3N6ZA

Crystal structure of a putative immunoglobulin a1 protease (bacova_03286) from bacteroides ovatus at 1.30 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
353
structure length
339
Chain Sequence
DSYTRVPGDGAGGLFEKGNGTDSKPYMIMNATQIRNMRSVLKSGMKVYFQLGADIDMAGIDDWQSLNGSGDFPYEIDFDGDSHVIKNFKCSAGDYPSFFGVLCGDCRNVGFVNASVSSARQGIGIITGYLGLKDKGNGNKTGRIVNCYTTGEVIGSGAAGGIAGVLANSYDGQESYIKNCYSNATVSDRAASGGKAGGIAGRKVGVGGFIENCYAYGAVSATKGGVGGILGQIDKSCDIAIKNSAAWSNLTGVDASSTVGRIVGVSASLGSYENCYACESIVLKVNEKTITASDESSATGTTFHGVAKSAEELGNIIVAWNPNLWKKGTNGYPIFQWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative immunoglobulin A1 protease (BACOVA_03286) from Bacteroides ovatus at 1.30 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Hydrolase
molecule keywords putative immunoglobulin A1 protease
total genus 132
structure length 339
sequence length 353
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.110 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3n6zA01
3N6ZA
chains in the Genus database with same CATH superfamily
2IQ7A 1EE6A 4XOTA 1LLWA 4HWVA 2X6YA 3SUCA 3SYJA 4OPWA 4YZ0A 1O8EA 2PYHA 4MXNA 1TYUA 4U4BA 2XTWA 1DBOA 4XOPA 2ODLA 1PLUA 4OJLA 3RIQA 2QZAA 1OFMA 1O8FA 3WWGA 3AK5A 3P4GA 4XLHA 1QA3A 1VBLA 2F3LA 3JURA 4OJOA 4XLEA 1K5CA 3B4NA 1IDJA 2VBMA 3JX8A 1OFEA 1QQ1A 4XN3A 2XT4A 1OFDA 2Z8GA 1IDKA 3VSVA 3PETA 4C2LA 1CLWA 1X0CA 3NAWA 4OJ6A 4YC5A 1O8KA 3VSTA 1DBGA 2BM6A 4W8QA 4XM3A 2UVEA 2INUA 2PYGA 1QA1A 1BHEA 1O8DA 2VFPA 3LJYA 4OJ5A 4YZAA 1CZFA 4U49A 4W8SA 1K8FA 1HG8A 2NTBA 1O8MA 4YZXA 1NHCA 4XQFA 1L1IA 2NZMA 2NTPA 1QCXA 1LLZA 1TYVA 3LYCA 4OZYA 3BH7B 2BX6A 3B8YA 4XONA 2IOUG 3VSUA 1O8IA 3GQAA 4PMHA 2W7ZA 1K4ZA 2G0YA 4YEIA 4MR0A 2NSTA 4KH3A 2VFOA 2VBKA 2B0RA 3EQOA 2BSPA 2QY1A 3N6ZA 4XN0A 2O1DA 2QXZA 3N90A 4YDTA 3GQ8A 1OGMX 1TYWA 3ZPPA 2BM4A 4XL9A 3VMVA 1PXZA 3PSSA 2VFQA 2O04A 5DNSA 1OGOX 2VBEA 2VJJA 1OFLA 2QYUA 4Z03A 2J8KA 2O0WA 1JTAA 1BN8A 3GQ9A 4YCQA 4XLFA 1IA5A 2X6WA 4W8TA 3SQVA 4XMYA 4W8RA 1EZGA 1KQ5A 4I84A 1JRGA 4AVZA 3BH6B 1O8GA 2O6WA 1XG2A 2X85A 1GQ8A 2X3HA 4XLAA 4YZQA 3SY2A 1IB4A 3SZEA 2J8IA 2NT9A 4Z06A 2XTYA 4OJPA 2NSPA 1KTWA 3PSZA 4XNFA 2PECA 1RWRA 2VFMA 2V5IA 4V02C 5AMVA 5C1EA 1RU4A 3ZSCA 1QRBA 1PE9A 4NK6A 2BM7A 1O8JA 4YELA 1O8HA 1TSPA 1OOCA 1RMGA 5JLVC 4Z05A 3VMWA 1QJVA 3ML3A 1H80A 2O17A 3B90A 4YEJA 2XC1A 3UW0A 3LMWA 3KRGA 4OZZA 2BM5A 1DABA 2XT2A 3EQNA 3TH0A 2NTQA 3H09A 1O88A 1AIRA 4XKWA 1TYXA 2VFNA 4OM9A 2EWEA 1QRCA 2XTXA 1KCCA 1QA2A 1WMRA 2INVA 2VJIA 3T9GA 1WXRA 4JRAC 1KCDA 4XKVA 3NB2A 4XORA 4XR6A 2NT6A 4XLCA 4URRA 2QX3A 2X6XA 2YUHA 4NK8A 5JMCB 5C1CA 3GRHA 3FY3A 2O0VA 1O8LA 4EW9A 1LM1A 1HF2A 2UVFA 3GQ7A 1EA0A 4YFOA 3DU1X
chains in the Genus database with same CATH topology
5JLVC 1QA1A 3ML3A 2VFPA 2XC1A 3LJYA 4OJ5A 2BM5A 3SYJA 4OPWA 1DABA 3TH0A 3RIQA 1TYUA 3H09A 5JMCB 1K8FA 4OJLA 1KQ5A 1TYXA 2VFNA 4OM9A 1TYVA 1QRCA 3BH6B 3LYCA 1QA2A 3P4GA 3BH7B 2BX6A 3AK5A 2IOUG 1QA3A 1WXRA 2F3LA 2J8IA 2W7ZA 4JRAC 4OJOA 1K4ZA 3SZEA 2G0YA 4OJPA 4KH3A 2VFOA 2VFMA 2B0RA 2YUHA 1QQ1A 3JX8A 3N6ZA 2V5IA 4V02C 3N90A 3PETA 1QRBA 1CLWA 4OJ6A 1TYWA 2BM7A 1HF2A 2BM4A 1TSPA 2BM6A 2VFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N6Z A; 
#chains in the Genus database with same CATH topology
 2IQ7 A;  1EE6 A;  4XOT A;  1LLW A;  4HWV A;  2X6Y A;  3SUC A;  3SYJ A;  4OPW A;  4YZ0 A;  1O8E A;  2PYH A;  4MXN A;  1TYU A;  4U4B A;  2XTW A;  1DBO A;  4XOP A;  2ODL A;  1PLU A;  4OJL A;  3RIQ A;  2QZA A;  1OFM A;  1O8F A;  3WWG A;  3AK5 A;  3P4G A;  4XLH A;  1QA3 A;  1VBL A;  2F3L A;  3JUR A;  4OJO A;  4XLE A;  1K5C A;  3B4N A;  1IDJ A;  2VBM A;  3JX8 A;  1OFE A;  1QQ1 A;  4XN3 A;  2XT4 A;  1OFD A;  2Z8G A;  1IDK A;  3VSV A;  3PET A;  4C2L A;  1CLW A;  1X0C A;  3NAW A;  4OJ6 A;  4YC5 A;  1O8K A;  3VST A;  1DBG A;  2BM6 A;  4W8Q A;  4XM3 A;  2UVE A;  2INU A;  2PYG A;  1QA1 A;  1BHE A;  1O8D A;  2VFP A;  3LJY A;  4OJ5 A;  4YZA A;  1CZF A;  4U49 A;  4W8S A;  1K8F A;  1HG8 A;  2NTB A;  1O8M A;  4YZX A;  1NHC A;  4XQF A;  1L1I A;  2NZM A;  2NTP A;  1QCX A;  1LLZ A;  1TYV A;  3LYC A;  4OZY A;  3BH7 B;  2BX6 A;  3B8Y A;  4XON A;  2IOU G;  3VSU A;  1O8I A;  3GQA A;  4PMH A;  2W7Z A;  1K4Z A;  2G0Y A;  4YEI A;  4MR0 A;  2NST A;  4KH3 A;  2VFO A;  2VBK A;  2B0R A;  3EQO A;  2BSP A;  2QY1 A;  3N6Z A;  4XN0 A;  2O1D A;  2QXZ A;  3N90 A;  4YDT A;  3GQ8 A;  1OGM X;  1TYW A;  3ZPP A;  2BM4 A;  4XL9 A;  3VMV A;  1PXZ A;  3PSS A;  2VFQ A;  2O04 A;  5DNS A;  1OGO X;  2VBE A;  2VJJ A;  1OFL A;  2QYU A;  4Z03 A;  2J8K A;  2O0W A;  1JTA A;  1BN8 A;  3GQ9 A;  4YCQ A;  4XLF A;  1IA5 A;  2X6W A;  4W8T A;  3SQV A;  4XMY A;  4W8R A;  1EZG A;  1KQ5 A;  4I84 A;  1JRG A;  4AVZ A;  3BH6 B;  1O8G A;  2O6W A;  1XG2 A;  2X85 A;  1GQ8 A;  2X3H A;  4XLA A;  4YZQ A;  3SY2 A;  1IB4 A;  3SZE A;  2J8I A;  2NT9 A;  4Z06 A;  2XTY A;  4OJP A;  2NSP A;  1KTW A;  3PSZ A;  4XNF A;  2PEC A;  1RWR A;  2VFM A;  2V5I A;  4V02 C;  5AMV A;  5C1E A;  1RU4 A;  3ZSC A;  1QRB A;  1PE9 A;  4NK6 A;  2BM7 A;  1O8J A;  4YEL A;  1O8H A;  1TSP A;  1OOC A;  1RMG A;  5JLV C;  4Z05 A;  3VMW A;  1QJV A;  3ML3 A;  1H80 A;  2O17 A;  3B90 A;  4YEJ A;  2XC1 A;  3UW0 A;  3LMW A;  3KRG A;  4OZZ A;  2BM5 A;  1DAB A;  2XT2 A;  3EQN A;  3TH0 A;  2NTQ A;  3H09 A;  1O88 A;  1AIR A;  4XKW A;  1TYX A;  2VFN A;  4OM9 A;  2EWE A;  1QRC A;  2XTX A;  1KCC A;  1QA2 A;  1WMR A;  2INV A;  2VJI A;  3T9G A;  1WXR A;  4JRA C;  1KCD A;  4XKV A;  3NB2 A;  4XOR A;  4XR6 A;  2NT6 A;  4XLC A;  4URR A;  2QX3 A;  2X6X A;  2YUH A;  4NK8 A;  5JMC B;  5C1C A;  3GRH A;  3FY3 A;  2O0V A;  1O8L A;  4EW9 A;  1LM1 A;  1HF2 A;  2UVF A;  3GQ7 A;  1EA0 A;  4YFO A;  3DU1 X; 
#chains in the Genus database with same CATH homology
 5JLV C;  1QA1 A;  3ML3 A;  2VFP A;  2XC1 A;  3LJY A;  4OJ5 A;  2BM5 A;  3SYJ A;  4OPW A;  1DAB A;  3TH0 A;  3RIQ A;  1TYU A;  3H09 A;  5JMC B;  1K8F A;  4OJL A;  1KQ5 A;  1TYX A;  2VFN A;  4OM9 A;  1TYV A;  1QRC A;  3BH6 B;  3LYC A;  1QA2 A;  3P4G A;  3BH7 B;  2BX6 A;  3AK5 A;  2IOU G;  1QA3 A;  1WXR A;  2F3L A;  2J8I A;  2W7Z A;  4JRA C;  4OJO A;  1K4Z A;  3SZE A;  2G0Y A;  4OJP A;  4KH3 A;  2VFO A;  2VFM A;  2B0R A;  2YUH A;  1QQ1 A;  3JX8 A;  3N6Z A;  2V5I A;  4V02 C;  3N90 A;  3PET A;  1QRB A;  1CLW A;  4OJ6 A;  1TYW A;  2BM7 A;  1HF2 A;  2BM4 A;  1TSP A;  2BM6 A;  2VFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...