4YCQA

Beta1 synthetic solenoid protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
183
structure length
183
Chain Sequence
LTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords beta1 protein
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
total genus 82
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2015-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4ycqA00
4YFOA 3PSZA 3SY2A 3SQVA 2QYUA 2XTYA 2O6WA 3NAWA 2XT4A 2XTXA 5DNSA 3DU1X 2XTWA 2QZAA 4YCQA 3NB2A 4YC5A 4YDTA 2XT2A 2J8KA 3PSSA 4YEIA
chains in the Genus database with same CATH superfamily
4V02C 3LJYA 4W8RA 1WMRA 4YELA 1O8MA 4U4BA 2VFMA 2X6XA 1RU4A 1KQ5A 1EZGA 5JMCB 4YZQA 1LLZA 3SZEA 1O8JA 2PYHA 1HG8A 2NTQA 2NSTA 2VFQA 4XLEA 2IQ7A 4OJOA 4JRAC 4OPWA 4XLFA 3VMWA 3VSUA 4C2LA 4MR0A 2O6WA 4U49A 3T9GA 2NTPA 2INUA 2PECA 3GRHA 1DABA 1GQ8A 4I84A 2YUHA 3EQNA 5DNSA 1TYXA 4W8TA 2G0YA 4XQFA 2VJIA 4XONA 4YDTA 2VBEA 3GQ7A 4NK8A 3VSTA 2O04A 4W8QA 4XOPA 1PXZA 1LM1A 1QJVA 4YEIA 4XLHA 2QY1A 2BM6A 2Z8GA 3P4GA 3BH6B 4XKWA 3SYJA 3AK5A 1O8HA 1EA0A 4OJPA 2X3HA 3TH0A 1IDJA 4XNFA 3ZSCA 1IA5A 3WWGA 1TSPA 4Z03A 2X6YA 1QRBA 2EWEA 1O8FA 2NT9A 1L1IA 2V5IA 2B0RA 1HF2A 3ML3A 1WXRA 1JRGA 4XM3A 1TYWA 2QXZA 4OJ6A 4YZXA 3B8YA 4XMYA 3GQ9A 1PLUA 2NZMA 1CZFA 1BN8A 3DU1X 2VFPA 3H09A 4OZYA 2J8IA 2PYGA 4XN3A 3VSVA 1QA2A 2XT2A 1TYUA 2W7ZA 2XC1A 4XR6A 3RIQA 2X85A 1NHCA 2X6WA 1XG2A 4Z06A 2O1DA 4OZZA 4YZAA 3GQ8A 4XORA 3ZPPA 4W8SA 1RWRA 2VBMA 3PSZA 1OGOX 4URRA 5AMVA 3VMVA 2BX6A 1QA3A 2F3LA 1OOCA 2O17A 3PETA 3B90A 1KCCA 1BHEA 1O8KA 1IDKA 2O0WA 2QYUA 4HWVA 2BM5A 2ODLA 2XTYA 3SUCA 3NAWA 4XLAA 2UVEA 2BM7A 2XT4A 3JURA 1K8FA 1RMGA 4AVZA 1CLWA 1EE6A 4EW9A 2UVFA 3LYCA 3N6ZA 1OFLA 2VFOA 1OGMX 4YCQA 3NB2A 2VJJA 2BSPA 1QQ1A 2J8KA 3FY3A 2VBKA 3PSSA 1IB4A 1KCDA 1K4ZA 3JX8A 4XN0A 5C1EA 4YFOA 5JLVC 1O88A 1PE9A 4OM9A 1TYVA 1QA1A 1QCXA 2O0VA 4Z05A 3GQAA 4PMHA 2IOUG 1AIRA 1QRCA 4MXNA 4OJLA 1O8LA 1X0CA 2INVA 4XLCA 3SQVA 1O8GA 3EQOA 3SY2A 3LMWA 1H80A 1OFMA 5C1CA 1DBGA 1K5CA 2NSPA 4OJ5A 4XKVA 2QX3A 2NT6A 3B4NA 1DBOA 1O8IA 2XTXA 1OFDA 1VBLA 3N90A 3KRGA 4KH3A 3BH7B 2XTWA 2QZAA 4XOTA 1JTAA 2BM4A 4YC5A 1KTWA 4XL9A 4YZ0A 2NTBA 1O8EA 2VFNA 4YEJA 3UW0A 4NK6A 1O8DA 1LLWA 1OFEA
chains in the Genus database with same CATH topology
4YFOA 3PSZA 3SY2A 3SQVA 2QYUA 2XTYA 2O6WA 3NAWA 2XT4A 2XTXA 5DNSA 3DU1X 2XTWA 2QZAA 4YCQA 3NB2A 4YC5A 4YDTA 2XT2A 2J8KA 3PSSA 4YEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFO A;  3PSZ A;  3SY2 A;  3SQV A;  2QYU A;  2XTY A;  2O6W A;  3NAW A;  2XT4 A;  2XTX A;  5DNS A;  3DU1 X;  2XTW A;  2QZA A;  4YCQ A;  3NB2 A;  4YC5 A;  4YDT A;  2XT2 A;  2J8K A;  3PSS A;  4YEI A; 
#chains in the Genus database with same CATH topology
 4V02 C;  3LJY A;  4W8R A;  1WMR A;  4YEL A;  1O8M A;  4U4B A;  2VFM A;  2X6X A;  1RU4 A;  1KQ5 A;  1EZG A;  5JMC B;  4YZQ A;  1LLZ A;  3SZE A;  1O8J A;  2PYH A;  1HG8 A;  2NTQ A;  2NST A;  2VFQ A;  4XLE A;  2IQ7 A;  4OJO A;  4JRA C;  4OPW A;  4XLF A;  3VMW A;  3VSU A;  4C2L A;  4MR0 A;  2O6W A;  4U49 A;  3T9G A;  2NTP A;  2INU A;  2PEC A;  3GRH A;  1DAB A;  1GQ8 A;  4I84 A;  2YUH A;  3EQN A;  5DNS A;  1TYX A;  4W8T A;  2G0Y A;  4XQF A;  2VJI A;  4XON A;  4YDT A;  2VBE A;  3GQ7 A;  4NK8 A;  3VST A;  2O04 A;  4W8Q A;  4XOP A;  1PXZ A;  1LM1 A;  1QJV A;  4YEI A;  4XLH A;  2QY1 A;  2BM6 A;  2Z8G A;  3P4G A;  3BH6 B;  4XKW A;  3SYJ A;  3AK5 A;  1O8H A;  1EA0 A;  4OJP A;  2X3H A;  3TH0 A;  1IDJ A;  4XNF A;  3ZSC A;  1IA5 A;  3WWG A;  1TSP A;  4Z03 A;  2X6Y A;  1QRB A;  2EWE A;  1O8F A;  2NT9 A;  1L1I A;  2V5I A;  2B0R A;  1HF2 A;  3ML3 A;  1WXR A;  1JRG A;  4XM3 A;  1TYW A;  2QXZ A;  4OJ6 A;  4YZX A;  3B8Y A;  4XMY A;  3GQ9 A;  1PLU A;  2NZM A;  1CZF A;  1BN8 A;  3DU1 X;  2VFP A;  3H09 A;  4OZY A;  2J8I A;  2PYG A;  4XN3 A;  3VSV A;  1QA2 A;  2XT2 A;  1TYU A;  2W7Z A;  2XC1 A;  4XR6 A;  3RIQ A;  2X85 A;  1NHC A;  2X6W A;  1XG2 A;  4Z06 A;  2O1D A;  4OZZ A;  4YZA A;  3GQ8 A;  4XOR A;  3ZPP A;  4W8S A;  1RWR A;  2VBM A;  3PSZ A;  1OGO X;  4URR A;  5AMV A;  3VMV A;  2BX6 A;  1QA3 A;  2F3L A;  1OOC A;  2O17 A;  3PET A;  3B90 A;  1KCC A;  1BHE A;  1O8K A;  1IDK A;  2O0W A;  2QYU A;  4HWV A;  2BM5 A;  2ODL A;  2XTY A;  3SUC A;  3NAW A;  4XLA A;  2UVE A;  2BM7 A;  2XT4 A;  3JUR A;  1K8F A;  1RMG A;  4AVZ A;  1CLW A;  1EE6 A;  4EW9 A;  2UVF A;  3LYC A;  3N6Z A;  1OFL A;  2VFO A;  1OGM X;  4YCQ A;  3NB2 A;  2VJJ A;  2BSP A;  1QQ1 A;  2J8K A;  3FY3 A;  2VBK A;  3PSS A;  1IB4 A;  1KCD A;  1K4Z A;  3JX8 A;  4XN0 A;  5C1E A;  4YFO A;  5JLV C;  1O88 A;  1PE9 A;  4OM9 A;  1TYV A;  1QA1 A;  1QCX A;  2O0V A;  4Z05 A;  3GQA A;  4PMH A;  2IOU G;  1AIR A;  1QRC A;  4MXN A;  4OJL A;  1O8L A;  1X0C A;  2INV A;  4XLC A;  3SQV A;  1O8G A;  3EQO A;  3SY2 A;  3LMW A;  1H80 A;  1OFM A;  5C1C A;  1DBG A;  1K5C A;  2NSP A;  4OJ5 A;  4XKV A;  2QX3 A;  2NT6 A;  3B4N A;  1DBO A;  1O8I A;  2XTX A;  1OFD A;  1VBL A;  3N90 A;  3KRG A;  4KH3 A;  3BH7 B;  2XTW A;  2QZA A;  4XOT A;  1JTA A;  2BM4 A;  4YC5 A;  1KTW A;  4XL9 A;  4YZ0 A;  2NTB A;  1O8E A;  2VFN A;  4YEJ A;  3UW0 A;  4NK6 A;  1O8D A;  1LLW A;  1OFE A; 
#chains in the Genus database with same CATH homology
 4YFO A;  3PSZ A;  3SY2 A;  3SQV A;  2QYU A;  2XTY A;  2O6W A;  3NAW A;  2XT4 A;  2XTX A;  5DNS A;  3DU1 X;  2XTW A;  2QZA A;  4YCQ A;  3NB2 A;  4YC5 A;  4YDT A;  2XT2 A;  2J8K A;  3PSS A;  4YEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...