2NTQA

Crystal structure of pectin methylesterase in complex with hexasaccharide vii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2ntqA00
3UW0A 1O8EA 4YEJA 4YZAA 1OGMX 3ZSCA 2NTQA 4YELA 3VSTA 2NSPA 1CZFA 2BSPA 4NK8A 1VBLA 4Z05A 4OJ6A 4W8QA 3GQ8A 2IQ7A 4XLHA 1O8IA 2O0VA 2Z8GA 1IA5A 4OJPA 1IDKA 2UVFA 4XMYA 4OZYA 3EQOA 1GQ8A 3ZPPA 1O8KA 4Z06A 1K5CA 3GQ9A 3VMVA 4AVZA 1QJVA 4YZQA 4XQFA 1PLUA 1HG8A 1PXZA 1O8JA 2NT9A 4I84A 1JTAA 3VSVA 3LMWA 3VMWA 2NTPA 1OFMA 2NT6A 4OJOA 3WWGA 1NHCA 3GQ7A 1DBGA 2VBEA 4OZZA 3EQNA 1IB4A 4XKVA 4XNFA 1O8GA 4C2LA 2O0WA 4MR0A 3GQAA 1O88A 4XOTA 1JRGA 4W8RA 1QCXA 2X85A 2VJJA 4OJ5A 1H80A 5AMVA 1PE9A 2ODLA 2QX3A 4W8TA 1KCCA 1RWRA 1IDJA 2O1DA 3KRGA 1O8LA 3VSUA 1OOCA 1RU4A 2VBKA 4XN0A 2X3HA 2PECA 2PYHA 1KCDA 4Z03A 4XM3A 2INUA 1RMGA 2O17A 3B4NA 3B90A 2NTBA 3B8YA 1XG2A 4XLAA 4XR6A 1O8FA 1AIRA 4XLFA 4OJLA 4U4BA 5C1EA 3SUCA 1OFLA 4MXNA 1OGOX 4URRA 2INVA 4YZXA 4NK6A 2NSTA 4YZ0A 1O8MA 2NZMA 2QY1A 1DBOA 4XN3A 4XONA 3JURA 1EE6A 3GRHA 4XLEA 1KTWA 4XORA 4PMHA 3T9GA 4W8SA 2X6WA 2X6XA 2EWEA 1BHEA 4EW9A 3FY3A 2X6YA 5C1CA 4XKWA 4XLCA 4XOPA 4HWVA 4U49A 2PYGA 1WMRA 1BN8A 2UVEA 2VBMA 2VJIA 4XL9A 1O8HA 2QXZA 2O04A 1X0CA 1O8DA
chains in the Genus database with same CATH superfamily
2O6WA 3P4GA 2XT2A 3UW0A 3SY2A 3N6ZA 1O8EA 4YEJA 4YZAA 1OGMX 3LYCA 2NTQA 1QRCA 2F3LA 4YELA 3VSTA 3ZSCA 2NSPA 3N90A 3BH6B 2XC1A 3NB2A 1CZFA 2BSPA 4NK8A 1TYUA 1VBLA 4OJ6A 4Z05A 4W8QA 3GQ8A 2IQ7A 3RIQA 2YUHA 4XLHA 1K4ZA 1TYWA 4YEIA 1QA1A 1O8IA 2O0VA 2Z8GA 1IA5A 4OJPA 1IDKA 2UVFA 1WXRA 1DABA 4XMYA 4OZYA 3EQOA 1GQ8A 3ZPPA 1O8KA 4Z06A 1K5CA 3GQ9A 3VMVA 4AVZA 1LM1A 3TH0A 3ML3A 3SZEA 1QJVA 1LLZA 3JX8A 2W7ZA 4YZQA 1PLUA 1HG8A 1PXZA 1O8JA 2NT9A 4I84A 1JTAA 4OM9A 3VSVA 3LMWA 3VMWA 4V02C 1QA2A 2BX6A 2NTPA 3SQVA 1OFMA 1TSPA 2NT6A 2V5IA 3H09A 4OJOA 3WWGA 1QA3A 2QZAA 1NHCA 3GQ7A 1DBGA 2VBEA 1K8FA 3EQNA 4OZZA 1IB4A 4XKVA 4XNFA 1O8GA 2VFMA 4C2LA 2O0WA 4MR0A 3GQAA 2BM6A 3AK5A 1O88A 2BM7A 4XOTA 5JMCB 1JRGA 3PSZA 4W8RA 1QCXA 5DNSA 2X85A 2VJJA 4OJ5A 1H80A 1TYVA 1PE9A 2ODLA 5AMVA 2QX3A 1QRBA 2BM4A 4W8TA 4YDTA 1KCCA 1RWRA 3BH7B 1IDJA 2XTYA 3PSSA 4YC5A 2VFOA 2O1DA 3KRGA 1KQ5A 1O8LA 3NAWA 5JLVC 3VSUA 1OOCA 4OPWA 1RU4A 2VBKA 1CLWA 2VFQA 2X3HA 2PECA 4XN0A 2PYHA 1KCDA 4JRAC 4Z03A 2B0RA 4XM3A 2INUA 1RMGA 1QQ1A 2O17A 3B4NA 3B90A 2NTBA 2VFNA 3B8YA 1XG2A 4XLAA 3LJYA 4XR6A 1O8FA 1AIRA 4XLFA 4OJLA 4U4BA 1LLWA 5C1EA 1OFLA 4MXNA 3SUCA 3SYJA 1OGOX 4XQFA 4URRA 2INVA 4YZXA 4KH3A 4YCQA 1TYXA 4NK6A 2NSTA 4YZ0A 1O8MA 2NZMA 2QY1A 1DBOA 2BM5A 2XT4A 3JURA 4XN3A 4XONA 1HF2A 1EE6A 3GRHA 4XLEA 2VFPA 1KTWA 4XORA 4PMHA 1EA0A 3T9GA 4W8SA 2X6WA 2J8IA 2XTXA 1OFEA 2G0YA 2X6XA 2EWEA 1BHEA 4EW9A 2IOUG 3FY3A 2X6YA 5C1CA 4XKWA 1L1IA 4XLCA 4XOPA 4HWVA 4U49A 2PYGA 2XTWA 1WMRA 1EZGA 1BN8A 2UVEA 2VBMA 2VJIA 4XL9A 1OFDA 4YFOA 1O8HA 2QYUA 2QXZA 2J8KA 2O04A 3PETA 1X0CA 3DU1X 1O8DA
chains in the Genus database with same CATH topology
3UW0A 1O8EA 4YEJA 4YZAA 1OGMX 3ZSCA 2NTQA 4YELA 3VSTA 2NSPA 1CZFA 2BSPA 4NK8A 1VBLA 4Z05A 4OJ6A 4W8QA 3GQ8A 2IQ7A 4XLHA 1O8IA 2O0VA 2Z8GA 1IA5A 4OJPA 1IDKA 2UVFA 4XMYA 4OZYA 3EQOA 1GQ8A 3ZPPA 1O8KA 4Z06A 1K5CA 3GQ9A 3VMVA 4AVZA 1QJVA 4YZQA 4XQFA 1PLUA 1HG8A 1PXZA 1O8JA 2NT9A 4I84A 1JTAA 3VSVA 3LMWA 3VMWA 2NTPA 1OFMA 2NT6A 4OJOA 3WWGA 1NHCA 3GQ7A 1DBGA 2VBEA 4OZZA 3EQNA 1IB4A 4XKVA 4XNFA 1O8GA 4C2LA 2O0WA 4MR0A 3GQAA 1O88A 4XOTA 1JRGA 4W8RA 1QCXA 2X85A 2VJJA 4OJ5A 1H80A 5AMVA 1PE9A 2ODLA 2QX3A 4W8TA 1KCCA 1RWRA 1IDJA 2O1DA 3KRGA 1O8LA 3VSUA 1OOCA 1RU4A 2VBKA 4XN0A 2X3HA 2PECA 2PYHA 1KCDA 4Z03A 4XM3A 2INUA 1RMGA 2O17A 3B4NA 3B90A 2NTBA 3B8YA 1XG2A 4XLAA 4XR6A 1O8FA 1AIRA 4XLFA 4OJLA 4U4BA 5C1EA 3SUCA 1OFLA 4MXNA 1OGOX 4URRA 2INVA 4YZXA 4NK6A 2NSTA 4YZ0A 1O8MA 2NZMA 2QY1A 1DBOA 4XN3A 4XONA 3JURA 1EE6A 3GRHA 4XLEA 1KTWA 4XORA 4PMHA 3T9GA 4W8SA 2X6WA 2X6XA 2EWEA 1BHEA 4EW9A 3FY3A 2X6YA 5C1CA 4XKWA 4XLCA 4XOPA 4HWVA 4U49A 2PYGA 1WMRA 1BN8A 2UVEA 2VBMA 2VJIA 4XL9A 1O8HA 2QXZA 2O04A 1X0CA 1O8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UW0 A;  1O8E A;  4YEJ A;  4YZA A;  1OGM X;  3ZSC A;  2NTQ A;  4YEL A;  3VST A;  2NSP A;  1CZF A;  2BSP A;  4NK8 A;  1VBL A;  4Z05 A;  4OJ6 A;  4W8Q A;  3GQ8 A;  2IQ7 A;  4XLH A;  1O8I A;  2O0V A;  2Z8G A;  1IA5 A;  4OJP A;  1IDK A;  2UVF A;  4XMY A;  4OZY A;  3EQO A;  1GQ8 A;  3ZPP A;  1O8K A;  4Z06 A;  1K5C A;  3GQ9 A;  3VMV A;  4AVZ A;  1QJV A;  4YZQ A;  4XQF A;  1PLU A;  1HG8 A;  1PXZ A;  1O8J A;  2NT9 A;  4I84 A;  1JTA A;  3VSV A;  3LMW A;  3VMW A;  2NTP A;  1OFM A;  2NT6 A;  4OJO A;  3WWG A;  1NHC A;  3GQ7 A;  1DBG A;  2VBE A;  4OZZ A;  3EQN A;  1IB4 A;  4XKV A;  4XNF A;  1O8G A;  4C2L A;  2O0W A;  4MR0 A;  3GQA A;  1O88 A;  4XOT A;  1JRG A;  4W8R A;  1QCX A;  2X85 A;  2VJJ A;  4OJ5 A;  1H80 A;  5AMV A;  1PE9 A;  2ODL A;  2QX3 A;  4W8T A;  1KCC A;  1RWR A;  1IDJ A;  2O1D A;  3KRG A;  1O8L A;  3VSU A;  1OOC A;  1RU4 A;  2VBK A;  4XN0 A;  2X3H A;  2PEC A;  2PYH A;  1KCD A;  4Z03 A;  4XM3 A;  2INU A;  1RMG A;  2O17 A;  3B4N A;  3B90 A;  2NTB A;  3B8Y A;  1XG2 A;  4XLA A;  4XR6 A;  1O8F A;  1AIR A;  4XLF A;  4OJL A;  4U4B A;  5C1E A;  3SUC A;  1OFL A;  4MXN A;  1OGO X;  4URR A;  2INV A;  4YZX A;  4NK6 A;  2NST A;  4YZ0 A;  1O8M A;  2NZM A;  2QY1 A;  1DBO A;  4XN3 A;  4XON A;  3JUR A;  1EE6 A;  3GRH A;  4XLE A;  1KTW A;  4XOR A;  4PMH A;  3T9G A;  4W8S A;  2X6W A;  2X6X A;  2EWE A;  1BHE A;  4EW9 A;  3FY3 A;  2X6Y A;  5C1C A;  4XKW A;  4XLC A;  4XOP A;  4HWV A;  4U49 A;  2PYG A;  1WMR A;  1BN8 A;  2UVE A;  2VBM A;  2VJI A;  4XL9 A;  1O8H A;  2QXZ A;  2O04 A;  1X0C A;  1O8D A; 
#chains in the Genus database with same CATH topology
 2O6W A;  3P4G A;  2XT2 A;  3UW0 A;  3SY2 A;  3N6Z A;  1O8E A;  4YEJ A;  4YZA A;  1OGM X;  3LYC A;  2NTQ A;  1QRC A;  2F3L A;  4YEL A;  3VST A;  3ZSC A;  2NSP A;  3N90 A;  3BH6 B;  2XC1 A;  3NB2 A;  1CZF A;  2BSP A;  4NK8 A;  1TYU A;  1VBL A;  4OJ6 A;  4Z05 A;  4W8Q A;  3GQ8 A;  2IQ7 A;  3RIQ A;  2YUH A;  4XLH A;  1K4Z A;  1TYW A;  4YEI A;  1QA1 A;  1O8I A;  2O0V A;  2Z8G A;  1IA5 A;  4OJP A;  1IDK A;  2UVF A;  1WXR A;  1DAB A;  4XMY A;  4OZY A;  3EQO A;  1GQ8 A;  3ZPP A;  1O8K A;  4Z06 A;  1K5C A;  3GQ9 A;  3VMV A;  4AVZ A;  1LM1 A;  3TH0 A;  3ML3 A;  3SZE A;  1QJV A;  1LLZ A;  3JX8 A;  2W7Z A;  4YZQ A;  1PLU A;  1HG8 A;  1PXZ A;  1O8J A;  2NT9 A;  4I84 A;  1JTA A;  4OM9 A;  3VSV A;  3LMW A;  3VMW A;  4V02 C;  1QA2 A;  2BX6 A;  2NTP A;  3SQV A;  1OFM A;  1TSP A;  2NT6 A;  2V5I A;  3H09 A;  4OJO A;  3WWG A;  1QA3 A;  2QZA A;  1NHC A;  3GQ7 A;  1DBG A;  2VBE A;  1K8F A;  3EQN A;  4OZZ A;  1IB4 A;  4XKV A;  4XNF A;  1O8G A;  2VFM A;  4C2L A;  2O0W A;  4MR0 A;  3GQA A;  2BM6 A;  3AK5 A;  1O88 A;  2BM7 A;  4XOT A;  5JMC B;  1JRG A;  3PSZ A;  4W8R A;  1QCX A;  5DNS A;  2X85 A;  2VJJ A;  4OJ5 A;  1H80 A;  1TYV A;  1PE9 A;  2ODL A;  5AMV A;  2QX3 A;  1QRB A;  2BM4 A;  4W8T A;  4YDT A;  1KCC A;  1RWR A;  3BH7 B;  1IDJ A;  2XTY A;  3PSS A;  4YC5 A;  2VFO A;  2O1D A;  3KRG A;  1KQ5 A;  1O8L A;  3NAW A;  5JLV C;  3VSU A;  1OOC A;  4OPW A;  1RU4 A;  2VBK A;  1CLW A;  2VFQ A;  2X3H A;  2PEC A;  4XN0 A;  2PYH A;  1KCD A;  4JRA C;  4Z03 A;  2B0R A;  4XM3 A;  2INU A;  1RMG A;  1QQ1 A;  2O17 A;  3B4N A;  3B90 A;  2NTB A;  2VFN A;  3B8Y A;  1XG2 A;  4XLA A;  3LJY A;  4XR6 A;  1O8F A;  1AIR A;  4XLF A;  4OJL A;  4U4B A;  1LLW A;  5C1E A;  1OFL A;  4MXN A;  3SUC A;  3SYJ A;  1OGO X;  4XQF A;  4URR A;  2INV A;  4YZX A;  4KH3 A;  4YCQ A;  1TYX A;  4NK6 A;  2NST A;  4YZ0 A;  1O8M A;  2NZM A;  2QY1 A;  1DBO A;  2BM5 A;  2XT4 A;  3JUR A;  4XN3 A;  4XON A;  1HF2 A;  1EE6 A;  3GRH A;  4XLE A;  2VFP A;  1KTW A;  4XOR A;  4PMH A;  1EA0 A;  3T9G A;  4W8S A;  2X6W A;  2J8I A;  2XTX A;  1OFE A;  2G0Y A;  2X6X A;  2EWE A;  1BHE A;  4EW9 A;  2IOU G;  3FY3 A;  2X6Y A;  5C1C A;  4XKW A;  1L1I A;  4XLC A;  4XOP A;  4HWV A;  4U49 A;  2PYG A;  2XTW A;  1WMR A;  1EZG A;  1BN8 A;  2UVE A;  2VBM A;  2VJI A;  4XL9 A;  1OFD A;  4YFO A;  1O8H A;  2QYU A;  2QXZ A;  2J8K A;  2O04 A;  3PET A;  1X0C A;  3DU1 X;  1O8D A; 
#chains in the Genus database with same CATH homology
 3UW0 A;  1O8E A;  4YEJ A;  4YZA A;  1OGM X;  3ZSC A;  2NTQ A;  4YEL A;  3VST A;  2NSP A;  1CZF A;  2BSP A;  4NK8 A;  1VBL A;  4Z05 A;  4OJ6 A;  4W8Q A;  3GQ8 A;  2IQ7 A;  4XLH A;  1O8I A;  2O0V A;  2Z8G A;  1IA5 A;  4OJP A;  1IDK A;  2UVF A;  4XMY A;  4OZY A;  3EQO A;  1GQ8 A;  3ZPP A;  1O8K A;  4Z06 A;  1K5C A;  3GQ9 A;  3VMV A;  4AVZ A;  1QJV A;  4YZQ A;  4XQF A;  1PLU A;  1HG8 A;  1PXZ A;  1O8J A;  2NT9 A;  4I84 A;  1JTA A;  3VSV A;  3LMW A;  3VMW A;  2NTP A;  1OFM A;  2NT6 A;  4OJO A;  3WWG A;  1NHC A;  3GQ7 A;  1DBG A;  2VBE A;  4OZZ A;  3EQN A;  1IB4 A;  4XKV A;  4XNF A;  1O8G A;  4C2L A;  2O0W A;  4MR0 A;  3GQA A;  1O88 A;  4XOT A;  1JRG A;  4W8R A;  1QCX A;  2X85 A;  2VJJ A;  4OJ5 A;  1H80 A;  5AMV A;  1PE9 A;  2ODL A;  2QX3 A;  4W8T A;  1KCC A;  1RWR A;  1IDJ A;  2O1D A;  3KRG A;  1O8L A;  3VSU A;  1OOC A;  1RU4 A;  2VBK A;  4XN0 A;  2X3H A;  2PEC A;  2PYH A;  1KCD A;  4Z03 A;  4XM3 A;  2INU A;  1RMG A;  2O17 A;  3B4N A;  3B90 A;  2NTB A;  3B8Y A;  1XG2 A;  4XLA A;  4XR6 A;  1O8F A;  1AIR A;  4XLF A;  4OJL A;  4U4B A;  5C1E A;  3SUC A;  1OFL A;  4MXN A;  1OGO X;  4URR A;  2INV A;  4YZX A;  4NK6 A;  2NST A;  4YZ0 A;  1O8M A;  2NZM A;  2QY1 A;  1DBO A;  4XN3 A;  4XON A;  3JUR A;  1EE6 A;  3GRH A;  4XLE A;  1KTW A;  4XOR A;  4PMH A;  3T9G A;  4W8S A;  2X6W A;  2X6X A;  2EWE A;  1BHE A;  4EW9 A;  3FY3 A;  2X6Y A;  5C1C A;  4XKW A;  4XLC A;  4XOP A;  4HWV A;  4U49 A;  2PYG A;  1WMR A;  1BN8 A;  2UVE A;  2VBM A;  2VJI A;  4XL9 A;  1O8H A;  2QXZ A;  2O04 A;  1X0C A;  1O8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...