3LYCA

Crystal structure of putative pectinase (yp_001304412.1) from parabacteroides distasonis atcc 8503 at 2.30 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
241
Chain Sequence
GGDGNITTENIPVSEYDCLELEGGGMVVNYTQSDAPEGLEIKTDRNIFEKYEFNVENHKLKIRPKKEFRKHTNFRPTEFMVTANSRNLKKLAAAGSTHVNINSPLQAEEFEAGLAGSGIIQFHDTASFTNLKIEIAGSGDFVGHKVYCEELNGDMAGSNTIVLGGTVGIAEFSIAGSGTVRAFDCTMDELECKIAGSGDIEAFVVNKIKAEIAGSGSVKYKGDPQDIQKKVMGSGKIEKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Putative pectinase
publication title Crystal structure of Putative pectinase (YP_001304412.1) from Parabacteroides distasonis ATCC 8503 at 2.30 A resolution
rcsb
source organism Parabacteroides distasonis
total genus 90
structure length 241
sequence length 241
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3lycA00
3JX8A 4OPWA 3LYCA 3PETA 3LJYA
chains in the Genus database with same CATH superfamily
2O04A 4YZQA 1DABA 2NTPA 1CLWA 1K4ZA 3GQ9A 3SUCA 2QX3A 1IDJA 1EE6A 1VBLA 2XTXA 4XN0A 4YZ0A 4I84A 4MXNA 3WWGA 1L1IA 2UVFA 1TYUA 4OM9A 4YEJA 3H09A 1WMRA 2NTBA 4YZXA 3NB2A 2VBMA 4YCQA 2X85A 1BHEA 3PSSA 3BH7B 3JX8A 1QRBA 1JRGA 2Z8GA 3UW0A 1NHCA 5AMVA 1GQ8A 2X6WA 2W7ZA 1OGMX 1QJVA 2J8IA 4JRAC 2BX6A 1QQ1A 1H80A 3GQ7A 4KH3A 3NAWA 1IA5A 1KQ5A 4XKVA 1O8GA 4XNFA 1QA3A 1O8LA 5C1CA 2BM4A 5C1EA 4XL9A 2IQ7A 4W8TA 2NT6A 3P4GA 2J8KA 1LLWA 4XLCA 4OZYA 4U4BA 4XLHA 3LJYA 1TSPA 2VJJA 3T9GA 1KCCA 1OFLA 2VFNA 4YFOA 3KRGA 2ODLA 3GQAA 2PYHA 4OJOA 3VSUA 2NT9A 4OJ5A 1O8KA 4HWVA 4XN3A 3ZPPA 2PYGA 1LLZA 2O0WA 4OJ6A 5JMCB 2QZAA 1PE9A 4W8RA 4XOPA 2X6XA 2QY1A 1AIRA 2X3HA 3GQ8A 4OJLA 5DNSA 2XTYA 4C2LA 4YEIA 1WXRA 1O8JA 1QCXA 1OFDA 2XC1A 1KTWA 3GRHA 1O8FA 3VSTA 4Z06A 1K8FA 3JURA 1BN8A 3ML3A 2O1DA 2NTQA 4XOTA 4YELA 2F3LA 3B90A 4NK8A 1CZFA 2PECA 4XONA 1O8MA 2VFPA 2X6YA 3SQVA 4W8SA 3VMVA 3LMWA 4XR6A 4MR0A 4YZAA 4Z03A 2VFMA 1PLUA 1KCDA 2EWEA 1QRCA 2INVA 4EW9A 1QA1A 2XT4A 2XTWA 3DU1X 1OOCA 1RU4A 1X0CA 3TH0A 3BH6B 1DBOA 2O0VA 2QXZA 4OZZA 3SYJA 3LYCA 1HG8A 1EZGA 1O8HA 1OFMA 2G0YA 2VFQA 4XM3A 1XG2A 2BM7A 4XLAA 2BM5A 3N90A 4NK6A 3ZSCA 2VFOA 2NZMA 1DBGA 1LM1A 2O17A 2IOUG 1HF2A 1RMGA 1PXZA 2VJIA 2BM6A 4V02C 3N6ZA 2V5IA 4OPWA 4XORA 2B0RA 1TYWA 4U49A 4XLFA 4AVZA 4XMYA 2NSPA 3EQOA 3B8YA 1O8DA 1OGOX 1OFEA 4XKWA 2UVEA 5JLVC 1RWRA 3PETA 3AK5A 2XT2A 1K5CA 2O6WA 3VSVA 1O88A 4YDTA 4XQFA 2VBKA 4PMHA 3RIQA 3SZEA 2NSTA 1IB4A 3B4NA 1IDKA 3FY3A 4YC5A 1EA0A 1JTAA 3VMWA 4OJPA 1TYXA 1TYVA 3PSZA 4W8QA 2BSPA 3SY2A 2QYUA 3EQNA 2VBEA 4Z05A 4URRA 1QA2A 4XLEA 1O8IA 1O8EA 2INUA 2YUHA
chains in the Genus database with same CATH topology
2BM6A 3ML3A 4V02C 3N6ZA 1DABA 2F3LA 1CLWA 2V5IA 3P4GA 4OPWA 2B0RA 1TYWA 1K4ZA 2VFPA 3LJYA 1TSPA 2VFNA 2VFMA 4OM9A 1TYUA 1QRCA 3H09A 1QA1A 4OJOA 3PETA 5JLVC 3AK5A 4OJ5A 3RIQA 3TH0A 3SZEA 3BH7B 3BH6B 3JX8A 1QRBA 4OJ6A 3SYJA 5JMCB 3LYCA 2VFQA 2G0YA 4OJPA 1TYXA 2BM7A 4OJLA 1TYVA 2W7ZA 2BM5A 2J8IA 3N90A 4JRAC 2BX6A 2VFOA 1QQ1A 4KH3A 1WXRA 1QA2A 2IOUG 1KQ5A 2XC1A 1QA3A 1HF2A 1K8FA 2BM4A 2YUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JX8 A;  4OPW A;  3LYC A;  3PET A;  3LJY A; 
#chains in the Genus database with same CATH topology
 2O04 A;  4YZQ A;  1DAB A;  2NTP A;  1CLW A;  1K4Z A;  3GQ9 A;  3SUC A;  2QX3 A;  1IDJ A;  1EE6 A;  1VBL A;  2XTX A;  4XN0 A;  4YZ0 A;  4I84 A;  4MXN A;  3WWG A;  1L1I A;  2UVF A;  1TYU A;  4OM9 A;  4YEJ A;  3H09 A;  1WMR A;  2NTB A;  4YZX A;  3NB2 A;  2VBM A;  4YCQ A;  2X85 A;  1BHE A;  3PSS A;  3BH7 B;  3JX8 A;  1QRB A;  1JRG A;  2Z8G A;  3UW0 A;  1NHC A;  5AMV A;  1GQ8 A;  2X6W A;  2W7Z A;  1OGM X;  1QJV A;  2J8I A;  4JRA C;  2BX6 A;  1QQ1 A;  1H80 A;  3GQ7 A;  4KH3 A;  3NAW A;  1IA5 A;  1KQ5 A;  4XKV A;  1O8G A;  4XNF A;  1QA3 A;  1O8L A;  5C1C A;  2BM4 A;  5C1E A;  4XL9 A;  2IQ7 A;  4W8T A;  2NT6 A;  3P4G A;  2J8K A;  1LLW A;  4XLC A;  4OZY A;  4U4B A;  4XLH A;  3LJY A;  1TSP A;  2VJJ A;  3T9G A;  1KCC A;  1OFL A;  2VFN A;  4YFO A;  3KRG A;  2ODL A;  3GQA A;  2PYH A;  4OJO A;  3VSU A;  2NT9 A;  4OJ5 A;  1O8K A;  4HWV A;  4XN3 A;  3ZPP A;  2PYG A;  1LLZ A;  2O0W A;  4OJ6 A;  5JMC B;  2QZA A;  1PE9 A;  4W8R A;  4XOP A;  2X6X A;  2QY1 A;  1AIR A;  2X3H A;  3GQ8 A;  4OJL A;  5DNS A;  2XTY A;  4C2L A;  4YEI A;  1WXR A;  1O8J A;  1QCX A;  1OFD A;  2XC1 A;  1KTW A;  3GRH A;  1O8F A;  3VST A;  4Z06 A;  1K8F A;  3JUR A;  1BN8 A;  3ML3 A;  2O1D A;  2NTQ A;  4XOT A;  4YEL A;  2F3L A;  3B90 A;  4NK8 A;  1CZF A;  2PEC A;  4XON A;  1O8M A;  2VFP A;  2X6Y A;  3SQV A;  4W8S A;  3VMV A;  3LMW A;  4XR6 A;  4MR0 A;  4YZA A;  4Z03 A;  2VFM A;  1PLU A;  1KCD A;  2EWE A;  1QRC A;  2INV A;  4EW9 A;  1QA1 A;  2XT4 A;  2XTW A;  3DU1 X;  1OOC A;  1RU4 A;  1X0C A;  3TH0 A;  3BH6 B;  1DBO A;  2O0V A;  2QXZ A;  4OZZ A;  3SYJ A;  3LYC A;  1HG8 A;  1EZG A;  1O8H A;  1OFM A;  2G0Y A;  2VFQ A;  4XM3 A;  1XG2 A;  2BM7 A;  4XLA A;  2BM5 A;  3N90 A;  4NK6 A;  3ZSC A;  2VFO A;  2NZM A;  1DBG A;  1LM1 A;  2O17 A;  2IOU G;  1HF2 A;  1RMG A;  1PXZ A;  2VJI A;  2BM6 A;  4V02 C;  3N6Z A;  2V5I A;  4OPW A;  4XOR A;  2B0R A;  1TYW A;  4U49 A;  4XLF A;  4AVZ A;  4XMY A;  2NSP A;  3EQO A;  3B8Y A;  1O8D A;  1OGO X;  1OFE A;  4XKW A;  2UVE A;  5JLV C;  1RWR A;  3PET A;  3AK5 A;  2XT2 A;  1K5C A;  2O6W A;  3VSV A;  1O88 A;  4YDT A;  4XQF A;  2VBK A;  4PMH A;  3RIQ A;  3SZE A;  2NST A;  1IB4 A;  3B4N A;  1IDK A;  3FY3 A;  4YC5 A;  1EA0 A;  1JTA A;  3VMW A;  4OJP A;  1TYX A;  1TYV A;  3PSZ A;  4W8Q A;  2BSP A;  3SY2 A;  2QYU A;  3EQN A;  2VBE A;  4Z05 A;  4URR A;  1QA2 A;  4XLE A;  1O8I A;  1O8E A;  2INU A;  2YUH A; 
#chains in the Genus database with same CATH homology
 2BM6 A;  3ML3 A;  4V02 C;  3N6Z A;  1DAB A;  2F3L A;  1CLW A;  2V5I A;  3P4G A;  4OPW A;  2B0R A;  1TYW A;  1K4Z A;  2VFP A;  3LJY A;  1TSP A;  2VFN A;  2VFM A;  4OM9 A;  1TYU A;  1QRC A;  3H09 A;  1QA1 A;  4OJO A;  3PET A;  5JLV C;  3AK5 A;  4OJ5 A;  3RIQ A;  3TH0 A;  3SZE A;  3BH7 B;  3BH6 B;  3JX8 A;  1QRB A;  4OJ6 A;  3SYJ A;  5JMC B;  3LYC A;  2VFQ A;  2G0Y A;  4OJP A;  1TYX A;  2BM7 A;  4OJL A;  1TYV A;  2W7Z A;  2BM5 A;  2J8I A;  3N90 A;  4JRA C;  2BX6 A;  2VFO A;  1QQ1 A;  4KH3 A;  1WXR A;  1QA2 A;  2IOU G;  1KQ5 A;  2XC1 A;  1QA3 A;  1HF2 A;  1K8F A;  2BM4 A;  2YUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...