2XTXA

Structure of qnrb1 (m102r-trypsin treated), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
216
structure length
207
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFRCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QNRB1
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
total genus 83
structure length 207
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtxA00
3SQVA 4YFOA 2J8KA 2O6WA 3DU1X 4YC5A 4YDTA 3PSSA 2XT2A 2XT4A 2QYUA 4YCQA 2XTXA 3NAWA 5DNSA 3PSZA 4YEIA 3NB2A 3SY2A 2XTYA 2XTWA 2QZAA
chains in the Genus database with same CATH superfamily
1BHEA 3SUCA 3SZEA 2QXZA 3FY3A 3VSUA 4NK8A 1LLZA 2O6WA 4U4BA 4YDTA 1LLWA 2EWEA 1QA3A 1AIRA 2VFMA 4JRAC 1QRBA 1TSPA 2F3LA 2VJJA 4XOTA 4EW9A 2XT2A 1O8GA 3B4NA 1RWRA 4AVZA 4YZ0A 1O8HA 1RU4A 2NT6A 4XKWA 4XQFA 2VBEA 4YEJA 1L1IA 4XR6A 4YZXA 1TYVA 3WWGA 1QA1A 3BH6B 1O8LA 2VBMA 4V02C 3UW0A 1O8MA 2O1DA 1OFMA 2VFOA 2Z8GA 3P4GA 4OPWA 4XM3A 1IA5A 3KRGA 3LYCA 1DBOA 1IDJA 1LM1A 4XNFA 3GQ7A 2BM7A 1DBGA 4XLEA 3B90A 4XLFA 2VFNA 2XTWA 3EQOA 5JMCB 2J8KA 2NTQA 1CLWA 1OFDA 2IOUG 4W8TA 4OJ5A 2X6XA 1KQ5A 4W8RA 2X85A 4YC5A 4XN3A 1EZGA 4PMHA 3ZSCA 3AK5A 1O8JA 3VMWA 3JURA 3PSSA 2INUA 3ZPPA 4XL9A 2NTPA 4KH3A 5C1CA 2QZAA 2XT4A 1HF2A 1K8FA 4OJOA 1RMGA 1KCDA 1OFLA 4W8QA 4XONA 4XORA 3VSVA 1TYXA 1CZFA 1QCXA 1WMRA 4C2LA 1KTWA 2O0VA 2UVFA 1JRGA 4OZZA 4YELA 2ODLA 2X3HA 2BSPA 2VJIA 4XOPA 3TH0A 3SY2A 3VMVA 1GQ8A 1O8IA 1JTAA 1PE9A 4XLHA 2X6WA 4U49A 3VSTA 3N6ZA 3SQVA 4YFOA 3T9GA 1X0CA 4OJLA 1QA2A 1KCCA 1TYWA 1DABA 4XN0A 1XG2A 3RIQA 3DU1X 1O8FA 4OJ6A 1O8EA 4YZAA 4OZYA 1H80A 1IDKA 2BM5A 1QQ1A 1OGOX 2NSTA 1VBLA 1QJVA 4Z03A 2O04A 2QYUA 5C1EA 2V5IA 3PETA 1OGMX 4YCQA 2NTBA 1WXRA 3ML3A 4MR0A 1K4ZA 2O17A 2B0RA 4XMYA 1K5CA 1QRCA 4HWVA 2YUHA 4YEIA 3NB2A 1EA0A 1OOCA 2NT9A 1O88A 2XTYA 3GRHA 1PLUA 2QX3A 2BM6A 2VFPA 3BH7B 2QY1A 3LMWA 1BN8A 1O8DA 5AMVA 1NHCA 2NZMA 3JX8A 2INVA 2PECA 3GQAA 1HG8A 4XLAA 3EQNA 4NK6A 1TYUA 3GQ8A 2BM4A 4YZQA 4XLCA 2IQ7A 5JLVC 4URRA 4OJPA 4Z05A 4XKVA 1OFEA 2NSPA 4I84A 2G0YA 3LJYA 4W8SA 2XC1A 2XTXA 3NAWA 1IB4A 4MXNA 5DNSA 2UVEA 3PSZA 2BX6A 2PYHA 2X6YA 2O0WA 2J8IA 2W7ZA 3H09A 3SYJA 3B8YA 1O8KA 4OM9A 2VBKA 2PYGA 2VFQA 4Z06A 3N90A 3GQ9A 1EE6A 1PXZA
chains in the Genus database with same CATH topology
3SQVA 4YFOA 2J8KA 2O6WA 3DU1X 4YC5A 4YDTA 3PSSA 2XT2A 2XT4A 2QYUA 4YCQA 2XTXA 3NAWA 5DNSA 3PSZA 4YEIA 3NB2A 3SY2A 2XTYA 2XTWA 2QZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQV A;  4YFO A;  2J8K A;  2O6W A;  3DU1 X;  4YC5 A;  4YDT A;  3PSS A;  2XT2 A;  2XT4 A;  2QYU A;  4YCQ A;  2XTX A;  3NAW A;  5DNS A;  3PSZ A;  4YEI A;  3NB2 A;  3SY2 A;  2XTY A;  2XTW A;  2QZA A; 
#chains in the Genus database with same CATH topology
 1BHE A;  3SUC A;  3SZE A;  2QXZ A;  3FY3 A;  3VSU A;  4NK8 A;  1LLZ A;  2O6W A;  4U4B A;  4YDT A;  1LLW A;  2EWE A;  1QA3 A;  1AIR A;  2VFM A;  4JRA C;  1QRB A;  1TSP A;  2F3L A;  2VJJ A;  4XOT A;  4EW9 A;  2XT2 A;  1O8G A;  3B4N A;  1RWR A;  4AVZ A;  4YZ0 A;  1O8H A;  1RU4 A;  2NT6 A;  4XKW A;  4XQF A;  2VBE A;  4YEJ A;  1L1I A;  4XR6 A;  4YZX A;  1TYV A;  3WWG A;  1QA1 A;  3BH6 B;  1O8L A;  2VBM A;  4V02 C;  3UW0 A;  1O8M A;  2O1D A;  1OFM A;  2VFO A;  2Z8G A;  3P4G A;  4OPW A;  4XM3 A;  1IA5 A;  3KRG A;  3LYC A;  1DBO A;  1IDJ A;  1LM1 A;  4XNF A;  3GQ7 A;  2BM7 A;  1DBG A;  4XLE A;  3B90 A;  4XLF A;  2VFN A;  2XTW A;  3EQO A;  5JMC B;  2J8K A;  2NTQ A;  1CLW A;  1OFD A;  2IOU G;  4W8T A;  4OJ5 A;  2X6X A;  1KQ5 A;  4W8R A;  2X85 A;  4YC5 A;  4XN3 A;  1EZG A;  4PMH A;  3ZSC A;  3AK5 A;  1O8J A;  3VMW A;  3JUR A;  3PSS A;  2INU A;  3ZPP A;  4XL9 A;  2NTP A;  4KH3 A;  5C1C A;  2QZA A;  2XT4 A;  1HF2 A;  1K8F A;  4OJO A;  1RMG A;  1KCD A;  1OFL A;  4W8Q A;  4XON A;  4XOR A;  3VSV A;  1TYX A;  1CZF A;  1QCX A;  1WMR A;  4C2L A;  1KTW A;  2O0V A;  2UVF A;  1JRG A;  4OZZ A;  4YEL A;  2ODL A;  2X3H A;  2BSP A;  2VJI A;  4XOP A;  3TH0 A;  3SY2 A;  3VMV A;  1GQ8 A;  1O8I A;  1JTA A;  1PE9 A;  4XLH A;  2X6W A;  4U49 A;  3VST A;  3N6Z A;  3SQV A;  4YFO A;  3T9G A;  1X0C A;  4OJL A;  1QA2 A;  1KCC A;  1TYW A;  1DAB A;  4XN0 A;  1XG2 A;  3RIQ A;  3DU1 X;  1O8F A;  4OJ6 A;  1O8E A;  4YZA A;  4OZY A;  1H80 A;  1IDK A;  2BM5 A;  1QQ1 A;  1OGO X;  2NST A;  1VBL A;  1QJV A;  4Z03 A;  2O04 A;  2QYU A;  5C1E A;  2V5I A;  3PET A;  1OGM X;  4YCQ A;  2NTB A;  1WXR A;  3ML3 A;  4MR0 A;  1K4Z A;  2O17 A;  2B0R A;  4XMY A;  1K5C A;  1QRC A;  4HWV A;  2YUH A;  4YEI A;  3NB2 A;  1EA0 A;  1OOC A;  2NT9 A;  1O88 A;  2XTY A;  3GRH A;  1PLU A;  2QX3 A;  2BM6 A;  2VFP A;  3BH7 B;  2QY1 A;  3LMW A;  1BN8 A;  1O8D A;  5AMV A;  1NHC A;  2NZM A;  3JX8 A;  2INV A;  2PEC A;  3GQA A;  1HG8 A;  4XLA A;  3EQN A;  4NK6 A;  1TYU A;  3GQ8 A;  2BM4 A;  4YZQ A;  4XLC A;  2IQ7 A;  5JLV C;  4URR A;  4OJP A;  4Z05 A;  4XKV A;  1OFE A;  2NSP A;  4I84 A;  2G0Y A;  3LJY A;  4W8S A;  2XC1 A;  2XTX A;  3NAW A;  1IB4 A;  4MXN A;  5DNS A;  2UVE A;  3PSZ A;  2BX6 A;  2PYH A;  2X6Y A;  2O0W A;  2J8I A;  2W7Z A;  3H09 A;  3SYJ A;  3B8Y A;  1O8K A;  4OM9 A;  2VBK A;  2PYG A;  2VFQ A;  4Z06 A;  3N90 A;  3GQ9 A;  1EE6 A;  1PXZ A; 
#chains in the Genus database with same CATH homology
 3SQV A;  4YFO A;  2J8K A;  2O6W A;  3DU1 X;  4YC5 A;  4YDT A;  3PSS A;  2XT2 A;  2XT4 A;  2QYU A;  4YCQ A;  2XTX A;  3NAW A;  5DNS A;  3PSZ A;  4YEI A;  3NB2 A;  3SY2 A;  2XTY A;  2XTW A;  2QZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...