2BM7A

The structure of mfpa (rv3361c, p3221 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
178
structure length
178
Chain Sequence
QWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
total genus 77
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm7A00
4JRAC 2BM4A 2F3LA 3N90A 2G0YA 2J8IA 2BM6A 5JMCB 2BM7A 2W7ZA 5JLVC 2BM5A
chains in the Genus database with same CATH superfamily
2F3LA 4YCQA 3GQ7A 3H09A 4I84A 2IQ7A 2IOUG 3PSZA 4OJLA 1IDKA 4XR6A 4Z06A 1BHEA 1LLWA 4PMHA 1O88A 3EQOA 3GQ9A 4U49A 4OZZA 1X0CA 2QYUA 4YEJA 2O6WA 5DNSA 2X3HA 2PYHA 3LJYA 4XOPA 4URRA 4XONA 1OGOX 2BX6A 3BH7B 1KTWA 4XLFA 1K5CA 4W8TA 1O8JA 3GQAA 2V5IA 1QA1A 1O8IA 1PLUA 1TYUA 2QZAA 2X85A 3SZEA 1TYXA 4OPWA 4XLEA 1O8KA 4XOTA 3VMWA 1QRCA 2INVA 2NTBA 3LYCA 1TSPA 1WMRA 1O8FA 3B90A 5JMCB 2X6YA 2O0WA 3VMVA 1CZFA 1JRGA 2NZMA 3PSSA 4W8RA 1O8MA 3SYJA 3EQNA 1OFDA 4YZQA 1XG2A 2BM5A 3LMWA 1RMGA 2X6XA 3SY2A 1KCDA 1AIRA 2BM6A 2VJJA 1EA0A 5JLVC 4V02C 4XLHA 2QX3A 4XL9A 1RWRA 4YELA 4W8SA 1DBOA 2VFQA 4XORA 1BN8A 3VSTA 3VSUA 1QCXA 4JRAC 2INUA 4XN3A 3VSVA 1DABA 2XTYA 2PYGA 4Z05A 2O17A 2J8IA 1QJVA 1EZGA 4W8QA 4C2LA 1TYWA 3FY3A 3ML3A 4Z03A 3GRHA 1QRBA 3KRGA 4NK8A 3JURA 3UW0A 5C1EA 2NSTA 1QA3A 2VBMA 4YZXA 1OFEA 4YDTA 4YEIA 2UVEA 3B8YA 1RU4A 2NSPA 2VFPA 1O8LA 1KCCA 1PXZA 4HWVA 1H80A 4XLCA 3T9GA 3NAWA 4XLAA 4XQFA 3PETA 2VFMA 3AK5A 2O04A 1LM1A 4XKVA 1WXRA 2QY1A 3TH0A 1VBLA 2QXZA 2XT2A 1DBGA 3B4NA 3P4GA 3ZSCA 1IB4A 4OZYA 4XM3A 4AVZA 2NT9A 1QA2A 5AMVA 1IA5A 2O0VA 2XC1A 4XMYA 3SQVA 1OFLA 2NT6A 2W7ZA 2VJIA 3GQ8A 4YFOA 1OFMA 1K8FA 2B0RA 4MR0A 4YZAA 1PE9A 2YUHA 3DU1X 2ODLA 2UVFA 1O8HA 2VBKA 3BH6B 1O8DA 3NB2A 4XKWA 4MXNA 4OJ5A 4XN0A 1IDJA 4EW9A 1HF2A 2Z8GA 3N90A 2X6WA 3WWGA 1GQ8A 2VFNA 1CLWA 1EE6A 2EWEA 2VBEA 2O1DA 2VFOA 4OJ6A 4OJPA 2J8KA 2NTPA 1TYVA 1HG8A 4OM9A 4YC5A 4NK6A 1LLZA 1KQ5A 1O8EA 4KH3A 4U4BA 1OGMX 1JTAA 2BM7A 3N6ZA 1L1IA 2XTXA 3JX8A 5C1CA 4XNFA 2NTQA 1O8GA 2XT4A 2BM4A 2XTWA 2BSPA 3ZPPA 2G0YA 4OJOA 3RIQA 1QQ1A 4YZ0A 1K4ZA 1OOCA 2PECA 1NHCA 3SUCA
chains in the Genus database with same CATH topology
2B0RA 1QRBA 2F3LA 3H09A 2IOUG 4OJLA 2YUHA 3SYJA 1QA3A 3BH6B 4OJ5A 2BM5A 1HF2A 2VFPA 3N90A 2VFNA 1CLWA 2BM6A 2VFOA 4OJ6A 3LJYA 4OJPA 5JLVC 4V02C 1TYVA 2BX6A 4OM9A 3BH7B 3PETA 4KH3A 1KQ5A 2VFMA 2VFQA 3AK5A 2BM7A 1WXRA 3N6ZA 3TH0A 2V5IA 1QA1A 3JX8A 3P4GA 1TYUA 3SZEA 4JRAC 1TYXA 2BM4A 4OPWA 1DABA 1QA2A 2G0YA 1QRCA 2J8IA 3LYCA 1TSPA 4OJOA 2XC1A 3RIQA 5JMCB 1QQ1A 1K4ZA 1TYWA 2W7ZA 3ML3A 1K8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRA C;  2BM4 A;  2F3L A;  3N90 A;  2G0Y A;  2J8I A;  2BM6 A;  5JMC B;  2BM7 A;  2W7Z A;  5JLV C;  2BM5 A; 
#chains in the Genus database with same CATH topology
 2F3L A;  4YCQ A;  3GQ7 A;  3H09 A;  4I84 A;  2IQ7 A;  2IOU G;  3PSZ A;  4OJL A;  1IDK A;  4XR6 A;  4Z06 A;  1BHE A;  1LLW A;  4PMH A;  1O88 A;  3EQO A;  3GQ9 A;  4U49 A;  4OZZ A;  1X0C A;  2QYU A;  4YEJ A;  2O6W A;  5DNS A;  2X3H A;  2PYH A;  3LJY A;  4XOP A;  4URR A;  4XON A;  1OGO X;  2BX6 A;  3BH7 B;  1KTW A;  4XLF A;  1K5C A;  4W8T A;  1O8J A;  3GQA A;  2V5I A;  1QA1 A;  1O8I A;  1PLU A;  1TYU A;  2QZA A;  2X85 A;  3SZE A;  1TYX A;  4OPW A;  4XLE A;  1O8K A;  4XOT A;  3VMW A;  1QRC A;  2INV A;  2NTB A;  3LYC A;  1TSP A;  1WMR A;  1O8F A;  3B90 A;  5JMC B;  2X6Y A;  2O0W A;  3VMV A;  1CZF A;  1JRG A;  2NZM A;  3PSS A;  4W8R A;  1O8M A;  3SYJ A;  3EQN A;  1OFD A;  4YZQ A;  1XG2 A;  2BM5 A;  3LMW A;  1RMG A;  2X6X A;  3SY2 A;  1KCD A;  1AIR A;  2BM6 A;  2VJJ A;  1EA0 A;  5JLV C;  4V02 C;  4XLH A;  2QX3 A;  4XL9 A;  1RWR A;  4YEL A;  4W8S A;  1DBO A;  2VFQ A;  4XOR A;  1BN8 A;  3VST A;  3VSU A;  1QCX A;  4JRA C;  2INU A;  4XN3 A;  3VSV A;  1DAB A;  2XTY A;  2PYG A;  4Z05 A;  2O17 A;  2J8I A;  1QJV A;  1EZG A;  4W8Q A;  4C2L A;  1TYW A;  3FY3 A;  3ML3 A;  4Z03 A;  3GRH A;  1QRB A;  3KRG A;  4NK8 A;  3JUR A;  3UW0 A;  5C1E A;  2NST A;  1QA3 A;  2VBM A;  4YZX A;  1OFE A;  4YDT A;  4YEI A;  2UVE A;  3B8Y A;  1RU4 A;  2NSP A;  2VFP A;  1O8L A;  1KCC A;  1PXZ A;  4HWV A;  1H80 A;  4XLC A;  3T9G A;  3NAW A;  4XLA A;  4XQF A;  3PET A;  2VFM A;  3AK5 A;  2O04 A;  1LM1 A;  4XKV A;  1WXR A;  2QY1 A;  3TH0 A;  1VBL A;  2QXZ A;  2XT2 A;  1DBG A;  3B4N A;  3P4G A;  3ZSC A;  1IB4 A;  4OZY A;  4XM3 A;  4AVZ A;  2NT9 A;  1QA2 A;  5AMV A;  1IA5 A;  2O0V A;  2XC1 A;  4XMY A;  3SQV A;  1OFL A;  2NT6 A;  2W7Z A;  2VJI A;  3GQ8 A;  4YFO A;  1OFM A;  1K8F A;  2B0R A;  4MR0 A;  4YZA A;  1PE9 A;  2YUH A;  3DU1 X;  2ODL A;  2UVF A;  1O8H A;  2VBK A;  3BH6 B;  1O8D A;  3NB2 A;  4XKW A;  4MXN A;  4OJ5 A;  4XN0 A;  1IDJ A;  4EW9 A;  1HF2 A;  2Z8G A;  3N90 A;  2X6W A;  3WWG A;  1GQ8 A;  2VFN A;  1CLW A;  1EE6 A;  2EWE A;  2VBE A;  2O1D A;  2VFO A;  4OJ6 A;  4OJP A;  2J8K A;  2NTP A;  1TYV A;  1HG8 A;  4OM9 A;  4YC5 A;  4NK6 A;  1LLZ A;  1KQ5 A;  1O8E A;  4KH3 A;  4U4B A;  1OGM X;  1JTA A;  2BM7 A;  3N6Z A;  1L1I A;  2XTX A;  3JX8 A;  5C1C A;  4XNF A;  2NTQ A;  1O8G A;  2XT4 A;  2BM4 A;  2XTW A;  2BSP A;  3ZPP A;  2G0Y A;  4OJO A;  3RIQ A;  1QQ1 A;  4YZ0 A;  1K4Z A;  1OOC A;  2PEC A;  1NHC A;  3SUC A; 
#chains in the Genus database with same CATH homology
 2B0R A;  1QRB A;  2F3L A;  3H09 A;  2IOU G;  4OJL A;  2YUH A;  3SYJ A;  1QA3 A;  3BH6 B;  4OJ5 A;  2BM5 A;  1HF2 A;  2VFP A;  3N90 A;  2VFN A;  1CLW A;  2BM6 A;  2VFO A;  4OJ6 A;  3LJY A;  4OJP A;  5JLV C;  4V02 C;  1TYV A;  2BX6 A;  4OM9 A;  3BH7 B;  3PET A;  4KH3 A;  1KQ5 A;  2VFM A;  2VFQ A;  3AK5 A;  2BM7 A;  1WXR A;  3N6Z A;  3TH0 A;  2V5I A;  1QA1 A;  3JX8 A;  3P4G A;  1TYU A;  3SZE A;  4JRA C;  1TYX A;  2BM4 A;  4OPW A;  1DAB A;  1QA2 A;  2G0Y A;  1QRC A;  2J8I A;  3LYC A;  1TSP A;  4OJO A;  2XC1 A;  3RIQ A;  5JMC B;  1QQ1 A;  1K4Z A;  1TYW A;  2W7Z A;  3ML3 A;  1K8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...