4YZ0A

C. bescii family 3 pectate lyase double mutant k108a/e39q in complex with trigalacturonic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSQNQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 85
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yz0A00
4XLCA 3GQ7A 1BN8A 2BSPA 2NTQA 2VBKA 1AIRA 1O8IA 4NK6A 4OZYA 2NT9A 4XLHA 4U49A 1O8DA 2X6YA 1XG2A 3FY3A 4YZXA 3GQAA 2O1DA 4YZAA 2VBMA 1O8HA 4AVZA 1KCDA 4PMHA 4YZ0A 4XLAA 2VJIA 4YZQA 4MR0A 4OJPA 4XQFA 4OJOA 1OFLA 2O0WA 2NSTA 4YELA 4XKWA 1O8FA 1BHEA 1RU4A 1OFMA 5AMVA 1DBOA 1KTWA 3EQOA 2INVA 2PYHA 1KCCA 3VMVA 3SUCA 1O8MA 3VSTA 4OJ5A 2NTPA 2UVEA 4W8TA 1EE6A 2X6XA 1JRGA 3GQ9A 4W8RA 2O04A 3GQ8A 1IDKA 1VBLA 4NK8A 1OGOX 1OGMX 1IDJA 1NHCA 4HWVA 2QX3A 1X0CA 3VSUA 5C1EA 4Z06A 3LMWA 2EWEA 2X85A 4W8QA 4XOPA 3VMWA 1O8KA 2NT6A 2VJJA 3B4NA 4XR6A 4C2LA 2X6WA 4XLFA 2ODLA 1QJVA 3ZSCA 1H80A 3VSVA 2UVFA 4XMYA 3EQNA 3B90A 2PYGA 1O8EA 4XNFA 2QXZA 4XLEA 2QY1A 2X3HA 1PLUA 1O8GA 3JURA 4XORA 1K5CA 4URRA 1RMGA 1PE9A 1CZFA 1RWRA 1WMRA 3B8YA 4I84A 4XM3A 3ZPPA 1HG8A 2IQ7A 2Z8GA 4OJLA 1IA5A 2NZMA 5C1CA 3T9GA 2PECA 4EW9A 4OZZA 2NSPA 1DBGA 3WWGA 1PXZA 4YEJA 3GRHA 4Z05A 2O17A 4XL9A 1GQ8A 4MXNA 2VBEA 3UW0A 4XOTA 4XONA 1QCXA 2INUA 4XN3A 1IB4A 1O8JA 1O8LA 4Z03A 4XKVA 4W8SA 2NTBA 3KRGA 1O88A 4U4BA 4OJ6A 1JTAA 4XN0A 2O0VA 1OOCA
chains in the Genus database with same CATH superfamily
4XLCA 3GQ7A 1BN8A 5JMCB 2BSPA 2NTQA 2V5IA 1AIRA 1O8IA 2VBKA 2XTWA 3N90A 4YCQA 4NK6A 4OZYA 2NT9A 3ML3A 3NAWA 4XLHA 3H09A 2XTXA 4U49A 1O8DA 2XC1A 2J8KA 2X6YA 1XG2A 3FY3A 4YZXA 3GQAA 2O1DA 4YC5A 4YZAA 4YFOA 2VBMA 2BM7A 1O8HA 4AVZA 1LLZA 4PMHA 1KCDA 4YZ0A 4XLAA 4OM9A 2VFQA 4XN0A 2VJIA 4KH3A 1TYXA 4YEIA 3NB2A 4MR0A 4YZQA 4OJPA 1K8FA 4XQFA 3JX8A 1LLWA 2BM6A 4OJOA 1OFLA 1QA3A 2O0WA 2NSTA 1EZGA 4YELA 4XKWA 1QA2A 1O8FA 3SZEA 1BHEA 3BH7B 1TYUA 2YUHA 1OFMA 1QRBA 2BM5A 1DBOA 1KTWA 2O6WA 3EQOA 5AMVA 2INVA 2PYHA 2W7ZA 2XTYA 2VFOA 1KCCA 3VMVA 3SUCA 1O8MA 3VSTA 4OJ5A 4V02C 2BM4A 2NTPA 2UVEA 4W8TA 1EE6A 1LM1A 2X6XA 1JRGA 3GQ9A 3LYCA 4W8RA 2O04A 3GQ8A 1IDKA 1VBLA 1QA1A 4NK8A 1OGOX 1OGMX 1IDJA 1NHCA 4HWVA 2QX3A 1X0CA 3VSUA 1TSPA 3SQVA 5C1EA 4Z06A 3LMWA 2EWEA 2X85A 4W8QA 4XOPA 2BX6A 1O8KA 2NT6A 2VJJA 2F3LA 3B4NA 4XR6A 3VMWA 4C2LA 3PSZA 2O0VA 2X6WA 4XLFA 2J8IA 2ODLA 1QJVA 2G0YA 1H80A 3ZSCA 1OFEA 3AK5A 3P4GA 1TYVA 1TYWA 5DNSA 3VSVA 2UVFA 4XMYA 3EQNA 3B90A 1HF2A 3SY2A 3TH0A 2PYGA 1O8EA 4XNFA 2IOUG 2QXZA 3PETA 4XLEA 1DABA 2QY1A 2X3HA 1PLUA 1O8GA 2VFNA 2QZAA 3JURA 4XORA 1K5CA 4URRA 1RMGA 1PE9A 1CZFA 1RWRA 1WMRA 2XT4A 2VFPA 3B8YA 4I84A 4XM3A 3PSSA 3ZPPA 5JLVC 1OFDA 1HG8A 2IQ7A 2Z8GA 4OJLA 1IA5A 2NZMA 5C1CA 3T9GA 2PECA 4EW9A 4OZZA 1EA0A 2QYUA 4YDTA 2NSPA 1DBGA 3BH6B 3WWGA 1PXZA 4YEJA 3GRHA 3N6ZA 4OPWA 4Z05A 1QRCA 3RIQA 2O17A 3SYJA 1WXRA 4XL9A 1GQ8A 4MXNA 2VBEA 1CLWA 4XOTA 3UW0A 4XONA 1QCXA 4JRAC 1KQ5A 2INUA 4XN3A 1IB4A 1O8JA 1O8LA 1K4ZA 3LJYA 4Z03A 2XT2A 4XKVA 4W8SA 2VFMA 2B0RA 2NTBA 3KRGA 1QQ1A 1O88A 4U4BA 4OJ6A 1JTAA 3DU1X 1RU4A 1OOCA 1L1IA
chains in the Genus database with same CATH topology
4XLCA 3GQ7A 1BN8A 2BSPA 2NTQA 2VBKA 1AIRA 1O8IA 4NK6A 4OZYA 2NT9A 4XLHA 4U49A 1O8DA 2X6YA 1XG2A 3FY3A 4YZXA 3GQAA 2O1DA 4YZAA 2VBMA 1O8HA 4AVZA 1KCDA 4PMHA 4YZ0A 4XLAA 2VJIA 4YZQA 4MR0A 4OJPA 4XQFA 4OJOA 1OFLA 2O0WA 2NSTA 4YELA 4XKWA 1O8FA 1BHEA 1RU4A 1OFMA 5AMVA 1DBOA 1KTWA 3EQOA 2INVA 2PYHA 1KCCA 3VMVA 3SUCA 1O8MA 3VSTA 4OJ5A 2NTPA 2UVEA 4W8TA 1EE6A 2X6XA 1JRGA 3GQ9A 4W8RA 2O04A 3GQ8A 1IDKA 1VBLA 4NK8A 1OGOX 1OGMX 1IDJA 1NHCA 4HWVA 2QX3A 1X0CA 3VSUA 5C1EA 4Z06A 3LMWA 2EWEA 2X85A 4W8QA 4XOPA 3VMWA 1O8KA 2NT6A 2VJJA 3B4NA 4XR6A 4C2LA 2X6WA 4XLFA 2ODLA 1QJVA 3ZSCA 1H80A 3VSVA 2UVFA 4XMYA 3EQNA 3B90A 2PYGA 1O8EA 4XNFA 2QXZA 4XLEA 2QY1A 2X3HA 1PLUA 1O8GA 3JURA 4XORA 1K5CA 4URRA 1RMGA 1PE9A 1CZFA 1RWRA 1WMRA 3B8YA 4I84A 4XM3A 3ZPPA 1HG8A 2IQ7A 2Z8GA 4OJLA 1IA5A 2NZMA 5C1CA 3T9GA 2PECA 4EW9A 4OZZA 2NSPA 1DBGA 3WWGA 1PXZA 4YEJA 3GRHA 4Z05A 2O17A 4XL9A 1GQ8A 4MXNA 2VBEA 3UW0A 4XOTA 4XONA 1QCXA 2INUA 4XN3A 1IB4A 1O8JA 1O8LA 4Z03A 4XKVA 4W8SA 2NTBA 3KRGA 1O88A 4U4BA 4OJ6A 1JTAA 4XN0A 2O0VA 1OOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLC A;  3GQ7 A;  1BN8 A;  2BSP A;  2NTQ A;  2VBK A;  1AIR A;  1O8I A;  4NK6 A;  4OZY A;  2NT9 A;  4XLH A;  4U49 A;  1O8D A;  2X6Y A;  1XG2 A;  3FY3 A;  4YZX A;  3GQA A;  2O1D A;  4YZA A;  2VBM A;  1O8H A;  4AVZ A;  1KCD A;  4PMH A;  4YZ0 A;  4XLA A;  2VJI A;  4YZQ A;  4MR0 A;  4OJP A;  4XQF A;  4OJO A;  1OFL A;  2O0W A;  2NST A;  4YEL A;  4XKW A;  1O8F A;  1BHE A;  1RU4 A;  1OFM A;  5AMV A;  1DBO A;  1KTW A;  3EQO A;  2INV A;  2PYH A;  1KCC A;  3VMV A;  3SUC A;  1O8M A;  3VST A;  4OJ5 A;  2NTP A;  2UVE A;  4W8T A;  1EE6 A;  2X6X A;  1JRG A;  3GQ9 A;  4W8R A;  2O04 A;  3GQ8 A;  1IDK A;  1VBL A;  4NK8 A;  1OGO X;  1OGM X;  1IDJ A;  1NHC A;  4HWV A;  2QX3 A;  1X0C A;  3VSU A;  5C1E A;  4Z06 A;  3LMW A;  2EWE A;  2X85 A;  4W8Q A;  4XOP A;  3VMW A;  1O8K A;  2NT6 A;  2VJJ A;  3B4N A;  4XR6 A;  4C2L A;  2X6W A;  4XLF A;  2ODL A;  1QJV A;  3ZSC A;  1H80 A;  3VSV A;  2UVF A;  4XMY A;  3EQN A;  3B90 A;  2PYG A;  1O8E A;  4XNF A;  2QXZ A;  4XLE A;  2QY1 A;  2X3H A;  1PLU A;  1O8G A;  3JUR A;  4XOR A;  1K5C A;  4URR A;  1RMG A;  1PE9 A;  1CZF A;  1RWR A;  1WMR A;  3B8Y A;  4I84 A;  4XM3 A;  3ZPP A;  1HG8 A;  2IQ7 A;  2Z8G A;  4OJL A;  1IA5 A;  2NZM A;  5C1C A;  3T9G A;  2PEC A;  4EW9 A;  4OZZ A;  2NSP A;  1DBG A;  3WWG A;  1PXZ A;  4YEJ A;  3GRH A;  4Z05 A;  2O17 A;  4XL9 A;  1GQ8 A;  4MXN A;  2VBE A;  3UW0 A;  4XOT A;  4XON A;  1QCX A;  2INU A;  4XN3 A;  1IB4 A;  1O8J A;  1O8L A;  4Z03 A;  4XKV A;  4W8S A;  2NTB A;  3KRG A;  1O88 A;  4U4B A;  4OJ6 A;  1JTA A;  4XN0 A;  2O0V A;  1OOC A; 
#chains in the Genus database with same CATH topology
 4XLC A;  3GQ7 A;  1BN8 A;  5JMC B;  2BSP A;  2NTQ A;  2V5I A;  1AIR A;  1O8I A;  2VBK A;  2XTW A;  3N90 A;  4YCQ A;  4NK6 A;  4OZY A;  2NT9 A;  3ML3 A;  3NAW A;  4XLH A;  3H09 A;  2XTX A;  4U49 A;  1O8D A;  2XC1 A;  2J8K A;  2X6Y A;  1XG2 A;  3FY3 A;  4YZX A;  3GQA A;  2O1D A;  4YC5 A;  4YZA A;  4YFO A;  2VBM A;  2BM7 A;  1O8H A;  4AVZ A;  1LLZ A;  4PMH A;  1KCD A;  4YZ0 A;  4XLA A;  4OM9 A;  2VFQ A;  4XN0 A;  2VJI A;  4KH3 A;  1TYX A;  4YEI A;  3NB2 A;  4MR0 A;  4YZQ A;  4OJP A;  1K8F A;  4XQF A;  3JX8 A;  1LLW A;  2BM6 A;  4OJO A;  1OFL A;  1QA3 A;  2O0W A;  2NST A;  1EZG A;  4YEL A;  4XKW A;  1QA2 A;  1O8F A;  3SZE A;  1BHE A;  3BH7 B;  1TYU A;  2YUH A;  1OFM A;  1QRB A;  2BM5 A;  1DBO A;  1KTW A;  2O6W A;  3EQO A;  5AMV A;  2INV A;  2PYH A;  2W7Z A;  2XTY A;  2VFO A;  1KCC A;  3VMV A;  3SUC A;  1O8M A;  3VST A;  4OJ5 A;  4V02 C;  2BM4 A;  2NTP A;  2UVE A;  4W8T A;  1EE6 A;  1LM1 A;  2X6X A;  1JRG A;  3GQ9 A;  3LYC A;  4W8R A;  2O04 A;  3GQ8 A;  1IDK A;  1VBL A;  1QA1 A;  4NK8 A;  1OGO X;  1OGM X;  1IDJ A;  1NHC A;  4HWV A;  2QX3 A;  1X0C A;  3VSU A;  1TSP A;  3SQV A;  5C1E A;  4Z06 A;  3LMW A;  2EWE A;  2X85 A;  4W8Q A;  4XOP A;  2BX6 A;  1O8K A;  2NT6 A;  2VJJ A;  2F3L A;  3B4N A;  4XR6 A;  3VMW A;  4C2L A;  3PSZ A;  2O0V A;  2X6W A;  4XLF A;  2J8I A;  2ODL A;  1QJV A;  2G0Y A;  1H80 A;  3ZSC A;  1OFE A;  3AK5 A;  3P4G A;  1TYV A;  1TYW A;  5DNS A;  3VSV A;  2UVF A;  4XMY A;  3EQN A;  3B90 A;  1HF2 A;  3SY2 A;  3TH0 A;  2PYG A;  1O8E A;  4XNF A;  2IOU G;  2QXZ A;  3PET A;  4XLE A;  1DAB A;  2QY1 A;  2X3H A;  1PLU A;  1O8G A;  2VFN A;  2QZA A;  3JUR A;  4XOR A;  1K5C A;  4URR A;  1RMG A;  1PE9 A;  1CZF A;  1RWR A;  1WMR A;  2XT4 A;  2VFP A;  3B8Y A;  4I84 A;  4XM3 A;  3PSS A;  3ZPP A;  5JLV C;  1OFD A;  1HG8 A;  2IQ7 A;  2Z8G A;  4OJL A;  1IA5 A;  2NZM A;  5C1C A;  3T9G A;  2PEC A;  4EW9 A;  4OZZ A;  1EA0 A;  2QYU A;  4YDT A;  2NSP A;  1DBG A;  3BH6 B;  3WWG A;  1PXZ A;  4YEJ A;  3GRH A;  3N6Z A;  4OPW A;  4Z05 A;  1QRC A;  3RIQ A;  2O17 A;  3SYJ A;  1WXR A;  4XL9 A;  1GQ8 A;  4MXN A;  2VBE A;  1CLW A;  4XOT A;  3UW0 A;  4XON A;  1QCX A;  4JRA C;  1KQ5 A;  2INU A;  4XN3 A;  1IB4 A;  1O8J A;  1O8L A;  1K4Z A;  3LJY A;  4Z03 A;  2XT2 A;  4XKV A;  4W8S A;  2VFM A;  2B0R A;  2NTB A;  3KRG A;  1QQ1 A;  1O88 A;  4U4B A;  4OJ6 A;  1JTA A;  3DU1 X;  1RU4 A;  1OOC A;  1L1I A; 
#chains in the Genus database with same CATH homology
 4XLC A;  3GQ7 A;  1BN8 A;  2BSP A;  2NTQ A;  2VBK A;  1AIR A;  1O8I A;  4NK6 A;  4OZY A;  2NT9 A;  4XLH A;  4U49 A;  1O8D A;  2X6Y A;  1XG2 A;  3FY3 A;  4YZX A;  3GQA A;  2O1D A;  4YZA A;  2VBM A;  1O8H A;  4AVZ A;  1KCD A;  4PMH A;  4YZ0 A;  4XLA A;  2VJI A;  4YZQ A;  4MR0 A;  4OJP A;  4XQF A;  4OJO A;  1OFL A;  2O0W A;  2NST A;  4YEL A;  4XKW A;  1O8F A;  1BHE A;  1RU4 A;  1OFM A;  5AMV A;  1DBO A;  1KTW A;  3EQO A;  2INV A;  2PYH A;  1KCC A;  3VMV A;  3SUC A;  1O8M A;  3VST A;  4OJ5 A;  2NTP A;  2UVE A;  4W8T A;  1EE6 A;  2X6X A;  1JRG A;  3GQ9 A;  4W8R A;  2O04 A;  3GQ8 A;  1IDK A;  1VBL A;  4NK8 A;  1OGO X;  1OGM X;  1IDJ A;  1NHC A;  4HWV A;  2QX3 A;  1X0C A;  3VSU A;  5C1E A;  4Z06 A;  3LMW A;  2EWE A;  2X85 A;  4W8Q A;  4XOP A;  3VMW A;  1O8K A;  2NT6 A;  2VJJ A;  3B4N A;  4XR6 A;  4C2L A;  2X6W A;  4XLF A;  2ODL A;  1QJV A;  3ZSC A;  1H80 A;  3VSV A;  2UVF A;  4XMY A;  3EQN A;  3B90 A;  2PYG A;  1O8E A;  4XNF A;  2QXZ A;  4XLE A;  2QY1 A;  2X3H A;  1PLU A;  1O8G A;  3JUR A;  4XOR A;  1K5C A;  4URR A;  1RMG A;  1PE9 A;  1CZF A;  1RWR A;  1WMR A;  3B8Y A;  4I84 A;  4XM3 A;  3ZPP A;  1HG8 A;  2IQ7 A;  2Z8G A;  4OJL A;  1IA5 A;  2NZM A;  5C1C A;  3T9G A;  2PEC A;  4EW9 A;  4OZZ A;  2NSP A;  1DBG A;  3WWG A;  1PXZ A;  4YEJ A;  3GRH A;  4Z05 A;  2O17 A;  4XL9 A;  1GQ8 A;  4MXN A;  2VBE A;  3UW0 A;  4XOT A;  4XON A;  1QCX A;  2INU A;  4XN3 A;  1IB4 A;  1O8J A;  1O8L A;  4Z03 A;  4XKV A;  4W8S A;  2NTB A;  3KRG A;  1O88 A;  4U4B A;  4OJ6 A;  1JTA A;  4XN0 A;  2O0V A;  1OOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...