2BM7A

The structure of mfpa (rv3361c, p3221 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
178
structure length
178
Chain Sequence
QWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
total genus 77
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm7A00
2G0YA 2BM6A 5JLVC 2J8IA 2BM5A 2F3LA 4JRAC 3N90A 2BM4A 2W7ZA 2BM7A 5JMCB
chains in the Genus database with same CATH superfamily
1O8GA 1PXZA 2O1DA 4MR0A 4C2LA 3GQ9A 1LLWA 1OFMA 1KCDA 1TYVA 2ODLA 2O04A 4EW9A 1BN8A 1BHEA 1X0CA 2O17A 3NB2A 1K5CA 4HWVA 1NHCA 3BH6B 2QX3A 2NTPA 2VFPA 3BH7B 2QZAA 3KRGA 1QRCA 4OJLA 1O8HA 3LMWA 4W8SA 5C1EA 4XONA 2BSPA 1DBOA 2VFQA 2NSPA 4XKVA 2XT2A 4XM3A 4XOPA 2XTYA 2XTWA 4Z05A 1OFEA 4XLHA 2X6YA 1IB4A 1KTWA 3LJYA 1O88A 2BM5A 4W8QA 1RMGA 2IOUG 3PSSA 4XR6A 1LM1A 4YZQA 2B0RA 1QJVA 2BM6A 5C1CA 2INVA 2O0VA 4AVZA 2X85A 3H09A 4OJPA 3B8YA 2INUA 3N90A 4YDTA 1TYUA 4U49A 4YFOA 4XLCA 3SZEA 1L1IA 3PSZA 5DNSA 3P4GA 4XLAA 4PMHA 3B4NA 1IDJA 1CLWA 2NTBA 3VSVA 1TYWA 2VBEA 4YELA 4YEIA 3PETA 4NK6A 2G0YA 2QYUA 3DU1X 4W8TA 1H80A 1QA2A 1OFLA 1PLUA 1DBGA 4OPWA 1O8FA 1DABA 3NAWA 1O8MA 2VBMA 4XNFA 4XORA 2F3LA 2XT4A 4XN3A 1XG2A 4YC5A 4MXNA 1EE6A 4XQFA 3VSUA 2NSTA 2X6XA 2BX6A 4URRA 2J8KA 1RWRA 1JRGA 2VFMA 3GQ8A 1O8DA 2QXZA 3GQ7A 2V5IA 3T9GA 1TSPA 2PECA 4OM9A 4V02C 4XMYA 4XL9A 1LLZA 1EZGA 4YZ0A 4XN0A 3SYJA 3SQVA 1KQ5A 2XC1A 3SY2A 2Z8GA 3GQAA 4OJ6A 3UW0A 1QQ1A 2O6WA 1QRBA 3GRHA 4OJOA 1OOCA 1QA3A 1OFDA 1O8LA 3WWGA 1EA0A 1O8KA 5JLVC 3JX8A 1GQ8A 4NK8A 1TYXA 2NTQA 2BM7A 2IQ7A 2X6WA 4XLEA 2VJJA 3VMWA 2XTXA 3LYCA 3VSTA 1OGMX 1JTAA 3TH0A 3AK5A 4XOTA 2EWEA 2NT6A 4KH3A 1QA1A 2QY1A 1WXRA 1K8FA 1K4ZA 1VBLA 2VFNA 2YUHA 3EQNA 2UVFA 4YZAA 4W8RA 4Z03A 3JURA 3FY3A 4JRAC 3ZPPA 2PYHA 1RU4A 2NZMA 2VFOA 1OGOX 2VJIA 4Z06A 4XLFA 2J8IA 1HF2A 4YZXA 2X3HA 2NT9A 2PYGA 1KCCA 2UVEA 4XKWA 1O8EA 2BM4A 2W7ZA 1HG8A 3ZSCA 3N6ZA 1IDKA 4U4BA 1QCXA 3SUCA 1AIRA 4OZYA 1O8IA 4OJ5A 4I84A 1IA5A 4YEJA 3ML3A 5JMCB 3B90A 2VBKA 4OZZA 3RIQA 1PE9A 5AMVA 1WMRA 3EQOA 2O0WA 3VMVA 4YCQA 1O8JA 1CZFA
chains in the Genus database with same CATH topology
2VFMA 2YUHA 2BM6A 2V5IA 1TSPA 4OM9A 4V02C 3H09A 4JRAC 4OJPA 3N90A 1TYUA 3SZEA 1TYVA 3SYJA 2VFOA 1KQ5A 2XC1A 2J8IA 1HF2A 3P4GA 4OJ6A 1QQ1A 1QRBA 3BH6B 1CLWA 2VFPA 3BH7B 1TYWA 2BM4A 2W7ZA 4OJOA 1QA3A 4OJLA 1QRCA 3PETA 2G0YA 3N6ZA 5JLVC 2VFQA 3JX8A 4OJ5A 1QA2A 1TYXA 3ML3A 2BM7A 4OPWA 5JMCB 1DABA 3LYCA 3LJYA 3RIQA 3AK5A 2BM5A 2F3LA 3TH0A 4KH3A 1QA1A 2IOUG 1WXRA 1K8FA 1K4ZA 2B0RA 2BX6A 2VFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0Y A;  2BM6 A;  5JLV C;  2J8I A;  2BM5 A;  2F3L A;  4JRA C;  3N90 A;  2BM4 A;  2W7Z A;  2BM7 A;  5JMC B; 
#chains in the Genus database with same CATH topology
 1O8G A;  1PXZ A;  2O1D A;  4MR0 A;  4C2L A;  3GQ9 A;  1LLW A;  1OFM A;  1KCD A;  1TYV A;  2ODL A;  2O04 A;  4EW9 A;  1BN8 A;  1BHE A;  1X0C A;  2O17 A;  3NB2 A;  1K5C A;  4HWV A;  1NHC A;  3BH6 B;  2QX3 A;  2NTP A;  2VFP A;  3BH7 B;  2QZA A;  3KRG A;  1QRC A;  4OJL A;  1O8H A;  3LMW A;  4W8S A;  5C1E A;  4XON A;  2BSP A;  1DBO A;  2VFQ A;  2NSP A;  4XKV A;  2XT2 A;  4XM3 A;  4XOP A;  2XTY A;  2XTW A;  4Z05 A;  1OFE A;  4XLH A;  2X6Y A;  1IB4 A;  1KTW A;  3LJY A;  1O88 A;  2BM5 A;  4W8Q A;  1RMG A;  2IOU G;  3PSS A;  4XR6 A;  1LM1 A;  4YZQ A;  2B0R A;  1QJV A;  2BM6 A;  5C1C A;  2INV A;  2O0V A;  4AVZ A;  2X85 A;  3H09 A;  4OJP A;  3B8Y A;  2INU A;  3N90 A;  4YDT A;  1TYU A;  4U49 A;  4YFO A;  4XLC A;  3SZE A;  1L1I A;  3PSZ A;  5DNS A;  3P4G A;  4XLA A;  4PMH A;  3B4N A;  1IDJ A;  1CLW A;  2NTB A;  3VSV A;  1TYW A;  2VBE A;  4YEL A;  4YEI A;  3PET A;  4NK6 A;  2G0Y A;  2QYU A;  3DU1 X;  4W8T A;  1H80 A;  1QA2 A;  1OFL A;  1PLU A;  1DBG A;  4OPW A;  1O8F A;  1DAB A;  3NAW A;  1O8M A;  2VBM A;  4XNF A;  4XOR A;  2F3L A;  2XT4 A;  4XN3 A;  1XG2 A;  4YC5 A;  4MXN A;  1EE6 A;  4XQF A;  3VSU A;  2NST A;  2X6X A;  2BX6 A;  4URR A;  2J8K A;  1RWR A;  1JRG A;  2VFM A;  3GQ8 A;  1O8D A;  2QXZ A;  3GQ7 A;  2V5I A;  3T9G A;  1TSP A;  2PEC A;  4OM9 A;  4V02 C;  4XMY A;  4XL9 A;  1LLZ A;  1EZG A;  4YZ0 A;  4XN0 A;  3SYJ A;  3SQV A;  1KQ5 A;  2XC1 A;  3SY2 A;  2Z8G A;  3GQA A;  4OJ6 A;  3UW0 A;  1QQ1 A;  2O6W A;  1QRB A;  3GRH A;  4OJO A;  1OOC A;  1QA3 A;  1OFD A;  1O8L A;  3WWG A;  1EA0 A;  1O8K A;  5JLV C;  3JX8 A;  1GQ8 A;  4NK8 A;  1TYX A;  2NTQ A;  2BM7 A;  2IQ7 A;  2X6W A;  4XLE A;  2VJJ A;  3VMW A;  2XTX A;  3LYC A;  3VST A;  1OGM X;  1JTA A;  3TH0 A;  3AK5 A;  4XOT A;  2EWE A;  2NT6 A;  4KH3 A;  1QA1 A;  2QY1 A;  1WXR A;  1K8F A;  1K4Z A;  1VBL A;  2VFN A;  2YUH A;  3EQN A;  2UVF A;  4YZA A;  4W8R A;  4Z03 A;  3JUR A;  3FY3 A;  4JRA C;  3ZPP A;  2PYH A;  1RU4 A;  2NZM A;  2VFO A;  1OGO X;  2VJI A;  4Z06 A;  4XLF A;  2J8I A;  1HF2 A;  4YZX A;  2X3H A;  2NT9 A;  2PYG A;  1KCC A;  2UVE A;  4XKW A;  1O8E A;  2BM4 A;  2W7Z A;  1HG8 A;  3ZSC A;  3N6Z A;  1IDK A;  4U4B A;  1QCX A;  3SUC A;  1AIR A;  4OZY A;  1O8I A;  4OJ5 A;  4I84 A;  1IA5 A;  4YEJ A;  3ML3 A;  5JMC B;  3B90 A;  2VBK A;  4OZZ A;  3RIQ A;  1PE9 A;  5AMV A;  1WMR A;  3EQO A;  2O0W A;  3VMV A;  4YCQ A;  1O8J A;  1CZF A; 
#chains in the Genus database with same CATH homology
 2VFM A;  2YUH A;  2BM6 A;  2V5I A;  1TSP A;  4OM9 A;  4V02 C;  3H09 A;  4JRA C;  4OJP A;  3N90 A;  1TYU A;  3SZE A;  1TYV A;  3SYJ A;  2VFO A;  1KQ5 A;  2XC1 A;  2J8I A;  1HF2 A;  3P4G A;  4OJ6 A;  1QQ1 A;  1QRB A;  3BH6 B;  1CLW A;  2VFP A;  3BH7 B;  1TYW A;  2BM4 A;  2W7Z A;  4OJO A;  1QA3 A;  4OJL A;  1QRC A;  3PET A;  2G0Y A;  3N6Z A;  5JLV C;  2VFQ A;  3JX8 A;  4OJ5 A;  1QA2 A;  1TYX A;  3ML3 A;  2BM7 A;  4OPW A;  5JMC B;  1DAB A;  3LYC A;  3LJY A;  3RIQ A;  3AK5 A;  2BM5 A;  2F3L A;  3TH0 A;  4KH3 A;  1QA1 A;  2IOU G;  1WXR A;  1K8F A;  1K4Z A;  2B0R A;  2BX6 A;  2VFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...