3N6ZA

Crystal structure of a putative immunoglobulin a1 protease (bacova_03286) from bacteroides ovatus at 1.30 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
353
structure length
339
Chain Sequence
DSYTRVPGDGAGGLFEKGNGTDSKPYMIMNATQIRNMRSVLKSGMKVYFQLGADIDMAGIDDWQSLNGSGDFPYEIDFDGDSHVIKNFKCSAGDYPSFFGVLCGDCRNVGFVNASVSSARQGIGIITGYLGLKDKGNGNKTGRIVNCYTTGEVIGSGAAGGIAGVLANSYDGQESYIKNCYSNATVSDRAASGGKAGGIAGRKVGVGGFIENCYAYGAVSATKGGVGGILGQIDKSCDIAIKNSAAWSNLTGVDASSTVGRIVGVSASLGSYENCYACESIVLKVNEKTITASDESSATGTTFHGVAKSAEELGNIIVAWNPNLWKKGTNGYPIFQWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative immunoglobulin A1 protease (BACOVA_03286) from Bacteroides ovatus at 1.30 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Hydrolase
molecule keywords putative immunoglobulin A1 protease
total genus 132
structure length 339
sequence length 353
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.110 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3n6zA01
3N6ZA
chains in the Genus database with same CATH superfamily
1O8IA 1IA5A 2NZMA 4OZYA 1O8EA 2VFOA 4XONA 2UVFA 2X6XA 3PSZA 2Z8GA 1CZFA 3DU1X 4C2LA 5JMCB 1KCDA 1GQ8A 1KQ5A 1EA0A 3GQ8A 2VFMA 1IB4A 2VBMA 4XNFA 2VFNA 4I84A 4XLHA 4XOTA 3SUCA 1QA1A 1NHCA 4U49A 2BM6A 1JRGA 3BH7B 4YELA 3GQ7A 3RIQA 1DBOA 2NSPA 4OJ5A 4YDTA 1O88A 2O0VA 3BH6B 4YFOA 2VBEA 2BM7A 2NTBA 2O17A 2ODLA 3N6ZA 3ML3A 3SZEA 1HF2A 1LLZA 3PETA 1DBGA 3NB2A 3LYCA 4XN3A 3VSUA 2XTWA 1QRBA 2J8KA 1L1IA 3B90A 1CLWA 4OM9A 3SQVA 4XLCA 3UW0A 1AIRA 1LM1A 2X85A 1O8FA 4HWVA 4XQFA 4YEJA 3TH0A 1H80A 2INUA 3ZSCA 4URRA 3B4NA 1WMRA 1PXZA 4XORA 3VSVA 1HG8A 4XM3A 4OJPA 1OGOX 1K5CA 3GQ9A 4XL9A 4XR6A 2QXZA 3ZPPA 1DABA 4W8RA 2BM5A 2INVA 1RU4A 4XKVA 2NT9A 3H09A 2IOUG 4OJOA 2B0RA 1K8FA 4YZXA 3B8YA 1K4ZA 1TYXA 1VBLA 2O1DA 3GRHA 1O8JA 2VJIA 4EW9A 2O04A 3VSTA 4OJLA 1O8GA 3KRGA 3N90A 1QA2A 2NTQA 4NK6A 4XMYA 1TYWA 1OFDA 2YUHA 3SYJA 1IDJA 1TYUA 2BX6A 3WWGA 1PE9A 4YZAA 4PMHA 4XOPA 1QA3A 2NSTA 1O8LA 4XLFA 2VJJA 2VFPA 2BSPA 3JX8A 2XT2A 1EZGA 1IDKA 1QRCA 1RMGA 2XC1A 3NAWA 4OPWA 4XLEA 4Z03A 1JTAA 4XN0A 4YC5A 2XT4A 5JLVC 2VBKA 4KH3A 2BM4A 1TYVA 4XKWA 4W8SA 1KTWA 4V02C 4Z05A 4AVZA 4W8QA 1QQ1A 2X3HA 5DNSA 1O8KA 1OOCA 2QZAA 3EQNA 3LJYA 1OGMX 2XTXA 4MR0A 2XTYA 1O8DA 3T9GA 2V5IA 2PECA 3AK5A 2NT6A 4MXNA 5C1EA 3VMVA 4YZQA 4YZ0A 2IQ7A 1LLWA 2PYHA 4NK8A 4Z06A 4JRAC 3P4GA 1WXRA 4YCQA 1EE6A 1OFLA 4XLAA 1X0CA 3VMWA 1QCXA 2UVEA 4OJ6A 2X6WA 1TSPA 1O8HA 2O0WA 4U4BA 2W7ZA 1OFMA 1BHEA 4W8TA 2O6WA 3JURA 3FY3A 1OFEA 2NTPA 1QJVA 3GQAA 4YEIA 5C1CA 3EQOA 3LMWA 1PLUA 2EWEA 2QX3A 2QYUA 5AMVA 2QY1A 2F3LA 3PSSA 1XG2A 2VFQA 2G0YA 2PYGA 1O8MA 4OZZA 1KCCA 1RWRA 2X6YA 2J8IA 3SY2A 1BN8A
chains in the Genus database with same CATH topology
2J8IA 1CLWA 4JRAC 3P4GA 2VFOA 4OM9A 1QA3A 1WXRA 3TH0A 5JMCB 2VFPA 3JX8A 4OJ6A 1KQ5A 1TSPA 4OPWA 1QRCA 2VFMA 2XC1A 4OJPA 2W7ZA 2VFNA 1QA1A 5JLVC 4KH3A 2BM4A 1TYVA 2BM6A 2BM5A 3BH7B 4V02C 3RIQA 1DABA 1QQ1A 3H09A 4OJ5A 2IOUG 4OJOA 2B0RA 1K8FA 1K4ZA 1TYXA 3BH6B 2BM7A 3N6ZA 3ML3A 3SZEA 1HF2A 3LJYA 3PETA 4OJLA 3N90A 2F3LA 3LYCA 1QA2A 2VFQA 1QRBA 2G0YA 2V5IA 3AK5A 1TYWA 2YUHA 3SYJA 1TYUA 2BX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N6Z A; 
#chains in the Genus database with same CATH topology
 1O8I A;  1IA5 A;  2NZM A;  4OZY A;  1O8E A;  2VFO A;  4XON A;  2UVF A;  2X6X A;  3PSZ A;  2Z8G A;  1CZF A;  3DU1 X;  4C2L A;  5JMC B;  1KCD A;  1GQ8 A;  1KQ5 A;  1EA0 A;  3GQ8 A;  2VFM A;  1IB4 A;  2VBM A;  4XNF A;  2VFN A;  4I84 A;  4XLH A;  4XOT A;  3SUC A;  1QA1 A;  1NHC A;  4U49 A;  2BM6 A;  1JRG A;  3BH7 B;  4YEL A;  3GQ7 A;  3RIQ A;  1DBO A;  2NSP A;  4OJ5 A;  4YDT A;  1O88 A;  2O0V A;  3BH6 B;  4YFO A;  2VBE A;  2BM7 A;  2NTB A;  2O17 A;  2ODL A;  3N6Z A;  3ML3 A;  3SZE A;  1HF2 A;  1LLZ A;  3PET A;  1DBG A;  3NB2 A;  3LYC A;  4XN3 A;  3VSU A;  2XTW A;  1QRB A;  2J8K A;  1L1I A;  3B90 A;  1CLW A;  4OM9 A;  3SQV A;  4XLC A;  3UW0 A;  1AIR A;  1LM1 A;  2X85 A;  1O8F A;  4HWV A;  4XQF A;  4YEJ A;  3TH0 A;  1H80 A;  2INU A;  3ZSC A;  4URR A;  3B4N A;  1WMR A;  1PXZ A;  4XOR A;  3VSV A;  1HG8 A;  4XM3 A;  4OJP A;  1OGO X;  1K5C A;  3GQ9 A;  4XL9 A;  4XR6 A;  2QXZ A;  3ZPP A;  1DAB A;  4W8R A;  2BM5 A;  2INV A;  1RU4 A;  4XKV A;  2NT9 A;  3H09 A;  2IOU G;  4OJO A;  2B0R A;  1K8F A;  4YZX A;  3B8Y A;  1K4Z A;  1TYX A;  1VBL A;  2O1D A;  3GRH A;  1O8J A;  2VJI A;  4EW9 A;  2O04 A;  3VST A;  4OJL A;  1O8G A;  3KRG A;  3N90 A;  1QA2 A;  2NTQ A;  4NK6 A;  4XMY A;  1TYW A;  1OFD A;  2YUH A;  3SYJ A;  1IDJ A;  1TYU A;  2BX6 A;  3WWG A;  1PE9 A;  4YZA A;  4PMH A;  4XOP A;  1QA3 A;  2NST A;  1O8L A;  4XLF A;  2VJJ A;  2VFP A;  2BSP A;  3JX8 A;  2XT2 A;  1EZG A;  1IDK A;  1QRC A;  1RMG A;  2XC1 A;  3NAW A;  4OPW A;  4XLE A;  4Z03 A;  1JTA A;  4XN0 A;  4YC5 A;  2XT4 A;  5JLV C;  2VBK A;  4KH3 A;  2BM4 A;  1TYV A;  4XKW A;  4W8S A;  1KTW A;  4V02 C;  4Z05 A;  4AVZ A;  4W8Q A;  1QQ1 A;  2X3H A;  5DNS A;  1O8K A;  1OOC A;  2QZA A;  3EQN A;  3LJY A;  1OGM X;  2XTX A;  4MR0 A;  2XTY A;  1O8D A;  3T9G A;  2V5I A;  2PEC A;  3AK5 A;  2NT6 A;  4MXN A;  5C1E A;  3VMV A;  4YZQ A;  4YZ0 A;  2IQ7 A;  1LLW A;  2PYH A;  4NK8 A;  4Z06 A;  4JRA C;  3P4G A;  1WXR A;  4YCQ A;  1EE6 A;  1OFL A;  4XLA A;  1X0C A;  3VMW A;  1QCX A;  2UVE A;  4OJ6 A;  2X6W A;  1TSP A;  1O8H A;  2O0W A;  4U4B A;  2W7Z A;  1OFM A;  1BHE A;  4W8T A;  2O6W A;  3JUR A;  3FY3 A;  1OFE A;  2NTP A;  1QJV A;  3GQA A;  4YEI A;  5C1C A;  3EQO A;  3LMW A;  1PLU A;  2EWE A;  2QX3 A;  2QYU A;  5AMV A;  2QY1 A;  2F3L A;  3PSS A;  1XG2 A;  2VFQ A;  2G0Y A;  2PYG A;  1O8M A;  4OZZ A;  1KCC A;  1RWR A;  2X6Y A;  2J8I A;  3SY2 A;  1BN8 A; 
#chains in the Genus database with same CATH homology
 2J8I A;  1CLW A;  4JRA C;  3P4G A;  2VFO A;  4OM9 A;  1QA3 A;  1WXR A;  3TH0 A;  5JMC B;  2VFP A;  3JX8 A;  4OJ6 A;  1KQ5 A;  1TSP A;  4OPW A;  1QRC A;  2VFM A;  2XC1 A;  4OJP A;  2W7Z A;  2VFN A;  1QA1 A;  5JLV C;  4KH3 A;  2BM4 A;  1TYV A;  2BM6 A;  2BM5 A;  3BH7 B;  4V02 C;  3RIQ A;  1DAB A;  1QQ1 A;  3H09 A;  4OJ5 A;  2IOU G;  4OJO A;  2B0R A;  1K8F A;  1K4Z A;  1TYX A;  3BH6 B;  2BM7 A;  3N6Z A;  3ML3 A;  3SZE A;  1HF2 A;  3LJY A;  3PET A;  4OJL A;  3N90 A;  2F3L A;  3LYC A;  1QA2 A;  2VFQ A;  1QRB A;  2G0Y A;  2V5I A;  3AK5 A;  1TYW A;  2YUH A;  3SYJ A;  1TYU A;  2BX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...