2BM5A

The structure of mfpa (rv3361c, p21 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
183
structure length
183
Chain Sequence
b'MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
total genus 78
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm5A00
2BM4A 2G0YA 2F3LA 3N90A 2J8IA 5JLVC 2BM7A 4JRAC 5JMCB 2BM5A 2W7ZA 2BM6A
chains in the Genus database with same CATH superfamily
4Z03A 2BX6A 1H80A 1HF2A 2G0YA 3VSTA 2QXZA 4OJ6A 1O8JA 4XLFA 2O1DA 4Z05A 4YZXA 3ZSCA 4AVZA 1O8HA 2BM7A 1K8FA 2UVFA 3GQ9A 2X6XA 1AIRA 2BSPA 4YZQA 2NTQA 1O8KA 2BM6A 2VFMA 2NTPA 4XQFA 4C2LA 2J8IA 1O88A 1JRGA 1PE9A 4YEJA 1DBGA 2O04A 2PYHA 4V02C 1LLZA 1O8MA 2PYGA 3JX8A 3SZEA 3RIQA 3BH7B 1OFMA 1EE6A 4YDTA 4W8SA 1GQ8A 4XR6A 1OFEA 4MR0A 1LM1A 2IOUG 1PXZA 2UVEA 2X6YA 2VJIA 3GQ7A 3B8YA 4XLHA 4EW9A 1NHCA 3NAWA 1EZGA 4XONA 4KH3A 4XM3A 2NTBA 4I84A 2XC1A 4XOPA 3FY3A 1QA2A 1HG8A 1JTAA 1K4ZA 1DABA 1X0CA 2NSPA 3SY2A 3LJYA 5C1EA 4W8QA 3VMVA 3AK5A 3ZPPA 3TH0A 2VBEA 4OJOA 1O8GA 3B90A 4Z06A 4XN3A 3UW0A 4OM9A 2QZAA 1WMRA 3JURA 1KCCA 1KQ5A 2XTWA 2O17A 2J8KA 2INVA 3SYJA 4URRA 4XKWA 2XT4A 4XL9A 1IA5A 1L1IA 1EA0A 1QQ1A 4U4BA 1IDJA 5AMVA 1TYVA 3KRGA 4OJ5A 4YFOA 2VJJA 3BH6B 2IQ7A 4XORA 1QA3A 3SUCA 1QRCA 1OOCA 1O8FA 2QYUA 2VFQA 1OFLA 2QX3A 3PSSA 1VBLA 2XTXA 1IDKA 2QY1A 3N6ZA 2O6WA 1OGOX 2VFNA 3EQOA 2XTYA 1CZFA 3LYCA 2VBMA 2V5IA 3N90A 1O8LA 3VSUA 1DBOA 3SQVA 1KCDA 1BN8A 4YC5A 1K5CA 4XNFA 2NT6A 1TSPA 2NSTA 3B4NA 5JLVC 4XOTA 1O8EA 2Z8GA 4YELA 4YEIA 1TYXA 4W8TA 4OPWA 3VMWA 2VFOA 2O0WA 1WXRA 1LLWA 3H09A 4OZZA 4PMHA 3WWGA 1QA1A 1RMGA 1QCXA 3VSVA 2O0VA 2EWEA 4XLEA 1PLUA 5DNSA 4YZAA 4JRAC 3GQ8A 3NB2A 4NK6A 1BHEA 5C1CA 2BM5A 2PECA 4XLCA 1O8DA 2W7ZA 4W8RA 4XMYA 3GQAA 1RU4A 2X3HA 2F3LA 4YZ0A 2VFPA 1OGMX 4OJPA 2X85A 2INUA 1OFDA 4HWVA 3ML3A 4NK8A 2NT9A 4XLAA 5JMCB 2YUHA 4OJLA 3EQNA 3GRHA 4XN0A 2BM4A 2VBKA 2X6WA 3PSZA 1RWRA 4U49A 1TYWA 1TYUA 1CLWA 4YCQA 3PETA 2ODLA 2XT2A 2B0RA 3DU1X 1QJVA 1IB4A 3P4GA 2NZMA 3T9GA 1QRBA 1O8IA 4MXNA 4XKVA 3LMWA 1KTWA 1XG2A 4OZYA
chains in the Genus database with same CATH topology
2BX6A 1K4ZA 1HF2A 2G0YA 1DABA 4OJ6A 3LJYA 2BM7A 1K8FA 4JRAC 1QA3A 2BM5A 3N6ZA 2W7ZA 2BM6A 3AK5A 2VFMA 3TH0A 2F3LA 2VFPA 2J8IA 2VFNA 4OJPA 3LYCA 3ML3A 4OJOA 5JMCB 2V5IA 2YUHA 3JX8A 3N90A 4OJLA 4OM9A 4V02C 3SZEA 3RIQA 2BM4A 3BH7B 1KQ5A 1TSPA 5JLVC 3SYJA 1TYXA 1TYWA 1TYUA 1CLWA 2VFOA 4OPWA 3PETA 1QQ1A 2IOUG 2B0RA 1WXRA 1TYVA 3H09A 4OJ5A 1QA2A 3P4GA 2XC1A 1QA1A 3BH6B 4KH3A 1QRBA 1QRCA 2VFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM4 A;  2G0Y A;  2F3L A;  3N90 A;  2J8I A;  5JLV C;  2BM7 A;  4JRA C;  5JMC B;  2BM5 A;  2W7Z A;  2BM6 A; 
#chains in the Genus database with same CATH topology
 4Z03 A;  2BX6 A;  1H80 A;  1HF2 A;  2G0Y A;  3VST A;  2QXZ A;  4OJ6 A;  1O8J A;  4XLF A;  2O1D A;  4Z05 A;  4YZX A;  3ZSC A;  4AVZ A;  1O8H A;  2BM7 A;  1K8F A;  2UVF A;  3GQ9 A;  2X6X A;  1AIR A;  2BSP A;  4YZQ A;  2NTQ A;  1O8K A;  2BM6 A;  2VFM A;  2NTP A;  4XQF A;  4C2L A;  2J8I A;  1O88 A;  1JRG A;  1PE9 A;  4YEJ A;  1DBG A;  2O04 A;  2PYH A;  4V02 C;  1LLZ A;  1O8M A;  2PYG A;  3JX8 A;  3SZE A;  3RIQ A;  3BH7 B;  1OFM A;  1EE6 A;  4YDT A;  4W8S A;  1GQ8 A;  4XR6 A;  1OFE A;  4MR0 A;  1LM1 A;  2IOU G;  1PXZ A;  2UVE A;  2X6Y A;  2VJI A;  3GQ7 A;  3B8Y A;  4XLH A;  4EW9 A;  1NHC A;  3NAW A;  1EZG A;  4XON A;  4KH3 A;  4XM3 A;  2NTB A;  4I84 A;  2XC1 A;  4XOP A;  3FY3 A;  1QA2 A;  1HG8 A;  1JTA A;  1K4Z A;  1DAB A;  1X0C A;  2NSP A;  3SY2 A;  3LJY A;  5C1E A;  4W8Q A;  3VMV A;  3AK5 A;  3ZPP A;  3TH0 A;  2VBE A;  4OJO A;  1O8G A;  3B90 A;  4Z06 A;  4XN3 A;  3UW0 A;  4OM9 A;  2QZA A;  1WMR A;  3JUR A;  1KCC A;  1KQ5 A;  2XTW A;  2O17 A;  2J8K A;  2INV A;  3SYJ A;  4URR A;  4XKW A;  2XT4 A;  4XL9 A;  1IA5 A;  1L1I A;  1EA0 A;  1QQ1 A;  4U4B A;  1IDJ A;  5AMV A;  1TYV A;  3KRG A;  4OJ5 A;  4YFO A;  2VJJ A;  3BH6 B;  2IQ7 A;  4XOR A;  1QA3 A;  3SUC A;  1QRC A;  1OOC A;  1O8F A;  2QYU A;  2VFQ A;  1OFL A;  2QX3 A;  3PSS A;  1VBL A;  2XTX A;  1IDK A;  2QY1 A;  3N6Z A;  2O6W A;  1OGO X;  2VFN A;  3EQO A;  2XTY A;  1CZF A;  3LYC A;  2VBM A;  2V5I A;  3N90 A;  1O8L A;  3VSU A;  1DBO A;  3SQV A;  1KCD A;  1BN8 A;  4YC5 A;  1K5C A;  4XNF A;  2NT6 A;  1TSP A;  2NST A;  3B4N A;  5JLV C;  4XOT A;  1O8E A;  2Z8G A;  4YEL A;  4YEI A;  1TYX A;  4W8T A;  4OPW A;  3VMW A;  2VFO A;  2O0W A;  1WXR A;  1LLW A;  3H09 A;  4OZZ A;  4PMH A;  3WWG A;  1QA1 A;  1RMG A;  1QCX A;  3VSV A;  2O0V A;  2EWE A;  4XLE A;  1PLU A;  5DNS A;  4YZA A;  4JRA C;  3GQ8 A;  3NB2 A;  4NK6 A;  1BHE A;  5C1C A;  2BM5 A;  2PEC A;  4XLC A;  1O8D A;  2W7Z A;  4W8R A;  4XMY A;  3GQA A;  1RU4 A;  2X3H A;  2F3L A;  4YZ0 A;  2VFP A;  1OGM X;  4OJP A;  2X85 A;  2INU A;  1OFD A;  4HWV A;  3ML3 A;  4NK8 A;  2NT9 A;  4XLA A;  5JMC B;  2YUH A;  4OJL A;  3EQN A;  3GRH A;  4XN0 A;  2BM4 A;  2VBK A;  2X6W A;  3PSZ A;  1RWR A;  4U49 A;  1TYW A;  1TYU A;  1CLW A;  4YCQ A;  3PET A;  2ODL A;  2XT2 A;  2B0R A;  3DU1 X;  1QJV A;  1IB4 A;  3P4G A;  2NZM A;  3T9G A;  1QRB A;  1O8I A;  4MXN A;  4XKV A;  3LMW A;  1KTW A;  1XG2 A;  4OZY A; 
#chains in the Genus database with same CATH homology
 2BX6 A;  1K4Z A;  1HF2 A;  2G0Y A;  1DAB A;  4OJ6 A;  3LJY A;  2BM7 A;  1K8F A;  4JRA C;  1QA3 A;  2BM5 A;  3N6Z A;  2W7Z A;  2BM6 A;  3AK5 A;  2VFM A;  3TH0 A;  2F3L A;  2VFP A;  2J8I A;  2VFN A;  4OJP A;  3LYC A;  3ML3 A;  4OJO A;  5JMC B;  2V5I A;  2YUH A;  3JX8 A;  3N90 A;  4OJL A;  4OM9 A;  4V02 C;  3SZE A;  3RIQ A;  2BM4 A;  3BH7 B;  1KQ5 A;  1TSP A;  5JLV C;  3SYJ A;  1TYX A;  1TYW A;  1TYU A;  1CLW A;  2VFO A;  4OPW A;  3PET A;  1QQ1 A;  2IOU G;  2B0R A;  1WXR A;  1TYV A;  3H09 A;  4OJ5 A;  1QA2 A;  3P4G A;  2XC1 A;  1QA1 A;  3BH6 B;  4KH3 A;  1QRB A;  1QRC A;  2VFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...