2BM5A

The structure of mfpa (rv3361c, p21 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
183
structure length
183
Chain Sequence
MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pentapeptide repeat protein
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 78
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm5A00
2J8IA 2BM5A 5JMCB 2W7ZA 3N90A 2F3LA 2BM6A 2G0YA 5JLVC 2BM7A 2BM4A 4JRAC
chains in the Genus database with same CATH superfamily
2PYGA 1JTAA 3BH7B 4YZQA 4XMYA 2VJJA 2BM6A 4OZYA 2QZAA 4YFOA 5JMCB 1RMGA 2PYHA 3WWGA 4KH3A 2O6WA 1VBLA 1OFDA 2INVA 1O8MA 3GQAA 4W8TA 4YEJA 2XT2A 1KTWA 2X6XA 3ML3A 4XN0A 2BM7A 1DBGA 3GQ7A 1HF2A 4OM9A 3NB2A 2X6WA 1QA1A 4XONA 2G0YA 2VFPA 4U4BA 3AK5A 3EQOA 1RU4A 2XT4A 1K8FA 3BH6B 4V02C 1PXZA 4YZAA 3VMWA 1BHEA 4XQFA 1LLWA 1QCXA 1K4ZA 3LJYA 4XOTA 1OFMA 3B4NA 2NZMA 3ZSCA 2BM5A 4XLHA 2J8KA 2UVFA 1DBOA 2W7ZA 1QQ1A 3NAWA 1IA5A 3VMVA 2X3HA 2NTQA 2BM4A 2VFOA 1OFEA 1BN8A 1PE9A 2J8IA 1RWRA 3ZPPA 1O88A 4YZ0A 1O8LA 1QA2A 1O8KA 2EWEA 4W8RA 4XL9A 2NT9A 4YDTA 3SQVA 1XG2A 2B0RA 2XTWA 4I84A 4Z06A 1LM1A 1OFLA 1TYWA 2Z8GA 3SZEA 4OJ5A 4URRA 5C1EA 1H80A 1LLZA 3DU1X 3P4GA 4OJLA 2QYUA 4XLAA 4XLFA 4XOPA 1IB4A 1TSPA 3B90A 3LYCA 1DABA 3T9GA 3B8YA 4OJPA 1CLWA 1O8GA 4EW9A 1KQ5A 2QX3A 2O0VA 3JX8A 4XLEA 3UW0A 1NHCA 2NSPA 2VJIA 4YC5A 1JRGA 1O8EA 1TYXA 3LMWA 4NK8A 3GQ9A 3H09A 4YEIA 2O04A 1O8JA 3GQ8A 4OZZA 5JLVC 2XC1A 1QRCA 2ODLA 5AMVA 4MR0A 1GQ8A 3N6ZA 1O8IA 1OOCA 2BSPA 3GRHA 1IDJA 1CZFA 2O17A 2O1DA 2VFMA 2VBEA 1WXRA 4HWVA 2INUA 3PSZA 4W8QA 4OJOA 2NTBA 1KCCA 4U49A 2NTPA 2BX6A 1OGOX 3SUCA 4W8SA 3SY2A 2IQ7A 1QJVA 2UVEA 2IOUG 2VFQA 2NT6A 4OPWA 4XLCA 4C2LA 3SYJA 1O8DA 1QA3A 4YZXA 2X6YA 2QY1A 1EZGA 1KCDA 3PSSA 1HG8A 1X0CA 3FY3A 3JURA 4NK6A 4XORA 4YCQA 4Z05A 4AVZA 1WMRA 1K5CA 2F3LA 1O8FA 1IDKA 2XTYA 2YUHA 2NSTA 4PMHA 5C1CA 2PECA 4XM3A 1QRBA 4OJ6A 3VSUA 2X85A 2VBKA 3TH0A 4XNFA 1L1IA 4XKVA 2XTXA 2O0WA 4MXNA 3KRGA 2QXZA 1AIRA 3EQNA 3VSVA 1TYUA 4XN3A 3PETA 3RIQA 2V5IA 3N90A 4XR6A 4YELA 3VSTA 2VFNA 1EE6A 4XKWA 4Z03A 5DNSA 1O8HA 1EA0A 1PLUA 1OGMX 1TYVA 4JRAC 2VBMA
chains in the Genus database with same CATH topology
4OPWA 4OJPA 2IOUG 2VFQA 2BM5A 3BH7B 1CLWA 2W7ZA 3SYJA 1QQ1A 1KQ5A 2BM6A 1QA3A 3JX8A 2BM4A 5JMCB 1TYXA 2VFOA 4KH3A 2J8IA 3H09A 1K4ZA 1QA2A 2F3LA 2YUHA 3ML3A 5JLVC 2BM7A 2XC1A 1QRCA 1QRBA 4OJ6A 1HF2A 2B0RA 4OM9A 3TH0A 1QA1A 2G0YA 1TYWA 2VFPA 3N6ZA 3SZEA 4OJ5A 3AK5A 1TYUA 2VFMA 3PETA 3RIQA 2V5IA 3BH6B 1K8FA 3N90A 4V02C 3LJYA 3P4GA 2VFNA 4OJLA 4OJOA 1WXRA 1TSPA 1TYVA 2BX6A 3LYCA 4JRAC 1DABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8I A;  2BM5 A;  5JMC B;  2W7Z A;  3N90 A;  2F3L A;  2BM6 A;  2G0Y A;  5JLV C;  2BM7 A;  2BM4 A;  4JRA C; 
#chains in the Genus database with same CATH topology
 2PYG A;  1JTA A;  3BH7 B;  4YZQ A;  4XMY A;  2VJJ A;  2BM6 A;  4OZY A;  2QZA A;  4YFO A;  5JMC B;  1RMG A;  2PYH A;  3WWG A;  4KH3 A;  2O6W A;  1VBL A;  1OFD A;  2INV A;  1O8M A;  3GQA A;  4W8T A;  4YEJ A;  2XT2 A;  1KTW A;  2X6X A;  3ML3 A;  4XN0 A;  2BM7 A;  1DBG A;  3GQ7 A;  1HF2 A;  4OM9 A;  3NB2 A;  2X6W A;  1QA1 A;  4XON A;  2G0Y A;  2VFP A;  4U4B A;  3AK5 A;  3EQO A;  1RU4 A;  2XT4 A;  1K8F A;  3BH6 B;  4V02 C;  1PXZ A;  4YZA A;  3VMW A;  1BHE A;  4XQF A;  1LLW A;  1QCX A;  1K4Z A;  3LJY A;  4XOT A;  1OFM A;  3B4N A;  2NZM A;  3ZSC A;  2BM5 A;  4XLH A;  2J8K A;  2UVF A;  1DBO A;  2W7Z A;  1QQ1 A;  3NAW A;  1IA5 A;  3VMV A;  2X3H A;  2NTQ A;  2BM4 A;  2VFO A;  1OFE A;  1BN8 A;  1PE9 A;  2J8I A;  1RWR A;  3ZPP A;  1O88 A;  4YZ0 A;  1O8L A;  1QA2 A;  1O8K A;  2EWE A;  4W8R A;  4XL9 A;  2NT9 A;  4YDT A;  3SQV A;  1XG2 A;  2B0R A;  2XTW A;  4I84 A;  4Z06 A;  1LM1 A;  1OFL A;  1TYW A;  2Z8G A;  3SZE A;  4OJ5 A;  4URR A;  5C1E A;  1H80 A;  1LLZ A;  3DU1 X;  3P4G A;  4OJL A;  2QYU A;  4XLA A;  4XLF A;  4XOP A;  1IB4 A;  1TSP A;  3B90 A;  3LYC A;  1DAB A;  3T9G A;  3B8Y A;  4OJP A;  1CLW A;  1O8G A;  4EW9 A;  1KQ5 A;  2QX3 A;  2O0V A;  3JX8 A;  4XLE A;  3UW0 A;  1NHC A;  2NSP A;  2VJI A;  4YC5 A;  1JRG A;  1O8E A;  1TYX A;  3LMW A;  4NK8 A;  3GQ9 A;  3H09 A;  4YEI A;  2O04 A;  1O8J A;  3GQ8 A;  4OZZ A;  5JLV C;  2XC1 A;  1QRC A;  2ODL A;  5AMV A;  4MR0 A;  1GQ8 A;  3N6Z A;  1O8I A;  1OOC A;  2BSP A;  3GRH A;  1IDJ A;  1CZF A;  2O17 A;  2O1D A;  2VFM A;  2VBE A;  1WXR A;  4HWV A;  2INU A;  3PSZ A;  4W8Q A;  4OJO A;  2NTB A;  1KCC A;  4U49 A;  2NTP A;  2BX6 A;  1OGO X;  3SUC A;  4W8S A;  3SY2 A;  2IQ7 A;  1QJV A;  2UVE A;  2IOU G;  2VFQ A;  2NT6 A;  4OPW A;  4XLC A;  4C2L A;  3SYJ A;  1O8D A;  1QA3 A;  4YZX A;  2X6Y A;  2QY1 A;  1EZG A;  1KCD A;  3PSS A;  1HG8 A;  1X0C A;  3FY3 A;  3JUR A;  4NK6 A;  4XOR A;  4YCQ A;  4Z05 A;  4AVZ A;  1WMR A;  1K5C A;  2F3L A;  1O8F A;  1IDK A;  2XTY A;  2YUH A;  2NST A;  4PMH A;  5C1C A;  2PEC A;  4XM3 A;  1QRB A;  4OJ6 A;  3VSU A;  2X85 A;  2VBK A;  3TH0 A;  4XNF A;  1L1I A;  4XKV A;  2XTX A;  2O0W A;  4MXN A;  3KRG A;  2QXZ A;  1AIR A;  3EQN A;  3VSV A;  1TYU A;  4XN3 A;  3PET A;  3RIQ A;  2V5I A;  3N90 A;  4XR6 A;  4YEL A;  3VST A;  2VFN A;  1EE6 A;  4XKW A;  4Z03 A;  5DNS A;  1O8H A;  1EA0 A;  1PLU A;  1OGM X;  1TYV A;  4JRA C;  2VBM A; 
#chains in the Genus database with same CATH homology
 4OPW A;  4OJP A;  2IOU G;  2VFQ A;  2BM5 A;  3BH7 B;  1CLW A;  2W7Z A;  3SYJ A;  1QQ1 A;  1KQ5 A;  2BM6 A;  1QA3 A;  3JX8 A;  2BM4 A;  5JMC B;  1TYX A;  2VFO A;  4KH3 A;  2J8I A;  3H09 A;  1K4Z A;  1QA2 A;  2F3L A;  2YUH A;  3ML3 A;  5JLV C;  2BM7 A;  2XC1 A;  1QRC A;  1QRB A;  4OJ6 A;  1HF2 A;  2B0R A;  4OM9 A;  3TH0 A;  1QA1 A;  2G0Y A;  1TYW A;  2VFP A;  3N6Z A;  3SZE A;  4OJ5 A;  3AK5 A;  1TYU A;  2VFM A;  3PET A;  3RIQ A;  2V5I A;  3BH6 B;  1K8F A;  3N90 A;  4V02 C;  3LJY A;  3P4G A;  2VFN A;  4OJL A;  4OJO A;  1WXR A;  1TSP A;  1TYV A;  2BX6 A;  3LYC A;  4JRA C;  1DAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...