;  2UVF A;  4OJL A;  3VMV A;  1O88 A;  4EW9 A;  3PSZ A;  1LLZ A;  3N90 A;  4XON A;  5DNS A;  1IA5 A;  2BSP A;  3N6Z A;  3UW0 A;  1O8H A;  1JTA A;  2X6Y A;  1QA3 A;  4NK6 A;  2IQ7 A;  4U4B A;  3BH6 B;  5JMC B;  2VBK A;  2O17 A;  4OZZ A;  2YUH A;  4V02 C;  2INV A;  4U49 A;  1XG2 A;  2O1D A;  2XC1 A;  1PE9 A;  3VSV A;  2NZM A;  3JX8 A;  1EZG A;  2PEC A;  1QJV A;  2J8I A;  3SZE A;  1HG8 A;  1O8D A;  4W8R A;  1VBL A;  1RMG A;  3B8Y A;  3SYJ A;  1WXR A;  1PLU A;  3LYC A;  4PMH A;  1JRG A;  1H80 A;  2XTX A;  4OJ6 A;  4XL9 A;  3ZPP A;  3AK5 A;  3GQ7 A;  4OZY A;  1OGO X;  1HF2 A;  1QRB A;  2QZA A;  2VBM A;  1O8I A;  3B90 A;  3DU1 X;  4MR0 A;  4OM9 A;  2NST A;  4YEJ A;  3VMW A;  4XM3 A;  3ZSC A;  5C1C A;  1K5C A;  4XN3 A;  1O8L A;  2O0V A;  3TH0 A;  2INU A;  4Z06 A;  5AMV A;  2PYG A;  2VFO A;  3WWG A; 
#chains in the Genus database with same CATH homology
 5C1E A;  4W8T A;  3FY3 A;  4XLH A;  4C2L A;  1OFL A;  1DBG A;  2NT9 A;  4OJO A;  4XKW A;  1IB4 A;  1O8J A;  4XOT A;  2NTQ A;  3T9G A;  2O0W A;  4OJP A;  4XLF A;  1O8F A;  2QY1 A;  4OJ5 A;  2ODL A;  1WMR A;  1O8G A;  2O04 A;  2EWE A;  2VBE A;  2UVE A;  4XKV A;  1KTW A;  4XOP A;  1GQ8 A;  3GRH A;  4XOR A;  3EQN A;  3B4N A;  1EE6 A;  3EQO A;  4YZX A;  1RU4 A;  2NSP A;  2X6W A;  3JUR A;  1CZF A;  3GQ9 A;  2X85 A;  1OGM X;  1PXZ A;  2VJI A;  3VST A;  4XNF A;  1NHC A;  1OFM A;  2NT6 A;  4W8Q A;  1BHE A;  1DBO A;  2QXZ A;  3VSU A;  4MXN A;  4YZ0 A;  3GQA A;  2Z8G A;  1O8K A;  1X0C A;  1KCC A;  4XMY A;  1KCD A;  2NTB A;  2PYH A;  1IDJ A;  2X3H A;  4XR6 A;  3GQ8 A;  4XLE A;  1RWR A;  4HWV A;  4YZA A;  4YEL A;  1O8M A;  3LMW A;  3KRG A;  2VJJ A;  1OOC A;  1QCX A;  4XQF A;  3SUC A;  1O8E A;  2X6X A;  4I84 A;  4YZQ A;  4Z05 A;  2NTP A;  1AIR A;  4URR A;  4NK8 A;  4XLA A;  4Z03 A;  1BN8 A;  4XLC A;  4XN0 A;  4AVZ A;  1IDK A;  4W8S A;  2QX3 A;  4OJL A;  2UVF A;  3VMV A;  4EW9 A;  1O88 A;  4XON A;  1IA5 A;  2BSP A;  3UW0 A;  1O8H A;  1JTA A;  2X6Y A;  4NK6 A;  2IQ7 A;  4U4B A;  2VBK A;  2O17 A;  4OZZ A;  2INV A;  4U49 A;  1XG2 A;  2O1D A;  1PE9 A;  3VSV A;  2NZM A;  2PEC A;  1QJV A;  1HG8 A;  1O8D A;  4W8R A;  1VBL A;  1RMG A;  3B8Y A;  1PLU A;  4PMH A;  1JRG A;  1H80 A;  4OJ6 A;  4XL9 A;  3ZPP A;  3GQ7 A;  4OZY A;  1OGO X;  2VBM A;  3B90 A;  1O8I A;  4MR0 A;  4YEJ A;  3VMW A;  5C1C A;  2NST A;  3ZSC A;  4XM3 A;  1K5C A;  4XN3 A;  1O8L A;  2O0V A;  2INU A;  4Z06 A;  5AMV A;  2PYG A;  3WWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...