4YCQA

Beta1 synthetic solenoid protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
183
structure length
183
Chain Sequence
b'LTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta1 protein
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural protein
total genus 82
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2015-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4ycqA00
3DU1X 2XT4A 3NAWA 2J8KA 3NB2A 4YFOA 2QYUA 2XTXA 5DNSA 3SQVA 2XTYA 4YDTA 4YCQA 3SY2A 4YC5A 2O6WA 2QZAA 3PSSA 2XT2A 4YEIA 2XTWA 3PSZA
chains in the Genus database with same CATH superfamily
5JMCB 4OPWA 1OFMA 2XT4A 2X85A 3NAWA 2J8KA 1JRGA 1RU4A 1LLZA 2O0VA 4YZ0A 1KQ5A 2NTBA 4YFOA 1KTWA 1O8FA 2VFMA 1WMRA 3WWGA 2F3LA 2IOUG 3P4GA 2J8IA 4Z05A 4OZZA 4XORA 1QA1A 1PXZA 1O8IA 1QQ1A 2BM6A 2VBKA 4I84A 3B90A 1K5CA 2X3HA 2PYGA 3T9GA 1GQ8A 2ODLA 4JRAC 4YDTA 4XLEA 1EZGA 2O04A 4YC5A 2VFQA 4OJ6A 3LMWA 3VMWA 3LYCA 4XN3A 1K4ZA 4W8SA 3VSUA 3ZSCA 4YEIA 1EE6A 2NT6A 3GRHA 2QX3A 1IDKA 1DBOA 3DU1X 2INVA 2PECA 2Z8GA 4NK6A 1CLWA 1LLWA 3NB2A 4OZYA 4XLFA 2EWEA 1QCXA 1VBLA 2O0WA 1TSPA 1TYUA 4PMHA 4URRA 1OGMX 2VFOA 4NK8A 4YZXA 4YZQA 1HG8A 4XLAA 2PYHA 3GQ9A 2VFNA 3VSTA 4XLCA 3ZPPA 1DBGA 4OJOA 1TYVA 5DNSA 2UVFA 2VFPA 1O8GA 2X6XA 4OJPA 3UW0A 1OOCA 2BSPA 4HWVA 3B8YA 4V02C 1NHCA 1KCCA 1IDJA 4XLHA 3SZEA 1QA2A 4Z03A 3TH0A 2VJIA 2O6WA 2QZAA 4U4BA 3SYJA 4XQFA 4XM3A 2W7ZA 3ML3A 3H09A 4XMYA 4XKVA 4EW9A 1X0CA 2INUA 2IQ7A 1BN8A 3FY3A 4W8QA 4MXNA 4YZAA 4XOTA 1O8LA 3RIQA 4OJLA 1K8FA 4W8RA 2QXZA 4Z06A 4XKWA 1KCDA 1QRBA 2NZMA 1L1IA 3AK5A 3VSVA 3B4NA 4KH3A 1PE9A 1QJVA 2O1DA 2XTXA 3SQVA 1AIRA 2YUHA 4XOPA 3JX8A 3SUCA 2XTYA 1OFLA 1RWRA 4C2LA 1DABA 1CZFA 3KRGA 1O8KA 1TYXA 4XR6A 3SY2A 1O8EA 1IB4A 3EQNA 2UVEA 3JURA 3PSSA 4MR0A 4XN0A 2B0RA 2NSTA 1JTAA 3N90A 2XTWA 4OM9A 2BM4A 3PSZA 1O88A 2VJJA 2X6YA 3PETA 5C1CA 1H80A 2BX6A 2V5IA 1EA0A 1LM1A 3N6ZA 2QYUA 3GQ8A 1OGOX 1O8JA 1TYWA 2XC1A 4AVZA 3VMVA 5JLVC 3GQ7A 1BHEA 2VBMA 2BM7A 1RMGA 1WXRA 2X6WA 1IA5A 1XG2A 1O8MA 4XL9A 1O8HA 1O8DA 3LJYA 4XNFA 4YELA 4XONA 2BM5A 4YEJA 2NTPA 3EQOA 3GQAA 3BH7B 2O17A 4YCQA 2NSPA 1QRCA 1OFDA 5C1EA 4OJ5A 1QA3A 4W8TA 1PLUA 2G0YA 2NTQA 2VBEA 2QY1A 2XT2A 4U49A 1HF2A 3BH6B 2NT9A 1OFEA 5AMVA
chains in the Genus database with same CATH topology
3DU1X 2XT4A 3NAWA 2J8KA 3NB2A 4YFOA 2QYUA 2XTXA 5DNSA 3SQVA 2XTYA 4YDTA 4YCQA 3SY2A 4YC5A 2O6WA 2QZAA 3PSSA 2XT2A 4YEIA 2XTWA 3PSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DU1 X;  2XT4 A;  3NAW A;  2J8K A;  3NB2 A;  4YFO A;  2QYU A;  2XTX A;  5DNS A;  3SQV A;  2XTY A;  4YDT A;  4YCQ A;  3SY2 A;  4YC5 A;  2O6W A;  2QZA A;  3PSS A;  2XT2 A;  4YEI A;  2XTW A;  3PSZ A; 
#chains in the Genus database with same CATH topology
 5JMC B;  4OPW A;  1OFM A;  2XT4 A;  2X85 A;  3NAW A;  2J8K A;  1JRG A;  1RU4 A;  1LLZ A;  2O0V A;  4YZ0 A;  1KQ5 A;  2NTB A;  4YFO A;  1KTW A;  1O8F A;  2VFM A;  1WMR A;  3WWG A;  2F3L A;  2IOU G;  3P4G A;  2J8I A;  4Z05 A;  4OZZ A;  4XOR A;  1QA1 A;  1PXZ A;  1O8I A;  1QQ1 A;  2BM6 A;  2VBK A;  4I84 A;  3B90 A;  1K5C A;  2X3H A;  2PYG A;  3T9G A;  1GQ8 A;  2ODL A;  4JRA C;  4YDT A;  4XLE A;  1EZG A;  2O04 A;  4YC5 A;  2VFQ A;  4OJ6 A;  3LMW A;  3VMW A;  3LYC A;  4XN3 A;  1K4Z A;  4W8S A;  3VSU A;  3ZSC A;  4YEI A;  1EE6 A;  2NT6 A;  3GRH A;  2QX3 A;  1IDK A;  1DBO A;  3DU1 X;  2INV A;  2PEC A;  2Z8G A;  4NK6 A;  1CLW A;  1LLW A;  3NB2 A;  4OZY A;  4XLF A;  2EWE A;  1QCX A;  1VBL A;  2O0W A;  1TSP A;  1TYU A;  4PMH A;  4URR A;  1OGM X;  2VFO A;  4NK8 A;  4YZX A;  4YZQ A;  1HG8 A;  4XLA A;  2PYH A;  3GQ9 A;  2VFN A;  3VST A;  4XLC A;  3ZPP A;  1DBG A;  4OJO A;  1TYV A;  5DNS A;  2UVF A;  2VFP A;  1O8G A;  2X6X A;  4OJP A;  3UW0 A;  1OOC A;  2BSP A;  4HWV A;  3B8Y A;  4V02 C;  1NHC A;  1KCC A;  1IDJ A;  4XLH A;  3SZE A;  1QA2 A;  4Z03 A;  3TH0 A;  2VJI A;  2O6W A;  2QZA A;  4U4B A;  3SYJ A;  4XQF A;  4XM3 A;  2W7Z A;  3ML3 A;  3H09 A;  4XMY A;  4XKV A;  4EW9 A;  1X0C A;  2INU A;  2IQ7 A;  1BN8 A;  3FY3 A;  4W8Q A;  4MXN A;  4YZA A;  4XOT A;  1O8L A;  3RIQ A;  4OJL A;  1K8F A;  4W8R A;  2QXZ A;  4Z06 A;  4XKW A;  1KCD A;  1QRB A;  2NZM A;  1L1I A;  3AK5 A;  3VSV A;  3B4N A;  4KH3 A;  1PE9 A;  1QJV A;  2O1D A;  2XTX A;  3SQV A;  1AIR A;  2YUH A;  4XOP A;  3JX8 A;  3SUC A;  2XTY A;  1OFL A;  1RWR A;  4C2L A;  1DAB A;  1CZF A;  3KRG A;  1O8K A;  1TYX A;  4XR6 A;  3SY2 A;  1O8E A;  1IB4 A;  3EQN A;  2UVE A;  3JUR A;  3PSS A;  4MR0 A;  4XN0 A;  2B0R A;  2NST A;  1JTA A;  3N90 A;  2XTW A;  4OM9 A;  2BM4 A;  3PSZ A;  1O88 A;  2VJJ A;  2X6Y A;  3PET A;  5C1C A;  1H80 A;  2BX6 A;  2V5I A;  1EA0 A;  1LM1 A;  3N6Z A;  2QYU A;  3GQ8 A;  1OGO X;  1O8J A;  1TYW A;  2XC1 A;  4AVZ A;  3VMV A;  5JLV C;  3GQ7 A;  1BHE A;  2VBM A;  2BM7 A;  1RMG A;  1WXR A;  2X6W A;  1IA5 A;  1XG2 A;  1O8M A;  4XL9 A;  1O8H A;  1O8D A;  3LJY A;  4XNF A;  4YEL A;  4XON A;  2BM5 A;  4YEJ A;  2NTP A;  3EQO A;  3GQA A;  3BH7 B;  2O17 A;  4YCQ A;  2NSP A;  1QRC A;  1OFD A;  5C1E A;  4OJ5 A;  1QA3 A;  4W8T A;  1PLU A;  2G0Y A;  2NTQ A;  2VBE A;  2QY1 A;  2XT2 A;  4U49 A;  1HF2 A;  3BH6 B;  2NT9 A;  1OFE A;  5AMV A; 
#chains in the Genus database with same CATH homology
 3DU1 X;  2XT4 A;  3NAW A;  2J8K A;  3NB2 A;  4YFO A;  2QYU A;  2XTX A;  5DNS A;  3SQV A;  2XTY A;  4YDT A;  4YCQ A;  3SY2 A;  4YC5 A;  2O6W A;  2QZA A;  3PSS A;  2XT2 A;  4YEI A;  2XTW A;  3PSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...