2BM7A

The structure of mfpa (rv3361c, p3221 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
178
structure length
178
Chain Sequence
QWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pentapeptide repeat protein
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 77
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm7A00
4JRAC 5JMCB 3N90A 2BM5A 2BM4A 2G0YA 2BM6A 5JLVC 2W7ZA 2J8IA 2F3LA 2BM7A
chains in the Genus database with same CATH superfamily
4OPWA 4YZAA 2Z8GA 4EW9A 4XL9A 2VFOA 3GQ9A 4YELA 2NZMA 2EWEA 2X85A 3DU1X 3RIQA 4OJ6A 3T9GA 1DBOA 4W8QA 2O0WA 4NK8A 4OJLA 2V5IA 2INUA 4YZXA 1QRCA 3ZSCA 1QA1A 1PE9A 1TSPA 1RU4A 4OJOA 2YUHA 4XN0A 3SY2A 1TYWA 1BHEA 3GQ8A 4C2LA 1VBLA 3JX8A 1OFMA 2VJJA 2NSTA 2BM6A 1K4ZA 1WXRA 1O88A 3TH0A 4OJ5A 1GQ8A 4U4BA 1BN8A 3UW0A 1TYUA 2XTYA 4XN3A 3NAWA 4OM9A 1QRBA 3PSZA 3EQNA 1O8GA 2NSPA 4XLEA 2NTBA 1K8FA 2BM4A 2VBMA 4XLFA 1IB4A 5JLVC 2XT2A 3GRHA 2NTPA 2QX3A 1CLWA 4MR0A 1O8EA 4W8RA 1OFEA 1OFDA 2QY1A 2VBKA 4XLHA 3ML3A 4YZ0A 2BM5A 3LJYA 1TYVA 4XMYA 2X3HA 2XC1A 3LYCA 1KCDA 2QXZA 1O8JA 2B0RA 3N6ZA 3GQ7A 4YEJA 1AIRA 4AVZA 3VSVA 2XT4A 1KCCA 1QCXA 3B8YA 4MXNA 1OOCA 2O17A 1LLZA 1JTAA 1QA3A 4W8SA 3VSUA 1EZGA 4URRA 2G0YA 1EE6A 4YCQA 2O0VA 1TYXA 4YC5A 4XLAA 2BM7A 1IA5A 1O8DA 2O1DA 4Z06A 1XG2A 1KQ5A 4YEIA 1O8KA 2VFQA 4PMHA 2INVA 3VMVA 1LLWA 1CZFA 3PETA 3B90A 3ZPPA 5DNSA 1O8HA 4XNFA 1OGOX 2VBEA 1DABA 2W7ZA 3BH7B 2QZAA 4I84A 2O6WA 5JMCB 3VMWA 1JRGA 3KRGA 2NT6A 1HG8A 1PXZA 1OGMX 2O04A 3JURA 4XKVA 3P4GA 3SUCA 2VFNA 1H80A 2X6XA 4XQFA 1L1IA 2J8KA 1RWRA 3GQAA 4V02C 1RMGA 2NTQA 4OJPA 1WMRA 4JRAC 1O8IA 1QQ1A 2UVFA 1HF2A 2XTXA 4W8TA 1DBGA 1NHCA 3SYJA 2NT9A 2VFMA 1K5CA 4XOTA 1EA0A 4XORA 1QA2A 1O8LA 2BX6A 2IOUG 2UVEA 4XLCA 2BSPA 2X6WA 4YZQA 1KTWA 1QJVA 2VJIA 4OZZA 1O8MA 4HWVA 3H09A 2IQ7A 3SZEA 3VSTA 2PYHA 4OZYA 1X0CA 3LMWA 5AMVA 4Z05A 4XONA 1O8FA 2QYUA 3SQVA 3FY3A 4NK6A 3B4NA 2PYGA 4Z03A 1IDJA 4YDTA 2X6YA 3PSSA 2PECA 2XTWA 2F3LA 4XOPA 3WWGA 3AK5A 4XKWA 5C1CA 3N90A 4U49A 1LM1A 3BH6B 1IDKA 2ODLA 3EQOA 4KH3A 1PLUA 4XR6A 4YFOA 5C1EA 1OFLA 3NB2A 2J8IA 2VFPA 4XM3A
chains in the Genus database with same CATH topology
4JRAC 4OPWA 1QQ1A 1HF2A 2VFOA 1K8FA 3SYJA 2BM4A 2VFMA 1KQ5A 5JLVC 1QA2A 2BX6A 1CLWA 2VFQA 2IOUG 3RIQA 4OJ6A 3ML3A 3PETA 2BM5A 3LJYA 1DABA 1TYVA 2XC1A 3LYCA 2V5IA 1QA1A 1QRCA 3H09A 2B0RA 2W7ZA 1TSPA 3BH7B 3N6ZA 2YUHA 4OJOA 3SZEA 1TYWA 5JMCB 3JX8A 2BM6A 1K4ZA 1WXRA 3AK5A 2F3LA 3TH0A 1QA3A 3P4GA 4OJ5A 2VFNA 3N90A 1TYUA 3BH6B 4KH3A 4V02C 2G0YA 4OM9A 4OJLA 4OJPA 1TYXA 2J8IA 2VFPA 1QRBA 2BM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRA C;  5JMC B;  3N90 A;  2BM5 A;  2BM4 A;  2G0Y A;  2BM6 A;  5JLV C;  2W7Z A;  2J8I A;  2F3L A;  2BM7 A; 
#chains in the Genus database with same CATH topology
 4OPW A;  4YZA A;  2Z8G A;  4EW9 A;  4XL9 A;  2VFO A;  3GQ9 A;  4YEL A;  2NZM A;  2EWE A;  2X85 A;  3DU1 X;  3RIQ A;  4OJ6 A;  3T9G A;  1DBO A;  4W8Q A;  2O0W A;  4NK8 A;  4OJL A;  2V5I A;  2INU A;  4YZX A;  1QRC A;  3ZSC A;  1QA1 A;  1PE9 A;  1TSP A;  1RU4 A;  4OJO A;  2YUH A;  4XN0 A;  3SY2 A;  1TYW A;  1BHE A;  3GQ8 A;  4C2L A;  1VBL A;  3JX8 A;  1OFM A;  2VJJ A;  2NST A;  2BM6 A;  1K4Z A;  1WXR A;  1O88 A;  3TH0 A;  4OJ5 A;  1GQ8 A;  4U4B A;  1BN8 A;  3UW0 A;  1TYU A;  2XTY A;  4XN3 A;  3NAW A;  4OM9 A;  1QRB A;  3PSZ A;  3EQN A;  1O8G A;  2NSP A;  4XLE A;  2NTB A;  1K8F A;  2BM4 A;  2VBM A;  4XLF A;  1IB4 A;  5JLV C;  2XT2 A;  3GRH A;  2NTP A;  2QX3 A;  1CLW A;  4MR0 A;  1O8E A;  4W8R A;  1OFE A;  1OFD A;  2QY1 A;  2VBK A;  4XLH A;  3ML3 A;  4YZ0 A;  2BM5 A;  3LJY A;  1TYV A;  4XMY A;  2X3H A;  2XC1 A;  3LYC A;  1KCD A;  2QXZ A;  1O8J A;  2B0R A;  3N6Z A;  3GQ7 A;  4YEJ A;  1AIR A;  4AVZ A;  3VSV A;  2XT4 A;  1KCC A;  1QCX A;  3B8Y A;  4MXN A;  1OOC A;  2O17 A;  1LLZ A;  1JTA A;  1QA3 A;  4W8S A;  3VSU A;  1EZG A;  4URR A;  2G0Y A;  1EE6 A;  4YCQ A;  2O0V A;  1TYX A;  4YC5 A;  4XLA A;  2BM7 A;  1IA5 A;  1O8D A;  2O1D A;  4Z06 A;  1XG2 A;  1KQ5 A;  4YEI A;  1O8K A;  2VFQ A;  4PMH A;  2INV A;  3VMV A;  1LLW A;  1CZF A;  3PET A;  3B90 A;  3ZPP A;  5DNS A;  1O8H A;  4XNF A;  1OGO X;  2VBE A;  1DAB A;  2W7Z A;  3BH7 B;  2QZA A;  4I84 A;  2O6W A;  5JMC B;  3VMW A;  1JRG A;  3KRG A;  2NT6 A;  1HG8 A;  1PXZ A;  1OGM X;  2O04 A;  3JUR A;  4XKV A;  3P4G A;  3SUC A;  2VFN A;  1H80 A;  2X6X A;  4XQF A;  1L1I A;  2J8K A;  1RWR A;  3GQA A;  4V02 C;  1RMG A;  2NTQ A;  4OJP A;  1WMR A;  4JRA C;  1O8I A;  1QQ1 A;  2UVF A;  1HF2 A;  2XTX A;  4W8T A;  1DBG A;  1NHC A;  3SYJ A;  2NT9 A;  2VFM A;  1K5C A;  4XOT A;  1EA0 A;  4XOR A;  1QA2 A;  1O8L A;  2BX6 A;  2IOU G;  2UVE A;  4XLC A;  2BSP A;  2X6W A;  4YZQ A;  1KTW A;  1QJV A;  2VJI A;  4OZZ A;  1O8M A;  4HWV A;  3H09 A;  2IQ7 A;  3SZE A;  3VST A;  2PYH A;  4OZY A;  1X0C A;  3LMW A;  5AMV A;  4Z05 A;  4XON A;  1O8F A;  2QYU A;  3SQV A;  3FY3 A;  4NK6 A;  3B4N A;  2PYG A;  4Z03 A;  1IDJ A;  4YDT A;  2X6Y A;  3PSS A;  2PEC A;  2XTW A;  2F3L A;  4XOP A;  3WWG A;  3AK5 A;  4XKW A;  5C1C A;  3N90 A;  4U49 A;  1LM1 A;  3BH6 B;  1IDK A;  2ODL A;  3EQO A;  4KH3 A;  1PLU A;  4XR6 A;  4YFO A;  5C1E A;  1OFL A;  3NB2 A;  2J8I A;  2VFP A;  4XM3 A; 
#chains in the Genus database with same CATH homology
 4JRA C;  4OPW A;  1QQ1 A;  1HF2 A;  2VFO A;  1K8F A;  3SYJ A;  2BM4 A;  2VFM A;  1KQ5 A;  5JLV C;  1QA2 A;  2BX6 A;  1CLW A;  2VFQ A;  2IOU G;  3RIQ A;  4OJ6 A;  3ML3 A;  3PET A;  2BM5 A;  3LJY A;  1DAB A;  1TYV A;  2XC1 A;  3LYC A;  2V5I A;  1QA1 A;  1QRC A;  3H09 A;  2B0R A;  2W7Z A;  1TSP A;  3BH7 B;  3N6Z A;  2YUH A;  4OJO A;  3SZE A;  1TYW A;  5JMC B;  3JX8 A;  2BM6 A;  1K4Z A;  1WXR A;  3AK5 A;  2F3L A;  3TH0 A;  1QA3 A;  3P4G A;  4OJ5 A;  2VFN A;  3N90 A;  1TYU A;  3BH6 B;  4KH3 A;  4V02 C;  2G0Y A;  4OM9 A;  4OJL A;  4OJP A;  1TYX A;  2J8I A;  2VFP A;  1QRB A;  2BM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...