2NTQA

Crystal structure of pectin methylesterase in complex with hexasaccharide vii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
b'ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2ntqA00
4NK6A 2ODLA 4XN3A 4W8TA 3EQOA 4XKWA 3UW0A 1IB4A 4XMYA 1EE6A 1XG2A 2O0VA 2BSPA 2PYGA 2X85A 2NSTA 4XM3A 3VSVA 2INVA 1O8LA 1O8KA 4U4BA 1OFMA 4XQFA 1JRGA 4W8RA 2O04A 4OJLA 2PECA 2NTBA 4URRA 4XOPA 3FY3A 4EW9A 4I84A 2X6WA 3GRHA 1GQ8A 4XLFA 3ZSCA 1AIRA 2VBMA 3EQNA 1CZFA 3VMWA 1O8JA 3T9GA 2O1DA 2X6XA 4XONA 4PMHA 2EWEA 4XNFA 2NZMA 2NT9A 4Z05A 3GQ7A 4YZ0A 1BN8A 4XORA 1RMGA 3JURA 4C2LA 1K5CA 2Z8GA 4XLEA 2O17A 4YZAA 1PXZA 2NTQA 3B8YA 1OOCA 4W8SA 2O0WA 4OJ5A 3SUCA 4HWVA 1DBOA 4Z06A 3VSTA 1H80A 3B90A 1KCCA 1O8FA 2X6YA 3VSUA 1O8GA 4YELA 5C1CA 4MXNA 1WMRA 1IDKA 2NT6A 1PE9A 4YZXA 2VBKA 1IDJA 4OJPA 4Z03A 2INUA 5AMVA 1RWRA 4XR6A 4NK8A 2NTPA 4XL9A 2QX3A 3KRGA 4XN0A 4XKVA 1OGMX 4OJOA 1OGOX 1KTWA 3GQAA 2PYHA 3VMVA 1VBLA 4YZQA 2UVFA 4AVZA 1O8MA 3ZPPA 1DBGA 1KCDA 2IQ7A 3WWGA 2VJIA 2X3HA 4OZYA 4XOTA 4XLHA 4YEJA 1O8EA 3B4NA 4MR0A 4OJ6A 2NSPA 1NHCA 4XLCA 3LMWA 2VJJA 1O8IA 2VBEA 1JTAA 3GQ8A 1BHEA 4XLAA 3GQ9A 1O88A 2QXZA 1QJVA 1QCXA 2UVEA 4U49A 4OZZA 2QY1A 1RU4A 1PLUA 4W8QA 5C1EA 1IA5A 1O8DA 1O8HA 1OFLA 1X0CA 1HG8A
chains in the Genus database with same CATH superfamily
3PSZA 1LM1A 4NK6A 2ODLA 4XN3A 4W8TA 1EA0A 1KQ5A 3EQOA 4XKWA 4JRAC 3UW0A 3H09A 1IB4A 2F3LA 2VFQA 4XMYA 1EE6A 1XG2A 2O0VA 2VFOA 2BSPA 2PYGA 2G0YA 2X85A 2NSTA 4XM3A 3VSVA 2B0RA 2INVA 1O8LA 1O8KA 5DNSA 1TYWA 4U4BA 1OFMA 3SYJA 4XQFA 1JRGA 4W8RA 2O04A 3N90A 4OJLA 2PECA 2NTBA 2BM7A 4URRA 2XTWA 4XOPA 3FY3A 4EW9A 4I84A 2X6WA 3GRHA 1LLZA 1WXRA 1GQ8A 3ML3A 4XLFA 3ZSCA 1AIRA 2VBMA 3EQNA 1CZFA 3AK5A 2XTXA 2YUHA 3VMWA 1O8JA 3T9GA 2VFPA 2O1DA 2X6XA 3P4GA 4XONA 4PMHA 3SZEA 2EWEA 4XNFA 2NZMA 2NT9A 4Z05A 3GQ7A 2VFMA 5JLVC 4YZ0A 1OFDA 2W7ZA 1BN8A 2VFNA 4XORA 1RMGA 3JURA 3NB2A 4C2LA 1K5CA 2Z8GA 1TYXA 1QRCA 3BH6B 2O17A 4XLEA 1QA1A 4YFOA 4YZAA 1PXZA 2NTQA 3B8YA 1OOCA 4W8SA 1LLWA 2O0WA 2IOUG 4YDTA 4OJ5A 4YC5A 4YCQA 3SUCA 4HWVA 1DBOA 5JMCB 4Z06A 3VSTA 1H80A 3B90A 1KCCA 1O8FA 2O6WA 2X6YA 3VSUA 1O8GA 4YELA 5C1CA 1HF2A 4MXNA 1WMRA 1IDKA 2NT6A 1PE9A 4YZXA 2VBKA 2BM6A 4OM9A 1IDJA 4OJPA 4Z03A 2INUA 3BH7B 5AMVA 2V5IA 1RWRA 1K8FA 4NK8A 4XR6A 2NTPA 4XL9A 2QX3A 3KRGA 1QRBA 1TYVA 4XKVA 1OGMX 4XN0A 4OJOA 1OGOX 1KTWA 3GQAA 2PYHA 2J8KA 3VMVA 1VBLA 4YZQA 2UVFA 4AVZA 1O8MA 3ZPPA 1DBGA 1KCDA 3LJYA 2IQ7A 3WWGA 2VJIA 2X3HA 1K4ZA 1QQ1A 4OZYA 4XOTA 4XLHA 2XT2A 1HG8A 4YEJA 1O8EA 3B4NA 4MR0A 4OJ6A 2NSPA 1NHCA 4XLCA 3LMWA 2VJJA 4KH3A 3SY2A 1QA3A 1O8IA 4OPWA 2J8IA 2VBEA 3JX8A 1JTAA 2XTYA 3GQ8A 1BHEA 2BM4A 4XLAA 3GQ9A 3PETA 4V02C 1O88A 3DU1X 2XC1A 3LYCA 2QXZA 1QJVA 1QCXA 2BX6A 2UVEA 3SQVA 4U49A 4YEIA 3RIQA 4OZZA 1TSPA 3NAWA 2QY1A 2QZAA 1RU4A 1PLUA 3TH0A 2XT4A 4W8QA 3PSSA 1QA2A 5C1EA 1OFEA 1IA5A 1CLWA 1O8DA 1O8HA 1OFLA 1TYUA 3N6ZA 2QYUA 1X0CA 1L1IA 1EZGA 1DABA 2BM5A
chains in the Genus database with same CATH topology
4NK6A 2ODLA 4XN3A 4W8TA 3EQOA 4XKWA 3UW0A 1IB4A 4XMYA 1EE6A 1XG2A 2O0VA 2BSPA 2PYGA 2X85A 2NSTA 4XM3A 3VSVA 2INVA 1O8LA 1O8KA 4U4BA 1OFMA 4XQFA 1JRGA 4W8RA 2O04A 4OJLA 2PECA 2NTBA 4URRA 4XOPA 3FY3A 4EW9A 4I84A 2X6WA 3GRHA 1GQ8A 4XLFA 3ZSCA 1AIRA 2VBMA 3EQNA 1CZFA 3VMWA 1O8JA 3T9GA 2O1DA 2X6XA 4XONA 4PMHA 2EWEA 4XNFA 2NZMA 2NT9A 4Z05A 3GQ7A 4YZ0A 1BN8A 4XORA 1RMGA 3JURA 4C2LA 1K5CA 2Z8GA 4XLEA 2O17A 4YZAA 1PXZA 2NTQA 3B8YA 1OOCA 4W8SA 2O0WA 4OJ5A 3SUCA 4HWVA 1DBOA 4Z06A 3VSTA 1H80A 3B90A 1KCCA 1O8FA 2X6YA 3VSUA 1O8GA 4YELA 5C1CA 4MXNA 1WMRA 1IDKA 2NT6A 1PE9A 4YZXA 2VBKA 1IDJA 4OJPA 4Z03A 2INUA 5AMVA 1RWRA 4XR6A 4NK8A 2NTPA 4XL9A 2QX3A 3KRGA 4XN0A 4XKVA 1OGMX 4OJOA 1OGOX 1KTWA 3GQAA 2PYHA 3VMVA 1VBLA 4YZQA 2UVFA 4AVZA 1O8MA 3ZPPA 1DBGA 1KCDA 2IQ7A 3WWGA 2VJIA 2X3HA 4OZYA 4XOTA 4XLHA 4YEJA 1O8EA 3B4NA 4MR0A 4OJ6A 2NSPA 1NHCA 4XLCA 3LMWA 2VJJA 1O8IA 2VBEA 1JTAA 3GQ8A 1BHEA 4XLAA 3GQ9A 1O88A 2QXZA 1QJVA 1QCXA 2UVEA 4U49A 4OZZA 2QY1A 1RU4A 1PLUA 4W8QA 5C1EA 1IA5A 1O8DA 1O8HA 1OFLA 1X0CA 1HG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NK6 A;  2ODL A;  4XN3 A;  4W8T A;  3EQO A;  4XKW A;  3UW0 A;  1IB4 A;  4XMY A;  1EE6 A;  1XG2 A;  2O0V A;  2BSP A;  2PYG A;  2X85 A;  2NST A;  4XM3 A;  3VSV A;  2INV A;  1O8L A;  1O8K A;  4U4B A;  1OFM A;  4XQF A;  1JRG A;  4W8R A;  2O04 A;  4OJL A;  2PEC A;  2NTB A;  4URR A;  4XOP A;  3FY3 A;  4EW9 A;  4I84 A;  2X6W A;  3GRH A;  1GQ8 A;  4XLF A;  3ZSC A;  1AIR A;  2VBM A;  3EQN A;  1CZF A;  3VMW A;  1O8J A;  3T9G A;  2O1D A;  2X6X A;  4XON A;  4PMH A;  2EWE A;  4XNF A;  2NZM A;  2NT9 A;  4Z05 A;  3GQ7 A;  4YZ0 A;  1BN8 A;  4XOR A;  1RMG A;  3JUR A;  4C2L A;  1K5C A;  2Z8G A;  4XLE A;  2O17 A;  4YZA A;  1PXZ A;  2NTQ A;  3B8Y A;  1OOC A;  4W8S A;  2O0W A;  4OJ5 A;  3SUC A;  4HWV A;  1DBO A;  4Z06 A;  3VST A;  1H80 A;  3B90 A;  1KCC A;  1O8F A;  2X6Y A;  3VSU A;  1O8G A;  4YEL A;  5C1C A;  4MXN A;  1WMR A;  1IDK A;  2NT6 A;  1PE9 A;  4YZX A;  2VBK A;  1IDJ A;  4OJP A;  4Z03 A;  2INU A;  5AMV A;  1RWR A;  4XR6 A;  4NK8 A;  2NTP A;  4XL9 A;  2QX3 A;  3KRG A;  4XN0 A;  4XKV A;  1OGM X;  4OJO A;  1OGO X;  1KTW A;  3GQA A;  2PYH A;  3VMV A;  1VBL A;  4YZQ A;  2UVF A;  4AVZ A;  1O8M A;  3ZPP A;  1DBG A;  1KCD A;  2IQ7 A;  3WWG A;  2VJI A;  2X3H A;  4OZY A;  4XOT A;  4XLH A;  4YEJ A;  1O8E A;  3B4N A;  4MR0 A;  4OJ6 A;  2NSP A;  1NHC A;  4XLC A;  3LMW A;  2VJJ A;  1O8I A;  2VBE A;  1JTA A;  3GQ8 A;  1BHE A;  4XLA A;  3GQ9 A;  1O88 A;  2QXZ A;  1QJV A;  1QCX A;  2UVE A;  4U49 A;  4OZZ A;  2QY1 A;  1RU4 A;  1PLU A;  4W8Q A;  5C1E A;  1IA5 A;  1O8D A;  1O8H A;  1OFL A;  1X0C A;  1HG8 A; 
#chains in the Genus database with same CATH topology
 3PSZ A;  1LM1 A;  4NK6 A;  2ODL A;  4XN3 A;  4W8T A;  1EA0 A;  1KQ5 A;  3EQO A;  4XKW A;  4JRA C;  3UW0 A;  3H09 A;  1IB4 A;  2F3L A;  2VFQ A;  4XMY A;  1EE6 A;  1XG2 A;  2O0V A;  2VFO A;  2BSP A;  2PYG A;  2G0Y A;  2X85 A;  2NST A;  4XM3 A;  3VSV A;  2B0R A;  2INV A;  1O8L A;  1O8K A;  5DNS A;  1TYW A;  4U4B A;  1OFM A;  3SYJ A;  4XQF A;  1JRG A;  4W8R A;  2O04 A;  3N90 A;  4OJL A;  2PEC A;  2NTB A;  2BM7 A;  4URR A;  2XTW A;  4XOP A;  3FY3 A;  4EW9 A;  4I84 A;  2X6W A;  3GRH A;  1LLZ A;  1WXR A;  1GQ8 A;  3ML3 A;  4XLF A;  3ZSC A;  1AIR A;  2VBM A;  3EQN A;  1CZF A;  3AK5 A;  2XTX A;  2YUH A;  3VMW A;  1O8J A;  3T9G A;  2VFP A;  2O1D A;  2X6X A;  3P4G A;  4XON A;  4PMH A;  3SZE A;  2EWE A;  4XNF A;  2NZM A;  2NT9 A;  4Z05 A;  3GQ7 A;  2VFM A;  5JLV C;  4YZ0 A;  1OFD A;  2W7Z A;  1BN8 A;  2VFN A;  4XOR A;  1RMG A;  3JUR A;  3NB2 A;  4C2L A;  1K5C A;  2Z8G A;  1TYX A;  1QRC A;  3BH6 B;  2O17 A;  4XLE A;  1QA1 A;  4YFO A;  4YZA A;  1PXZ A;  2NTQ A;  3B8Y A;  1OOC A;  4W8S A;  1LLW A;  2O0W A;  2IOU G;  4YDT A;  4OJ5 A;  4YC5 A;  4YCQ A;  3SUC A;  4HWV A;  1DBO A;  5JMC B;  4Z06 A;  3VST A;  1H80 A;  3B90 A;  1KCC A;  1O8F A;  2O6W A;  2X6Y A;  3VSU A;  1O8G A;  4YEL A;  5C1C A;  1HF2 A;  4MXN A;  1WMR A;  1IDK A;  2NT6 A;  1PE9 A;  4YZX A;  2VBK A;  2BM6 A;  4OM9 A;  1IDJ A;  4OJP A;  4Z03 A;  2INU A;  3BH7 B;  5AMV A;  2V5I A;  1RWR A;  1K8F A;  4NK8 A;  4XR6 A;  2NTP A;  4XL9 A;  2QX3 A;  3KRG A;  1QRB A;  1TYV A;  4XKV A;  1OGM X;  4XN0 A;  4OJO A;  1OGO X;  1KTW A;  3GQA A;  2PYH A;  2J8K A;  3VMV A;  1VBL A;  4YZQ A;  2UVF A;  4AVZ A;  1O8M A;  3ZPP A;  1DBG A;  1KCD A;  3LJY A;  2IQ7 A;  3WWG A;  2VJI A;  2X3H A;  1K4Z A;  1QQ1 A;  4OZY A;  4XOT A;  4XLH A;  2XT2 A;  1HG8 A;  4YEJ A;  1O8E A;  3B4N A;  4MR0 A;  4OJ6 A;  2NSP A;  1NHC A;  4XLC A;  3LMW A;  2VJJ A;  4KH3 A;  3SY2 A;  1QA3 A;  1O8I A;  4OPW A;  2J8I A;  2VBE A;  3JX8 A;  1JTA A;  2XTY A;  3GQ8 A;  1BHE A;  2BM4 A;  4XLA A;  3GQ9 A;  3PET A;  4V02 C;  1O88 A;  3DU1 X;  2XC1 A;  3LYC A;  2QXZ A;  1QJV A;  1QCX A;  2BX6 A;  2UVE A;  3SQV A;  4U49 A;  4YEI A;  3RIQ A;  4OZZ A;  1TSP A;  3NAW A;  2QY1 A;  2QZA A;  1RU4 A;  1PLU A;  3TH0 A;  2XT4 A;  4W8Q A;  3PSS A;  1QA2 A;  5C1E A;  1OFE A;  1IA5 A;  1CLW A;  1O8D A;  1O8H A;  1OFL A;  1TYU A;  3N6Z A;  2QYU A;  1X0C A;  1L1I A;  1EZG A;  1DAB A;  2BM5 A; 
#chains in the Genus database with same CATH homology
 4NK6 A;  2ODL A;  4XN3 A;  4W8T A;  3EQO A;  4XKW A;  3UW0 A;  1IB4 A;  4XMY A;  1EE6 A;  1XG2 A;  2O0V A;  2BSP A;  2PYG A;  2X85 A;  2NST A;  4XM3 A;  3VSV A;  2INV A;  1O8L A;  1O8K A;  4U4B A;  1OFM A;  4XQF A;  1JRG A;  4W8R A;  2O04 A;  4OJL A;  2PEC A;  2NTB A;  4URR A;  4XOP A;  3FY3 A;  4EW9 A;  4I84 A;  2X6W A;  3GRH A;  1GQ8 A;  4XLF A;  3ZSC A;  1AIR A;  2VBM A;  3EQN A;  1CZF A;  3VMW A;  1O8J A;  3T9G A;  2O1D A;  2X6X A;  4XON A;  4PMH A;  2EWE A;  4XNF A;  2NZM A;  2NT9 A;  4Z05 A;  3GQ7 A;  4YZ0 A;  1BN8 A;  4XOR A;  1RMG A;  3JUR A;  4C2L A;  1K5C A;  2Z8G A;  4XLE A;  2O17 A;  4YZA A;  1PXZ A;  2NTQ A;  3B8Y A;  1OOC A;  4W8S A;  2O0W A;  4OJ5 A;  3SUC A;  4HWV A;  1DBO A;  4Z06 A;  3VST A;  1H80 A;  3B90 A;  1KCC A;  1O8F A;  2X6Y A;  3VSU A;  1O8G A;  4YEL A;  5C1C A;  4MXN A;  1WMR A;  1IDK A;  2NT6 A;  1PE9 A;  4YZX A;  2VBK A;  1IDJ A;  4OJP A;  4Z03 A;  2INU A;  5AMV A;  1RWR A;  4XR6 A;  4NK8 A;  2NTP A;  4XL9 A;  2QX3 A;  3KRG A;  4XN0 A;  4XKV A;  1OGM X;  4OJO A;  1OGO X;  1KTW A;  3GQA A;  2PYH A;  3VMV A;  1VBL A;  4YZQ A;  2UVF A;  4AVZ A;  1O8M A;  3ZPP A;  1DBG A;  1KCD A;  2IQ7 A;  3WWG A;  2VJI A;  2X3H A;  4OZY A;  4XOT A;  4XLH A;  4YEJ A;  1O8E A;  3B4N A;  4MR0 A;  4OJ6 A;  2NSP A;  1NHC A;  4XLC A;  3LMW A;  2VJJ A;  1O8I A;  2VBE A;  1JTA A;  3GQ8 A;  1BHE A;  4XLA A;  3GQ9 A;  1O88 A;  2QXZ A;  1QJV A;  1QCX A;  2UVE A;  4U49 A;  4OZZ A;  2QY1 A;  1RU4 A;  1PLU A;  4W8Q A;  5C1E A;  1IA5 A;  1O8D A;  1O8H A;  1OFL A;  1X0C A;  1HG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...