4YZ0A

C. bescii family 3 pectate lyase double mutant k108a/e39q in complex with trigalacturonic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSQNQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
molecule keywords Pectate lyase
total genus 85
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yz0A00
4XL9A 2NTPA 1O8JA 2PECA 1HG8A 4EW9A 1CZFA 4Z05A 3ZSCA 2NT6A 1O8LA 4W8QA 1IDKA 1X0CA 2X6XA 1DBGA 4OJ5A 2NSPA 3B8YA 4YEJA 1OGOX 1RMGA 2QXZA 4OJLA 2VBMA 4U49A 4C2LA 3GQ7A 1IA5A 1O8GA 1BN8A 2QY1A 4XKWA 1QCXA 4YZ0A 4YZXA 1BHEA 3ZPPA 4XM3A 5AMVA 4XMYA 2O0VA 4W8SA 1O8KA 4XKVA 2UVEA 2IQ7A 2VBEA 3LMWA 5C1CA 4XR6A 1QJVA 3GRHA 2O17A 4XONA 2VJIA 1GQ8A 4W8TA 3VSTA 4URRA 1JTAA 2QX3A 3B90A 2VBKA 2PYHA 4NK6A 3FY3A 2NTBA 2PYGA 2EWEA 4MR0A 4YZAA 4XLEA 4XOPA 4XN0A 1O8IA 1JRGA 4OZZA 1KCCA 3VSUA 1OFMA 3VMVA 1DBOA 1O88A 1K5CA 1O8MA 1OFLA 4XLFA 4XN3A 4HWVA 4NK8A 3GQAA 3EQNA 1PE9A 4U4BA 4OJ6A 4Z03A 3WWGA 2NT9A 1OGMX 4AVZA 4MXNA 2VJJA 4YZQA 1PLUA 3UW0A 1EE6A 4OJOA 2ODLA 3GQ9A 1WMRA 5C1EA 1O8FA 3JURA 4XORA 4XLCA 2NZMA 4OJPA 1AIRA 2O0WA 1RWRA 1RU4A 4XQFA 1IDJA 4Z06A 4OZYA 2O04A 1H80A 4YELA 2UVFA 3KRGA 4XLHA 4XLAA 3SUCA 1VBLA 1KCDA 4I84A 1OOCA 2X6WA 2X6YA 4PMHA 3GQ8A 1O8EA 1O8HA 3B4NA 2INVA 2NSTA 4XOTA 2X85A 1KTWA 2Z8GA 4W8RA 1IB4A 1NHCA 3EQOA 3VMWA 1O8DA 1PXZA 2BSPA 2X3HA 3VSVA 3T9GA 2INUA 2NTQA 1XG2A 2O1DA 4XNFA
chains in the Genus database with same CATH superfamily
4XL9A 2NTPA 1O8JA 1LM1A 2PECA 1L1IA 1HG8A 4EW9A 2BM4A 1CZFA 4YC5A 4Z05A 1DABA 1OFEA 3NAWA 2NT6A 3TH0A 3ZSCA 1O8LA 4W8QA 1QQ1A 1IDKA 4OPWA 1X0CA 2X6XA 1DBGA 3RIQA 4OJ5A 2NSPA 3B8YA 4YEJA 1OGOX 1RMGA 2QXZA 4OJLA 2VBMA 4U49A 2O6WA 4C2LA 3GQ7A 1IA5A 1O8GA 2F3LA 1BN8A 2QY1A 4XKWA 1QCXA 4YZ0A 2QZAA 4YZXA 2V5IA 1BHEA 2VFNA 3ZPPA 4XM3A 2XT2A 5AMVA 1QA3A 3JX8A 4XMYA 2O0VA 4W8SA 1O8KA 4V02C 4XKVA 2UVEA 2IQ7A 2VBEA 3SY2A 3LMWA 5C1CA 4XR6A 1QJVA 2VFPA 2XTYA 3GRHA 1WXRA 2XT4A 2O17A 4XONA 2VJIA 1EA0A 3H09A 1GQ8A 4W8TA 2BX6A 3VSTA 1TYWA 4URRA 1JTAA 2QX3A 2VBKA 3B90A 2PYHA 2BM6A 1HF2A 4NK6A 3FY3A 2NTBA 1LLWA 2BM7A 2PYGA 2EWEA 4MR0A 4YZAA 4XLEA 3DU1X 4XOPA 4XN0A 1O8IA 1JRGA 2J8IA 2QYUA 2BM5A 4OZZA 1KCCA 3VSUA 1OFMA 3SQVA 3VMVA 1DBOA 1K4ZA 3P4GA 1O88A 2VFMA 1K5CA 1QA2A 1O8MA 2IOUG 1K8FA 1KQ5A 2B0RA 1OFLA 4XLFA 4XN3A 1EZGA 4HWVA 3GQAA 4NK8A 2YUHA 3EQNA 1PE9A 4U4BA 4OJ6A 4Z03A 3WWGA 1QA1A 2NT9A 1CLWA 1OGMX 1TYVA 4AVZA 4MXNA 2VJJA 5JMCB 4YZQA 1PLUA 3UW0A 1EE6A 4OJOA 2ODLA 2XC1A 1WMRA 3GQ9A 5C1EA 3PSZA 4YCQA 1O8FA 1TYUA 3JURA 2G0YA 4XORA 4XLCA 2NZMA 4OJPA 1AIRA 2O0WA 1RWRA 1RU4A 4XQFA 3AK5A 1IDJA 1QRBA 1OFDA 5DNSA 4Z06A 3BH7B 2O04A 4KH3A 1H80A 4OZYA 4YELA 2UVFA 3KRGA 3SYJA 1TYXA 4XLHA 3BH6B 3N6ZA 4XLAA 3SUCA 1VBLA 1KCDA 4I84A 1OOCA 2X6WA 2X6YA 2VFQA 4PMHA 3GQ8A 2J8KA 1LLZA 1O8EA 4YDTA 3SZEA 1O8HA 5JLVC 4OM9A 4YFOA 2W7ZA 2INVA 3B4NA 2NSTA 2XTXA 2VFOA 3LJYA 4XOTA 2X85A 4JRAC 1KTWA 2Z8GA 4W8RA 3LYCA 3NB2A 1IB4A 1NHCA 2XTWA 3EQOA 1O8DA 3ML3A 3PSSA 3VMWA 1PXZA 2BSPA 2X3HA 3VSVA 3T9GA 4YEIA 1QRCA 3N90A 2INUA 1TSPA 2NTQA 3PETA 1XG2A 2O1DA 4XNFA
chains in the Genus database with same CATH topology
4XL9A 2NTPA 1O8JA 2PECA 1HG8A 4EW9A 1CZFA 4Z05A 3ZSCA 2NT6A 1O8LA 4W8QA 1IDKA 1X0CA 2X6XA 1DBGA 4OJ5A 2NSPA 3B8YA 4YEJA 1OGOX 1RMGA 2QXZA 4OJLA 2VBMA 4U49A 4C2LA 3GQ7A 1IA5A 1O8GA 1BN8A 2QY1A 4XKWA 1QCXA 4YZ0A 4YZXA 1BHEA 3ZPPA 4XM3A 5AMVA 4XMYA 2O0VA 4W8SA 1O8KA 4XKVA 2UVEA 2IQ7A 2VBEA 3LMWA 5C1CA 4XR6A 1QJVA 3GRHA 2O17A 4XONA 2VJIA 1GQ8A 4W8TA 3VSTA 4URRA 1JTAA 2QX3A 3B90A 2VBKA 2PYHA 4NK6A 3FY3A 2NTBA 2PYGA 2EWEA 4MR0A 4YZAA 4XLEA 4XOPA 4XN0A 1O8IA 1JRGA 4OZZA 1KCCA 3VSUA 1OFMA 3VMVA 1DBOA 1O88A 1K5CA 1O8MA 1OFLA 4XLFA 4XN3A 4HWVA 4NK8A 3GQAA 3EQNA 1PE9A 4U4BA 4OJ6A 4Z03A 3WWGA 2NT9A 1OGMX 4AVZA 4MXNA 2VJJA 4YZQA 1PLUA 3UW0A 1EE6A 4OJOA 2ODLA 3GQ9A 1WMRA 5C1EA 1O8FA 3JURA 4XORA 4XLCA 2NZMA 4OJPA 1AIRA 2O0WA 1RWRA 1RU4A 4XQFA 1IDJA 4Z06A 4OZYA 2O04A 1H80A 4YELA 2UVFA 3KRGA 4XLHA 4XLAA 3SUCA 1VBLA 1KCDA 4I84A 1OOCA 2X6WA 2X6YA 4PMHA 3GQ8A 1O8EA 1O8HA 3B4NA 2INVA 2NSTA 4XOTA 2X85A 1KTWA 2Z8GA 4W8RA 1IB4A 1NHCA 3EQOA 3VMWA 1O8DA 1PXZA 2BSPA 2X3HA 3VSVA 3T9GA 2INUA 2NTQA 1XG2A 2O1DA 4XNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XL9 A;  2NTP A;  1O8J A;  2PEC A;  1HG8 A;  4EW9 A;  1CZF A;  4Z05 A;  3ZSC A;  2NT6 A;  1O8L A;  4W8Q A;  1IDK A;  1X0C A;  2X6X A;  1DBG A;  4OJ5 A;  2NSP A;  3B8Y A;  4YEJ A;  1OGO X;  1RMG A;  2QXZ A;  4OJL A;  2VBM A;  4U49 A;  4C2L A;  3GQ7 A;  1IA5 A;  1O8G A;  1BN8 A;  2QY1 A;  4XKW A;  1QCX A;  4YZ0 A;  4YZX A;  1BHE A;  3ZPP A;  4XM3 A;  5AMV A;  4XMY A;  2O0V A;  4W8S A;  1O8K A;  4XKV A;  2UVE A;  2IQ7 A;  2VBE A;  3LMW A;  5C1C A;  4XR6 A;  1QJV A;  3GRH A;  2O17 A;  4XON A;  2VJI A;  1GQ8 A;  4W8T A;  3VST A;  4URR A;  1JTA A;  2QX3 A;  3B90 A;  2VBK A;  2PYH A;  4NK6 A;  3FY3 A;  2NTB A;  2PYG A;  2EWE A;  4MR0 A;  4YZA A;  4XLE A;  4XOP A;  4XN0 A;  1O8I A;  1JRG A;  4OZZ A;  1KCC A;  3VSU A;  1OFM A;  3VMV A;  1DBO A;  1O88 A;  1K5C A;  1O8M A;  1OFL A;  4XLF A;  4XN3 A;  4HWV A;  4NK8 A;  3GQA A;  3EQN A;  1PE9 A;  4U4B A;  4OJ6 A;  4Z03 A;  3WWG A;  2NT9 A;  1OGM X;  4AVZ A;  4MXN A;  2VJJ A;  4YZQ A;  1PLU A;  3UW0 A;  1EE6 A;  4OJO A;  2ODL A;  3GQ9 A;  1WMR A;  5C1E A;  1O8F A;  3JUR A;  4XOR A;  4XLC A;  2NZM A;  4OJP A;  1AIR A;  2O0W A;  1RWR A;  1RU4 A;  4XQF A;  1IDJ A;  4Z06 A;  4OZY A;  2O04 A;  1H80 A;  4YEL A;  2UVF A;  3KRG A;  4XLH A;  4XLA A;  3SUC A;  1VBL A;  1KCD A;  4I84 A;  1OOC A;  2X6W A;  2X6Y A;  4PMH A;  3GQ8 A;  1O8E A;  1O8H A;  3B4N A;  2INV A;  2NST A;  4XOT A;  2X85 A;  1KTW A;  2Z8G A;  4W8R A;  1IB4 A;  1NHC A;  3EQO A;  3VMW A;  1O8D A;  1PXZ A;  2BSP A;  2X3H A;  3VSV A;  3T9G A;  2INU A;  2NTQ A;  1XG2 A;  2O1D A;  4XNF A; 
#chains in the Genus database with same CATH topology
 4XL9 A;  2NTP A;  1O8J A;  1LM1 A;  2PEC A;  1L1I A;  1HG8 A;  4EW9 A;  2BM4 A;  1CZF A;  4YC5 A;  4Z05 A;  1DAB A;  1OFE A;  3NAW A;  2NT6 A;  3TH0 A;  3ZSC A;  1O8L A;  4W8Q A;  1QQ1 A;  1IDK A;  4OPW A;  1X0C A;  2X6X A;  1DBG A;  3RIQ A;  4OJ5 A;  2NSP A;  3B8Y A;  4YEJ A;  1OGO X;  1RMG A;  2QXZ A;  4OJL A;  2VBM A;  4U49 A;  2O6W A;  4C2L A;  3GQ7 A;  1IA5 A;  1O8G A;  2F3L A;  1BN8 A;  2QY1 A;  4XKW A;  1QCX A;  4YZ0 A;  2QZA A;  4YZX A;  2V5I A;  1BHE A;  2VFN A;  3ZPP A;  4XM3 A;  2XT2 A;  5AMV A;  1QA3 A;  3JX8 A;  4XMY A;  2O0V A;  4W8S A;  1O8K A;  4V02 C;  4XKV A;  2UVE A;  2IQ7 A;  2VBE A;  3SY2 A;  3LMW A;  5C1C A;  4XR6 A;  1QJV A;  2VFP A;  2XTY A;  3GRH A;  1WXR A;  2XT4 A;  2O17 A;  4XON A;  2VJI A;  1EA0 A;  3H09 A;  1GQ8 A;  4W8T A;  2BX6 A;  3VST A;  1TYW A;  4URR A;  1JTA A;  2QX3 A;  2VBK A;  3B90 A;  2PYH A;  2BM6 A;  1HF2 A;  4NK6 A;  3FY3 A;  2NTB A;  1LLW A;  2BM7 A;  2PYG A;  2EWE A;  4MR0 A;  4YZA A;  4XLE A;  3DU1 X;  4XOP A;  4XN0 A;  1O8I A;  1JRG A;  2J8I A;  2QYU A;  2BM5 A;  4OZZ A;  1KCC A;  3VSU A;  1OFM A;  3SQV A;  3VMV A;  1DBO A;  1K4Z A;  3P4G A;  1O88 A;  2VFM A;  1K5C A;  1QA2 A;  1O8M A;  2IOU G;  1K8F A;  1KQ5 A;  2B0R A;  1OFL A;  4XLF A;  4XN3 A;  1EZG A;  4HWV A;  3GQA A;  4NK8 A;  2YUH A;  3EQN A;  1PE9 A;  4U4B A;  4OJ6 A;  4Z03 A;  3WWG A;  1QA1 A;  2NT9 A;  1CLW A;  1OGM X;  1TYV A;  4AVZ A;  4MXN A;  2VJJ A;  5JMC B;  4YZQ A;  1PLU A;  3UW0 A;  1EE6 A;  4OJO A;  2ODL A;  2XC1 A;  1WMR A;  3GQ9 A;  5C1E A;  3PSZ A;  4YCQ A;  1O8F A;  1TYU A;  3JUR A;  2G0Y A;  4XOR A;  4XLC A;  2NZM A;  4OJP A;  1AIR A;  2O0W A;  1RWR A;  1RU4 A;  4XQF A;  3AK5 A;  1IDJ A;  1QRB A;  1OFD A;  5DNS A;  4Z06 A;  3BH7 B;  2O04 A;  4KH3 A;  1H80 A;  4OZY A;  4YEL A;  2UVF A;  3KRG A;  3SYJ A;  1TYX A;  4XLH A;  3BH6 B;  3N6Z A;  4XLA A;  3SUC A;  1VBL A;  1KCD A;  4I84 A;  1OOC A;  2X6W A;  2X6Y A;  2VFQ A;  4PMH A;  3GQ8 A;  2J8K A;  1LLZ A;  1O8E A;  4YDT A;  3SZE A;  1O8H A;  5JLV C;  4OM9 A;  4YFO A;  2W7Z A;  2INV A;  3B4N A;  2NST A;  2XTX A;  2VFO A;  3LJY A;  4XOT A;  2X85 A;  4JRA C;  1KTW A;  2Z8G A;  4W8R A;  3LYC A;  3NB2 A;  1IB4 A;  1NHC A;  2XTW A;  3EQO A;  1O8D A;  3ML3 A;  3PSS A;  3VMW A;  1PXZ A;  2BSP A;  2X3H A;  3VSV A;  3T9G A;  4YEI A;  1QRC A;  3N90 A;  2INU A;  1TSP A;  2NTQ A;  3PET A;  1XG2 A;  2O1D A;  4XNF A; 
#chains in the Genus database with same CATH homology
 4XL9 A;  2NTP A;  1O8J A;  2PEC A;  1HG8 A;  4EW9 A;  1CZF A;  4Z05 A;  3ZSC A;  2NT6 A;  1O8L A;  4W8Q A;  1IDK A;  1X0C A;  2X6X A;  1DBG A;  4OJ5 A;  2NSP A;  3B8Y A;  4YEJ A;  1OGO X;  1RMG A;  2QXZ A;  4OJL A;  2VBM A;  4U49 A;  4C2L A;  3GQ7 A;  1IA5 A;  1O8G A;  1BN8 A;  2QY1 A;  4XKW A;  1QCX A;  4YZ0 A;  4YZX A;  1BHE A;  3ZPP A;  4XM3 A;  5AMV A;  4XMY A;  2O0V A;  4W8S A;  1O8K A;  4XKV A;  2UVE A;  2IQ7 A;  2VBE A;  3LMW A;  5C1C A;  4XR6 A;  1QJV A;  3GRH A;  2O17 A;  4XON A;  2VJI A;  1GQ8 A;  4W8T A;  3VST A;  4URR A;  1JTA A;  2QX3 A;  3B90 A;  2VBK A;  2PYH A;  4NK6 A;  3FY3 A;  2NTB A;  2PYG A;  2EWE A;  4MR0 A;  4YZA A;  4XLE A;  4XOP A;  4XN0 A;  1O8I A;  1JRG A;  4OZZ A;  1KCC A;  3VSU A;  1OFM A;  3VMV A;  1DBO A;  1O88 A;  1K5C A;  1O8M A;  1OFL A;  4XLF A;  4XN3 A;  4HWV A;  4NK8 A;  3GQA A;  3EQN A;  1PE9 A;  4U4B A;  4OJ6 A;  4Z03 A;  3WWG A;  2NT9 A;  1OGM X;  4AVZ A;  4MXN A;  2VJJ A;  4YZQ A;  1PLU A;  3UW0 A;  1EE6 A;  4OJO A;  2ODL A;  3GQ9 A;  1WMR A;  5C1E A;  1O8F A;  3JUR A;  4XOR A;  4XLC A;  2NZM A;  4OJP A;  1AIR A;  2O0W A;  1RWR A;  1RU4 A;  4XQF A;  1IDJ A;  4Z06 A;  4OZY A;  2O04 A;  1H80 A;  4YEL A;  2UVF A;  3KRG A;  4XLH A;  4XLA A;  3SUC A;  1VBL A;  1KCD A;  4I84 A;  1OOC A;  2X6W A;  2X6Y A;  4PMH A;  3GQ8 A;  1O8E A;  1O8H A;  3B4N A;  2INV A;  2NST A;  4XOT A;  2X85 A;  1KTW A;  2Z8G A;  4W8R A;  1IB4 A;  1NHC A;  3EQO A;  3VMW A;  1O8D A;  1PXZ A;  2BSP A;  2X3H A;  3VSV A;  3T9G A;  2INU A;  2NTQ A;  1XG2 A;  2O1D A;  4XNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...