1EE6A

Crystal structure of pectate lyase from bacillus sp. strain ksm-p15.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
197
structure length
197
Chain Sequence
APTVVHETIRVPAGQTFDGKGQTYVANPNTLGDGSQAENQKPIFRLEAGASLKNVVIGAPAADGVHCYGDCTITNVIWEDVGEDALTLKSSGTVNISGGAAYKAYDKVFQINAAGTINIRNFRADDIGKLVRQNGGTTYKVVMNVENCNISRVKDAILRTDSSTSTGRIVNTRYSNVPTLFKGFKSGNTTASGNTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first structure of pectate lyase belonging to polysaccharide lyase family 3.
pubmed doi rcsb
molecule tags Lyase
molecule keywords PECTATE LYASE
total genus 78
structure length 197
sequence length 197
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2000-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1ee6A00
4MXNA 3VMVA 4W8SA 2O17A 4U49A 4OJOA 3VSUA 4XORA 1PLUA 2QXZA 3LMWA 1HG8A 1O8LA 3FY3A 3EQOA 3UW0A 1PXZA 1IDKA 3KRGA 2NZMA 2Z8GA 1O8KA 1AIRA 4XN0A 4XOTA 4XLCA 4YZAA 1CZFA 2X6YA 4XONA 3EQNA 1KTWA 4YEJA 2NSPA 4YZ0A 5C1CA 2INUA 2NTPA 2VBEA 4XLEA 1K5CA 1IDJA 4XLHA 3GQ8A 4Z03A 4URRA 3ZSCA 4MR0A 5C1EA 2VBKA 1RWRA 1OFLA 1OFMA 1O8IA 1BHEA 3T9GA 2QX3A 1JTAA 3B4NA 3VSVA 2NTQA 4XN3A 2X6WA 2PECA 1GQ8A 4XLFA 4HWVA 2NTBA 1EE6A 4OJPA 2NT9A 1O8JA 4YZXA 3GRHA 4XOPA 2UVFA 1OOCA 2VJIA 3GQ9A 4XQFA 1O8GA 2O04A 2O1DA 2O0WA 4NK6A 4XLAA 2IQ7A 2X85A 1RU4A 1DBOA 2PYHA 4YZQA 1QCXA 3GQAA 1PE9A 4XL9A 2UVEA 1IA5A 3JURA 4OJ6A 4XM3A 4OZZA 1O8DA 2NT6A 1WMRA 1RMGA 2X6XA 4XNFA 1O88A 2NSTA 4YELA 1IB4A 2X3HA 4W8QA 4AVZA 3SUCA 2PYGA 2VJJA 2EWEA 4W8TA 2O0VA 1BN8A 1OGOX 1O8MA 4OZYA 3VSTA 1DBGA 3B8YA 1OGMX 2VBMA 3GQ7A 4U4BA 4C2LA 3B90A 4NK8A 3VMWA 1O8EA 1VBLA 4OJ5A 4XKVA 1H80A 4W8RA 1O8HA 1NHCA 4I84A 4EW9A 1XG2A 4OJLA 2QY1A 4Z06A 4XR6A 1QJVA 3ZPPA 4XKWA 1KCCA 1X0CA 1JRGA 2ODLA 3WWGA 2BSPA 4Z05A 4PMHA 1KCDA 1O8FA 2INVA 5AMVA 4XMYA
chains in the Genus database with same CATH superfamily
4MXNA 2XTYA 3VMVA 4W8SA 2O17A 4U49A 4OJOA 3BH7B 3VSUA 2VFQA 4XORA 1PLUA 3N90A 2QXZA 2BM6A 2XT4A 3LMWA 1HG8A 1QRBA 4YFOA 1HF2A 1O8LA 3FY3A 3EQOA 3UW0A 1PXZA 1IDKA 3PSZA 3KRGA 2QYUA 2NZMA 2J8IA 2Z8GA 1O8KA 1AIRA 4XN0A 3N6ZA 4JRAC 4XLCA 1QRCA 4XOTA 4YZAA 1CZFA 3JX8A 2X6YA 4YDTA 4XONA 1L1IA 2BX6A 3EQNA 1KTWA 4YEJA 2NSPA 3SZEA 4YZ0A 5C1CA 2INUA 2NTPA 1KQ5A 2VBEA 4XLEA 1K5CA 1IDJA 2YUHA 3BH6B 1K8FA 3SY2A 5JMCB 1TYUA 1EZGA 2BM4A 4XLHA 3GQ8A 3SYJA 4Z03A 1QQ1A 4URRA 3ZSCA 4MR0A 5C1EA 3H09A 2VBKA 2IOUG 1RWRA 1OFEA 1OFLA 2XTXA 3LJYA 1TYWA 1OFMA 1O8IA 1QA1A 1BHEA 3T9GA 2QX3A 1JTAA 3B4NA 2O6WA 3VSVA 1WXRA 2NTQA 4XN3A 2X6WA 2J8KA 2PECA 1GQ8A 2XTWA 4XLFA 1QA3A 4HWVA 3SQVA 1LLWA 1TYXA 2NTBA 4YC5A 1EE6A 4OJPA 1EA0A 1TYVA 2NT9A 2VFMA 1DABA 1O8JA 4KH3A 4YZXA 3GRHA 4XOPA 2UVFA 3ML3A 2VFPA 1OOCA 2G0YA 2VJIA 3GQ9A 4XQFA 1O8GA 2O04A 2O1DA 2O0WA 2XT2A 2W7ZA 4NK6A 4XLAA 2IQ7A 2X85A 1RU4A 1DBOA 2BM7A 2BM5A 2PYHA 3PSSA 4YZQA 1LLZA 2V5IA 1QCXA 3GQAA 1PE9A 5JLVC 4OPWA 2UVEA 4XL9A 1IA5A 3JURA 4OJ6A 4XM3A 3NAWA 4OZZA 1K4ZA 1O8DA 2NT6A 1WMRA 1RMGA 2B0RA 2X6XA 2XC1A 4XNFA 1O88A 2NSTA 4YELA 4OM9A 1IB4A 2X3HA 3DU1X 2QZAA 3LYCA 4W8QA 4AVZA 3SUCA 2PYGA 2VJJA 4V02C 1OFDA 2EWEA 4W8TA 2O0VA 3TH0A 1BN8A 1OGOX 1O8MA 4OZYA 3VSTA 3NB2A 1DBGA 3B8YA 1OGMX 1QA2A 3AK5A 2VBMA 3GQ7A 4U4BA 4C2LA 3B90A 4NK8A 1CLWA 1TSPA 2F3LA 3VMWA 1O8EA 1VBLA 2VFOA 4OJ5A 4XKVA 5DNSA 4YEIA 1H80A 3PETA 4W8RA 1O8HA 2VFNA 1NHCA 4I84A 4EW9A 1XG2A 4OJLA 2QY1A 4Z06A 4XR6A 1QJVA 3ZPPA 4XKWA 4YCQA 1X0CA 1JRGA 2ODLA 3WWGA 1KCCA 4XMYA 2BSPA 4Z05A 4PMHA 1KCDA 1O8FA 3P4GA 2INVA 5AMVA 3RIQA 1LM1A
chains in the Genus database with same CATH topology
4MXNA 3VMVA 4W8SA 2O17A 4U49A 4OJOA 3VSUA 4XORA 1PLUA 2QXZA 3LMWA 1HG8A 1O8LA 3FY3A 3EQOA 3UW0A 1PXZA 1IDKA 3KRGA 2NZMA 2Z8GA 1O8KA 1AIRA 4XN0A 4XOTA 4XLCA 4YZAA 1CZFA 2X6YA 4XONA 3EQNA 1KTWA 4YEJA 2NSPA 4YZ0A 5C1CA 2INUA 2NTPA 2VBEA 4XLEA 1K5CA 1IDJA 4XLHA 3GQ8A 4Z03A 4URRA 3ZSCA 4MR0A 5C1EA 2VBKA 1RWRA 1OFLA 1OFMA 1O8IA 1BHEA 3T9GA 2QX3A 1JTAA 3B4NA 3VSVA 2NTQA 4XN3A 2X6WA 2PECA 1GQ8A 4XLFA 4HWVA 2NTBA 1EE6A 4OJPA 2NT9A 1O8JA 4YZXA 3GRHA 4XOPA 2UVFA 1OOCA 2VJIA 3GQ9A 4XQFA 1O8GA 2O04A 2O1DA 2O0WA 4NK6A 4XLAA 2IQ7A 2X85A 1RU4A 1DBOA 2PYHA 4YZQA 1QCXA 3GQAA 1PE9A 4XL9A 2UVEA 1IA5A 3JURA 4OJ6A 4XM3A 4OZZA 1O8DA 2NT6A 1WMRA 1RMGA 2X6XA 4XNFA 1O88A 2NSTA 4YELA 1IB4A 2X3HA 4W8QA 4AVZA 3SUCA 2PYGA 2VJJA 2EWEA 4W8TA 2O0VA 1BN8A 1OGOX 1O8MA 4OZYA 3VSTA 1DBGA 3B8YA 1OGMX 2VBMA 3GQ7A 4U4BA 4C2LA 3B90A 4NK8A 3VMWA 1O8EA 1VBLA 4OJ5A 4XKVA 1H80A 4W8RA 1O8HA 1NHCA 4I84A 4EW9A 1XG2A 4OJLA 2QY1A 4Z06A 4XR6A 1QJVA 3ZPPA 4XKWA 1KCCA 1X0CA 1JRGA 2ODLA 3WWGA 2BSPA 4Z05A 4PMHA 1KCDA 1O8FA 2INVA 5AMVA 4XMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MXN A;  3VMV A;  4W8S A;  2O17 A;  4U49 A;  4OJO A;  3VSU A;  4XOR A;  1PLU A;  2QXZ A;  3LMW A;  1HG8 A;  1O8L A;  3FY3 A;  3EQO A;  3UW0 A;  1PXZ A;  1IDK A;  3KRG A;  2NZM A;  2Z8G A;  1O8K A;  1AIR A;  4XN0 A;  4XOT A;  4XLC A;  4YZA A;  1CZF A;  2X6Y A;  4XON A;  3EQN A;  1KTW A;  4YEJ A;  2NSP A;  4YZ0 A;  5C1C A;  2INU A;  2NTP A;  2VBE A;  4XLE A;  1K5C A;  1IDJ A;  4XLH A;  3GQ8 A;  4Z03 A;  4URR A;  3ZSC A;  4MR0 A;  5C1E A;  2VBK A;  1RWR A;  1OFL A;  1OFM A;  1O8I A;  1BHE A;  3T9G A;  2QX3 A;  1JTA A;  3B4N A;  3VSV A;  2NTQ A;  4XN3 A;  2X6W A;  2PEC A;  1GQ8 A;  4XLF A;  4HWV A;  2NTB A;  1EE6 A;  4OJP A;  2NT9 A;  1O8J A;  4YZX A;  3GRH A;  4XOP A;  2UVF A;  1OOC A;  2VJI A;  3GQ9 A;  4XQF A;  1O8G A;  2O04 A;  2O1D A;  2O0W A;  4NK6 A;  4XLA A;  2IQ7 A;  2X85 A;  1RU4 A;  1DBO A;  2PYH A;  4YZQ A;  1QCX A;  3GQA A;  1PE9 A;  4XL9 A;  2UVE A;  1IA5 A;  3JUR A;  4OJ6 A;  4XM3 A;  4OZZ A;  1O8D A;  2NT6 A;  1WMR A;  1RMG A;  2X6X A;  4XNF A;  1O88 A;  2NST A;  4YEL A;  1IB4 A;  2X3H A;  4W8Q A;  4AVZ A;  3SUC A;  2PYG A;  2VJJ A;  2EWE A;  4W8T A;  2O0V A;  1BN8 A;  1OGO X;  1O8M A;  4OZY A;  3VST A;  1DBG A;  3B8Y A;  1OGM X;  2VBM A;  3GQ7 A;  4U4B A;  4C2L A;  3B90 A;  4NK8 A;  3VMW A;  1O8E A;  1VBL A;  4OJ5 A;  4XKV A;  1H80 A;  4W8R A;  1O8H A;  1NHC A;  4I84 A;  4EW9 A;  1XG2 A;  4OJL A;  2QY1 A;  4Z06 A;  4XR6 A;  1QJV A;  3ZPP A;  4XKW A;  1KCC A;  1X0C A;  1JRG A;  2ODL A;  3WWG A;  2BSP A;  4Z05 A;  4PMH A;  1KCD A;  1O8F A;  2INV A;  5AMV A;  4XMY A; 
#chains in the Genus database with same CATH topology
 4MXN A;  2XTY A;  3VMV A;  4W8S A;  2O17 A;  4U49 A;  4OJO A;  3BH7 B;  3VSU A;  2VFQ A;  4XOR A;  1PLU A;  3N90 A;  2QXZ A;  2BM6 A;  2XT4 A;  3LMW A;  1HG8 A;  1QRB A;  4YFO A;  1HF2 A;  1O8L A;  3FY3 A;  3EQO A;  3UW0 A;  1PXZ A;  1IDK A;  3PSZ A;  3KRG A;  2QYU A;  2NZM A;  2J8I A;  2Z8G A;  1O8K A;  1AIR A;  4XN0 A;  3N6Z A;  4JRA C;  4XLC A;  1QRC A;  4XOT A;  4YZA A;  1CZF A;  3JX8 A;  2X6Y A;  4YDT A;  4XON A;  1L1I A;  2BX6 A;  3EQN A;  1KTW A;  4YEJ A;  2NSP A;  3SZE A;  4YZ0 A;  5C1C A;  2INU A;  2NTP A;  1KQ5 A;  2VBE A;  4XLE A;  1K5C A;  1IDJ A;  2YUH A;  3BH6 B;  1K8F A;  3SY2 A;  5JMC B;  1TYU A;  1EZG A;  2BM4 A;  4XLH A;  3GQ8 A;  3SYJ A;  4Z03 A;  1QQ1 A;  4URR A;  3ZSC A;  4MR0 A;  5C1E A;  3H09 A;  2VBK A;  2IOU G;  1RWR A;  1OFE A;  1OFL A;  2XTX A;  3LJY A;  1TYW A;  1OFM A;  1O8I A;  1QA1 A;  1BHE A;  3T9G A;  2QX3 A;  1JTA A;  3B4N A;  2O6W A;  3VSV A;  1WXR A;  2NTQ A;  4XN3 A;  2X6W A;  2J8K A;  2PEC A;  1GQ8 A;  2XTW A;  4XLF A;  1QA3 A;  4HWV A;  3SQV A;  1LLW A;  1TYX A;  2NTB A;  4YC5 A;  1EE6 A;  4OJP A;  1EA0 A;  1TYV A;  2NT9 A;  2VFM A;  1DAB A;  1O8J A;  4KH3 A;  4YZX A;  3GRH A;  4XOP A;  2UVF A;  3ML3 A;  2VFP A;  1OOC A;  2G0Y A;  2VJI A;  3GQ9 A;  4XQF A;  1O8G A;  2O04 A;  2O1D A;  2O0W A;  2XT2 A;  2W7Z A;  4NK6 A;  4XLA A;  2IQ7 A;  2X85 A;  1RU4 A;  1DBO A;  2BM7 A;  2BM5 A;  2PYH A;  3PSS A;  4YZQ A;  1LLZ A;  2V5I A;  1QCX A;  3GQA A;  1PE9 A;  5JLV C;  4OPW A;  2UVE A;  4XL9 A;  1IA5 A;  3JUR A;  4OJ6 A;  4XM3 A;  3NAW A;  4OZZ A;  1K4Z A;  1O8D A;  2NT6 A;  1WMR A;  1RMG A;  2B0R A;  2X6X A;  2XC1 A;  4XNF A;  1O88 A;  2NST A;  4YEL A;  4OM9 A;  1IB4 A;  2X3H A;  3DU1 X;  2QZA A;  3LYC A;  4W8Q A;  4AVZ A;  3SUC A;  2PYG A;  2VJJ A;  4V02 C;  1OFD A;  2EWE A;  4W8T A;  2O0V A;  3TH0 A;  1BN8 A;  1OGO X;  1O8M A;  4OZY A;  3VST A;  3NB2 A;  1DBG A;  3B8Y A;  1OGM X;  1QA2 A;  3AK5 A;  2VBM A;  3GQ7 A;  4U4B A;  4C2L A;  3B90 A;  4NK8 A;  1CLW A;  1TSP A;  2F3L A;  3VMW A;  1O8E A;  1VBL A;  2VFO A;  4OJ5 A;  4XKV A;  5DNS A;  4YEI A;  1H80 A;  3PET A;  4W8R A;  1O8H A;  2VFN A;  1NHC A;  4I84 A;  4EW9 A;  1XG2 A;  4OJL A;  2QY1 A;  4Z06 A;  4XR6 A;  1QJV A;  3ZPP A;  4XKW A;  4YCQ A;  1X0C A;  1JRG A;  2ODL A;  3WWG A;  1KCC A;  4XMY A;  2BSP A;  4Z05 A;  4PMH A;  1KCD A;  1O8F A;  3P4G A;  2INV A;  5AMV A;  3RIQ A;  1LM1 A; 
#chains in the Genus database with same CATH homology
 4MXN A;  3VMV A;  4W8S A;  2O17 A;  4U49 A;  4OJO A;  3VSU A;  4XOR A;  1PLU A;  2QXZ A;  3LMW A;  1HG8 A;  1O8L A;  3FY3 A;  3EQO A;  3UW0 A;  1PXZ A;  1IDK A;  3KRG A;  2NZM A;  2Z8G A;  1O8K A;  1AIR A;  4XN0 A;  4XOT A;  4XLC A;  4YZA A;  1CZF A;  2X6Y A;  4XON A;  3EQN A;  1KTW A;  4YEJ A;  2NSP A;  4YZ0 A;  5C1C A;  2INU A;  2NTP A;  2VBE A;  4XLE A;  1K5C A;  1IDJ A;  4XLH A;  3GQ8 A;  4Z03 A;  4URR A;  3ZSC A;  4MR0 A;  5C1E A;  2VBK A;  1RWR A;  1OFL A;  1OFM A;  1O8I A;  1BHE A;  3T9G A;  2QX3 A;  1JTA A;  3B4N A;  3VSV A;  2NTQ A;  4XN3 A;  2X6W A;  2PEC A;  1GQ8 A;  4XLF A;  4HWV A;  2NTB A;  1EE6 A;  4OJP A;  2NT9 A;  1O8J A;  4YZX A;  3GRH A;  4XOP A;  2UVF A;  1OOC A;  2VJI A;  3GQ9 A;  4XQF A;  1O8G A;  2O04 A;  2O1D A;  2O0W A;  4NK6 A;  4XLA A;  2IQ7 A;  2X85 A;  1RU4 A;  1DBO A;  2PYH A;  4YZQ A;  1QCX A;  3GQA A;  1PE9 A;  4XL9 A;  2UVE A;  1IA5 A;  3JUR A;  4OJ6 A;  4XM3 A;  4OZZ A;  1O8D A;  2NT6 A;  1WMR A;  1RMG A;  2X6X A;  4XNF A;  1O88 A;  2NST A;  4YEL A;  1IB4 A;  2X3H A;  4W8Q A;  4AVZ A;  3SUC A;  2PYG A;  2VJJ A;  2EWE A;  4W8T A;  2O0V A;  1BN8 A;  1OGO X;  1O8M A;  4OZY A;  3VST A;  1DBG A;  3B8Y A;  1OGM X;  2VBM A;  3GQ7 A;  4U4B A;  4C2L A;  3B90 A;  4NK8 A;  3VMW A;  1O8E A;  1VBL A;  4OJ5 A;  4XKV A;  1H80 A;  4W8R A;  1O8H A;  1NHC A;  4I84 A;  4EW9 A;  1XG2 A;  4OJL A;  2QY1 A;  4Z06 A;  4XR6 A;  1QJV A;  3ZPP A;  4XKW A;  1KCC A;  1X0C A;  1JRG A;  2ODL A;  3WWG A;  2BSP A;  4Z05 A;  4PMH A;  1KCD A;  1O8F A;  2INV A;  5AMV A;  4XMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...