4YZ0A

C. bescii family 3 pectate lyase double mutant k108a/e39q in complex with trigalacturonic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
198
structure length
198
Chain Sequence
b'HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSQNQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 85
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yz0A00
2NT6A 2X85A 2IQ7A 2PYHA 2PECA 4Z05A 3GQ7A 5AMVA 2O17A 4OJOA 1VBLA 4OJLA 2VBKA 4XN0A 4XNFA 1O8EA 1O8HA 4YZXA 5C1CA 1XG2A 4XR6A 4XORA 4XOTA 4NK8A 4XLAA 4XLCA 1NHCA 1BHEA 2VBMA 2PYGA 1OFMA 2QXZA 2BSPA 4OZYA 3JURA 3FY3A 1O8KA 4OJPA 3VMVA 2NSTA 3B90A 1JRGA 1AIRA 4XLEA 2X6XA 4NK6A 4U49A 4Z06A 1O8JA 1OGMX 2QX3A 2NTQA 1HG8A 3WWGA 3B8YA 1IDJA 1RWRA 3GQ8A 3T9GA 1WMRA 1IDKA 4HWVA 3VSUA 4AVZA 1PE9A 3B4NA 3VSVA 1OFLA 1JTAA 5C1EA 3VMWA 2X6WA 3VSTA 4YZ0A 4OJ5A 4XQFA 4XM3A 2NSPA 2EWEA 4XLHA 1PXZA 4OZZA 3GQAA 1O8IA 4XONA 1GQ8A 2UVFA 4I84A 4XMYA 2NT9A 1O8LA 4W8TA 2UVEA 1RU4A 2X3HA 1RMGA 2Z8GA 4XKWA 3SUCA 1KCCA 4YZQA 1K5CA 3KRGA 4Z03A 2VJIA 1O8FA 1KTWA 4C2LA 4U4BA 3GRHA 4EW9A 2INUA 3ZPPA 1PLUA 1OGOX 2NTPA 3EQNA 1O88A 1OOCA 2O0WA 2QY1A 1QCXA 1BN8A 4URRA 4PMHA 4MR0A 2NZMA 2ODLA 4MXNA 4W8RA 4XLFA 2NTBA 2VBEA 2O1DA 4XL9A 1X0CA 4YEJA 3UW0A 1O8DA 1IB4A 1EE6A 4OJ6A 4W8SA 1CZFA 3ZSCA 3EQOA 1QJVA 3LMWA 4XKVA 4XOPA 4XN3A 2X6YA 3GQ9A 1DBOA 4W8QA 4YZAA 1DBGA 1H80A 2VJJA 2INVA 2O04A 4YELA 1IA5A 1O8GA 1KCDA 2O0VA 1O8MA
chains in the Genus database with same CATH superfamily
2NT6A 2X85A 2IQ7A 2PYHA 2PECA 4Z05A 2W7ZA 2BM7A 3GQ7A 2BM4A 5AMVA 2O17A 4KH3A 1VBLA 2XT4A 4OJLA 2VBKA 4OJOA 4XN0A 1QA1A 2G0YA 4XNFA 1O8EA 1O8HA 3PETA 1TSPA 4V02C 3H09A 4YZXA 5C1CA 1TYWA 1XG2A 1QRBA 1QRCA 4XR6A 4XORA 4XOTA 4NK8A 4XLAA 4XLCA 1NHCA 1BHEA 2VBMA 2PYGA 1OFMA 2QXZA 2BSPA 2VFOA 4JRAC 4OZYA 3P4GA 3JURA 3FY3A 1O8KA 2YUHA 4OJPA 3VMVA 1QA2A 3NAWA 3ML3A 2NSTA 3B90A 1LLZA 1JRGA 1AIRA 4XLEA 3PSZA 3SY2A 2X6XA 4NK6A 4OM9A 4U49A 4Z06A 1O8JA 1OGMX 2QX3A 2IOUG 2NTQA 1HG8A 3WWGA 1EZGA 3B8YA 1IDJA 1RWRA 2XC1A 3GQ8A 3DU1X 3LJYA 1WMRA 2B0RA 2QYUA 1IDKA 3BH6B 4HWVA 3VSUA 4AVZA 1PE9A 3B4NA 3VSVA 3N6ZA 1OFLA 3RIQA 1QQ1A 1JTAA 2VFPA 2F3LA 2X6WA 5C1EA 3VMWA 3VSTA 4OJ5A 2J8KA 4YZ0A 2XTXA 4XQFA 4XM3A 2NSPA 1K8FA 3PSSA 2EWEA 4XLHA 1PXZA 4OZZA 3GQAA 1O8IA 2QZAA 4XONA 3SQVA 1HF2A 4YEIA 1LLWA 2J8IA 2BX6A 1GQ8A 2UVFA 4I84A 4XMYA 1O8LA 1TYVA 2BM5A 2NT9A 1TYXA 2UVEA 4W8TA 2V5IA 3TH0A 1RU4A 2X3HA 2VFMA 2XTYA 1DABA 1L1IA 1RMGA 1CLWA 2Z8GA 4XKWA 4YCQA 3SUCA 1KCCA 4YZQA 1K5CA 4YFOA 5DNSA 3SYJA 3KRGA 3AK5A 4Z03A 2VJIA 1O8FA 3N90A 1OFDA 1TYUA 3NB2A 1LM1A 1WXRA 1KTWA 3SZEA 4C2LA 5JLVC 1K4ZA 4U4BA 1QA3A 3GRHA 4EW9A 2INUA 3ZPPA 1PLUA 1OGOX 2NTPA 3EQNA 1O88A 1OOCA 2O0WA 2QY1A 1QCXA 3BH7B 1BN8A 4URRA 4OPWA 4PMHA 4MR0A 2NZMA 3JX8A 2ODLA 4MXNA 4W8RA 4YDTA 4XLFA 2NTBA 2VBEA 2O1DA 4XL9A 1X0CA 4YEJA 3UW0A 1EA0A 1KQ5A 1O8DA 3T9GA 1IB4A 1EE6A 4OJ6A 4W8SA 1CZFA 3ZSCA 2XT2A 3EQOA 1QJVA 3LMWA 4XKVA 4XOPA 4XN3A 2X6YA 3GQ9A 2BM6A 1DBOA 3LYCA 4W8QA 4YZAA 1DBGA 1H80A 2VJJA 2INVA 1OFEA 2O04A 2XTWA 4YELA 1IA5A 1O8GA 1KCDA 5JMCB 4YC5A 2VFQA 2VFNA 2O0VA 2O6WA 1O8MA
chains in the Genus database with same CATH topology
2NT6A 2X85A 2IQ7A 2PYHA 2PECA 4Z05A 3GQ7A 5AMVA 2O17A 4OJOA 1VBLA 4OJLA 2VBKA 4XN0A 4XNFA 1O8EA 1O8HA 4YZXA 5C1CA 1XG2A 4XR6A 4XORA 4XOTA 4NK8A 4XLAA 4XLCA 1NHCA 1BHEA 2VBMA 2PYGA 1OFMA 2QXZA 2BSPA 4OZYA 3JURA 3FY3A 1O8KA 4OJPA 3VMVA 2NSTA 3B90A 1JRGA 1AIRA 4XLEA 2X6XA 4NK6A 4U49A 4Z06A 1O8JA 1OGMX 2QX3A 2NTQA 1HG8A 3WWGA 3B8YA 1IDJA 1RWRA 3GQ8A 3T9GA 1WMRA 1IDKA 4HWVA 3VSUA 4AVZA 1PE9A 3B4NA 3VSVA 1OFLA 1JTAA 5C1EA 3VMWA 2X6WA 3VSTA 4YZ0A 4OJ5A 4XQFA 4XM3A 2NSPA 2EWEA 4XLHA 1PXZA 4OZZA 3GQAA 1O8IA 4XONA 1GQ8A 2UVFA 4I84A 4XMYA 2NT9A 1O8LA 4W8TA 2UVEA 1RU4A 2X3HA 1RMGA 2Z8GA 4XKWA 3SUCA 1KCCA 4YZQA 1K5CA 3KRGA 4Z03A 2VJIA 1O8FA 1KTWA 4C2LA 4U4BA 3GRHA 4EW9A 2INUA 3ZPPA 1PLUA 1OGOX 2NTPA 3EQNA 1O88A 1OOCA 2O0WA 2QY1A 1QCXA 1BN8A 4URRA 4PMHA 4MR0A 2NZMA 2ODLA 4MXNA 4W8RA 4XLFA 2NTBA 2VBEA 2O1DA 4XL9A 1X0CA 4YEJA 3UW0A 1O8DA 1IB4A 1EE6A 4OJ6A 4W8SA 1CZFA 3ZSCA 3EQOA 1QJVA 3LMWA 4XKVA 4XOPA 4XN3A 2X6YA 3GQ9A 1DBOA 4W8QA 4YZAA 1DBGA 1H80A 2VJJA 2INVA 2O04A 4YELA 1IA5A 1O8GA 1KCDA 2O0VA 1O8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NT6 A;  2X85 A;  2IQ7 A;  2PYH A;  2PEC A;  4Z05 A;  3GQ7 A;  5AMV A;  2O17 A;  4OJO A;  1VBL A;  4OJL A;  2VBK A;  4XN0 A;  4XNF A;  1O8E A;  1O8H A;  4YZX A;  5C1C A;  1XG2 A;  4XR6 A;  4XOR A;  4XOT A;  4NK8 A;  4XLA A;  4XLC A;  1NHC A;  1BHE A;  2VBM A;  2PYG A;  1OFM A;  2QXZ A;  2BSP A;  4OZY A;  3JUR A;  3FY3 A;  1O8K A;  4OJP A;  3VMV A;  2NST A;  3B90 A;  1JRG A;  1AIR A;  4XLE A;  2X6X A;  4NK6 A;  4U49 A;  4Z06 A;  1O8J A;  1OGM X;  2QX3 A;  2NTQ A;  1HG8 A;  3WWG A;  3B8Y A;  1IDJ A;  1RWR A;  3GQ8 A;  3T9G A;  1WMR A;  1IDK A;  4HWV A;  3VSU A;  4AVZ A;  1PE9 A;  3B4N A;  3VSV A;  1OFL A;  1JTA A;  5C1E A;  3VMW A;  2X6W A;  3VST A;  4YZ0 A;  4OJ5 A;  4XQF A;  4XM3 A;  2NSP A;  2EWE A;  4XLH A;  1PXZ A;  4OZZ A;  3GQA A;  1O8I A;  4XON A;  1GQ8 A;  2UVF A;  4I84 A;  4XMY A;  2NT9 A;  1O8L A;  4W8T A;  2UVE A;  1RU4 A;  2X3H A;  1RMG A;  2Z8G A;  4XKW A;  3SUC A;  1KCC A;  4YZQ A;  1K5C A;  3KRG A;  4Z03 A;  2VJI A;  1O8F A;  1KTW A;  4C2L A;  4U4B A;  3GRH A;  4EW9 A;  2INU A;  3ZPP A;  1PLU A;  1OGO X;  2NTP A;  3EQN A;  1O88 A;  1OOC A;  2O0W A;  2QY1 A;  1QCX A;  1BN8 A;  4URR A;  4PMH A;  4MR0 A;  2NZM A;  2ODL A;  4MXN A;  4W8R A;  4XLF A;  2NTB A;  2VBE A;  2O1D A;  4XL9 A;  1X0C A;  4YEJ A;  3UW0 A;  1O8D A;  1IB4 A;  1EE6 A;  4OJ6 A;  4W8S A;  1CZF A;  3ZSC A;  3EQO A;  1QJV A;  3LMW A;  4XKV A;  4XOP A;  4XN3 A;  2X6Y A;  3GQ9 A;  1DBO A;  4W8Q A;  4YZA A;  1DBG A;  1H80 A;  2VJJ A;  2INV A;  2O04 A;  4YEL A;  1IA5 A;  1O8G A;  1KCD A;  2O0V A;  1O8M A; 
#chains in the Genus database with same CATH topology
 2NT6 A;  2X85 A;  2IQ7 A;  2PYH A;  2PEC A;  4Z05 A;  2W7Z A;  2BM7 A;  3GQ7 A;  2BM4 A;  5AMV A;  2O17 A;  4KH3 A;  1VBL A;  2XT4 A;  4OJL A;  2VBK A;  4OJO A;  4XN0 A;  1QA1 A;  2G0Y A;  4XNF A;  1O8E A;  1O8H A;  3PET A;  1TSP A;  4V02 C;  3H09 A;  4YZX A;  5C1C A;  1TYW A;  1XG2 A;  1QRB A;  1QRC A;  4XR6 A;  4XOR A;  4XOT A;  4NK8 A;  4XLA A;  4XLC A;  1NHC A;  1BHE A;  2VBM A;  2PYG A;  1OFM A;  2QXZ A;  2BSP A;  2VFO A;  4JRA C;  4OZY A;  3P4G A;  3JUR A;  3FY3 A;  1O8K A;  2YUH A;  4OJP A;  3VMV A;  1QA2 A;  3NAW A;  3ML3 A;  2NST A;  3B90 A;  1LLZ A;  1JRG A;  1AIR A;  4XLE A;  3PSZ A;  3SY2 A;  2X6X A;  4NK6 A;  4OM9 A;  4U49 A;  4Z06 A;  1O8J A;  1OGM X;  2QX3 A;  2IOU G;  2NTQ A;  1HG8 A;  3WWG A;  1EZG A;  3B8Y A;  1IDJ A;  1RWR A;  2XC1 A;  3GQ8 A;  3DU1 X;  3LJY A;  1WMR A;  2B0R A;  2QYU A;  1IDK A;  3BH6 B;  4HWV A;  3VSU A;  4AVZ A;  1PE9 A;  3B4N A;  3VSV A;  3N6Z A;  1OFL A;  3RIQ A;  1QQ1 A;  1JTA A;  2VFP A;  2F3L A;  2X6W A;  5C1E A;  3VMW A;  3VST A;  4OJ5 A;  2J8K A;  4YZ0 A;  2XTX A;  4XQF A;  4XM3 A;  2NSP A;  1K8F A;  3PSS A;  2EWE A;  4XLH A;  1PXZ A;  4OZZ A;  3GQA A;  1O8I A;  2QZA A;  4XON A;  3SQV A;  1HF2 A;  4YEI A;  1LLW A;  2J8I A;  2BX6 A;  1GQ8 A;  2UVF A;  4I84 A;  4XMY A;  1O8L A;  1TYV A;  2BM5 A;  2NT9 A;  1TYX A;  2UVE A;  4W8T A;  2V5I A;  3TH0 A;  1RU4 A;  2X3H A;  2VFM A;  2XTY A;  1DAB A;  1L1I A;  1RMG A;  1CLW A;  2Z8G A;  4XKW A;  4YCQ A;  3SUC A;  1KCC A;  4YZQ A;  1K5C A;  4YFO A;  5DNS A;  3SYJ A;  3KRG A;  3AK5 A;  4Z03 A;  2VJI A;  1O8F A;  3N90 A;  1OFD A;  1TYU A;  3NB2 A;  1LM1 A;  1WXR A;  1KTW A;  3SZE A;  4C2L A;  5JLV C;  1K4Z A;  4U4B A;  1QA3 A;  3GRH A;  4EW9 A;  2INU A;  3ZPP A;  1PLU A;  1OGO X;  2NTP A;  3EQN A;  1O88 A;  1OOC A;  2O0W A;  2QY1 A;  1QCX A;  3BH7 B;  1BN8 A;  4URR A;  4OPW A;  4PMH A;  4MR0 A;  2NZM A;  3JX8 A;  2ODL A;  4MXN A;  4W8R A;  4YDT A;  4XLF A;  2NTB A;  2VBE A;  2O1D A;  4XL9 A;  1X0C A;  4YEJ A;  3UW0 A;  1EA0 A;  1KQ5 A;  1O8D A;  3T9G A;  1IB4 A;  1EE6 A;  4OJ6 A;  4W8S A;  1CZF A;  3ZSC A;  2XT2 A;  3EQO A;  1QJV A;  3LMW A;  4XKV A;  4XOP A;  4XN3 A;  2X6Y A;  3GQ9 A;  2BM6 A;  1DBO A;  3LYC A;  4W8Q A;  4YZA A;  1DBG A;  1H80 A;  2VJJ A;  2INV A;  1OFE A;  2O04 A;  2XTW A;  4YEL A;  1IA5 A;  1O8G A;  1KCD A;  5JMC B;  4YC5 A;  2VFQ A;  2VFN A;  2O0V A;  2O6W A;  1O8M A; 
#chains in the Genus database with same CATH homology
 2NT6 A;  2X85 A;  2IQ7 A;  2PYH A;  2PEC A;  4Z05 A;  3GQ7 A;  5AMV A;  2O17 A;  4OJO A;  1VBL A;  4OJL A;  2VBK A;  4XN0 A;  4XNF A;  1O8E A;  1O8H A;  4YZX A;  5C1C A;  1XG2 A;  4XR6 A;  4XOR A;  4XOT A;  4NK8 A;  4XLA A;  4XLC A;  1NHC A;  1BHE A;  2VBM A;  2PYG A;  1OFM A;  2QXZ A;  2BSP A;  4OZY A;  3JUR A;  3FY3 A;  1O8K A;  4OJP A;  3VMV A;  2NST A;  3B90 A;  1JRG A;  1AIR A;  4XLE A;  2X6X A;  4NK6 A;  4U49 A;  4Z06 A;  1O8J A;  1OGM X;  2QX3 A;  2NTQ A;  1HG8 A;  3WWG A;  3B8Y A;  1IDJ A;  1RWR A;  3GQ8 A;  3T9G A;  1WMR A;  1IDK A;  4HWV A;  3VSU A;  4AVZ A;  1PE9 A;  3B4N A;  3VSV A;  1OFL A;  1JTA A;  5C1E A;  3VMW A;  2X6W A;  3VST A;  4YZ0 A;  4OJ5 A;  4XQF A;  4XM3 A;  2NSP A;  2EWE A;  4XLH A;  1PXZ A;  4OZZ A;  3GQA A;  1O8I A;  4XON A;  1GQ8 A;  2UVF A;  4I84 A;  4XMY A;  2NT9 A;  1O8L A;  4W8T A;  2UVE A;  1RU4 A;  2X3H A;  1RMG A;  2Z8G A;  4XKW A;  3SUC A;  1KCC A;  4YZQ A;  1K5C A;  3KRG A;  4Z03 A;  2VJI A;  1O8F A;  1KTW A;  4C2L A;  4U4B A;  3GRH A;  4EW9 A;  2INU A;  3ZPP A;  1PLU A;  1OGO X;  2NTP A;  3EQN A;  1O88 A;  1OOC A;  2O0W A;  2QY1 A;  1QCX A;  1BN8 A;  4URR A;  4PMH A;  4MR0 A;  2NZM A;  2ODL A;  4MXN A;  4W8R A;  4XLF A;  2NTB A;  2VBE A;  2O1D A;  4XL9 A;  1X0C A;  4YEJ A;  3UW0 A;  1O8D A;  1IB4 A;  1EE6 A;  4OJ6 A;  4W8S A;  1CZF A;  3ZSC A;  3EQO A;  1QJV A;  3LMW A;  4XKV A;  4XOP A;  4XN3 A;  2X6Y A;  3GQ9 A;  1DBO A;  4W8Q A;  4YZA A;  1DBG A;  1H80 A;  2VJJ A;  2INV A;  2O04 A;  4YEL A;  1IA5 A;  1O8G A;  1KCD A;  2O0V A;  1O8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...