2INVA

Crystal structure of insulin fructotransferase in the presence of di-fructose
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
PNTYDVTTWRIKAHPEVTAQSDIGAVINDIIADIKQRQTSPDARPGAAIIIPPGDYDLHTQVVVDVSYLTIAGFGHGFFSRSILDNSNPTGWQNLQPGASHIRVLTSPSAPQAFLVKRAGDPRLSGIVFRDFCLDGVGFTPGKNSYHNGKTGIEVASDNDSFHITGMGFVYLEHALIVRGADALRVNDNMIAECGNCVELTGAGQATIVSGNHMGAGPDGVTLLAENHEGLLVTGNNLFPRGRSLIEFTGCNRCSVTSNRLQGFYPGMLRLLNGCKENLITANHIRRTNEGYPPFIGRGNGLDDLYGVVHIAGDNNLISDNLFAYNVPPANIAPAGAQPTQILIAGGDANVVALNHVVSDVASQHVVLDASTTHSKVLDSGTASQITSYSSDTAIRPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into intramolecular fructosyl transfer by insulin fructotransferase
pubmed doi rcsb
source organism Bacillus sp. snu-7
molecule tags Lyase
molecule keywords Insulin Fructotransferase
total genus 149
structure length 399
sequence length 399
chains with identical sequence B, C
ec nomenclature ec 4.2.2.18: Inulin fructotransferase (DFA-III-forming).
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18835 Beta_helix_2 Beta helix repeat of Inulin fructotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2invA00
2UVFA 3GQ9A 4EW9A 3GQ8A 2NT9A 4NK6A 1PLUA 1O8KA 4YZ0A 4W8SA 4XM3A 1KCCA 1RMGA 3VMWA 4XN3A 2O1DA 2PYHA 2VBEA 2UVEA 1IDKA 2QXZA 4Z05A 4XLAA 5C1CA 1CZFA 3GRHA 1OGMX 1JRGA 1O88A 1WMRA 2NZMA 4OJPA 4XNFA 3VSUA 2O0WA 4W8QA 4OJ5A 3UW0A 1OOCA 2PYGA 4XLCA 2NSTA 4XLFA 3WWGA 4U49A 4XLEA 1O8JA 1O8HA 1PXZA 4U4BA 2NTPA 3EQNA 5AMVA 4OZYA 2EWEA 4XQFA 1EE6A 1IA5A 3GQAA 4XLHA 4W8TA 2NTQA 4MXNA 4W8RA 1K5CA 4XKWA 1AIRA 1PE9A 2QY1A 1HG8A 2INVA 3VSTA 4YZXA 1QJVA 2PECA 1BN8A 2BSPA 4Z03A 3FY3A 4XOTA 4XL9A 1GQ8A 2X6YA 3ZSCA 4XN0A 4YEJA 1XG2A 3EQOA 4NK8A 3B90A 1X0CA 4YZAA 1O8DA 3VSVA 1O8LA 2X85A 4OJLA 3JURA 2IQ7A 1O8MA 2O17A 1H80A 4XR6A 4OJ6A 2NT6A 4XOPA 4AVZA 4URRA 4PMHA 4YELA 2NTBA 3KRGA 4I84A 4OZZA 3SUCA 1OFMA 1RWRA 1QCXA 4YZQA 1BHEA 3B8YA 1DBGA 2VBMA 1OGOX 2O0VA 4XMYA 2X6WA 1IDJA 3ZPPA 1IB4A 4OJOA 1DBOA 4C2LA 2O04A 3B4NA 1O8EA 2Z8GA 2INUA 5C1EA 3VMVA 2QX3A 2VJJA 4XKVA 1KCDA 3T9GA 2X3HA 3GQ7A 2ODLA 4XONA 2VBKA 1KTWA 4Z06A 2X6XA 1JTAA 1O8IA 1NHCA 2VJIA 4XORA 3LMWA 1OFLA 1O8GA 1VBLA 2NSPA 1O8FA 4HWVA 1RU4A 4MR0A
chains in the Genus database with same CATH superfamily
2UVFA 1QA2A 3GQ9A 2XC1A 3GQ8A 2NT9A 4NK6A 1PLUA 2W7ZA 4EW9A 1O8KA 2QZAA 4YZ0A 4W8SA 4XM3A 3SQVA 1KCCA 1EZGA 3H09A 1L1IA 1RMGA 3VMWA 4XN3A 2O1DA 2PYHA 2VBEA 2VFQA 5JMCB 2UVEA 1IDKA 2QXZA 3N6ZA 2VFMA 4OM9A 4Z05A 3PETA 4XLAA 5C1CA 1CZFA 3GRHA 1OGMX 1JRGA 1O88A 1WMRA 2NZMA 4OJPA 4XNFA 1OFDA 3VSUA 2O0WA 4W8QA 4OJ5A 3UW0A 1OOCA 2PYGA 4XLCA 2NSTA 4XLFA 3WWGA 4U49A 4XLEA 1O8JA 1O8HA 1PXZA 4U4BA 2NTPA 3EQNA 5AMVA 1QA1A 1TYWA 2V5IA 4OZYA 3SYJA 2EWEA 4XQFA 1EE6A 3TH0A 3GQAA 1IA5A 4XLHA 4W8TA 4YCQA 2NTQA 4MXNA 1LLWA 4W8RA 1K5CA 4XKWA 1AIRA 1PE9A 2QY1A 1HG8A 2INVA 3VSTA 4YZXA 1QJVA 2PECA 4JRAC 1KQ5A 3RIQA 1BN8A 1CLWA 1QQ1A 3JX8A 2BSPA 4Z03A 1DABA 2YUHA 3FY3A 1LLZA 4XOTA 4XL9A 1GQ8A 3ML3A 2F3LA 2X6YA 4XN0A 3ZSCA 2B0RA 4YEJA 1XG2A 3EQOA 4NK8A 3B90A 1X0CA 2QYUA 4OPWA 2J8KA 1TYXA 4YZAA 1O8DA 3VSVA 1O8LA 1TYUA 2X85A 4OJLA 2XT4A 3JURA 3LYCA 3SZEA 2VFOA 2IQ7A 1O8MA 2O17A 1H80A 3LJYA 4XR6A 4OJ6A 1QRBA 2NT6A 4XOPA 4URRA 4AVZA 1QA3A 4PMHA 2XTYA 4YELA 2NTBA 1OFEA 4V02C 3KRGA 2VFPA 4I84A 3SY2A 4OZZA 3SUCA 1OFMA 1RWRA 1QCXA 2XT2A 1WXRA 4YZQA 3BH7B 1BHEA 3B8YA 1DBGA 2O6WA 4YC5A 1OGOX 2O0VA 2VBMA 2BM6A 2BM5A 4XMYA 2X6WA 3AK5A 2IOUG 1IDJA 3ZPPA 1IB4A 4OJOA 1DBOA 3NB2A 4C2LA 2BM7A 2O04A 3B4NA 1O8EA 2Z8GA 3NAWA 1QRCA 2INUA 3BH6B 1LM1A 2J8IA 5C1EA 3VMVA 2QX3A 2VJJA 2XTWA 2G0YA 4KH3A 4XKVA 1KCDA 1TSPA 1HF2A 3T9GA 3N90A 1K8FA 2X3HA 3GQ7A 2ODLA 4XONA 1K4ZA 1KTWA 2VBKA 3P4GA 4Z06A 2X6XA 1JTAA 1O8IA 3PSSA 1NHCA 2VFNA 2VJIA 4XORA 3LMWA 1OFLA 2BX6A 3PSZA 4YFOA 5DNSA 1EA0A 1O8GA 1TYVA 2BM4A 5JLVC 1VBLA 2XTXA 2NSPA 4YDTA 1O8FA 3DU1X 4HWVA 4YEIA 1RU4A 4MR0A
chains in the Genus database with same CATH topology
2UVFA 3GQ9A 4EW9A 3GQ8A 2NT9A 4NK6A 1PLUA 1O8KA 4YZ0A 4W8SA 4XM3A 1KCCA 1RMGA 3VMWA 4XN3A 2O1DA 2PYHA 2VBEA 2UVEA 1IDKA 2QXZA 4Z05A 4XLAA 5C1CA 1CZFA 3GRHA 1OGMX 1JRGA 1O88A 1WMRA 2NZMA 4OJPA 4XNFA 3VSUA 2O0WA 4W8QA 4OJ5A 3UW0A 1OOCA 2PYGA 4XLCA 2NSTA 4XLFA 3WWGA 4U49A 4XLEA 1O8JA 1O8HA 1PXZA 4U4BA 2NTPA 3EQNA 5AMVA 4OZYA 2EWEA 4XQFA 1EE6A 1IA5A 3GQAA 4XLHA 4W8TA 2NTQA 4MXNA 4W8RA 1K5CA 4XKWA 1AIRA 1PE9A 2QY1A 1HG8A 2INVA 3VSTA 4YZXA 1QJVA 2PECA 1BN8A 2BSPA 4Z03A 3FY3A 4XOTA 4XL9A 1GQ8A 2X6YA 3ZSCA 4XN0A 4YEJA 1XG2A 3EQOA 4NK8A 3B90A 1X0CA 4YZAA 1O8DA 3VSVA 1O8LA 2X85A 4OJLA 3JURA 2IQ7A 1O8MA 2O17A 1H80A 4XR6A 4OJ6A 2NT6A 4XOPA 4AVZA 4URRA 4PMHA 4YELA 2NTBA 3KRGA 4I84A 4OZZA 3SUCA 1OFMA 1RWRA 1QCXA 4YZQA 1BHEA 3B8YA 1DBGA 2VBMA 1OGOX 2O0VA 4XMYA 2X6WA 1IDJA 3ZPPA 1IB4A 4OJOA 1DBOA 4C2LA 2O04A 3B4NA 1O8EA 2Z8GA 2INUA 5C1EA 3VMVA 2QX3A 2VJJA 4XKVA 1KCDA 3T9GA 2X3HA 3GQ7A 2ODLA 4XONA 2VBKA 1KTWA 4Z06A 2X6XA 1JTAA 1O8IA 1NHCA 2VJIA 4XORA 3LMWA 1OFLA 1O8GA 1VBLA 2NSPA 1O8FA 4HWVA 1RU4A 4MR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVF A;  3GQ9 A;  4EW9 A;  3GQ8 A;  2NT9 A;  4NK6 A;  1PLU A;  1O8K A;  4YZ0 A;  4W8S A;  4XM3 A;  1KCC A;  1RMG A;  3VMW A;  4XN3 A;  2O1D A;  2PYH A;  2VBE A;  2UVE A;  1IDK A;  2QXZ A;  4Z05 A;  4XLA A;  5C1C A;  1CZF A;  3GRH A;  1OGM X;  1JRG A;  1O88 A;  1WMR A;  2NZM A;  4OJP A;  4XNF A;  3VSU A;  2O0W A;  4W8Q A;  4OJ5 A;  3UW0 A;  1OOC A;  2PYG A;  4XLC A;  2NST A;  4XLF A;  3WWG A;  4U49 A;  4XLE A;  1O8J A;  1O8H A;  1PXZ A;  4U4B A;  2NTP A;  3EQN A;  5AMV A;  4OZY A;  2EWE A;  4XQF A;  1EE6 A;  1IA5 A;  3GQA A;  4XLH A;  4W8T A;  2NTQ A;  4MXN A;  4W8R A;  1K5C A;  4XKW A;  1AIR A;  1PE9 A;  2QY1 A;  1HG8 A;  2INV A;  3VST A;  4YZX A;  1QJV A;  2PEC A;  1BN8 A;  2BSP A;  4Z03 A;  3FY3 A;  4XOT A;  4XL9 A;  1GQ8 A;  2X6Y A;  3ZSC A;  4XN0 A;  4YEJ A;  1XG2 A;  3EQO A;  4NK8 A;  3B90 A;  1X0C A;  4YZA A;  1O8D A;  3VSV A;  1O8L A;  2X85 A;  4OJL A;  3JUR A;  2IQ7 A;  1O8M A;  2O17 A;  1H80 A;  4XR6 A;  4OJ6 A;  2NT6 A;  4XOP A;  4AVZ A;  4URR A;  4PMH A;  4YEL A;  2NTB A;  3KRG A;  4I84 A;  4OZZ A;  3SUC A;  1OFM A;  1RWR A;  1QCX A;  4YZQ A;  1BHE A;  3B8Y A;  1DBG A;  2VBM A;  1OGO X;  2O0V A;  4XMY A;  2X6W A;  1IDJ A;  3ZPP A;  1IB4 A;  4OJO A;  1DBO A;  4C2L A;  2O04 A;  3B4N A;  1O8E A;  2Z8G A;  2INU A;  5C1E A;  3VMV A;  2QX3 A;  2VJJ A;  4XKV A;  1KCD A;  3T9G A;  2X3H A;  3GQ7 A;  2ODL A;  4XON A;  2VBK A;  1KTW A;  4Z06 A;  2X6X A;  1JTA A;  1O8I A;  1NHC A;  2VJI A;  4XOR A;  3LMW A;  1OFL A;  1O8G A;  1VBL A;  2NSP A;  1O8F A;  4HWV A;  1RU4 A;  4MR0 A; 
#chains in the Genus database with same CATH topology
 2UVF A;  1QA2 A;  3GQ9 A;  2XC1 A;  3GQ8 A;  2NT9 A;  4NK6 A;  1PLU A;  2W7Z A;  4EW9 A;  1O8K A;  2QZA A;  4YZ0 A;  4W8S A;  4XM3 A;  3SQV A;  1KCC A;  1EZG A;  3H09 A;  1L1I A;  1RMG A;  3VMW A;  4XN3 A;  2O1D A;  2PYH A;  2VBE A;  2VFQ A;  5JMC B;  2UVE A;  1IDK A;  2QXZ A;  3N6Z A;  2VFM A;  4OM9 A;  4Z05 A;  3PET A;  4XLA A;  5C1C A;  1CZF A;  3GRH A;  1OGM X;  1JRG A;  1O88 A;  1WMR A;  2NZM A;  4OJP A;  4XNF A;  1OFD A;  3VSU A;  2O0W A;  4W8Q A;  4OJ5 A;  3UW0 A;  1OOC A;  2PYG A;  4XLC A;  2NST A;  4XLF A;  3WWG A;  4U49 A;  4XLE A;  1O8J A;  1O8H A;  1PXZ A;  4U4B A;  2NTP A;  3EQN A;  5AMV A;  1QA1 A;  1TYW A;  2V5I A;  4OZY A;  3SYJ A;  2EWE A;  4XQF A;  1EE6 A;  3TH0 A;  3GQA A;  1IA5 A;  4XLH A;  4W8T A;  4YCQ A;  2NTQ A;  4MXN A;  1LLW A;  4W8R A;  1K5C A;  4XKW A;  1AIR A;  1PE9 A;  2QY1 A;  1HG8 A;  2INV A;  3VST A;  4YZX A;  1QJV A;  2PEC A;  4JRA C;  1KQ5 A;  3RIQ A;  1BN8 A;  1CLW A;  1QQ1 A;  3JX8 A;  2BSP A;  4Z03 A;  1DAB A;  2YUH A;  3FY3 A;  1LLZ A;  4XOT A;  4XL9 A;  1GQ8 A;  3ML3 A;  2F3L A;  2X6Y A;  4XN0 A;  3ZSC A;  2B0R A;  4YEJ A;  1XG2 A;  3EQO A;  4NK8 A;  3B90 A;  1X0C A;  2QYU A;  4OPW A;  2J8K A;  1TYX A;  4YZA A;  1O8D A;  3VSV A;  1O8L A;  1TYU A;  2X85 A;  4OJL A;  2XT4 A;  3JUR A;  3LYC A;  3SZE A;  2VFO A;  2IQ7 A;  1O8M A;  2O17 A;  1H80 A;  3LJY A;  4XR6 A;  4OJ6 A;  1QRB A;  2NT6 A;  4XOP A;  4URR A;  4AVZ A;  1QA3 A;  4PMH A;  2XTY A;  4YEL A;  2NTB A;  1OFE A;  4V02 C;  3KRG A;  2VFP A;  4I84 A;  3SY2 A;  4OZZ A;  3SUC A;  1OFM A;  1RWR A;  1QCX A;  2XT2 A;  1WXR A;  4YZQ A;  3BH7 B;  1BHE A;  3B8Y A;  1DBG A;  2O6W A;  4YC5 A;  1OGO X;  2O0V A;  2VBM A;  2BM6 A;  2BM5 A;  4XMY A;  2X6W A;  3AK5 A;  2IOU G;  1IDJ A;  3ZPP A;  1IB4 A;  4OJO A;  1DBO A;  3NB2 A;  4C2L A;  2BM7 A;  2O04 A;  3B4N A;  1O8E A;  2Z8G A;  3NAW A;  1QRC A;  2INU A;  3BH6 B;  1LM1 A;  2J8I A;  5C1E A;  3VMV A;  2QX3 A;  2VJJ A;  2XTW A;  2G0Y A;  4KH3 A;  4XKV A;  1KCD A;  1TSP A;  1HF2 A;  3T9G A;  3N90 A;  1K8F A;  2X3H A;  3GQ7 A;  2ODL A;  4XON A;  1K4Z A;  1KTW A;  2VBK A;  3P4G A;  4Z06 A;  2X6X A;  1JTA A;  1O8I A;  3PSS A;  1NHC A;  2VFN A;  2VJI A;  4XOR A;  3LMW A;  1OFL A;  2BX6 A;  3PSZ A;  4YFO A;  5DNS A;  1EA0 A;  1O8G A;  1TYV A;  2BM4 A;  5JLV C;  1VBL A;  2XTX A;  2NSP A;  4YDT A;  1O8F A;  3DU1 X;  4HWV A;  4YEI A;  1RU4 A;  4MR0 A; 
#chains in the Genus database with same CATH homology
 2UVF A;  3GQ9 A;  4EW9 A;  3GQ8 A;  2NT9 A;  4NK6 A;  1PLU A;  1O8K A;  4YZ0 A;  4W8S A;  4XM3 A;  1KCC A;  1RMG A;  3VMW A;  4XN3 A;  2O1D A;  2PYH A;  2VBE A;  2UVE A;  1IDK A;  2QXZ A;  4Z05 A;  4XLA A;  5C1C A;  1CZF A;  3GRH A;  1OGM X;  1JRG A;  1O88 A;  1WMR A;  2NZM A;  4OJP A;  4XNF A;  3VSU A;  2O0W A;  4W8Q A;  4OJ5 A;  3UW0 A;  1OOC A;  2PYG A;  4XLC A;  2NST A;  4XLF A;  3WWG A;  4U49 A;  4XLE A;  1O8J A;  1O8H A;  1PXZ A;  4U4B A;  2NTP A;  3EQN A;  5AMV A;  4OZY A;  2EWE A;  4XQF A;  1EE6 A;  1IA5 A;  3GQA A;  4XLH A;  4W8T A;  2NTQ A;  4MXN A;  4W8R A;  1K5C A;  4XKW A;  1AIR A;  1PE9 A;  2QY1 A;  1HG8 A;  2INV A;  3VST A;  4YZX A;  1QJV A;  2PEC A;  1BN8 A;  2BSP A;  4Z03 A;  3FY3 A;  4XOT A;  4XL9 A;  1GQ8 A;  2X6Y A;  3ZSC A;  4XN0 A;  4YEJ A;  1XG2 A;  3EQO A;  4NK8 A;  3B90 A;  1X0C A;  4YZA A;  1O8D A;  3VSV A;  1O8L A;  2X85 A;  4OJL A;  3JUR A;  2IQ7 A;  1O8M A;  2O17 A;  1H80 A;  4XR6 A;  4OJ6 A;  2NT6 A;  4XOP A;  4AVZ A;  4URR A;  4PMH A;  4YEL A;  2NTB A;  3KRG A;  4I84 A;  4OZZ A;  3SUC A;  1OFM A;  1RWR A;  1QCX A;  4YZQ A;  1BHE A;  3B8Y A;  1DBG A;  2VBM A;  1OGO X;  2O0V A;  4XMY A;  2X6W A;  1IDJ A;  3ZPP A;  1IB4 A;  4OJO A;  1DBO A;  4C2L A;  2O04 A;  3B4N A;  1O8E A;  2Z8G A;  2INU A;  5C1E A;  3VMV A;  2QX3 A;  2VJJ A;  4XKV A;  1KCD A;  3T9G A;  2X3H A;  3GQ7 A;  2ODL A;  4XON A;  2VBK A;  1KTW A;  4Z06 A;  2X6X A;  1JTA A;  1O8I A;  1NHC A;  2VJI A;  4XOR A;  3LMW A;  1OFL A;  1O8G A;  1VBL A;  2NSP A;  1O8F A;  4HWV A;  1RU4 A;  4MR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...