3N6ZA

Crystal structure of a putative immunoglobulin a1 protease (bacova_03286) from bacteroides ovatus at 1.30 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
353
structure length
339
Chain Sequence
b'DSYTRVPGDGAGGLFEKGNGTDSKPYMIMNATQIRNMRSVLKSGMKVYFQLGADIDMAGIDDWQSLNGSGDFPYEIDFDGDSHVIKNFKCSAGDYPSFFGVLCGDCRNVGFVNASVSSARQGIGIITGYLGLKDKGNGNKTGRIVNCYTTGEVIGSGAAGGIAGVLANSYDGQESYIKNCYSNATVSDRAASGGKAGGIAGRKVGVGGFIENCYAYGAVSATKGGVGGILGQIDKSCDIAIKNSAAWSNLTGVDASSTVGRIVGVSASLGSYENCYACESIVLKVNEKTITASDESSATGTTFHGVAKSAEELGNIIVAWNPNLWKKGTNGYPIFQWSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative immunoglobulin A1 protease
publication title Crystal structure of a putative immunoglobulin A1 protease (BACOVA_03286) from Bacteroides ovatus at 1.30 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Hydrolase
total genus 132
structure length 339
sequence length 353
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.110 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3n6zA01
3N6ZA
chains in the Genus database with same CATH superfamily
1EZGA 4XONA 2BSPA 2VFPA 3UW0A 3VSVA 2VBEA 3JURA 2UVFA 2ODLA 1O8JA 4Z06A 1O8HA 2VFNA 1BN8A 3GQ8A 1WMRA 4MR0A 1O8MA 4XKVA 2O04A 1OFMA 2O6WA 3SUCA 2QXZA 2NSTA 3SZEA 3KRGA 1K5CA 1OOCA 2QYUA 4XMYA 2G0YA 4YC5A 1PXZA 4XORA 1PE9A 2YUHA 3PSZA 3TH0A 1OFDA 4YZ0A 1QA2A 3VSUA 3SQVA 2IOUG 2XTXA 4Z05A 1X0CA 2PYGA 2J8IA 2V5IA 1DABA 1AIRA 2O0VA 2NTBA 2VFQA 2XT4A 4I84A 1LLZA 4PMHA 4XKWA 3T9GA 1TYUA 1HG8A 2X85A 1VBLA 3GQAA 4HWVA 1TSPA 2O0WA 2BM7A 1OGOX 3DU1X 2B0RA 2XC1A 3EQOA 2NSPA 4YCQA 1JTAA 1PLUA 2O17A 3GQ9A 2F3LA 2X6XA 2QX3A 3AK5A 4U49A 4URRA 3VMVA 4XQFA 2J8KA 1KCDA 4V02C 2QY1A 3B90A 4XLEA 4OJLA 3WWGA 4YFOA 1IB4A 2VBMA 4OZYA 3PETA 4OPWA 4YELA 2W7ZA 4XR6A 1XG2A 4NK6A 4XLCA 4W8QA 3VMWA 3B4NA 3N6ZA 2BM4A 3BH7B 4XLFA 1IDKA 3ZPPA 1DBGA 1BHEA 1GQ8A 1OFLA 3B8YA 4YZAA 4YEJA 1TYWA 4W8RA 1HF2A 5C1EA 1KCCA 3ML3A 1KTWA 1TYVA 2XT2A 2PYHA 2EWEA 1O8FA 3P4GA 4KH3A 4NK8A 3RIQA 4AVZA 1IA5A 1QA3A 1QJVA 1K8FA 1O8EA 1CLWA 1O8LA 4XN3A 1TYXA 1OFEA 2NT6A 2O1DA 2INVA 1LLWA 4EW9A 2INUA 4XNFA 2QZAA 5JLVC 1O8IA 1IDJA 1O8GA 3JX8A 5DNSA 2VJIA 4JRAC 4XL9A 1KQ5A 2PECA 1QRCA 2NTQA 1EA0A 3GQ7A 1NHCA 2X6YA 4YZXA 3FY3A 3ZSCA 1DBOA 4XOPA 4MXNA 2NTPA 3VSTA 3LYCA 5AMVA 2NZMA 4OJPA 3N90A 2VBKA 3LMWA 4OZZA 2XTYA 5C1CA 2IQ7A 1O88A 1CZFA 1RMGA 3PSSA 4Z03A 4OM9A 1QQ1A 5JMCB 1O8KA 4OJ6A 1RU4A 1EE6A 1QRBA 2XTWA 1RWRA 2UVEA 4YZQA 4XN0A 1JRGA 3LJYA 2VFOA 2BM6A 3NAWA 2VFMA 2BX6A 1QCXA 1WXRA 3NB2A 4W8TA 1LM1A 2Z8GA 3EQNA 4OJ5A 4XOTA 1OGMX 1QA1A 1L1IA 3SY2A 4C2LA 2X6WA 3SYJA 3BH6B 1O8DA 4XLAA 1H80A 4YDTA 2NT9A 2X3HA 4XM3A 4W8SA 4U4BA 1K4ZA 2BM5A 3GRHA 3H09A 4OJOA 2VJJA 4XLHA 4YEIA
chains in the Genus database with same CATH topology
2VFPA 1TYVA 3P4GA 4KH3A 1TYUA 3RIQA 4OM9A 1QQ1A 1TSPA 1QA3A 2BM7A 2VFNA 1K8FA 5JMCB 1CLWA 2B0RA 2XC1A 4OJ6A 1QRBA 1TYXA 2F3LA 3AK5A 3LJYA 3SZEA 2VFOA 4V02C 2BM6A 4OJLA 2G0YA 5JLVC 2VFMA 3JX8A 2BX6A 4JRAC 3PETA 4OPWA 1WXRA 1KQ5A 2W7ZA 1QRCA 2YUHA 4OJ5A 3TH0A 1QA1A 3N6ZA 2BM4A 3BH7B 3SYJA 1QA2A 3BH6B 2IOUG 3LYCA 1K4ZA 1TYWA 4OJPA 2BM5A 2V5IA 2J8IA 3H09A 1HF2A 3N90A 4OJOA 2VFQA 3ML3A 1DABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N6Z A; 
#chains in the Genus database with same CATH topology
 1EZG A;  4XON A;  2BSP A;  2VFP A;  3UW0 A;  3VSV A;  2VBE A;  3JUR A;  2UVF A;  2ODL A;  1O8J A;  4Z06 A;  1O8H A;  2VFN A;  1BN8 A;  3GQ8 A;  1WMR A;  4MR0 A;  1O8M A;  4XKV A;  2O04 A;  1OFM A;  2O6W A;  3SUC A;  2QXZ A;  2NST A;  3SZE A;  3KRG A;  1K5C A;  1OOC A;  2QYU A;  4XMY A;  2G0Y A;  4YC5 A;  1PXZ A;  4XOR A;  1PE9 A;  2YUH A;  3PSZ A;  3TH0 A;  1OFD A;  4YZ0 A;  1QA2 A;  3VSU A;  3SQV A;  2IOU G;  2XTX A;  4Z05 A;  1X0C A;  2PYG A;  2J8I A;  2V5I A;  1DAB A;  1AIR A;  2O0V A;  2NTB A;  2VFQ A;  2XT4 A;  4I84 A;  1LLZ A;  4PMH A;  4XKW A;  3T9G A;  1TYU A;  1HG8 A;  2X85 A;  1VBL A;  3GQA A;  4HWV A;  1TSP A;  2O0W A;  2BM7 A;  1OGO X;  3DU1 X;  2B0R A;  2XC1 A;  3EQO A;  2NSP A;  4YCQ A;  1JTA A;  1PLU A;  2O17 A;  3GQ9 A;  2F3L A;  2X6X A;  2QX3 A;  3AK5 A;  4U49 A;  4URR A;  3VMV A;  4XQF A;  2J8K A;  1KCD A;  4V02 C;  2QY1 A;  3B90 A;  4XLE A;  4OJL A;  3WWG A;  4YFO A;  1IB4 A;  2VBM A;  4OZY A;  3PET A;  4OPW A;  4YEL A;  2W7Z A;  4XR6 A;  1XG2 A;  4NK6 A;  4XLC A;  4W8Q A;  3VMW A;  3B4N A;  3N6Z A;  2BM4 A;  3BH7 B;  4XLF A;  1IDK A;  3ZPP A;  1DBG A;  1BHE A;  1GQ8 A;  1OFL A;  3B8Y A;  4YZA A;  4YEJ A;  1TYW A;  4W8R A;  1HF2 A;  5C1E A;  1KCC A;  3ML3 A;  1KTW A;  1TYV A;  2XT2 A;  2PYH A;  2EWE A;  1O8F A;  3P4G A;  4KH3 A;  4NK8 A;  3RIQ A;  4AVZ A;  1IA5 A;  1QA3 A;  1QJV A;  1K8F A;  1O8E A;  1CLW A;  1O8L A;  4XN3 A;  1TYX A;  1OFE A;  2NT6 A;  2O1D A;  2INV A;  1LLW A;  4EW9 A;  2INU A;  4XNF A;  2QZA A;  5JLV C;  1O8I A;  1IDJ A;  1O8G A;  3JX8 A;  5DNS A;  2VJI A;  4JRA C;  4XL9 A;  1KQ5 A;  2PEC A;  1QRC A;  2NTQ A;  1EA0 A;  3GQ7 A;  1NHC A;  2X6Y A;  4YZX A;  3FY3 A;  3ZSC A;  1DBO A;  4XOP A;  4MXN A;  2NTP A;  3VST A;  3LYC A;  5AMV A;  2NZM A;  4OJP A;  3N90 A;  2VBK A;  3LMW A;  4OZZ A;  2XTY A;  5C1C A;  2IQ7 A;  1O88 A;  1CZF A;  1RMG A;  3PSS A;  4Z03 A;  4OM9 A;  1QQ1 A;  5JMC B;  1O8K A;  4OJ6 A;  1RU4 A;  1EE6 A;  1QRB A;  2XTW A;  1RWR A;  2UVE A;  4YZQ A;  4XN0 A;  1JRG A;  3LJY A;  2VFO A;  2BM6 A;  3NAW A;  2VFM A;  2BX6 A;  1QCX A;  1WXR A;  3NB2 A;  4W8T A;  1LM1 A;  2Z8G A;  3EQN A;  4OJ5 A;  4XOT A;  1OGM X;  1QA1 A;  1L1I A;  3SY2 A;  4C2L A;  2X6W A;  3SYJ A;  3BH6 B;  1O8D A;  4XLA A;  1H80 A;  4YDT A;  2NT9 A;  2X3H A;  4XM3 A;  4W8S A;  4U4B A;  1K4Z A;  2BM5 A;  3GRH A;  3H09 A;  4OJO A;  2VJJ A;  4XLH A;  4YEI A; 
#chains in the Genus database with same CATH homology
 2VFP A;  1TYV A;  3P4G A;  4KH3 A;  1TYU A;  3RIQ A;  4OM9 A;  1QQ1 A;  1TSP A;  1QA3 A;  2BM7 A;  2VFN A;  1K8F A;  5JMC B;  1CLW A;  2B0R A;  2XC1 A;  4OJ6 A;  1QRB A;  1TYX A;  2F3L A;  3AK5 A;  3LJY A;  3SZE A;  2VFO A;  4V02 C;  2BM6 A;  4OJL A;  2G0Y A;  5JLV C;  2VFM A;  3JX8 A;  2BX6 A;  4JRA C;  3PET A;  4OPW A;  1WXR A;  1KQ5 A;  2W7Z A;  1QRC A;  2YUH A;  4OJ5 A;  3TH0 A;  1QA1 A;  3N6Z A;  2BM4 A;  3BH7 B;  3SYJ A;  1QA2 A;  3BH6 B;  2IOU G;  3LYC A;  1K4Z A;  1TYW A;  4OJP A;  2BM5 A;  2V5I A;  2J8I A;  3H09 A;  1HF2 A;  3N90 A;  4OJO A;  2VFQ A;  3ML3 A;  1DAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...