2BM5A

The structure of mfpa (rv3361c, p21 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
183
structure length
183
Chain Sequence
MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
total genus 78
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm5A00
5JLVC 2BM7A 2BM4A 5JMCB 2BM6A 2BM5A 3N90A 2J8IA 2W7ZA 4JRAC 2F3LA 2G0YA
chains in the Genus database with same CATH superfamily
1DBOA 4W8RA 4OJPA 1H80A 1CZFA 2BM5A 1QA2A 2QYUA 4NK8A 3GQ9A 1L1IA 1QRCA 2INUA 1K5CA 3NAWA 1O8HA 2BM6A 4YZ0A 5DNSA 3FY3A 2NTQA 1KQ5A 2F3LA 3SUCA 2XTWA 1OFMA 1DBGA 1O8DA 4XLAA 3SYJA 4HWVA 2XC1A 3JX8A 3N90A 2VBMA 2QZAA 3DU1X 4C2LA 2IQ7A 1IDJA 3KRGA 2UVFA 5C1CA 3BH6B 2NT6A 3H09A 4YZAA 3T9GA 1TYUA 2BM7A 2VFQA 3PSZA 4XKWA 1BHEA 4MR0A 3TH0A 2X85A 3GQAA 1PXZA 1RWRA 4KH3A 2VFMA 2XT2A 1NHCA 4NK6A 2XTYA 3VSTA 5AMVA 4URRA 3PETA 4U4BA 4YEIA 1EZGA 2INVA 1O8KA 3B8YA 1GQ8A 4W8TA 4OZYA 1PLUA 1WMRA 2VBEA 3GQ7A 4XM3A 3UW0A 2IOUG 1OGOX 4XN0A 4OJLA 1CLWA 4AVZA 1K4ZA 3GQ8A 1RMGA 3P4GA 2NTPA 4OM9A 1HF2A 4YDTA 4YELA 1EE6A 1OFDA 2VFOA 4XL9A 4MXNA 1K8FA 4XOPA 4I84A 1OFEA 1JRGA 1QJVA 2B0RA 2ODLA 1KTWA 2BSPA 1WXRA 2VBKA 1LLWA 1OGMX 1IB4A 2QXZA 4OZZA 4XQFA 1O8JA 1O8FA 2X6XA 2EWEA 4U49A 2X3HA 4XOTA 4Z03A 2V5IA 4XORA 4Z06A 4Z05A 3RIQA 3VSUA 3ZPPA 1KCCA 4OJ6A 4YFOA 4XONA 1IA5A 4XR6A 1OOCA 4XMYA 4W8SA 4YZQA 3LYCA 4OJOA 2O04A 2J8KA 2PECA 3EQOA 4XNFA 2PYHA 3BH7B 2J8IA 2O0WA 2Z8GA 1O8IA 2PYGA 3LJYA 1RU4A 1TSPA 2BX6A 2VJJA 3JURA 2YUHA 1JTAA 4YEJA 2O17A 4EW9A 1QA1A 1EA0A 2NSTA 1O8EA 4YCQA 4XLEA 1KCDA 1LM1A 2XTXA 4XLCA 3VMWA 3B4NA 1O88A 4XLHA 2NTBA 2W7ZA 3LMWA 1LLZA 2O1DA 1O8LA 1PE9A 2X6WA 2X6YA 3B90A 3N6ZA 5JMCB 1QQ1A 3PSSA 1TYVA 5C1EA 3ZSCA 1QCXA 1TYWA 2NZMA 1AIRA 4XLFA 1BN8A 4YC5A 2G0YA 1O8GA 3VSVA 5JLVC 2BM4A 1DABA 1QRBA 3AK5A 3GRHA 3VMVA 4W8QA 3SZEA 2NSPA 2O6WA 3WWGA 3ML3A 4PMHA 4JRAC 1IDKA 2NT9A 2QY1A 2VJIA 1TYXA 1X0CA 3EQNA 2QX3A 4V02C 1O8MA 4YZXA 3SQVA 2UVEA 4OPWA 2VFNA 4XKVA 2XT4A 1HG8A 2O0VA 1QA3A 1VBLA 3SY2A 4OJ5A 4XN3A 1OFLA 2VFPA 1XG2A 3NB2A
chains in the Genus database with same CATH topology
1WXRA 2BM7A 2VFQA 4OJPA 1QA2A 2BM5A 3TH0A 4KH3A 2VFMA 1QRCA 2W7ZA 5JMCB 3N6ZA 2V5IA 3RIQA 3PETA 2BM6A 4OJ6A 1QQ1A 1TYVA 1TYWA 1DABA 1KQ5A 2F3LA 2G0YA 3AK5A 3LYCA 4OJOA 2BM4A 1QRBA 3SYJA 2IOUG 3SZEA 2XC1A 3JX8A 3N90A 3ML3A 3BH7B 4OJLA 2J8IA 4JRAC 1CLWA 1K4ZA 5JLVC 4OM9A 1TYXA 3P4GA 1HF2A 3LJYA 4V02C 2VFOA 1TSPA 2BX6A 4OPWA 2VFNA 2YUHA 1K8FA 3BH6B 3H09A 1QA3A 1QA1A 4OJ5A 2B0RA 2VFPA 1TYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLV C;  2BM7 A;  2BM4 A;  5JMC B;  2BM6 A;  2BM5 A;  3N90 A;  2J8I A;  2W7Z A;  4JRA C;  2F3L A;  2G0Y A; 
#chains in the Genus database with same CATH topology
 1DBO A;  4W8R A;  4OJP A;  1H80 A;  1CZF A;  2BM5 A;  1QA2 A;  2QYU A;  4NK8 A;  3GQ9 A;  1L1I A;  1QRC A;  2INU A;  1K5C A;  3NAW A;  1O8H A;  2BM6 A;  4YZ0 A;  5DNS A;  3FY3 A;  2NTQ A;  1KQ5 A;  2F3L A;  3SUC A;  2XTW A;  1OFM A;  1DBG A;  1O8D A;  4XLA A;  3SYJ A;  4HWV A;  2XC1 A;  3JX8 A;  3N90 A;  2VBM A;  2QZA A;  3DU1 X;  4C2L A;  2IQ7 A;  1IDJ A;  3KRG A;  2UVF A;  5C1C A;  3BH6 B;  2NT6 A;  3H09 A;  4YZA A;  3T9G A;  1TYU A;  2BM7 A;  2VFQ A;  3PSZ A;  4XKW A;  1BHE A;  4MR0 A;  3TH0 A;  2X85 A;  3GQA A;  1PXZ A;  1RWR A;  4KH3 A;  2VFM A;  2XT2 A;  1NHC A;  4NK6 A;  2XTY A;  3VST A;  5AMV A;  4URR A;  3PET A;  4U4B A;  4YEI A;  1EZG A;  2INV A;  1O8K A;  3B8Y A;  1GQ8 A;  4W8T A;  4OZY A;  1PLU A;  1WMR A;  2VBE A;  3GQ7 A;  4XM3 A;  3UW0 A;  2IOU G;  1OGO X;  4XN0 A;  4OJL A;  1CLW A;  4AVZ A;  1K4Z A;  3GQ8 A;  1RMG A;  3P4G A;  2NTP A;  4OM9 A;  1HF2 A;  4YDT A;  4YEL A;  1EE6 A;  1OFD A;  2VFO A;  4XL9 A;  4MXN A;  1K8F A;  4XOP A;  4I84 A;  1OFE A;  1JRG A;  1QJV A;  2B0R A;  2ODL A;  1KTW A;  2BSP A;  1WXR A;  2VBK A;  1LLW A;  1OGM X;  1IB4 A;  2QXZ A;  4OZZ A;  4XQF A;  1O8J A;  1O8F A;  2X6X A;  2EWE A;  4U49 A;  2X3H A;  4XOT A;  4Z03 A;  2V5I A;  4XOR A;  4Z06 A;  4Z05 A;  3RIQ A;  3VSU A;  3ZPP A;  1KCC A;  4OJ6 A;  4YFO A;  4XON A;  1IA5 A;  4XR6 A;  1OOC A;  4XMY A;  4W8S A;  4YZQ A;  3LYC A;  4OJO A;  2O04 A;  2J8K A;  2PEC A;  3EQO A;  4XNF A;  2PYH A;  3BH7 B;  2J8I A;  2O0W A;  2Z8G A;  1O8I A;  2PYG A;  3LJY A;  1RU4 A;  1TSP A;  2BX6 A;  2VJJ A;  3JUR A;  2YUH A;  1JTA A;  4YEJ A;  2O17 A;  4EW9 A;  1QA1 A;  1EA0 A;  2NST A;  1O8E A;  4YCQ A;  4XLE A;  1KCD A;  1LM1 A;  2XTX A;  4XLC A;  3VMW A;  3B4N A;  1O88 A;  4XLH A;  2NTB A;  2W7Z A;  3LMW A;  1LLZ A;  2O1D A;  1O8L A;  1PE9 A;  2X6W A;  2X6Y A;  3B90 A;  3N6Z A;  5JMC B;  1QQ1 A;  3PSS A;  1TYV A;  5C1E A;  3ZSC A;  1QCX A;  1TYW A;  2NZM A;  1AIR A;  4XLF A;  1BN8 A;  4YC5 A;  2G0Y A;  1O8G A;  3VSV A;  5JLV C;  2BM4 A;  1DAB A;  1QRB A;  3AK5 A;  3GRH A;  3VMV A;  4W8Q A;  3SZE A;  2NSP A;  2O6W A;  3WWG A;  3ML3 A;  4PMH A;  4JRA C;  1IDK A;  2NT9 A;  2QY1 A;  2VJI A;  1TYX A;  1X0C A;  3EQN A;  2QX3 A;  4V02 C;  1O8M A;  4YZX A;  3SQV A;  2UVE A;  4OPW A;  2VFN A;  4XKV A;  2XT4 A;  1HG8 A;  2O0V A;  1QA3 A;  1VBL A;  3SY2 A;  4OJ5 A;  4XN3 A;  1OFL A;  2VFP A;  1XG2 A;  3NB2 A; 
#chains in the Genus database with same CATH homology
 1WXR A;  2BM7 A;  2VFQ A;  4OJP A;  1QA2 A;  2BM5 A;  3TH0 A;  4KH3 A;  2VFM A;  1QRC A;  2W7Z A;  5JMC B;  3N6Z A;  2V5I A;  3RIQ A;  3PET A;  2BM6 A;  4OJ6 A;  1QQ1 A;  1TYV A;  1TYW A;  1DAB A;  1KQ5 A;  2F3L A;  2G0Y A;  3AK5 A;  3LYC A;  4OJO A;  2BM4 A;  1QRB A;  3SYJ A;  2IOU G;  3SZE A;  2XC1 A;  3JX8 A;  3N90 A;  3ML3 A;  3BH7 B;  4OJL A;  2J8I A;  4JRA C;  1CLW A;  1K4Z A;  5JLV C;  4OM9 A;  1TYX A;  3P4G A;  1HF2 A;  3LJY A;  4V02 C;  2VFO A;  1TSP A;  2BX6 A;  4OPW A;  2VFN A;  2YUH A;  1K8F A;  3BH6 B;  3H09 A;  1QA3 A;  1QA1 A;  4OJ5 A;  2B0R A;  2VFP A;  1TYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...