2BM5A

The structure of mfpa (rv3361c, p21 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
183
structure length
183
Chain Sequence
MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
total genus 78
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm5A00
5JMCB 2BM6A 2BM4A 2G0YA 4JRAC 2W7ZA 3N90A 2BM7A 5JLVC 2F3LA 2BM5A 2J8IA
chains in the Genus database with same CATH superfamily
1O8FA 2XT2A 3GQAA 3SYJA 4YEJA 2UVFA 3SUCA 1O88A 4OJLA 2XTXA 2BX6A 3BH6B 1QRCA 1HG8A 2BM5A 1KCDA 1O8MA 1OOCA 4U49A 1OFEA 4XONA 2J8KA 2VFQA 1EZGA 4YFOA 2NSPA 4XLAA 1GQ8A 1OGOX 2UVEA 1OGMX 1LLWA 2J8IA 3B4NA 4YELA 4JRAC 2VFNA 3NB2A 4MR0A 4URRA 4XNFA 1EA0A 1KQ5A 4I84A 4OZZA 4OZYA 4XLCA 1QJVA 3PSSA 4W8TA 1X0CA 2X6XA 4OM9A 1BN8A 1KCCA 1O8JA 2PYGA 1OFMA 1VBLA 4PMHA 1IDKA 2QX3A 4Z05A 2IQ7A 4OJ6A 2V5IA 3PETA 4XR6A 4XQFA 3DU1X 1LM1A 2IOUG 2EWEA 2W7ZA 3AK5A 2XC1A 3N90A 4YC5A 3ZPPA 3P4GA 3LYCA 1QCXA 3VSVA 4AVZA 1BHEA 2QXZA 2PYHA 5C1CA 1K4ZA 4EW9A 3LJYA 1CZFA 4W8RA 1OFDA 2BSPA 1O8GA 4YZ0A 4OJ5A 2BM6A 2X6WA 1TYVA 1OFLA 3PSZA 4Z06A 1WXRA 2VBKA 2NT9A 4HWVA 4C2LA 1DABA 1QA1A 5AMVA 3JX8A 1RU4A 2ODLA 2O0VA 2VFOA 1RWRA 2NTQA 1O8LA 1TSPA 2VBEA 2NT6A 1JRGA 1O8HA 2QYUA 4XN3A 1K8FA 3N6ZA 3SZEA 3ZSCA 4NK8A 1TYWA 4W8QA 3WWGA 3KRGA 2F3LA 2VJIA 4XMYA 2XTWA 4XLEA 1O8IA 1O8EA 1L1IA 1QRBA 1WMRA 1LLZA 2NSTA 2NTPA 1PE9A 2O6WA 3GQ9A 3JURA 4XL9A 1EE6A 2BM7A 3LMWA 4XLFA 3H09A 3TH0A 2VFPA 2YUHA 1IB4A 4NK6A 2O04A 3FY3A 2X6YA 4YDTA 3B90A 4KH3A 2QY1A 1QA2A 4XOPA 1KTWA 5JLVC 2O1DA 2XT4A 3RIQA 1O8DA 4OJPA 4YZXA 3UW0A 3VMVA 5DNSA 3SQVA 2INUA 1CLWA 5JMCB 1RMGA 2BM4A 3T9GA 3ML3A 4XKVA 2PECA 4OJOA 2X3HA 1TYUA 2INVA 1H80A 2B0RA 3VSTA 1PXZA 1IDJA 4YZAA 4XORA 3GRHA 1PLUA 2O17A 1TYXA 4MXNA 1DBOA 4XLHA 2NTBA 3EQOA 1XG2A 3B8YA 1QA3A 1JTAA 3BH7B 3EQNA 2VFMA 1NHCA 2Z8GA 3SY2A 4W8SA 4Z03A 4XKWA 4XM3A 3VSUA 1AIRA 2NZMA 4XOTA 1O8KA 4XN0A 4V02C 4YEIA 2G0YA 2O0WA 5C1EA 2X85A 2QZAA 1IA5A 2VBMA 3GQ8A 4YZQA 1HF2A 1QQ1A 1K5CA 1DBGA 4YCQA 2VJJA 4U4BA 3VMWA 3GQ7A 3NAWA 2XTYA 4OPWA
chains in the Genus database with same CATH topology
5JMCB 2V5IA 3PETA 2BM4A 1K8FA 3N6ZA 3SZEA 2IOUG 3SYJA 3ML3A 2W7ZA 3AK5A 1TYWA 2XC1A 3N90A 4OJLA 2BX6A 3BH6B 3LYCA 1QRCA 2F3LA 3P4GA 4OJOA 2BM5A 1TYUA 2B0RA 1QRBA 1K4ZA 2VFQA 3LJYA 2BM7A 1TYXA 3H09A 3TH0A 2VFPA 2J8IA 4OJ5A 2BM6A 2YUHA 4JRAC 1TYVA 2VFNA 1QA3A 1KQ5A 3BH7B 2VFMA 1WXRA 1QA2A 4KH3A 1DABA 1QA1A 3JX8A 4OM9A 5JLVC 4V02C 2G0YA 3RIQA 4OJPA 2VFOA 1HF2A 1QQ1A 1TSPA 1CLWA 4OJ6A 4OPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JMC B;  2BM6 A;  2BM4 A;  2G0Y A;  4JRA C;  2W7Z A;  3N90 A;  2BM7 A;  5JLV C;  2F3L A;  2BM5 A;  2J8I A; 
#chains in the Genus database with same CATH topology
 1O8F A;  2XT2 A;  3GQA A;  3SYJ A;  4YEJ A;  2UVF A;  3SUC A;  1O88 A;  4OJL A;  2XTX A;  2BX6 A;  3BH6 B;  1QRC A;  1HG8 A;  2BM5 A;  1KCD A;  1O8M A;  1OOC A;  4U49 A;  1OFE A;  4XON A;  2J8K A;  2VFQ A;  1EZG A;  4YFO A;  2NSP A;  4XLA A;  1GQ8 A;  1OGO X;  2UVE A;  1OGM X;  1LLW A;  2J8I A;  3B4N A;  4YEL A;  4JRA C;  2VFN A;  3NB2 A;  4MR0 A;  4URR A;  4XNF A;  1EA0 A;  1KQ5 A;  4I84 A;  4OZZ A;  4OZY A;  4XLC A;  1QJV A;  3PSS A;  4W8T A;  1X0C A;  2X6X A;  4OM9 A;  1BN8 A;  1KCC A;  1O8J A;  2PYG A;  1OFM A;  1VBL A;  4PMH A;  1IDK A;  2QX3 A;  4Z05 A;  2IQ7 A;  4OJ6 A;  2V5I A;  3PET A;  4XR6 A;  4XQF A;  3DU1 X;  1LM1 A;  2IOU G;  2EWE A;  2W7Z A;  3AK5 A;  2XC1 A;  3N90 A;  4YC5 A;  3ZPP A;  3P4G A;  3LYC A;  1QCX A;  3VSV A;  4AVZ A;  1BHE A;  2QXZ A;  2PYH A;  5C1C A;  1K4Z A;  4EW9 A;  3LJY A;  1CZF A;  4W8R A;  1OFD A;  2BSP A;  1O8G A;  4YZ0 A;  4OJ5 A;  2BM6 A;  2X6W A;  1TYV A;  1OFL A;  3PSZ A;  4Z06 A;  1WXR A;  2VBK A;  2NT9 A;  4HWV A;  4C2L A;  1DAB A;  1QA1 A;  5AMV A;  3JX8 A;  1RU4 A;  2ODL A;  2O0V A;  2VFO A;  1RWR A;  2NTQ A;  1O8L A;  1TSP A;  2VBE A;  2NT6 A;  1JRG A;  1O8H A;  2QYU A;  4XN3 A;  1K8F A;  3N6Z A;  3SZE A;  3ZSC A;  4NK8 A;  1TYW A;  4W8Q A;  3WWG A;  3KRG A;  2F3L A;  2VJI A;  4XMY A;  2XTW A;  4XLE A;  1O8I A;  1O8E A;  1L1I A;  1QRB A;  1WMR A;  1LLZ A;  2NST A;  2NTP A;  1PE9 A;  2O6W A;  3GQ9 A;  3JUR A;  4XL9 A;  1EE6 A;  2BM7 A;  3LMW A;  4XLF A;  3H09 A;  3TH0 A;  2VFP A;  2YUH A;  1IB4 A;  4NK6 A;  2O04 A;  3FY3 A;  2X6Y A;  4YDT A;  3B90 A;  4KH3 A;  2QY1 A;  1QA2 A;  4XOP A;  1KTW A;  5JLV C;  2O1D A;  2XT4 A;  3RIQ A;  1O8D A;  4OJP A;  4YZX A;  3UW0 A;  3VMV A;  5DNS A;  3SQV A;  2INU A;  1CLW A;  5JMC B;  1RMG A;  2BM4 A;  3T9G A;  3ML3 A;  4XKV A;  2PEC A;  4OJO A;  2X3H A;  1TYU A;  2INV A;  1H80 A;  2B0R A;  3VST A;  1PXZ A;  1IDJ A;  4YZA A;  4XOR A;  3GRH A;  1PLU A;  2O17 A;  1TYX A;  4MXN A;  1DBO A;  4XLH A;  2NTB A;  3EQO A;  1XG2 A;  3B8Y A;  1QA3 A;  1JTA A;  3BH7 B;  3EQN A;  2VFM A;  1NHC A;  2Z8G A;  3SY2 A;  4W8S A;  4Z03 A;  4XKW A;  4XM3 A;  3VSU A;  1AIR A;  2NZM A;  4XOT A;  1O8K A;  4XN0 A;  4V02 C;  4YEI A;  2G0Y A;  2O0W A;  5C1E A;  2X85 A;  2QZA A;  1IA5 A;  2VBM A;  3GQ8 A;  4YZQ A;  1HF2 A;  1QQ1 A;  1K5C A;  1DBG A;  4YCQ A;  2VJJ A;  4U4B A;  3VMW A;  3GQ7 A;  3NAW A;  2XTY A;  4OPW A; 
#chains in the Genus database with same CATH homology
 5JMC B;  2V5I A;  3PET A;  2BM4 A;  1K8F A;  3N6Z A;  3SZE A;  2IOU G;  3SYJ A;  3ML3 A;  2W7Z A;  3AK5 A;  1TYW A;  2XC1 A;  3N90 A;  4OJL A;  2BX6 A;  3BH6 B;  3LYC A;  1QRC A;  2F3L A;  3P4G A;  4OJO A;  2BM5 A;  1TYU A;  2B0R A;  1QRB A;  1K4Z A;  2VFQ A;  3LJY A;  2BM7 A;  1TYX A;  3H09 A;  3TH0 A;  2VFP A;  2J8I A;  4OJ5 A;  2BM6 A;  2YUH A;  4JRA C;  1TYV A;  2VFN A;  1QA3 A;  1KQ5 A;  3BH7 B;  2VFM A;  1WXR A;  1QA2 A;  4KH3 A;  1DAB A;  1QA1 A;  3JX8 A;  4OM9 A;  5JLV C;  4V02 C;  2G0Y A;  3RIQ A;  4OJP A;  2VFO A;  1HF2 A;  1QQ1 A;  1TSP A;  1CLW A;  4OJ6 A;  4OPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...