1EE6A

Crystal structure of pectate lyase from bacillus sp. strain ksm-p15.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
197
structure length
197
Chain Sequence
b'APTVVHETIRVPAGQTFDGKGQTYVANPNTLGDGSQAENQKPIFRLEAGASLKNVVIGAPAADGVHCYGDCTITNVIWEDVGEDALTLKSSGTVNISGGAAYKAYDKVFQINAAGTINIRNFRADDIGKLVRQNGGTTYKVVMNVENCNISRVKDAILRTDSSTSTGRIVNTRYSNVPTLFKGFKSGNTTASGNTQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PECTATE LYASE
molecule tags Lyase
publication title The first structure of pectate lyase belonging to polysaccharide lyase family 3.
pubmed doi rcsb
total genus 78
structure length 197
sequence length 197
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2000-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1ee6A00
4XKWA 4OJ6A 2X6YA 4W8RA 1O8KA 4OJ5A 4AVZA 2BSPA 1WMRA 2QX3A 3JURA 1OFLA 1O8DA 1DBGA 1O8JA 2NT9A 2X85A 1OGOX 2NTPA 4U4BA 3UW0A 2X3HA 2UVFA 2O1DA 1PE9A 1AIRA 1DBOA 4URRA 4YELA 3B4NA 2NT6A 2QXZA 4YEJA 4Z03A 4XN3A 4XLEA 2O17A 4XLFA 1KCDA 1EE6A 4EW9A 1RU4A 2NTQA 2NZMA 4XOPA 4W8SA 4XMYA 1VBLA 4YZ0A 4Z05A 2ODLA 3VSTA 4OZZA 5AMVA 2VBEA 4HWVA 5C1EA 4XORA 4OZYA 3ZSCA 3B8YA 2PYGA 4XLAA 2EWEA 4XR6A 2VBKA 3SUCA 4XNFA 1KTWA 3VMVA 2PYHA 4XONA 1RWRA 4OJPA 2X6WA 4XKVA 1PXZA 2NSPA 1NHCA 1O8GA 3GRHA 4MXNA 3FY3A 4XL9A 3GQ7A 2IQ7A 1O88A 1O8HA 4XM3A 2INUA 2X6XA 1GQ8A 4YZAA 3KRGA 4NK6A 4XQFA 3GQAA 2NTBA 1JRGA 1RMGA 3WWGA 1OOCA 2PECA 1O8LA 1O8EA 1X0CA 2NSTA 1CZFA 3T9GA 1OFMA 3GQ8A 4U49A 1O8MA 4NK8A 4XN0A 1QJVA 4MR0A 3VSUA 4C2LA 1JTAA 1IDJA 4XLCA 4W8QA 3VMWA 5C1CA 1BN8A 1OGMX 2VBMA 4YZXA 3EQNA 4OJLA 2Z8GA 1IDKA 1QCXA 1K5CA 4XLHA 2UVEA 4PMHA 1PLUA 1HG8A 3EQOA 2O0VA 4W8TA 1IB4A 1O8FA 1O8IA 4OJOA 1KCCA 4XOTA 2VJIA 2INVA 1IA5A 2O0WA 3LMWA 4YZQA 1H80A 2QY1A 3B90A 3GQ9A 4Z06A 2O04A 2VJJA 3ZPPA 3VSVA 4I84A 1XG2A 1BHEA
chains in the Genus database with same CATH superfamily
3DU1X 4XKWA 4OJ6A 2X6YA 1QA3A 1TYXA 2XTWA 1O8KA 3LJYA 4OJ5A 4W8RA 4AVZA 2BX6A 2BSPA 1WMRA 2QX3A 3LYCA 2QYUA 3JURA 4OM9A 1QA1A 1OFLA 2V5IA 1O8DA 1DBGA 1O8JA 1QQ1A 3SYJA 3TH0A 2J8IA 2NT9A 2X85A 1OGOX 2NTPA 4U4BA 3UW0A 3VSUA 2X3HA 2UVFA 2W7ZA 2VFQA 2O1DA 5JLVC 1PE9A 2BM5A 1AIRA 3PSSA 1TSPA 1DBOA 4URRA 1TYVA 4YELA 3B4NA 2NT6A 2QXZA 4YEJA 4Z03A 4XN3A 4XLEA 2O17A 4XLFA 1KCDA 1EE6A 4EW9A 1RU4A 2NTQA 2NZMA 4XOPA 4W8SA 1L1IA 4XMYA 1VBLA 4YZ0A 3BH6B 4OPWA 4V02C 4Z05A 2ODLA 3VSTA 4OZZA 2IOUG 5AMVA 2VBEA 4HWVA 5C1EA 4XORA 4OZYA 3ZSCA 3B8YA 2PYGA 2XT4A 4XLAA 2XT2A 1QRBA 2EWEA 4XR6A 2VBKA 3SUCA 1KQ5A 1QRCA 1KTWA 4XNFA 3VMVA 2PYHA 4XONA 1RWRA 4OJPA 1LLZA 2X6WA 4XKVA 1EA0A 1PXZA 2NSPA 1NHCA 1EZGA 1O8GA 3GRHA 3PETA 4MXNA 2J8KA 3FY3A 2BM6A 4XL9A 5JMCB 3GQ7A 2IQ7A 2VFOA 1O88A 1O8HA 3N90A 4XM3A 2G0YA 1CLWA 2INUA 2XC1A 4YFOA 4YDTA 2X6XA 2O6WA 1GQ8A 2QZAA 4YZAA 3KRGA 1K4ZA 4NK6A 4XQFA 3GQAA 2NTBA 1JRGA 1RMGA 5DNSA 3WWGA 2YUHA 3AK5A 1OOCA 2B0RA 2PECA 1O8LA 2BM7A 1O8EA 1TYUA 2XTXA 1X0CA 2NSTA 1DABA 4YCQA 3N6ZA 1HF2A 1CZFA 3SZEA 3T9GA 1OFMA 3GQ8A 4U49A 4JRAC 2BM4A 1O8MA 4NK8A 4XN0A 1OFEA 1QJVA 2F3LA 4MR0A 3RIQA 3SY2A 1JTAA 1IDJA 4XLCA 2XTYA 1TYWA 4W8QA 3VMWA 3JX8A 4C2LA 5C1CA 1LLWA 1BN8A 1OGMX 2VBMA 1QA2A 4YZXA 3NB2A 3EQNA 4OJLA 2Z8GA 1IDKA 1QCXA 1K5CA 4YC5A 4XLHA 3H09A 2UVEA 4PMHA 1PLUA 1HG8A 2VFMA 3P4GA 3EQOA 2O0VA 3NAWA 4KH3A 3ML3A 4W8TA 4YEIA 1IB4A 1WXRA 1O8FA 1O8IA 4OJOA 1KCCA 1K8FA 4XOTA 2INVA 2VJIA 1IA5A 2O0WA 3LMWA 4YZQA 1H80A 1OFDA 2VFNA 2VFPA 3SQVA 2QY1A 3B90A 3GQ9A 4Z06A 3PSZA 2O04A 2VJJA 3ZPPA 3VSVA 3BH7B 4I84A 1XG2A 1BHEA 1LM1A
chains in the Genus database with same CATH topology
4XKWA 4OJ6A 2X6YA 4W8RA 1O8KA 4OJ5A 4AVZA 2BSPA 1WMRA 2QX3A 3JURA 1OFLA 1O8DA 1DBGA 1O8JA 2NT9A 2X85A 1OGOX 2NTPA 4U4BA 3UW0A 2X3HA 2UVFA 2O1DA 1PE9A 1AIRA 1DBOA 4URRA 4YELA 3B4NA 2NT6A 2QXZA 4YEJA 4Z03A 4XN3A 4XLEA 2O17A 4XLFA 1KCDA 1EE6A 4EW9A 1RU4A 2NTQA 2NZMA 4XOPA 4W8SA 4XMYA 1VBLA 4YZ0A 4Z05A 2ODLA 3VSTA 4OZZA 5AMVA 2VBEA 4HWVA 5C1EA 4XORA 4OZYA 3ZSCA 3B8YA 2PYGA 4XLAA 2EWEA 4XR6A 2VBKA 3SUCA 4XNFA 1KTWA 3VMVA 2PYHA 4XONA 1RWRA 4OJPA 2X6WA 4XKVA 1PXZA 2NSPA 1NHCA 1O8GA 3GRHA 4MXNA 3FY3A 4XL9A 3GQ7A 2IQ7A 1O88A 1O8HA 4XM3A 2INUA 2X6XA 1GQ8A 4YZAA 3KRGA 4NK6A 4XQFA 3GQAA 2NTBA 1JRGA 1RMGA 3WWGA 1OOCA 2PECA 1O8LA 1O8EA 1X0CA 2NSTA 1CZFA 3T9GA 1OFMA 3GQ8A 4U49A 1O8MA 4NK8A 4XN0A 1QJVA 4MR0A 3VSUA 4C2LA 1JTAA 1IDJA 4XLCA 4W8QA 3VMWA 5C1CA 1BN8A 1OGMX 2VBMA 4YZXA 3EQNA 4OJLA 2Z8GA 1IDKA 1QCXA 1K5CA 4XLHA 2UVEA 4PMHA 1PLUA 1HG8A 3EQOA 2O0VA 4W8TA 1IB4A 1O8FA 1O8IA 4OJOA 1KCCA 4XOTA 2VJIA 2INVA 1IA5A 2O0WA 3LMWA 4YZQA 1H80A 2QY1A 3B90A 3GQ9A 4Z06A 2O04A 2VJJA 3ZPPA 3VSVA 4I84A 1XG2A 1BHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XKW A;  4OJ6 A;  2X6Y A;  4W8R A;  1O8K A;  4OJ5 A;  4AVZ A;  2BSP A;  1WMR A;  2QX3 A;  3JUR A;  1OFL A;  1O8D A;  1DBG A;  1O8J A;  2NT9 A;  2X85 A;  1OGO X;  2NTP A;  4U4B A;  3UW0 A;  2X3H A;  2UVF A;  2O1D A;  1PE9 A;  1AIR A;  1DBO A;  4URR A;  4YEL A;  3B4N A;  2NT6 A;  2QXZ A;  4YEJ A;  4Z03 A;  4XN3 A;  4XLE A;  2O17 A;  4XLF A;  1KCD A;  1EE6 A;  4EW9 A;  1RU4 A;  2NTQ A;  2NZM A;  4XOP A;  4W8S A;  4XMY A;  1VBL A;  4YZ0 A;  4Z05 A;  2ODL A;  3VST A;  4OZZ A;  5AMV A;  2VBE A;  4HWV A;  5C1E A;  4XOR A;  4OZY A;  3ZSC A;  3B8Y A;  2PYG A;  4XLA A;  2EWE A;  4XR6 A;  2VBK A;  3SUC A;  4XNF A;  1KTW A;  3VMV A;  2PYH A;  4XON A;  1RWR A;  4OJP A;  2X6W A;  4XKV A;  1PXZ A;  2NSP A;  1NHC A;  1O8G A;  3GRH A;  4MXN A;  3FY3 A;  4XL9 A;  3GQ7 A;  2IQ7 A;  1O88 A;  1O8H A;  4XM3 A;  2INU A;  2X6X A;  1GQ8 A;  4YZA A;  3KRG A;  4NK6 A;  4XQF A;  3GQA A;  2NTB A;  1JRG A;  1RMG A;  3WWG A;  1OOC A;  2PEC A;  1O8L A;  1O8E A;  1X0C A;  2NST A;  1CZF A;  3T9G A;  1OFM A;  3GQ8 A;  4U49 A;  1O8M A;  4NK8 A;  4XN0 A;  1QJV A;  4MR0 A;  3VSU A;  4C2L A;  1JTA A;  1IDJ A;  4XLC A;  4W8Q A;  3VMW A;  5C1C A;  1BN8 A;  1OGM X;  2VBM A;  4YZX A;  3EQN A;  4OJL A;  2Z8G A;  1IDK A;  1QCX A;  1K5C A;  4XLH A;  2UVE A;  4PMH A;  1PLU A;  1HG8 A;  3EQO A;  2O0V A;  4W8T A;  1IB4 A;  1O8F A;  1O8I A;  4OJO A;  1KCC A;  4XOT A;  2VJI A;  2INV A;  1IA5 A;  2O0W A;  3LMW A;  4YZQ A;  1H80 A;  2QY1 A;  3B90 A;  3GQ9 A;  4Z06 A;  2O04 A;  2VJJ A;  3ZPP A;  3VSV A;  4I84 A;  1XG2 A;  1BHE A; 
#chains in the Genus database with same CATH topology
 3DU1 X;  4XKW A;  4OJ6 A;  2X6Y A;  1QA3 A;  1TYX A;  2XTW A;  1O8K A;  3LJY A;  4OJ5 A;  4W8R A;  4AVZ A;  2BX6 A;  2BSP A;  1WMR A;  2QX3 A;  3LYC A;  2QYU A;  3JUR A;  4OM9 A;  1QA1 A;  1OFL A;  2V5I A;  1O8D A;  1DBG A;  1O8J A;  1QQ1 A;  3SYJ A;  3TH0 A;  2J8I A;  2NT9 A;  2X85 A;  1OGO X;  2NTP A;  4U4B A;  3UW0 A;  3VSU A;  2X3H A;  2UVF A;  2W7Z A;  2VFQ A;  2O1D A;  5JLV C;  1PE9 A;  2BM5 A;  1AIR A;  3PSS A;  1TSP A;  1DBO A;  4URR A;  1TYV A;  4YEL A;  3B4N A;  2NT6 A;  2QXZ A;  4YEJ A;  4Z03 A;  4XN3 A;  4XLE A;  2O17 A;  4XLF A;  1KCD A;  1EE6 A;  4EW9 A;  1RU4 A;  2NTQ A;  2NZM A;  4XOP A;  4W8S A;  1L1I A;  4XMY A;  1VBL A;  4YZ0 A;  3BH6 B;  4OPW A;  4V02 C;  4Z05 A;  2ODL A;  3VST A;  4OZZ A;  2IOU G;  5AMV A;  2VBE A;  4HWV A;  5C1E A;  4XOR A;  4OZY A;  3ZSC A;  3B8Y A;  2PYG A;  2XT4 A;  4XLA A;  2XT2 A;  1QRB A;  2EWE A;  4XR6 A;  2VBK A;  3SUC A;  1KQ5 A;  1QRC A;  1KTW A;  4XNF A;  3VMV A;  2PYH A;  4XON A;  1RWR A;  4OJP A;  1LLZ A;  2X6W A;  4XKV A;  1EA0 A;  1PXZ A;  2NSP A;  1NHC A;  1EZG A;  1O8G A;  3GRH A;  3PET A;  4MXN A;  2J8K A;  3FY3 A;  2BM6 A;  4XL9 A;  5JMC B;  3GQ7 A;  2IQ7 A;  2VFO A;  1O88 A;  1O8H A;  3N90 A;  4XM3 A;  2G0Y A;  1CLW A;  2INU A;  2XC1 A;  4YFO A;  4YDT A;  2X6X A;  2O6W A;  1GQ8 A;  2QZA A;  4YZA A;  3KRG A;  1K4Z A;  4NK6 A;  4XQF A;  3GQA A;  2NTB A;  1JRG A;  1RMG A;  5DNS A;  3WWG A;  2YUH A;  3AK5 A;  1OOC A;  2B0R A;  2PEC A;  1O8L A;  2BM7 A;  1O8E A;  1TYU A;  2XTX A;  1X0C A;  2NST A;  1DAB A;  4YCQ A;  3N6Z A;  1HF2 A;  1CZF A;  3SZE A;  3T9G A;  1OFM A;  3GQ8 A;  4U49 A;  4JRA C;  2BM4 A;  1O8M A;  4NK8 A;  4XN0 A;  1OFE A;  1QJV A;  2F3L A;  4MR0 A;  3RIQ A;  3SY2 A;  1JTA A;  1IDJ A;  4XLC A;  2XTY A;  1TYW A;  4W8Q A;  3VMW A;  3JX8 A;  4C2L A;  5C1C A;  1LLW A;  1BN8 A;  1OGM X;  2VBM A;  1QA2 A;  4YZX A;  3NB2 A;  3EQN A;  4OJL A;  2Z8G A;  1IDK A;  1QCX A;  1K5C A;  4YC5 A;  4XLH A;  3H09 A;  2UVE A;  4PMH A;  1PLU A;  1HG8 A;  2VFM A;  3P4G A;  3EQO A;  2O0V A;  3NAW A;  4KH3 A;  3ML3 A;  4W8T A;  4YEI A;  1IB4 A;  1WXR A;  1O8F A;  1O8I A;  4OJO A;  1KCC A;  1K8F A;  4XOT A;  2INV A;  2VJI A;  1IA5 A;  2O0W A;  3LMW A;  4YZQ A;  1H80 A;  1OFD A;  2VFN A;  2VFP A;  3SQV A;  2QY1 A;  3B90 A;  3GQ9 A;  4Z06 A;  3PSZ A;  2O04 A;  2VJJ A;  3ZPP A;  3VSV A;  3BH7 B;  4I84 A;  1XG2 A;  1BHE A;  1LM1 A; 
#chains in the Genus database with same CATH homology
 4XKW A;  4OJ6 A;  2X6Y A;  4W8R A;  1O8K A;  4OJ5 A;  4AVZ A;  2BSP A;  1WMR A;  2QX3 A;  3JUR A;  1OFL A;  1O8D A;  1DBG A;  1O8J A;  2NT9 A;  2X85 A;  1OGO X;  2NTP A;  4U4B A;  3UW0 A;  2X3H A;  2UVF A;  2O1D A;  1PE9 A;  1AIR A;  1DBO A;  4URR A;  4YEL A;  3B4N A;  2NT6 A;  2QXZ A;  4YEJ A;  4Z03 A;  4XN3 A;  4XLE A;  2O17 A;  4XLF A;  1KCD A;  1EE6 A;  4EW9 A;  1RU4 A;  2NTQ A;  2NZM A;  4XOP A;  4W8S A;  4XMY A;  1VBL A;  4YZ0 A;  4Z05 A;  2ODL A;  3VST A;  4OZZ A;  5AMV A;  2VBE A;  4HWV A;  5C1E A;  4XOR A;  4OZY A;  3ZSC A;  3B8Y A;  2PYG A;  4XLA A;  2EWE A;  4XR6 A;  2VBK A;  3SUC A;  4XNF A;  1KTW A;  3VMV A;  2PYH A;  4XON A;  1RWR A;  4OJP A;  2X6W A;  4XKV A;  1PXZ A;  2NSP A;  1NHC A;  1O8G A;  3GRH A;  4MXN A;  3FY3 A;  4XL9 A;  3GQ7 A;  2IQ7 A;  1O88 A;  1O8H A;  4XM3 A;  2INU A;  2X6X A;  1GQ8 A;  4YZA A;  3KRG A;  4NK6 A;  4XQF A;  3GQA A;  2NTB A;  1JRG A;  1RMG A;  3WWG A;  1OOC A;  2PEC A;  1O8L A;  1O8E A;  1X0C A;  2NST A;  1CZF A;  3T9G A;  1OFM A;  3GQ8 A;  4U49 A;  1O8M A;  4NK8 A;  4XN0 A;  1QJV A;  4MR0 A;  3VSU A;  4C2L A;  1JTA A;  1IDJ A;  4XLC A;  4W8Q A;  3VMW A;  5C1C A;  1BN8 A;  1OGM X;  2VBM A;  4YZX A;  3EQN A;  4OJL A;  2Z8G A;  1IDK A;  1QCX A;  1K5C A;  4XLH A;  2UVE A;  4PMH A;  1PLU A;  1HG8 A;  3EQO A;  2O0V A;  4W8T A;  1IB4 A;  1O8F A;  1O8I A;  4OJO A;  1KCC A;  4XOT A;  2VJI A;  2INV A;  1IA5 A;  2O0W A;  3LMW A;  4YZQ A;  1H80 A;  2QY1 A;  3B90 A;  3GQ9 A;  4Z06 A;  2O04 A;  2VJJ A;  3ZPP A;  3VSV A;  4I84 A;  1XG2 A;  1BHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...