3P4GA

X-ray crystal structure of a hyperactive, ca2+-dependent, beta-helical antifreeze protein from an antarctic bacterium
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
301
structure length
301
Chain Sequence
HSFDHYIGSAFDASNNNVAVTGNVSATLNVLAGDDKVSIDGNVEDVLVAANVAVLDMGTGNDQLYVAGDVLGKIDAGTGNDEIYIKGDVSAAVDAGTGNDEVYIGGNLSGDLDAGTDNDNIQIGGDVNAALNAGTGNDNLIIGHDVSGIVNMGTDNDTVEVGRTINASGKVLLDTGDDSLLVSGDLFGEVDGGTGNDTIIIAGKVSGNIQGGTGNDIVRVQSQVWAEANISLGTGDDVLIVEHELHGTVAGNEGDDSIYLKFYTKEQYNNNSDLRNRVANFEHIRVSDGVVKGSPADFADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anchored clathrate waters bind antifreeze proteins to ice.
pubmed doi rcsb
source organism Marinomonas primoryensis
molecule tags Antifreeze protein
molecule keywords Antifreeze protein
total genus 109
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18815 AFP_2 Bacterial antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.160 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3p4gA00
3P4GA
chains in the Genus database with same CATH superfamily
2G0YA 2VBEA 1O8DA 2VJIA 1RWRA 3P4GA 4YEIA 1GQ8A 1JTAA 2BM6A 4I84A 4OJ6A 1O8HA 4YC5A 4EW9A 4PMHA 1K4ZA 2X6XA 1LM1A 4XNFA 1HF2A 1O8FA 1AIRA 4OJOA 1TYVA 1KCCA 4W8QA 2VBMA 1EE6A 2O17A 3LMWA 2W7ZA 4XOPA 4MR0A 2V5IA 3ZPPA 5JMCB 5C1EA 1O8MA 4W8TA 2X3HA 1CLWA 1EA0A 1BN8A 1QCXA 1BHEA 2QZAA 5AMVA 1QRCA 2XT2A 1KTWA 4OZZA 3VSTA 3WWGA 2J8KA 2Z8GA 2NZMA 3GQ9A 1OGMX 3AK5A 3SYJA 4XLAA 2INUA 2XTWA 4XLCA 1DBGA 4YDTA 2NSTA 4URRA 2QYUA 1QRBA 1O8IA 3TH0A 3NAWA 3GRHA 3LJYA 1QA2A 2XTXA 1X0CA 2PECA 4V02C 1O8LA 2UVEA 2BM5A 2VFPA 3N90A 4YEJA 3EQOA 1KCDA 4NK6A 1PLUA 1OFEA 1EZGA 1KQ5A 3VSVA 3BH6B 3VMVA 1TYXA 2EWEA 3FY3A 4XOTA 3ML3A 1O8JA 1K8FA 1TYUA 4XMYA 1IB4A 1LLWA 2NTPA 2VFOA 2X6WA 4OJPA 4XM3A 1OFLA 3PSZA 2O1DA 2XTYA 4YZQA 4XLEA 1WXRA 1O8EA 4OM9A 2BM4A 2F3LA 3PETA 4MXNA 2IOUG 3GQ7A 2XT4A 3N6ZA 1OOCA 1RU4A 4XORA 3RIQA 3UW0A 2NTBA 4XN0A 3LYCA 3VSUA 2BSPA 2NSPA 1HG8A 2IQ7A 4YZAA 1IDJA 1OFDA 4XKVA 4YFOA 1IA5A 4Z06A 2VJJA 2PYHA 4XR6A 4OPWA 2NTQA 1DBOA 2X6YA 4YCQA 1QJVA 1NHCA 5JLVC 2NT6A 3VMWA 3GQAA 4HWVA 4YELA 4OJ5A 4U4BA 3ZSCA 2VFNA 3SZEA 4AVZA 1K5CA 2INVA 1VBLA 3SQVA 1CZFA 3JURA 2O0VA 2QX3A 2YUHA 1O8KA 1TYWA 1XG2A 3H09A 4W8SA 4W8RA 1O8GA 4XN3A 3SY2A 2B0RA 3B90A 1IDKA 2VFMA 3BH7B 1TSPA 4XLFA 1RMGA 1H80A 3PSSA 2BM7A 2ODLA 4YZXA 1PXZA 4XQFA 3NB2A 1LLZA 3B4NA 4YZ0A 1PE9A 2X85A 1OGOX 2QXZA 4JRAC 2NT9A 1L1IA 3KRGA 2PYGA 4OZYA 4Z05A 4XONA 3B8YA 3GQ8A 3JX8A 2O6WA 4XKWA 2J8IA 4NK8A 4U49A 1WMRA 2VFQA 4XLHA 5C1CA 2QY1A 2VBKA 2UVFA 2O04A 3EQNA 1DABA 3DU1X 2BX6A 2O0WA 4KH3A 4Z03A 1QA1A 1O88A 1JRGA 5DNSA 1QA3A 1QQ1A 2XC1A 4OJLA 1OFMA 4XL9A 3SUCA 4C2LA 3T9GA
chains in the Genus database with same CATH topology
3RIQA 3H09A 1TYWA 2G0YA 3LYCA 2B0RA 1QRBA 2VFMA 3BH7B 3P4GA 3TH0A 1TSPA 2BM6A 4OJ6A 3LJYA 1QA2A 4V02C 2BM7A 1K4ZA 4OPWA 1HF2A 2BM5A 2VFPA 3N90A 4OJOA 1TYVA 4JRAC 5JLVC 1KQ5A 2W7ZA 3BH6B 1TYXA 4OJ5A 2V5IA 3JX8A 5JMCB 2J8IA 3ML3A 1K8FA 1CLWA 1TYUA 2VFQA 2VFNA 2VFOA 1WXRA 4OJPA 3SZEA 1QRCA 1DABA 4KH3A 2BX6A 1QA1A 4OM9A 2BM4A 2F3LA 3PETA 2IOUG 1QA3A 1QQ1A 2XC1A 4OJLA 3AK5A 3SYJA 3N6ZA 2YUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4G A; 
#chains in the Genus database with same CATH topology
 2G0Y A;  2VBE A;  1O8D A;  2VJI A;  1RWR A;  3P4G A;  4YEI A;  1GQ8 A;  1JTA A;  2BM6 A;  4I84 A;  4OJ6 A;  1O8H A;  4YC5 A;  4EW9 A;  4PMH A;  1K4Z A;  2X6X A;  1LM1 A;  4XNF A;  1HF2 A;  1O8F A;  1AIR A;  4OJO A;  1TYV A;  1KCC A;  4W8Q A;  2VBM A;  1EE6 A;  2O17 A;  3LMW A;  2W7Z A;  4XOP A;  4MR0 A;  2V5I A;  3ZPP A;  5JMC B;  5C1E A;  1O8M A;  4W8T A;  2X3H A;  1CLW A;  1EA0 A;  1BN8 A;  1QCX A;  1BHE A;  2QZA A;  5AMV A;  1QRC A;  2XT2 A;  1KTW A;  4OZZ A;  3VST A;  3WWG A;  2J8K A;  2Z8G A;  2NZM A;  3GQ9 A;  1OGM X;  3AK5 A;  3SYJ A;  4XLA A;  2INU A;  2XTW A;  4XLC A;  1DBG A;  4YDT A;  2NST A;  4URR A;  2QYU A;  1QRB A;  1O8I A;  3TH0 A;  3NAW A;  3GRH A;  3LJY A;  1QA2 A;  2XTX A;  1X0C A;  2PEC A;  4V02 C;  1O8L A;  2UVE A;  2BM5 A;  2VFP A;  3N90 A;  4YEJ A;  3EQO A;  1KCD A;  4NK6 A;  1PLU A;  1OFE A;  1EZG A;  1KQ5 A;  3VSV A;  3BH6 B;  3VMV A;  1TYX A;  2EWE A;  3FY3 A;  4XOT A;  3ML3 A;  1O8J A;  1K8F A;  1TYU A;  4XMY A;  1IB4 A;  1LLW A;  2NTP A;  2VFO A;  2X6W A;  4OJP A;  4XM3 A;  1OFL A;  3PSZ A;  2O1D A;  2XTY A;  4YZQ A;  4XLE A;  1WXR A;  1O8E A;  4OM9 A;  2BM4 A;  2F3L A;  3PET A;  4MXN A;  2IOU G;  3GQ7 A;  2XT4 A;  3N6Z A;  1OOC A;  1RU4 A;  4XOR A;  3RIQ A;  3UW0 A;  2NTB A;  4XN0 A;  3LYC A;  3VSU A;  2BSP A;  2NSP A;  1HG8 A;  2IQ7 A;  4YZA A;  1IDJ A;  1OFD A;  4XKV A;  4YFO A;  1IA5 A;  4Z06 A;  2VJJ A;  2PYH A;  4XR6 A;  4OPW A;  2NTQ A;  1DBO A;  2X6Y A;  4YCQ A;  1QJV A;  1NHC A;  5JLV C;  2NT6 A;  3VMW A;  3GQA A;  4HWV A;  4YEL A;  4OJ5 A;  4U4B A;  3ZSC A;  2VFN A;  3SZE A;  4AVZ A;  1K5C A;  2INV A;  1VBL A;  3SQV A;  1CZF A;  3JUR A;  2O0V A;  2QX3 A;  2YUH A;  1O8K A;  1TYW A;  1XG2 A;  3H09 A;  4W8S A;  4W8R A;  1O8G A;  4XN3 A;  3SY2 A;  2B0R A;  3B90 A;  1IDK A;  2VFM A;  3BH7 B;  1TSP A;  4XLF A;  1RMG A;  1H80 A;  3PSS A;  2BM7 A;  2ODL A;  4YZX A;  1PXZ A;  4XQF A;  3NB2 A;  1LLZ A;  3B4N A;  4YZ0 A;  1PE9 A;  2X85 A;  1OGO X;  2QXZ A;  4JRA C;  2NT9 A;  1L1I A;  3KRG A;  2PYG A;  4OZY A;  4Z05 A;  4XON A;  3B8Y A;  3GQ8 A;  3JX8 A;  2O6W A;  4XKW A;  2J8I A;  4NK8 A;  4U49 A;  1WMR A;  2VFQ A;  4XLH A;  5C1C A;  2QY1 A;  2VBK A;  2UVF A;  2O04 A;  3EQN A;  1DAB A;  3DU1 X;  2BX6 A;  2O0W A;  4KH3 A;  4Z03 A;  1QA1 A;  1O88 A;  1JRG A;  5DNS A;  1QA3 A;  1QQ1 A;  2XC1 A;  4OJL A;  1OFM A;  4XL9 A;  3SUC A;  4C2L A;  3T9G A; 
#chains in the Genus database with same CATH homology
 3RIQ A;  3H09 A;  1TYW A;  2G0Y A;  3LYC A;  2B0R A;  1QRB A;  2VFM A;  3BH7 B;  3P4G A;  3TH0 A;  1TSP A;  2BM6 A;  4OJ6 A;  3LJY A;  1QA2 A;  4V02 C;  2BM7 A;  1K4Z A;  4OPW A;  1HF2 A;  2BM5 A;  2VFP A;  3N90 A;  4OJO A;  1TYV A;  4JRA C;  5JLV C;  1KQ5 A;  2W7Z A;  3BH6 B;  1TYX A;  4OJ5 A;  2V5I A;  3JX8 A;  5JMC B;  2J8I A;  3ML3 A;  1K8F A;  1CLW A;  1TYU A;  2VFQ A;  2VFN A;  2VFO A;  1WXR A;  4OJP A;  3SZE A;  1QRC A;  1DAB A;  4KH3 A;  2BX6 A;  1QA1 A;  4OM9 A;  2BM4 A;  2F3L A;  3PET A;  2IOU G;  1QA3 A;  1QQ1 A;  2XC1 A;  4OJL A;  3AK5 A;  3SYJ A;  3N6Z A;  2YUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...