1GQ8A

Pectin methylesterase from carrot
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
319
structure length
319
Chain Sequence
b'ESSTVGPNVVVAADGSGDYKTVSEAVAAAPEDSKTRYVIRIKAGVYRENVDVPKKKKNIMFLGDGRTSTIITASKNVQDGSTTFNSATVAAVGAGFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTYLGRPWKEYSRTVVMQSSITNVINPAGWFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSSTEAQGFTPGSFIAGGSWLKATTFPFSLGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PECTINESTERASE
publication title Crystal Structure of Plant Pectin Methylesterase
pubmed doi rcsb
molecule tags Hydrolase
total genus 122
structure length 319
sequence length 319
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2001-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1gq8A00
4YEJA 4XONA 4XNFA 3B90A 2NZMA 4U4BA 1DBOA 2NSPA 1PE9A 4OZZA 3WWGA 1QJVA 1O8KA 4C2LA 1BN8A 3SUCA 1OFMA 1O8IA 4XLCA 3B4NA 2EWEA 2QX3A 3UW0A 1PXZA 2O04A 4XOPA 3VSUA 3GQ9A 1O8MA 4XORA 4NK6A 2O1DA 4YZAA 1PLUA 3VMVA 1KCCA 4Z03A 4OZYA 2X85A 4URRA 1OGMX 1DBGA 4AVZA 1IA5A 2QY1A 3T9GA 2NTPA 4W8SA 4XQFA 4XMYA 2X6XA 4XLFA 1VBLA 1HG8A 1JRGA 3GQAA 3LMWA 1IDJA 4XKVA 4XLHA 3VMWA 2NTBA 3KRGA 4W8QA 4YZ0A 1KCDA 1H80A 2NT9A 5AMVA 3GQ7A 4Z06A 3GQ8A 2NT6A 5C1CA 3FY3A 1WMRA 2INVA 2NTQA 4XKWA 1BHEA 2O17A 2UVEA 1OFLA 2VJIA 1O88A 3B8YA 1GQ8A 1QCXA 2VBMA 2O0VA 4Z05A 2ODLA 2NSTA 1JTAA 3GRHA 3EQNA 2Z8GA 4W8RA 2VBKA 4XLAA 1O8FA 2VJJA 4XM3A 4XN0A 3JURA 1RMGA 2X6YA 2PECA 1O8LA 1OGOX 4YZXA 4EW9A 2QXZA 1O8JA 4MXNA 1AIRA 1IDKA 2X3HA 2X6WA 4OJ5A 1O8HA 4YELA 3VSTA 3VSVA 2PYGA 2UVFA 1K5CA 3ZSCA 1EE6A 1KTWA 4XOTA 1RU4A 4OJ6A 4XN3A 4MR0A 3ZPPA 2PYHA 3EQOA 1OOCA 4NK8A 1IB4A 4XL9A 4YZQA 1O8EA 2O0WA 1NHCA 1O8DA 4W8TA 4OJPA 4OJLA 1CZFA 4XR6A 4OJOA 4PMHA 4XLEA 4I84A 2VBEA 1O8GA 5C1EA 4HWVA 1X0CA 4U49A 1XG2A 2IQ7A 1RWRA 2BSPA 2INUA
chains in the Genus database with same CATH superfamily
4YEJA 4XONA 4XNFA 2V5IA 3B90A 2NZMA 2J8KA 4U4BA 1DBOA 2NSPA 1PE9A 3TH0A 4OZZA 3WWGA 1QA1A 3LYCA 1QJVA 3PETA 1O8KA 1TYWA 4C2LA 2O6WA 1BN8A 3SUCA 1OFMA 1O8IA 4XLCA 3B4NA 2EWEA 1EZGA 2VFMA 2QX3A 3UW0A 2XTXA 3PSSA 1PXZA 2O04A 4XOPA 2BSPA 3BH6B 3GQ9A 3VSUA 1O8MA 1TYUA 4XORA 1LLWA 3SY2A 4NK6A 2O1DA 3NAWA 4YZAA 4JRAC 1HF2A 1PLUA 3VMVA 1KCCA 4Z03A 4OZYA 1TYVA 2X85A 5JMCB 4URRA 1OGMX 1DBGA 4AVZA 2QYUA 3RIQA 2XTYA 1QA3A 1OFDA 3JX8A 4YCQA 1IA5A 2QY1A 3T9GA 2NTPA 4W8SA 2XTWA 4XQFA 4XMYA 4YFOA 1WXRA 1QRCA 2X6XA 4XLFA 1VBLA 1KQ5A 1HG8A 1DABA 1EA0A 1JRGA 3GQAA 3LMWA 1IDJA 4XKVA 4XLHA 3VMWA 1K8FA 2NTBA 1TSPA 3KRGA 4W8QA 4YZ0A 1K4ZA 1KCDA 3AK5A 3SYJA 1H80A 1LM1A 2NT9A 5AMVA 3N90A 3GQ7A 4Z06A 3GQ8A 2NT6A 5C1CA 3FY3A 1WMRA 2INVA 2NTQA 4XKWA 1BHEA 3ML3A 2O17A 1LLZA 2UVEA 2VFNA 1OFLA 2VJIA 2BM4A 1O88A 1QRBA 1GQ8A 2G0YA 2IOUG 3B8YA 1QCXA 1TYXA 2VBMA 2O0VA 4KH3A 4Z05A 3BH7B 2ODLA 2NSTA 2XT4A 1JTAA 3GRHA 4OM9A 3EQNA 2Z8GA 4W8RA 2J8IA 2VBKA 4XLAA 3SQVA 2BX6A 1O8FA 3P4GA 2VJJA 2W7ZA 4XM3A 3PSZA 4XN0A 3JURA 1RMGA 2VFOA 2X6YA 2PECA 1O8LA 1OGOX 4YZXA 4EW9A 2QXZA 2QZAA 1O8JA 4YEIA 3NB2A 2B0RA 4MXNA 1AIRA 1IDKA 2X3HA 2X6WA 3LJYA 5JLVC 4OJ5A 2BM6A 4YDTA 1O8HA 4YELA 3VSTA 2XT2A 2PYGA 2UVFA 4V02C 5DNSA 3VSVA 3ZSCA 1EE6A 1K5CA 1KTWA 4XOTA 1RU4A 4OJ6A 1CLWA 4XN3A 4MR0A 3ZPPA 2PYHA 3EQOA 1OOCA 2VFQA 3H09A 1OFEA 4NK8A 1IB4A 4XL9A 2BM5A 3DU1X 2YUHA 4YZQA 1O8EA 2VFPA 2O0WA 1NHCA 1O8DA 4W8TA 4OJPA 1L1IA 4OJLA 1QA2A 1CZFA 4XR6A 3SZEA 1QQ1A 3N6ZA 4OJOA 4PMHA 4XLEA 4I84A 2VBEA 1O8GA 2XC1A 5C1EA 4HWVA 1X0CA 4OPWA 1XG2A 2BM7A 4U49A 2IQ7A 1RWRA 2F3LA 2INUA 4YC5A
chains in the Genus database with same CATH topology
4YEJA 4XONA 4XNFA 3B90A 2NZMA 4U4BA 1DBOA 2NSPA 1PE9A 4OZZA 3WWGA 1QJVA 1O8KA 4C2LA 1BN8A 3SUCA 1OFMA 1O8IA 4XLCA 3B4NA 2EWEA 2QX3A 3UW0A 1PXZA 2O04A 4XOPA 3VSUA 3GQ9A 1O8MA 4XORA 4NK6A 2O1DA 4YZAA 1PLUA 3VMVA 1KCCA 4Z03A 4OZYA 2X85A 4URRA 1OGMX 1DBGA 4AVZA 1IA5A 2QY1A 3T9GA 2NTPA 4W8SA 4XQFA 4XMYA 2X6XA 4XLFA 1VBLA 1HG8A 1JRGA 3GQAA 3LMWA 1IDJA 4XKVA 4XLHA 3VMWA 2NTBA 3KRGA 4W8QA 4YZ0A 1KCDA 1H80A 2NT9A 5AMVA 3GQ7A 4Z06A 3GQ8A 2NT6A 5C1CA 3FY3A 1WMRA 2INVA 2NTQA 4XKWA 1BHEA 2O17A 2UVEA 1OFLA 2VJIA 1O88A 3B8YA 1GQ8A 1QCXA 2VBMA 2O0VA 4Z05A 2ODLA 2NSTA 1JTAA 3GRHA 3EQNA 2Z8GA 4W8RA 2VBKA 4XLAA 1O8FA 2VJJA 4XM3A 4XN0A 3JURA 1RMGA 2X6YA 2PECA 1O8LA 1OGOX 4YZXA 4EW9A 2QXZA 1O8JA 4MXNA 1AIRA 1IDKA 2X3HA 2X6WA 4OJ5A 1O8HA 4YELA 3VSTA 3VSVA 2PYGA 2UVFA 1K5CA 3ZSCA 1EE6A 1KTWA 4XOTA 1RU4A 4OJ6A 4XN3A 4MR0A 3ZPPA 2PYHA 3EQOA 1OOCA 4NK8A 1IB4A 4XL9A 4YZQA 1O8EA 2O0WA 1NHCA 1O8DA 4W8TA 4OJPA 4OJLA 1CZFA 4XR6A 4OJOA 4PMHA 4XLEA 4I84A 2VBEA 1O8GA 5C1EA 4HWVA 1X0CA 4U49A 1XG2A 2IQ7A 1RWRA 2BSPA 2INUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEJ A;  4XON A;  4XNF A;  3B90 A;  2NZM A;  4U4B A;  1DBO A;  2NSP A;  1PE9 A;  4OZZ A;  3WWG A;  1QJV A;  1O8K A;  4C2L A;  1BN8 A;  3SUC A;  1OFM A;  1O8I A;  4XLC A;  3B4N A;  2EWE A;  2QX3 A;  3UW0 A;  1PXZ A;  2O04 A;  4XOP A;  3VSU A;  3GQ9 A;  1O8M A;  4XOR A;  4NK6 A;  2O1D A;  4YZA A;  1PLU A;  3VMV A;  1KCC A;  4Z03 A;  4OZY A;  2X85 A;  4URR A;  1OGM X;  1DBG A;  4AVZ A;  1IA5 A;  2QY1 A;  3T9G A;  2NTP A;  4W8S A;  4XQF A;  4XMY A;  2X6X A;  4XLF A;  1VBL A;  1HG8 A;  1JRG A;  3GQA A;  3LMW A;  1IDJ A;  4XKV A;  4XLH A;  3VMW A;  2NTB A;  3KRG A;  4W8Q A;  4YZ0 A;  1KCD A;  1H80 A;  2NT9 A;  5AMV A;  3GQ7 A;  4Z06 A;  3GQ8 A;  2NT6 A;  5C1C A;  3FY3 A;  1WMR A;  2INV A;  2NTQ A;  4XKW A;  1BHE A;  2O17 A;  2UVE A;  1OFL A;  2VJI A;  1O88 A;  3B8Y A;  1GQ8 A;  1QCX A;  2VBM A;  2O0V A;  4Z05 A;  2ODL A;  2NST A;  1JTA A;  3GRH A;  3EQN A;  2Z8G A;  4W8R A;  2VBK A;  4XLA A;  1O8F A;  2VJJ A;  4XM3 A;  4XN0 A;  3JUR A;  1RMG A;  2X6Y A;  2PEC A;  1O8L A;  1OGO X;  4YZX A;  4EW9 A;  2QXZ A;  1O8J A;  4MXN A;  1AIR A;  1IDK A;  2X3H A;  2X6W A;  4OJ5 A;  1O8H A;  4YEL A;  3VST A;  3VSV A;  2PYG A;  2UVF A;  1K5C A;  3ZSC A;  1EE6 A;  1KTW A;  4XOT A;  1RU4 A;  4OJ6 A;  4XN3 A;  4MR0 A;  3ZPP A;  2PYH A;  3EQO A;  1OOC A;  4NK8 A;  1IB4 A;  4XL9 A;  4YZQ A;  1O8E A;  2O0W A;  1NHC A;  1O8D A;  4W8T A;  4OJP A;  4OJL A;  1CZF A;  4XR6 A;  4OJO A;  4PMH A;  4XLE A;  4I84 A;  2VBE A;  1O8G A;  5C1E A;  4HWV A;  1X0C A;  4U49 A;  1XG2 A;  2IQ7 A;  1RWR A;  2BSP A;  2INU A; 
#chains in the Genus database with same CATH topology
 4YEJ A;  4XON A;  4XNF A;  2V5I A;  3B90 A;  2NZM A;  2J8K A;  4U4B A;  1DBO A;  2NSP A;  1PE9 A;  3TH0 A;  4OZZ A;  3WWG A;  1QA1 A;  3LYC A;  1QJV A;  3PET A;  1O8K A;  1TYW A;  4C2L A;  2O6W A;  1BN8 A;  3SUC A;  1OFM A;  1O8I A;  4XLC A;  3B4N A;  2EWE A;  1EZG A;  2VFM A;  2QX3 A;  3UW0 A;  2XTX A;  3PSS A;  1PXZ A;  2O04 A;  4XOP A;  2BSP A;  3BH6 B;  3GQ9 A;  3VSU A;  1O8M A;  1TYU A;  4XOR A;  1LLW A;  3SY2 A;  4NK6 A;  2O1D A;  3NAW A;  4YZA A;  4JRA C;  1HF2 A;  1PLU A;  3VMV A;  1KCC A;  4Z03 A;  4OZY A;  1TYV A;  2X85 A;  5JMC B;  4URR A;  1OGM X;  1DBG A;  4AVZ A;  2QYU A;  3RIQ A;  2XTY A;  1QA3 A;  1OFD A;  3JX8 A;  4YCQ A;  1IA5 A;  2QY1 A;  3T9G A;  2NTP A;  4W8S A;  2XTW A;  4XQF A;  4XMY A;  4YFO A;  1WXR A;  1QRC A;  2X6X A;  4XLF A;  1VBL A;  1KQ5 A;  1HG8 A;  1DAB A;  1EA0 A;  1JRG A;  3GQA A;  3LMW A;  1IDJ A;  4XKV A;  4XLH A;  3VMW A;  1K8F A;  2NTB A;  1TSP A;  3KRG A;  4W8Q A;  4YZ0 A;  1K4Z A;  1KCD A;  3AK5 A;  3SYJ A;  1H80 A;  1LM1 A;  2NT9 A;  5AMV A;  3N90 A;  3GQ7 A;  4Z06 A;  3GQ8 A;  2NT6 A;  5C1C A;  3FY3 A;  1WMR A;  2INV A;  2NTQ A;  4XKW A;  1BHE A;  3ML3 A;  2O17 A;  1LLZ A;  2UVE A;  2VFN A;  1OFL A;  2VJI A;  2BM4 A;  1O88 A;  1QRB A;  1GQ8 A;  2G0Y A;  2IOU G;  3B8Y A;  1QCX A;  1TYX A;  2VBM A;  2O0V A;  4KH3 A;  4Z05 A;  3BH7 B;  2ODL A;  2NST A;  2XT4 A;  1JTA A;  3GRH A;  4OM9 A;  3EQN A;  2Z8G A;  4W8R A;  2J8I A;  2VBK A;  4XLA A;  3SQV A;  2BX6 A;  1O8F A;  3P4G A;  2VJJ A;  2W7Z A;  4XM3 A;  3PSZ A;  4XN0 A;  3JUR A;  1RMG A;  2VFO A;  2X6Y A;  2PEC A;  1O8L A;  1OGO X;  4YZX A;  4EW9 A;  2QXZ A;  2QZA A;  1O8J A;  4YEI A;  3NB2 A;  2B0R A;  4MXN A;  1AIR A;  1IDK A;  2X3H A;  2X6W A;  3LJY A;  5JLV C;  4OJ5 A;  2BM6 A;  4YDT A;  1O8H A;  4YEL A;  3VST A;  2XT2 A;  2PYG A;  2UVF A;  4V02 C;  5DNS A;  3VSV A;  3ZSC A;  1EE6 A;  1K5C A;  1KTW A;  4XOT A;  1RU4 A;  4OJ6 A;  1CLW A;  4XN3 A;  4MR0 A;  3ZPP A;  2PYH A;  3EQO A;  1OOC A;  2VFQ A;  3H09 A;  1OFE A;  4NK8 A;  1IB4 A;  4XL9 A;  2BM5 A;  3DU1 X;  2YUH A;  4YZQ A;  1O8E A;  2VFP A;  2O0W A;  1NHC A;  1O8D A;  4W8T A;  4OJP A;  1L1I A;  4OJL A;  1QA2 A;  1CZF A;  4XR6 A;  3SZE A;  1QQ1 A;  3N6Z A;  4OJO A;  4PMH A;  4XLE A;  4I84 A;  2VBE A;  1O8G A;  2XC1 A;  5C1E A;  4HWV A;  1X0C A;  4OPW A;  1XG2 A;  2BM7 A;  4U49 A;  2IQ7 A;  1RWR A;  2F3L A;  2INU A;  4YC5 A; 
#chains in the Genus database with same CATH homology
 4YEJ A;  4XON A;  4XNF A;  3B90 A;  2NZM A;  4U4B A;  1DBO A;  2NSP A;  1PE9 A;  4OZZ A;  3WWG A;  1QJV A;  1O8K A;  4C2L A;  1BN8 A;  3SUC A;  1OFM A;  1O8I A;  4XLC A;  3B4N A;  2EWE A;  2QX3 A;  3UW0 A;  1PXZ A;  2O04 A;  4XOP A;  3VSU A;  3GQ9 A;  1O8M A;  4XOR A;  4NK6 A;  2O1D A;  4YZA A;  1PLU A;  3VMV A;  1KCC A;  4Z03 A;  4OZY A;  2X85 A;  4URR A;  1OGM X;  1DBG A;  4AVZ A;  1IA5 A;  2QY1 A;  3T9G A;  2NTP A;  4W8S A;  4XQF A;  4XMY A;  2X6X A;  4XLF A;  1VBL A;  1HG8 A;  1JRG A;  3GQA A;  3LMW A;  1IDJ A;  4XKV A;  4XLH A;  3VMW A;  2NTB A;  3KRG A;  4W8Q A;  4YZ0 A;  1KCD A;  1H80 A;  2NT9 A;  5AMV A;  3GQ7 A;  4Z06 A;  3GQ8 A;  2NT6 A;  5C1C A;  3FY3 A;  1WMR A;  2INV A;  2NTQ A;  4XKW A;  1BHE A;  2O17 A;  2UVE A;  1OFL A;  2VJI A;  1O88 A;  3B8Y A;  1GQ8 A;  1QCX A;  2VBM A;  2O0V A;  4Z05 A;  2ODL A;  2NST A;  1JTA A;  3GRH A;  3EQN A;  2Z8G A;  4W8R A;  2VBK A;  4XLA A;  1O8F A;  2VJJ A;  4XM3 A;  4XN0 A;  3JUR A;  1RMG A;  2X6Y A;  2PEC A;  1O8L A;  1OGO X;  4YZX A;  4EW9 A;  2QXZ A;  1O8J A;  4MXN A;  1AIR A;  1IDK A;  2X3H A;  2X6W A;  4OJ5 A;  1O8H A;  4YEL A;  3VST A;  3VSV A;  2PYG A;  2UVF A;  1K5C A;  3ZSC A;  1EE6 A;  1KTW A;  4XOT A;  1RU4 A;  4OJ6 A;  4XN3 A;  4MR0 A;  3ZPP A;  2PYH A;  3EQO A;  1OOC A;  4NK8 A;  1IB4 A;  4XL9 A;  4YZQ A;  1O8E A;  2O0W A;  1NHC A;  1O8D A;  4W8T A;  4OJP A;  4OJL A;  1CZF A;  4XR6 A;  4OJO A;  4PMH A;  4XLE A;  4I84 A;  2VBE A;  1O8G A;  5C1E A;  4HWV A;  1X0C A;  4U49 A;  1XG2 A;  2IQ7 A;  1RWR A;  2BSP A;  2INU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...