3N6ZA

Crystal structure of a putative immunoglobulin a1 protease (bacova_03286) from bacteroides ovatus at 1.30 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
353
structure length
339
Chain Sequence
DSYTRVPGDGAGGLFEKGNGTDSKPYMIMNATQIRNMRSVLKSGMKVYFQLGADIDMAGIDDWQSLNGSGDFPYEIDFDGDSHVIKNFKCSAGDYPSFFGVLCGDCRNVGFVNASVSSARQGIGIITGYLGLKDKGNGNKTGRIVNCYTTGEVIGSGAAGGIAGVLANSYDGQESYIKNCYSNATVSDRAASGGKAGGIAGRKVGVGGFIENCYAYGAVSATKGGVGGILGQIDKSCDIAIKNSAAWSNLTGVDASSTVGRIVGVSASLGSYENCYACESIVLKVNEKTITASDESSATGTTFHGVAKSAEELGNIIVAWNPNLWKKGTNGYPIFQWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative immunoglobulin A1 protease (BACOVA_03286) from Bacteroides ovatus at 1.30 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Hydrolase
molecule keywords putative immunoglobulin A1 protease
total genus 132
structure length 339
sequence length 353
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.110 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3n6zA01
3N6ZA
chains in the Genus database with same CATH superfamily
2PYHA 1NHCA 3FY3A 1X0CA 1OGOX 1OGMX 1RU4A 1K8FA 2F3LA 3DU1X 4YZ0A 4YZQA 3BH7B 1QA3A 2O0VA 2VJJA 5JMCB 5C1EA 4OM9A 1IA5A 1OFEA 2X3HA 1RWRA 2VFOA 2ODLA 3B8YA 3KRGA 4OJ5A 4XONA 4Z05A 1JRGA 3JURA 5C1CA 3B90A 2NTPA 2VBKA 2QY1A 1QCXA 2VJIA 4Z03A 1K5CA 1XG2A 1GQ8A 1O8EA 1CZFA 3RIQA 5JLVC 2VBEA 1HF2A 4XOTA 4XKVA 1VBLA 2O04A 2VFMA 3H09A 2NT6A 1IDJA 2UVFA 4MR0A 3JX8A 1O8DA 4XQFA 1O8GA 2B0RA 1QRBA 1PLUA 4V02C 2QX3A 3PETA 4YEIA 4YZXA 2YUHA 2X6YA 2X85A 1PXZA 1TYVA 4W8TA 2O6WA 4C2LA 1EA0A 1H80A 1LLZA 1O8HA 2IOUG 4W8SA 4U49A 2BM5A 3SQVA 4NK8A 2XTYA 4YC5A 5DNSA 1QA2A 3EQNA 4KH3A 2BM7A 1JTAA 2X6XA 2VFNA 2W7ZA 1PE9A 1TSPA 3P4GA 2INVA 4NK6A 1O8LA 3AK5A 1O8MA 1CLWA 4OZZA 4XLEA 3GQ9A 3VSTA 1OFMA 4XR6A 1TYUA 4W8RA 1LLWA 2NSPA 3LYCA 3NB2A 4Z06A 2XTWA 3VMVA 1OFDA 4XN0A 1RMGA 3VMWA 3LJYA 4HWVA 1KCDA 4XKWA 4XLHA 2V5IA 4U4BA 1LM1A 2NTQA 1EE6A 4JRAC 1QA1A 1WXRA 2Z8GA 1DBOA 3PSZA 2BM4A 1OOCA 1HG8A 2BM6A 2UVEA 3EQOA 4OJ6A 4XN3A 4XMYA 1TYWA 1BHEA 2VBMA 1O8FA 2NSTA 4YELA 4XLFA 2O1DA 4YFOA 3TH0A 3B4NA 1KTWA 1AIRA 3GQ7A 4PMHA 2BSPA 4XORA 3SY2A 1O8IA 2QXZA 4XL9A 2O17A 3T9GA 2BX6A 3SZEA 5AMVA 3PSSA 1OFLA 2NZMA 1QRCA 4I84A 4OJOA 3N6ZA 4OZYA 3SUCA 3ML3A 2QYUA 4W8QA 4XOPA 1O8KA 3GQ8A 3ZPPA 3SYJA 3GQAA 3WWGA 3ZSCA 1WMRA 1O88A 2QZAA 1DABA 2O0WA 4OPWA 2EWEA 1IB4A 4URRA 1EZGA 3LMWA 4XLCA 2NT9A 2PYGA 4YEJA 4XLAA 4YDTA 4OJLA 4EW9A 1L1IA 1QJVA 3VSUA 2XT2A 1O8JA 1KQ5A 4YCQA 3BH6B 1DBGA 1TYXA 2X6WA 3N90A 3UW0A 2J8KA 1IDKA 4OJPA 4AVZA 1KCCA 4XM3A 4XNFA 3NAWA 1K4ZA 2NTBA 1QQ1A 2XTXA 2G0YA 2PECA 2VFQA 3GRHA 2VFPA 2XT4A 4MXNA 3VSVA 2IQ7A 2INUA 2J8IA 2XC1A 4YZAA 1BN8A
chains in the Genus database with same CATH topology
2V5IA 2YUHA 4OPWA 1TYVA 1QA1A 4JRAC 1WXRA 2IOUG 2BM4A 2F3LA 1K8FA 2BM5A 2BM6A 3BH7B 4OJLA 4OJ6A 5JMCB 1QA3A 1QRBA 1TYWA 4OM9A 2VFOA 1QA2A 4OJ5A 4KH3A 2BM7A 1KQ5A 3BH6B 2VFNA 2W7ZA 3TH0A 1TYXA 1TSPA 3N90A 3P4GA 4OJPA 3AK5A 5JLVC 3RIQA 1CLWA 1HF2A 2BX6A 3SZEA 2VFMA 3H09A 1K4ZA 1TYUA 1QQ1A 2G0YA 1QRCA 2VFQA 4OJOA 2VFPA 3LYCA 3N6ZA 3ML3A 3JX8A 2J8IA 2XC1A 3LJYA 3SYJA 2B0RA 1DABA 4V02C 3PETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N6Z A; 
#chains in the Genus database with same CATH topology
 2PYH A;  1NHC A;  3FY3 A;  1X0C A;  1OGO X;  1OGM X;  1RU4 A;  1K8F A;  2F3L A;  3DU1 X;  4YZ0 A;  4YZQ A;  3BH7 B;  1QA3 A;  2O0V A;  2VJJ A;  5JMC B;  5C1E A;  4OM9 A;  1IA5 A;  1OFE A;  2X3H A;  1RWR A;  2VFO A;  2ODL A;  3B8Y A;  3KRG A;  4OJ5 A;  4XON A;  4Z05 A;  1JRG A;  3JUR A;  5C1C A;  3B90 A;  2NTP A;  2VBK A;  2QY1 A;  1QCX A;  2VJI A;  4Z03 A;  1K5C A;  1XG2 A;  1GQ8 A;  1O8E A;  1CZF A;  3RIQ A;  5JLV C;  2VBE A;  1HF2 A;  4XOT A;  4XKV A;  1VBL A;  2O04 A;  2VFM A;  3H09 A;  2NT6 A;  1IDJ A;  2UVF A;  4MR0 A;  3JX8 A;  1O8D A;  4XQF A;  1O8G A;  2B0R A;  1QRB A;  1PLU A;  4V02 C;  2QX3 A;  3PET A;  4YEI A;  4YZX A;  2YUH A;  2X6Y A;  2X85 A;  1PXZ A;  1TYV A;  4W8T A;  2O6W A;  4C2L A;  1EA0 A;  1H80 A;  1LLZ A;  1O8H A;  2IOU G;  4W8S A;  4U49 A;  2BM5 A;  3SQV A;  4NK8 A;  2XTY A;  4YC5 A;  5DNS A;  1QA2 A;  3EQN A;  4KH3 A;  2BM7 A;  1JTA A;  2X6X A;  2VFN A;  2W7Z A;  1PE9 A;  1TSP A;  3P4G A;  2INV A;  4NK6 A;  1O8L A;  3AK5 A;  1O8M A;  1CLW A;  4OZZ A;  4XLE A;  3GQ9 A;  3VST A;  1OFM A;  4XR6 A;  1TYU A;  4W8R A;  1LLW A;  2NSP A;  3LYC A;  3NB2 A;  4Z06 A;  2XTW A;  3VMV A;  1OFD A;  4XN0 A;  1RMG A;  3VMW A;  3LJY A;  4HWV A;  1KCD A;  4XKW A;  4XLH A;  2V5I A;  4U4B A;  1LM1 A;  2NTQ A;  1EE6 A;  4JRA C;  1QA1 A;  1WXR A;  2Z8G A;  1DBO A;  3PSZ A;  2BM4 A;  1OOC A;  1HG8 A;  2BM6 A;  2UVE A;  3EQO A;  4OJ6 A;  4XN3 A;  4XMY A;  1TYW A;  1BHE A;  2VBM A;  1O8F A;  2NST A;  4YEL A;  4XLF A;  2O1D A;  4YFO A;  3TH0 A;  3B4N A;  1KTW A;  1AIR A;  3GQ7 A;  4PMH A;  2BSP A;  4XOR A;  3SY2 A;  1O8I A;  2QXZ A;  4XL9 A;  2O17 A;  3T9G A;  2BX6 A;  3SZE A;  5AMV A;  3PSS A;  1OFL A;  2NZM A;  1QRC A;  4I84 A;  4OJO A;  3N6Z A;  4OZY A;  3SUC A;  3ML3 A;  2QYU A;  4W8Q A;  4XOP A;  1O8K A;  3GQ8 A;  3ZPP A;  3SYJ A;  3GQA A;  3WWG A;  3ZSC A;  1WMR A;  1O88 A;  2QZA A;  1DAB A;  2O0W A;  4OPW A;  2EWE A;  1IB4 A;  4URR A;  1EZG A;  3LMW A;  4XLC A;  2NT9 A;  2PYG A;  4YEJ A;  4XLA A;  4YDT A;  4OJL A;  4EW9 A;  1L1I A;  1QJV A;  3VSU A;  2XT2 A;  1O8J A;  1KQ5 A;  4YCQ A;  3BH6 B;  1DBG A;  1TYX A;  2X6W A;  3N90 A;  3UW0 A;  2J8K A;  1IDK A;  4OJP A;  4AVZ A;  1KCC A;  4XM3 A;  4XNF A;  3NAW A;  1K4Z A;  2NTB A;  1QQ1 A;  2XTX A;  2G0Y A;  2PEC A;  2VFQ A;  3GRH A;  2VFP A;  2XT4 A;  4MXN A;  3VSV A;  2IQ7 A;  2INU A;  2J8I A;  2XC1 A;  4YZA A;  1BN8 A; 
#chains in the Genus database with same CATH homology
 2V5I A;  2YUH A;  4OPW A;  1TYV A;  1QA1 A;  4JRA C;  1WXR A;  2IOU G;  2BM4 A;  2F3L A;  1K8F A;  2BM5 A;  2BM6 A;  3BH7 B;  4OJL A;  4OJ6 A;  5JMC B;  1QA3 A;  1QRB A;  1TYW A;  4OM9 A;  2VFO A;  1QA2 A;  4OJ5 A;  4KH3 A;  2BM7 A;  1KQ5 A;  3BH6 B;  2VFN A;  2W7Z A;  3TH0 A;  1TYX A;  1TSP A;  3N90 A;  3P4G A;  4OJP A;  3AK5 A;  5JLV C;  3RIQ A;  1CLW A;  1HF2 A;  2BX6 A;  3SZE A;  2VFM A;  3H09 A;  1K4Z A;  1TYU A;  1QQ1 A;  2G0Y A;  1QRC A;  2VFQ A;  4OJO A;  2VFP A;  3LYC A;  3N6Z A;  3ML3 A;  3JX8 A;  2J8I A;  2XC1 A;  3LJY A;  3SYJ A;  2B0R A;  1DAB A;  4V02 C;  3PET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...