3LYCA

Crystal structure of putative pectinase (yp_001304412.1) from parabacteroides distasonis atcc 8503 at 2.30 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
241
Chain Sequence
GGDGNITTENIPVSEYDCLELEGGGMVVNYTQSDAPEGLEIKTDRNIFEKYEFNVENHKLKIRPKKEFRKHTNFRPTEFMVTANSRNLKKLAAAGSTHVNINSPLQAEEFEAGLAGSGIIQFHDTASFTNLKIEIAGSGDFVGHKVYCEELNGDMAGSNTIVLGGTVGIAEFSIAGSGTVRAFDCTMDELECKIAGSGDIEAFVVNKIKAEIAGSGSVKYKGDPQDIQKKVMGSGKIEKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative pectinase (YP_001304412.1) from Parabacteroides distasonis ATCC 8503 at 2.30 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Cell adhesion
molecule keywords Putative pectinase
total genus 90
structure length 241
sequence length 241
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3lycA00
3JX8A 3LYCA 4OPWA 3LJYA 3PETA
chains in the Genus database with same CATH superfamily
1PXZA 4Z03A 1LLWA 1QJVA 1RMGA 2VFNA 4OPWA 4YELA 3AK5A 2PECA 2UVEA 1K4ZA 1PE9A 2BM5A 3B90A 3PETA 1O8LA 1OGOX 2XC1A 2XTXA 4XKWA 1KTWA 1NHCA 3NAWA 1O8DA 4XLFA 3N90A 2VBMA 1HG8A 4XOPA 2O1DA 2XT2A 1XG2A 2X6YA 1CZFA 3JX8A 4MR0A 4W8QA 2W7ZA 1BHEA 3FY3A 4OJ6A 2ODLA 3WWGA 3SUCA 2BM6A 2QZAA 2V5IA 1KQ5A 4XL9A 1DABA 4YEIA 2NSPA 5JLVC 5C1EA 3SZEA 5AMVA 1JRGA 1RWRA 4Z06A 2G0YA 2NTPA 2Z8GA 2VFQA 1O8JA 1QQ1A 1O8FA 3UW0A 3GQ7A 1KCCA 4OZZA 4URRA 3H09A 4XLHA 2X6XA 3BH6B 3VMVA 5C1CA 4I84A 4NK6A 2J8IA 4W8TA 4OJPA 4HWVA 4XOTA 4U4BA 2VJIA 2VBEA 1OFEA 1TSPA 1BN8A 2XTWA 1OFMA 1WMRA 4PMHA 1LLZA 2BSPA 4MXNA 4Z05A 1O8HA 3PSZA 2XTYA 3ML3A 4OJ5A 1QRCA 4YFOA 1QA3A 3VMWA 4XN3A 3LJYA 2NTQA 4OJOA 3SQVA 4OJLA 3T9GA 3LMWA 1O8KA 1IDJA 2PYGA 1OOCA 3B8YA 5DNSA 5JMCB 2IQ7A 4XMYA 3NB2A 1QA1A 4YEJA 4XLAA 1L1IA 2X6WA 1LM1A 4XN0A 3PSSA 4EW9A 1TYWA 4YDTA 2VBKA 1VBLA 2NSTA 4JRAC 1QRBA 2F3LA 1O88A 4NK8A 4XLEA 4V02C 1K5CA 3VSUA 3GQ8A 4KH3A 1EE6A 4XQFA 4YC5A 2QY1A 1X0CA 2BM4A 1TYVA 2NTBA 3SY2A 3ZSCA 2O0WA 2NZMA 2BM7A 2UVFA 3ZPPA 1HF2A 1O8GA 4XM3A 4YZ0A 1H80A 2INVA 3GQAA 4C2LA 2IOUG 3GQ9A 3DU1X 1DBGA 4YZAA 3RIQA 2BX6A 1DBOA 1O8EA 4W8RA 2INUA 2O6WA 1GQ8A 1O8MA 4XR6A 2XT4A 1QCXA 2VFPA 2X85A 4XKVA 2J8KA 2B0RA 3JURA 3B4NA 3BH7B 4OM9A 2X3HA 1WXRA 1IDKA 2PYHA 2VJJA 2YUHA 4W8SA 3N6ZA 3KRGA 3P4GA 1TYXA 3TH0A 1TYUA 1JTAA 1OFLA 2VFMA 2QYUA 1K8FA 4OZYA 4U49A 4XNFA 4YZXA 4AVZA 1EA0A 3LYCA 4XORA 1OFDA 2NT6A 1KCDA 2QX3A 1QA2A 3VSVA 1O8IA 2O04A 2NT9A 3EQNA 4XONA 1OGMX 1IB4A 3EQOA 3SYJA 1EZGA 2VFOA 1AIRA 2O0VA 2O17A 2QXZA 3VSTA 1CLWA 1PLUA 4XLCA 2EWEA 4YZQA 1IA5A 3GRHA 1RU4A 4YCQA
chains in the Genus database with same CATH topology
4OM9A 1WXRA 1TYWA 2J8IA 2VFNA 3AK5A 4OPWA 4JRAC 3BH6B 4OJPA 1QRBA 2F3LA 2YUHA 1K4ZA 2BM5A 3PETA 3N6ZA 2XC1A 4V02C 3P4GA 1TYXA 1TSPA 3TH0A 1TYUA 2VFMA 3N90A 1K8FA 4KH3A 2BM4A 1TYVA 3JX8A 2BM7A 2W7ZA 3LYCA 3ML3A 1HF2A 1QRCA 4OJ5A 4OJ6A 1QA3A 2BM6A 3LJYA 2V5IA 1KQ5A 2IOUG 4OJOA 4OJLA 1DABA 5JLVC 1QA2A 3SZEA 3RIQA 2BX6A 5JMCB 3SYJA 2G0YA 2VFOA 2VFQA 1QA1A 2VFPA 1CLWA 1QQ1A 2B0RA 3H09A 3BH7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JX8 A;  3LYC A;  4OPW A;  3LJY A;  3PET A; 
#chains in the Genus database with same CATH topology
 1PXZ A;  4Z03 A;  1LLW A;  1QJV A;  1RMG A;  2VFN A;  4OPW A;  4YEL A;  3AK5 A;  2PEC A;  2UVE A;  1K4Z A;  1PE9 A;  2BM5 A;  3B90 A;  3PET A;  1O8L A;  1OGO X;  2XC1 A;  2XTX A;  4XKW A;  1KTW A;  1NHC A;  3NAW A;  1O8D A;  4XLF A;  3N90 A;  2VBM A;  1HG8 A;  4XOP A;  2O1D A;  2XT2 A;  1XG2 A;  2X6Y A;  1CZF A;  3JX8 A;  4MR0 A;  4W8Q A;  2W7Z A;  1BHE A;  3FY3 A;  4OJ6 A;  2ODL A;  3WWG A;  3SUC A;  2BM6 A;  2QZA A;  2V5I A;  1KQ5 A;  4XL9 A;  1DAB A;  4YEI A;  2NSP A;  5JLV C;  5C1E A;  3SZE A;  5AMV A;  1JRG A;  1RWR A;  4Z06 A;  2G0Y A;  2NTP A;  2Z8G A;  2VFQ A;  1O8J A;  1QQ1 A;  1O8F A;  3UW0 A;  3GQ7 A;  1KCC A;  4OZZ A;  4URR A;  3H09 A;  4XLH A;  2X6X A;  3BH6 B;  3VMV A;  5C1C A;  4I84 A;  4NK6 A;  2J8I A;  4W8T A;  4OJP A;  4HWV A;  4XOT A;  4U4B A;  2VJI A;  2VBE A;  1OFE A;  1TSP A;  1BN8 A;  2XTW A;  1OFM A;  1WMR A;  4PMH A;  1LLZ A;  2BSP A;  4MXN A;  4Z05 A;  1O8H A;  3PSZ A;  2XTY A;  3ML3 A;  4OJ5 A;  1QRC A;  4YFO A;  1QA3 A;  3VMW A;  4XN3 A;  3LJY A;  2NTQ A;  4OJO A;  3SQV A;  4OJL A;  3T9G A;  3LMW A;  1O8K A;  1IDJ A;  2PYG A;  1OOC A;  3B8Y A;  5DNS A;  5JMC B;  2IQ7 A;  4XMY A;  3NB2 A;  1QA1 A;  4YEJ A;  4XLA A;  1L1I A;  2X6W A;  1LM1 A;  4XN0 A;  3PSS A;  4EW9 A;  1TYW A;  4YDT A;  2VBK A;  1VBL A;  2NST A;  4JRA C;  1QRB A;  2F3L A;  1O88 A;  4NK8 A;  4XLE A;  4V02 C;  1K5C A;  3VSU A;  3GQ8 A;  4KH3 A;  1EE6 A;  4XQF A;  4YC5 A;  2QY1 A;  1X0C A;  2BM4 A;  1TYV A;  2NTB A;  3SY2 A;  3ZSC A;  2O0W A;  2NZM A;  2BM7 A;  2UVF A;  3ZPP A;  1HF2 A;  1O8G A;  4XM3 A;  4YZ0 A;  1H80 A;  2INV A;  3GQA A;  4C2L A;  2IOU G;  3GQ9 A;  3DU1 X;  1DBG A;  4YZA A;  3RIQ A;  2BX6 A;  1DBO A;  1O8E A;  4W8R A;  2INU A;  2O6W A;  1GQ8 A;  1O8M A;  4XR6 A;  2XT4 A;  1QCX A;  2VFP A;  2X85 A;  4XKV A;  2J8K A;  2B0R A;  3JUR A;  3B4N A;  3BH7 B;  4OM9 A;  2X3H A;  1WXR A;  1IDK A;  2PYH A;  2VJJ A;  2YUH A;  4W8S A;  3N6Z A;  3KRG A;  3P4G A;  1TYX A;  3TH0 A;  1TYU A;  1JTA A;  1OFL A;  2VFM A;  2QYU A;  1K8F A;  4OZY A;  4U49 A;  4XNF A;  4YZX A;  4AVZ A;  1EA0 A;  3LYC A;  4XOR A;  1OFD A;  2NT6 A;  1KCD A;  2QX3 A;  1QA2 A;  3VSV A;  1O8I A;  2O04 A;  2NT9 A;  3EQN A;  4XON A;  1OGM X;  1IB4 A;  3EQO A;  3SYJ A;  1EZG A;  2VFO A;  1AIR A;  2O0V A;  2O17 A;  2QXZ A;  3VST A;  1CLW A;  1PLU A;  4XLC A;  2EWE A;  4YZQ A;  1IA5 A;  3GRH A;  1RU4 A;  4YCQ A; 
#chains in the Genus database with same CATH homology
 4OM9 A;  1WXR A;  1TYW A;  2J8I A;  2VFN A;  3AK5 A;  4OPW A;  4JRA C;  3BH6 B;  4OJP A;  1QRB A;  2F3L A;  2YUH A;  1K4Z A;  2BM5 A;  3PET A;  3N6Z A;  2XC1 A;  4V02 C;  3P4G A;  1TYX A;  1TSP A;  3TH0 A;  1TYU A;  2VFM A;  3N90 A;  1K8F A;  4KH3 A;  2BM4 A;  1TYV A;  3JX8 A;  2BM7 A;  2W7Z A;  3LYC A;  3ML3 A;  1HF2 A;  1QRC A;  4OJ5 A;  4OJ6 A;  1QA3 A;  2BM6 A;  3LJY A;  2V5I A;  1KQ5 A;  2IOU G;  4OJO A;  4OJL A;  1DAB A;  5JLV C;  1QA2 A;  3SZE A;  3RIQ A;  2BX6 A;  5JMC B;  3SYJ A;  2G0Y A;  2VFO A;  2VFQ A;  1QA1 A;  2VFP A;  1CLW A;  1QQ1 A;  2B0R A;  3H09 A;  3BH7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...