2INVA

Crystal structure of insulin fructotransferase in the presence of di-fructose
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
PNTYDVTTWRIKAHPEVTAQSDIGAVINDIIADIKQRQTSPDARPGAAIIIPPGDYDLHTQVVVDVSYLTIAGFGHGFFSRSILDNSNPTGWQNLQPGASHIRVLTSPSAPQAFLVKRAGDPRLSGIVFRDFCLDGVGFTPGKNSYHNGKTGIEVASDNDSFHITGMGFVYLEHALIVRGADALRVNDNMIAECGNCVELTGAGQATIVSGNHMGAGPDGVTLLAENHEGLLVTGNNLFPRGRSLIEFTGCNRCSVTSNRLQGFYPGMLRLLNGCKENLITANHIRRTNEGYPPFIGRGNGLDDLYGVVHIAGDNNLISDNLFAYNVPPANIAPAGAQPTQILIAGGDANVVALNHVVSDVASQHVVLDASTTHSKVLDSGTASQITSYSSDTAIRPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Insulin Fructotransferase
publication title Structural and functional insights into intramolecular fructosyl transfer by insulin fructotransferase
pubmed doi rcsb
source organism Bacillus sp. snu-7
total genus 149
structure length 399
sequence length 399
chains with identical sequence B, C
ec nomenclature ec 4.2.2.18: Inulin fructotransferase (DFA-III-forming).
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18835 Beta_helix_2 Beta helix repeat of Inulin fructotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2invA00
3GRHA 4XNFA 4XLAA 5C1EA 2EWEA 2O1DA 3KRGA 4XLCA 2QX3A 1O8JA 1O8DA 3VSVA 2ODLA 1K5CA 3GQAA 3UW0A 1HG8A 1PLUA 2IQ7A 2O04A 2VJIA 4XL9A 3VSUA 2NTQA 5C1CA 1JTAA 2VBEA 2PYHA 4YEJA 4YZ0A 3T9GA 1BHEA 1PXZA 1O8LA 3GQ8A 2NZMA 4OZZA 3ZPPA 1RU4A 5AMVA 4U4BA 2INVA 1NHCA 2X6YA 1H80A 1OFMA 4PMHA 1IA5A 1IB4A 3B4NA 1KTWA 1O8IA 3VMWA 1RWRA 4XKVA 1GQ8A 2X85A 3LMWA 2NTPA 1O8HA 2X6XA 4MR0A 1JRGA 4XM3A 4AVZA 4XOTA 4I84A 1X0CA 1DBGA 1KCDA 4XLHA 1OGOX 1XG2A 4XKWA 4YZQA 4XR6A 2NSTA 3FY3A 2NT9A 4Z06A 1RMGA 4U49A 2VJJA 2NSPA 1QCXA 2X6WA 3VMVA 2QY1A 4W8RA 2NTBA 2X3HA 1OOCA 1BN8A 2PYGA 3B90A 4HWVA 4OJ6A 4YELA 3ZSCA 4XLEA 3WWGA 1O8KA 3VSTA 4XLFA 3EQNA 1O8EA 3EQOA 4MXNA 4YZXA 1O8FA 2PECA 4W8QA 4C2LA 4EW9A 1AIRA 2O0VA 4NK8A 2QXZA 4XONA 1EE6A 4YZAA 4W8SA 1PE9A 3GQ7A 1IDKA 1VBLA 1WMRA 2Z8GA 3SUCA 4XORA 2BSPA 4XQFA 1OGMX 4NK6A 1OFLA 1O88A 2UVFA 4OJPA 4XN0A 1CZFA 4W8TA 1O8GA 1O8MA 4OJLA 2O17A 2INUA 4XMYA 2O0WA 4OZYA 2UVEA 4URRA 4XN3A 4XOPA 4OJ5A 1KCCA 3GQ9A 4OJOA 4Z05A 2VBKA 3B8YA 4Z03A 1IDJA 3JURA 1DBOA 2NT6A 2VBMA 1QJVA
chains in the Genus database with same CATH superfamily
1TYXA 3GRHA 4XNFA 4XLAA 5C1EA 1LLWA 2XT4A 2EWEA 1DABA 2O1DA 3KRGA 4XLCA 4YFOA 2XT2A 2QX3A 1O8JA 1O8DA 2BM5A 3VSVA 2ODLA 4YEIA 1K5CA 3GQAA 3UW0A 1HG8A 1PLUA 2IQ7A 2O04A 1K4ZA 2VJIA 4XL9A 2QZAA 3PETA 3VSUA 2NTQA 3N90A 2XTXA 5C1CA 1JTAA 2VBEA 2PYHA 4YEJA 4YZ0A 3T9GA 3ZSCA 3ML3A 1BHEA 1PXZA 3P4GA 1O8LA 1CLWA 3GQ8A 4YDTA 2NZMA 4OZZA 3ZPPA 1RU4A 1TYWA 5AMVA 4U4BA 2INVA 1NHCA 2X6YA 1H80A 1OFMA 4PMHA 1IA5A 2XC1A 3SQVA 4YCQA 1IB4A 3SY2A 3B4NA 1KTWA 1O8IA 1QA2A 3VMWA 1RWRA 3H09A 1GQ8A 3BH6B 4OM9A 2X85A 4XKVA 1OFDA 3LMWA 3TH0A 2NTPA 3SYJA 1LLZA 1O8HA 2X6XA 4MR0A 1JRGA 3LJYA 4XM3A 4AVZA 1QA1A 3NB2A 1QRBA 5JLVC 3NAWA 4XOTA 1KQ5A 4I84A 4YC5A 1X0CA 1DBGA 1K8FA 4XLHA 1OGOX 1XG2A 3SZEA 4V02C 4XKWA 1KCDA 2XTYA 4YZQA 4XR6A 1L1IA 2BM6A 2NSTA 3FY3A 3RIQA 2NT9A 4Z06A 1RMGA 4U49A 2QYUA 2VJJA 2NSPA 1QCXA 2X6WA 3VMVA 1LM1A 2QY1A 4W8RA 1OOCA 2NTBA 2PYGA 1BN8A 2X3HA 3B90A 2BM4A 2VFPA 2YUHA 4HWVA 4OJ6A 2VBMA 4YELA 4XLEA 3WWGA 2BM7A 1O8KA 3LYCA 3VSTA 1EA0A 4XLFA 3EQNA 1O8EA 1EZGA 1QQ1A 3EQOA 4JRAC 1O8FA 2PECA 4MXNA 4W8QA 4YZXA 4C2LA 4EW9A 3PSSA 1AIRA 2B0RA 2O0VA 5DNSA 4OPWA 4NK8A 2QXZA 4XONA 1EE6A 4KH3A 4YZAA 3AK5A 1HF2A 4W8SA 1PE9A 3GQ7A 1IDKA 1TYVA 1VBLA 2V5IA 2F3LA 1WMRA 3PSZA 2J8IA 2Z8GA 3SUCA 1WXRA 4XORA 2BSPA 2VFOA 4XQFA 1OGMX 4NK6A 5JMCB 2IOUG 1OFLA 2VFQA 2G0YA 1QRCA 1TSPA 1O88A 3DU1X 1QA3A 3BH7B 2J8KA 2UVFA 4OJPA 4XN0A 1CZFA 4W8TA 1O8GA 1TYUA 3JX8A 2BX6A 1OFEA 2VFNA 1O8MA 4OJLA 2O17A 2XTWA 2INUA 4XMYA 2O0WA 4OZYA 2UVEA 4URRA 4XN3A 2VFMA 4XOPA 4OJ5A 1KCCA 3GQ9A 4OJOA 4Z05A 2W7ZA 2VBKA 3B8YA 3N6ZA 4Z03A 1IDJA 3JURA 1DBOA 2NT6A 2O6WA 1QJVA
chains in the Genus database with same CATH topology
3GRHA 4XNFA 4XLAA 5C1EA 2EWEA 2O1DA 3KRGA 4XLCA 2QX3A 1O8JA 1O8DA 3VSVA 2ODLA 1K5CA 3GQAA 3UW0A 1HG8A 1PLUA 2IQ7A 2O04A 2VJIA 4XL9A 3VSUA 2NTQA 5C1CA 1JTAA 2VBEA 2PYHA 4YEJA 4YZ0A 3T9GA 1BHEA 1PXZA 1O8LA 3GQ8A 2NZMA 4OZZA 3ZPPA 1RU4A 5AMVA 4U4BA 2INVA 1NHCA 2X6YA 1H80A 1OFMA 4PMHA 1IA5A 1IB4A 3B4NA 1KTWA 1O8IA 3VMWA 1RWRA 4XKVA 1GQ8A 2X85A 3LMWA 2NTPA 1O8HA 2X6XA 4MR0A 1JRGA 4XM3A 4AVZA 4XOTA 4I84A 1X0CA 1DBGA 1KCDA 4XLHA 1OGOX 1XG2A 4XKWA 4YZQA 4XR6A 2NSTA 3FY3A 2NT9A 4Z06A 1RMGA 4U49A 2VJJA 2NSPA 1QCXA 2X6WA 3VMVA 2QY1A 4W8RA 2NTBA 2X3HA 1OOCA 1BN8A 2PYGA 3B90A 4HWVA 4OJ6A 4YELA 3ZSCA 4XLEA 3WWGA 1O8KA 3VSTA 4XLFA 3EQNA 1O8EA 3EQOA 4MXNA 4YZXA 1O8FA 2PECA 4W8QA 4C2LA 4EW9A 1AIRA 2O0VA 4NK8A 2QXZA 4XONA 1EE6A 4YZAA 4W8SA 1PE9A 3GQ7A 1IDKA 1VBLA 1WMRA 2Z8GA 3SUCA 4XORA 2BSPA 4XQFA 1OGMX 4NK6A 1OFLA 1O88A 2UVFA 4OJPA 4XN0A 1CZFA 4W8TA 1O8GA 1O8MA 4OJLA 2O17A 2INUA 4XMYA 2O0WA 4OZYA 2UVEA 4URRA 4XN3A 4XOPA 4OJ5A 1KCCA 3GQ9A 4OJOA 4Z05A 2VBKA 3B8YA 4Z03A 1IDJA 3JURA 1DBOA 2NT6A 2VBMA 1QJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRH A;  4XNF A;  4XLA A;  5C1E A;  2EWE A;  2O1D A;  3KRG A;  4XLC A;  2QX3 A;  1O8J A;  1O8D A;  3VSV A;  2ODL A;  1K5C A;  3GQA A;  3UW0 A;  1HG8 A;  1PLU A;  2IQ7 A;  2O04 A;  2VJI A;  4XL9 A;  3VSU A;  2NTQ A;  5C1C A;  1JTA A;  2VBE A;  2PYH A;  4YEJ A;  4YZ0 A;  3T9G A;  1BHE A;  1PXZ A;  1O8L A;  3GQ8 A;  2NZM A;  4OZZ A;  3ZPP A;  1RU4 A;  5AMV A;  4U4B A;  2INV A;  1NHC A;  2X6Y A;  1H80 A;  1OFM A;  4PMH A;  1IA5 A;  1IB4 A;  3B4N A;  1KTW A;  1O8I A;  3VMW A;  1RWR A;  4XKV A;  1GQ8 A;  2X85 A;  3LMW A;  2NTP A;  1O8H A;  2X6X A;  4MR0 A;  1JRG A;  4XM3 A;  4AVZ A;  4XOT A;  4I84 A;  1X0C A;  1DBG A;  1KCD A;  4XLH A;  1OGO X;  1XG2 A;  4XKW A;  4YZQ A;  4XR6 A;  2NST A;  3FY3 A;  2NT9 A;  4Z06 A;  1RMG A;  4U49 A;  2VJJ A;  2NSP A;  1QCX A;  2X6W A;  3VMV A;  2QY1 A;  4W8R A;  2NTB A;  2X3H A;  1OOC A;  1BN8 A;  2PYG A;  3B90 A;  4HWV A;  4OJ6 A;  4YEL A;  3ZSC A;  4XLE A;  3WWG A;  1O8K A;  3VST A;  4XLF A;  3EQN A;  1O8E A;  3EQO A;  4MXN A;  4YZX A;  1O8F A;  2PEC A;  4W8Q A;  4C2L A;  4EW9 A;  1AIR A;  2O0V A;  4NK8 A;  2QXZ A;  4XON A;  1EE6 A;  4YZA A;  4W8S A;  1PE9 A;  3GQ7 A;  1IDK A;  1VBL A;  1WMR A;  2Z8G A;  3SUC A;  4XOR A;  2BSP A;  4XQF A;  1OGM X;  4NK6 A;  1OFL A;  1O88 A;  2UVF A;  4OJP A;  4XN0 A;  1CZF A;  4W8T A;  1O8G A;  1O8M A;  4OJL A;  2O17 A;  2INU A;  4XMY A;  2O0W A;  4OZY A;  2UVE A;  4URR A;  4XN3 A;  4XOP A;  4OJ5 A;  1KCC A;  3GQ9 A;  4OJO A;  4Z05 A;  2VBK A;  3B8Y A;  4Z03 A;  1IDJ A;  3JUR A;  1DBO A;  2NT6 A;  2VBM A;  1QJV A; 
#chains in the Genus database with same CATH topology
 1TYX A;  3GRH A;  4XNF A;  4XLA A;  5C1E A;  1LLW A;  2XT4 A;  2EWE A;  1DAB A;  2O1D A;  3KRG A;  4XLC A;  4YFO A;  2XT2 A;  2QX3 A;  1O8J A;  1O8D A;  2BM5 A;  3VSV A;  2ODL A;  4YEI A;  1K5C A;  3GQA A;  3UW0 A;  1HG8 A;  1PLU A;  2IQ7 A;  2O04 A;  1K4Z A;  2VJI A;  4XL9 A;  2QZA A;  3PET A;  3VSU A;  2NTQ A;  3N90 A;  2XTX A;  5C1C A;  1JTA A;  2VBE A;  2PYH A;  4YEJ A;  4YZ0 A;  3T9G A;  3ZSC A;  3ML3 A;  1BHE A;  1PXZ A;  3P4G A;  1O8L A;  1CLW A;  3GQ8 A;  4YDT A;  2NZM A;  4OZZ A;  3ZPP A;  1RU4 A;  1TYW A;  5AMV A;  4U4B A;  2INV A;  1NHC A;  2X6Y A;  1H80 A;  1OFM A;  4PMH A;  1IA5 A;  2XC1 A;  3SQV A;  4YCQ A;  1IB4 A;  3SY2 A;  3B4N A;  1KTW A;  1O8I A;  1QA2 A;  3VMW A;  1RWR A;  3H09 A;  1GQ8 A;  3BH6 B;  4OM9 A;  2X85 A;  4XKV A;  1OFD A;  3LMW A;  3TH0 A;  2NTP A;  3SYJ A;  1LLZ A;  1O8H A;  2X6X A;  4MR0 A;  1JRG A;  3LJY A;  4XM3 A;  4AVZ A;  1QA1 A;  3NB2 A;  1QRB A;  5JLV C;  3NAW A;  4XOT A;  1KQ5 A;  4I84 A;  4YC5 A;  1X0C A;  1DBG A;  1K8F A;  4XLH A;  1OGO X;  1XG2 A;  3SZE A;  4V02 C;  4XKW A;  1KCD A;  2XTY A;  4YZQ A;  4XR6 A;  1L1I A;  2BM6 A;  2NST A;  3FY3 A;  3RIQ A;  2NT9 A;  4Z06 A;  1RMG A;  4U49 A;  2QYU A;  2VJJ A;  2NSP A;  1QCX A;  2X6W A;  3VMV A;  1LM1 A;  2QY1 A;  4W8R A;  1OOC A;  2NTB A;  2PYG A;  1BN8 A;  2X3H A;  3B90 A;  2BM4 A;  2VFP A;  2YUH A;  4HWV A;  4OJ6 A;  2VBM A;  4YEL A;  4XLE A;  3WWG A;  2BM7 A;  1O8K A;  3LYC A;  3VST A;  1EA0 A;  4XLF A;  3EQN A;  1O8E A;  1EZG A;  1QQ1 A;  3EQO A;  4JRA C;  1O8F A;  2PEC A;  4MXN A;  4W8Q A;  4YZX A;  4C2L A;  4EW9 A;  3PSS A;  1AIR A;  2B0R A;  2O0V A;  5DNS A;  4OPW A;  4NK8 A;  2QXZ A;  4XON A;  1EE6 A;  4KH3 A;  4YZA A;  3AK5 A;  1HF2 A;  4W8S A;  1PE9 A;  3GQ7 A;  1IDK A;  1TYV A;  1VBL A;  2V5I A;  2F3L A;  1WMR A;  3PSZ A;  2J8I A;  2Z8G A;  3SUC A;  1WXR A;  4XOR A;  2BSP A;  2VFO A;  4XQF A;  1OGM X;  4NK6 A;  5JMC B;  2IOU G;  1OFL A;  2VFQ A;  2G0Y A;  1QRC A;  1TSP A;  1O88 A;  3DU1 X;  1QA3 A;  3BH7 B;  2J8K A;  2UVF A;  4OJP A;  4XN0 A;  1CZF A;  4W8T A;  1O8G A;  1TYU A;  3JX8 A;  2BX6 A;  1OFE A;  2VFN A;  1O8M A;  4OJL A;  2O17 A;  2XTW A;  2INU A;  4XMY A;  2O0W A;  4OZY A;  2UVE A;  4URR A;  4XN3 A;  2VFM A;  4XOP A;  4OJ5 A;  1KCC A;  3GQ9 A;  4OJO A;  4Z05 A;  2W7Z A;  2VBK A;  3B8Y A;  3N6Z A;  4Z03 A;  1IDJ A;  3JUR A;  1DBO A;  2NT6 A;  2O6W A;  1QJV A; 
#chains in the Genus database with same CATH homology
 3GRH A;  4XNF A;  4XLA A;  5C1E A;  2EWE A;  2O1D A;  3KRG A;  4XLC A;  2QX3 A;  1O8J A;  1O8D A;  3VSV A;  2ODL A;  1K5C A;  3GQA A;  3UW0 A;  1HG8 A;  1PLU A;  2IQ7 A;  2O04 A;  2VJI A;  4XL9 A;  3VSU A;  2NTQ A;  5C1C A;  1JTA A;  2VBE A;  2PYH A;  4YEJ A;  4YZ0 A;  3T9G A;  1BHE A;  1PXZ A;  1O8L A;  3GQ8 A;  2NZM A;  4OZZ A;  3ZPP A;  1RU4 A;  5AMV A;  4U4B A;  2INV A;  1NHC A;  2X6Y A;  1H80 A;  1OFM A;  4PMH A;  1IA5 A;  1IB4 A;  3B4N A;  1KTW A;  1O8I A;  3VMW A;  1RWR A;  4XKV A;  1GQ8 A;  2X85 A;  3LMW A;  2NTP A;  1O8H A;  2X6X A;  4MR0 A;  1JRG A;  4XM3 A;  4AVZ A;  4XOT A;  4I84 A;  1X0C A;  1DBG A;  1KCD A;  4XLH A;  1OGO X;  1XG2 A;  4XKW A;  4YZQ A;  4XR6 A;  2NST A;  3FY3 A;  2NT9 A;  4Z06 A;  1RMG A;  4U49 A;  2VJJ A;  2NSP A;  1QCX A;  2X6W A;  3VMV A;  2QY1 A;  4W8R A;  2NTB A;  2X3H A;  1OOC A;  1BN8 A;  2PYG A;  3B90 A;  4HWV A;  4OJ6 A;  4YEL A;  3ZSC A;  4XLE A;  3WWG A;  1O8K A;  3VST A;  4XLF A;  3EQN A;  1O8E A;  3EQO A;  4MXN A;  4YZX A;  1O8F A;  2PEC A;  4W8Q A;  4C2L A;  4EW9 A;  1AIR A;  2O0V A;  4NK8 A;  2QXZ A;  4XON A;  1EE6 A;  4YZA A;  4W8S A;  1PE9 A;  3GQ7 A;  1IDK A;  1VBL A;  1WMR A;  2Z8G A;  3SUC A;  4XOR A;  2BSP A;  4XQF A;  1OGM X;  4NK6 A;  1OFL A;  1O88 A;  2UVF A;  4OJP A;  4XN0 A;  1CZF A;  4W8T A;  1O8G A;  1O8M A;  4OJL A;  2O17 A;  2INU A;  4XMY A;  2O0W A;  4OZY A;  2UVE A;  4URR A;  4XN3 A;  4XOP A;  4OJ5 A;  1KCC A;  3GQ9 A;  4OJO A;  4Z05 A;  2VBK A;  3B8Y A;  4Z03 A;  1IDJ A;  3JUR A;  1DBO A;  2NT6 A;  2VBM A;  1QJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...