4YCQA

Beta1 synthetic solenoid protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
183
structure length
183
Chain Sequence
LTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural protein
molecule keywords beta1 protein
total genus 82
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2015-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4ycqA00
2QZAA 2J8KA 3SY2A 4YCQA 3SQVA 3DU1X 3NAWA 3PSSA 4YC5A 4YFOA 4YEIA 2XTWA 2QYUA 2XT2A 4YDTA 3PSZA 2XT4A 2XTXA 3NB2A 2XTYA 5DNSA 2O6WA
chains in the Genus database with same CATH superfamily
2NZMA 1BHEA 2QXZA 2QZAA 2J8KA 3TH0A 2BM4A 3B90A 4XLHA 2PYGA 4XLCA 3SY2A 2O1DA 2NTBA 1PLUA 4XOPA 1NHCA 4XN0A 3VMWA 2VBMA 3GQ8A 4XNFA 1KCCA 1IA5A 3EQNA 1O8FA 4W8SA 4XLEA 4OJPA 3ZSCA 1TSPA 1RU4A 3VMVA 1IDJA 2PYHA 3SYJA 3B8YA 4XN3A 1JTAA 4KH3A 3N90A 2NSTA 2IOUG 3SUCA 4XQFA 1O8LA 2B0RA 2XT2A 4YZ0A 5JLVC 3GQAA 1TYWA 2XT4A 1CZFA 4XKWA 4YZAA 4OM9A 3VSTA 4AVZA 1JRGA 5DNSA 1OOCA 4U49A 4I84A 2J8IA 4HWVA 3BH7B 3ML3A 4XONA 3UW0A 3VSVA 2O17A 1TYXA 4OJLA 1IDKA 1OGMX 4PMHA 3JURA 2XC1A 2UVFA 4XL9A 4XMYA 3RIQA 2VJJA 1EA0A 2YUHA 3N6ZA 1LLWA 1WMRA 3B4NA 1O8HA 2QY1A 3DU1X 1QRBA 2ODLA 3PSSA 2X3HA 1EZGA 2Z8GA 4MR0A 3EQOA 2X6YA 1OFMA 1RWRA 1QQ1A 4YC5A 3T9GA 1O88A 5AMVA 2XTWA 4OZYA 2X6WA 4YEJA 4Z05A 4XLAA 1OFDA 3BH6B 1O8EA 2VFNA 4OZZA 2VJIA 4YELA 1L1IA 1CLWA 1EE6A 1QJVA 2BM6A 2XTXA 3WWGA 3GQ7A 3LYCA 4OJ6A 4OJOA 2INUA 3GQ9A 1HG8A 2BM7A 1O8JA 2QYUA 5JMCB 1IB4A 1OGOX 2VFQA 1RMGA 2NTQA 2IQ7A 1O8KA 2VFOA 1O8IA 1QRCA 4XLFA 4C2LA 3VSUA 2VBEA 3P4GA 3PETA 1DBGA 2PECA 2BM5A 1K5CA 2BSPA 3ZPPA 2NT9A 4XR6A 4YFOA 1QA3A 4YEIA 1LLZA 2BX6A 2VBKA 4XORA 4OJ5A 4OPWA 2X6XA 3H09A 1BN8A 4NK6A 3JX8A 4YDTA 1KQ5A 4Z06A 1X0CA 2G0YA 2UVEA 1O8GA 2V5IA 2XTYA 4U4BA 4YZQA 4EW9A 1OFLA 1LM1A 1K8FA 5C1EA 2O6WA 2QX3A 1O8DA 1H80A 4Z03A 1TYUA 4YCQA 2X85A 2EWEA 1VBLA 1OFEA 3GRHA 1AIRA 3LMWA 4URRA 4XKVA 2NT6A 2O04A 4YZXA 1K4ZA 1KTWA 1O8MA 4XOTA 3NAWA 1PXZA 4W8TA 1PE9A 2NSPA 3SZEA 1QCXA 2NTPA 1WXRA 1DABA 2VFPA 3LJYA 1XG2A 2O0WA 2INVA 3KRGA 4MXNA 1KCDA 1QA2A 4NK8A 2VFMA 5C1CA 4W8QA 4V02C 1GQ8A 4JRAC 1HF2A 4W8RA 3SQVA 2O0VA 3PSZA 3AK5A 3NB2A 1QA1A 2F3LA 1DBOA 2W7ZA 4XM3A 1TYVA 3FY3A
chains in the Genus database with same CATH topology
2QZAA 2J8KA 3SY2A 4YCQA 3SQVA 3DU1X 3NAWA 3PSSA 4YC5A 4YFOA 4YEIA 2XTWA 2QYUA 2XT2A 4YDTA 3PSZA 2XT4A 2XTXA 3NB2A 2XTYA 5DNSA 2O6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QZA A;  2J8K A;  3SY2 A;  4YCQ A;  3SQV A;  3DU1 X;  3NAW A;  3PSS A;  4YC5 A;  4YFO A;  4YEI A;  2XTW A;  2QYU A;  2XT2 A;  4YDT A;  3PSZ A;  2XT4 A;  2XTX A;  3NB2 A;  2XTY A;  5DNS A;  2O6W A; 
#chains in the Genus database with same CATH topology
 2NZM A;  1BHE A;  2QXZ A;  2QZA A;  2J8K A;  3TH0 A;  2BM4 A;  3B90 A;  4XLH A;  2PYG A;  4XLC A;  3SY2 A;  2O1D A;  2NTB A;  1PLU A;  4XOP A;  1NHC A;  4XN0 A;  3VMW A;  2VBM A;  3GQ8 A;  4XNF A;  1KCC A;  1IA5 A;  3EQN A;  1O8F A;  4W8S A;  4XLE A;  4OJP A;  3ZSC A;  1TSP A;  1RU4 A;  3VMV A;  1IDJ A;  2PYH A;  3SYJ A;  3B8Y A;  4XN3 A;  1JTA A;  4KH3 A;  3N90 A;  2NST A;  2IOU G;  3SUC A;  4XQF A;  1O8L A;  2B0R A;  2XT2 A;  4YZ0 A;  5JLV C;  3GQA A;  1TYW A;  2XT4 A;  1CZF A;  4XKW A;  4YZA A;  4OM9 A;  3VST A;  4AVZ A;  1JRG A;  5DNS A;  1OOC A;  4U49 A;  4I84 A;  2J8I A;  4HWV A;  3BH7 B;  3ML3 A;  4XON A;  3UW0 A;  3VSV A;  2O17 A;  1TYX A;  4OJL A;  1IDK A;  1OGM X;  4PMH A;  3JUR A;  2XC1 A;  2UVF A;  4XL9 A;  4XMY A;  3RIQ A;  2VJJ A;  1EA0 A;  2YUH A;  3N6Z A;  1LLW A;  1WMR A;  3B4N A;  1O8H A;  2QY1 A;  3DU1 X;  1QRB A;  2ODL A;  3PSS A;  2X3H A;  1EZG A;  2Z8G A;  4MR0 A;  3EQO A;  2X6Y A;  1OFM A;  1RWR A;  1QQ1 A;  4YC5 A;  3T9G A;  1O88 A;  5AMV A;  2XTW A;  4OZY A;  2X6W A;  4YEJ A;  4Z05 A;  4XLA A;  1OFD A;  3BH6 B;  1O8E A;  2VFN A;  4OZZ A;  2VJI A;  4YEL A;  1L1I A;  1CLW A;  1EE6 A;  1QJV A;  2BM6 A;  2XTX A;  3WWG A;  3GQ7 A;  3LYC A;  4OJ6 A;  4OJO A;  2INU A;  3GQ9 A;  1HG8 A;  2BM7 A;  1O8J A;  2QYU A;  5JMC B;  1IB4 A;  1OGO X;  2VFQ A;  1RMG A;  2NTQ A;  2IQ7 A;  1O8K A;  2VFO A;  1O8I A;  1QRC A;  4XLF A;  4C2L A;  3VSU A;  2VBE A;  3P4G A;  3PET A;  1DBG A;  2PEC A;  2BM5 A;  1K5C A;  2BSP A;  3ZPP A;  2NT9 A;  4XR6 A;  4YFO A;  1QA3 A;  4YEI A;  1LLZ A;  2BX6 A;  2VBK A;  4XOR A;  4OJ5 A;  4OPW A;  2X6X A;  3H09 A;  1BN8 A;  4NK6 A;  3JX8 A;  4YDT A;  1KQ5 A;  4Z06 A;  1X0C A;  2G0Y A;  2UVE A;  1O8G A;  2V5I A;  2XTY A;  4U4B A;  4YZQ A;  4EW9 A;  1OFL A;  1LM1 A;  1K8F A;  5C1E A;  2O6W A;  2QX3 A;  1O8D A;  1H80 A;  4Z03 A;  1TYU A;  4YCQ A;  2X85 A;  2EWE A;  1VBL A;  1OFE A;  3GRH A;  1AIR A;  3LMW A;  4URR A;  4XKV A;  2NT6 A;  2O04 A;  4YZX A;  1K4Z A;  1KTW A;  1O8M A;  4XOT A;  3NAW A;  1PXZ A;  4W8T A;  1PE9 A;  2NSP A;  3SZE A;  1QCX A;  2NTP A;  1WXR A;  1DAB A;  2VFP A;  3LJY A;  1XG2 A;  2O0W A;  2INV A;  3KRG A;  4MXN A;  1KCD A;  1QA2 A;  4NK8 A;  2VFM A;  5C1C A;  4W8Q A;  4V02 C;  1GQ8 A;  4JRA C;  1HF2 A;  4W8R A;  3SQV A;  2O0V A;  3PSZ A;  3AK5 A;  3NB2 A;  1QA1 A;  2F3L A;  1DBO A;  2W7Z A;  4XM3 A;  1TYV A;  3FY3 A; 
#chains in the Genus database with same CATH homology
 2QZA A;  2J8K A;  3SY2 A;  4YCQ A;  3SQV A;  3DU1 X;  3NAW A;  3PSS A;  4YC5 A;  4YFO A;  4YEI A;  2XTW A;  2QYU A;  2XT2 A;  4YDT A;  3PSZ A;  2XT4 A;  2XTX A;  3NB2 A;  2XTY A;  5DNS A;  2O6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...