2NTQA

Crystal structure of pectin methylesterase in complex with hexasaccharide vii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords Pectinesterase A
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2ntqA00
1O88A 3UW0A 1BHEA 1DBGA 4W8RA 2O0VA 4Z05A 3SUCA 2NZMA 2O17A 2O1DA 2X6XA 2VBKA 2BSPA 2VBMA 2X6YA 4XLAA 3WWGA 3FY3A 4W8QA 1O8EA 3KRGA 2QX3A 1PE9A 4YZQA 2O04A 2NT9A 5AMVA 2NTPA 4OJOA 2O0WA 1IA5A 1HG8A 1OGMX 1AIRA 3B90A 1OOCA 4YELA 1IB4A 4MXNA 1RU4A 1QJVA 4XR6A 4YZXA 2UVFA 1OGOX 1O8IA 2VJJA 1O8KA 2QY1A 3VSVA 3GQ7A 3GQ8A 2VBEA 1OFLA 4XN0A 1PLUA 1XG2A 4C2LA 1O8LA 1KCDA 1VBLA 1DBOA 4Z06A 4XM3A 3VMWA 3GQAA 1H80A 4EW9A 4XLEA 4XLHA 4XQFA 3ZSCA 4U4BA 4OJLA 1CZFA 3EQOA 1GQ8A 1QCXA 1X0CA 4XORA 1O8JA 1OFMA 2IQ7A 1PXZA 1IDJA 3B8YA 1JTAA 4XNFA 3GRHA 3JURA 1O8DA 1JRGA 4NK6A 1O8HA 2QXZA 5C1EA 3VSUA 1KTWA 4HWVA 4NK8A 1O8FA 4AVZA 4XKVA 1BN8A 2NT6A 2UVEA 2PECA 3EQNA 4XMYA 4YEJA 1EE6A 4XONA 1RWRA 2NSTA 2VJIA 4URRA 2X6WA 3VSTA 4OZYA 3LMWA 4XLFA 3GQ9A 1NHCA 2X85A 4XL9A 2INUA 1KCCA 2PYHA 2NTBA 1RMGA 4OJ5A 4YZ0A 1WMRA 4W8TA 2NSPA 2PYGA 5C1CA 2INVA 1IDKA 4PMHA 4YZAA 4U49A 1K5CA 2X3HA 4XLCA 2NTQA 2Z8GA 4OJPA 3B4NA 4OZZA 3VMVA 3ZPPA 4XOTA 4W8SA 4I84A 4XOPA 2EWEA 2ODLA 1O8MA 4OJ6A 4MR0A 3T9GA 4XN3A 4Z03A 4XKWA 1O8GA
chains in the Genus database with same CATH superfamily
1O88A 3UW0A 1BHEA 1DBGA 1TYVA 2O0VA 4W8RA 4Z05A 3SUCA 2NZMA 2XTWA 3PETA 2O17A 2O1DA 2X6XA 1QRBA 3NAWA 2VBKA 2BSPA 2VBMA 2BM4A 2X6YA 4XLAA 3WWGA 3FY3A 4W8QA 1O8EA 3KRGA 3P4GA 5JLVC 1QA1A 2QX3A 2IOUG 1PE9A 4YZQA 2O04A 2NT9A 3PSSA 4YFOA 4V02C 5AMVA 3RIQA 1CLWA 2NTPA 4OJOA 2O0WA 1IA5A 2QZAA 1HG8A 1OGMX 3JX8A 1AIRA 3LYCA 3B90A 1OOCA 2J8IA 4YELA 1IB4A 4MXNA 1QA3A 1RU4A 1QJVA 4XR6A 1KQ5A 4YZXA 3AK5A 2VFOA 2UVFA 1OGOX 2BM5A 1O8IA 1O8KA 2VJJA 2QY1A 3VSVA 3GQ7A 3GQ8A 2VBEA 1OFLA 4XN0A 1PLUA 1XG2A 2XT2A 1O8LA 4C2LA 1VBLA 1KCDA 4YCQA 1EZGA 1DBOA 1TYUA 4XM3A 4Z06A 1QRCA 3VMWA 3GQAA 2F3LA 1K8FA 1H80A 4EW9A 4XLEA 3SQVA 4XLHA 4XQFA 3ZSCA 4U4BA 4OJLA 1CZFA 2G0YA 3EQOA 1GQ8A 2VFQA 1QCXA 4YDTA 4YEIA 1X0CA 3ML3A 4XORA 1O8JA 1OFMA 2IQ7A 2J8KA 1PXZA 1IDJA 1JTAA 3B8YA 3LJYA 4XNFA 3GRHA 4YC5A 3JURA 4OPWA 1O8DA 1JRGA 4NK6A 5DNSA 3TH0A 1O8HA 2VFPA 1TYWA 2QXZA 2V5IA 5C1EA 3VSUA 1KTWA 2W7ZA 4HWVA 4NK8A 1O8FA 2YUHA 4AVZA 1QA2A 2BX6A 1BN8A 4XKVA 2BM7A 1TSPA 2NT6A 2UVEA 2PECA 4JRAC 3EQNA 4XMYA 3SYJA 2QYUA 4YEJA 1EE6A 4XONA 1DABA 1RWRA 2NSTA 2VJIA 1HF2A 1OFEA 3N6ZA 2X6WA 4URRA 3SY2A 2VFMA 2XT4A 3VSTA 4OZYA 1QQ1A 3LMWA 4XLFA 3GQ9A 1NHCA 2X85A 1L1IA 4XL9A 2INUA 1LLZA 1KCCA 2PYHA 2NTBA 1RMGA 3DU1X 4OJ5A 4YZ0A 1WMRA 1TYXA 4W8TA 2NSPA 2XTXA 2XTYA 3BH7B 1EA0A 2PYGA 4OM9A 5C1CA 2VFNA 2INVA 5JMCB 1LM1A 2XC1A 1IDKA 4PMHA 4YZAA 2BM6A 4U49A 1K5CA 2X3HA 4XLCA 3H09A 2NTQA 2Z8GA 1OFDA 3BH6B 4OJPA 3B4NA 3N90A 4OZZA 3VMVA 3ZPPA 2B0RA 2O6WA 4XOTA 4W8SA 1LLWA 1WXRA 4I84A 4XOPA 3SZEA 3NB2A 1K4ZA 3PSZA 4KH3A 2EWEA 2ODLA 1O8MA 4OJ6A 4MR0A 3T9GA 4XN3A 4Z03A 4XKWA 1O8GA
chains in the Genus database with same CATH topology
1O88A 3UW0A 1BHEA 1DBGA 4W8RA 2O0VA 4Z05A 3SUCA 2NZMA 2O17A 2O1DA 2X6XA 2VBKA 2BSPA 2VBMA 2X6YA 4XLAA 3WWGA 3FY3A 4W8QA 1O8EA 3KRGA 2QX3A 1PE9A 4YZQA 2O04A 2NT9A 5AMVA 2NTPA 4OJOA 2O0WA 1IA5A 1HG8A 1OGMX 1AIRA 3B90A 1OOCA 4YELA 1IB4A 4MXNA 1RU4A 1QJVA 4XR6A 4YZXA 2UVFA 1OGOX 1O8IA 2VJJA 1O8KA 2QY1A 3VSVA 3GQ7A 3GQ8A 2VBEA 1OFLA 4XN0A 1PLUA 1XG2A 4C2LA 1O8LA 1KCDA 1VBLA 1DBOA 4Z06A 4XM3A 3VMWA 3GQAA 1H80A 4EW9A 4XLEA 4XLHA 4XQFA 3ZSCA 4U4BA 4OJLA 1CZFA 3EQOA 1GQ8A 1QCXA 1X0CA 4XORA 1O8JA 1OFMA 2IQ7A 1PXZA 1IDJA 3B8YA 1JTAA 4XNFA 3GRHA 3JURA 1O8DA 1JRGA 4NK6A 1O8HA 2QXZA 5C1EA 3VSUA 1KTWA 4HWVA 4NK8A 1O8FA 4AVZA 4XKVA 1BN8A 2NT6A 2UVEA 2PECA 3EQNA 4XMYA 4YEJA 1EE6A 4XONA 1RWRA 2NSTA 2VJIA 4URRA 2X6WA 3VSTA 4OZYA 3LMWA 4XLFA 3GQ9A 1NHCA 2X85A 4XL9A 2INUA 1KCCA 2PYHA 2NTBA 1RMGA 4OJ5A 4YZ0A 1WMRA 4W8TA 2NSPA 2PYGA 5C1CA 2INVA 1IDKA 4PMHA 4YZAA 4U49A 1K5CA 2X3HA 4XLCA 2NTQA 2Z8GA 4OJPA 3B4NA 4OZZA 3VMVA 3ZPPA 4XOTA 4W8SA 4I84A 4XOPA 2EWEA 2ODLA 1O8MA 4OJ6A 4MR0A 3T9GA 4XN3A 4Z03A 4XKWA 1O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O88 A;  3UW0 A;  1BHE A;  1DBG A;  4W8R A;  2O0V A;  4Z05 A;  3SUC A;  2NZM A;  2O17 A;  2O1D A;  2X6X A;  2VBK A;  2BSP A;  2VBM A;  2X6Y A;  4XLA A;  3WWG A;  3FY3 A;  4W8Q A;  1O8E A;  3KRG A;  2QX3 A;  1PE9 A;  4YZQ A;  2O04 A;  2NT9 A;  5AMV A;  2NTP A;  4OJO A;  2O0W A;  1IA5 A;  1HG8 A;  1OGM X;  1AIR A;  3B90 A;  1OOC A;  4YEL A;  1IB4 A;  4MXN A;  1RU4 A;  1QJV A;  4XR6 A;  4YZX A;  2UVF A;  1OGO X;  1O8I A;  2VJJ A;  1O8K A;  2QY1 A;  3VSV A;  3GQ7 A;  3GQ8 A;  2VBE A;  1OFL A;  4XN0 A;  1PLU A;  1XG2 A;  4C2L A;  1O8L A;  1KCD A;  1VBL A;  1DBO A;  4Z06 A;  4XM3 A;  3VMW A;  3GQA A;  1H80 A;  4EW9 A;  4XLE A;  4XLH A;  4XQF A;  3ZSC A;  4U4B A;  4OJL A;  1CZF A;  3EQO A;  1GQ8 A;  1QCX A;  1X0C A;  4XOR A;  1O8J A;  1OFM A;  2IQ7 A;  1PXZ A;  1IDJ A;  3B8Y A;  1JTA A;  4XNF A;  3GRH A;  3JUR A;  1O8D A;  1JRG A;  4NK6 A;  1O8H A;  2QXZ A;  5C1E A;  3VSU A;  1KTW A;  4HWV A;  4NK8 A;  1O8F A;  4AVZ A;  4XKV A;  1BN8 A;  2NT6 A;  2UVE A;  2PEC A;  3EQN A;  4XMY A;  4YEJ A;  1EE6 A;  4XON A;  1RWR A;  2NST A;  2VJI A;  4URR A;  2X6W A;  3VST A;  4OZY A;  3LMW A;  4XLF A;  3GQ9 A;  1NHC A;  2X85 A;  4XL9 A;  2INU A;  1KCC A;  2PYH A;  2NTB A;  1RMG A;  4OJ5 A;  4YZ0 A;  1WMR A;  4W8T A;  2NSP A;  2PYG A;  5C1C A;  2INV A;  1IDK A;  4PMH A;  4YZA A;  4U49 A;  1K5C A;  2X3H A;  4XLC A;  2NTQ A;  2Z8G A;  4OJP A;  3B4N A;  4OZZ A;  3VMV A;  3ZPP A;  4XOT A;  4W8S A;  4I84 A;  4XOP A;  2EWE A;  2ODL A;  1O8M A;  4OJ6 A;  4MR0 A;  3T9G A;  4XN3 A;  4Z03 A;  4XKW A;  1O8G A; 
#chains in the Genus database with same CATH topology
 1O88 A;  3UW0 A;  1BHE A;  1DBG A;  1TYV A;  2O0V A;  4W8R A;  4Z05 A;  3SUC A;  2NZM A;  2XTW A;  3PET A;  2O17 A;  2O1D A;  2X6X A;  1QRB A;  3NAW A;  2VBK A;  2BSP A;  2VBM A;  2BM4 A;  2X6Y A;  4XLA A;  3WWG A;  3FY3 A;  4W8Q A;  1O8E A;  3KRG A;  3P4G A;  5JLV C;  1QA1 A;  2QX3 A;  2IOU G;  1PE9 A;  4YZQ A;  2O04 A;  2NT9 A;  3PSS A;  4YFO A;  4V02 C;  5AMV A;  3RIQ A;  1CLW A;  2NTP A;  4OJO A;  2O0W A;  1IA5 A;  2QZA A;  1HG8 A;  1OGM X;  3JX8 A;  1AIR A;  3LYC A;  3B90 A;  1OOC A;  2J8I A;  4YEL A;  1IB4 A;  4MXN A;  1QA3 A;  1RU4 A;  1QJV A;  4XR6 A;  1KQ5 A;  4YZX A;  3AK5 A;  2VFO A;  2UVF A;  1OGO X;  2BM5 A;  1O8I A;  1O8K A;  2VJJ A;  2QY1 A;  3VSV A;  3GQ7 A;  3GQ8 A;  2VBE A;  1OFL A;  4XN0 A;  1PLU A;  1XG2 A;  2XT2 A;  1O8L A;  4C2L A;  1VBL A;  1KCD A;  4YCQ A;  1EZG A;  1DBO A;  1TYU A;  4XM3 A;  4Z06 A;  1QRC A;  3VMW A;  3GQA A;  2F3L A;  1K8F A;  1H80 A;  4EW9 A;  4XLE A;  3SQV A;  4XLH A;  4XQF A;  3ZSC A;  4U4B A;  4OJL A;  1CZF A;  2G0Y A;  3EQO A;  1GQ8 A;  2VFQ A;  1QCX A;  4YDT A;  4YEI A;  1X0C A;  3ML3 A;  4XOR A;  1O8J A;  1OFM A;  2IQ7 A;  2J8K A;  1PXZ A;  1IDJ A;  1JTA A;  3B8Y A;  3LJY A;  4XNF A;  3GRH A;  4YC5 A;  3JUR A;  4OPW A;  1O8D A;  1JRG A;  4NK6 A;  5DNS A;  3TH0 A;  1O8H A;  2VFP A;  1TYW A;  2QXZ A;  2V5I A;  5C1E A;  3VSU A;  1KTW A;  2W7Z A;  4HWV A;  4NK8 A;  1O8F A;  2YUH A;  4AVZ A;  1QA2 A;  2BX6 A;  1BN8 A;  4XKV A;  2BM7 A;  1TSP A;  2NT6 A;  2UVE A;  2PEC A;  4JRA C;  3EQN A;  4XMY A;  3SYJ A;  2QYU A;  4YEJ A;  1EE6 A;  4XON A;  1DAB A;  1RWR A;  2NST A;  2VJI A;  1HF2 A;  1OFE A;  3N6Z A;  2X6W A;  4URR A;  3SY2 A;  2VFM A;  2XT4 A;  3VST A;  4OZY A;  1QQ1 A;  3LMW A;  4XLF A;  3GQ9 A;  1NHC A;  2X85 A;  1L1I A;  4XL9 A;  2INU A;  1LLZ A;  1KCC A;  2PYH A;  2NTB A;  1RMG A;  3DU1 X;  4OJ5 A;  4YZ0 A;  1WMR A;  1TYX A;  4W8T A;  2NSP A;  2XTX A;  2XTY A;  3BH7 B;  1EA0 A;  2PYG A;  4OM9 A;  5C1C A;  2VFN A;  2INV A;  5JMC B;  1LM1 A;  2XC1 A;  1IDK A;  4PMH A;  4YZA A;  2BM6 A;  4U49 A;  1K5C A;  2X3H A;  4XLC A;  3H09 A;  2NTQ A;  2Z8G A;  1OFD A;  3BH6 B;  4OJP A;  3B4N A;  3N90 A;  4OZZ A;  3VMV A;  3ZPP A;  2B0R A;  2O6W A;  4XOT A;  4W8S A;  1LLW A;  1WXR A;  4I84 A;  4XOP A;  3SZE A;  3NB2 A;  1K4Z A;  3PSZ A;  4KH3 A;  2EWE A;  2ODL A;  1O8M A;  4OJ6 A;  4MR0 A;  3T9G A;  4XN3 A;  4Z03 A;  4XKW A;  1O8G A; 
#chains in the Genus database with same CATH homology
 1O88 A;  3UW0 A;  1BHE A;  1DBG A;  4W8R A;  2O0V A;  4Z05 A;  3SUC A;  2NZM A;  2O17 A;  2O1D A;  2X6X A;  2VBK A;  2BSP A;  2VBM A;  2X6Y A;  4XLA A;  3WWG A;  3FY3 A;  4W8Q A;  1O8E A;  3KRG A;  2QX3 A;  1PE9 A;  4YZQ A;  2O04 A;  2NT9 A;  5AMV A;  2NTP A;  4OJO A;  2O0W A;  1IA5 A;  1HG8 A;  1OGM X;  1AIR A;  3B90 A;  1OOC A;  4YEL A;  1IB4 A;  4MXN A;  1RU4 A;  1QJV A;  4XR6 A;  4YZX A;  2UVF A;  1OGO X;  1O8I A;  2VJJ A;  1O8K A;  2QY1 A;  3VSV A;  3GQ7 A;  3GQ8 A;  2VBE A;  1OFL A;  4XN0 A;  1PLU A;  1XG2 A;  4C2L A;  1O8L A;  1KCD A;  1VBL A;  1DBO A;  4Z06 A;  4XM3 A;  3VMW A;  3GQA A;  1H80 A;  4EW9 A;  4XLE A;  4XLH A;  4XQF A;  3ZSC A;  4U4B A;  4OJL A;  1CZF A;  3EQO A;  1GQ8 A;  1QCX A;  1X0C A;  4XOR A;  1O8J A;  1OFM A;  2IQ7 A;  1PXZ A;  1IDJ A;  3B8Y A;  1JTA A;  4XNF A;  3GRH A;  3JUR A;  1O8D A;  1JRG A;  4NK6 A;  1O8H A;  2QXZ A;  5C1E A;  3VSU A;  1KTW A;  4HWV A;  4NK8 A;  1O8F A;  4AVZ A;  4XKV A;  1BN8 A;  2NT6 A;  2UVE A;  2PEC A;  3EQN A;  4XMY A;  4YEJ A;  1EE6 A;  4XON A;  1RWR A;  2NST A;  2VJI A;  4URR A;  2X6W A;  3VST A;  4OZY A;  3LMW A;  4XLF A;  3GQ9 A;  1NHC A;  2X85 A;  4XL9 A;  2INU A;  1KCC A;  2PYH A;  2NTB A;  1RMG A;  4OJ5 A;  4YZ0 A;  1WMR A;  4W8T A;  2NSP A;  2PYG A;  5C1C A;  2INV A;  1IDK A;  4PMH A;  4YZA A;  4U49 A;  1K5C A;  2X3H A;  4XLC A;  2NTQ A;  2Z8G A;  4OJP A;  3B4N A;  4OZZ A;  3VMV A;  3ZPP A;  4XOT A;  4W8S A;  4I84 A;  4XOP A;  2EWE A;  2ODL A;  1O8M A;  4OJ6 A;  4MR0 A;  3T9G A;  4XN3 A;  4Z03 A;  4XKW A;  1O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...