3P4GA

X-ray crystal structure of a hyperactive, ca2+-dependent, beta-helical antifreeze protein from an antarctic bacterium
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
301
structure length
301
Chain Sequence
HSFDHYIGSAFDASNNNVAVTGNVSATLNVLAGDDKVSIDGNVEDVLVAANVAVLDMGTGNDQLYVAGDVLGKIDAGTGNDEIYIKGDVSAAVDAGTGNDEVYIGGNLSGDLDAGTDNDNIQIGGDVNAALNAGTGNDNLIIGHDVSGIVNMGTDNDTVEVGRTINASGKVLLDTGDDSLLVSGDLFGEVDGGTGNDTIIIAGKVSGNIQGGTGNDIVRVQSQVWAEANISLGTGDDVLIVEHELHGTVAGNEGDDSIYLKFYTKEQYNNNSDLRNRVANFEHIRVSDGVVKGSPADFADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antifreeze protein
publication title Anchored clathrate waters bind antifreeze proteins to ice.
pubmed doi rcsb
source organism Marinomonas primoryensis
molecule tags Antifreeze protein
total genus 109
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18815 AFP_2 Bacterial antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.160 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3p4gA00
3P4GA
chains in the Genus database with same CATH superfamily
4NK8A 1DBOA 1KTWA 1O8FA 1LLWA 2IOUG 2VFPA 2W7ZA 3H09A 4V02C 3SY2A 4I84A 1TYUA 4OZZA 2O1DA 4XKWA 1EA0A 3VMWA 1PE9A 1TSPA 4XLAA 1RU4A 3B4NA 1O8IA 1LM1A 4XOTA 2B0RA 4PMHA 4OJ6A 2NTBA 1QRCA 2J8IA 3LMWA 4W8TA 4YDTA 4HWVA 3SUCA 2NSTA 5AMVA 4XR6A 1RWRA 1OOCA 1K8FA 2UVEA 1CLWA 4XQFA 1K4ZA 3GQAA 2INVA 1JTAA 4Z03A 2VFNA 2BM7A 3B90A 2VFOA 2VFQA 5JLVC 1O8JA 4YZ0A 3TH0A 1H80A 4YELA 2XTWA 1OFLA 2NZMA 3AK5A 1PLUA 4W8RA 3UW0A 3LYCA 1OGMX 4Z06A 3B8YA 3VMVA 2XC1A 4XNFA 1IDKA 1O8KA 2X3HA 3FY3A 3NB2A 4XN0A 4W8SA 1AIRA 1O88A 2G0YA 4MXNA 4YZAA 1IB4A 3SZEA 1IDJA 4XLFA 2X6XA 1VBLA 4YEIA 2XTYA 2PYHA 1EZGA 1O8DA 4C2LA 4U4BA 2QZAA 1TYXA 1QCXA 5C1CA 1L1IA 1JRGA 3GQ8A 3LJYA 4XLHA 1IA5A 1QRBA 3SYJA 3GQ7A 3N6ZA 3PSSA 4EW9A 1O8LA 2BM5A 2QY1A 1CZFA 3DU1X 2YUHA 4XKVA 4YEJA 3SQVA 3BH6B 4YZQA 2X85A 3WWGA 2V5IA 3ZSCA 1QA1A 3GQ9A 1QQ1A 4JRAC 3P4GA 2X6YA 4OJ5A 3NAWA 1BHEA 4YZXA 3BH7B 2IQ7A 3KRGA 4OJPA 2O04A 2O17A 1O8EA 1KQ5A 3VSUA 4XOPA 1TYWA 2EWEA 4OJOA 2NT6A 1KCCA 2UVFA 2NTPA 5C1EA 2VBMA 1O8MA 3PETA 4KH3A 3ML3A 2XTXA 1QA3A 1RMGA 4U49A 5JMCB 4XM3A 2VJIA 2BX6A 1O8GA 4Z05A 4YFOA 4XONA 3EQOA 1OGOX 2X6WA 2O0WA 3ZPPA 3JX8A 3T9GA 1GQ8A 4MR0A 1HF2A 1TYVA 2F3LA 2PECA 1DABA 4OPWA 1WMRA 1PXZA 1BN8A 4XMYA 1K5CA 2XT4A 2ODLA 4YC5A 1QJVA 2NTQA 4W8QA 1O8HA 3GRHA 1OFEA 3JURA 1QA2A 1X0CA 2NT9A 2BM6A 3VSTA 1WXRA 2VJJA 1KCDA 1XG2A 1LLZA 2PYGA 4XN3A 2J8KA 2QXZA 2Z8GA 2NSPA 4XL9A 4OZYA 4XORA 3N90A 4NK6A 3PSZA 5DNSA 4YCQA 1OFMA 2BM4A 1NHCA 4AVZA 4OM9A 2QYUA 3RIQA 2BSPA 2VBKA 3VSVA 2INUA 1HG8A 1DBGA 3EQNA 1EE6A 2O0VA 2XT2A 4XLEA 4OJLA 2QX3A 4XLCA 2VBEA 2VFMA 4URRA 1OFDA 2O6WA
chains in the Genus database with same CATH topology
3AK5A 1QA1A 2IOUG 1QQ1A 3H09A 2W7ZA 2VFPA 3LYCA 4V02C 4JRAC 3P4GA 1TYUA 4OJ5A 2XC1A 2BM6A 1TSPA 1WXRA 3BH7B 4OJPA 2B0RA 4OJ6A 1QA2A 1KQ5A 1QRCA 2G0YA 2J8IA 3SZEA 1TYWA 4OJOA 1K8FA 1CLWA 3PETA 4KH3A 3ML3A 1K4ZA 1QA3A 3N90A 5JMCB 2BM4A 2BX6A 1TYXA 4OM9A 2VFNA 3LJYA 2BM7A 3RIQA 1QRBA 2VFOA 3SYJA 2VFQA 3N6ZA 3JX8A 5JLVC 1HF2A 1TYVA 2BM5A 2F3LA 3TH0A 4OPWA 4OJLA 1DABA 2YUHA 2VFMA 3BH6B 2V5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4G A; 
#chains in the Genus database with same CATH topology
 4NK8 A;  1DBO A;  1KTW A;  1O8F A;  1LLW A;  2IOU G;  2VFP A;  2W7Z A;  3H09 A;  4V02 C;  3SY2 A;  4I84 A;  1TYU A;  4OZZ A;  2O1D A;  4XKW A;  1EA0 A;  3VMW A;  1PE9 A;  1TSP A;  4XLA A;  1RU4 A;  3B4N A;  1O8I A;  1LM1 A;  4XOT A;  2B0R A;  4PMH A;  4OJ6 A;  2NTB A;  1QRC A;  2J8I A;  3LMW A;  4W8T A;  4YDT A;  4HWV A;  3SUC A;  2NST A;  5AMV A;  4XR6 A;  1RWR A;  1OOC A;  1K8F A;  2UVE A;  1CLW A;  4XQF A;  1K4Z A;  3GQA A;  2INV A;  1JTA A;  4Z03 A;  2VFN A;  2BM7 A;  3B90 A;  2VFO A;  2VFQ A;  5JLV C;  1O8J A;  4YZ0 A;  3TH0 A;  1H80 A;  4YEL A;  2XTW A;  1OFL A;  2NZM A;  3AK5 A;  1PLU A;  4W8R A;  3UW0 A;  3LYC A;  1OGM X;  4Z06 A;  3B8Y A;  3VMV A;  2XC1 A;  4XNF A;  1IDK A;  1O8K A;  2X3H A;  3FY3 A;  3NB2 A;  4XN0 A;  4W8S A;  1AIR A;  1O88 A;  2G0Y A;  4MXN A;  4YZA A;  1IB4 A;  3SZE A;  1IDJ A;  4XLF A;  2X6X A;  1VBL A;  4YEI A;  2XTY A;  2PYH A;  1EZG A;  1O8D A;  4C2L A;  4U4B A;  2QZA A;  1TYX A;  1QCX A;  5C1C A;  1L1I A;  1JRG A;  3GQ8 A;  3LJY A;  4XLH A;  1IA5 A;  1QRB A;  3SYJ A;  3GQ7 A;  3N6Z A;  3PSS A;  4EW9 A;  1O8L A;  2BM5 A;  2QY1 A;  1CZF A;  3DU1 X;  2YUH A;  4XKV A;  4YEJ A;  3SQV A;  3BH6 B;  4YZQ A;  2X85 A;  3WWG A;  2V5I A;  3ZSC A;  1QA1 A;  3GQ9 A;  1QQ1 A;  4JRA C;  3P4G A;  2X6Y A;  4OJ5 A;  3NAW A;  1BHE A;  4YZX A;  3BH7 B;  2IQ7 A;  3KRG A;  4OJP A;  2O04 A;  2O17 A;  1O8E A;  1KQ5 A;  3VSU A;  4XOP A;  1TYW A;  2EWE A;  4OJO A;  2NT6 A;  1KCC A;  2UVF A;  2NTP A;  5C1E A;  2VBM A;  1O8M A;  3PET A;  4KH3 A;  3ML3 A;  2XTX A;  1QA3 A;  1RMG A;  4U49 A;  5JMC B;  4XM3 A;  2VJI A;  2BX6 A;  1O8G A;  4Z05 A;  4YFO A;  4XON A;  3EQO A;  1OGO X;  2X6W A;  2O0W A;  3ZPP A;  3JX8 A;  3T9G A;  1GQ8 A;  4MR0 A;  1HF2 A;  1TYV A;  2F3L A;  2PEC A;  1DAB A;  4OPW A;  1WMR A;  1PXZ A;  1BN8 A;  4XMY A;  1K5C A;  2XT4 A;  2ODL A;  4YC5 A;  1QJV A;  2NTQ A;  4W8Q A;  1O8H A;  3GRH A;  1OFE A;  3JUR A;  1QA2 A;  1X0C A;  2NT9 A;  2BM6 A;  3VST A;  1WXR A;  2VJJ A;  1KCD A;  1XG2 A;  1LLZ A;  2PYG A;  4XN3 A;  2J8K A;  2QXZ A;  2Z8G A;  2NSP A;  4XL9 A;  4OZY A;  4XOR A;  3N90 A;  4NK6 A;  3PSZ A;  5DNS A;  4YCQ A;  1OFM A;  2BM4 A;  1NHC A;  4AVZ A;  4OM9 A;  2QYU A;  3RIQ A;  2BSP A;  2VBK A;  3VSV A;  2INU A;  1HG8 A;  1DBG A;  3EQN A;  1EE6 A;  2O0V A;  2XT2 A;  4XLE A;  4OJL A;  2QX3 A;  4XLC A;  2VBE A;  2VFM A;  4URR A;  1OFD A;  2O6W A; 
#chains in the Genus database with same CATH homology
 3AK5 A;  1QA1 A;  2IOU G;  1QQ1 A;  3H09 A;  2W7Z A;  2VFP A;  3LYC A;  4V02 C;  4JRA C;  3P4G A;  1TYU A;  4OJ5 A;  2XC1 A;  2BM6 A;  1TSP A;  1WXR A;  3BH7 B;  4OJP A;  2B0R A;  4OJ6 A;  1QA2 A;  1KQ5 A;  1QRC A;  2G0Y A;  2J8I A;  3SZE A;  1TYW A;  4OJO A;  1K8F A;  1CLW A;  3PET A;  4KH3 A;  3ML3 A;  1K4Z A;  1QA3 A;  3N90 A;  5JMC B;  2BM4 A;  2BX6 A;  1TYX A;  4OM9 A;  2VFN A;  3LJY A;  2BM7 A;  3RIQ A;  1QRB A;  2VFO A;  3SYJ A;  2VFQ A;  3N6Z A;  3JX8 A;  5JLV C;  1HF2 A;  1TYV A;  2BM5 A;  2F3L A;  3TH0 A;  4OPW A;  4OJL A;  1DAB A;  2YUH A;  2VFM A;  3BH6 B;  2V5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...