1EE6A

Crystal structure of pectate lyase from bacillus sp. strain ksm-p15.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
197
structure length
197
Chain Sequence
APTVVHETIRVPAGQTFDGKGQTYVANPNTLGDGSQAENQKPIFRLEAGASLKNVVIGAPAADGVHCYGDCTITNVIWEDVGEDALTLKSSGTVNISGGAAYKAYDKVFQINAAGTINIRNFRADDIGKLVRQNGGTTYKVVMNVENCNISRVKDAILRTDSSTSTGRIVNTRYSNVPTLFKGFKSGNTTASGNTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PECTATE LYASE
publication title The first structure of pectate lyase belonging to polysaccharide lyase family 3.
pubmed doi rcsb
total genus 78
structure length 197
sequence length 197
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2000-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1ee6A00
2VBMA 3GQ9A 1O8GA 2Z8GA 1O8JA 2NSTA 4XNFA 4YZ0A 4U49A 2O0VA 3SUCA 4XMYA 2NSPA 2O04A 1KCCA 4XR6A 4MXNA 2QY1A 1K5CA 4XLCA 4XKWA 1O8KA 3ZPPA 3GRHA 2X6YA 4XLFA 4OJPA 1KTWA 1CZFA 4YZQA 4Z05A 3VMWA 5C1CA 1OFMA 1O8IA 4XN3A 3ZSCA 1O8EA 1QCXA 3VMVA 1O8MA 3VSVA 1AIRA 2X85A 3GQ7A 2ODLA 4XM3A 4XQFA 4YZXA 4PMHA 1O8DA 4OJOA 2PECA 4NK8A 3T9GA 1EE6A 2O1DA 3KRGA 5AMVA 4AVZA 2INUA 1O8LA 1KCDA 3EQNA 1BN8A 1GQ8A 2BSPA 2IQ7A 4OJ6A 2X6WA 4XOTA 3UW0A 1XG2A 1VBLA 2PYHA 4YELA 1DBGA 3JURA 1IA5A 3GQAA 4Z06A 1PLUA 2VBKA 1IDJA 4NK6A 2NTPA 3FY3A 5C1EA 1OGMX 1NHCA 1RU4A 2NT6A 2NTBA 4XL9A 4Z03A 1O8FA 1RMGA 1WMRA 4W8TA 4XKVA 3B8YA 4XORA 1DBOA 4XLEA 3GQ8A 2NT9A 4C2LA 1PE9A 2X3HA 3EQOA 1IB4A 3VSUA 1H80A 2O17A 4URRA 4YEJA 4YZAA 4W8RA 4U4BA 4XLAA 1QJVA 2VJJA 1PXZA 2PYGA 2UVEA 2UVFA 4OZYA 4W8SA 1JTAA 1BHEA 3B90A 4XONA 3VSTA 1HG8A 2VJIA 4W8QA 1OGOX 1OFLA 4OZZA 2INVA 3WWGA 1O8HA 4MR0A 4EW9A 1X0CA 2NTQA 4XN0A 2QXZA 1O88A 3B4NA 4OJ5A 4XOPA 2VBEA 2X6XA 4I84A 2O0WA 2EWEA 2QX3A 2NZMA 4OJLA 1JRGA 4XLHA 1RWRA 1OOCA 4HWVA 1IDKA 3LMWA
chains in the Genus database with same CATH superfamily
2VBMA 3GQ9A 3PETA 3P4GA 1O8GA 3SY2A 2Z8GA 1O8JA 2NSTA 4OM9A 4XNFA 4YZ0A 4U49A 3NAWA 2O0VA 3LMWA 3ML3A 3SUCA 4XMYA 1KQ5A 2NSPA 2O04A 3N6ZA 1KCCA 1K8FA 4XR6A 4MXNA 2QY1A 2BM6A 3BH7B 3RIQA 1K5CA 4XLCA 4XKWA 1O8KA 3N90A 3ZPPA 3GRHA 2J8KA 2X6YA 1LLWA 2XT2A 4KH3A 4XLFA 4OJPA 4YEIA 1KTWA 5JMCB 1CZFA 4YZQA 4Z05A 3VMWA 5C1CA 4YCQA 1OFMA 1O8IA 4XN3A 3ZSCA 1O8EA 1QCXA 3VMVA 1O8MA 3VSVA 1AIRA 1EZGA 2X85A 1WXRA 3GQ7A 2BM4A 2ODLA 4XM3A 1TYVA 4YZXA 4XQFA 3BH6B 2VFNA 4PMHA 3H09A 3LYCA 1O8DA 4OJOA 2PECA 4NK8A 3T9GA 3PSZA 1EE6A 2O1DA 1TYWA 5DNSA 2XTWA 3KRGA 2O6WA 5AMVA 2W7ZA 4YDTA 3LJYA 4AVZA 3SQVA 1K4ZA 2INUA 1O8LA 1KCDA 3EQNA 1BN8A 1GQ8A 2BSPA 2IQ7A 2QYUA 2XTXA 4OJ6A 2X6WA 4XOTA 4YFOA 3UW0A 3DU1X 1XG2A 1VBLA 2B0RA 2PYHA 2V5IA 4YELA 1DBGA 3JURA 1IA5A 1CLWA 2QZAA 4JRAC 3SZEA 3GQAA 1QRCA 4Z06A 2IOUG 1PLUA 2VFPA 1QA2A 2VBKA 1QA1A 1IDJA 1TYUA 2YUHA 3TH0A 4NK6A 2NTPA 3FY3A 5JLVC 5C1EA 3JX8A 1OGMX 1NHCA 1RU4A 2NT6A 2NTBA 2VFMA 4XL9A 4Z03A 1OFDA 1O8FA 1RMGA 1TSPA 1WMRA 4W8TA 4XKVA 3B8YA 2XTYA 4XORA 1DBOA 4XLEA 3GQ8A 1TYXA 2NT9A 4C2LA 2VFOA 2BM7A 3SYJA 1PE9A 2X3HA 3EQOA 1L1IA 1IB4A 3VSUA 4YC5A 1H80A 2O17A 1QQ1A 4URRA 4YEJA 2XT4A 4YZAA 2BM5A 4W8RA 3NB2A 4U4BA 1QJVA 2VJJA 1PXZA 2PYGA 4XLAA 2UVEA 3AK5A 2UVFA 2F3LA 4OZYA 4W8SA 1JTAA 1BHEA 1QRBA 3B90A 4XONA 2J8IA 3VSTA 1HG8A 1EA0A 2VJIA 4W8QA 1OGOX 4OPWA 1OFLA 2G0YA 4OZZA 2INVA 3WWGA 1O8HA 4MR0A 4EW9A 1X0CA 2NTQA 1OFEA 3PSSA 4XN0A 1LLZA 1O88A 2QXZA 2VFQA 2BX6A 3B4NA 4OJ5A 4XOPA 2VBEA 2X6XA 4I84A 2O0WA 4V02C 2XC1A 2EWEA 2QX3A 2NZMA 4OJLA 1JRGA 1LM1A 4XLHA 1DABA 1RWRA 1OOCA 4HWVA 1IDKA 1HF2A 1QA3A
chains in the Genus database with same CATH topology
2VBMA 3GQ9A 1O8GA 2Z8GA 1O8JA 2NSTA 4XNFA 4YZ0A 4U49A 2O0VA 3SUCA 4XMYA 2NSPA 2O04A 1KCCA 4XR6A 4MXNA 2QY1A 1K5CA 4XLCA 4XKWA 1O8KA 3ZPPA 3GRHA 2X6YA 4XLFA 4OJPA 1KTWA 1CZFA 4YZQA 4Z05A 3VMWA 5C1CA 1OFMA 1O8IA 4XN3A 3ZSCA 1O8EA 1QCXA 3VMVA 1O8MA 3VSVA 1AIRA 2X85A 3GQ7A 2ODLA 4XM3A 4XQFA 4YZXA 4PMHA 1O8DA 4OJOA 2PECA 4NK8A 3T9GA 1EE6A 2O1DA 3KRGA 5AMVA 4AVZA 2INUA 1O8LA 1KCDA 3EQNA 1BN8A 1GQ8A 2BSPA 2IQ7A 4OJ6A 2X6WA 4XOTA 3UW0A 1XG2A 1VBLA 2PYHA 4YELA 1DBGA 3JURA 1IA5A 3GQAA 4Z06A 1PLUA 2VBKA 1IDJA 4NK6A 2NTPA 3FY3A 5C1EA 1OGMX 1NHCA 1RU4A 2NT6A 2NTBA 4XL9A 4Z03A 1O8FA 1RMGA 1WMRA 4W8TA 4XKVA 3B8YA 4XORA 1DBOA 4XLEA 3GQ8A 2NT9A 4C2LA 1PE9A 2X3HA 3EQOA 1IB4A 3VSUA 1H80A 2O17A 4URRA 4YEJA 4YZAA 4W8RA 4U4BA 4XLAA 1QJVA 2VJJA 1PXZA 2PYGA 2UVEA 2UVFA 4OZYA 4W8SA 1JTAA 1BHEA 3B90A 4XONA 3VSTA 1HG8A 2VJIA 4W8QA 1OGOX 1OFLA 4OZZA 2INVA 3WWGA 1O8HA 4MR0A 4EW9A 1X0CA 2NTQA 4XN0A 2QXZA 1O88A 3B4NA 4OJ5A 4XOPA 2VBEA 2X6XA 4I84A 2O0WA 2EWEA 2QX3A 2NZMA 4OJLA 1JRGA 4XLHA 1RWRA 1OOCA 4HWVA 1IDKA 3LMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBM A;  3GQ9 A;  1O8G A;  2Z8G A;  1O8J A;  2NST A;  4XNF A;  4YZ0 A;  4U49 A;  2O0V A;  3SUC A;  4XMY A;  2NSP A;  2O04 A;  1KCC A;  4XR6 A;  4MXN A;  2QY1 A;  1K5C A;  4XLC A;  4XKW A;  1O8K A;  3ZPP A;  3GRH A;  2X6Y A;  4XLF A;  4OJP A;  1KTW A;  1CZF A;  4YZQ A;  4Z05 A;  3VMW A;  5C1C A;  1OFM A;  1O8I A;  4XN3 A;  3ZSC A;  1O8E A;  1QCX A;  3VMV A;  1O8M A;  3VSV A;  1AIR A;  2X85 A;  3GQ7 A;  2ODL A;  4XM3 A;  4XQF A;  4YZX A;  4PMH A;  1O8D A;  4OJO A;  2PEC A;  4NK8 A;  3T9G A;  1EE6 A;  2O1D A;  3KRG A;  5AMV A;  4AVZ A;  2INU A;  1O8L A;  1KCD A;  3EQN A;  1BN8 A;  1GQ8 A;  2BSP A;  2IQ7 A;  4OJ6 A;  2X6W A;  4XOT A;  3UW0 A;  1XG2 A;  1VBL A;  2PYH A;  4YEL A;  1DBG A;  3JUR A;  1IA5 A;  3GQA A;  4Z06 A;  1PLU A;  2VBK A;  1IDJ A;  4NK6 A;  2NTP A;  3FY3 A;  5C1E A;  1OGM X;  1NHC A;  1RU4 A;  2NT6 A;  2NTB A;  4XL9 A;  4Z03 A;  1O8F A;  1RMG A;  1WMR A;  4W8T A;  4XKV A;  3B8Y A;  4XOR A;  1DBO A;  4XLE A;  3GQ8 A;  2NT9 A;  4C2L A;  1PE9 A;  2X3H A;  3EQO A;  1IB4 A;  3VSU A;  1H80 A;  2O17 A;  4URR A;  4YEJ A;  4YZA A;  4W8R A;  4U4B A;  4XLA A;  1QJV A;  2VJJ A;  1PXZ A;  2PYG A;  2UVE A;  2UVF A;  4OZY A;  4W8S A;  1JTA A;  1BHE A;  3B90 A;  4XON A;  3VST A;  1HG8 A;  2VJI A;  4W8Q A;  1OGO X;  1OFL A;  4OZZ A;  2INV A;  3WWG A;  1O8H A;  4MR0 A;  4EW9 A;  1X0C A;  2NTQ A;  4XN0 A;  2QXZ A;  1O88 A;  3B4N A;  4OJ5 A;  4XOP A;  2VBE A;  2X6X A;  4I84 A;  2O0W A;  2EWE A;  2QX3 A;  2NZM A;  4OJL A;  1JRG A;  4XLH A;  1RWR A;  1OOC A;  4HWV A;  1IDK A;  3LMW A; 
#chains in the Genus database with same CATH topology
 2VBM A;  3GQ9 A;  3PET A;  3P4G A;  1O8G A;  3SY2 A;  2Z8G A;  1O8J A;  2NST A;  4OM9 A;  4XNF A;  4YZ0 A;  4U49 A;  3NAW A;  2O0V A;  3LMW A;  3ML3 A;  3SUC A;  4XMY A;  1KQ5 A;  2NSP A;  2O04 A;  3N6Z A;  1KCC A;  1K8F A;  4XR6 A;  4MXN A;  2QY1 A;  2BM6 A;  3BH7 B;  3RIQ A;  1K5C A;  4XLC A;  4XKW A;  1O8K A;  3N90 A;  3ZPP A;  3GRH A;  2J8K A;  2X6Y A;  1LLW A;  2XT2 A;  4KH3 A;  4XLF A;  4OJP A;  4YEI A;  1KTW A;  5JMC B;  1CZF A;  4YZQ A;  4Z05 A;  3VMW A;  5C1C A;  4YCQ A;  1OFM A;  1O8I A;  4XN3 A;  3ZSC A;  1O8E A;  1QCX A;  3VMV A;  1O8M A;  3VSV A;  1AIR A;  1EZG A;  2X85 A;  1WXR A;  3GQ7 A;  2BM4 A;  2ODL A;  4XM3 A;  1TYV A;  4YZX A;  4XQF A;  3BH6 B;  2VFN A;  4PMH A;  3H09 A;  3LYC A;  1O8D A;  4OJO A;  2PEC A;  4NK8 A;  3T9G A;  3PSZ A;  1EE6 A;  2O1D A;  1TYW A;  5DNS A;  2XTW A;  3KRG A;  2O6W A;  5AMV A;  2W7Z A;  4YDT A;  3LJY A;  4AVZ A;  3SQV A;  1K4Z A;  2INU A;  1O8L A;  1KCD A;  3EQN A;  1BN8 A;  1GQ8 A;  2BSP A;  2IQ7 A;  2QYU A;  2XTX A;  4OJ6 A;  2X6W A;  4XOT A;  4YFO A;  3UW0 A;  3DU1 X;  1XG2 A;  1VBL A;  2B0R A;  2PYH A;  2V5I A;  4YEL A;  1DBG A;  3JUR A;  1IA5 A;  1CLW A;  2QZA A;  4JRA C;  3SZE A;  3GQA A;  1QRC A;  4Z06 A;  2IOU G;  1PLU A;  2VFP A;  1QA2 A;  2VBK A;  1QA1 A;  1IDJ A;  1TYU A;  2YUH A;  3TH0 A;  4NK6 A;  2NTP A;  3FY3 A;  5JLV C;  5C1E A;  3JX8 A;  1OGM X;  1NHC A;  1RU4 A;  2NT6 A;  2NTB A;  2VFM A;  4XL9 A;  4Z03 A;  1OFD A;  1O8F A;  1RMG A;  1TSP A;  1WMR A;  4W8T A;  4XKV A;  3B8Y A;  2XTY A;  4XOR A;  1DBO A;  4XLE A;  3GQ8 A;  1TYX A;  2NT9 A;  4C2L A;  2VFO A;  2BM7 A;  3SYJ A;  1PE9 A;  2X3H A;  3EQO A;  1L1I A;  1IB4 A;  3VSU A;  4YC5 A;  1H80 A;  2O17 A;  1QQ1 A;  4URR A;  4YEJ A;  2XT4 A;  4YZA A;  2BM5 A;  4W8R A;  3NB2 A;  4U4B A;  1QJV A;  2VJJ A;  1PXZ A;  2PYG A;  4XLA A;  2UVE A;  3AK5 A;  2UVF A;  2F3L A;  4OZY A;  4W8S A;  1JTA A;  1BHE A;  1QRB A;  3B90 A;  4XON A;  2J8I A;  3VST A;  1HG8 A;  1EA0 A;  2VJI A;  4W8Q A;  1OGO X;  4OPW A;  1OFL A;  2G0Y A;  4OZZ A;  2INV A;  3WWG A;  1O8H A;  4MR0 A;  4EW9 A;  1X0C A;  2NTQ A;  1OFE A;  3PSS A;  4XN0 A;  1LLZ A;  1O88 A;  2QXZ A;  2VFQ A;  2BX6 A;  3B4N A;  4OJ5 A;  4XOP A;  2VBE A;  2X6X A;  4I84 A;  2O0W A;  4V02 C;  2XC1 A;  2EWE A;  2QX3 A;  2NZM A;  4OJL A;  1JRG A;  1LM1 A;  4XLH A;  1DAB A;  1RWR A;  1OOC A;  4HWV A;  1IDK A;  1HF2 A;  1QA3 A; 
#chains in the Genus database with same CATH homology
 2VBM A;  3GQ9 A;  1O8G A;  2Z8G A;  1O8J A;  2NST A;  4XNF A;  4YZ0 A;  4U49 A;  2O0V A;  3SUC A;  4XMY A;  2NSP A;  2O04 A;  1KCC A;  4XR6 A;  4MXN A;  2QY1 A;  1K5C A;  4XLC A;  4XKW A;  1O8K A;  3ZPP A;  3GRH A;  2X6Y A;  4XLF A;  4OJP A;  1KTW A;  1CZF A;  4YZQ A;  4Z05 A;  3VMW A;  5C1C A;  1OFM A;  1O8I A;  4XN3 A;  3ZSC A;  1O8E A;  1QCX A;  3VMV A;  1O8M A;  3VSV A;  1AIR A;  2X85 A;  3GQ7 A;  2ODL A;  4XM3 A;  4XQF A;  4YZX A;  4PMH A;  1O8D A;  4OJO A;  2PEC A;  4NK8 A;  3T9G A;  1EE6 A;  2O1D A;  3KRG A;  5AMV A;  4AVZ A;  2INU A;  1O8L A;  1KCD A;  3EQN A;  1BN8 A;  1GQ8 A;  2BSP A;  2IQ7 A;  4OJ6 A;  2X6W A;  4XOT A;  3UW0 A;  1XG2 A;  1VBL A;  2PYH A;  4YEL A;  1DBG A;  3JUR A;  1IA5 A;  3GQA A;  4Z06 A;  1PLU A;  2VBK A;  1IDJ A;  4NK6 A;  2NTP A;  3FY3 A;  5C1E A;  1OGM X;  1NHC A;  1RU4 A;  2NT6 A;  2NTB A;  4XL9 A;  4Z03 A;  1O8F A;  1RMG A;  1WMR A;  4W8T A;  4XKV A;  3B8Y A;  4XOR A;  1DBO A;  4XLE A;  3GQ8 A;  2NT9 A;  4C2L A;  1PE9 A;  2X3H A;  3EQO A;  1IB4 A;  3VSU A;  1H80 A;  2O17 A;  4URR A;  4YEJ A;  4YZA A;  4W8R A;  4U4B A;  4XLA A;  1QJV A;  2VJJ A;  1PXZ A;  2PYG A;  2UVE A;  2UVF A;  4OZY A;  4W8S A;  1JTA A;  1BHE A;  3B90 A;  4XON A;  3VST A;  1HG8 A;  2VJI A;  4W8Q A;  1OGO X;  1OFL A;  4OZZ A;  2INV A;  3WWG A;  1O8H A;  4MR0 A;  4EW9 A;  1X0C A;  2NTQ A;  4XN0 A;  2QXZ A;  1O88 A;  3B4N A;  4OJ5 A;  4XOP A;  2VBE A;  2X6X A;  4I84 A;  2O0W A;  2EWE A;  2QX3 A;  2NZM A;  4OJL A;  1JRG A;  4XLH A;  1RWR A;  1OOC A;  4HWV A;  1IDK A;  3LMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...