2XTXA

Structure of qnrb1 (m102r-trypsin treated), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
216
structure length
207
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFRCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords QNRB1
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 83
structure length 207
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtxA00
2J8KA 3SQVA 4YCQA 4YFOA 5DNSA 3SY2A 2XTYA 4YEIA 3NB2A 3PSSA 2XT4A 2XT2A 3NAWA 3PSZA 4YDTA 2XTXA 2O6WA 4YC5A 2QYUA 3DU1X 2XTWA 2QZAA
chains in the Genus database with same CATH superfamily
2O1DA 4OZYA 5C1CA 1OGMX 1JTAA 2ODLA 3SZEA 1O8GA 1LLZA 4XNFA 4YZXA 4W8SA 3SY2A 4HWVA 3T9GA 1TSPA 4AVZA 3WWGA 1O8MA 2VJJA 2X3HA 1OFMA 2VFMA 1OFEA 2O17A 2INUA 2Z8GA 4PMHA 1O8KA 3VSTA 4XLCA 4XQFA 4XR6A 4YDTA 1TYXA 1DABA 3GRHA 1L1IA 1EA0A 4XM3A 2NZMA 3BH7B 3DU1X 1AIRA 2PECA 3EQOA 4XORA 2XC1A 1O8FA 2QY1A 1O8HA 2X6XA 5AMVA 2V5IA 1CZFA 1TYWA 1IB4A 2QXZA 2BSPA 1NHCA 2VBMA 3GQ9A 1OGOX 1GQ8A 1O8IA 1PE9A 5C1EA 2X6WA 3JURA 3ML3A 4URRA 3PETA 1QA2A 1XG2A 1OFDA 3EQNA 1VBLA 2VBKA 2NTQA 3NB2A 2IQ7A 4OJ6A 1LM1A 1OOCA 3LYCA 3GQAA 3NAWA 1K4ZA 2W7ZA 1QJVA 3P4GA 1H80A 1RWRA 4KH3A 4OJOA 1KTWA 4XL9A 4XN0A 3GQ8A 1PXZA 3B90A 1BN8A 4XONA 2BM7A 1K8FA 2QYUA 3LMWA 1HG8A 1O8JA 2BM6A 1HF2A 2UVEA 3ZPPA 4V02C 4OPWA 3ZSCA 4U49A 1IDKA 2XTWA 2BM5A 1DBGA 1X0CA 2UVFA 1WMRA 1KCCA 2INVA 2VFQA 3RIQA 4W8RA 4YZ0A 2BM4A 4XLFA 3AK5A 2VFPA 1RU4A 4XOPA 4YELA 2YUHA 4YCQA 4NK6A 3KRGA 4EW9A 2PYHA 3JX8A 4OM9A 4XOTA 1O8DA 1KQ5A 2NSTA 3BH6B 4YEIA 3PSSA 3VSVA 4OJPA 1QRBA 2O0WA 4XN3A 3N90A 1TYVA 3PSZA 3LJYA 4I84A 4OJ5A 1WXRA 2QX3A 1LLWA 2G0YA 1QA1A 1O8EA 1O8LA 4NK8A 1OFLA 4YZAA 4XLHA 2IOUG 2NT9A 2X85A 4XKVA 3VMWA 1EZGA 1TYUA 4U4BA 1JRGA 2VFOA 4W8QA 2O0VA 1CLWA 2QZAA 3B8YA 4MXNA 4XMYA 1DBOA 2J8KA 4Z05A 4JRAC 5JMCB 3SYJA 4C2LA 2VBEA 3SQVA 2X6YA 2O04A 1IDJA 4YFOA 3SUCA 5DNSA 1KCDA 2NSPA 2XTYA 1RMGA 2NT6A 1K5CA 3GQ7A 3VMVA 2XT4A 2NTBA 2XT2A 1PLUA 2EWEA 4OJLA 1BHEA 4XKWA 3VSUA 4XLEA 3N6ZA 4YZQA 3B4NA 2B0RA 2XTXA 1O88A 4W8TA 4MR0A 3TH0A 5JLVC 2BX6A 2O6WA 2PYGA 4XLAA 1QQ1A 2VFNA 1QRCA 2VJIA 4YC5A 1QA3A 2J8IA 1IA5A 3H09A 2F3LA 3UW0A 1QCXA 4Z03A 4Z06A 4OZZA 2NTPA 1EE6A 4YEJA 3FY3A
chains in the Genus database with same CATH topology
2J8KA 3SQVA 4YCQA 4YFOA 5DNSA 3SY2A 2XTYA 4YEIA 3NB2A 3PSSA 2XT4A 2XT2A 3NAWA 3PSZA 4YDTA 2XTXA 2O6WA 4YC5A 2QYUA 3DU1X 2XTWA 2QZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8K A;  3SQV A;  4YCQ A;  4YFO A;  5DNS A;  3SY2 A;  2XTY A;  4YEI A;  3NB2 A;  3PSS A;  2XT4 A;  2XT2 A;  3NAW A;  3PSZ A;  4YDT A;  2XTX A;  2O6W A;  4YC5 A;  2QYU A;  3DU1 X;  2XTW A;  2QZA A; 
#chains in the Genus database with same CATH topology
 2O1D A;  4OZY A;  5C1C A;  1OGM X;  1JTA A;  2ODL A;  3SZE A;  1O8G A;  1LLZ A;  4XNF A;  4YZX A;  4W8S A;  3SY2 A;  4HWV A;  3T9G A;  1TSP A;  4AVZ A;  3WWG A;  1O8M A;  2VJJ A;  2X3H A;  1OFM A;  2VFM A;  1OFE A;  2O17 A;  2INU A;  2Z8G A;  4PMH A;  1O8K A;  3VST A;  4XLC A;  4XQF A;  4XR6 A;  4YDT A;  1TYX A;  1DAB A;  3GRH A;  1L1I A;  1EA0 A;  4XM3 A;  2NZM A;  3BH7 B;  3DU1 X;  1AIR A;  2PEC A;  3EQO A;  4XOR A;  2XC1 A;  1O8F A;  2QY1 A;  1O8H A;  2X6X A;  5AMV A;  2V5I A;  1CZF A;  1TYW A;  1IB4 A;  2QXZ A;  2BSP A;  1NHC A;  2VBM A;  3GQ9 A;  1OGO X;  1GQ8 A;  1O8I A;  1PE9 A;  5C1E A;  2X6W A;  3JUR A;  3ML3 A;  4URR A;  3PET A;  1QA2 A;  1XG2 A;  1OFD A;  3EQN A;  1VBL A;  2VBK A;  2NTQ A;  3NB2 A;  2IQ7 A;  4OJ6 A;  1LM1 A;  1OOC A;  3LYC A;  3GQA A;  3NAW A;  1K4Z A;  2W7Z A;  1QJV A;  3P4G A;  1H80 A;  1RWR A;  4KH3 A;  4OJO A;  1KTW A;  4XL9 A;  4XN0 A;  3GQ8 A;  1PXZ A;  3B90 A;  1BN8 A;  4XON A;  2BM7 A;  1K8F A;  2QYU A;  3LMW A;  1HG8 A;  1O8J A;  2BM6 A;  1HF2 A;  2UVE A;  3ZPP A;  4V02 C;  4OPW A;  3ZSC A;  4U49 A;  1IDK A;  2XTW A;  2BM5 A;  1DBG A;  1X0C A;  2UVF A;  1WMR A;  1KCC A;  2INV A;  2VFQ A;  3RIQ A;  4W8R A;  4YZ0 A;  2BM4 A;  4XLF A;  3AK5 A;  2VFP A;  1RU4 A;  4XOP A;  4YEL A;  2YUH A;  4YCQ A;  4NK6 A;  3KRG A;  4EW9 A;  2PYH A;  3JX8 A;  4OM9 A;  4XOT A;  1O8D A;  1KQ5 A;  2NST A;  3BH6 B;  4YEI A;  3PSS A;  3VSV A;  4OJP A;  1QRB A;  2O0W A;  4XN3 A;  3N90 A;  1TYV A;  3PSZ A;  3LJY A;  4I84 A;  4OJ5 A;  1WXR A;  2QX3 A;  1LLW A;  2G0Y A;  1QA1 A;  1O8E A;  1O8L A;  4NK8 A;  1OFL A;  4YZA A;  4XLH A;  2IOU G;  2NT9 A;  2X85 A;  4XKV A;  3VMW A;  1EZG A;  1TYU A;  4U4B A;  1JRG A;  2VFO A;  4W8Q A;  2O0V A;  1CLW A;  2QZA A;  3B8Y A;  4MXN A;  4XMY A;  1DBO A;  2J8K A;  4Z05 A;  4JRA C;  5JMC B;  3SYJ A;  4C2L A;  2VBE A;  3SQV A;  2X6Y A;  2O04 A;  1IDJ A;  4YFO A;  3SUC A;  5DNS A;  1KCD A;  2NSP A;  2XTY A;  1RMG A;  2NT6 A;  1K5C A;  3GQ7 A;  3VMV A;  2XT4 A;  2NTB A;  2XT2 A;  1PLU A;  2EWE A;  4OJL A;  1BHE A;  4XKW A;  3VSU A;  4XLE A;  3N6Z A;  4YZQ A;  3B4N A;  2B0R A;  2XTX A;  1O88 A;  4W8T A;  4MR0 A;  3TH0 A;  5JLV C;  2BX6 A;  2O6W A;  2PYG A;  4XLA A;  1QQ1 A;  2VFN A;  1QRC A;  2VJI A;  4YC5 A;  1QA3 A;  2J8I A;  1IA5 A;  3H09 A;  2F3L A;  3UW0 A;  1QCX A;  4Z03 A;  4Z06 A;  4OZZ A;  2NTP A;  1EE6 A;  4YEJ A;  3FY3 A; 
#chains in the Genus database with same CATH homology
 2J8K A;  3SQV A;  4YCQ A;  4YFO A;  5DNS A;  3SY2 A;  2XTY A;  4YEI A;  3NB2 A;  3PSS A;  2XT4 A;  2XT2 A;  3NAW A;  3PSZ A;  4YDT A;  2XTX A;  2O6W A;  4YC5 A;  2QYU A;  3DU1 X;  2XTW A;  2QZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...