2NTQA

Crystal structure of pectin methylesterase in complex with hexasaccharide vii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords Pectinesterase A
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2ntqA00
4U4BA 2BSPA 2X6XA 4OZYA 4XONA 4XN0A 4NK8A 2O0VA 2VBMA 3KRGA 2UVEA 4MXNA 3GRHA 1IA5A 2X3HA 2VJIA 3VSVA 4XM3A 3VSUA 4XLEA 1KTWA 1JTAA 1NHCA 4XKWA 3VSTA 4Z06A 4EW9A 1XG2A 4OJPA 1RMGA 4URRA 4XLFA 1O88A 4AVZA 4Z03A 1BHEA 4YZ0A 1OOCA 3GQ7A 4OZZA 2X6YA 4XOPA 4YEJA 1O8IA 3GQ9A 1JRGA 1QJVA 1O8LA 4XKVA 4MR0A 4XNFA 4OJOA 2O0WA 2QXZA 2O04A 1DBOA 3B4NA 2QX3A 1EE6A 1OFLA 1PLUA 4YELA 1IB4A 2PYHA 2O1DA 2UVFA 4XQFA 1PE9A 2EWEA 3SUCA 4PMHA 2X6WA 4NK6A 4W8QA 4OJ6A 1O8HA 4XR6A 2NZMA 4HWVA 2INVA 4YZXA 2NTBA 1OGMX 2X85A 2NSTA 1RWRA 2VBEA 4XORA 3ZSCA 1O8JA 4W8TA 1VBLA 4W8SA 1RU4A 2VJJA 1OGOX 1BN8A 3GQAA 4YZQA 1O8GA 2QY1A 1KCDA 2ODLA 1O8KA 2PECA 2NT9A 4W8RA 2NSPA 1QCXA 1OFMA 2Z8GA 3LMWA 4XLCA 4I84A 4OJLA 5AMVA 1IDKA 2NTQA 1HG8A 4XLAA 5C1EA 3ZPPA 1O8DA 1H80A 3VMWA 1GQ8A 3UW0A 1K5CA 1O8MA 3WWGA 1X0CA 3EQNA 2O17A 4Z05A 3GQ8A 4XOTA 1AIRA 4U49A 2IQ7A 3EQOA 3B8YA 2NT6A 4XN3A 4XL9A 2NTPA 3T9GA 3FY3A 2PYGA 1KCCA 1IDJA 5C1CA 4C2LA 3B90A 1PXZA 2INUA 1O8FA 1DBGA 1WMRA 4OJ5A 4XMYA 4YZAA 4XLHA 3VMVA 2VBKA 1CZFA 3JURA 1O8EA
chains in the Genus database with same CATH superfamily
4U4BA 2BSPA 2X6XA 4OZYA 3BH7B 3H09A 4XONA 4YC5A 2J8KA 3NAWA 4XN0A 4NK8A 2O0VA 2VBMA 2XT2A 3KRGA 2UVEA 4MXNA 3GRHA 1IA5A 2X3HA 3SY2A 2QYUA 2VJIA 2XTXA 4YCQA 3NB2A 3VSVA 1HF2A 1TSPA 2BM4A 1DABA 4XM3A 3VSUA 4XLEA 1KTWA 1JTAA 3TH0A 1TYWA 1NHCA 1CLWA 4XKWA 3VSTA 3P4GA 1QA3A 4Z06A 4EW9A 2XTYA 1XG2A 1EA0A 4OJPA 1RMGA 1EZGA 2V5IA 4JRAC 4URRA 4XLFA 1K8FA 1O88A 4AVZA 3AK5A 4Z03A 1BHEA 2XTWA 4YZ0A 5JMCB 2B0RA 1OOCA 3GQ7A 4OZZA 2X6YA 1OFDA 2XT4A 4XOPA 1LLWA 4YEJA 1QQ1A 5DNSA 1O8IA 3GQ9A 1JRGA 3LYCA 2W7ZA 1QJVA 1O8LA 4XKVA 4MR0A 4XNFA 4OJOA 2O0WA 2QXZA 2O04A 4KH3A 4YEIA 3PSSA 1DBOA 2XC1A 2IOUG 3B4NA 2QX3A 1EE6A 1OFLA 1PLUA 4YELA 1IB4A 1QA2A 2PYHA 2O1DA 2UVFA 4XQFA 1PE9A 1KQ5A 2EWEA 3DU1X 4PMHA 3SUCA 2X6WA 4NK6A 3N6ZA 4W8QA 4OJ6A 1O8HA 4XR6A 2NZMA 3ML3A 4HWVA 2INVA 2J8IA 4YZXA 1QA1A 2NTBA 3PSZA 1OGMX 1WXRA 2X85A 2NSTA 1RWRA 2VBEA 4V02C 4XORA 1O8JA 3SQVA 3ZSCA 1K4ZA 4W8TA 1VBLA 4W8SA 2VFPA 1RU4A 3RIQA 2VJJA 1OGOX 1BN8A 3GQAA 1QRBA 4YZQA 1O8GA 2QY1A 1KCDA 2QZAA 2ODLA 1O8KA 2PECA 3SZEA 3N90A 4YFOA 2NT9A 4W8RA 2NSPA 1QCXA 1OFMA 2BM6A 2Z8GA 3LMWA 4XLCA 4I84A 1TYUA 4OJLA 1QRCA 2BX6A 1IDKA 2F3LA 1HG8A 2NTQA 3JX8A 4XLAA 5AMVA 5C1EA 3ZPPA 1O8DA 2VFMA 1H80A 3SYJA 1GQ8A 1TYXA 2YUHA 3VMWA 2VFQA 3UW0A 1K5CA 1O8MA 3WWGA 1LLZA 1X0CA 3EQNA 2O17A 4Z05A 3GQ8A 3LJYA 4XOTA 2G0YA 1AIRA 4U49A 2IQ7A 3EQOA 3B8YA 2NT6A 4XN3A 4XL9A 2NTPA 3T9GA 2O6WA 2BM7A 4OM9A 3FY3A 2PYGA 1TYVA 1IDJA 5C1CA 1KCCA 2BM5A 1OFEA 4C2LA 4YDTA 3B90A 2INUA 1PXZA 1O8FA 1DBGA 1WMRA 2VFOA 3PETA 4OJ5A 4XMYA 1L1IA 4YZAA 2VFNA 1LM1A 4OPWA 4XLHA 3VMVA 2VBKA 5JLVC 1CZFA 3BH6B 3JURA 1O8EA
chains in the Genus database with same CATH topology
4U4BA 2BSPA 2X6XA 4OZYA 4XONA 4XN0A 4NK8A 2O0VA 2VBMA 3KRGA 2UVEA 4MXNA 3GRHA 1IA5A 2X3HA 2VJIA 3VSVA 4XM3A 3VSUA 4XLEA 1KTWA 1JTAA 1NHCA 4XKWA 3VSTA 4Z06A 4EW9A 1XG2A 4OJPA 1RMGA 4URRA 4XLFA 1O88A 4AVZA 4Z03A 1BHEA 4YZ0A 1OOCA 3GQ7A 4OZZA 2X6YA 4XOPA 4YEJA 1O8IA 3GQ9A 1JRGA 1QJVA 1O8LA 4XKVA 4MR0A 4XNFA 4OJOA 2O0WA 2QXZA 2O04A 1DBOA 3B4NA 2QX3A 1EE6A 1OFLA 1PLUA 4YELA 1IB4A 2PYHA 2O1DA 2UVFA 4XQFA 1PE9A 2EWEA 3SUCA 4PMHA 2X6WA 4NK6A 4W8QA 4OJ6A 1O8HA 4XR6A 2NZMA 4HWVA 2INVA 4YZXA 2NTBA 1OGMX 2X85A 2NSTA 1RWRA 2VBEA 4XORA 3ZSCA 1O8JA 4W8TA 1VBLA 4W8SA 1RU4A 2VJJA 1OGOX 1BN8A 3GQAA 4YZQA 1O8GA 2QY1A 1KCDA 2ODLA 1O8KA 2PECA 2NT9A 4W8RA 2NSPA 1QCXA 1OFMA 2Z8GA 3LMWA 4XLCA 4I84A 4OJLA 5AMVA 1IDKA 2NTQA 1HG8A 4XLAA 5C1EA 3ZPPA 1O8DA 1H80A 3VMWA 1GQ8A 3UW0A 1K5CA 1O8MA 3WWGA 1X0CA 3EQNA 2O17A 4Z05A 3GQ8A 4XOTA 1AIRA 4U49A 2IQ7A 3EQOA 3B8YA 2NT6A 4XN3A 4XL9A 2NTPA 3T9GA 3FY3A 2PYGA 1KCCA 1IDJA 5C1CA 4C2LA 3B90A 1PXZA 2INUA 1O8FA 1DBGA 1WMRA 4OJ5A 4XMYA 4YZAA 4XLHA 3VMVA 2VBKA 1CZFA 3JURA 1O8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U4B A;  2BSP A;  2X6X A;  4OZY A;  4XON A;  4XN0 A;  4NK8 A;  2O0V A;  2VBM A;  3KRG A;  2UVE A;  4MXN A;  3GRH A;  1IA5 A;  2X3H A;  2VJI A;  3VSV A;  4XM3 A;  3VSU A;  4XLE A;  1KTW A;  1JTA A;  1NHC A;  4XKW A;  3VST A;  4Z06 A;  4EW9 A;  1XG2 A;  4OJP A;  1RMG A;  4URR A;  4XLF A;  1O88 A;  4AVZ A;  4Z03 A;  1BHE A;  4YZ0 A;  1OOC A;  3GQ7 A;  4OZZ A;  2X6Y A;  4XOP A;  4YEJ A;  1O8I A;  3GQ9 A;  1JRG A;  1QJV A;  1O8L A;  4XKV A;  4MR0 A;  4XNF A;  4OJO A;  2O0W A;  2QXZ A;  2O04 A;  1DBO A;  3B4N A;  2QX3 A;  1EE6 A;  1OFL A;  1PLU A;  4YEL A;  1IB4 A;  2PYH A;  2O1D A;  2UVF A;  4XQF A;  1PE9 A;  2EWE A;  3SUC A;  4PMH A;  2X6W A;  4NK6 A;  4W8Q A;  4OJ6 A;  1O8H A;  4XR6 A;  2NZM A;  4HWV A;  2INV A;  4YZX A;  2NTB A;  1OGM X;  2X85 A;  2NST A;  1RWR A;  2VBE A;  4XOR A;  3ZSC A;  1O8J A;  4W8T A;  1VBL A;  4W8S A;  1RU4 A;  2VJJ A;  1OGO X;  1BN8 A;  3GQA A;  4YZQ A;  1O8G A;  2QY1 A;  1KCD A;  2ODL A;  1O8K A;  2PEC A;  2NT9 A;  4W8R A;  2NSP A;  1QCX A;  1OFM A;  2Z8G A;  3LMW A;  4XLC A;  4I84 A;  4OJL A;  5AMV A;  1IDK A;  2NTQ A;  1HG8 A;  4XLA A;  5C1E A;  3ZPP A;  1O8D A;  1H80 A;  3VMW A;  1GQ8 A;  3UW0 A;  1K5C A;  1O8M A;  3WWG A;  1X0C A;  3EQN A;  2O17 A;  4Z05 A;  3GQ8 A;  4XOT A;  1AIR A;  4U49 A;  2IQ7 A;  3EQO A;  3B8Y A;  2NT6 A;  4XN3 A;  4XL9 A;  2NTP A;  3T9G A;  3FY3 A;  2PYG A;  1KCC A;  1IDJ A;  5C1C A;  4C2L A;  3B90 A;  1PXZ A;  2INU A;  1O8F A;  1DBG A;  1WMR A;  4OJ5 A;  4XMY A;  4YZA A;  4XLH A;  3VMV A;  2VBK A;  1CZF A;  3JUR A;  1O8E A; 
#chains in the Genus database with same CATH topology
 4U4B A;  2BSP A;  2X6X A;  4OZY A;  3BH7 B;  3H09 A;  4XON A;  4YC5 A;  2J8K A;  3NAW A;  4XN0 A;  4NK8 A;  2O0V A;  2VBM A;  2XT2 A;  3KRG A;  2UVE A;  4MXN A;  3GRH A;  1IA5 A;  2X3H A;  3SY2 A;  2QYU A;  2VJI A;  2XTX A;  4YCQ A;  3NB2 A;  3VSV A;  1HF2 A;  1TSP A;  2BM4 A;  1DAB A;  4XM3 A;  3VSU A;  4XLE A;  1KTW A;  1JTA A;  3TH0 A;  1TYW A;  1NHC A;  1CLW A;  4XKW A;  3VST A;  3P4G A;  1QA3 A;  4Z06 A;  4EW9 A;  2XTY A;  1XG2 A;  1EA0 A;  4OJP A;  1RMG A;  1EZG A;  2V5I A;  4JRA C;  4URR A;  4XLF A;  1K8F A;  1O88 A;  4AVZ A;  3AK5 A;  4Z03 A;  1BHE A;  2XTW A;  4YZ0 A;  5JMC B;  2B0R A;  1OOC A;  3GQ7 A;  4OZZ A;  2X6Y A;  1OFD A;  2XT4 A;  4XOP A;  1LLW A;  4YEJ A;  1QQ1 A;  5DNS A;  1O8I A;  3GQ9 A;  1JRG A;  3LYC A;  2W7Z A;  1QJV A;  1O8L A;  4XKV A;  4MR0 A;  4XNF A;  4OJO A;  2O0W A;  2QXZ A;  2O04 A;  4KH3 A;  4YEI A;  3PSS A;  1DBO A;  2XC1 A;  2IOU G;  3B4N A;  2QX3 A;  1EE6 A;  1OFL A;  1PLU A;  4YEL A;  1IB4 A;  1QA2 A;  2PYH A;  2O1D A;  2UVF A;  4XQF A;  1PE9 A;  1KQ5 A;  2EWE A;  3DU1 X;  4PMH A;  3SUC A;  2X6W A;  4NK6 A;  3N6Z A;  4W8Q A;  4OJ6 A;  1O8H A;  4XR6 A;  2NZM A;  3ML3 A;  4HWV A;  2INV A;  2J8I A;  4YZX A;  1QA1 A;  2NTB A;  3PSZ A;  1OGM X;  1WXR A;  2X85 A;  2NST A;  1RWR A;  2VBE A;  4V02 C;  4XOR A;  1O8J A;  3SQV A;  3ZSC A;  1K4Z A;  4W8T A;  1VBL A;  4W8S A;  2VFP A;  1RU4 A;  3RIQ A;  2VJJ A;  1OGO X;  1BN8 A;  3GQA A;  1QRB A;  4YZQ A;  1O8G A;  2QY1 A;  1KCD A;  2QZA A;  2ODL A;  1O8K A;  2PEC A;  3SZE A;  3N90 A;  4YFO A;  2NT9 A;  4W8R A;  2NSP A;  1QCX A;  1OFM A;  2BM6 A;  2Z8G A;  3LMW A;  4XLC A;  4I84 A;  1TYU A;  4OJL A;  1QRC A;  2BX6 A;  1IDK A;  2F3L A;  1HG8 A;  2NTQ A;  3JX8 A;  4XLA A;  5AMV A;  5C1E A;  3ZPP A;  1O8D A;  2VFM A;  1H80 A;  3SYJ A;  1GQ8 A;  1TYX A;  2YUH A;  3VMW A;  2VFQ A;  3UW0 A;  1K5C A;  1O8M A;  3WWG A;  1LLZ A;  1X0C A;  3EQN A;  2O17 A;  4Z05 A;  3GQ8 A;  3LJY A;  4XOT A;  2G0Y A;  1AIR A;  4U49 A;  2IQ7 A;  3EQO A;  3B8Y A;  2NT6 A;  4XN3 A;  4XL9 A;  2NTP A;  3T9G A;  2O6W A;  2BM7 A;  4OM9 A;  3FY3 A;  2PYG A;  1TYV A;  1IDJ A;  5C1C A;  1KCC A;  2BM5 A;  1OFE A;  4C2L A;  4YDT A;  3B90 A;  2INU A;  1PXZ A;  1O8F A;  1DBG A;  1WMR A;  2VFO A;  3PET A;  4OJ5 A;  4XMY A;  1L1I A;  4YZA A;  2VFN A;  1LM1 A;  4OPW A;  4XLH A;  3VMV A;  2VBK A;  5JLV C;  1CZF A;  3BH6 B;  3JUR A;  1O8E A; 
#chains in the Genus database with same CATH homology
 4U4B A;  2BSP A;  2X6X A;  4OZY A;  4XON A;  4XN0 A;  4NK8 A;  2O0V A;  2VBM A;  3KRG A;  2UVE A;  4MXN A;  3GRH A;  1IA5 A;  2X3H A;  2VJI A;  3VSV A;  4XM3 A;  3VSU A;  4XLE A;  1KTW A;  1JTA A;  1NHC A;  4XKW A;  3VST A;  4Z06 A;  4EW9 A;  1XG2 A;  4OJP A;  1RMG A;  4URR A;  4XLF A;  1O88 A;  4AVZ A;  4Z03 A;  1BHE A;  4YZ0 A;  1OOC A;  3GQ7 A;  4OZZ A;  2X6Y A;  4XOP A;  4YEJ A;  1O8I A;  3GQ9 A;  1JRG A;  1QJV A;  1O8L A;  4XKV A;  4MR0 A;  4XNF A;  4OJO A;  2O0W A;  2QXZ A;  2O04 A;  1DBO A;  3B4N A;  2QX3 A;  1EE6 A;  1OFL A;  1PLU A;  4YEL A;  1IB4 A;  2PYH A;  2O1D A;  2UVF A;  4XQF A;  1PE9 A;  2EWE A;  3SUC A;  4PMH A;  2X6W A;  4NK6 A;  4W8Q A;  4OJ6 A;  1O8H A;  4XR6 A;  2NZM A;  4HWV A;  2INV A;  4YZX A;  2NTB A;  1OGM X;  2X85 A;  2NST A;  1RWR A;  2VBE A;  4XOR A;  3ZSC A;  1O8J A;  4W8T A;  1VBL A;  4W8S A;  1RU4 A;  2VJJ A;  1OGO X;  1BN8 A;  3GQA A;  4YZQ A;  1O8G A;  2QY1 A;  1KCD A;  2ODL A;  1O8K A;  2PEC A;  2NT9 A;  4W8R A;  2NSP A;  1QCX A;  1OFM A;  2Z8G A;  3LMW A;  4XLC A;  4I84 A;  4OJL A;  5AMV A;  1IDK A;  2NTQ A;  1HG8 A;  4XLA A;  5C1E A;  3ZPP A;  1O8D A;  1H80 A;  3VMW A;  1GQ8 A;  3UW0 A;  1K5C A;  1O8M A;  3WWG A;  1X0C A;  3EQN A;  2O17 A;  4Z05 A;  3GQ8 A;  4XOT A;  1AIR A;  4U49 A;  2IQ7 A;  3EQO A;  3B8Y A;  2NT6 A;  4XN3 A;  4XL9 A;  2NTP A;  3T9G A;  3FY3 A;  2PYG A;  1KCC A;  1IDJ A;  5C1C A;  4C2L A;  3B90 A;  1PXZ A;  2INU A;  1O8F A;  1DBG A;  1WMR A;  4OJ5 A;  4XMY A;  4YZA A;  4XLH A;  3VMV A;  2VBK A;  1CZF A;  3JUR A;  1O8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...