2XTXA

Structure of qnrb1 (m102r-trypsin treated), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
216
structure length
207
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFRCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
molecule keywords QNRB1
total genus 83
structure length 207
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtxA00
4YC5A 4YEIA 4YCQA 2J8KA 2XTXA 3SY2A 2XTYA 3NB2A 5DNSA 2XT2A 3PSZA 2QZAA 3PSSA 3DU1X 4YFOA 2QYUA 4YDTA 2XT4A 3SQVA 2XTWA 3NAWA 2O6WA
chains in the Genus database with same CATH superfamily
4YZ0A 4W8RA 5JLVC 2VFMA 2VFQA 2J8KA 1IDKA 4XMYA 1JTAA 2INVA 4YELA 2NSTA 2XTXA 3SY2A 1O8EA 5JMCB 2BM7A 4XQFA 3UW0A 2VFOA 1OFMA 4XLHA 1OFLA 3NB2A 2UVEA 1LM1A 2XT2A 4C2LA 1XG2A 3FY3A 3VMWA 2NZMA 2BX6A 3B8YA 3N6ZA 1DBGA 2XC1A 4V02C 3BH6B 4NK6A 4W8QA 4U49A 4XN3A 2YUHA 4XLCA 4XORA 2B0RA 3KRGA 4YZQA 3SQVA 1EZGA 2NTBA 2O1DA 5AMVA 5C1CA 1QA3A 2INUA 2VJJA 4OM9A 4W8SA 2O6WA 2VBKA 1O8DA 1LLWA 4YZXA 3GRHA 3GQ8A 4MR0A 4W8TA 4XL9A 1QA2A 1CZFA 4Z03A 2NT6A 2X6YA 1QRCA 1O8GA 1DBOA 4EW9A 3B90A 1TYVA 2QXZA 2NTPA 3SUCA 3H09A 1QA1A 1OGMX 1OGOX 3GQ7A 3JX8A 4OJLA 1L1IA 4OJPA 1PXZA 1O8HA 2O17A 1X0CA 2VBMA 2NT9A 3B4NA 3WWGA 1KTWA 4I84A 1BHEA 2IOUG 3GQ9A 4XNFA 1O8KA 4OJOA 4YDTA 3VMVA 1K5CA 2PYHA 1O8MA 2XTWA 1JRGA 2X6WA 2X6XA 2BSPA 4YC5A 2O04A 2VFPA 3ML3A 4U4BA 1IB4A 1RWRA 4YEIA 1O8IA 1O88A 1TSPA 3BH7B 2VJIA 2BM6A 4XLFA 4XLEA 4YCQA 1TYWA 3SYJA 1WMRA 1QCXA 3LYCA 4XR6A 3VSUA 1BN8A 1PLUA 1TYXA 2F3LA 4KH3A 3SZEA 4AVZA 4XLAA 2QY1A 1TYUA 3VSVA 2ODLA 3PSZA 4JRAC 2QZAA 3PSSA 4OPWA 3DU1X 3T9GA 4XM3A 3TH0A 1HF2A 4XKVA 4HWVA 2V5IA 2PYGA 5C1EA 1WXRA 1DABA 1H80A 3AK5A 2QYUA 2UVFA 4URRA 4Z05A 4OJ5A 4OZYA 4XN0A 1GQ8A 2BM4A 2J8IA 4OZZA 1NHCA 2O0WA 1IDJA 4XOTA 3NAWA 4XONA 1PE9A 3JURA 4YZAA 2Z8GA 2O0VA 3PETA 2W7ZA 1O8JA 2X3HA 3N90A 1OOCA 3LJYA 4NK8A 2VFNA 1O8FA 3VSTA 2NTQA 1VBLA 2VBEA 4OJ6A 2IQ7A 1QJVA 1RMGA 1K4ZA 2XTYA 3LMWA 1AIRA 1KQ5A 2G0YA 1OFEA 3GQAA 1QRBA 5DNSA 1EE6A 3ZSCA 4Z06A 1HG8A 3ZPPA 1IA5A 1CLWA 1RU4A 4XOPA 2QX3A 3EQOA 1LLZA 4MXNA 4XKWA 4YFOA 2PECA 4YEJA 1KCCA 1K8FA 1QQ1A 3P4GA 2NSPA 2X85A 2XT4A 2BM5A 1O8LA 1KCDA 1EA0A 1OFDA 2EWEA 3RIQA 4PMHA 3EQNA
chains in the Genus database with same CATH topology
4YC5A 4YEIA 4YCQA 2J8KA 2XTXA 3SY2A 2XTYA 3NB2A 5DNSA 2XT2A 3PSZA 2QZAA 3PSSA 3DU1X 4YFOA 2QYUA 4YDTA 2XT4A 3SQVA 2XTWA 3NAWA 2O6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YC5 A;  4YEI A;  4YCQ A;  2J8K A;  2XTX A;  3SY2 A;  2XTY A;  3NB2 A;  5DNS A;  2XT2 A;  3PSZ A;  2QZA A;  3PSS A;  3DU1 X;  4YFO A;  2QYU A;  4YDT A;  2XT4 A;  3SQV A;  2XTW A;  3NAW A;  2O6W A; 
#chains in the Genus database with same CATH topology
 4YZ0 A;  4W8R A;  5JLV C;  2VFM A;  2VFQ A;  2J8K A;  1IDK A;  4XMY A;  1JTA A;  2INV A;  4YEL A;  2NST A;  2XTX A;  3SY2 A;  1O8E A;  5JMC B;  2BM7 A;  4XQF A;  3UW0 A;  2VFO A;  1OFM A;  4XLH A;  1OFL A;  3NB2 A;  2UVE A;  1LM1 A;  2XT2 A;  4C2L A;  1XG2 A;  3FY3 A;  3VMW A;  2NZM A;  2BX6 A;  3B8Y A;  3N6Z A;  1DBG A;  2XC1 A;  4V02 C;  3BH6 B;  4NK6 A;  4W8Q A;  4U49 A;  4XN3 A;  2YUH A;  4XLC A;  4XOR A;  2B0R A;  3KRG A;  4YZQ A;  3SQV A;  1EZG A;  2NTB A;  2O1D A;  5AMV A;  5C1C A;  1QA3 A;  2INU A;  2VJJ A;  4OM9 A;  4W8S A;  2O6W A;  2VBK A;  1O8D A;  1LLW A;  4YZX A;  3GRH A;  3GQ8 A;  4MR0 A;  4W8T A;  4XL9 A;  1QA2 A;  1CZF A;  4Z03 A;  2NT6 A;  2X6Y A;  1QRC A;  1O8G A;  1DBO A;  4EW9 A;  3B90 A;  1TYV A;  2QXZ A;  2NTP A;  3SUC A;  3H09 A;  1QA1 A;  1OGM X;  1OGO X;  3GQ7 A;  3JX8 A;  4OJL A;  1L1I A;  4OJP A;  1PXZ A;  1O8H A;  2O17 A;  1X0C A;  2VBM A;  2NT9 A;  3B4N A;  3WWG A;  1KTW A;  4I84 A;  1BHE A;  2IOU G;  3GQ9 A;  4XNF A;  1O8K A;  4OJO A;  4YDT A;  3VMV A;  1K5C A;  2PYH A;  1O8M A;  2XTW A;  1JRG A;  2X6W A;  2X6X A;  2BSP A;  4YC5 A;  2O04 A;  2VFP A;  3ML3 A;  4U4B A;  1IB4 A;  1RWR A;  4YEI A;  1O8I A;  1O88 A;  1TSP A;  3BH7 B;  2VJI A;  2BM6 A;  4XLF A;  4XLE A;  4YCQ A;  1TYW A;  3SYJ A;  1WMR A;  1QCX A;  3LYC A;  4XR6 A;  3VSU A;  1BN8 A;  1PLU A;  1TYX A;  2F3L A;  4KH3 A;  3SZE A;  4AVZ A;  4XLA A;  2QY1 A;  1TYU A;  3VSV A;  2ODL A;  3PSZ A;  4JRA C;  2QZA A;  3PSS A;  4OPW A;  3DU1 X;  3T9G A;  4XM3 A;  3TH0 A;  1HF2 A;  4XKV A;  4HWV A;  2V5I A;  2PYG A;  5C1E A;  1WXR A;  1DAB A;  1H80 A;  3AK5 A;  2QYU A;  2UVF A;  4URR A;  4Z05 A;  4OJ5 A;  4OZY A;  4XN0 A;  1GQ8 A;  2BM4 A;  2J8I A;  4OZZ A;  1NHC A;  2O0W A;  1IDJ A;  4XOT A;  3NAW A;  4XON A;  1PE9 A;  3JUR A;  4YZA A;  2Z8G A;  2O0V A;  3PET A;  2W7Z A;  1O8J A;  2X3H A;  3N90 A;  1OOC A;  3LJY A;  4NK8 A;  2VFN A;  1O8F A;  3VST A;  2NTQ A;  1VBL A;  2VBE A;  4OJ6 A;  2IQ7 A;  1QJV A;  1RMG A;  1K4Z A;  2XTY A;  3LMW A;  1AIR A;  1KQ5 A;  2G0Y A;  1OFE A;  3GQA A;  1QRB A;  5DNS A;  1EE6 A;  3ZSC A;  4Z06 A;  1HG8 A;  3ZPP A;  1IA5 A;  1CLW A;  1RU4 A;  4XOP A;  2QX3 A;  3EQO A;  1LLZ A;  4MXN A;  4XKW A;  4YFO A;  2PEC A;  4YEJ A;  1KCC A;  1K8F A;  1QQ1 A;  3P4G A;  2NSP A;  2X85 A;  2XT4 A;  2BM5 A;  1O8L A;  1KCD A;  1EA0 A;  1OFD A;  2EWE A;  3RIQ A;  4PMH A;  3EQN A; 
#chains in the Genus database with same CATH homology
 4YC5 A;  4YEI A;  4YCQ A;  2J8K A;  2XTX A;  3SY2 A;  2XTY A;  3NB2 A;  5DNS A;  2XT2 A;  3PSZ A;  2QZA A;  3PSS A;  3DU1 X;  4YFO A;  2QYU A;  4YDT A;  2XT4 A;  3SQV A;  2XTW A;  3NAW A;  2O6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...