3N6ZA

Crystal structure of a putative immunoglobulin a1 protease (bacova_03286) from bacteroides ovatus at 1.30 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
353
structure length
339
Chain Sequence
DSYTRVPGDGAGGLFEKGNGTDSKPYMIMNATQIRNMRSVLKSGMKVYFQLGADIDMAGIDDWQSLNGSGDFPYEIDFDGDSHVIKNFKCSAGDYPSFFGVLCGDCRNVGFVNASVSSARQGIGIITGYLGLKDKGNGNKTGRIVNCYTTGEVIGSGAAGGIAGVLANSYDGQESYIKNCYSNATVSDRAASGGKAGGIAGRKVGVGGFIENCYAYGAVSATKGGVGGILGQIDKSCDIAIKNSAAWSNLTGVDASSTVGRIVGVSASLGSYENCYACESIVLKVNEKTITASDESSATGTTFHGVAKSAEELGNIIVAWNPNLWKKGTNGYPIFQWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords putative immunoglobulin A1 protease
publication title Crystal structure of a putative immunoglobulin A1 protease (BACOVA_03286) from Bacteroides ovatus at 1.30 A resolution
rcsb
source organism Bacteroides ovatus
total genus 132
structure length 339
sequence length 353
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.110 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3n6zA01
3N6ZA
chains in the Genus database with same CATH superfamily
1LLZA 2YUHA 1QCXA 2NT6A 1O8MA 2NTBA 3VMWA 4OZZA 2EWEA 3B8YA 3PETA 1TYWA 2BSPA 4YZXA 2XTWA 4XN3A 5AMVA 2QX3A 2J8KA 3SQVA 2QZAA 3WWGA 2O17A 2INVA 2VJJA 2PECA 3GQAA 2INUA 2J8IA 1HF2A 4Z06A 3BH7B 4YC5A 2B0RA 3BH6B 2VFQA 4XOTA 4EW9A 1AIRA 1OOCA 2VJIA 3UW0A 4Z05A 3TH0A 3ML3A 2X85A 2NSTA 4URRA 1OFMA 5JLVC 2VFNA 2BX6A 1O88A 3LMWA 1RWRA 4OM9A 4XLCA 4AVZA 1QA2A 3JURA 4YZ0A 1RMGA 2X3HA 1IDKA 3GQ7A 1QA3A 4KH3A 1EA0A 3GRHA 1OFLA 2X6XA 2XTXA 1EE6A 4XLAA 4YFOA 5JMCB 1KTWA 1X0CA 3GQ9A 1K4ZA 4OPWA 3GQ8A 1VBLA 4PMHA 2VBKA 1OFDA 1OFEA 2VFPA 3EQNA 3H09A 2VFMA 3NAWA 4NK8A 4OJOA 1O8JA 2G0YA 4OJ5A 4W8QA 4YZQA 3PSZA 4XOPA 2VFOA 3VSUA 1BN8A 1EZGA 4XKVA 2NTQA 3KRGA 4U4BA 4C2LA 3B4NA 3EQOA 4JRAC 2PYGA 1PLUA 4W8SA 2BM4A 3N90A 1DABA 2BM5A 1O8IA 1IA5A 1K8FA 1LLWA 2VBEA 1TYVA 1PXZA 2IQ7A 4XNFA 1GQ8A 3VMVA 1H80A 1QQ1A 5C1CA 1RU4A 4MR0A 3SUCA 2Z8GA 1TYXA 4YZAA 4XMYA 3VSTA 2O1DA 1O8DA 4YCQA 1BHEA 4XLHA 1O8EA 1TYUA 4W8RA 1QRBA 2UVEA 1IDJA 2ODLA 4OJLA 4XLEA 3SYJA 4I84A 1OGMX 4XKWA 2O04A 2V5IA 3FY3A 1DBGA 3NB2A 1WXRA 2VBMA 2XC1A 3P4GA 1QRCA 3RIQA 1IB4A 3T9GA 4XR6A 3N6ZA 3PSSA 2NT9A 1QA1A 2QXZA 1O8KA 1OGOX 2XT2A 1KCCA 1CZFA 2F3LA 4OJPA 4V02C 1CLWA 2X6WA 4OZYA 4OJ6A 1WMRA 2UVFA 1HG8A 1XG2A 4XL9A 4XORA 2NSPA 1O8LA 1O8GA 1TSPA 2X6YA 2NTPA 3JX8A 4XN0A 1O8HA 3LJYA 3LYCA 3SZEA 1LM1A 4MXNA 4YELA 2IOUG 3B90A 4YDTA 2BM6A 4Z03A 4YEJA 3ZPPA 1KCDA 2O0WA 4NK6A 5DNSA 4YEIA 4HWVA 3AK5A 4U49A 2BM7A 1NHCA 2XT4A 1JRGA 1QJVA 2O6WA 2QY1A 3DU1X 2XTYA 3ZSCA 1JTAA 2QYUA 1O8FA 2O0VA 4W8TA 4XM3A 3VSVA 5C1EA 4XQFA 1K5CA 2PYHA 1PE9A 4XLFA 2NZMA 1DBOA 3SY2A 1KQ5A 4XONA 2W7ZA 1L1IA
chains in the Genus database with same CATH topology
4V02C 1CLWA 1KQ5A 2YUHA 1QQ1A 4OJ6A 1QA3A 4KH3A 1TYXA 1TSPA 3JX8A 3PETA 5JMCB 1TYWA 3LJYA 3LYCA 3SZEA 1K4ZA 4OPWA 1TYUA 1QRBA 4OJLA 3SYJA 4OJOA 1QA2A 3H09A 2VFPA 2VFMA 2IOUG 2BM6A 2G0YA 2V5IA 4OJ5A 3AK5A 2VFOA 2J8IA 1HF2A 2BM7A 3BH7B 1WXRA 2B0RA 2XC1A 1QRCA 3BH6B 2VFQA 3P4GA 3RIQA 3N6ZA 4JRAC 2BM4A 3N90A 1DABA 1QA1A 2BM5A 3TH0A 3ML3A 5JLVC 1K8FA 2F3LA 2VFNA 2BX6A 4OM9A 4OJPA 1TYVA 2W7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N6Z A; 
#chains in the Genus database with same CATH topology
 1LLZ A;  2YUH A;  1QCX A;  2NT6 A;  1O8M A;  2NTB A;  3VMW A;  4OZZ A;  2EWE A;  3B8Y A;  3PET A;  1TYW A;  2BSP A;  4YZX A;  2XTW A;  4XN3 A;  5AMV A;  2QX3 A;  2J8K A;  3SQV A;  2QZA A;  3WWG A;  2O17 A;  2INV A;  2VJJ A;  2PEC A;  3GQA A;  2INU A;  2J8I A;  1HF2 A;  4Z06 A;  3BH7 B;  4YC5 A;  2B0R A;  3BH6 B;  2VFQ A;  4XOT A;  4EW9 A;  1AIR A;  1OOC A;  2VJI A;  3UW0 A;  4Z05 A;  3TH0 A;  3ML3 A;  2X85 A;  2NST A;  4URR A;  1OFM A;  5JLV C;  2VFN A;  2BX6 A;  1O88 A;  3LMW A;  1RWR A;  4OM9 A;  4XLC A;  4AVZ A;  1QA2 A;  3JUR A;  4YZ0 A;  1RMG A;  2X3H A;  1IDK A;  3GQ7 A;  1QA3 A;  4KH3 A;  1EA0 A;  3GRH A;  1OFL A;  2X6X A;  2XTX A;  1EE6 A;  4XLA A;  4YFO A;  5JMC B;  1KTW A;  1X0C A;  3GQ9 A;  1K4Z A;  4OPW A;  3GQ8 A;  1VBL A;  4PMH A;  2VBK A;  1OFD A;  1OFE A;  2VFP A;  3EQN A;  3H09 A;  2VFM A;  3NAW A;  4NK8 A;  4OJO A;  1O8J A;  2G0Y A;  4OJ5 A;  4W8Q A;  4YZQ A;  3PSZ A;  4XOP A;  2VFO A;  3VSU A;  1BN8 A;  1EZG A;  4XKV A;  2NTQ A;  3KRG A;  4U4B A;  4C2L A;  3B4N A;  3EQO A;  4JRA C;  2PYG A;  1PLU A;  4W8S A;  2BM4 A;  3N90 A;  1DAB A;  2BM5 A;  1O8I A;  1IA5 A;  1K8F A;  1LLW A;  2VBE A;  1TYV A;  1PXZ A;  2IQ7 A;  4XNF A;  1GQ8 A;  3VMV A;  1H80 A;  1QQ1 A;  5C1C A;  1RU4 A;  4MR0 A;  3SUC A;  2Z8G A;  1TYX A;  4YZA A;  4XMY A;  3VST A;  2O1D A;  1O8D A;  4YCQ A;  1BHE A;  4XLH A;  1O8E A;  1TYU A;  4W8R A;  1QRB A;  2UVE A;  1IDJ A;  2ODL A;  4OJL A;  4XLE A;  3SYJ A;  4I84 A;  1OGM X;  4XKW A;  2O04 A;  2V5I A;  3FY3 A;  1DBG A;  3NB2 A;  1WXR A;  2VBM A;  2XC1 A;  3P4G A;  1QRC A;  3RIQ A;  1IB4 A;  3T9G A;  4XR6 A;  3N6Z A;  3PSS A;  2NT9 A;  1QA1 A;  2QXZ A;  1O8K A;  1OGO X;  2XT2 A;  1KCC A;  1CZF A;  2F3L A;  4OJP A;  4V02 C;  1CLW A;  2X6W A;  4OZY A;  4OJ6 A;  1WMR A;  2UVF A;  1HG8 A;  1XG2 A;  4XL9 A;  4XOR A;  2NSP A;  1O8L A;  1O8G A;  1TSP A;  2X6Y A;  2NTP A;  3JX8 A;  4XN0 A;  1O8H A;  3LJY A;  3LYC A;  3SZE A;  1LM1 A;  4MXN A;  4YEL A;  2IOU G;  3B90 A;  4YDT A;  2BM6 A;  4Z03 A;  4YEJ A;  3ZPP A;  1KCD A;  2O0W A;  4NK6 A;  5DNS A;  4YEI A;  4HWV A;  3AK5 A;  4U49 A;  2BM7 A;  1NHC A;  2XT4 A;  1JRG A;  1QJV A;  2O6W A;  2QY1 A;  3DU1 X;  2XTY A;  3ZSC A;  1JTA A;  2QYU A;  1O8F A;  2O0V A;  4W8T A;  4XM3 A;  3VSV A;  5C1E A;  4XQF A;  1K5C A;  2PYH A;  1PE9 A;  4XLF A;  2NZM A;  1DBO A;  3SY2 A;  1KQ5 A;  4XON A;  2W7Z A;  1L1I A; 
#chains in the Genus database with same CATH homology
 4V02 C;  1CLW A;  1KQ5 A;  2YUH A;  1QQ1 A;  4OJ6 A;  1QA3 A;  4KH3 A;  1TYX A;  1TSP A;  3JX8 A;  3PET A;  5JMC B;  1TYW A;  3LJY A;  3LYC A;  3SZE A;  1K4Z A;  4OPW A;  1TYU A;  1QRB A;  4OJL A;  3SYJ A;  4OJO A;  1QA2 A;  3H09 A;  2VFP A;  2VFM A;  2IOU G;  2BM6 A;  2G0Y A;  2V5I A;  4OJ5 A;  3AK5 A;  2VFO A;  2J8I A;  1HF2 A;  2BM7 A;  3BH7 B;  1WXR A;  2B0R A;  2XC1 A;  1QRC A;  3BH6 B;  2VFQ A;  3P4G A;  3RIQ A;  3N6Z A;  4JRA C;  2BM4 A;  3N90 A;  1DAB A;  1QA1 A;  2BM5 A;  3TH0 A;  3ML3 A;  5JLV C;  1K8F A;  2F3L A;  2VFN A;  2BX6 A;  4OM9 A;  4OJP A;  1TYV A;  2W7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...