2INVA

Crystal structure of insulin fructotransferase in the presence of di-fructose
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
PNTYDVTTWRIKAHPEVTAQSDIGAVINDIIADIKQRQTSPDARPGAAIIIPPGDYDLHTQVVVDVSYLTIAGFGHGFFSRSILDNSNPTGWQNLQPGASHIRVLTSPSAPQAFLVKRAGDPRLSGIVFRDFCLDGVGFTPGKNSYHNGKTGIEVASDNDSFHITGMGFVYLEHALIVRGADALRVNDNMIAECGNCVELTGAGQATIVSGNHMGAGPDGVTLLAENHEGLLVTGNNLFPRGRSLIEFTGCNRCSVTSNRLQGFYPGMLRLLNGCKENLITANHIRRTNEGYPPFIGRGNGLDDLYGVVHIAGDNNLISDNLFAYNVPPANIAPAGAQPTQILIAGGDANVVALNHVVSDVASQHVVLDASTTHSKVLDSGTASQITSYSSDTAIRPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into intramolecular fructosyl transfer by insulin fructotransferase
pubmed doi rcsb
source organism Bacillus sp. snu-7
molecule tags Lyase
molecule keywords Insulin Fructotransferase
total genus 149
structure length 399
sequence length 399
chains with identical sequence B, C
ec nomenclature ec 4.2.2.18: Inulin fructotransferase (DFA-III-forming).
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18835 Beta_helix_2 Beta helix repeat of Inulin fructotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2invA00
4XN0A 1IDJA 4XORA 4Z03A 1JRGA 4W8QA 1PXZA 1RU4A 2PYHA 3WWGA 1O8IA 1HG8A 1O8HA 4XQFA 4XL9A 4W8RA 2NSTA 4W8TA 2O17A 1WMRA 2NTBA 4XKWA 2VBEA 4YEJA 3LMWA 1PLUA 4U4BA 1O8FA 4XMYA 3FY3A 4OZYA 2VJIA 1OFLA 2X6YA 1O88A 3GRHA 4MR0A 4MXNA 1QCXA 4U49A 4EW9A 3T9GA 2PECA 2UVEA 3EQNA 4YZAA 2BSPA 3JURA 1BN8A 4NK6A 1DBOA 1KCDA 1O8JA 3VMVA 4I84A 2O0WA 4YZXA 2NT9A 2VBKA 4XLHA 1O8EA 1O8MA 4PMHA 1X0CA 2NT6A 1BHEA 2O1DA 5C1CA 3SUCA 1CZFA 3GQ9A 4OJPA 4W8SA 4XKVA 3KRGA 3GQAA 4OJ6A 3ZPPA 2NZMA 1OGMX 4OZZA 1RMGA 2EWEA 4XOTA 3EQOA 4HWVA 4YZQA 2QXZA 1DBGA 4URRA 2UVFA 1OGOX 4XLAA 4XM3A 2NTPA 2VBMA 4XNFA 1GQ8A 1QJVA 3B90A 2VJJA 4XLCA 1O8LA 1XG2A 4YELA 4XOPA 2NTQA 1NHCA 1VBLA 2QY1A 4XN3A 3ZSCA 1KCCA 2X6XA 4XLEA 3VSUA 1H80A 3VSTA 1K5CA 2NSPA 1O8GA 4XLFA 2QX3A 1OOCA 4C2LA 2X85A 2X6WA 4Z05A 4NK8A 1RWRA 4Z06A 1JTAA 4XR6A 4XONA 2INUA 4OJLA 1PE9A 2IQ7A 3B4NA 3GQ7A 4OJ5A 2X3HA 1OFMA 3VMWA 2Z8GA 1O8KA 4AVZA 1IA5A 1EE6A 3GQ8A 2O04A 2PYGA 1IDKA 3UW0A 3B8YA 4YZ0A 1O8DA 1AIRA 5C1EA 2INVA 2O0VA 4OJOA 1KTWA 2ODLA 5AMVA 1IB4A 3VSVA
chains in the Genus database with same CATH superfamily
3BH7B 2VFOA 4XN0A 1IDJA 4XORA 2W7ZA 4Z03A 1JRGA 4W8QA 1PXZA 1RU4A 2PYHA 3WWGA 2BM6A 2XTXA 1O8IA 1HG8A 1O8HA 2IOUG 4XQFA 1TYVA 4XL9A 4W8RA 2NSTA 4W8TA 2O17A 1WMRA 2NTBA 3H09A 2VBEA 4XKWA 3LMWA 4YEJA 5DNSA 1PLUA 4U4BA 2YUHA 1O8FA 4XMYA 2XT2A 3FY3A 2VJIA 4OZYA 4YCQA 2BX6A 1OFDA 1OFLA 2X6YA 1TSPA 1O88A 1TYWA 3GRHA 3TH0A 4MR0A 4MXNA 1QCXA 4U49A 4EW9A 1WXRA 2QYUA 2XTWA 3N90A 3T9GA 5JLVC 3LJYA 2PECA 4XM3A 2UVEA 3EQNA 3AK5A 4YZAA 4OM9A 2BSPA 3JURA 1BN8A 4YC5A 1QA2A 4NK6A 1DBOA 1KCDA 1O8JA 3DU1X 3VMVA 4I84A 2O0WA 4YZXA 2NT9A 2VBKA 4XLHA 1O8EA 1O8MA 3N6ZA 1X0CA 2NT6A 3NAWA 4PMHA 1BHEA 2O1DA 5C1CA 3SUCA 1LLZA 2VFMA 4JRAC 1CZFA 3GQ9A 4OJPA 2VFPA 4W8SA 4XKVA 3KRGA 2XC1A 3GQAA 4OJ6A 3ZPPA 2NZMA 1OGMX 4OZZA 4YDTA 3SY2A 1RMGA 2EWEA 4XOTA 3EQOA 4HWVA 4YZQA 2QXZA 1DBGA 4URRA 1LLWA 1OGOX 2UVFA 1LM1A 2BM7A 4XLAA 1OFEA 2XT4A 4V02C 1TYXA 2NTPA 2F3LA 2VBMA 4XNFA 1GQ8A 1QJVA 3B90A 3JX8A 2VJJA 1EA0A 2J8IA 4XLCA 1O8LA 1XG2A 4YELA 1EZGA 4XOPA 2NTQA 1NHCA 1VBLA 2QY1A 4XN3A 3ZSCA 1KCCA 3LYCA 2B0RA 2X6XA 4XLEA 2XTYA 1H80A 3VSUA 3VSTA 1CLWA 1K5CA 2NSPA 3SYJA 1O8GA 4XLFA 3NB2A 2QX3A 1OOCA 4C2LA 2X85A 3PETA 2X6WA 4KH3A 2BM5A 4Z05A 4NK8A 1K8FA 1RWRA 4Z06A 3PSZA 4YFOA 1JTAA 1QRCA 2O6WA 4XR6A 3PSSA 4XONA 3ML3A 2INUA 4OJLA 3P4GA 1PE9A 5JMCB 2IQ7A 3B4NA 3GQ7A 1HF2A 4OJ5A 2VFNA 3SQVA 1QA1A 1TYUA 1KQ5A 2VFQA 2X3HA 3RIQA 1OFMA 3VMWA 1QA3A 2QZAA 3SZEA 2Z8GA 1O8KA 1QRBA 4AVZA 1IA5A 1EE6A 3GQ8A 2O04A 3BH6B 2PYGA 2G0YA 1IDKA 2V5IA 3UW0A 3B8YA 4YZ0A 2J8KA 4YEIA 1O8DA 4OPWA 1DABA 1AIRA 5C1EA 1K4ZA 1QQ1A 2INVA 2O0VA 1L1IA 4OJOA 1KTWA 2ODLA 2BM4A 5AMVA 1IB4A 3VSVA
chains in the Genus database with same CATH topology
4XN0A 1IDJA 4XORA 4Z03A 1JRGA 4W8QA 1PXZA 1RU4A 2PYHA 3WWGA 1O8IA 1HG8A 1O8HA 4XQFA 4XL9A 4W8RA 2NSTA 4W8TA 2O17A 1WMRA 2NTBA 4XKWA 2VBEA 4YEJA 3LMWA 1PLUA 4U4BA 1O8FA 4XMYA 3FY3A 4OZYA 2VJIA 1OFLA 2X6YA 1O88A 3GRHA 4MR0A 4MXNA 1QCXA 4U49A 4EW9A 3T9GA 2PECA 2UVEA 3EQNA 4YZAA 2BSPA 3JURA 1BN8A 4NK6A 1DBOA 1KCDA 1O8JA 3VMVA 4I84A 2O0WA 4YZXA 2NT9A 2VBKA 4XLHA 1O8EA 1O8MA 4PMHA 1X0CA 2NT6A 1BHEA 2O1DA 5C1CA 3SUCA 1CZFA 3GQ9A 4OJPA 4W8SA 4XKVA 3KRGA 3GQAA 4OJ6A 3ZPPA 2NZMA 1OGMX 4OZZA 1RMGA 2EWEA 4XOTA 3EQOA 4HWVA 4YZQA 2QXZA 1DBGA 4URRA 2UVFA 1OGOX 4XLAA 4XM3A 2NTPA 2VBMA 4XNFA 1GQ8A 1QJVA 3B90A 2VJJA 4XLCA 1O8LA 1XG2A 4YELA 4XOPA 2NTQA 1NHCA 1VBLA 2QY1A 4XN3A 3ZSCA 1KCCA 2X6XA 4XLEA 3VSUA 1H80A 3VSTA 1K5CA 2NSPA 1O8GA 4XLFA 2QX3A 1OOCA 4C2LA 2X85A 2X6WA 4Z05A 4NK8A 1RWRA 4Z06A 1JTAA 4XR6A 4XONA 2INUA 4OJLA 1PE9A 2IQ7A 3B4NA 3GQ7A 4OJ5A 2X3HA 1OFMA 3VMWA 2Z8GA 1O8KA 4AVZA 1IA5A 1EE6A 3GQ8A 2O04A 2PYGA 1IDKA 3UW0A 3B8YA 4YZ0A 1O8DA 1AIRA 5C1EA 2INVA 2O0VA 4OJOA 1KTWA 2ODLA 5AMVA 1IB4A 3VSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XN0 A;  1IDJ A;  4XOR A;  4Z03 A;  1JRG A;  4W8Q A;  1PXZ A;  1RU4 A;  2PYH A;  3WWG A;  1O8I A;  1HG8 A;  1O8H A;  4XQF A;  4XL9 A;  4W8R A;  2NST A;  4W8T A;  2O17 A;  1WMR A;  2NTB A;  4XKW A;  2VBE A;  4YEJ A;  3LMW A;  1PLU A;  4U4B A;  1O8F A;  4XMY A;  3FY3 A;  4OZY A;  2VJI A;  1OFL A;  2X6Y A;  1O88 A;  3GRH A;  4MR0 A;  4MXN A;  1QCX A;  4U49 A;  4EW9 A;  3T9G A;  2PEC A;  2UVE A;  3EQN A;  4YZA A;  2BSP A;  3JUR A;  1BN8 A;  4NK6 A;  1DBO A;  1KCD A;  1O8J A;  3VMV A;  4I84 A;  2O0W A;  4YZX A;  2NT9 A;  2VBK A;  4XLH A;  1O8E A;  1O8M A;  4PMH A;  1X0C A;  2NT6 A;  1BHE A;  2O1D A;  5C1C A;  3SUC A;  1CZF A;  3GQ9 A;  4OJP A;  4W8S A;  4XKV A;  3KRG A;  3GQA A;  4OJ6 A;  3ZPP A;  2NZM A;  1OGM X;  4OZZ A;  1RMG A;  2EWE A;  4XOT A;  3EQO A;  4HWV A;  4YZQ A;  2QXZ A;  1DBG A;  4URR A;  2UVF A;  1OGO X;  4XLA A;  4XM3 A;  2NTP A;  2VBM A;  4XNF A;  1GQ8 A;  1QJV A;  3B90 A;  2VJJ A;  4XLC A;  1O8L A;  1XG2 A;  4YEL A;  4XOP A;  2NTQ A;  1NHC A;  1VBL A;  2QY1 A;  4XN3 A;  3ZSC A;  1KCC A;  2X6X A;  4XLE A;  3VSU A;  1H80 A;  3VST A;  1K5C A;  2NSP A;  1O8G A;  4XLF A;  2QX3 A;  1OOC A;  4C2L A;  2X85 A;  2X6W A;  4Z05 A;  4NK8 A;  1RWR A;  4Z06 A;  1JTA A;  4XR6 A;  4XON A;  2INU A;  4OJL A;  1PE9 A;  2IQ7 A;  3B4N A;  3GQ7 A;  4OJ5 A;  2X3H A;  1OFM A;  3VMW A;  2Z8G A;  1O8K A;  4AVZ A;  1IA5 A;  1EE6 A;  3GQ8 A;  2O04 A;  2PYG A;  1IDK A;  3UW0 A;  3B8Y A;  4YZ0 A;  1O8D A;  1AIR A;  5C1E A;  2INV A;  2O0V A;  4OJO A;  1KTW A;  2ODL A;  5AMV A;  1IB4 A;  3VSV A; 
#chains in the Genus database with same CATH topology
 3BH7 B;  2VFO A;  4XN0 A;  1IDJ A;  4XOR A;  2W7Z A;  4Z03 A;  1JRG A;  4W8Q A;  1PXZ A;  1RU4 A;  2PYH A;  3WWG A;  2BM6 A;  2XTX A;  1O8I A;  1HG8 A;  1O8H A;  2IOU G;  4XQF A;  1TYV A;  4XL9 A;  4W8R A;  2NST A;  4W8T A;  2O17 A;  1WMR A;  2NTB A;  3H09 A;  2VBE A;  4XKW A;  3LMW A;  4YEJ A;  5DNS A;  1PLU A;  4U4B A;  2YUH A;  1O8F A;  4XMY A;  2XT2 A;  3FY3 A;  2VJI A;  4OZY A;  4YCQ A;  2BX6 A;  1OFD A;  1OFL A;  2X6Y A;  1TSP A;  1O88 A;  1TYW A;  3GRH A;  3TH0 A;  4MR0 A;  4MXN A;  1QCX A;  4U49 A;  4EW9 A;  1WXR A;  2QYU A;  2XTW A;  3N90 A;  3T9G A;  5JLV C;  3LJY A;  2PEC A;  4XM3 A;  2UVE A;  3EQN A;  3AK5 A;  4YZA A;  4OM9 A;  2BSP A;  3JUR A;  1BN8 A;  4YC5 A;  1QA2 A;  4NK6 A;  1DBO A;  1KCD A;  1O8J A;  3DU1 X;  3VMV A;  4I84 A;  2O0W A;  4YZX A;  2NT9 A;  2VBK A;  4XLH A;  1O8E A;  1O8M A;  3N6Z A;  1X0C A;  2NT6 A;  3NAW A;  4PMH A;  1BHE A;  2O1D A;  5C1C A;  3SUC A;  1LLZ A;  2VFM A;  4JRA C;  1CZF A;  3GQ9 A;  4OJP A;  2VFP A;  4W8S A;  4XKV A;  3KRG A;  2XC1 A;  3GQA A;  4OJ6 A;  3ZPP A;  2NZM A;  1OGM X;  4OZZ A;  4YDT A;  3SY2 A;  1RMG A;  2EWE A;  4XOT A;  3EQO A;  4HWV A;  4YZQ A;  2QXZ A;  1DBG A;  4URR A;  1LLW A;  1OGO X;  2UVF A;  1LM1 A;  2BM7 A;  4XLA A;  1OFE A;  2XT4 A;  4V02 C;  1TYX A;  2NTP A;  2F3L A;  2VBM A;  4XNF A;  1GQ8 A;  1QJV A;  3B90 A;  3JX8 A;  2VJJ A;  1EA0 A;  2J8I A;  4XLC A;  1O8L A;  1XG2 A;  4YEL A;  1EZG A;  4XOP A;  2NTQ A;  1NHC A;  1VBL A;  2QY1 A;  4XN3 A;  3ZSC A;  1KCC A;  3LYC A;  2B0R A;  2X6X A;  4XLE A;  2XTY A;  1H80 A;  3VSU A;  3VST A;  1CLW A;  1K5C A;  2NSP A;  3SYJ A;  1O8G A;  4XLF A;  3NB2 A;  2QX3 A;  1OOC A;  4C2L A;  2X85 A;  3PET A;  2X6W A;  4KH3 A;  2BM5 A;  4Z05 A;  4NK8 A;  1K8F A;  1RWR A;  4Z06 A;  3PSZ A;  4YFO A;  1JTA A;  1QRC A;  2O6W A;  4XR6 A;  3PSS A;  4XON A;  3ML3 A;  2INU A;  4OJL A;  3P4G A;  1PE9 A;  5JMC B;  2IQ7 A;  3B4N A;  3GQ7 A;  1HF2 A;  4OJ5 A;  2VFN A;  3SQV A;  1QA1 A;  1TYU A;  1KQ5 A;  2VFQ A;  2X3H A;  3RIQ A;  1OFM A;  3VMW A;  1QA3 A;  2QZA A;  3SZE A;  2Z8G A;  1O8K A;  1QRB A;  4AVZ A;  1IA5 A;  1EE6 A;  3GQ8 A;  2O04 A;  3BH6 B;  2PYG A;  2G0Y A;  1IDK A;  2V5I A;  3UW0 A;  3B8Y A;  4YZ0 A;  2J8K A;  4YEI A;  1O8D A;  4OPW A;  1DAB A;  1AIR A;  5C1E A;  1K4Z A;  1QQ1 A;  2INV A;  2O0V A;  1L1I A;  4OJO A;  1KTW A;  2ODL A;  2BM4 A;  5AMV A;  1IB4 A;  3VSV A; 
#chains in the Genus database with same CATH homology
 4XN0 A;  1IDJ A;  4XOR A;  4Z03 A;  1JRG A;  4W8Q A;  1PXZ A;  1RU4 A;  2PYH A;  3WWG A;  1O8I A;  1HG8 A;  1O8H A;  4XQF A;  4XL9 A;  4W8R A;  2NST A;  4W8T A;  2O17 A;  1WMR A;  2NTB A;  4XKW A;  2VBE A;  4YEJ A;  3LMW A;  1PLU A;  4U4B A;  1O8F A;  4XMY A;  3FY3 A;  4OZY A;  2VJI A;  1OFL A;  2X6Y A;  1O88 A;  3GRH A;  4MR0 A;  4MXN A;  1QCX A;  4U49 A;  4EW9 A;  3T9G A;  2PEC A;  2UVE A;  3EQN A;  4YZA A;  2BSP A;  3JUR A;  1BN8 A;  4NK6 A;  1DBO A;  1KCD A;  1O8J A;  3VMV A;  4I84 A;  2O0W A;  4YZX A;  2NT9 A;  2VBK A;  4XLH A;  1O8E A;  1O8M A;  4PMH A;  1X0C A;  2NT6 A;  1BHE A;  2O1D A;  5C1C A;  3SUC A;  1CZF A;  3GQ9 A;  4OJP A;  4W8S A;  4XKV A;  3KRG A;  3GQA A;  4OJ6 A;  3ZPP A;  2NZM A;  1OGM X;  4OZZ A;  1RMG A;  2EWE A;  4XOT A;  3EQO A;  4HWV A;  4YZQ A;  2QXZ A;  1DBG A;  4URR A;  2UVF A;  1OGO X;  4XLA A;  4XM3 A;  2NTP A;  2VBM A;  4XNF A;  1GQ8 A;  1QJV A;  3B90 A;  2VJJ A;  4XLC A;  1O8L A;  1XG2 A;  4YEL A;  4XOP A;  2NTQ A;  1NHC A;  1VBL A;  2QY1 A;  4XN3 A;  3ZSC A;  1KCC A;  2X6X A;  4XLE A;  3VSU A;  1H80 A;  3VST A;  1K5C A;  2NSP A;  1O8G A;  4XLF A;  2QX3 A;  1OOC A;  4C2L A;  2X85 A;  2X6W A;  4Z05 A;  4NK8 A;  1RWR A;  4Z06 A;  1JTA A;  4XR6 A;  4XON A;  2INU A;  4OJL A;  1PE9 A;  2IQ7 A;  3B4N A;  3GQ7 A;  4OJ5 A;  2X3H A;  1OFM A;  3VMW A;  2Z8G A;  1O8K A;  4AVZ A;  1IA5 A;  1EE6 A;  3GQ8 A;  2O04 A;  2PYG A;  1IDK A;  3UW0 A;  3B8Y A;  4YZ0 A;  1O8D A;  1AIR A;  5C1E A;  2INV A;  2O0V A;  4OJO A;  1KTW A;  2ODL A;  5AMV A;  1IB4 A;  3VSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...