2BM5A

The structure of mfpa (rv3361c, p21 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
183
structure length
183
Chain Sequence
MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
total genus 78
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm5A00
5JMCB 2J8IA 2BM5A 2BM7A 2G0YA 2W7ZA 2F3LA 2BM4A 4JRAC 2BM6A 3N90A 5JLVC
chains in the Genus database with same CATH superfamily
3EQOA 2BM7A 1CZFA 4XLCA 1XG2A 3GQ9A 3UW0A 2NSTA 3BH7B 3PETA 4W8QA 3T9GA 4XLAA 4OJ6A 2INUA 1O8GA 4XR6A 2ODLA 3N90A 3ZSCA 4XLHA 2QXZA 2NT6A 2XTYA 2QYUA 4XLEA 3ZPPA 3ML3A 1QA2A 1KTWA 3SUCA 2NSPA 1HG8A 4OJLA 1OFLA 4URRA 1OFDA 1OGOX 1QA1A 1L1IA 2O6WA 1RU4A 2J8IA 2W7ZA 2G0YA 5DNSA 1QJVA 2V5IA 1O8FA 1O8LA 2BM6A 3PSSA 4I84A 1WMRA 4YZAA 1BN8A 1O8HA 3JURA 1AIRA 4U4BA 4MXNA 4NK8A 1DBGA 1LLWA 4JRAC 4XORA 3SYJA 3N6ZA 2XT4A 1EE6A 2NZMA 1IA5A 4XN0A 4YDTA 3B8YA 4XQFA 1O8EA 2UVEA 4OZYA 4Z05A 4EW9A 3SY2A 2QZAA 4W8RA 1KCCA 2PECA 5JLVC 3GQAA 4OJ5A 4YCQA 4Z03A 5JMCB 1K5CA 1O8KA 3NB2A 2VFNA 4W8SA 4XL9A 3VSVA 3VMWA 5C1CA 4YFOA 2X6WA 1DBOA 2VBMA 2VFOA 2YUHA 4OM9A 4W8TA 4XKVA 3BH6B 2VBEA 1RMGA 2NTQA 1TSPA 2O17A 4YZXA 2Z8GA 2IOUG 2QY1A 2BM4A 3AK5A 1K8FA 1OOCA 2B0RA 1IDKA 4YZQA 3DU1X 2BM5A 4YEIA 4XKWA 2NTBA 2UVFA 3FY3A 1TYUA 4YELA 1IDJA 2INVA 2XTWA 3SQVA 5C1EA 3VSUA 2VJIA 4YC5A 3WWGA 1OFMA 1VBLA 1IB4A 1PXZA 4YZ0A 1NHCA 2NT9A 1PE9A 2NTPA 4HWVA 4C2LA 2VFQA 3NAWA 1QA3A 1O8JA 4AVZA 1WXRA 4XLFA 1K4ZA 3LMWA 2VFMA 1QRBA 4OJOA 1OFEA 4Z06A 1KCDA 1O8MA 2XTXA 4MR0A 4OJPA 1EZGA 1TYVA 1O8DA 2F3LA 1EA0A 4XONA 2J8KA 3GQ8A 4XOTA 3GQ7A 2X85A 3PSZA 2VFPA 3EQNA 1H80A 2IQ7A 2O0VA 3VMVA 1KQ5A 2QX3A 2BX6A 4XN3A 2PYHA 1LLZA 1O8IA 2VJJA 2XT2A 4XM3A 3B90A 4YEJA 2X6XA 5AMVA 1QRCA 1DABA 2O04A 2X3HA 3LJYA 2XC1A 3P4GA 3TH0A 3GRHA 1X0CA 2PYGA 4PMHA 4OZZA 1GQ8A 2O1DA 1LM1A 4U49A 3LYCA 4XMYA 3SZEA 1RWRA 1TYWA 1O88A 1QCXA 4OPWA 3B4NA 3JX8A 4XOPA 2EWEA 3RIQA 2BSPA 1OGMX 4XNFA 4NK6A 1HF2A 1PLUA 2X6YA 1BHEA 3VSTA 1JRGA 3H09A 2VBKA 3KRGA 1QQ1A 4V02C 1TYXA 1JTAA 2O0WA 1CLWA 4KH3A
chains in the Genus database with same CATH topology
2BM7A 2BM5A 2VFPA 1TYUA 4JRAC 3SYJA 1KQ5A 3N6ZA 3BH7B 3PETA 2BX6A 1DABA 4OJ6A 1QRCA 3LJYA 3P4GA 2XC1A 3TH0A 2VFQA 3SZEA 3N90A 1QA3A 3LYCA 5JLVC 5JMCB 4OJ5A 1TYWA 1WXRA 4OPWA 2VFNA 3ML3A 3JX8A 1K4ZA 1QA2A 4OJLA 2VFMA 1QRBA 2VFOA 2YUHA 4OJOA 4OM9A 3RIQA 3BH6B 1QA1A 1HF2A 4OJPA 2J8IA 2W7ZA 2G0YA 1TSPA 3H09A 1TYVA 2IOUG 2F3LA 2V5IA 1QQ1A 2BM4A 4V02C 2BM6A 3AK5A 1TYXA 1K8FA 1CLWA 4KH3A 2B0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JMC B;  2J8I A;  2BM5 A;  2BM7 A;  2G0Y A;  2W7Z A;  2F3L A;  2BM4 A;  4JRA C;  2BM6 A;  3N90 A;  5JLV C; 
#chains in the Genus database with same CATH topology
 3EQO A;  2BM7 A;  1CZF A;  4XLC A;  1XG2 A;  3GQ9 A;  3UW0 A;  2NST A;  3BH7 B;  3PET A;  4W8Q A;  3T9G A;  4XLA A;  4OJ6 A;  2INU A;  1O8G A;  4XR6 A;  2ODL A;  3N90 A;  3ZSC A;  4XLH A;  2QXZ A;  2NT6 A;  2XTY A;  2QYU A;  4XLE A;  3ZPP A;  3ML3 A;  1QA2 A;  1KTW A;  3SUC A;  2NSP A;  1HG8 A;  4OJL A;  1OFL A;  4URR A;  1OFD A;  1OGO X;  1QA1 A;  1L1I A;  2O6W A;  1RU4 A;  2J8I A;  2W7Z A;  2G0Y A;  5DNS A;  1QJV A;  2V5I A;  1O8F A;  1O8L A;  2BM6 A;  3PSS A;  4I84 A;  1WMR A;  4YZA A;  1BN8 A;  1O8H A;  3JUR A;  1AIR A;  4U4B A;  4MXN A;  4NK8 A;  1DBG A;  1LLW A;  4JRA C;  4XOR A;  3SYJ A;  3N6Z A;  2XT4 A;  1EE6 A;  2NZM A;  1IA5 A;  4XN0 A;  4YDT A;  3B8Y A;  4XQF A;  1O8E A;  2UVE A;  4OZY A;  4Z05 A;  4EW9 A;  3SY2 A;  2QZA A;  4W8R A;  1KCC A;  2PEC A;  5JLV C;  3GQA A;  4OJ5 A;  4YCQ A;  4Z03 A;  5JMC B;  1K5C A;  1O8K A;  3NB2 A;  2VFN A;  4W8S A;  4XL9 A;  3VSV A;  3VMW A;  5C1C A;  4YFO A;  2X6W A;  1DBO A;  2VBM A;  2VFO A;  2YUH A;  4OM9 A;  4W8T A;  4XKV A;  3BH6 B;  2VBE A;  1RMG A;  2NTQ A;  1TSP A;  2O17 A;  4YZX A;  2Z8G A;  2IOU G;  2QY1 A;  2BM4 A;  3AK5 A;  1K8F A;  1OOC A;  2B0R A;  1IDK A;  4YZQ A;  3DU1 X;  2BM5 A;  4YEI A;  4XKW A;  2NTB A;  2UVF A;  3FY3 A;  1TYU A;  4YEL A;  1IDJ A;  2INV A;  2XTW A;  3SQV A;  5C1E A;  3VSU A;  2VJI A;  4YC5 A;  3WWG A;  1OFM A;  1VBL A;  1IB4 A;  1PXZ A;  4YZ0 A;  1NHC A;  2NT9 A;  1PE9 A;  2NTP A;  4HWV A;  4C2L A;  2VFQ A;  3NAW A;  1QA3 A;  1O8J A;  4AVZ A;  1WXR A;  4XLF A;  1K4Z A;  3LMW A;  2VFM A;  1QRB A;  4OJO A;  1OFE A;  4Z06 A;  1KCD A;  1O8M A;  2XTX A;  4MR0 A;  4OJP A;  1EZG A;  1TYV A;  1O8D A;  2F3L A;  1EA0 A;  4XON A;  2J8K A;  3GQ8 A;  4XOT A;  3GQ7 A;  2X85 A;  3PSZ A;  2VFP A;  3EQN A;  1H80 A;  2IQ7 A;  2O0V A;  3VMV A;  1KQ5 A;  2QX3 A;  2BX6 A;  4XN3 A;  2PYH A;  1LLZ A;  1O8I A;  2VJJ A;  2XT2 A;  4XM3 A;  3B90 A;  4YEJ A;  2X6X A;  5AMV A;  1QRC A;  1DAB A;  2O04 A;  2X3H A;  3LJY A;  2XC1 A;  3P4G A;  3TH0 A;  3GRH A;  1X0C A;  2PYG A;  4PMH A;  4OZZ A;  1GQ8 A;  2O1D A;  1LM1 A;  4U49 A;  3LYC A;  4XMY A;  3SZE A;  1RWR A;  1TYW A;  1O88 A;  1QCX A;  4OPW A;  3B4N A;  3JX8 A;  4XOP A;  2EWE A;  3RIQ A;  2BSP A;  1OGM X;  4XNF A;  4NK6 A;  1HF2 A;  1PLU A;  2X6Y A;  1BHE A;  3VST A;  1JRG A;  3H09 A;  2VBK A;  3KRG A;  1QQ1 A;  4V02 C;  1TYX A;  1JTA A;  2O0W A;  1CLW A;  4KH3 A; 
#chains in the Genus database with same CATH homology
 2BM7 A;  2BM5 A;  2VFP A;  1TYU A;  4JRA C;  3SYJ A;  1KQ5 A;  3N6Z A;  3BH7 B;  3PET A;  2BX6 A;  1DAB A;  4OJ6 A;  1QRC A;  3LJY A;  3P4G A;  2XC1 A;  3TH0 A;  2VFQ A;  3SZE A;  3N90 A;  1QA3 A;  3LYC A;  5JLV C;  5JMC B;  4OJ5 A;  1TYW A;  1WXR A;  4OPW A;  2VFN A;  3ML3 A;  3JX8 A;  1K4Z A;  1QA2 A;  4OJL A;  2VFM A;  1QRB A;  2VFO A;  2YUH A;  4OJO A;  4OM9 A;  3RIQ A;  3BH6 B;  1QA1 A;  1HF2 A;  4OJP A;  2J8I A;  2W7Z A;  2G0Y A;  1TSP A;  3H09 A;  1TYV A;  2IOU G;  2F3L A;  2V5I A;  1QQ1 A;  2BM4 A;  4V02 C;  2BM6 A;  3AK5 A;  1TYX A;  1K8F A;  1CLW A;  4KH3 A;  2B0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...