2INVA

Crystal structure of insulin fructotransferase in the presence of di-fructose
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
399
structure length
399
Chain Sequence
b'PNTYDVTTWRIKAHPEVTAQSDIGAVINDIIADIKQRQTSPDARPGAAIIIPPGDYDLHTQVVVDVSYLTIAGFGHGFFSRSILDNSNPTGWQNLQPGASHIRVLTSPSAPQAFLVKRAGDPRLSGIVFRDFCLDGVGFTPGKNSYHNGKTGIEVASDNDSFHITGMGFVYLEHALIVRGADALRVNDNMIAECGNCVELTGAGQATIVSGNHMGAGPDGVTLLAENHEGLLVTGNNLFPRGRSLIEFTGCNRCSVTSNRLQGFYPGMLRLLNGCKENLITANHIRRTNEGYPPFIGRGNGLDDLYGVVHIAGDNNLISDNLFAYNVPPANIAPAGAQPTQILIAGGDANVVALNHVVSDVASQHVVLDASTTHSKVLDSGTASQITSYSSDTAIRPTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulin Fructotransferase
publication title Structural and functional insights into intramolecular fructosyl transfer by insulin fructotransferase
pubmed doi rcsb
source organism Bacillus sp. snu-7
molecule tags Lyase
total genus 149
structure length 399
sequence length 399
chains with identical sequence B, C
ec nomenclature ec 4.2.2.18: Inulin fructotransferase (DFA-III-forming).
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18835 Beta_helix_2 Beta helix repeat of Inulin fructotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2invA00
2PYGA 2NTBA 3UW0A 1H80A 4XN3A 1EE6A 4XQFA 1O8DA 2X85A 1O88A 3WWGA 1O8JA 4W8SA 2VJIA 2X6YA 3GQ9A 2X6XA 4W8RA 4XLHA 4OJPA 2X6WA 1O8HA 1OFLA 3EQNA 4OJLA 4XOTA 1O8IA 1HG8A 4PMHA 4EW9A 3KRGA 4W8TA 1O8KA 4XORA 4I84A 4XR6A 1O8EA 1PE9A 3FY3A 2O04A 2O1DA 1XG2A 1K5CA 1OGMX 1JRGA 2X3HA 4YZ0A 3B8YA 4XLCA 1RU4A 4Z05A 4XONA 4XLAA 4XN0A 4XLEA 1OFMA 1PXZA 2QX3A 3VSUA 4OZYA 2NZMA 4YELA 2VJJA 2IQ7A 4XM3A 2EWEA 2QXZA 2QY1A 4Z06A 5AMVA 2VBMA 1X0CA 4U49A 1VBLA 3T9GA 4XLFA 1BHEA 4XKWA 4OJOA 4AVZA 1O8GA 4XKVA 4C2LA 2NTPA 4W8QA 3SUCA 1JTAA 4U4BA 1GQ8A 2NTQA 2VBEA 2BSPA 4YZQA 1IA5A 1DBGA 1NHCA 4YZXA 4XOPA 1O8FA 2INUA 3VSVA 2O0WA 1OOCA 4XL9A 2Z8GA 1KCDA 1DBOA 4NK6A 3GQAA 1AIRA 1QCXA 1O8LA 2O0VA 3GQ8A 5C1EA 3VSTA 2UVFA 3LMWA 1RMGA 2VBKA 2O17A 1O8MA 3B90A 2NT9A 4NK8A 4XMYA 1KTWA 1RWRA 1IDJA 1BN8A 3JURA 2NSTA 4YEJA 4Z03A 2NSPA 2PECA 4OJ6A 5C1CA 4MXNA 2NT6A 4OZZA 4XNFA 1IB4A 1WMRA 4OJ5A 4URRA 3EQOA 1PLUA 1QJVA 3GQ7A 3ZPPA 1OGOX 4MR0A 4YZAA 2PYHA 1CZFA 2ODLA 2UVEA 3ZSCA 3GRHA 3VMVA 3VMWA 2INVA 1IDKA 3B4NA 1KCCA 4HWVA
chains in the Genus database with same CATH superfamily
2PYGA 2NTBA 2VFNA 3UW0A 1H80A 4XN3A 3LYCA 1EE6A 4XQFA 1O8DA 3N6ZA 1QA3A 2X85A 2QZAA 3SQVA 1O88A 1L1IA 1EA0A 3WWGA 1O8JA 4W8SA 2VJIA 2X6YA 1WXRA 3GQ9A 1TSPA 2X6XA 4W8RA 4XLHA 2J8KA 5JLVC 4OJPA 2X6WA 1O8HA 1OFLA 3EQNA 4OJLA 4XOTA 1O8IA 1HG8A 4PMHA 2BM4A 2XTYA 4EW9A 3KRGA 4W8TA 1O8KA 2VFPA 1LM1A 1DABA 3P4GA 4XORA 4I84A 4XR6A 1O8EA 3AK5A 4YEIA 1PE9A 3BH7B 3FY3A 2O04A 2O1DA 3NB2A 1XG2A 1K5CA 1QRCA 1OGMX 1JRGA 2X3HA 4YZ0A 2IOUG 3B8YA 4XLCA 1RU4A 4Z05A 4OPWA 1K8FA 2W7ZA 4XONA 4XLAA 4XN0A 4XLEA 4YFOA 1OFMA 1PXZA 2QX3A 1KQ5A 3VSUA 4OZYA 2NZMA 3JX8A 3N90A 4YELA 2VJJA 2VFOA 2IQ7A 4XM3A 3LJYA 1TYWA 3TH0A 2EWEA 3PSZA 1TYUA 2QXZA 2QY1A 4Z06A 5AMVA 2VBMA 1X0CA 2BX6A 3H09A 4U49A 1VBLA 3T9GA 4XLFA 1BHEA 1LLWA 4YCQA 4XKWA 2J8IA 4OJOA 3RIQA 4AVZA 1O8GA 4XKVA 4C2LA 2NTPA 4W8QA 3SUCA 2QYUA 1OFDA 3PSSA 5JMCB 1JTAA 4U4BA 1GQ8A 2NTQA 2VBEA 4V02C 2BSPA 4YZQA 1CLWA 2F3LA 1IA5A 1DBGA 1TYXA 1QA1A 1NHCA 4YZXA 4XOPA 5DNSA 1O8FA 2INUA 3VSVA 2O0WA 1OOCA 4XL9A 2Z8GA 1QQ1A 1KCDA 1DBOA 2XT2A 2YUHA 2BM5A 4NK6A 1K4ZA 3GQAA 1AIRA 1QCXA 1O8LA 2O0VA 3GQ8A 5C1EA 3VSTA 4JRAC 2V5IA 1TYVA 2UVFA 2BM6A 3LMWA 4OM9A 3SZEA 1RMGA 2VFQA 4KH3A 2VBKA 2O17A 1O8MA 3B90A 4YDTA 2NT9A 4NK8A 3BH6B 3SY2A 4XMYA 1KTWA 1RWRA 3NAWA 1IDJA 1BN8A 2XC1A 2NSTA 2XT4A 3JURA 4YEJA 4Z03A 2NSPA 2XTWA 4YC5A 3ML3A 2PECA 4OJ6A 5C1CA 2B0RA 2XTXA 4MXNA 1HF2A 2NT6A 4OZZA 4XNFA 1IB4A 1WMRA 1EZGA 2VFMA 4OJ5A 4URRA 1QRBA 3EQOA 2BM7A 1PLUA 1QJVA 2O6WA 3GQ7A 3SYJA 3ZPPA 1OGOX 4MR0A 4YZAA 1QA2A 2PYHA 3PETA 1CZFA 2ODLA 2UVEA 1LLZA 2G0YA 3GRHA 3VMVA 3VMWA 3DU1X 3ZSCA 2INVA 1IDKA 3B4NA 1KCCA 1OFEA 4HWVA
chains in the Genus database with same CATH topology
2PYGA 2NTBA 3UW0A 1H80A 4XN3A 1EE6A 4XQFA 1O8DA 2X85A 1O88A 3WWGA 1O8JA 4W8SA 2VJIA 2X6YA 3GQ9A 2X6XA 4W8RA 4XLHA 4OJPA 2X6WA 1O8HA 1OFLA 3EQNA 4OJLA 4XOTA 1O8IA 1HG8A 4PMHA 4EW9A 3KRGA 4W8TA 1O8KA 4XORA 4I84A 4XR6A 1O8EA 1PE9A 3FY3A 2O04A 2O1DA 1XG2A 1K5CA 1OGMX 1JRGA 2X3HA 4YZ0A 3B8YA 4XLCA 1RU4A 4Z05A 4XONA 4XLAA 4XN0A 4XLEA 1OFMA 1PXZA 2QX3A 3VSUA 4OZYA 2NZMA 4YELA 2VJJA 2IQ7A 4XM3A 2EWEA 2QXZA 2QY1A 4Z06A 5AMVA 2VBMA 1X0CA 4U49A 1VBLA 3T9GA 4XLFA 1BHEA 4XKWA 4OJOA 4AVZA 1O8GA 4XKVA 4C2LA 2NTPA 4W8QA 3SUCA 1JTAA 4U4BA 1GQ8A 2NTQA 2VBEA 2BSPA 4YZQA 1IA5A 1DBGA 1NHCA 4YZXA 4XOPA 1O8FA 2INUA 3VSVA 2O0WA 1OOCA 4XL9A 2Z8GA 1KCDA 1DBOA 4NK6A 3GQAA 1AIRA 1QCXA 1O8LA 2O0VA 3GQ8A 5C1EA 3VSTA 2UVFA 3LMWA 1RMGA 2VBKA 2O17A 1O8MA 3B90A 2NT9A 4NK8A 4XMYA 1KTWA 1RWRA 1IDJA 1BN8A 3JURA 2NSTA 4YEJA 4Z03A 2NSPA 2PECA 4OJ6A 5C1CA 4MXNA 2NT6A 4OZZA 4XNFA 1IB4A 1WMRA 4OJ5A 4URRA 3EQOA 1PLUA 1QJVA 3GQ7A 3ZPPA 1OGOX 4MR0A 4YZAA 2PYHA 1CZFA 2ODLA 2UVEA 3ZSCA 3GRHA 3VMVA 3VMWA 2INVA 1IDKA 3B4NA 1KCCA 4HWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYG A;  2NTB A;  3UW0 A;  1H80 A;  4XN3 A;  1EE6 A;  4XQF A;  1O8D A;  2X85 A;  1O88 A;  3WWG A;  1O8J A;  4W8S A;  2VJI A;  2X6Y A;  3GQ9 A;  2X6X A;  4W8R A;  4XLH A;  4OJP A;  2X6W A;  1O8H A;  1OFL A;  3EQN A;  4OJL A;  4XOT A;  1O8I A;  1HG8 A;  4PMH A;  4EW9 A;  3KRG A;  4W8T A;  1O8K A;  4XOR A;  4I84 A;  4XR6 A;  1O8E A;  1PE9 A;  3FY3 A;  2O04 A;  2O1D A;  1XG2 A;  1K5C A;  1OGM X;  1JRG A;  2X3H A;  4YZ0 A;  3B8Y A;  4XLC A;  1RU4 A;  4Z05 A;  4XON A;  4XLA A;  4XN0 A;  4XLE A;  1OFM A;  1PXZ A;  2QX3 A;  3VSU A;  4OZY A;  2NZM A;  4YEL A;  2VJJ A;  2IQ7 A;  4XM3 A;  2EWE A;  2QXZ A;  2QY1 A;  4Z06 A;  5AMV A;  2VBM A;  1X0C A;  4U49 A;  1VBL A;  3T9G A;  4XLF A;  1BHE A;  4XKW A;  4OJO A;  4AVZ A;  1O8G A;  4XKV A;  4C2L A;  2NTP A;  4W8Q A;  3SUC A;  1JTA A;  4U4B A;  1GQ8 A;  2NTQ A;  2VBE A;  2BSP A;  4YZQ A;  1IA5 A;  1DBG A;  1NHC A;  4YZX A;  4XOP A;  1O8F A;  2INU A;  3VSV A;  2O0W A;  1OOC A;  4XL9 A;  2Z8G A;  1KCD A;  1DBO A;  4NK6 A;  3GQA A;  1AIR A;  1QCX A;  1O8L A;  2O0V A;  3GQ8 A;  5C1E A;  3VST A;  2UVF A;  3LMW A;  1RMG A;  2VBK A;  2O17 A;  1O8M A;  3B90 A;  2NT9 A;  4NK8 A;  4XMY A;  1KTW A;  1RWR A;  1IDJ A;  1BN8 A;  3JUR A;  2NST A;  4YEJ A;  4Z03 A;  2NSP A;  2PEC A;  4OJ6 A;  5C1C A;  4MXN A;  2NT6 A;  4OZZ A;  4XNF A;  1IB4 A;  1WMR A;  4OJ5 A;  4URR A;  3EQO A;  1PLU A;  1QJV A;  3GQ7 A;  3ZPP A;  1OGO X;  4MR0 A;  4YZA A;  2PYH A;  1CZF A;  2ODL A;  2UVE A;  3ZSC A;  3GRH A;  3VMV A;  3VMW A;  2INV A;  1IDK A;  3B4N A;  1KCC A;  4HWV A; 
#chains in the Genus database with same CATH topology
 2PYG A;  2NTB A;  2VFN A;  3UW0 A;  1H80 A;  4XN3 A;  3LYC A;  1EE6 A;  4XQF A;  1O8D A;  3N6Z A;  1QA3 A;  2X85 A;  2QZA A;  3SQV A;  1O88 A;  1L1I A;  1EA0 A;  3WWG A;  1O8J A;  4W8S A;  2VJI A;  2X6Y A;  1WXR A;  3GQ9 A;  1TSP A;  2X6X A;  4W8R A;  4XLH A;  2J8K A;  5JLV C;  4OJP A;  2X6W A;  1O8H A;  1OFL A;  3EQN A;  4OJL A;  4XOT A;  1O8I A;  1HG8 A;  4PMH A;  2BM4 A;  2XTY A;  4EW9 A;  3KRG A;  4W8T A;  1O8K A;  2VFP A;  1LM1 A;  1DAB A;  3P4G A;  4XOR A;  4I84 A;  4XR6 A;  1O8E A;  3AK5 A;  4YEI A;  1PE9 A;  3BH7 B;  3FY3 A;  2O04 A;  2O1D A;  3NB2 A;  1XG2 A;  1K5C A;  1QRC A;  1OGM X;  1JRG A;  2X3H A;  4YZ0 A;  2IOU G;  3B8Y A;  4XLC A;  1RU4 A;  4Z05 A;  4OPW A;  1K8F A;  2W7Z A;  4XON A;  4XLA A;  4XN0 A;  4XLE A;  4YFO A;  1OFM A;  1PXZ A;  2QX3 A;  1KQ5 A;  3VSU A;  4OZY A;  2NZM A;  3JX8 A;  3N90 A;  4YEL A;  2VJJ A;  2VFO A;  2IQ7 A;  4XM3 A;  3LJY A;  1TYW A;  3TH0 A;  2EWE A;  3PSZ A;  1TYU A;  2QXZ A;  2QY1 A;  4Z06 A;  5AMV A;  2VBM A;  1X0C A;  2BX6 A;  3H09 A;  4U49 A;  1VBL A;  3T9G A;  4XLF A;  1BHE A;  1LLW A;  4YCQ A;  4XKW A;  2J8I A;  4OJO A;  3RIQ A;  4AVZ A;  1O8G A;  4XKV A;  4C2L A;  2NTP A;  4W8Q A;  3SUC A;  2QYU A;  1OFD A;  3PSS A;  5JMC B;  1JTA A;  4U4B A;  1GQ8 A;  2NTQ A;  2VBE A;  4V02 C;  2BSP A;  4YZQ A;  1CLW A;  2F3L A;  1IA5 A;  1DBG A;  1TYX A;  1QA1 A;  1NHC A;  4YZX A;  4XOP A;  5DNS A;  1O8F A;  2INU A;  3VSV A;  2O0W A;  1OOC A;  4XL9 A;  2Z8G A;  1QQ1 A;  1KCD A;  1DBO A;  2XT2 A;  2YUH A;  2BM5 A;  4NK6 A;  1K4Z A;  3GQA A;  1AIR A;  1QCX A;  1O8L A;  2O0V A;  3GQ8 A;  5C1E A;  3VST A;  4JRA C;  2V5I A;  1TYV A;  2UVF A;  2BM6 A;  3LMW A;  4OM9 A;  3SZE A;  1RMG A;  2VFQ A;  4KH3 A;  2VBK A;  2O17 A;  1O8M A;  3B90 A;  4YDT A;  2NT9 A;  4NK8 A;  3BH6 B;  3SY2 A;  4XMY A;  1KTW A;  1RWR A;  3NAW A;  1IDJ A;  1BN8 A;  2XC1 A;  2NST A;  2XT4 A;  3JUR A;  4YEJ A;  4Z03 A;  2NSP A;  2XTW A;  4YC5 A;  3ML3 A;  2PEC A;  4OJ6 A;  5C1C A;  2B0R A;  2XTX A;  4MXN A;  1HF2 A;  2NT6 A;  4OZZ A;  4XNF A;  1IB4 A;  1WMR A;  1EZG A;  2VFM A;  4OJ5 A;  4URR A;  1QRB A;  3EQO A;  2BM7 A;  1PLU A;  1QJV A;  2O6W A;  3GQ7 A;  3SYJ A;  3ZPP A;  1OGO X;  4MR0 A;  4YZA A;  1QA2 A;  2PYH A;  3PET A;  1CZF A;  2ODL A;  2UVE A;  1LLZ A;  2G0Y A;  3GRH A;  3VMV A;  3VMW A;  3DU1 X;  3ZSC A;  2INV A;  1IDK A;  3B4N A;  1KCC A;  1OFE A;  4HWV A; 
#chains in the Genus database with same CATH homology
 2PYG A;  2NTB A;  3UW0 A;  1H80 A;  4XN3 A;  1EE6 A;  4XQF A;  1O8D A;  2X85 A;  1O88 A;  3WWG A;  1O8J A;  4W8S A;  2VJI A;  2X6Y A;  3GQ9 A;  2X6X A;  4W8R A;  4XLH A;  4OJP A;  2X6W A;  1O8H A;  1OFL A;  3EQN A;  4OJL A;  4XOT A;  1O8I A;  1HG8 A;  4PMH A;  4EW9 A;  3KRG A;  4W8T A;  1O8K A;  4XOR A;  4I84 A;  4XR6 A;  1O8E A;  1PE9 A;  3FY3 A;  2O04 A;  2O1D A;  1XG2 A;  1K5C A;  1OGM X;  1JRG A;  2X3H A;  4YZ0 A;  3B8Y A;  4XLC A;  1RU4 A;  4Z05 A;  4XON A;  4XLA A;  4XN0 A;  4XLE A;  1OFM A;  1PXZ A;  2QX3 A;  3VSU A;  4OZY A;  2NZM A;  4YEL A;  2VJJ A;  2IQ7 A;  4XM3 A;  2EWE A;  2QXZ A;  2QY1 A;  4Z06 A;  5AMV A;  2VBM A;  1X0C A;  4U49 A;  1VBL A;  3T9G A;  4XLF A;  1BHE A;  4XKW A;  4OJO A;  4AVZ A;  1O8G A;  4XKV A;  4C2L A;  2NTP A;  4W8Q A;  3SUC A;  1JTA A;  4U4B A;  1GQ8 A;  2NTQ A;  2VBE A;  2BSP A;  4YZQ A;  1IA5 A;  1DBG A;  1NHC A;  4YZX A;  4XOP A;  1O8F A;  2INU A;  3VSV A;  2O0W A;  1OOC A;  4XL9 A;  2Z8G A;  1KCD A;  1DBO A;  4NK6 A;  3GQA A;  1AIR A;  1QCX A;  1O8L A;  2O0V A;  3GQ8 A;  5C1E A;  3VST A;  2UVF A;  3LMW A;  1RMG A;  2VBK A;  2O17 A;  1O8M A;  3B90 A;  2NT9 A;  4NK8 A;  4XMY A;  1KTW A;  1RWR A;  1IDJ A;  1BN8 A;  3JUR A;  2NST A;  4YEJ A;  4Z03 A;  2NSP A;  2PEC A;  4OJ6 A;  5C1C A;  4MXN A;  2NT6 A;  4OZZ A;  4XNF A;  1IB4 A;  1WMR A;  4OJ5 A;  4URR A;  3EQO A;  1PLU A;  1QJV A;  3GQ7 A;  3ZPP A;  1OGO X;  4MR0 A;  4YZA A;  2PYH A;  1CZF A;  2ODL A;  2UVE A;  3ZSC A;  3GRH A;  3VMV A;  3VMW A;  2INV A;  1IDK A;  3B4N A;  1KCC A;  4HWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...