3P4GA

X-ray crystal structure of a hyperactive, ca2+-dependent, beta-helical antifreeze protein from an antarctic bacterium
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
301
structure length
301
Chain Sequence
HSFDHYIGSAFDASNNNVAVTGNVSATLNVLAGDDKVSIDGNVEDVLVAANVAVLDMGTGNDQLYVAGDVLGKIDAGTGNDEIYIKGDVSAAVDAGTGNDEVYIGGNLSGDLDAGTDNDNIQIGGDVNAALNAGTGNDNLIIGHDVSGIVNMGTDNDTVEVGRTINASGKVLLDTGDDSLLVSGDLFGEVDGGTGNDTIIIAGKVSGNIQGGTGNDIVRVQSQVWAEANISLGTGDDVLIVEHELHGTVAGNEGDDSIYLKFYTKEQYNNNSDLRNRVANFEHIRVSDGVVKGSPADFADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifreeze protein
molecule keywords Antifreeze protein
publication title Anchored clathrate waters bind antifreeze proteins to ice.
pubmed doi rcsb
source organism Marinomonas primoryensis
total genus 109
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18815 AFP_2 Bacterial antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.160 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3p4gA00
3P4GA
chains in the Genus database with same CATH superfamily
3GQ9A 1OFLA 1QRCA 1X0CA 1IB4A 3EQOA 1HG8A 1OOCA 3GQ7A 1O8IA 4NK6A 3UW0A 5C1CA 3BH7B 2VJJA 1BHEA 1KCDA 2IOUG 3NAWA 2G0YA 2PYHA 4YELA 2NSTA 2NZMA 3JX8A 4OZZA 1TYVA 2BM7A 4Z03A 1GQ8A 1OGMX 4YCQA 1LLZA 2VFOA 2QZAA 4Z05A 1O8DA 1QA3A 3SQVA 3VSUA 1NHCA 3P4GA 1O8KA 3PSZA 1OGOX 1EA0A 4W8TA 4XLFA 2X6YA 1QA1A 1VBLA 1TSPA 3EQNA 4XN0A 1L1IA 2EWEA 4NK8A 4U4BA 2B0RA 1HF2A 4C2LA 4XLEA 2BM5A 1K4ZA 4V02C 3B8YA 4YDTA 4YEJA 2VBKA 2IQ7A 2VJIA 3ML3A 1JTAA 1AIRA 1OFDA 3PETA 1K8FA 3PSSA 2VFMA 2VFQA 1CLWA 4XM3A 2QYUA 2QX3A 4KH3A 2BM6A 2F3LA 1QA2A 1PLUA 1TYUA 4OJPA 1LM1A 4MXNA 4XLHA 1TYWA 4XL9A 1XG2A 2XTXA 4XNFA 2V5IA 4YZAA 5AMVA 4XOPA 3T9GA 2J8IA 4OJOA 2XTWA 4YFOA 4OPWA 4URRA 3ZSCA 1CZFA 4XN3A 2VBEA 1RWRA 2XTYA 1LLWA 3AK5A 1TYXA 2BX6A 5DNSA 3BH6B 4W8RA 3SY2A 3DU1X 2NTQA 4AVZA 1O8EA 2BM4A 4YEIA 1O8HA 1IA5A 1OFEA 1KQ5A 3JURA 2O04A 3RIQA 1EZGA 3SUCA 2ODLA 4W8QA 1EE6A 3LJYA 1DABA 1IDJA 3GQAA 1QJVA 4MR0A 5C1EA 3VSTA 1PXZA 3H09A 1K5CA 1QQ1A 1KTWA 2NTBA 1WXRA 4XLAA 1H80A 2XT2A 3GRHA 2W7ZA 3N90A 3VMVA 2BSPA 1WMRA 4HWVA 3ZPPA 1RMGA 2X85A 4YC5A 1O8MA 1O8LA 3LMWA 2PYGA 3SYJA 4OJ5A 4XR6A 1KCCA 2INVA 3GQ8A 4YZ0A 4XOTA 4OZYA 1IDKA 3SZEA 1DBGA 2O0WA 3B90A 2O6WA 2X6WA 2XC1A 4EW9A 4XONA 4Z06A 1PE9A 4YZQA 4JRAC 1QCXA 2PECA 4W8SA 3N6ZA 2X3HA 2X6XA 4OJLA 4OM9A 1O8JA 3TH0A 1DBOA 4XKVA 2NT6A 4I84A 2UVEA 2VBMA 3LYCA 1O8GA 4OJ6A 5JMCB 2NSPA 2NT9A 2Z8GA 1O8FA 1JRGA 2NTPA 4PMHA 1O88A 2O1DA 2O0VA 3FY3A 3WWGA 1OFMA 2J8KA 3KRGA 3NB2A 2XT4A 2VFPA 3VSVA 1QRBA 2QY1A 4XORA 2VFNA 1BN8A 3VMWA 1RU4A 4XLCA 4U49A 2QXZA 4XKWA 2INUA 4XMYA 4YZXA 5JLVC 2UVFA 2YUHA 4XQFA 3B4NA 2O17A
chains in the Genus database with same CATH topology
2BM4A 2BM5A 1K4ZA 1QRCA 1KQ5A 4V02C 4JRAC 3RIQA 3N6ZA 3ML3A 4OJLA 3PETA 4OM9A 3TH0A 1K8FA 2VFMA 2VFQA 1CLWA 3BH7B 3LJYA 2BM6A 2F3LA 2IOUG 2G0YA 4KH3A 1DABA 3LYCA 1QA2A 1TYUA 4OJPA 3H09A 4OJ6A 1QQ1A 5JMCB 1TYWA 1WXRA 3N90A 2W7ZA 2V5IA 3JX8A 1TYVA 2BM7A 2J8IA 4OJOA 4OPWA 2VFPA 2VFOA 1QRBA 1QA3A 3SYJA 4OJ5A 3P4GA 3AK5A 1TYXA 2VFNA 2XC1A 2BX6A 3SZEA 5JLVC 1QA1A 3BH6B 1TSPA 2YUHA 2B0RA 1HF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4G A; 
#chains in the Genus database with same CATH topology
 3GQ9 A;  1OFL A;  1QRC A;  1X0C A;  1IB4 A;  3EQO A;  1HG8 A;  1OOC A;  3GQ7 A;  1O8I A;  4NK6 A;  3UW0 A;  5C1C A;  3BH7 B;  2VJJ A;  1BHE A;  1KCD A;  2IOU G;  3NAW A;  2G0Y A;  2PYH A;  4YEL A;  2NST A;  2NZM A;  3JX8 A;  4OZZ A;  1TYV A;  2BM7 A;  4Z03 A;  1GQ8 A;  1OGM X;  4YCQ A;  1LLZ A;  2VFO A;  2QZA A;  4Z05 A;  1O8D A;  1QA3 A;  3SQV A;  3VSU A;  1NHC A;  3P4G A;  1O8K A;  3PSZ A;  1OGO X;  1EA0 A;  4W8T A;  4XLF A;  2X6Y A;  1QA1 A;  1VBL A;  1TSP A;  3EQN A;  4XN0 A;  1L1I A;  2EWE A;  4NK8 A;  4U4B A;  2B0R A;  1HF2 A;  4C2L A;  4XLE A;  2BM5 A;  1K4Z A;  4V02 C;  3B8Y A;  4YDT A;  4YEJ A;  2VBK A;  2IQ7 A;  2VJI A;  3ML3 A;  1JTA A;  1AIR A;  1OFD A;  3PET A;  1K8F A;  3PSS A;  2VFM A;  2VFQ A;  1CLW A;  4XM3 A;  2QYU A;  2QX3 A;  4KH3 A;  2BM6 A;  2F3L A;  1QA2 A;  1PLU A;  1TYU A;  4OJP A;  1LM1 A;  4MXN A;  4XLH A;  1TYW A;  4XL9 A;  1XG2 A;  2XTX A;  4XNF A;  2V5I A;  4YZA A;  5AMV A;  4XOP A;  3T9G A;  2J8I A;  4OJO A;  2XTW A;  4YFO A;  4OPW A;  4URR A;  3ZSC A;  1CZF A;  4XN3 A;  2VBE A;  1RWR A;  2XTY A;  1LLW A;  3AK5 A;  1TYX A;  2BX6 A;  5DNS A;  3BH6 B;  4W8R A;  3SY2 A;  3DU1 X;  2NTQ A;  4AVZ A;  1O8E A;  2BM4 A;  4YEI A;  1O8H A;  1IA5 A;  1OFE A;  1KQ5 A;  3JUR A;  2O04 A;  3RIQ A;  1EZG A;  3SUC A;  2ODL A;  4W8Q A;  1EE6 A;  3LJY A;  1DAB A;  1IDJ A;  3GQA A;  1QJV A;  4MR0 A;  5C1E A;  3VST A;  1PXZ A;  3H09 A;  1K5C A;  1QQ1 A;  1KTW A;  2NTB A;  1WXR A;  4XLA A;  1H80 A;  2XT2 A;  3GRH A;  2W7Z A;  3N90 A;  3VMV A;  2BSP A;  1WMR A;  4HWV A;  3ZPP A;  1RMG A;  2X85 A;  4YC5 A;  1O8M A;  1O8L A;  3LMW A;  2PYG A;  3SYJ A;  4OJ5 A;  4XR6 A;  1KCC A;  2INV A;  3GQ8 A;  4YZ0 A;  4XOT A;  4OZY A;  1IDK A;  3SZE A;  1DBG A;  2O0W A;  3B90 A;  2O6W A;  2X6W A;  2XC1 A;  4EW9 A;  4XON A;  4Z06 A;  1PE9 A;  4YZQ A;  4JRA C;  1QCX A;  2PEC A;  4W8S A;  3N6Z A;  2X3H A;  2X6X A;  4OJL A;  4OM9 A;  1O8J A;  3TH0 A;  1DBO A;  4XKV A;  2NT6 A;  4I84 A;  2UVE A;  2VBM A;  3LYC A;  1O8G A;  4OJ6 A;  5JMC B;  2NSP A;  2NT9 A;  2Z8G A;  1O8F A;  1JRG A;  2NTP A;  4PMH A;  1O88 A;  2O1D A;  2O0V A;  3FY3 A;  3WWG A;  1OFM A;  2J8K A;  3KRG A;  3NB2 A;  2XT4 A;  2VFP A;  3VSV A;  1QRB A;  2QY1 A;  4XOR A;  2VFN A;  1BN8 A;  3VMW A;  1RU4 A;  4XLC A;  4U49 A;  2QXZ A;  4XKW A;  2INU A;  4XMY A;  4YZX A;  5JLV C;  2UVF A;  2YUH A;  4XQF A;  3B4N A;  2O17 A; 
#chains in the Genus database with same CATH homology
 2BM4 A;  2BM5 A;  1K4Z A;  1QRC A;  1KQ5 A;  4V02 C;  4JRA C;  3RIQ A;  3N6Z A;  3ML3 A;  4OJL A;  3PET A;  4OM9 A;  3TH0 A;  1K8F A;  2VFM A;  2VFQ A;  1CLW A;  3BH7 B;  3LJY A;  2BM6 A;  2F3L A;  2IOU G;  2G0Y A;  4KH3 A;  1DAB A;  3LYC A;  1QA2 A;  1TYU A;  4OJP A;  3H09 A;  4OJ6 A;  1QQ1 A;  5JMC B;  1TYW A;  1WXR A;  3N90 A;  2W7Z A;  2V5I A;  3JX8 A;  1TYV A;  2BM7 A;  2J8I A;  4OJO A;  4OPW A;  2VFP A;  2VFO A;  1QRB A;  1QA3 A;  3SYJ A;  4OJ5 A;  3P4G A;  3AK5 A;  1TYX A;  2VFN A;  2XC1 A;  2BX6 A;  3SZE A;  5JLV C;  1QA1 A;  3BH6 B;  1TSP A;  2YUH A;  2B0R A;  1HF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...