3LYCA

Crystal structure of putative pectinase (yp_001304412.1) from parabacteroides distasonis atcc 8503 at 2.30 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
241
Chain Sequence
GGDGNITTENIPVSEYDCLELEGGGMVVNYTQSDAPEGLEIKTDRNIFEKYEFNVENHKLKIRPKKEFRKHTNFRPTEFMVTANSRNLKKLAAAGSTHVNINSPLQAEEFEAGLAGSGIIQFHDTASFTNLKIEIAGSGDFVGHKVYCEELNGDMAGSNTIVLGGTVGIAEFSIAGSGTVRAFDCTMDELECKIAGSGDIEAFVVNKIKAEIAGSGSVKYKGDPQDIQKKVMGSGKIEKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative pectinase
publication title Crystal structure of Putative pectinase (YP_001304412.1) from Parabacteroides distasonis ATCC 8503 at 2.30 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Cell adhesion
total genus 90
structure length 241
sequence length 241
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3lycA00
4OPWA 3LJYA 3JX8A 3PETA 3LYCA
chains in the Genus database with same CATH superfamily
4MXNA 4YCQA 4W8SA 1PE9A 2J8IA 2BM5A 3PSZA 1KQ5A 1VBLA 4Z05A 1TYUA 1GQ8A 2XC1A 3H09A 2V5IA 1O88A 2INVA 2IOUG 4PMHA 4HWVA 2PYGA 4W8QA 2PYHA 3N90A 1KCDA 4NK8A 3EQOA 4XN3A 3T9GA 2QYUA 3JURA 3ZSCA 4XLAA 4XKWA 1OGOX 4U4BA 4W8RA 1QQ1A 1TYXA 2X3HA 2VJIA 3GRHA 1KTWA 2QXZA 2XTYA 4OZZA 4AVZA 1HG8A 2UVEA 1PXZA 1IDKA 2BX6A 4XOPA 3FY3A 3VSUA 3RIQA 2X6WA 3KRGA 3SQVA 2J8KA 2QX3A 2O0VA 2UVFA 2BM6A 4Z06A 1IB4A 2BM4A 4XM3A 2VBMA 2VBKA 1OGMX 4XKVA 5C1CA 4YZXA 3LJYA 1AIRA 4XN0A 1OFLA 2BSPA 4YFOA 3AK5A 1QA3A 3LYCA 4XQFA 4Z03A 1JRGA 1QA2A 3N6ZA 1JTAA 2B0RA 1EZGA 1O8GA 1O8HA 3GQAA 2O1DA 1OFEA 4YELA 1DBGA 2IQ7A 4XLCA 3WWGA 2VFPA 3VMVA 1RWRA 2O17A 4XR6A 1WMRA 2INUA 4JRAC 3SZEA 4OPWA 2ODLA 2O04A 3P4GA 3NAWA 4OZYA 4YZAA 1KCCA 1K5CA 3EQNA 3PSSA 1EA0A 3GQ9A 1HF2A 4XLFA 1O8DA 1QCXA 1OFDA 2XT4A 2VJJA 2X85A 1K4ZA 2X6YA 2XTXA 4XNFA 3VSVA 1DABA 4YEIA 3ZPPA 4YZ0A 4XONA 1TYVA 2NTPA 2PECA 1OOCA 1RU4A 3BH7B 4I84A 4XMYA 3BH6B 1RMGA 1O8JA 4OJOA 1O8LA 4EW9A 4V02C 1CZFA 4XL9A 5C1EA 1EE6A 4OJ6A 2NSTA 1LLZA 2NTBA 5DNSA 2Z8GA 2XT2A 2XTWA 1LM1A 3B90A 1BHEA 2VFNA 2X6XA 3B4NA 2VFOA 5JMCB 4YC5A 1O8EA 4XOTA 2QZAA 5AMVA 1QJVA 4W8TA 2VFQA 4OJ5A 5JLVC 4XLEA 2NTQA 3VMWA 2NZMA 1TSPA 2QY1A 3LMWA 4MR0A 3VSTA 1QA1A 3SUCA 4YZQA 4C2LA 1IA5A 4YEJA 1BN8A 3NB2A 4URRA 1XG2A 4OM9A 4XLHA 2VFMA 3GQ7A 2NSPA 1X0CA 2O0WA 2NT9A 3B8YA 2W7ZA 4YDTA 3JX8A 4NK6A 3ML3A 3GQ8A 1IDJA 3PETA 1K8FA 4U49A 1NHCA 3SY2A 1CLWA 2G0YA 2NT6A 2VBEA 1QRBA 1O8KA 1DBOA 2O6WA 2EWEA 2YUHA 1O8FA 2BM7A 2F3LA 1LLWA 1O8IA 1OFMA 3TH0A 1L1IA 1QRCA 3SYJA 1O8MA 1PLUA 1TYWA 3DU1X 4OJLA 4XORA 4OJPA 1H80A 1WXRA 4KH3A 3UW0A
chains in the Genus database with same CATH topology
3RIQA 2J8IA 2BM5A 1K4ZA 1DABA 1KQ5A 2BM6A 2BM4A 1TYUA 4OM9A 2VFMA 2XC1A 1TYVA 3BH7B 2V5IA 3H09A 2W7ZA 2IOUG 3JX8A 1HF2A 3LJYA 3ML3A 3BH6B 4OJOA 3PETA 1K8FA 3LYCA 3N90A 4V02C 1CLWA 2G0YA 1QA3A 3AK5A 1QA2A 1QRBA 2B0RA 3N6ZA 4OJ6A 2YUHA 2BM7A 2F3LA 3TH0A 2VFPA 1QQ1A 1QRCA 1TYXA 2VFNA 2VFOA 3SYJA 1TYWA 4JRAC 5JMCB 3SZEA 4OPWA 4OJLA 4OJPA 3P4GA 2BX6A 2VFQA 4OJ5A 5JLVC 1WXRA 4KH3A 1TSPA 1QA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPW A;  3LJY A;  3JX8 A;  3PET A;  3LYC A; 
#chains in the Genus database with same CATH topology
 4MXN A;  4YCQ A;  4W8S A;  1PE9 A;  2J8I A;  2BM5 A;  3PSZ A;  1KQ5 A;  1VBL A;  4Z05 A;  1TYU A;  1GQ8 A;  2XC1 A;  3H09 A;  2V5I A;  1O88 A;  2INV A;  2IOU G;  4PMH A;  4HWV A;  2PYG A;  4W8Q A;  2PYH A;  3N90 A;  1KCD A;  4NK8 A;  3EQO A;  4XN3 A;  3T9G A;  2QYU A;  3JUR A;  3ZSC A;  4XLA A;  4XKW A;  1OGO X;  4U4B A;  4W8R A;  1QQ1 A;  1TYX A;  2X3H A;  2VJI A;  3GRH A;  1KTW A;  2QXZ A;  2XTY A;  4OZZ A;  4AVZ A;  1HG8 A;  2UVE A;  1PXZ A;  1IDK A;  2BX6 A;  4XOP A;  3FY3 A;  3VSU A;  3RIQ A;  2X6W A;  3KRG A;  3SQV A;  2J8K A;  2QX3 A;  2O0V A;  2UVF A;  2BM6 A;  4Z06 A;  1IB4 A;  2BM4 A;  4XM3 A;  2VBM A;  2VBK A;  1OGM X;  4XKV A;  5C1C A;  4YZX A;  3LJY A;  1AIR A;  4XN0 A;  1OFL A;  2BSP A;  4YFO A;  3AK5 A;  1QA3 A;  3LYC A;  4XQF A;  4Z03 A;  1JRG A;  1QA2 A;  3N6Z A;  1JTA A;  2B0R A;  1EZG A;  1O8G A;  1O8H A;  3GQA A;  2O1D A;  1OFE A;  4YEL A;  1DBG A;  2IQ7 A;  4XLC A;  3WWG A;  2VFP A;  3VMV A;  1RWR A;  2O17 A;  4XR6 A;  1WMR A;  2INU A;  4JRA C;  3SZE A;  4OPW A;  2ODL A;  2O04 A;  3P4G A;  3NAW A;  4OZY A;  4YZA A;  1KCC A;  1K5C A;  3EQN A;  3PSS A;  1EA0 A;  3GQ9 A;  1HF2 A;  4XLF A;  1O8D A;  1QCX A;  1OFD A;  2XT4 A;  2VJJ A;  2X85 A;  1K4Z A;  2X6Y A;  2XTX A;  4XNF A;  3VSV A;  1DAB A;  4YEI A;  3ZPP A;  4YZ0 A;  4XON A;  1TYV A;  2NTP A;  2PEC A;  1OOC A;  1RU4 A;  3BH7 B;  4I84 A;  4XMY A;  3BH6 B;  1RMG A;  1O8J A;  4OJO A;  1O8L A;  4EW9 A;  4V02 C;  1CZF A;  4XL9 A;  5C1E A;  1EE6 A;  4OJ6 A;  2NST A;  1LLZ A;  2NTB A;  5DNS A;  2Z8G A;  2XT2 A;  2XTW A;  1LM1 A;  3B90 A;  1BHE A;  2VFN A;  2X6X A;  3B4N A;  2VFO A;  5JMC B;  4YC5 A;  1O8E A;  4XOT A;  2QZA A;  5AMV A;  1QJV A;  4W8T A;  2VFQ A;  4OJ5 A;  5JLV C;  4XLE A;  2NTQ A;  3VMW A;  2NZM A;  1TSP A;  2QY1 A;  3LMW A;  4MR0 A;  3VST A;  1QA1 A;  3SUC A;  4YZQ A;  4C2L A;  1IA5 A;  4YEJ A;  1BN8 A;  3NB2 A;  4URR A;  1XG2 A;  4OM9 A;  4XLH A;  2VFM A;  3GQ7 A;  2NSP A;  1X0C A;  2O0W A;  2NT9 A;  3B8Y A;  2W7Z A;  4YDT A;  3JX8 A;  4NK6 A;  3ML3 A;  3GQ8 A;  1IDJ A;  3PET A;  1K8F A;  4U49 A;  1NHC A;  3SY2 A;  1CLW A;  2G0Y A;  2NT6 A;  2VBE A;  1QRB A;  1O8K A;  1DBO A;  2O6W A;  2EWE A;  2YUH A;  1O8F A;  2BM7 A;  2F3L A;  1LLW A;  1O8I A;  1OFM A;  3TH0 A;  1L1I A;  1QRC A;  3SYJ A;  1O8M A;  1PLU A;  1TYW A;  3DU1 X;  4OJL A;  4XOR A;  4OJP A;  1H80 A;  1WXR A;  4KH3 A;  3UW0 A; 
#chains in the Genus database with same CATH homology
 3RIQ A;  2J8I A;  2BM5 A;  1K4Z A;  1DAB A;  1KQ5 A;  2BM6 A;  2BM4 A;  1TYU A;  4OM9 A;  2VFM A;  2XC1 A;  1TYV A;  3BH7 B;  2V5I A;  3H09 A;  2W7Z A;  2IOU G;  3JX8 A;  1HF2 A;  3LJY A;  3ML3 A;  3BH6 B;  4OJO A;  3PET A;  1K8F A;  3LYC A;  3N90 A;  4V02 C;  1CLW A;  2G0Y A;  1QA3 A;  3AK5 A;  1QA2 A;  1QRB A;  2B0R A;  3N6Z A;  4OJ6 A;  2YUH A;  2BM7 A;  2F3L A;  3TH0 A;  2VFP A;  1QQ1 A;  1QRC A;  1TYX A;  2VFN A;  2VFO A;  3SYJ A;  1TYW A;  4JRA C;  5JMC B;  3SZE A;  4OPW A;  4OJL A;  4OJP A;  3P4G A;  2BX6 A;  2VFQ A;  4OJ5 A;  5JLV C;  1WXR A;  4KH3 A;  1TSP A;  1QA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...