1GQ8A

Pectin methylesterase from carrot
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
319
structure length
319
Chain Sequence
ESSTVGPNVVVAADGSGDYKTVSEAVAAAPEDSKTRYVIRIKAGVYRENVDVPKKKKNIMFLGDGRTSTIITASKNVQDGSTTFNSATVAAVGAGFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTYLGRPWKEYSRTVVMQSSITNVINPAGWFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSSTEAQGFTPGSFIAGGSWLKATTFPFSLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PECTINESTERASE
publication title Crystal Structure of Plant Pectin Methylesterase
pubmed doi rcsb
total genus 122
structure length 319
sequence length 319
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2001-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1gq8A00
4YZAA 1H80A 1JTAA 2QY1A 3GQ7A 4URRA 1AIRA 5AMVA 3VSVA 1O8MA 2VBEA 4XORA 3VMVA 2VBKA 2IQ7A 1IB4A 1O8JA 4OJ5A 5C1EA 1DBOA 2NT6A 1QJVA 1EE6A 4OJ6A 4XL9A 4NK8A 4YZQA 1O8LA 2INUA 4W8TA 1O88A 1K5CA 2INVA 3SUCA 3B8YA 2O04A 4I84A 4XOTA 4PMHA 2NZMA 1O8HA 4OJPA 1IDKA 4XLFA 3WWGA 4XKVA 3GRHA 2NTBA 4XLHA 3GQ9A 1IA5A 3B90A 4XR6A 4U49A 1OFLA 4YEJA 4XKWA 3VMWA 2Z8GA 2QXZA 4XQFA 2NSPA 4XNFA 5C1CA 1PLUA 4EW9A 1KCDA 1KTWA 4OJOA 4W8SA 1DBGA 4W8RA 1XG2A 3FY3A 2X6YA 2O1DA 1O8GA 3GQAA 4MXNA 1OGOX 3KRGA 1JRGA 2NSTA 2O0VA 4XN3A 4W8QA 2X85A 2BSPA 4XLAA 4OJLA 1NHCA 4C2LA 4OZYA 4XLEA 2X6WA 1O8EA 3GQ8A 4HWVA 4NK6A 4XM3A 4YELA 1RU4A 1O8DA 4XLCA 1WMRA 4XMYA 4U4BA 2VJJA 1OGMX 1O8FA 4YZXA 1O8KA 2UVFA 1OOCA 1X0CA 4YZ0A 3T9GA 1QCXA 2EWEA 4OZZA 2ODLA 1GQ8A 1OFMA 1VBLA 4XN0A 4Z06A 3JURA 3ZPPA 4Z05A 2NTQA 1BN8A 2UVEA 2PECA 2QX3A 1CZFA 2O0WA 3LMWA 1PE9A 4MR0A 3ZSCA 1HG8A 3EQOA 2PYGA 2NTPA 3B4NA 2VJIA 2NT9A 2VBMA 1O8IA 1IDJA 2X6XA 3UW0A 4Z03A 3VSTA 4XONA 1RWRA 1BHEA 2X3HA 1KCCA 2O17A 3EQNA 4XOPA 2PYHA 1RMGA 3VSUA 1PXZA 4AVZA
chains in the Genus database with same CATH superfamily
4YZAA 1H80A 1JTAA 2QY1A 2XTXA 3GQ7A 1AIRA 2BM6A 4URRA 5DNSA 2IOUG 2XTYA 3AK5A 3RIQA 4JRAC 5AMVA 1K4ZA 1PXZA 4KH3A 3VSVA 1O8MA 2VBEA 4XORA 3VMVA 2VBKA 2IQ7A 1IB4A 1O8JA 2QZAA 4OJ5A 3BH7B 1DBOA 5C1EA 2NT6A 2VFMA 5JMCB 1QJVA 1EE6A 4OJ6A 4XL9A 4NK8A 2B0RA 1TYXA 4YZQA 3SY2A 1O8LA 2INUA 2VFNA 4W8TA 2F3LA 1O88A 1K5CA 2INVA 3SUCA 3B8YA 2O04A 4I84A 4XOTA 4PMHA 3H09A 3P4GA 2NZMA 1O8HA 3BH6B 4OJPA 1QQ1A 2VFPA 1IDKA 3NAWA 4XLFA 3WWGA 4XKVA 3GRHA 2NTBA 4XLHA 3GQ9A 3TH0A 4YFOA 1IA5A 1QA1A 3B90A 4XR6A 4OM9A 4U49A 1OFLA 2VFQA 4YEJA 4XKWA 3VMWA 2Z8GA 1EZGA 2QXZA 4XQFA 2NSPA 1K8FA 4XNFA 4YCQA 5C1CA 1PLUA 4EW9A 1KCDA 1KTWA 4OJOA 4W8SA 1KQ5A 2BM4A 4YEIA 1DBGA 1EA0A 4W8RA 2QYUA 1TYVA 1LM1A 1XG2A 3FY3A 2X6YA 4YDTA 2O1DA 1O8GA 3GQAA 3SYJA 1OFDA 1OGOX 4MXNA 3KRGA 1JRGA 1LLZA 2YUHA 1QRBA 2NSTA 2O0VA 4XN3A 4W8QA 2X85A 2BSPA 4XLAA 1DABA 4OJLA 1LLWA 2BM7A 1NHCA 4C2LA 4OZYA 4XLEA 2X6WA 1O8EA 3GQ8A 1TSPA 4HWVA 4NK6A 4XM3A 4YELA 1RU4A 2XC1A 2VFOA 1O8DA 4XLCA 1WMRA 4XMYA 1TYWA 4U4BA 2VJJA 1OGMX 2XT2A 1O8FA 3LYCA 3N6ZA 4OPWA 4YZXA 1O8KA 2UVFA 1OOCA 1X0CA 3SQVA 2O6WA 4YZ0A 1TYUA 3T9GA 3ML3A 5JLVC 1QCXA 2EWEA 3NB2A 4OZZA 2XTWA 2ODLA 1WXRA 1GQ8A 1OFMA 1QA3A 1VBLA 4XN0A 4Z06A 3JURA 1QA2A 3ZPPA 2J8IA 4Z05A 2NTQA 1QRCA 1BN8A 2XT4A 3PSZA 3PSSA 3N90A 1HF2A 2UVEA 2PECA 2QX3A 1CZFA 2O0WA 3LMWA 1PE9A 3LJYA 4MR0A 3JX8A 4V02C 3ZSCA 1L1IA 2V5IA 1HG8A 3EQOA 2PYGA 3PETA 2NTPA 3B4NA 2BM5A 2J8KA 2NT9A 2G0YA 2VJIA 2VBMA 1IDJA 1O8IA 2X6XA 3UW0A 4Z03A 3VSTA 3DU1X 4YC5A 4XONA 1RWRA 1BHEA 2X3HA 1KCCA 2O17A 3EQNA 4XOPA 2BX6A 3SZEA 2PYHA 2W7ZA 1RMGA 3VSUA 1CLWA 1OFEA 4AVZA
chains in the Genus database with same CATH topology
4YZAA 1H80A 1JTAA 2QY1A 3GQ7A 4URRA 1AIRA 5AMVA 3VSVA 1O8MA 2VBEA 4XORA 3VMVA 2VBKA 2IQ7A 1IB4A 1O8JA 4OJ5A 5C1EA 1DBOA 2NT6A 1QJVA 1EE6A 4OJ6A 4XL9A 4NK8A 4YZQA 1O8LA 2INUA 4W8TA 1O88A 1K5CA 2INVA 3SUCA 3B8YA 2O04A 4I84A 4XOTA 4PMHA 2NZMA 1O8HA 4OJPA 1IDKA 4XLFA 3WWGA 4XKVA 3GRHA 2NTBA 4XLHA 3GQ9A 1IA5A 3B90A 4XR6A 4U49A 1OFLA 4YEJA 4XKWA 3VMWA 2Z8GA 2QXZA 4XQFA 2NSPA 4XNFA 5C1CA 1PLUA 4EW9A 1KCDA 1KTWA 4OJOA 4W8SA 1DBGA 4W8RA 1XG2A 3FY3A 2X6YA 2O1DA 1O8GA 3GQAA 4MXNA 1OGOX 3KRGA 1JRGA 2NSTA 2O0VA 4XN3A 4W8QA 2X85A 2BSPA 4XLAA 4OJLA 1NHCA 4C2LA 4OZYA 4XLEA 2X6WA 1O8EA 3GQ8A 4HWVA 4NK6A 4XM3A 4YELA 1RU4A 1O8DA 4XLCA 1WMRA 4XMYA 4U4BA 2VJJA 1OGMX 1O8FA 4YZXA 1O8KA 2UVFA 1OOCA 1X0CA 4YZ0A 3T9GA 1QCXA 2EWEA 4OZZA 2ODLA 1GQ8A 1OFMA 1VBLA 4XN0A 4Z06A 3JURA 3ZPPA 4Z05A 2NTQA 1BN8A 2UVEA 2PECA 2QX3A 1CZFA 2O0WA 3LMWA 1PE9A 4MR0A 3ZSCA 1HG8A 3EQOA 2PYGA 2NTPA 3B4NA 2VJIA 2NT9A 2VBMA 1O8IA 1IDJA 2X6XA 3UW0A 4Z03A 3VSTA 4XONA 1RWRA 1BHEA 2X3HA 1KCCA 2O17A 3EQNA 4XOPA 2PYHA 1RMGA 3VSUA 1PXZA 4AVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZA A;  1H80 A;  1JTA A;  2QY1 A;  3GQ7 A;  4URR A;  1AIR A;  5AMV A;  3VSV A;  1O8M A;  2VBE A;  4XOR A;  3VMV A;  2VBK A;  2IQ7 A;  1IB4 A;  1O8J A;  4OJ5 A;  5C1E A;  1DBO A;  2NT6 A;  1QJV A;  1EE6 A;  4OJ6 A;  4XL9 A;  4NK8 A;  4YZQ A;  1O8L A;  2INU A;  4W8T A;  1O88 A;  1K5C A;  2INV A;  3SUC A;  3B8Y A;  2O04 A;  4I84 A;  4XOT A;  4PMH A;  2NZM A;  1O8H A;  4OJP A;  1IDK A;  4XLF A;  3WWG A;  4XKV A;  3GRH A;  2NTB A;  4XLH A;  3GQ9 A;  1IA5 A;  3B90 A;  4XR6 A;  4U49 A;  1OFL A;  4YEJ A;  4XKW A;  3VMW A;  2Z8G A;  2QXZ A;  4XQF A;  2NSP A;  4XNF A;  5C1C A;  1PLU A;  4EW9 A;  1KCD A;  1KTW A;  4OJO A;  4W8S A;  1DBG A;  4W8R A;  1XG2 A;  3FY3 A;  2X6Y A;  2O1D A;  1O8G A;  3GQA A;  4MXN A;  1OGO X;  3KRG A;  1JRG A;  2NST A;  2O0V A;  4XN3 A;  4W8Q A;  2X85 A;  2BSP A;  4XLA A;  4OJL A;  1NHC A;  4C2L A;  4OZY A;  4XLE A;  2X6W A;  1O8E A;  3GQ8 A;  4HWV A;  4NK6 A;  4XM3 A;  4YEL A;  1RU4 A;  1O8D A;  4XLC A;  1WMR A;  4XMY A;  4U4B A;  2VJJ A;  1OGM X;  1O8F A;  4YZX A;  1O8K A;  2UVF A;  1OOC A;  1X0C A;  4YZ0 A;  3T9G A;  1QCX A;  2EWE A;  4OZZ A;  2ODL A;  1GQ8 A;  1OFM A;  1VBL A;  4XN0 A;  4Z06 A;  3JUR A;  3ZPP A;  4Z05 A;  2NTQ A;  1BN8 A;  2UVE A;  2PEC A;  2QX3 A;  1CZF A;  2O0W A;  3LMW A;  1PE9 A;  4MR0 A;  3ZSC A;  1HG8 A;  3EQO A;  2PYG A;  2NTP A;  3B4N A;  2VJI A;  2NT9 A;  2VBM A;  1O8I A;  1IDJ A;  2X6X A;  3UW0 A;  4Z03 A;  3VST A;  4XON A;  1RWR A;  1BHE A;  2X3H A;  1KCC A;  2O17 A;  3EQN A;  4XOP A;  2PYH A;  1RMG A;  3VSU A;  1PXZ A;  4AVZ A; 
#chains in the Genus database with same CATH topology
 4YZA A;  1H80 A;  1JTA A;  2QY1 A;  2XTX A;  3GQ7 A;  1AIR A;  2BM6 A;  4URR A;  5DNS A;  2IOU G;  2XTY A;  3AK5 A;  3RIQ A;  4JRA C;  5AMV A;  1K4Z A;  1PXZ A;  4KH3 A;  3VSV A;  1O8M A;  2VBE A;  4XOR A;  3VMV A;  2VBK A;  2IQ7 A;  1IB4 A;  1O8J A;  2QZA A;  4OJ5 A;  3BH7 B;  1DBO A;  5C1E A;  2NT6 A;  2VFM A;  5JMC B;  1QJV A;  1EE6 A;  4OJ6 A;  4XL9 A;  4NK8 A;  2B0R A;  1TYX A;  4YZQ A;  3SY2 A;  1O8L A;  2INU A;  2VFN A;  4W8T A;  2F3L A;  1O88 A;  1K5C A;  2INV A;  3SUC A;  3B8Y A;  2O04 A;  4I84 A;  4XOT A;  4PMH A;  3H09 A;  3P4G A;  2NZM A;  1O8H A;  3BH6 B;  4OJP A;  1QQ1 A;  2VFP A;  1IDK A;  3NAW A;  4XLF A;  3WWG A;  4XKV A;  3GRH A;  2NTB A;  4XLH A;  3GQ9 A;  3TH0 A;  4YFO A;  1IA5 A;  1QA1 A;  3B90 A;  4XR6 A;  4OM9 A;  4U49 A;  1OFL A;  2VFQ A;  4YEJ A;  4XKW A;  3VMW A;  2Z8G A;  1EZG A;  2QXZ A;  4XQF A;  2NSP A;  1K8F A;  4XNF A;  4YCQ A;  5C1C A;  1PLU A;  4EW9 A;  1KCD A;  1KTW A;  4OJO A;  4W8S A;  1KQ5 A;  2BM4 A;  4YEI A;  1DBG A;  1EA0 A;  4W8R A;  2QYU A;  1TYV A;  1LM1 A;  1XG2 A;  3FY3 A;  2X6Y A;  4YDT A;  2O1D A;  1O8G A;  3GQA A;  3SYJ A;  1OFD A;  1OGO X;  4MXN A;  3KRG A;  1JRG A;  1LLZ A;  2YUH A;  1QRB A;  2NST A;  2O0V A;  4XN3 A;  4W8Q A;  2X85 A;  2BSP A;  4XLA A;  1DAB A;  4OJL A;  1LLW A;  2BM7 A;  1NHC A;  4C2L A;  4OZY A;  4XLE A;  2X6W A;  1O8E A;  3GQ8 A;  1TSP A;  4HWV A;  4NK6 A;  4XM3 A;  4YEL A;  1RU4 A;  2XC1 A;  2VFO A;  1O8D A;  4XLC A;  1WMR A;  4XMY A;  1TYW A;  4U4B A;  2VJJ A;  1OGM X;  2XT2 A;  1O8F A;  3LYC A;  3N6Z A;  4OPW A;  4YZX A;  1O8K A;  2UVF A;  1OOC A;  1X0C A;  3SQV A;  2O6W A;  4YZ0 A;  1TYU A;  3T9G A;  3ML3 A;  5JLV C;  1QCX A;  2EWE A;  3NB2 A;  4OZZ A;  2XTW A;  2ODL A;  1WXR A;  1GQ8 A;  1OFM A;  1QA3 A;  1VBL A;  4XN0 A;  4Z06 A;  3JUR A;  1QA2 A;  3ZPP A;  2J8I A;  4Z05 A;  2NTQ A;  1QRC A;  1BN8 A;  2XT4 A;  3PSZ A;  3PSS A;  3N90 A;  1HF2 A;  2UVE A;  2PEC A;  2QX3 A;  1CZF A;  2O0W A;  3LMW A;  1PE9 A;  3LJY A;  4MR0 A;  3JX8 A;  4V02 C;  3ZSC A;  1L1I A;  2V5I A;  1HG8 A;  3EQO A;  2PYG A;  3PET A;  2NTP A;  3B4N A;  2BM5 A;  2J8K A;  2NT9 A;  2G0Y A;  2VJI A;  2VBM A;  1IDJ A;  1O8I A;  2X6X A;  3UW0 A;  4Z03 A;  3VST A;  3DU1 X;  4YC5 A;  4XON A;  1RWR A;  1BHE A;  2X3H A;  1KCC A;  2O17 A;  3EQN A;  4XOP A;  2BX6 A;  3SZE A;  2PYH A;  2W7Z A;  1RMG A;  3VSU A;  1CLW A;  1OFE A;  4AVZ A; 
#chains in the Genus database with same CATH homology
 4YZA A;  1H80 A;  1JTA A;  2QY1 A;  3GQ7 A;  4URR A;  1AIR A;  5AMV A;  3VSV A;  1O8M A;  2VBE A;  4XOR A;  3VMV A;  2VBK A;  2IQ7 A;  1IB4 A;  1O8J A;  4OJ5 A;  5C1E A;  1DBO A;  2NT6 A;  1QJV A;  1EE6 A;  4OJ6 A;  4XL9 A;  4NK8 A;  4YZQ A;  1O8L A;  2INU A;  4W8T A;  1O88 A;  1K5C A;  2INV A;  3SUC A;  3B8Y A;  2O04 A;  4I84 A;  4XOT A;  4PMH A;  2NZM A;  1O8H A;  4OJP A;  1IDK A;  4XLF A;  3WWG A;  4XKV A;  3GRH A;  2NTB A;  4XLH A;  3GQ9 A;  1IA5 A;  3B90 A;  4XR6 A;  4U49 A;  1OFL A;  4YEJ A;  4XKW A;  3VMW A;  2Z8G A;  2QXZ A;  4XQF A;  2NSP A;  4XNF A;  5C1C A;  1PLU A;  4EW9 A;  1KCD A;  1KTW A;  4OJO A;  4W8S A;  1DBG A;  4W8R A;  1XG2 A;  3FY3 A;  2X6Y A;  2O1D A;  1O8G A;  3GQA A;  4MXN A;  1OGO X;  3KRG A;  1JRG A;  2NST A;  2O0V A;  4XN3 A;  4W8Q A;  2X85 A;  2BSP A;  4XLA A;  4OJL A;  1NHC A;  4C2L A;  4OZY A;  4XLE A;  2X6W A;  1O8E A;  3GQ8 A;  4HWV A;  4NK6 A;  4XM3 A;  4YEL A;  1RU4 A;  1O8D A;  4XLC A;  1WMR A;  4XMY A;  4U4B A;  2VJJ A;  1OGM X;  1O8F A;  4YZX A;  1O8K A;  2UVF A;  1OOC A;  1X0C A;  4YZ0 A;  3T9G A;  1QCX A;  2EWE A;  4OZZ A;  2ODL A;  1GQ8 A;  1OFM A;  1VBL A;  4XN0 A;  4Z06 A;  3JUR A;  3ZPP A;  4Z05 A;  2NTQ A;  1BN8 A;  2UVE A;  2PEC A;  2QX3 A;  1CZF A;  2O0W A;  3LMW A;  1PE9 A;  4MR0 A;  3ZSC A;  1HG8 A;  3EQO A;  2PYG A;  2NTP A;  3B4N A;  2VJI A;  2NT9 A;  2VBM A;  1O8I A;  1IDJ A;  2X6X A;  3UW0 A;  4Z03 A;  3VST A;  4XON A;  1RWR A;  1BHE A;  2X3H A;  1KCC A;  2O17 A;  3EQN A;  4XOP A;  2PYH A;  1RMG A;  3VSU A;  1PXZ A;  4AVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...