2BM5A

The structure of mfpa (rv3361c, p21 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
183
structure length
183
Chain Sequence
MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
total genus 78
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm5A00
5JLVC 2BM6A 5JMCB 2BM5A 2F3LA 2G0YA 2W7ZA 3N90A 2BM4A 2BM7A 4JRAC 2J8IA
chains in the Genus database with same CATH superfamily
4W8QA 3SZEA 4OZYA 5AMVA 2NTBA 1OOCA 3JX8A 1O8IA 1PE9A 2NZMA 2X3HA 3B90A 3ML3A 2Z8GA 2J8IA 3LYCA 2BM6A 1QA2A 2O6WA 1K4ZA 5DNSA 3PETA 3VSTA 2EWEA 2IOUG 1RMGA 3GQ9A 3PSZA 2BM7A 3TH0A 1HF2A 1O8LA 1QRCA 2X6XA 1KCCA 2NT6A 2NTQA 3KRGA 2QYUA 2INVA 1O8EA 1O8HA 4URRA 5C1CA 3GQ8A 1LM1A 2VBEA 1QA1A 1QA3A 4Z03A 4Z05A 4C2LA 5JMCB 1O8FA 2IQ7A 3ZSCA 3BH6B 4XORA 1OFEA 2PYHA 4OJ5A 4YFOA 2ODLA 4JRAC 1WXRA 1IDKA 4OZZA 4YDTA 3RIQA 4OJ6A 3LMWA 3SYJA 2B0RA 1TYWA 2XTWA 2XTXA 1LLZA 3VMWA 1CZFA 4MXNA 3NB2A 1EA0A 2BX6A 2V5IA 4NK6A 4OJPA 2UVFA 2BM5A 3SQVA 4YEIA 1X0CA 3VMVA 1CLWA 4KH3A 1KQ5A 1PXZA 2QY1A 2QZAA 4XMYA 1KCDA 4XR6A 1H80A 3BH7B 1RU4A 2G0YA 2QXZA 1GQ8A 2NT9A 2W7ZA 4XL9A 1OGOX 1HG8A 4Z06A 1K5CA 2NTPA 2UVEA 2X6WA 3VSVA 3EQOA 1LLWA 4OM9A 3SY2A 2O0WA 4XKVA 1DBGA 2VFPA 1JRGA 2VFQA 1AIRA 3JURA 3N90A 3N6ZA 3ZPPA 4XQFA 3AK5A 2XT4A 4XLEA 2VBMA 1IDJA 4XOTA 1JTAA 1O8KA 1DBOA 2QX3A 2F3LA 1RWRA 1TSPA 2VFOA 1EE6A 4XM3A 2VJIA 3UW0A 3FY3A 4YZQA 4XONA 4HWVA 4XLAA 2NSTA 4XLFA 2VFNA 3SUCA 5JLVC 2J8KA 3WWGA 4XNFA 4YZ0A 4XOPA 1QRBA 1XG2A 4NK8A 2YUHA 4YZAA 5C1EA 3GQ7A 1OFLA 3PSSA 4YC5A 3H09A 1OGMX 4XLCA 2VFMA 4AVZA 2XTYA 3LJYA 3DU1X 1IB4A 2O17A 1EZGA 4YCQA 4I84A 4W8TA 1K8FA 4YELA 3B8YA 2INUA 1O8GA 1TYVA 3B4NA 1O8JA 4W8SA 1QJVA 4PMHA 3GRHA 1IA5A 1BHEA 1BN8A 2BM4A 4OJLA 4OJOA 3GQAA 4XN3A 2PYGA 1KTWA 1O88A 2X6YA 4YZXA 2X85A 3T9GA 4U49A 3EQNA 1OFMA 3NAWA 4U4BA 1O8DA 1WMRA 1VBLA 4EW9A 1QQ1A 2NSPA 4XN0A 1L1IA 1O8MA 1TYXA 1QCXA 1TYUA 3VSUA 2VJJA 4XKWA 4OPWA 4W8RA 2O0VA 3P4GA 4V02C 1DABA 4MR0A 4XLHA 2O04A 2XT2A 2XC1A 2VBKA 1OFDA 4YEJA 2BSPA 2O1DA 1NHCA 1PLUA 2PECA
chains in the Genus database with same CATH topology
1TYVA 3SYJA 3RIQA 4OJ6A 3SZEA 2B0RA 1TYWA 2F3LA 1TSPA 2VFOA 3JX8A 2BM4A 4OJLA 4OJOA 3ML3A 2BX6A 2V5IA 2J8IA 3LYCA 4OJPA 2BM6A 1QA2A 2BM5A 1K4ZA 3PETA 1CLWA 2IOUG 2BM7A 3TH0A 1HF2A 2VFNA 1QRCA 1KQ5A 1QQ1A 5JLVC 1TYXA 1TYUA 3BH7B 1QRBA 2G0YA 2W7ZA 2YUHA 1DABA 4OPWA 3P4GA 4V02C 1QA1A 1QA3A 3H09A 5JMCB 4OM9A 2VFMA 3LJYA 3BH6B 2VFPA 2XC1A 2VFQA 4OJ5A 3N90A 3N6ZA 1K8FA 3AK5A 4KH3A 4JRAC 1WXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLV C;  2BM6 A;  5JMC B;  2BM5 A;  2F3L A;  2G0Y A;  2W7Z A;  3N90 A;  2BM4 A;  2BM7 A;  4JRA C;  2J8I A; 
#chains in the Genus database with same CATH topology
 4W8Q A;  3SZE A;  4OZY A;  5AMV A;  2NTB A;  1OOC A;  3JX8 A;  1O8I A;  1PE9 A;  2NZM A;  2X3H A;  3B90 A;  3ML3 A;  2Z8G A;  2J8I A;  3LYC A;  2BM6 A;  1QA2 A;  2O6W A;  1K4Z A;  5DNS A;  3PET A;  3VST A;  2EWE A;  2IOU G;  1RMG A;  3GQ9 A;  3PSZ A;  2BM7 A;  3TH0 A;  1HF2 A;  1O8L A;  1QRC A;  2X6X A;  1KCC A;  2NT6 A;  2NTQ A;  3KRG A;  2QYU A;  2INV A;  1O8E A;  1O8H A;  4URR A;  5C1C A;  3GQ8 A;  1LM1 A;  2VBE A;  1QA1 A;  1QA3 A;  4Z03 A;  4Z05 A;  4C2L A;  5JMC B;  1O8F A;  2IQ7 A;  3ZSC A;  3BH6 B;  4XOR A;  1OFE A;  2PYH A;  4OJ5 A;  4YFO A;  2ODL A;  4JRA C;  1WXR A;  1IDK A;  4OZZ A;  4YDT A;  3RIQ A;  4OJ6 A;  3LMW A;  3SYJ A;  2B0R A;  1TYW A;  2XTW A;  2XTX A;  1LLZ A;  3VMW A;  1CZF A;  4MXN A;  3NB2 A;  1EA0 A;  2BX6 A;  2V5I A;  4NK6 A;  4OJP A;  2UVF A;  2BM5 A;  3SQV A;  4YEI A;  1X0C A;  3VMV A;  1CLW A;  4KH3 A;  1KQ5 A;  1PXZ A;  2QY1 A;  2QZA A;  4XMY A;  1KCD A;  4XR6 A;  1H80 A;  3BH7 B;  1RU4 A;  2G0Y A;  2QXZ A;  1GQ8 A;  2NT9 A;  2W7Z A;  4XL9 A;  1OGO X;  1HG8 A;  4Z06 A;  1K5C A;  2NTP A;  2UVE A;  2X6W A;  3VSV A;  3EQO A;  1LLW A;  4OM9 A;  3SY2 A;  2O0W A;  4XKV A;  1DBG A;  2VFP A;  1JRG A;  2VFQ A;  1AIR A;  3JUR A;  3N90 A;  3N6Z A;  3ZPP A;  4XQF A;  3AK5 A;  2XT4 A;  4XLE A;  2VBM A;  1IDJ A;  4XOT A;  1JTA A;  1O8K A;  1DBO A;  2QX3 A;  2F3L A;  1RWR A;  1TSP A;  2VFO A;  1EE6 A;  4XM3 A;  2VJI A;  3UW0 A;  3FY3 A;  4YZQ A;  4XON A;  4HWV A;  4XLA A;  2NST A;  4XLF A;  2VFN A;  3SUC A;  5JLV C;  2J8K A;  3WWG A;  4XNF A;  4YZ0 A;  4XOP A;  1QRB A;  1XG2 A;  4NK8 A;  2YUH A;  4YZA A;  5C1E A;  3GQ7 A;  1OFL A;  3PSS A;  4YC5 A;  3H09 A;  1OGM X;  4XLC A;  2VFM A;  4AVZ A;  2XTY A;  3LJY A;  3DU1 X;  1IB4 A;  2O17 A;  1EZG A;  4YCQ A;  4I84 A;  4W8T A;  1K8F A;  4YEL A;  3B8Y A;  2INU A;  1O8G A;  1TYV A;  3B4N A;  1O8J A;  4W8S A;  1QJV A;  4PMH A;  3GRH A;  1IA5 A;  1BHE A;  1BN8 A;  2BM4 A;  4OJL A;  4OJO A;  3GQA A;  4XN3 A;  2PYG A;  1KTW A;  1O88 A;  2X6Y A;  4YZX A;  2X85 A;  3T9G A;  4U49 A;  3EQN A;  1OFM A;  3NAW A;  4U4B A;  1O8D A;  1WMR A;  1VBL A;  4EW9 A;  1QQ1 A;  2NSP A;  4XN0 A;  1L1I A;  1O8M A;  1TYX A;  1QCX A;  1TYU A;  3VSU A;  2VJJ A;  4XKW A;  4OPW A;  4W8R A;  2O0V A;  3P4G A;  4V02 C;  1DAB A;  4MR0 A;  4XLH A;  2O04 A;  2XT2 A;  2XC1 A;  2VBK A;  1OFD A;  4YEJ A;  2BSP A;  2O1D A;  1NHC A;  1PLU A;  2PEC A; 
#chains in the Genus database with same CATH homology
 1TYV A;  3SYJ A;  3RIQ A;  4OJ6 A;  3SZE A;  2B0R A;  1TYW A;  2F3L A;  1TSP A;  2VFO A;  3JX8 A;  2BM4 A;  4OJL A;  4OJO A;  3ML3 A;  2BX6 A;  2V5I A;  2J8I A;  3LYC A;  4OJP A;  2BM6 A;  1QA2 A;  2BM5 A;  1K4Z A;  3PET A;  1CLW A;  2IOU G;  2BM7 A;  3TH0 A;  1HF2 A;  2VFN A;  1QRC A;  1KQ5 A;  1QQ1 A;  5JLV C;  1TYX A;  1TYU A;  3BH7 B;  1QRB A;  2G0Y A;  2W7Z A;  2YUH A;  1DAB A;  4OPW A;  3P4G A;  4V02 C;  1QA1 A;  1QA3 A;  3H09 A;  5JMC B;  4OM9 A;  2VFM A;  3LJY A;  3BH6 B;  2VFP A;  2XC1 A;  2VFQ A;  4OJ5 A;  3N90 A;  3N6Z A;  1K8F A;  3AK5 A;  4KH3 A;  4JRA C;  1WXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...