2INVA

Crystal structure of insulin fructotransferase in the presence of di-fructose
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
PNTYDVTTWRIKAHPEVTAQSDIGAVINDIIADIKQRQTSPDARPGAAIIIPPGDYDLHTQVVVDVSYLTIAGFGHGFFSRSILDNSNPTGWQNLQPGASHIRVLTSPSAPQAFLVKRAGDPRLSGIVFRDFCLDGVGFTPGKNSYHNGKTGIEVASDNDSFHITGMGFVYLEHALIVRGADALRVNDNMIAECGNCVELTGAGQATIVSGNHMGAGPDGVTLLAENHEGLLVTGNNLFPRGRSLIEFTGCNRCSVTSNRLQGFYPGMLRLLNGCKENLITANHIRRTNEGYPPFIGRGNGLDDLYGVVHIAGDNNLISDNLFAYNVPPANIAPAGAQPTQILIAGGDANVVALNHVVSDVASQHVVLDASTTHSKVLDSGTASQITSYSSDTAIRPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulin Fructotransferase
publication title Structural and functional insights into intramolecular fructosyl transfer by insulin fructotransferase
pubmed doi rcsb
source organism Bacillus sp. snu-7
molecule tags Lyase
total genus 149
structure length 399
sequence length 399
chains with identical sequence B, C
ec nomenclature ec 4.2.2.18: Inulin fructotransferase (DFA-III-forming).
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18835 Beta_helix_2 Beta helix repeat of Inulin fructotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2invA00
4YZAA 1H80A 4XLCA 3FY3A 4XOTA 3GQ9A 4XN3A 2X6YA 1DBOA 4XL9A 1AIRA 4XMYA 4XNFA 4Z06A 1O8EA 2NSPA 2UVEA 1HG8A 2O04A 3JURA 1IDKA 1KCDA 1RWRA 2PYGA 2QY1A 3T9GA 3GQAA 1BHEA 2NZMA 4YEJA 3EQOA 4MXNA 4OJPA 3VSUA 1KTWA 1X0CA 4MR0A 3B8YA 4HWVA 1KCCA 4C2LA 2X85A 4OJLA 3GQ7A 4OZZA 1O88A 4EW9A 3VMVA 3KRGA 4XLFA 1CZFA 4XQFA 1VBLA 4XLAA 4OJOA 1JRGA 2QX3A 4YZ0A 1RU4A 2VJJA 1IB4A 2EWEA 1O8FA 5AMVA 3EQNA 4NK6A 3B90A 1O8IA 1O8HA 2X6XA 4XM3A 2X6WA 1PXZA 1GQ8A 2ODLA 1BN8A 2Z8GA 3GRHA 1O8MA 4U4BA 4XLEA 1IDJA 4OJ6A 2NT9A 1RMGA 1O8GA 1O8KA 2NTPA 1OFLA 2PECA 4U49A 2NSTA 4NK8A 4YELA 2VBKA 1O8DA 4XKWA 1IA5A 3VSTA 4W8RA 2BSPA 2QXZA 4URRA 4W8QA 4XLHA 5C1EA 4YZXA 4XR6A 1O8LA 1PE9A 4OJ5A 2X3HA 2INUA 2O0VA 1QCXA 1OGOX 2IQ7A 3LMWA 1JTAA 1XG2A 2NT6A 2O1DA 4XORA 5C1CA 3VMWA 4XKVA 1NHCA 2NTQA 4XN0A 1K5CA 2O17A 4OZYA 4AVZA 1O8JA 2VJIA 3B4NA 4XONA 2INVA 4Z03A 3ZSCA 4XOPA 2VBMA 4PMHA 3SUCA 4W8SA 1QJVA 2UVFA 3GQ8A 1DBGA 2O0WA 1OFMA 1WMRA 1PLUA 4W8TA 3WWGA 4I84A 1OOCA 3ZPPA 2NTBA 1OGMX 2VBEA 3UW0A 4YZQA 3VSVA 4Z05A 2PYHA 1EE6A
chains in the Genus database with same CATH superfamily
4YZAA 2VFMA 1H80A 4XLCA 2V5IA 3FY3A 3JX8A 4XOTA 3GQ9A 4XN3A 2X6YA 1DBOA 4XL9A 1AIRA 1TYXA 3PSSA 4XMYA 4XNFA 4Z06A 1QA2A 1O8EA 2NSPA 2UVEA 1HG8A 2O04A 3JURA 1IDKA 4YCQA 1RWRA 1KCDA 2PYGA 2BM5A 1EZGA 2QY1A 3DU1X 3T9GA 2W7ZA 3GQAA 1BHEA 2VFQA 3RIQA 3N90A 2NZMA 3PSZA 1QRBA 3EQOA 4MXNA 4OJPA 4YEJA 3LYCA 2VFPA 3VSUA 1KTWA 1X0CA 4MR0A 3ML3A 3B8YA 4HWVA 3BH7B 1KCCA 1QQ1A 2XT4A 4C2LA 1TSPA 1L1IA 2X85A 4OJLA 3GQ7A 4OZZA 1O88A 4EW9A 3NAWA 1OFEA 3KRGA 4XLFA 3VMVA 1CZFA 4XQFA 1VBLA 1LM1A 4XLAA 4OJOA 1JRGA 2BM7A 2QX3A 2J8KA 1RU4A 2QYUA 2VJJA 4YZ0A 1IB4A 2EWEA 1O8FA 5AMVA 3EQNA 1TYWA 1DABA 4NK6A 3B90A 1O8IA 1O8HA 2X6XA 4XM3A 2YUHA 2X6WA 1PXZA 2QZAA 3BH6B 1GQ8A 2ODLA 1BN8A 2Z8GA 3GRHA 1O8MA 4U4BA 4XLEA 1IDJA 4YDTA 4OJ6A 2NT9A 1RMGA 1HF2A 1O8GA 1O8KA 2BM4A 1OFLA 2NTPA 2PECA 4U49A 1CLWA 3AK5A 5DNSA 2NSTA 3SY2A 4NK8A 4YELA 4YEIA 5JMCB 2VBKA 2BX6A 3N6ZA 1O8DA 4XKWA 1IA5A 4OM9A 3VSTA 1TYUA 1QA1A 2VFNA 4W8RA 2IOUG 3H09A 2BSPA 2BM6A 2QXZA 4URRA 4W8QA 4XLHA 1QA3A 5C1EA 1WXRA 4YFOA 1K8FA 4JRAC 4YZXA 4XR6A 4YC5A 1O8LA 1PE9A 4OJ5A 2X3HA 2INUA 2O0VA 1QCXA 3LJYA 1EA0A 1OGOX 2IQ7A 3LMWA 1JTAA 1XG2A 2NT6A 2O1DA 4XORA 5C1CA 2J8IA 4OPWA 3VMWA 4XKVA 2XTWA 2NTQA 3P4GA 4V02C 4XN0A 1NHCA 1K5CA 2F3LA 1LLWA 2XT2A 2O17A 4OZYA 2XC1A 4AVZA 1TYVA 1KQ5A 1O8JA 2VJIA 1QRCA 3B4NA 2INVA 4XONA 4Z03A 3SYJA 3ZSCA 1OFDA 4XOPA 2VBMA 1K4ZA 2XTYA 4PMHA 2O6WA 3SUCA 4W8SA 4KH3A 1QJVA 2UVFA 3PETA 3GQ8A 1DBGA 2O0WA 1OFMA 5JLVC 1WMRA 2B0RA 1PLUA 4W8TA 3WWGA 4I84A 1OOCA 3SQVA 3ZPPA 2VFOA 1LLZA 2XTXA 2NTBA 3TH0A 2G0YA 3NB2A 1OGMX 2VBEA 3UW0A 4YZQA 3VSVA 4Z05A 3SZEA 2PYHA 1EE6A
chains in the Genus database with same CATH topology
4YZAA 1H80A 4XLCA 3FY3A 4XOTA 3GQ9A 4XN3A 2X6YA 1DBOA 4XL9A 1AIRA 4XMYA 4XNFA 4Z06A 1O8EA 2NSPA 2UVEA 1HG8A 2O04A 3JURA 1IDKA 1KCDA 1RWRA 2PYGA 2QY1A 3T9GA 3GQAA 1BHEA 2NZMA 4YEJA 3EQOA 4MXNA 4OJPA 3VSUA 1KTWA 1X0CA 4MR0A 3B8YA 4HWVA 1KCCA 4C2LA 2X85A 4OJLA 3GQ7A 4OZZA 1O88A 4EW9A 3VMVA 3KRGA 4XLFA 1CZFA 4XQFA 1VBLA 4XLAA 4OJOA 1JRGA 2QX3A 4YZ0A 1RU4A 2VJJA 1IB4A 2EWEA 1O8FA 5AMVA 3EQNA 4NK6A 3B90A 1O8IA 1O8HA 2X6XA 4XM3A 2X6WA 1PXZA 1GQ8A 2ODLA 1BN8A 2Z8GA 3GRHA 1O8MA 4U4BA 4XLEA 1IDJA 4OJ6A 2NT9A 1RMGA 1O8GA 1O8KA 2NTPA 1OFLA 2PECA 4U49A 2NSTA 4NK8A 4YELA 2VBKA 1O8DA 4XKWA 1IA5A 3VSTA 4W8RA 2BSPA 2QXZA 4URRA 4W8QA 4XLHA 5C1EA 4YZXA 4XR6A 1O8LA 1PE9A 4OJ5A 2X3HA 2INUA 2O0VA 1QCXA 1OGOX 2IQ7A 3LMWA 1JTAA 1XG2A 2NT6A 2O1DA 4XORA 5C1CA 3VMWA 4XKVA 1NHCA 2NTQA 4XN0A 1K5CA 2O17A 4OZYA 4AVZA 1O8JA 2VJIA 3B4NA 4XONA 2INVA 4Z03A 3ZSCA 4XOPA 2VBMA 4PMHA 3SUCA 4W8SA 1QJVA 2UVFA 3GQ8A 1DBGA 2O0WA 1OFMA 1WMRA 1PLUA 4W8TA 3WWGA 4I84A 1OOCA 3ZPPA 2NTBA 1OGMX 2VBEA 3UW0A 4YZQA 3VSVA 4Z05A 2PYHA 1EE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZA A;  1H80 A;  4XLC A;  3FY3 A;  4XOT A;  3GQ9 A;  4XN3 A;  2X6Y A;  1DBO A;  4XL9 A;  1AIR A;  4XMY A;  4XNF A;  4Z06 A;  1O8E A;  2NSP A;  2UVE A;  1HG8 A;  2O04 A;  3JUR A;  1IDK A;  1KCD A;  1RWR A;  2PYG A;  2QY1 A;  3T9G A;  3GQA A;  1BHE A;  2NZM A;  4YEJ A;  3EQO A;  4MXN A;  4OJP A;  3VSU A;  1KTW A;  1X0C A;  4MR0 A;  3B8Y A;  4HWV A;  1KCC A;  4C2L A;  2X85 A;  4OJL A;  3GQ7 A;  4OZZ A;  1O88 A;  4EW9 A;  3VMV A;  3KRG A;  4XLF A;  1CZF A;  4XQF A;  1VBL A;  4XLA A;  4OJO A;  1JRG A;  2QX3 A;  4YZ0 A;  1RU4 A;  2VJJ A;  1IB4 A;  2EWE A;  1O8F A;  5AMV A;  3EQN A;  4NK6 A;  3B90 A;  1O8I A;  1O8H A;  2X6X A;  4XM3 A;  2X6W A;  1PXZ A;  1GQ8 A;  2ODL A;  1BN8 A;  2Z8G A;  3GRH A;  1O8M A;  4U4B A;  4XLE A;  1IDJ A;  4OJ6 A;  2NT9 A;  1RMG A;  1O8G A;  1O8K A;  2NTP A;  1OFL A;  2PEC A;  4U49 A;  2NST A;  4NK8 A;  4YEL A;  2VBK A;  1O8D A;  4XKW A;  1IA5 A;  3VST A;  4W8R A;  2BSP A;  2QXZ A;  4URR A;  4W8Q A;  4XLH A;  5C1E A;  4YZX A;  4XR6 A;  1O8L A;  1PE9 A;  4OJ5 A;  2X3H A;  2INU A;  2O0V A;  1QCX A;  1OGO X;  2IQ7 A;  3LMW A;  1JTA A;  1XG2 A;  2NT6 A;  2O1D A;  4XOR A;  5C1C A;  3VMW A;  4XKV A;  1NHC A;  2NTQ A;  4XN0 A;  1K5C A;  2O17 A;  4OZY A;  4AVZ A;  1O8J A;  2VJI A;  3B4N A;  4XON A;  2INV A;  4Z03 A;  3ZSC A;  4XOP A;  2VBM A;  4PMH A;  3SUC A;  4W8S A;  1QJV A;  2UVF A;  3GQ8 A;  1DBG A;  2O0W A;  1OFM A;  1WMR A;  1PLU A;  4W8T A;  3WWG A;  4I84 A;  1OOC A;  3ZPP A;  2NTB A;  1OGM X;  2VBE A;  3UW0 A;  4YZQ A;  3VSV A;  4Z05 A;  2PYH A;  1EE6 A; 
#chains in the Genus database with same CATH topology
 4YZA A;  2VFM A;  1H80 A;  4XLC A;  2V5I A;  3FY3 A;  3JX8 A;  4XOT A;  3GQ9 A;  4XN3 A;  2X6Y A;  1DBO A;  4XL9 A;  1AIR A;  1TYX A;  3PSS A;  4XMY A;  4XNF A;  4Z06 A;  1QA2 A;  1O8E A;  2NSP A;  2UVE A;  1HG8 A;  2O04 A;  3JUR A;  1IDK A;  4YCQ A;  1RWR A;  1KCD A;  2PYG A;  2BM5 A;  1EZG A;  2QY1 A;  3DU1 X;  3T9G A;  2W7Z A;  3GQA A;  1BHE A;  2VFQ A;  3RIQ A;  3N90 A;  2NZM A;  3PSZ A;  1QRB A;  3EQO A;  4MXN A;  4OJP A;  4YEJ A;  3LYC A;  2VFP A;  3VSU A;  1KTW A;  1X0C A;  4MR0 A;  3ML3 A;  3B8Y A;  4HWV A;  3BH7 B;  1KCC A;  1QQ1 A;  2XT4 A;  4C2L A;  1TSP A;  1L1I A;  2X85 A;  4OJL A;  3GQ7 A;  4OZZ A;  1O88 A;  4EW9 A;  3NAW A;  1OFE A;  3KRG A;  4XLF A;  3VMV A;  1CZF A;  4XQF A;  1VBL A;  1LM1 A;  4XLA A;  4OJO A;  1JRG A;  2BM7 A;  2QX3 A;  2J8K A;  1RU4 A;  2QYU A;  2VJJ A;  4YZ0 A;  1IB4 A;  2EWE A;  1O8F A;  5AMV A;  3EQN A;  1TYW A;  1DAB A;  4NK6 A;  3B90 A;  1O8I A;  1O8H A;  2X6X A;  4XM3 A;  2YUH A;  2X6W A;  1PXZ A;  2QZA A;  3BH6 B;  1GQ8 A;  2ODL A;  1BN8 A;  2Z8G A;  3GRH A;  1O8M A;  4U4B A;  4XLE A;  1IDJ A;  4YDT A;  4OJ6 A;  2NT9 A;  1RMG A;  1HF2 A;  1O8G A;  1O8K A;  2BM4 A;  1OFL A;  2NTP A;  2PEC A;  4U49 A;  1CLW A;  3AK5 A;  5DNS A;  2NST A;  3SY2 A;  4NK8 A;  4YEL A;  4YEI A;  5JMC B;  2VBK A;  2BX6 A;  3N6Z A;  1O8D A;  4XKW A;  1IA5 A;  4OM9 A;  3VST A;  1TYU A;  1QA1 A;  2VFN A;  4W8R A;  2IOU G;  3H09 A;  2BSP A;  2BM6 A;  2QXZ A;  4URR A;  4W8Q A;  4XLH A;  1QA3 A;  5C1E A;  1WXR A;  4YFO A;  1K8F A;  4JRA C;  4YZX A;  4XR6 A;  4YC5 A;  1O8L A;  1PE9 A;  4OJ5 A;  2X3H A;  2INU A;  2O0V A;  1QCX A;  3LJY A;  1EA0 A;  1OGO X;  2IQ7 A;  3LMW A;  1JTA A;  1XG2 A;  2NT6 A;  2O1D A;  4XOR A;  5C1C A;  2J8I A;  4OPW A;  3VMW A;  4XKV A;  2XTW A;  2NTQ A;  3P4G A;  4V02 C;  4XN0 A;  1NHC A;  1K5C A;  2F3L A;  1LLW A;  2XT2 A;  2O17 A;  4OZY A;  2XC1 A;  4AVZ A;  1TYV A;  1KQ5 A;  1O8J A;  2VJI A;  1QRC A;  3B4N A;  2INV A;  4XON A;  4Z03 A;  3SYJ A;  3ZSC A;  1OFD A;  4XOP A;  2VBM A;  1K4Z A;  2XTY A;  4PMH A;  2O6W A;  3SUC A;  4W8S A;  4KH3 A;  1QJV A;  2UVF A;  3PET A;  3GQ8 A;  1DBG A;  2O0W A;  1OFM A;  5JLV C;  1WMR A;  2B0R A;  1PLU A;  4W8T A;  3WWG A;  4I84 A;  1OOC A;  3SQV A;  3ZPP A;  2VFO A;  1LLZ A;  2XTX A;  2NTB A;  3TH0 A;  2G0Y A;  3NB2 A;  1OGM X;  2VBE A;  3UW0 A;  4YZQ A;  3VSV A;  4Z05 A;  3SZE A;  2PYH A;  1EE6 A; 
#chains in the Genus database with same CATH homology
 4YZA A;  1H80 A;  4XLC A;  3FY3 A;  4XOT A;  3GQ9 A;  4XN3 A;  2X6Y A;  1DBO A;  4XL9 A;  1AIR A;  4XMY A;  4XNF A;  4Z06 A;  1O8E A;  2NSP A;  2UVE A;  1HG8 A;  2O04 A;  3JUR A;  1IDK A;  1KCD A;  1RWR A;  2PYG A;  2QY1 A;  3T9G A;  3GQA A;  1BHE A;  2NZM A;  4YEJ A;  3EQO A;  4MXN A;  4OJP A;  3VSU A;  1KTW A;  1X0C A;  4MR0 A;  3B8Y A;  4HWV A;  1KCC A;  4C2L A;  2X85 A;  4OJL A;  3GQ7 A;  4OZZ A;  1O88 A;  4EW9 A;  3VMV A;  3KRG A;  4XLF A;  1CZF A;  4XQF A;  1VBL A;  4XLA A;  4OJO A;  1JRG A;  2QX3 A;  4YZ0 A;  1RU4 A;  2VJJ A;  1IB4 A;  2EWE A;  1O8F A;  5AMV A;  3EQN A;  4NK6 A;  3B90 A;  1O8I A;  1O8H A;  2X6X A;  4XM3 A;  2X6W A;  1PXZ A;  1GQ8 A;  2ODL A;  1BN8 A;  2Z8G A;  3GRH A;  1O8M A;  4U4B A;  4XLE A;  1IDJ A;  4OJ6 A;  2NT9 A;  1RMG A;  1O8G A;  1O8K A;  2NTP A;  1OFL A;  2PEC A;  4U49 A;  2NST A;  4NK8 A;  4YEL A;  2VBK A;  1O8D A;  4XKW A;  1IA5 A;  3VST A;  4W8R A;  2BSP A;  2QXZ A;  4URR A;  4W8Q A;  4XLH A;  5C1E A;  4YZX A;  4XR6 A;  1O8L A;  1PE9 A;  4OJ5 A;  2X3H A;  2INU A;  2O0V A;  1QCX A;  1OGO X;  2IQ7 A;  3LMW A;  1JTA A;  1XG2 A;  2NT6 A;  2O1D A;  4XOR A;  5C1C A;  3VMW A;  4XKV A;  1NHC A;  2NTQ A;  4XN0 A;  1K5C A;  2O17 A;  4OZY A;  4AVZ A;  1O8J A;  2VJI A;  3B4N A;  4XON A;  2INV A;  4Z03 A;  3ZSC A;  4XOP A;  2VBM A;  4PMH A;  3SUC A;  4W8S A;  1QJV A;  2UVF A;  3GQ8 A;  1DBG A;  2O0W A;  1OFM A;  1WMR A;  1PLU A;  4W8T A;  3WWG A;  4I84 A;  1OOC A;  3ZPP A;  2NTB A;  1OGM X;  2VBE A;  3UW0 A;  4YZQ A;  3VSV A;  4Z05 A;  2PYH A;  1EE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...