4YCQA

Beta1 synthetic solenoid protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
183
structure length
183
Chain Sequence
LTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural protein
molecule keywords beta1 protein
total genus 82
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2015-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4ycqA00
3SY2A 2XT2A 4YCQA 2XTYA 3NB2A 3SQVA 2O6WA 2XT4A 2XTWA 5DNSA 4YC5A 3NAWA 4YEIA 3PSZA 4YFOA 2J8KA 3DU1X 4YDTA 2QZAA 3PSSA 2XTXA 2QYUA
chains in the Genus database with same CATH superfamily
4OJ6A 1O8GA 1O8LA 4YZXA 2VJIA 4YCQA 4XM3A 1OGMX 1AIRA 1TYXA 2O0WA 3NB2A 4XR6A 1KTWA 4XL9A 2QY1A 2O6WA 1RMGA 2VBKA 4OJOA 1QA1A 2QXZA 2BM5A 2XTWA 3GQ8A 4XNFA 5DNSA 3LYCA 1OGOX 1LLZA 1KQ5A 1O8IA 3EQOA 3LJYA 2V5IA 2INVA 2NTPA 1PE9A 1O8HA 3VSUA 1O8KA 4YEIA 4C2LA 1OFDA 2BM6A 2J8KA 1QRBA 2NSTA 4EW9A 1L1IA 2UVFA 1WXRA 2PYGA 4W8RA 2EWEA 1VBLA 2W7ZA 1GQ8A 3P4GA 4OJLA 2IOUG 2F3LA 2VBMA 3KRGA 4YELA 3GQAA 2QYUA 3ZSCA 2NZMA 4XN0A 3TH0A 4OPWA 1O8DA 2IQ7A 4W8TA 4XLAA 3SY2A 1RWRA 2ODLA 1KCCA 3LMWA 5JLVC 2XTYA 4Z05A 2X6WA 3B90A 3ML3A 4I84A 1QQ1A 1TYWA 4XKWA 1OFLA 1O8MA 1EA0A 4V02C 3PETA 2VFOA 1XG2A 2VJJA 3JX8A 1OOCA 1CLWA 4YEJA 3NAWA 5JMCB 5AMVA 1PLUA 1QCXA 3H09A 1QRCA 2VFNA 4YFOA 1X0CA 2NSPA 2O04A 4OM9A 4MR0A 2BM7A 4XMYA 3VMVA 2PYHA 4U49A 1IDKA 4YZQA 3PSSA 1TSPA 4XKVA 1BN8A 4XLFA 1NHCA 3VSVA 4OZZA 4XQFA 1LM1A 1K4ZA 2O0VA 4JRAC 1K8FA 3T9GA 2UVEA 2VFMA 2BX6A 2B0RA 2VBEA 2INUA 2YUHA 3BH6B 2X85A 3VSTA 2QX3A 1QA2A 2XT4A 4MXNA 3JURA 2J8IA 4PMHA 4W8QA 4Z06A 4W8SA 2Z8GA 3SZEA 5C1CA 1WMRA 3B8YA 3EQNA 4YC5A 1TYVA 4YZ0A 1OFMA 3ZPPA 1TYUA 3VMWA 4XLHA 2BM4A 1EE6A 1JRGA 2BSPA 1DBGA 1EZGA 2X6XA 3GQ9A 2XC1A 3SYJA 1JTAA 2O17A 1O88A 3GRHA 1DABA 4U4BA 4OJ5A 4NK8A 4XLEA 4YDTA 3BH7B 2X6YA 1K5CA 1IB4A 2VFPA 1BHEA 4URRA 2XTXA 5C1EA 4XORA 3SUCA 2XT2A 3N6ZA 4XOTA 2O1DA 4XOPA 3SQVA 1DBOA 3FY3A 1OFEA 4YZAA 2VFQA 4XONA 2NT9A 3N90A 1RU4A 2NT6A 1QA3A 4KH3A 3UW0A 1IDJA 2X3HA 4OZYA 2PECA 4Z03A 3RIQA 1CZFA 4OJPA 3WWGA 1KCDA 3AK5A 3PSZA 2NTBA 1O8JA 1LLWA 1H80A 4AVZA 1O8EA 3DU1X 1HF2A 1IA5A 2NTQA 4HWVA 1QJVA 1O8FA 2QZAA 1HG8A 3B4NA 3GQ7A 2G0YA 4XLCA 1PXZA 4XN3A 4NK6A
chains in the Genus database with same CATH topology
3SY2A 2XT2A 4YCQA 2XTYA 3NB2A 3SQVA 2O6WA 2XT4A 2XTWA 5DNSA 4YC5A 3NAWA 4YEIA 3PSZA 4YFOA 2J8KA 3DU1X 4YDTA 2QZAA 3PSSA 2XTXA 2QYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SY2 A;  2XT2 A;  4YCQ A;  2XTY A;  3NB2 A;  3SQV A;  2O6W A;  2XT4 A;  2XTW A;  5DNS A;  4YC5 A;  3NAW A;  4YEI A;  3PSZ A;  4YFO A;  2J8K A;  3DU1 X;  4YDT A;  2QZA A;  3PSS A;  2XTX A;  2QYU A; 
#chains in the Genus database with same CATH topology
 4OJ6 A;  1O8G A;  1O8L A;  4YZX A;  2VJI A;  4YCQ A;  4XM3 A;  1OGM X;  1AIR A;  1TYX A;  2O0W A;  3NB2 A;  4XR6 A;  1KTW A;  4XL9 A;  2QY1 A;  2O6W A;  1RMG A;  2VBK A;  4OJO A;  1QA1 A;  2QXZ A;  2BM5 A;  2XTW A;  3GQ8 A;  4XNF A;  5DNS A;  3LYC A;  1OGO X;  1LLZ A;  1KQ5 A;  1O8I A;  3EQO A;  3LJY A;  2V5I A;  2INV A;  2NTP A;  1PE9 A;  1O8H A;  3VSU A;  1O8K A;  4YEI A;  4C2L A;  1OFD A;  2BM6 A;  2J8K A;  1QRB A;  2NST A;  4EW9 A;  1L1I A;  2UVF A;  1WXR A;  2PYG A;  4W8R A;  2EWE A;  1VBL A;  2W7Z A;  1GQ8 A;  3P4G A;  4OJL A;  2IOU G;  2F3L A;  2VBM A;  3KRG A;  4YEL A;  3GQA A;  2QYU A;  3ZSC A;  2NZM A;  4XN0 A;  3TH0 A;  4OPW A;  1O8D A;  2IQ7 A;  4W8T A;  4XLA A;  3SY2 A;  1RWR A;  2ODL A;  1KCC A;  3LMW A;  5JLV C;  2XTY A;  4Z05 A;  2X6W A;  3B90 A;  3ML3 A;  4I84 A;  1QQ1 A;  1TYW A;  4XKW A;  1OFL A;  1O8M A;  1EA0 A;  4V02 C;  3PET A;  2VFO A;  1XG2 A;  2VJJ A;  3JX8 A;  1OOC A;  1CLW A;  4YEJ A;  3NAW A;  5JMC B;  5AMV A;  1PLU A;  1QCX A;  3H09 A;  1QRC A;  2VFN A;  4YFO A;  1X0C A;  2NSP A;  2O04 A;  4OM9 A;  4MR0 A;  2BM7 A;  4XMY A;  3VMV A;  2PYH A;  4U49 A;  1IDK A;  4YZQ A;  3PSS A;  1TSP A;  4XKV A;  1BN8 A;  4XLF A;  1NHC A;  3VSV A;  4OZZ A;  4XQF A;  1LM1 A;  1K4Z A;  2O0V A;  4JRA C;  1K8F A;  3T9G A;  2UVE A;  2VFM A;  2BX6 A;  2B0R A;  2VBE A;  2INU A;  2YUH A;  3BH6 B;  2X85 A;  3VST A;  2QX3 A;  1QA2 A;  2XT4 A;  4MXN A;  3JUR A;  2J8I A;  4PMH A;  4W8Q A;  4Z06 A;  4W8S A;  2Z8G A;  3SZE A;  5C1C A;  1WMR A;  3B8Y A;  3EQN A;  4YC5 A;  1TYV A;  4YZ0 A;  1OFM A;  3ZPP A;  1TYU A;  3VMW A;  4XLH A;  2BM4 A;  1EE6 A;  1JRG A;  2BSP A;  1DBG A;  1EZG A;  2X6X A;  3GQ9 A;  2XC1 A;  3SYJ A;  1JTA A;  2O17 A;  1O88 A;  3GRH A;  1DAB A;  4U4B A;  4OJ5 A;  4NK8 A;  4XLE A;  4YDT A;  3BH7 B;  2X6Y A;  1K5C A;  1IB4 A;  2VFP A;  1BHE A;  4URR A;  2XTX A;  5C1E A;  4XOR A;  3SUC A;  2XT2 A;  3N6Z A;  4XOT A;  2O1D A;  4XOP A;  3SQV A;  1DBO A;  3FY3 A;  1OFE A;  4YZA A;  2VFQ A;  4XON A;  2NT9 A;  3N90 A;  1RU4 A;  2NT6 A;  1QA3 A;  4KH3 A;  3UW0 A;  1IDJ A;  2X3H A;  4OZY A;  2PEC A;  4Z03 A;  3RIQ A;  1CZF A;  4OJP A;  3WWG A;  1KCD A;  3AK5 A;  3PSZ A;  2NTB A;  1O8J A;  1LLW A;  1H80 A;  4AVZ A;  1O8E A;  3DU1 X;  1HF2 A;  1IA5 A;  2NTQ A;  4HWV A;  1QJV A;  1O8F A;  2QZA A;  1HG8 A;  3B4N A;  3GQ7 A;  2G0Y A;  4XLC A;  1PXZ A;  4XN3 A;  4NK6 A; 
#chains in the Genus database with same CATH homology
 3SY2 A;  2XT2 A;  4YCQ A;  2XTY A;  3NB2 A;  3SQV A;  2O6W A;  2XT4 A;  2XTW A;  5DNS A;  4YC5 A;  3NAW A;  4YEI A;  3PSZ A;  4YFO A;  2J8K A;  3DU1 X;  4YDT A;  2QZA A;  3PSS A;  2XTX A;  2QYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...