3P4GA

X-ray crystal structure of a hyperactive, ca2+-dependent, beta-helical antifreeze protein from an antarctic bacterium
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
301
structure length
301
Chain Sequence
HSFDHYIGSAFDASNNNVAVTGNVSATLNVLAGDDKVSIDGNVEDVLVAANVAVLDMGTGNDQLYVAGDVLGKIDAGTGNDEIYIKGDVSAAVDAGTGNDEVYIGGNLSGDLDAGTDNDNIQIGGDVNAALNAGTGNDNLIIGHDVSGIVNMGTDNDTVEVGRTINASGKVLLDTGDDSLLVSGDLFGEVDGGTGNDTIIIAGKVSGNIQGGTGNDIVRVQSQVWAEANISLGTGDDVLIVEHELHGTVAGNEGDDSIYLKFYTKEQYNNNSDLRNRVANFEHIRVSDGVVKGSPADFADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anchored clathrate waters bind antifreeze proteins to ice.
pubmed doi rcsb
source organism Marinomonas primoryensis
molecule tags Antifreeze protein
molecule keywords Antifreeze protein
total genus 109
structure length 301
sequence length 301
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18815 AFP_2 Bacterial antifreeze protein repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.160 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3p4gA00
3P4GA
chains in the Genus database with same CATH superfamily
4OZYA 4HWVA 1JTAA 1KQ5A 1O8JA 1O8EA 4OM9A 4OPWA 2IQ7A 1IA5A 1NHCA 1L1IA 2NT6A 5AMVA 1OFDA 2ODLA 3EQOA 1O8FA 3LJYA 2VBKA 2INUA 1BHEA 4YCQA 5C1EA 2UVEA 3BH7B 4OZZA 3SUCA 3ZSCA 3KRGA 2VFOA 2X6YA 3B8YA 4W8RA 3SYJA 1K4ZA 2INVA 4OJ5A 1OOCA 3BH6B 3N90A 4KH3A 2NTQA 4YZQA 1TYXA 2VFNA 4YZXA 4PMHA 3FY3A 3PSSA 3GQ7A 1O8GA 2VJJA 4XOPA 3ZPPA 2PYGA 5DNSA 1H80A 3SY2A 2BM5A 1LLWA 1X0CA 4XORA 3VSUA 4URRA 1HG8A 1K5CA 3WWGA 2VBEA 1XG2A 2J8KA 2PYHA 2X3HA 3B4NA 3GQ8A 4U4BA 4MXNA 4XKWA 1BN8A 5C1CA 2O6WA 4YZAA 2O1DA 2VFPA 3LYCA 1QA1A 1OGMX 2NSTA 2O17A 2XT4A 1JRGA 2QZAA 3GRHA 4XN0A 1O8MA 1RU4A 1AIRA 2EWEA 3VMWA 1K8FA 4XMYA 3DU1X 2QY1A 3PETA 3RIQA 2X6WA 4NK6A 4XLCA 1DBOA 4OJPA 2G0YA 1EE6A 1O8DA 2NTBA 2XTYA 3LMWA 4XL9A 4XM3A 2VFMA 3SZEA 4AVZA 4YFOA 1IB4A 4MR0A 2BM7A 4V02C 2QYUA 4NK8A 3GQAA 2QXZA 3GQ9A 2BX6A 1OFLA 2X6XA 5JLVC 4XQFA 1LLZA 1O8LA 3VSTA 1OFEA 3N6ZA 4YC5A 1QA3A 1O8KA 4XLAA 2NSPA 1QCXA 1CZFA 2NT9A 4Z05A 1OGOX 1PLUA 3H09A 2J8IA 3TH0A 1TYWA 2O04A 4XLFA 4XR6A 1IDKA 3EQNA 1QRCA 1O8IA 4C2LA 4JRAC 4YZ0A 3P4GA 2W7ZA 3UW0A 3ML3A 2F3LA 4XONA 4I84A 1CLWA 4OJOA 2Z8GA 2PECA 1WXRA 2X85A 3VSVA 3B90A 4XNFA 2O0VA 2VBMA 2XTWA 1RMGA 4XN3A 1DBGA 1QRBA 1EZGA 1LM1A 1WMRA 3JX8A 3PSZA 4XKVA 4EW9A 1QA2A 3NB2A 2BM4A 1IDJA 1RWRA 1KCDA 2XTXA 1PE9A 2NZMA 2UVFA 3T9GA 2QX3A 1KTWA 4U49A 3SQVA 1EA0A 4YDTA 1QJVA 1HF2A 4XLHA 4Z03A 1GQ8A 4YEIA 4XLEA 3AK5A 1TYVA 4W8TA 2V5IA 1PXZA 4OJLA 1KCCA 3NAWA 1OFMA 2VJIA 3JURA 1O88A 1TSPA 1QQ1A 4W8QA 4XOTA 2B0RA 2IOUG 2O0WA 2XC1A 3VMVA 4OJ6A 4W8SA 2YUHA 4YELA 1TYUA 5JMCB 1VBLA 4Z06A 4YEJA 2BM6A 2VFQA 2NTPA 2XT2A 2BSPA 1O8HA 1DABA
chains in the Genus database with same CATH topology
1QRBA 2BX6A 1KQ5A 4OM9A 3JX8A 1QA2A 5JLVC 4OPWA 2BM4A 3N6ZA 1QA3A 3LYCA 2VFPA 3LJYA 1QA1A 3BH7B 1HF2A 2J8IA 3H09A 3TH0A 2VFOA 1TYWA 3SYJA 3AK5A 1K4ZA 1TYVA 1K8FA 4OJ5A 1QRCA 2V5IA 3BH6B 4JRAC 4OJLA 3N90A 3P4GA 4KH3A 2W7ZA 3PETA 1TYXA 2VFNA 3RIQA 1TSPA 1QQ1A 3ML3A 2F3LA 2B0RA 2IOUG 4OJPA 2XC1A 2G0YA 3SZEA 4OJ6A 1CLWA 2VFMA 2YUHA 4OJOA 1TYUA 1WXRA 2BM5A 5JMCB 2BM7A 4V02C 2BM6A 2VFQA 1DABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4G A; 
#chains in the Genus database with same CATH topology
 4OZY A;  4HWV A;  1JTA A;  1KQ5 A;  1O8J A;  1O8E A;  4OM9 A;  4OPW A;  2IQ7 A;  1IA5 A;  1NHC A;  1L1I A;  2NT6 A;  5AMV A;  1OFD A;  2ODL A;  3EQO A;  1O8F A;  3LJY A;  2VBK A;  2INU A;  1BHE A;  4YCQ A;  5C1E A;  2UVE A;  3BH7 B;  4OZZ A;  3SUC A;  3ZSC A;  3KRG A;  2VFO A;  2X6Y A;  3B8Y A;  4W8R A;  3SYJ A;  1K4Z A;  2INV A;  4OJ5 A;  1OOC A;  3BH6 B;  3N90 A;  4KH3 A;  2NTQ A;  4YZQ A;  1TYX A;  2VFN A;  4YZX A;  4PMH A;  3FY3 A;  3PSS A;  3GQ7 A;  1O8G A;  2VJJ A;  4XOP A;  3ZPP A;  2PYG A;  5DNS A;  1H80 A;  3SY2 A;  2BM5 A;  1LLW A;  1X0C A;  4XOR A;  3VSU A;  4URR A;  1HG8 A;  1K5C A;  3WWG A;  2VBE A;  1XG2 A;  2J8K A;  2PYH A;  2X3H A;  3B4N A;  3GQ8 A;  4U4B A;  4MXN A;  4XKW A;  1BN8 A;  5C1C A;  2O6W A;  4YZA A;  2O1D A;  2VFP A;  3LYC A;  1QA1 A;  1OGM X;  2NST A;  2O17 A;  2XT4 A;  1JRG A;  2QZA A;  3GRH A;  4XN0 A;  1O8M A;  1RU4 A;  1AIR A;  2EWE A;  3VMW A;  1K8F A;  4XMY A;  3DU1 X;  2QY1 A;  3PET A;  3RIQ A;  2X6W A;  4NK6 A;  4XLC A;  1DBO A;  4OJP A;  2G0Y A;  1EE6 A;  1O8D A;  2NTB A;  2XTY A;  3LMW A;  4XL9 A;  4XM3 A;  2VFM A;  3SZE A;  4AVZ A;  4YFO A;  1IB4 A;  4MR0 A;  2BM7 A;  4V02 C;  2QYU A;  4NK8 A;  3GQA A;  2QXZ A;  3GQ9 A;  2BX6 A;  1OFL A;  2X6X A;  5JLV C;  4XQF A;  1LLZ A;  1O8L A;  3VST A;  1OFE A;  3N6Z A;  4YC5 A;  1QA3 A;  1O8K A;  4XLA A;  2NSP A;  1QCX A;  1CZF A;  2NT9 A;  4Z05 A;  1OGO X;  1PLU A;  3H09 A;  2J8I A;  3TH0 A;  1TYW A;  2O04 A;  4XLF A;  4XR6 A;  1IDK A;  3EQN A;  1QRC A;  1O8I A;  4C2L A;  4JRA C;  4YZ0 A;  3P4G A;  2W7Z A;  3UW0 A;  3ML3 A;  2F3L A;  4XON A;  4I84 A;  1CLW A;  4OJO A;  2Z8G A;  2PEC A;  1WXR A;  2X85 A;  3VSV A;  3B90 A;  4XNF A;  2O0V A;  2VBM A;  2XTW A;  1RMG A;  4XN3 A;  1DBG A;  1QRB A;  1EZG A;  1LM1 A;  1WMR A;  3JX8 A;  3PSZ A;  4XKV A;  4EW9 A;  1QA2 A;  3NB2 A;  2BM4 A;  1IDJ A;  1RWR A;  1KCD A;  2XTX A;  1PE9 A;  2NZM A;  2UVF A;  3T9G A;  2QX3 A;  1KTW A;  4U49 A;  3SQV A;  1EA0 A;  4YDT A;  1QJV A;  1HF2 A;  4XLH A;  4Z03 A;  1GQ8 A;  4YEI A;  4XLE A;  3AK5 A;  1TYV A;  4W8T A;  2V5I A;  1PXZ A;  4OJL A;  1KCC A;  3NAW A;  1OFM A;  2VJI A;  3JUR A;  1O88 A;  1TSP A;  1QQ1 A;  4W8Q A;  4XOT A;  2B0R A;  2IOU G;  2O0W A;  2XC1 A;  3VMV A;  4OJ6 A;  4W8S A;  2YUH A;  4YEL A;  1TYU A;  5JMC B;  1VBL A;  4Z06 A;  4YEJ A;  2BM6 A;  2VFQ A;  2NTP A;  2XT2 A;  2BSP A;  1O8H A;  1DAB A; 
#chains in the Genus database with same CATH homology
 1QRB A;  2BX6 A;  1KQ5 A;  4OM9 A;  3JX8 A;  1QA2 A;  5JLV C;  4OPW A;  2BM4 A;  3N6Z A;  1QA3 A;  3LYC A;  2VFP A;  3LJY A;  1QA1 A;  3BH7 B;  1HF2 A;  2J8I A;  3H09 A;  3TH0 A;  2VFO A;  1TYW A;  3SYJ A;  3AK5 A;  1K4Z A;  1TYV A;  1K8F A;  4OJ5 A;  1QRC A;  2V5I A;  3BH6 B;  4JRA C;  4OJL A;  3N90 A;  3P4G A;  4KH3 A;  2W7Z A;  3PET A;  1TYX A;  2VFN A;  3RIQ A;  1TSP A;  1QQ1 A;  3ML3 A;  2F3L A;  2B0R A;  2IOU G;  4OJP A;  2XC1 A;  2G0Y A;  3SZE A;  4OJ6 A;  1CLW A;  2VFM A;  2YUH A;  4OJO A;  1TYU A;  1WXR A;  2BM5 A;  5JMC B;  2BM7 A;  4V02 C;  2BM6 A;  2VFQ A;  1DAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...