3P4GA

X-ray crystal structure of a hyperactive, ca2+-dependent, beta-helical antifreeze protein from an antarctic bacterium
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
301
structure length
301
Chain Sequence
HSFDHYIGSAFDASNNNVAVTGNVSATLNVLAGDDKVSIDGNVEDVLVAANVAVLDMGTGNDQLYVAGDVLGKIDAGTGNDEIYIKGDVSAAVDAGTGNDEVYIGGNLSGDLDAGTDNDNIQIGGDVNAALNAGTGNDNLIIGHDVSGIVNMGTDNDTVEVGRTINASGKVLLDTGDDSLLVSGDLFGEVDGGTGNDTIIIAGKVSGNIQGGTGNDIVRVQSQVWAEANISLGTGDDVLIVEHELHGTVAGNEGDDSIYLKFYTKEQYNNNSDLRNRVANFEHIRVSDGVVKGSPADFADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antifreeze protein
publication title Anchored clathrate waters bind antifreeze proteins to ice.
pubmed doi rcsb
source organism Marinomonas primoryensis
molecule tags Antifreeze protein
total genus 109
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18815 AFP_2 Bacterial antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.160 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3p4gA00
3P4GA
chains in the Genus database with same CATH superfamily
3EQNA 2PECA 3LYCA 4YEIA 4NK8A 2XC1A 4OJ6A 3PSZA 3H09A 4HWVA 3ZPPA 1OOCA 5JLVC 1L1IA 1QCXA 3NAWA 4XN0A 1IDJA 3SZEA 1QJVA 2BM6A 2J8IA 1TSPA 2EWEA 4U4BA 2NTQA 5C1EA 3LMWA 4XOTA 2NT6A 4I84A 1QQ1A 4YZAA 2XTXA 2QXZA 1HG8A 4YFOA 1EE6A 1O8MA 3NB2A 3TH0A 3GQ8A 2XT2A 3WWGA 4JRAC 1QA1A 2VBEA 2V5IA 4XQFA 1O8HA 4XONA 3P4GA 4W8QA 3VMWA 1DBOA 4XLFA 1JRGA 3BH7B 2QYUA 3VSVA 4XKWA 1TYVA 5JMCB 3PETA 5DNSA 4YEJA 1RWRA 1O8DA 4PMHA 1CLWA 2O17A 4V02C 2O0WA 3RIQA 1KCCA 1BHEA 4AVZA 3GQAA 5AMVA 1RU4A 4XN3A 4OZYA 1CZFA 4XLEA 2QY1A 2BM4A 3SUCA 4MXNA 1K8FA 1OFDA 1O8EA 2PYHA 4W8RA 2O1DA 1O8KA 4XR6A 1K5CA 1LLZA 2PYGA 2O04A 2QX3A 1KQ5A 4XLAA 3VSTA 1IDKA 3AK5A 2VBKA 2J8KA 3SY2A 2VFMA 1VBLA 2ODLA 2F3LA 2VFNA 1TYUA 1O8JA 2O0VA 3JX8A 4U49A 1O8GA 2XTWA 3ML3A 4Z03A 4OPWA 4C2LA 4OJLA 1PE9A 4NK6A 2BX6A 2IQ7A 1WMRA 3PSSA 2X3HA 2VJJA 4XORA 2NT9A 1IA5A 3UW0A 2NTPA 3N90A 4XM3A 2BM5A 1BN8A 3VMVA 2X6WA 4YCQA 1TYXA 2XTYA 3FY3A 4YDTA 4MR0A 3B8YA 3SYJA 1O88A 1AIRA 3GRHA 4XMYA 1LLWA 4URRA 4W8TA 2INUA 2Z8GA 1K4ZA 4Z06A 3JURA 2VBMA 4XOPA 2G0YA 3B90A 3T9GA 4OJOA 4XLHA 4YZQA 1QRBA 5C1CA 1KTWA 1DBGA 4XLCA 4XL9A 3VSUA 2UVFA 1O8IA 1JTAA 1GQ8A 2QZAA 3GQ7A 3KRGA 4OM9A 4XKVA 3EQOA 1O8FA 1PLUA 4W8SA 1KCDA 1X0CA 2NZMA 3B4NA 1DABA 2UVEA 2B0RA 2NTBA 2XT4A 2W7ZA 1TYWA 3BH6B 4Z05A 1QRCA 1H80A 1XG2A 2BSPA 1EZGA 4YZXA 4YZ0A 4XNFA 1PXZA 4YC5A 3ZSCA 1OFMA 2VFOA 1OFEA 2YUHA 1HF2A 2NSPA 2NSTA 1WXRA 2INVA 2VJIA 3DU1X 1QA2A 2X85A 1OGOX 2BM7A 2VFQA 1IB4A 2IOUG 2VFPA 3N6ZA 4OZZA 1QA3A 1NHCA 4OJPA 1O8LA 1LM1A 4KH3A 2X6YA 2X6XA 4EW9A 1EA0A 3GQ9A 1OGMX 4OJ5A 4YELA 1RMGA 1OFLA 2O6WA 3SQVA 3LJYA
chains in the Genus database with same CATH topology
1CLWA 4OJLA 4V02C 4OM9A 3LYCA 2BX6A 3RIQA 2XC1A 4OJ6A 5JLVC 3H09A 1DABA 3N90A 2B0RA 2BM5A 2BM4A 2BM6A 1TYWA 2J8IA 1TSPA 1K8FA 2W7ZA 1QRCA 1TYXA 3BH6B 1QQ1A 2VFOA 3SYJA 1KQ5A 2YUHA 1HF2A 1WXRA 3TH0A 1K4ZA 4JRAC 1QA1A 1QA2A 2BM7A 2VFQA 3AK5A 3SZEA 2V5IA 2G0YA 2IOUG 2VFPA 2VFMA 3P4GA 3N6ZA 2F3LA 4OJOA 1QA3A 4OJPA 2VFNA 1QRBA 3BH7B 4KH3A 1TYUA 3JX8A 1TYVA 5JMCB 3PETA 4OJ5A 3LJYA 3ML3A 4OPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4G A; 
#chains in the Genus database with same CATH topology
 3EQN A;  2PEC A;  3LYC A;  4YEI A;  4NK8 A;  2XC1 A;  4OJ6 A;  3PSZ A;  3H09 A;  4HWV A;  3ZPP A;  1OOC A;  5JLV C;  1L1I A;  1QCX A;  3NAW A;  4XN0 A;  1IDJ A;  3SZE A;  1QJV A;  2BM6 A;  2J8I A;  1TSP A;  2EWE A;  4U4B A;  2NTQ A;  5C1E A;  3LMW A;  4XOT A;  2NT6 A;  4I84 A;  1QQ1 A;  4YZA A;  2XTX A;  2QXZ A;  1HG8 A;  4YFO A;  1EE6 A;  1O8M A;  3NB2 A;  3TH0 A;  3GQ8 A;  2XT2 A;  3WWG A;  4JRA C;  1QA1 A;  2VBE A;  2V5I A;  4XQF A;  1O8H A;  4XON A;  3P4G A;  4W8Q A;  3VMW A;  1DBO A;  4XLF A;  1JRG A;  3BH7 B;  2QYU A;  3VSV A;  4XKW A;  1TYV A;  5JMC B;  3PET A;  5DNS A;  4YEJ A;  1RWR A;  1O8D A;  4PMH A;  1CLW A;  2O17 A;  4V02 C;  2O0W A;  3RIQ A;  1KCC A;  1BHE A;  4AVZ A;  3GQA A;  5AMV A;  1RU4 A;  4XN3 A;  4OZY A;  1CZF A;  4XLE A;  2QY1 A;  2BM4 A;  3SUC A;  4MXN A;  1K8F A;  1OFD A;  1O8E A;  2PYH A;  4W8R A;  2O1D A;  1O8K A;  4XR6 A;  1K5C A;  1LLZ A;  2PYG A;  2O04 A;  2QX3 A;  1KQ5 A;  4XLA A;  3VST A;  1IDK A;  3AK5 A;  2VBK A;  2J8K A;  3SY2 A;  2VFM A;  1VBL A;  2ODL A;  2F3L A;  2VFN A;  1TYU A;  1O8J A;  2O0V A;  3JX8 A;  4U49 A;  1O8G A;  2XTW A;  3ML3 A;  4Z03 A;  4OPW A;  4C2L A;  4OJL A;  1PE9 A;  4NK6 A;  2BX6 A;  2IQ7 A;  1WMR A;  3PSS A;  2X3H A;  2VJJ A;  4XOR A;  2NT9 A;  1IA5 A;  3UW0 A;  2NTP A;  3N90 A;  4XM3 A;  2BM5 A;  1BN8 A;  3VMV A;  2X6W A;  4YCQ A;  1TYX A;  2XTY A;  3FY3 A;  4YDT A;  4MR0 A;  3B8Y A;  3SYJ A;  1O88 A;  1AIR A;  3GRH A;  4XMY A;  1LLW A;  4URR A;  4W8T A;  2INU A;  2Z8G A;  1K4Z A;  4Z06 A;  3JUR A;  2VBM A;  4XOP A;  2G0Y A;  3B90 A;  3T9G A;  4OJO A;  4XLH A;  4YZQ A;  1QRB A;  5C1C A;  1KTW A;  1DBG A;  4XLC A;  4XL9 A;  3VSU A;  2UVF A;  1O8I A;  1JTA A;  1GQ8 A;  2QZA A;  3GQ7 A;  3KRG A;  4OM9 A;  4XKV A;  3EQO A;  1O8F A;  1PLU A;  4W8S A;  1KCD A;  1X0C A;  2NZM A;  3B4N A;  1DAB A;  2UVE A;  2B0R A;  2NTB A;  2XT4 A;  2W7Z A;  1TYW A;  3BH6 B;  4Z05 A;  1QRC A;  1H80 A;  1XG2 A;  2BSP A;  1EZG A;  4YZX A;  4YZ0 A;  4XNF A;  1PXZ A;  4YC5 A;  3ZSC A;  1OFM A;  2VFO A;  1OFE A;  2YUH A;  1HF2 A;  2NSP A;  2NST A;  1WXR A;  2INV A;  2VJI A;  3DU1 X;  1QA2 A;  2X85 A;  1OGO X;  2BM7 A;  2VFQ A;  1IB4 A;  2IOU G;  2VFP A;  3N6Z A;  4OZZ A;  1QA3 A;  1NHC A;  4OJP A;  1O8L A;  1LM1 A;  4KH3 A;  2X6Y A;  2X6X A;  4EW9 A;  1EA0 A;  3GQ9 A;  1OGM X;  4OJ5 A;  4YEL A;  1RMG A;  1OFL A;  2O6W A;  3SQV A;  3LJY A; 
#chains in the Genus database with same CATH homology
 1CLW A;  4OJL A;  4V02 C;  4OM9 A;  3LYC A;  2BX6 A;  3RIQ A;  2XC1 A;  4OJ6 A;  5JLV C;  3H09 A;  1DAB A;  3N90 A;  2B0R A;  2BM5 A;  2BM4 A;  2BM6 A;  1TYW A;  2J8I A;  1TSP A;  1K8F A;  2W7Z A;  1QRC A;  1TYX A;  3BH6 B;  1QQ1 A;  2VFO A;  3SYJ A;  1KQ5 A;  2YUH A;  1HF2 A;  1WXR A;  3TH0 A;  1K4Z A;  4JRA C;  1QA1 A;  1QA2 A;  2BM7 A;  2VFQ A;  3AK5 A;  3SZE A;  2V5I A;  2G0Y A;  2IOU G;  2VFP A;  2VFM A;  3P4G A;  3N6Z A;  2F3L A;  4OJO A;  1QA3 A;  4OJP A;  2VFN A;  1QRB A;  3BH7 B;  4KH3 A;  1TYU A;  3JX8 A;  1TYV A;  5JMC B;  3PET A;  4OJ5 A;  3LJY A;  3ML3 A;  4OPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...