3P4GA

X-ray crystal structure of a hyperactive, ca2+-dependent, beta-helical antifreeze protein from an antarctic bacterium
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
301
structure length
301
Chain Sequence
b'HSFDHYIGSAFDASNNNVAVTGNVSATLNVLAGDDKVSIDGNVEDVLVAANVAVLDMGTGNDQLYVAGDVLGKIDAGTGNDEIYIKGDVSAAVDAGTGNDEVYIGGNLSGDLDAGTDNDNIQIGGDVNAALNAGTGNDNLIIGHDVSGIVNMGTDNDTVEVGRTINASGKVLLDTGDDSLLVSGDLFGEVDGGTGNDTIIIAGKVSGNIQGGTGNDIVRVQSQVWAEANISLGTGDDVLIVEHELHGTVAGNEGDDSIYLKFYTKEQYNNNSDLRNRVANFEHIRVSDGVVKGSPADFADY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antifreeze protein
publication title Anchored clathrate waters bind antifreeze proteins to ice.
pubmed doi rcsb
source organism Marinomonas primoryensis
molecule tags Antifreeze protein
total genus 109
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18815 AFP_2 Bacterial antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.160 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3p4gA00
3P4GA
chains in the Genus database with same CATH superfamily
2NSTA 1H80A 4OZZA 2XTWA 3LJYA 4OJ5A 2XTYA 2PYGA 1KQ5A 1K8FA 4PMHA 4YDTA 1O8MA 2J8IA 5JLVC 1OOCA 2QY1A 1QJVA 3RIQA 3B8YA 1HG8A 2VFNA 3ZPPA 2INUA 4NK6A 5JMCB 1QA2A 3GRHA 5C1CA 1L1IA 4YZ0A 3VSTA 3SYJA 4YZXA 2NTQA 1KCCA 3NAWA 3GQ9A 4W8TA 4XONA 4XKVA 2XTXA 1IDKA 1O8JA 4OM9A 4XLAA 4NK8A 2UVFA 3T9GA 4Z06A 4XOPA 2NT9A 2XC1A 1DABA 1PE9A 4KH3A 1IB4A 1O88A 1O8HA 2VFPA 4YC5A 2VBEA 4XNFA 5C1EA 2J8KA 2V5IA 4YZAA 2B0RA 2BM7A 2VBKA 4OJPA 2IOUG 1O8KA 1KCDA 3B4NA 2X6XA 1CZFA 1PXZA 2O0WA 1OFEA 2UVEA 2VFMA 3GQAA 2F3LA 2NTPA 1TYUA 4XLHA 4XN0A 1PLUA 3SQVA 3SY2A 4C2LA 2VFQA 1CLWA 4YEJA 4XKWA 2XT4A 1GQ8A 4OJ6A 4XR6A 3BH6B 2O17A 1O8DA 3KRGA 4XLFA 2IQ7A 3N90A 4XQFA 1JRGA 2VJIA 3AK5A 3UW0A 2O04A 1QA1A 2NSPA 1DBOA 1KTWA 3WWGA 4YZQA 4MR0A 1JTAA 4U49A 1O8IA 1TSPA 4XLEA 1RU4A 2X3HA 4JRAC 4W8QA 3P4GA 1O8EA 4XL9A 4OJLA 2G0YA 4MXNA 3VMVA 4V02C 1NHCA 3VMWA 1RMGA 1K4ZA 2BM6A 3SUCA 2XT2A 1IA5A 2VBMA 1O8LA 1WXRA 1OFMA 2BM4A 1VBLA 3H09A 3TH0A 2NTBA 1TYXA 4YELA 1QQ1A 4XORA 2QX3A 3PSSA 4XMYA 2YUHA 3SZEA 4OZYA 1HF2A 4XOTA 1DBGA 2ODLA 2O6WA 2O0VA 3PETA 2Z8GA 2X85A 3VSVA 4AVZA 5DNSA 3DU1X 1QRCA 2EWEA 4Z05A 1OGOX 1EA0A 3ML3A 1O8FA 2NT6A 1QRBA 3BH7B 2X6YA 2QYUA 3N6ZA 3NB2A 3B90A 3JX8A 1XG2A 4XM3A 1IDJA 1O8GA 2BM5A 1AIRA 2QXZA 3GQ8A 1EZGA 1K5CA 2BX6A 4U4BA 4HWVA 3VSUA 1TYWA 2W7ZA 5AMVA 2VFOA 4I84A 4XLCA 2INVA 3LYCA 4YCQA 1X0CA 4YEIA 3LMWA 4OPWA 3ZSCA 1OGMX 1QCXA 4URRA 4EW9A 1WMRA 4YFOA 1BHEA 4Z03A 1BN8A 1OFLA 2PECA 3JURA 1QA3A 3FY3A 2VJJA 1LLWA 1LM1A 2QZAA 1TYVA 2X6WA 2NZMA 3EQNA 4W8RA 2BSPA 1EE6A 3PSZA 3EQOA 1RWRA 4OJOA 1LLZA 2O1DA 3GQ7A 4W8SA 4XN3A 1OFDA 2PYHA
chains in the Genus database with same CATH topology
3P4GA 2VFPA 3LJYA 3JX8A 4OJ5A 2V5IA 4OJLA 2BM5A 2B0RA 2BM7A 2G0YA 1KQ5A 1K8FA 4V02C 2BX6A 4OJPA 2IOUG 1K4ZA 2J8IA 2BM6A 1TYWA 2W7ZA 5JLVC 2VFMA 2VFOA 2F3LA 3RIQA 1WXRA 1TYUA 2VFNA 2BM4A 3H09A 3LYCA 3TH0A 1TYXA 2VFQA 1QQ1A 1CLWA 4OPWA 5JMCB 1QA2A 2YUHA 4OJ6A 3SZEA 3SYJA 3BH6B 1HF2A 1QA3A 3N90A 4KH3A 3AK5A 1TYVA 3PETA 1QA1A 4OM9A 2XC1A 4OJOA 1QRCA 1TSPA 3ML3A 4JRAC 1DABA 1QRBA 3BH7B 3N6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4G A; 
#chains in the Genus database with same CATH topology
 2NST A;  1H80 A;  4OZZ A;  2XTW A;  3LJY A;  4OJ5 A;  2XTY A;  2PYG A;  1KQ5 A;  1K8F A;  4PMH A;  4YDT A;  1O8M A;  2J8I A;  5JLV C;  1OOC A;  2QY1 A;  1QJV A;  3RIQ A;  3B8Y A;  1HG8 A;  2VFN A;  3ZPP A;  2INU A;  4NK6 A;  5JMC B;  1QA2 A;  3GRH A;  5C1C A;  1L1I A;  4YZ0 A;  3VST A;  3SYJ A;  4YZX A;  2NTQ A;  1KCC A;  3NAW A;  3GQ9 A;  4W8T A;  4XON A;  4XKV A;  2XTX A;  1IDK A;  1O8J A;  4OM9 A;  4XLA A;  4NK8 A;  2UVF A;  3T9G A;  4Z06 A;  4XOP A;  2NT9 A;  2XC1 A;  1DAB A;  1PE9 A;  4KH3 A;  1IB4 A;  1O88 A;  1O8H A;  2VFP A;  4YC5 A;  2VBE A;  4XNF A;  5C1E A;  2J8K A;  2V5I A;  4YZA A;  2B0R A;  2BM7 A;  2VBK A;  4OJP A;  2IOU G;  1O8K A;  1KCD A;  3B4N A;  2X6X A;  1CZF A;  1PXZ A;  2O0W A;  1OFE A;  2UVE A;  2VFM A;  3GQA A;  2F3L A;  2NTP A;  1TYU A;  4XLH A;  4XN0 A;  1PLU A;  3SQV A;  3SY2 A;  4C2L A;  2VFQ A;  1CLW A;  4YEJ A;  4XKW A;  2XT4 A;  1GQ8 A;  4OJ6 A;  4XR6 A;  3BH6 B;  2O17 A;  1O8D A;  3KRG A;  4XLF A;  2IQ7 A;  3N90 A;  4XQF A;  1JRG A;  2VJI A;  3AK5 A;  3UW0 A;  2O04 A;  1QA1 A;  2NSP A;  1DBO A;  1KTW A;  3WWG A;  4YZQ A;  4MR0 A;  1JTA A;  4U49 A;  1O8I A;  1TSP A;  4XLE A;  1RU4 A;  2X3H A;  4JRA C;  4W8Q A;  3P4G A;  1O8E A;  4XL9 A;  4OJL A;  2G0Y A;  4MXN A;  3VMV A;  4V02 C;  1NHC A;  3VMW A;  1RMG A;  1K4Z A;  2BM6 A;  3SUC A;  2XT2 A;  1IA5 A;  2VBM A;  1O8L A;  1WXR A;  1OFM A;  2BM4 A;  1VBL A;  3H09 A;  3TH0 A;  2NTB A;  1TYX A;  4YEL A;  1QQ1 A;  4XOR A;  2QX3 A;  3PSS A;  4XMY A;  2YUH A;  3SZE A;  4OZY A;  1HF2 A;  4XOT A;  1DBG A;  2ODL A;  2O6W A;  2O0V A;  3PET A;  2Z8G A;  2X85 A;  3VSV A;  4AVZ A;  5DNS A;  3DU1 X;  1QRC A;  2EWE A;  4Z05 A;  1OGO X;  1EA0 A;  3ML3 A;  1O8F A;  2NT6 A;  1QRB A;  3BH7 B;  2X6Y A;  2QYU A;  3N6Z A;  3NB2 A;  3B90 A;  3JX8 A;  1XG2 A;  4XM3 A;  1IDJ A;  1O8G A;  2BM5 A;  1AIR A;  2QXZ A;  3GQ8 A;  1EZG A;  1K5C A;  2BX6 A;  4U4B A;  4HWV A;  3VSU A;  1TYW A;  2W7Z A;  5AMV A;  2VFO A;  4I84 A;  4XLC A;  2INV A;  3LYC A;  4YCQ A;  1X0C A;  4YEI A;  3LMW A;  4OPW A;  3ZSC A;  1OGM X;  1QCX A;  4URR A;  4EW9 A;  1WMR A;  4YFO A;  1BHE A;  4Z03 A;  1BN8 A;  1OFL A;  2PEC A;  3JUR A;  1QA3 A;  3FY3 A;  2VJJ A;  1LLW A;  1LM1 A;  2QZA A;  1TYV A;  2X6W A;  2NZM A;  3EQN A;  4W8R A;  2BSP A;  1EE6 A;  3PSZ A;  3EQO A;  1RWR A;  4OJO A;  1LLZ A;  2O1D A;  3GQ7 A;  4W8S A;  4XN3 A;  1OFD A;  2PYH A; 
#chains in the Genus database with same CATH homology
 3P4G A;  2VFP A;  3LJY A;  3JX8 A;  4OJ5 A;  2V5I A;  4OJL A;  2BM5 A;  2B0R A;  2BM7 A;  2G0Y A;  1KQ5 A;  1K8F A;  4V02 C;  2BX6 A;  4OJP A;  2IOU G;  1K4Z A;  2J8I A;  2BM6 A;  1TYW A;  2W7Z A;  5JLV C;  2VFM A;  2VFO A;  2F3L A;  3RIQ A;  1WXR A;  1TYU A;  2VFN A;  2BM4 A;  3H09 A;  3LYC A;  3TH0 A;  1TYX A;  2VFQ A;  1QQ1 A;  1CLW A;  4OPW A;  5JMC B;  1QA2 A;  2YUH A;  4OJ6 A;  3SZE A;  3SYJ A;  3BH6 B;  1HF2 A;  1QA3 A;  3N90 A;  4KH3 A;  3AK5 A;  1TYV A;  3PET A;  1QA1 A;  4OM9 A;  2XC1 A;  4OJO A;  1QRC A;  1TSP A;  3ML3 A;  4JRA C;  1DAB A;  1QRB A;  3BH7 B;  3N6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...