2BM7A

The structure of mfpa (rv3361c, p3221 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
178
structure length
178
Chain Sequence
b'QWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
total genus 77
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm7A00
5JMCB 2BM6A 5JLVC 2BM7A 2BM5A 3N90A 2BM4A 4JRAC 2W7ZA 2J8IA 2F3LA 2G0YA
chains in the Genus database with same CATH superfamily
1TYUA 3PETA 1L1IA 3VSTA 1BHEA 5AMVA 3B90A 2BSPA 2EWEA 1KCDA 2NSPA 4OM9A 4V02C 1GQ8A 1K4ZA 2VBMA 2O1DA 2UVEA 1H80A 1EE6A 1LLWA 2XC1A 4XMYA 3EQNA 1O8JA 2VFPA 2QY1A 4YC5A 3AK5A 3JX8A 1O8IA 3GQAA 2YUHA 1QRCA 1O8LA 1OGMX 4OJ5A 2X6WA 3GQ9A 4XLHA 1HF2A 1CZFA 1PLUA 1BN8A 3LMWA 2IOUG 3PSZA 2O04A 2BM7A 1IDKA 4NK6A 4OPWA 4XORA 4YEJA 3VMWA 4YDTA 4OJLA 3BH6B 4XLFA 4C2LA 1O88A 4XLCA 3LYCA 2X85A 4YCQA 1K5CA 2V5IA 4OJOA 1QCXA 4MR0A 4XOPA 2XT2A 3JURA 5DNSA 3SY2A 2INUA 1K8FA 1X0CA 2QX3A 2VBKA 4Z05A 3TH0A 2J8KA 4PMHA 1IB4A 1IA5A 2VFOA 2VJIA 2XTWA 4XNFA 3SQVA 1O8EA 1QA1A 3SYJA 2VFQA 4U49A 4JRAC 2IQ7A 1QA3A 1QJVA 4YZQA 2J8IA 1TSPA 4XL9A 2VFMA 3N6ZA 3KRGA 2O17A 3NB2A 4I84A 4XONA 1XG2A 4YZXA 1CLWA 2QZAA 2BM5A 3NAWA 4XKVA 4NK8A 2BM4A 3VMVA 2BX6A 2PECA 1DBGA 1OFDA 1OFEA 2XTYA 4W8TA 2O0VA 2NTBA 2X6YA 4XKWA 4YFOA 1QRBA 1LLZA 1DBOA 1AIRA 1HG8A 3GQ7A 1NHCA 1PE9A 4YZ0A 4XLAA 3VSUA 2UVFA 1WMRA 1OFLA 3VSVA 1PXZA 1JRGA 3RIQA 1O8KA 2XT4A 3WWGA 4OZYA 2XTXA 4U4BA 4XN3A 4EW9A 4XQFA 1OOCA 2INVA 1QA2A 1DABA 2VJJA 2QXZA 1TYVA 2BM6A 2ODLA 1O8DA 4YEIA 3T9GA 2NTQA 3SZEA 4W8RA 4OJ6A 2NSTA 4XN0A 2X3HA 1TYWA 1RU4A 2G0YA 1O8GA 3FY3A 3ML3A 3H09A 3EQOA 2Z8GA 2O6WA 1O8MA 4HWVA 4XOTA 3UW0A 2VBEA 5JMCB 1RWRA 1WXRA 3B8YA 1LM1A 2NT9A 3SUCA 1KTWA 2PYHA 1KQ5A 2QYUA 3B4NA 4Z03A 4URRA 2NZMA 3ZPPA 3DU1X 5C1CA 4W8SA 4OZZA 3GRHA 4MXNA 2B0RA 3BH7B 4XR6A 1TYXA 2PYGA 4AVZA 1O8HA 3PSSA 1VBLA 5C1EA 2X6XA 1OFMA 1QQ1A 1KCCA 4YZAA 3N90A 4YELA 4XLEA 2W7ZA 4Z06A 1RMGA 4XM3A 2F3LA 4KH3A 4OJPA 2O0WA 1OGOX 1EZGA 1O8FA 3GQ8A 2NT6A 5JLVC 2VFNA 4W8QA 1IDJA 3LJYA 1EA0A 2NTPA 3ZSCA 3P4GA 1JTAA
chains in the Genus database with same CATH topology
1TYUA 3PETA 3ML3A 3H09A 5JMCB 1WXRA 3LYCA 2V5IA 4OJOA 1KQ5A 1QRBA 1K8FA 3TH0A 4OM9A 4V02C 2B0RA 3BH7B 2VFOA 1K4ZA 1TYXA 2XC1A 1QQ1A 3RIQA 3SYJA 1QA1A 2VFPA 3AK5A 2VFQA 3JX8A 3N90A 4JRAC 3P4GA 2W7ZA 1QA3A 2YUHA 2J8IA 1QRCA 1TSPA 1QA2A 2F3LA 4KH3A 4OJ5A 1DABA 4OJPA 2VFMA 1HF2A 3N6ZA 1TYVA 2BM6A 2IOUG 1CLWA 2BM7A 2BM5A 2VFNA 4OPWA 5JLVC 2BM4A 3SZEA 4OJLA 2BX6A 3BH6B 3LJYA 4OJ6A 1TYWA 2G0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JMC B;  2BM6 A;  5JLV C;  2BM7 A;  2BM5 A;  3N90 A;  2BM4 A;  4JRA C;  2W7Z A;  2J8I A;  2F3L A;  2G0Y A; 
#chains in the Genus database with same CATH topology
 1TYU A;  3PET A;  1L1I A;  3VST A;  1BHE A;  5AMV A;  3B90 A;  2BSP A;  2EWE A;  1KCD A;  2NSP A;  4OM9 A;  4V02 C;  1GQ8 A;  1K4Z A;  2VBM A;  2O1D A;  2UVE A;  1H80 A;  1EE6 A;  1LLW A;  2XC1 A;  4XMY A;  3EQN A;  1O8J A;  2VFP A;  2QY1 A;  4YC5 A;  3AK5 A;  3JX8 A;  1O8I A;  3GQA A;  2YUH A;  1QRC A;  1O8L A;  1OGM X;  4OJ5 A;  2X6W A;  3GQ9 A;  4XLH A;  1HF2 A;  1CZF A;  1PLU A;  1BN8 A;  3LMW A;  2IOU G;  3PSZ A;  2O04 A;  2BM7 A;  1IDK A;  4NK6 A;  4OPW A;  4XOR A;  4YEJ A;  3VMW A;  4YDT A;  4OJL A;  3BH6 B;  4XLF A;  4C2L A;  1O88 A;  4XLC A;  3LYC A;  2X85 A;  4YCQ A;  1K5C A;  2V5I A;  4OJO A;  1QCX A;  4MR0 A;  4XOP A;  2XT2 A;  3JUR A;  5DNS A;  3SY2 A;  2INU A;  1K8F A;  1X0C A;  2QX3 A;  2VBK A;  4Z05 A;  3TH0 A;  2J8K A;  4PMH A;  1IB4 A;  1IA5 A;  2VFO A;  2VJI A;  2XTW A;  4XNF A;  3SQV A;  1O8E A;  1QA1 A;  3SYJ A;  2VFQ A;  4U49 A;  4JRA C;  2IQ7 A;  1QA3 A;  1QJV A;  4YZQ A;  2J8I A;  1TSP A;  4XL9 A;  2VFM A;  3N6Z A;  3KRG A;  2O17 A;  3NB2 A;  4I84 A;  4XON A;  1XG2 A;  4YZX A;  1CLW A;  2QZA A;  2BM5 A;  3NAW A;  4XKV A;  4NK8 A;  2BM4 A;  3VMV A;  2BX6 A;  2PEC A;  1DBG A;  1OFD A;  1OFE A;  2XTY A;  4W8T A;  2O0V A;  2NTB A;  2X6Y A;  4XKW A;  4YFO A;  1QRB A;  1LLZ A;  1DBO A;  1AIR A;  1HG8 A;  3GQ7 A;  1NHC A;  1PE9 A;  4YZ0 A;  4XLA A;  3VSU A;  2UVF A;  1WMR A;  1OFL A;  3VSV A;  1PXZ A;  1JRG A;  3RIQ A;  1O8K A;  2XT4 A;  3WWG A;  4OZY A;  2XTX A;  4U4B A;  4XN3 A;  4EW9 A;  4XQF A;  1OOC A;  2INV A;  1QA2 A;  1DAB A;  2VJJ A;  2QXZ A;  1TYV A;  2BM6 A;  2ODL A;  1O8D A;  4YEI A;  3T9G A;  2NTQ A;  3SZE A;  4W8R A;  4OJ6 A;  2NST A;  4XN0 A;  2X3H A;  1TYW A;  1RU4 A;  2G0Y A;  1O8G A;  3FY3 A;  3ML3 A;  3H09 A;  3EQO A;  2Z8G A;  2O6W A;  1O8M A;  4HWV A;  4XOT A;  3UW0 A;  2VBE A;  5JMC B;  1RWR A;  1WXR A;  3B8Y A;  1LM1 A;  2NT9 A;  3SUC A;  1KTW A;  2PYH A;  1KQ5 A;  2QYU A;  3B4N A;  4Z03 A;  4URR A;  2NZM A;  3ZPP A;  3DU1 X;  5C1C A;  4W8S A;  4OZZ A;  3GRH A;  4MXN A;  2B0R A;  3BH7 B;  4XR6 A;  1TYX A;  2PYG A;  4AVZ A;  1O8H A;  3PSS A;  1VBL A;  5C1E A;  2X6X A;  1OFM A;  1QQ1 A;  1KCC A;  4YZA A;  3N90 A;  4YEL A;  4XLE A;  2W7Z A;  4Z06 A;  1RMG A;  4XM3 A;  2F3L A;  4KH3 A;  4OJP A;  2O0W A;  1OGO X;  1EZG A;  1O8F A;  3GQ8 A;  2NT6 A;  5JLV C;  2VFN A;  4W8Q A;  1IDJ A;  3LJY A;  1EA0 A;  2NTP A;  3ZSC A;  3P4G A;  1JTA A; 
#chains in the Genus database with same CATH homology
 1TYU A;  3PET A;  3ML3 A;  3H09 A;  5JMC B;  1WXR A;  3LYC A;  2V5I A;  4OJO A;  1KQ5 A;  1QRB A;  1K8F A;  3TH0 A;  4OM9 A;  4V02 C;  2B0R A;  3BH7 B;  2VFO A;  1K4Z A;  1TYX A;  2XC1 A;  1QQ1 A;  3RIQ A;  3SYJ A;  1QA1 A;  2VFP A;  3AK5 A;  2VFQ A;  3JX8 A;  3N90 A;  4JRA C;  3P4G A;  2W7Z A;  1QA3 A;  2YUH A;  2J8I A;  1QRC A;  1TSP A;  1QA2 A;  2F3L A;  4KH3 A;  4OJ5 A;  1DAB A;  4OJP A;  2VFM A;  1HF2 A;  3N6Z A;  1TYV A;  2BM6 A;  2IOU G;  1CLW A;  2BM7 A;  2BM5 A;  2VFN A;  4OPW A;  5JLV C;  2BM4 A;  3SZE A;  4OJL A;  2BX6 A;  3BH6 B;  3LJY A;  4OJ6 A;  1TYW A;  2G0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...