4YZ0A

C. bescii family 3 pectate lyase double mutant k108a/e39q in complex with trigalacturonic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSQNQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
total genus 85
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yz0A00
2NTPA 2X85A 3VMVA 1OFLA 1O8GA 4XLAA 4W8QA 1EE6A 2Z8GA 4URRA 2O0VA 4Z06A 2NZMA 1O8HA 3WWGA 1OOCA 3GQ8A 2NTBA 4W8SA 2PECA 1H80A 4XQFA 2INUA 1KCCA 1RMGA 4MXNA 1DBGA 3JURA 4YELA 3KRGA 3VMWA 2VJIA 2IQ7A 2ODLA 4Z05A 4MR0A 3ZSCA 1O8KA 4EW9A 4XR6A 4XLCA 1HG8A 2O04A 2VBEA 2NTQA 4AVZA 2UVEA 4W8TA 2X6WA 2NSTA 1X0CA 4YZXA 4YZ0A 4XN3A 1BHEA 4XOPA 3B8YA 1IDJA 2PYHA 1JTAA 4XONA 1OFMA 2UVFA 2X3HA 1K5CA 4PMHA 4XOTA 1IDKA 3B90A 1O8MA 2X6YA 2NSPA 1O8LA 2O17A 1WMRA 1OGMX 2EWEA 1XG2A 1DBOA 3GQ9A 2O1DA 1OGOX 2O0WA 1O8JA 4XNFA 4XKVA 3FY3A 3VSTA 1JRGA 1O8FA 1RU4A 1O8IA 5C1CA 1NHCA 2VBKA 1QCXA 3EQNA 1VBLA 4XL9A 2X6XA 4XLEA 4HWVA 3UW0A 1IB4A 1KCDA 3GQ7A 4OZYA 1CZFA 2QY1A 4U4BA 3GRHA 2PYGA 1O8EA 1PE9A 2QX3A 4Z03A 4OJOA 4W8RA 4XORA 1BN8A 4XM3A 2INVA 4YZQA 1AIRA 4OZZA 4OJLA 4OJPA 4NK6A 2NT6A 4YEJA 3ZPPA 1PXZA 4U49A 4XKWA 4XN0A 2VBMA 2BSPA 4XLHA 1IA5A 4OJ5A 4XLFA 2NT9A 3B4NA 1KTWA 4C2LA 2QXZA 1RWRA 1PLUA 1QJVA 1GQ8A 1O88A 4I84A 3VSUA 2VJJA 4OJ6A 3SUCA 4NK8A 5AMVA 3T9GA 4YZAA 5C1EA 3GQAA 4XMYA 3VSVA 1O8DA 3EQOA 3LMWA
chains in the Genus database with same CATH superfamily
2NTPA 2X85A 3VMVA 3NAWA 1OFLA 1O8GA 2G0YA 4XLAA 4W8QA 1EE6A 1L1IA 2Z8GA 4URRA 2VFNA 2O0VA 4V02C 2J8IA 2NZMA 3NB2A 4Z06A 1O8HA 3WWGA 3N6ZA 4YEIA 1OOCA 3GQ8A 2NTBA 2QYUA 1HF2A 2XT2A 4W8SA 3SZEA 1WXRA 2PECA 1H80A 2YUHA 4XQFA 2INUA 1KCCA 1LLZA 3DU1X 1RMGA 4MXNA 1DBGA 3JURA 1K8FA 3KRGA 3P4GA 4YELA 3VMWA 1TYXA 2VJIA 4JRAC 2IQ7A 3BH6B 2ODLA 4Z05A 4MR0A 3ZSCA 1O8KA 4EW9A 4XR6A 4XLCA 3SY2A 1HG8A 2O04A 1TYUA 2NTQA 2VBEA 4AVZA 2UVEA 4W8TA 2X6WA 3PETA 2NSTA 3PSSA 1EA0A 2XTWA 1X0CA 2BM7A 2B0RA 4YZXA 4YZ0A 4XN3A 1BHEA 4XOPA 3PSZA 3B8YA 1IDJA 2PYHA 5DNSA 1JTAA 2W7ZA 1OFMA 2UVFA 4XONA 1KQ5A 2X3HA 1K5CA 4PMHA 4XOTA 1IDKA 3B90A 1O8MA 2XT4A 2X6YA 4OM9A 2NSPA 3LYCA 1O8LA 2O17A 3ML3A 5JMCB 4YCQA 1TSPA 3SYJA 1CLWA 1WMRA 1OGMX 2EWEA 2V5IA 3SQVA 1XG2A 1DBOA 3GQ9A 3N90A 2O1DA 1OGOX 1EZGA 2O0WA 3H09A 3LJYA 1QQ1A 1LM1A 2BX6A 1O8JA 3TH0A 4XNFA 4XKVA 3FY3A 4YFOA 2XTXA 1OFDA 2VFQA 3VSTA 2XTYA 1JRGA 1O8FA 1QA2A 1RU4A 1O8IA 1LLWA 5C1CA 1NHCA 2VBKA 4OPWA 1QCXA 2O6WA 3EQNA 1VBLA 1OFEA 1QA3A 4XL9A 4YC5A 2BM6A 2X6XA 4XLEA 4HWVA 3UW0A 1IB4A 1KCDA 3GQ7A 4OZYA 1CZFA 5JLVC 2QY1A 4U4BA 3GRHA 2F3LA 2PYGA 1O8EA 1PE9A 2QX3A 2QZAA 4Z03A 2VFMA 1QRCA 1TYWA 4OJOA 1QA1A 4W8RA 4XORA 1BN8A 4KH3A 2INVA 4XM3A 4YZQA 1AIRA 4OZZA 3JX8A 4OJLA 2VFOA 4OJPA 2IOUG 4NK6A 2NT6A 3BH7B 2BM4A 4YEJA 3ZPPA 1PXZA 2J8KA 4YDTA 4U49A 4XKWA 2XC1A 4XN0A 2BM5A 1DABA 2VBMA 2BSPA 4XLHA 1IA5A 1QRBA 4OJ5A 4XLFA 2NT9A 3AK5A 3B4NA 1KTWA 4C2LA 2QXZA 1RWRA 1PLUA 1QJVA 1GQ8A 1O88A 4I84A 3VSUA 2VJJA 4OJ6A 3SUCA 4NK8A 5AMVA 1K4ZA 3T9GA 1TYVA 2VFPA 4YZAA 5C1EA 3GQAA 3RIQA 4XMYA 3VSVA 1O8DA 3EQOA 3LMWA
chains in the Genus database with same CATH topology
2NTPA 2X85A 3VMVA 1OFLA 1O8GA 4XLAA 4W8QA 1EE6A 2Z8GA 4URRA 2O0VA 4Z06A 2NZMA 1O8HA 3WWGA 1OOCA 3GQ8A 2NTBA 4W8SA 2PECA 1H80A 4XQFA 2INUA 1KCCA 1RMGA 4MXNA 1DBGA 3JURA 4YELA 3KRGA 3VMWA 2VJIA 2IQ7A 2ODLA 4Z05A 4MR0A 3ZSCA 1O8KA 4EW9A 4XR6A 4XLCA 1HG8A 2O04A 2VBEA 2NTQA 4AVZA 2UVEA 4W8TA 2X6WA 2NSTA 1X0CA 4YZXA 4YZ0A 4XN3A 1BHEA 4XOPA 3B8YA 1IDJA 2PYHA 1JTAA 4XONA 1OFMA 2UVFA 2X3HA 1K5CA 4PMHA 4XOTA 1IDKA 3B90A 1O8MA 2X6YA 2NSPA 1O8LA 2O17A 1WMRA 1OGMX 2EWEA 1XG2A 1DBOA 3GQ9A 2O1DA 1OGOX 2O0WA 1O8JA 4XNFA 4XKVA 3FY3A 3VSTA 1JRGA 1O8FA 1RU4A 1O8IA 5C1CA 1NHCA 2VBKA 1QCXA 3EQNA 1VBLA 4XL9A 2X6XA 4XLEA 4HWVA 3UW0A 1IB4A 1KCDA 3GQ7A 4OZYA 1CZFA 2QY1A 4U4BA 3GRHA 2PYGA 1O8EA 1PE9A 2QX3A 4Z03A 4OJOA 4W8RA 4XORA 1BN8A 4XM3A 2INVA 4YZQA 1AIRA 4OZZA 4OJLA 4OJPA 4NK6A 2NT6A 4YEJA 3ZPPA 1PXZA 4U49A 4XKWA 4XN0A 2VBMA 2BSPA 4XLHA 1IA5A 4OJ5A 4XLFA 2NT9A 3B4NA 1KTWA 4C2LA 2QXZA 1RWRA 1PLUA 1QJVA 1GQ8A 1O88A 4I84A 3VSUA 2VJJA 4OJ6A 3SUCA 4NK8A 5AMVA 3T9GA 4YZAA 5C1EA 3GQAA 4XMYA 3VSVA 1O8DA 3EQOA 3LMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NTP A;  2X85 A;  3VMV A;  1OFL A;  1O8G A;  4XLA A;  4W8Q A;  1EE6 A;  2Z8G A;  4URR A;  2O0V A;  4Z06 A;  2NZM A;  1O8H A;  3WWG A;  1OOC A;  3GQ8 A;  2NTB A;  4W8S A;  2PEC A;  1H80 A;  4XQF A;  2INU A;  1KCC A;  1RMG A;  4MXN A;  1DBG A;  3JUR A;  4YEL A;  3KRG A;  3VMW A;  2VJI A;  2IQ7 A;  2ODL A;  4Z05 A;  4MR0 A;  3ZSC A;  1O8K A;  4EW9 A;  4XR6 A;  4XLC A;  1HG8 A;  2O04 A;  2VBE A;  2NTQ A;  4AVZ A;  2UVE A;  4W8T A;  2X6W A;  2NST A;  1X0C A;  4YZX A;  4YZ0 A;  4XN3 A;  1BHE A;  4XOP A;  3B8Y A;  1IDJ A;  2PYH A;  1JTA A;  4XON A;  1OFM A;  2UVF A;  2X3H A;  1K5C A;  4PMH A;  4XOT A;  1IDK A;  3B90 A;  1O8M A;  2X6Y A;  2NSP A;  1O8L A;  2O17 A;  1WMR A;  1OGM X;  2EWE A;  1XG2 A;  1DBO A;  3GQ9 A;  2O1D A;  1OGO X;  2O0W A;  1O8J A;  4XNF A;  4XKV A;  3FY3 A;  3VST A;  1JRG A;  1O8F A;  1RU4 A;  1O8I A;  5C1C A;  1NHC A;  2VBK A;  1QCX A;  3EQN A;  1VBL A;  4XL9 A;  2X6X A;  4XLE A;  4HWV A;  3UW0 A;  1IB4 A;  1KCD A;  3GQ7 A;  4OZY A;  1CZF A;  2QY1 A;  4U4B A;  3GRH A;  2PYG A;  1O8E A;  1PE9 A;  2QX3 A;  4Z03 A;  4OJO A;  4W8R A;  4XOR A;  1BN8 A;  4XM3 A;  2INV A;  4YZQ A;  1AIR A;  4OZZ A;  4OJL A;  4OJP A;  4NK6 A;  2NT6 A;  4YEJ A;  3ZPP A;  1PXZ A;  4U49 A;  4XKW A;  4XN0 A;  2VBM A;  2BSP A;  4XLH A;  1IA5 A;  4OJ5 A;  4XLF A;  2NT9 A;  3B4N A;  1KTW A;  4C2L A;  2QXZ A;  1RWR A;  1PLU A;  1QJV A;  1GQ8 A;  1O88 A;  4I84 A;  3VSU A;  2VJJ A;  4OJ6 A;  3SUC A;  4NK8 A;  5AMV A;  3T9G A;  4YZA A;  5C1E A;  3GQA A;  4XMY A;  3VSV A;  1O8D A;  3EQO A;  3LMW A; 
#chains in the Genus database with same CATH topology
 2NTP A;  2X85 A;  3VMV A;  3NAW A;  1OFL A;  1O8G A;  2G0Y A;  4XLA A;  4W8Q A;  1EE6 A;  1L1I A;  2Z8G A;  4URR A;  2VFN A;  2O0V A;  4V02 C;  2J8I A;  2NZM A;  3NB2 A;  4Z06 A;  1O8H A;  3WWG A;  3N6Z A;  4YEI A;  1OOC A;  3GQ8 A;  2NTB A;  2QYU A;  1HF2 A;  2XT2 A;  4W8S A;  3SZE A;  1WXR A;  2PEC A;  1H80 A;  2YUH A;  4XQF A;  2INU A;  1KCC A;  1LLZ A;  3DU1 X;  1RMG A;  4MXN A;  1DBG A;  3JUR A;  1K8F A;  3KRG A;  3P4G A;  4YEL A;  3VMW A;  1TYX A;  2VJI A;  4JRA C;  2IQ7 A;  3BH6 B;  2ODL A;  4Z05 A;  4MR0 A;  3ZSC A;  1O8K A;  4EW9 A;  4XR6 A;  4XLC A;  3SY2 A;  1HG8 A;  2O04 A;  1TYU A;  2NTQ A;  2VBE A;  4AVZ A;  2UVE A;  4W8T A;  2X6W A;  3PET A;  2NST A;  3PSS A;  1EA0 A;  2XTW A;  1X0C A;  2BM7 A;  2B0R A;  4YZX A;  4YZ0 A;  4XN3 A;  1BHE A;  4XOP A;  3PSZ A;  3B8Y A;  1IDJ A;  2PYH A;  5DNS A;  1JTA A;  2W7Z A;  1OFM A;  2UVF A;  4XON A;  1KQ5 A;  2X3H A;  1K5C A;  4PMH A;  4XOT A;  1IDK A;  3B90 A;  1O8M A;  2XT4 A;  2X6Y A;  4OM9 A;  2NSP A;  3LYC A;  1O8L A;  2O17 A;  3ML3 A;  5JMC B;  4YCQ A;  1TSP A;  3SYJ A;  1CLW A;  1WMR A;  1OGM X;  2EWE A;  2V5I A;  3SQV A;  1XG2 A;  1DBO A;  3GQ9 A;  3N90 A;  2O1D A;  1OGO X;  1EZG A;  2O0W A;  3H09 A;  3LJY A;  1QQ1 A;  1LM1 A;  2BX6 A;  1O8J A;  3TH0 A;  4XNF A;  4XKV A;  3FY3 A;  4YFO A;  2XTX A;  1OFD A;  2VFQ A;  3VST A;  2XTY A;  1JRG A;  1O8F A;  1QA2 A;  1RU4 A;  1O8I A;  1LLW A;  5C1C A;  1NHC A;  2VBK A;  4OPW A;  1QCX A;  2O6W A;  3EQN A;  1VBL A;  1OFE A;  1QA3 A;  4XL9 A;  4YC5 A;  2BM6 A;  2X6X A;  4XLE A;  4HWV A;  3UW0 A;  1IB4 A;  1KCD A;  3GQ7 A;  4OZY A;  1CZF A;  5JLV C;  2QY1 A;  4U4B A;  3GRH A;  2F3L A;  2PYG A;  1O8E A;  1PE9 A;  2QX3 A;  2QZA A;  4Z03 A;  2VFM A;  1QRC A;  1TYW A;  4OJO A;  1QA1 A;  4W8R A;  4XOR A;  1BN8 A;  4KH3 A;  2INV A;  4XM3 A;  4YZQ A;  1AIR A;  4OZZ A;  3JX8 A;  4OJL A;  2VFO A;  4OJP A;  2IOU G;  4NK6 A;  2NT6 A;  3BH7 B;  2BM4 A;  4YEJ A;  3ZPP A;  1PXZ A;  2J8K A;  4YDT A;  4U49 A;  4XKW A;  2XC1 A;  4XN0 A;  2BM5 A;  1DAB A;  2VBM A;  2BSP A;  4XLH A;  1IA5 A;  1QRB A;  4OJ5 A;  4XLF A;  2NT9 A;  3AK5 A;  3B4N A;  1KTW A;  4C2L A;  2QXZ A;  1RWR A;  1PLU A;  1QJV A;  1GQ8 A;  1O88 A;  4I84 A;  3VSU A;  2VJJ A;  4OJ6 A;  3SUC A;  4NK8 A;  5AMV A;  1K4Z A;  3T9G A;  1TYV A;  2VFP A;  4YZA A;  5C1E A;  3GQA A;  3RIQ A;  4XMY A;  3VSV A;  1O8D A;  3EQO A;  3LMW A; 
#chains in the Genus database with same CATH homology
 2NTP A;  2X85 A;  3VMV A;  1OFL A;  1O8G A;  4XLA A;  4W8Q A;  1EE6 A;  2Z8G A;  4URR A;  2O0V A;  4Z06 A;  2NZM A;  1O8H A;  3WWG A;  1OOC A;  3GQ8 A;  2NTB A;  4W8S A;  2PEC A;  1H80 A;  4XQF A;  2INU A;  1KCC A;  1RMG A;  4MXN A;  1DBG A;  3JUR A;  4YEL A;  3KRG A;  3VMW A;  2VJI A;  2IQ7 A;  2ODL A;  4Z05 A;  4MR0 A;  3ZSC A;  1O8K A;  4EW9 A;  4XR6 A;  4XLC A;  1HG8 A;  2O04 A;  2VBE A;  2NTQ A;  4AVZ A;  2UVE A;  4W8T A;  2X6W A;  2NST A;  1X0C A;  4YZX A;  4YZ0 A;  4XN3 A;  1BHE A;  4XOP A;  3B8Y A;  1IDJ A;  2PYH A;  1JTA A;  4XON A;  1OFM A;  2UVF A;  2X3H A;  1K5C A;  4PMH A;  4XOT A;  1IDK A;  3B90 A;  1O8M A;  2X6Y A;  2NSP A;  1O8L A;  2O17 A;  1WMR A;  1OGM X;  2EWE A;  1XG2 A;  1DBO A;  3GQ9 A;  2O1D A;  1OGO X;  2O0W A;  1O8J A;  4XNF A;  4XKV A;  3FY3 A;  3VST A;  1JRG A;  1O8F A;  1RU4 A;  1O8I A;  5C1C A;  1NHC A;  2VBK A;  1QCX A;  3EQN A;  1VBL A;  4XL9 A;  2X6X A;  4XLE A;  4HWV A;  3UW0 A;  1IB4 A;  1KCD A;  3GQ7 A;  4OZY A;  1CZF A;  2QY1 A;  4U4B A;  3GRH A;  2PYG A;  1O8E A;  1PE9 A;  2QX3 A;  4Z03 A;  4OJO A;  4W8R A;  4XOR A;  1BN8 A;  4XM3 A;  2INV A;  4YZQ A;  1AIR A;  4OZZ A;  4OJL A;  4OJP A;  4NK6 A;  2NT6 A;  4YEJ A;  3ZPP A;  1PXZ A;  4U49 A;  4XKW A;  4XN0 A;  2VBM A;  2BSP A;  4XLH A;  1IA5 A;  4OJ5 A;  4XLF A;  2NT9 A;  3B4N A;  1KTW A;  4C2L A;  2QXZ A;  1RWR A;  1PLU A;  1QJV A;  1GQ8 A;  1O88 A;  4I84 A;  3VSU A;  2VJJ A;  4OJ6 A;  3SUC A;  4NK8 A;  5AMV A;  3T9G A;  4YZA A;  5C1E A;  3GQA A;  4XMY A;  3VSV A;  1O8D A;  3EQO A;  3LMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...