2NTQA

Crystal structure of pectin methylesterase in complex with hexasaccharide vii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2ntqA00
3SUCA 1PE9A 1KCCA 1DBOA 4W8SA 1IDKA 3VSTA 1PLUA 4EW9A 1QJVA 1O8GA 3VMWA 2PECA 2NTQA 4I84A 4XKVA 2NT9A 4XOPA 4MR0A 4XOTA 4Z05A 1O8EA 2INVA 3EQOA 2BSPA 4YZXA 4AVZA 1PXZA 4NK8A 1QCXA 2O1DA 2EWEA 1O8DA 2NSPA 2QY1A 4XM3A 4Z06A 3UW0A 2O0VA 3GQ7A 5C1CA 3FY3A 1IDJA 4XLCA 2UVFA 4YZQA 4XN3A 3ZSCA 2NZMA 4XL9A 4YZ0A 4XQFA 1JTAA 4OJ6A 2VJIA 3VSUA 1DBGA 4XMYA 1O8KA 4W8TA 4XKWA 3VSVA 1OGMX 3GRHA 1O8FA 1RU4A 4URRA 4OJPA 4OJOA 4OJ5A 4XORA 1NHCA 1EE6A 1KTWA 3B8YA 3LMWA 1HG8A 2IQ7A 4NK6A 3WWGA 4U49A 2UVEA 4U4BA 4XNFA 1AIRA 1IA5A 2ODLA 1CZFA 2X85A 2NSTA 3B90A 3GQ8A 4HWVA 4MXNA 1XG2A 1O8IA 1OGOX 4W8QA 1RMGA 2QXZA 4XLEA 1O8JA 4OJLA 1OFMA 2X6WA 5C1EA 1BN8A 4Z03A 2NT6A 2VJJA 1O88A 1X0CA 1WMRA 1GQ8A 3VMVA 2X6XA 2VBMA 2NTPA 2QX3A 4XLHA 1O8HA 1VBLA 2X6YA 4OZYA 3T9GA 4C2LA 1IB4A 2INUA 4W8RA 4XN0A 2PYHA 2X3HA 4PMHA 2Z8GA 1JRGA 4XR6A 4XONA 1H80A 3ZPPA 1RWRA 1O8LA 2PYGA 1BHEA 4YZAA 2O0WA 3JURA 1O8MA 4YEJA 1KCDA 3GQ9A 2NTBA 3GQAA 1OOCA 1OFLA 4XLAA 2O04A 5AMVA 2O17A 4OZZA 2VBKA 3EQNA 4YELA 3B4NA 1K5CA 4XLFA 2VBEA 3KRGA
chains in the Genus database with same CATH superfamily
1K8FA 2G0YA 2QZAA 1QQ1A 3SUCA 1PE9A 1KCCA 1DBOA 3NAWA 4W8SA 1IDKA 3VSTA 5JLVC 1PLUA 4EW9A 1QJVA 2W7ZA 3P4GA 1O8GA 3VMWA 2PECA 2NTQA 4I84A 4XKVA 3PSZA 2NT9A 4V02C 4XOPA 4MR0A 4XOTA 4Z05A 1QA1A 1O8EA 3LYCA 1TYXA 2INVA 1TYVA 2XTYA 3EQOA 3SZEA 2BSPA 4YZXA 4AVZA 1PXZA 4NK8A 2VFNA 1QCXA 1LM1A 2EWEA 2O1DA 1O8DA 2NSPA 2QY1A 2B0RA 2XT2A 4OPWA 4XM3A 4Z06A 3UW0A 3NB2A 2O0VA 3GQ7A 5C1CA 3FY3A 1IDJA 4XLCA 2BM5A 2UVFA 3LJYA 4YZQA 3SY2A 4XN3A 1CLWA 3DU1X 3ZSCA 2NZMA 4XL9A 4YZ0A 2J8IA 1QA3A 1TYWA 4KH3A 4XQFA 4JRAC 4YDTA 1JTAA 4OJ6A 2VJIA 3VSUA 3PSSA 5DNSA 1DBGA 2V5IA 4XMYA 2XTWA 1DABA 1O8KA 4W8TA 4XKWA 3H09A 1OGMX 3GRHA 1O8FA 1RU4A 3VSVA 4URRA 3BH7B 4OJPA 4OJOA 2BX6A 4OJ5A 1KQ5A 4XORA 1NHCA 1EE6A 1KTWA 3B8YA 2XC1A 3LMWA 1HG8A 1TSPA 2IQ7A 4NK6A 3WWGA 3AK5A 4U49A 2UVEA 4U4BA 4XNFA 1AIRA 1IA5A 2BM7A 2VFMA 2ODLA 2VFPA 1CZFA 1TYUA 2J8KA 2X85A 1OFEA 2NSTA 3B90A 3GQ8A 4HWVA 4MXNA 1XG2A 1O8IA 1OGOX 2O6WA 4W8QA 1RMGA 2QXZA 4XLEA 1O8JA 4OM9A 2VFOA 3RIQA 4YFOA 4OJLA 2VFQA 3BH6B 2YUHA 3N6ZA 1OFMA 2X6WA 5C1EA 1OFDA 1BN8A 1HF2A 4YC5A 4Z03A 2NT6A 2VJJA 2F3LA 1O88A 1X0CA 1WMRA 1GQ8A 2BM4A 3VMVA 1QRCA 2X6XA 2VBMA 2NTPA 2QX3A 4XLHA 3ML3A 1O8HA 1VBLA 2X6YA 4OZYA 4YCQA 3T9GA 4C2LA 1IB4A 2INUA 4W8RA 2XTXA 4XN0A 2PYHA 1EA0A 4YEIA 1EZGA 2X3HA 3N90A 2QYUA 4PMHA 1WXRA 2Z8GA 1JRGA 4XR6A 4XONA 1H80A 3ZPPA 1RWRA 1O8LA 2PYGA 1LLZA 1BHEA 4YZAA 2O0WA 3JURA 1O8MA 2IOUG 4YEJA 3GQ9A 1KCDA 2NTBA 3GQAA 3SQVA 1OOCA 3SYJA 1QRBA 1OFLA 4XLAA 3PETA 1K4ZA 2O04A 5AMVA 2O17A 4OZZA 2VBKA 1QA2A 2XT4A 1LLWA 3EQNA 4YELA 3TH0A 3B4NA 1L1IA 1K5CA 4XLFA 2BM6A 2VBEA 5JMCB 3JX8A 3KRGA
chains in the Genus database with same CATH topology
3SUCA 1PE9A 1KCCA 1DBOA 4W8SA 1IDKA 3VSTA 1PLUA 4EW9A 1QJVA 1O8GA 3VMWA 2PECA 2NTQA 4I84A 4XKVA 2NT9A 4XOPA 4MR0A 4XOTA 4Z05A 1O8EA 2INVA 3EQOA 2BSPA 4YZXA 4AVZA 1PXZA 4NK8A 1QCXA 2O1DA 2EWEA 1O8DA 2NSPA 2QY1A 4XM3A 4Z06A 3UW0A 2O0VA 3GQ7A 5C1CA 3FY3A 1IDJA 4XLCA 2UVFA 4YZQA 4XN3A 3ZSCA 2NZMA 4XL9A 4YZ0A 4XQFA 1JTAA 4OJ6A 2VJIA 3VSUA 1DBGA 4XMYA 1O8KA 4W8TA 4XKWA 3VSVA 1OGMX 3GRHA 1O8FA 1RU4A 4URRA 4OJPA 4OJOA 4OJ5A 4XORA 1NHCA 1EE6A 1KTWA 3B8YA 3LMWA 1HG8A 2IQ7A 4NK6A 3WWGA 4U49A 2UVEA 4U4BA 4XNFA 1AIRA 1IA5A 2ODLA 1CZFA 2X85A 2NSTA 3B90A 3GQ8A 4HWVA 4MXNA 1XG2A 1O8IA 1OGOX 4W8QA 1RMGA 2QXZA 4XLEA 1O8JA 4OJLA 1OFMA 2X6WA 5C1EA 1BN8A 4Z03A 2NT6A 2VJJA 1O88A 1X0CA 1WMRA 1GQ8A 3VMVA 2X6XA 2VBMA 2NTPA 2QX3A 4XLHA 1O8HA 1VBLA 2X6YA 4OZYA 3T9GA 4C2LA 1IB4A 2INUA 4W8RA 4XN0A 2PYHA 2X3HA 4PMHA 2Z8GA 1JRGA 4XR6A 4XONA 1H80A 3ZPPA 1RWRA 1O8LA 2PYGA 1BHEA 4YZAA 2O0WA 3JURA 1O8MA 4YEJA 1KCDA 3GQ9A 2NTBA 3GQAA 1OOCA 1OFLA 4XLAA 2O04A 5AMVA 2O17A 4OZZA 2VBKA 3EQNA 4YELA 3B4NA 1K5CA 4XLFA 2VBEA 3KRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUC A;  1PE9 A;  1KCC A;  1DBO A;  4W8S A;  1IDK A;  3VST A;  1PLU A;  4EW9 A;  1QJV A;  1O8G A;  3VMW A;  2PEC A;  2NTQ A;  4I84 A;  4XKV A;  2NT9 A;  4XOP A;  4MR0 A;  4XOT A;  4Z05 A;  1O8E A;  2INV A;  3EQO A;  2BSP A;  4YZX A;  4AVZ A;  1PXZ A;  4NK8 A;  1QCX A;  2O1D A;  2EWE A;  1O8D A;  2NSP A;  2QY1 A;  4XM3 A;  4Z06 A;  3UW0 A;  2O0V A;  3GQ7 A;  5C1C A;  3FY3 A;  1IDJ A;  4XLC A;  2UVF A;  4YZQ A;  4XN3 A;  3ZSC A;  2NZM A;  4XL9 A;  4YZ0 A;  4XQF A;  1JTA A;  4OJ6 A;  2VJI A;  3VSU A;  1DBG A;  4XMY A;  1O8K A;  4W8T A;  4XKW A;  3VSV A;  1OGM X;  3GRH A;  1O8F A;  1RU4 A;  4URR A;  4OJP A;  4OJO A;  4OJ5 A;  4XOR A;  1NHC A;  1EE6 A;  1KTW A;  3B8Y A;  3LMW A;  1HG8 A;  2IQ7 A;  4NK6 A;  3WWG A;  4U49 A;  2UVE A;  4U4B A;  4XNF A;  1AIR A;  1IA5 A;  2ODL A;  1CZF A;  2X85 A;  2NST A;  3B90 A;  3GQ8 A;  4HWV A;  4MXN A;  1XG2 A;  1O8I A;  1OGO X;  4W8Q A;  1RMG A;  2QXZ A;  4XLE A;  1O8J A;  4OJL A;  1OFM A;  2X6W A;  5C1E A;  1BN8 A;  4Z03 A;  2NT6 A;  2VJJ A;  1O88 A;  1X0C A;  1WMR A;  1GQ8 A;  3VMV A;  2X6X A;  2VBM A;  2NTP A;  2QX3 A;  4XLH A;  1O8H A;  1VBL A;  2X6Y A;  4OZY A;  3T9G A;  4C2L A;  1IB4 A;  2INU A;  4W8R A;  4XN0 A;  2PYH A;  2X3H A;  4PMH A;  2Z8G A;  1JRG A;  4XR6 A;  4XON A;  1H80 A;  3ZPP A;  1RWR A;  1O8L A;  2PYG A;  1BHE A;  4YZA A;  2O0W A;  3JUR A;  1O8M A;  4YEJ A;  1KCD A;  3GQ9 A;  2NTB A;  3GQA A;  1OOC A;  1OFL A;  4XLA A;  2O04 A;  5AMV A;  2O17 A;  4OZZ A;  2VBK A;  3EQN A;  4YEL A;  3B4N A;  1K5C A;  4XLF A;  2VBE A;  3KRG A; 
#chains in the Genus database with same CATH topology
 1K8F A;  2G0Y A;  2QZA A;  1QQ1 A;  3SUC A;  1PE9 A;  1KCC A;  1DBO A;  3NAW A;  4W8S A;  1IDK A;  3VST A;  5JLV C;  1PLU A;  4EW9 A;  1QJV A;  2W7Z A;  3P4G A;  1O8G A;  3VMW A;  2PEC A;  2NTQ A;  4I84 A;  4XKV A;  3PSZ A;  2NT9 A;  4V02 C;  4XOP A;  4MR0 A;  4XOT A;  4Z05 A;  1QA1 A;  1O8E A;  3LYC A;  1TYX A;  2INV A;  1TYV A;  2XTY A;  3EQO A;  3SZE A;  2BSP A;  4YZX A;  4AVZ A;  1PXZ A;  4NK8 A;  2VFN A;  1QCX A;  1LM1 A;  2EWE A;  2O1D A;  1O8D A;  2NSP A;  2QY1 A;  2B0R A;  2XT2 A;  4OPW A;  4XM3 A;  4Z06 A;  3UW0 A;  3NB2 A;  2O0V A;  3GQ7 A;  5C1C A;  3FY3 A;  1IDJ A;  4XLC A;  2BM5 A;  2UVF A;  3LJY A;  4YZQ A;  3SY2 A;  4XN3 A;  1CLW A;  3DU1 X;  3ZSC A;  2NZM A;  4XL9 A;  4YZ0 A;  2J8I A;  1QA3 A;  1TYW A;  4KH3 A;  4XQF A;  4JRA C;  4YDT A;  1JTA A;  4OJ6 A;  2VJI A;  3VSU A;  3PSS A;  5DNS A;  1DBG A;  2V5I A;  4XMY A;  2XTW A;  1DAB A;  1O8K A;  4W8T A;  4XKW A;  3H09 A;  1OGM X;  3GRH A;  1O8F A;  1RU4 A;  3VSV A;  4URR A;  3BH7 B;  4OJP A;  4OJO A;  2BX6 A;  4OJ5 A;  1KQ5 A;  4XOR A;  1NHC A;  1EE6 A;  1KTW A;  3B8Y A;  2XC1 A;  3LMW A;  1HG8 A;  1TSP A;  2IQ7 A;  4NK6 A;  3WWG A;  3AK5 A;  4U49 A;  2UVE A;  4U4B A;  4XNF A;  1AIR A;  1IA5 A;  2BM7 A;  2VFM A;  2ODL A;  2VFP A;  1CZF A;  1TYU A;  2J8K A;  2X85 A;  1OFE A;  2NST A;  3B90 A;  3GQ8 A;  4HWV A;  4MXN A;  1XG2 A;  1O8I A;  1OGO X;  2O6W A;  4W8Q A;  1RMG A;  2QXZ A;  4XLE A;  1O8J A;  4OM9 A;  2VFO A;  3RIQ A;  4YFO A;  4OJL A;  2VFQ A;  3BH6 B;  2YUH A;  3N6Z A;  1OFM A;  2X6W A;  5C1E A;  1OFD A;  1BN8 A;  1HF2 A;  4YC5 A;  4Z03 A;  2NT6 A;  2VJJ A;  2F3L A;  1O88 A;  1X0C A;  1WMR A;  1GQ8 A;  2BM4 A;  3VMV A;  1QRC A;  2X6X A;  2VBM A;  2NTP A;  2QX3 A;  4XLH A;  3ML3 A;  1O8H A;  1VBL A;  2X6Y A;  4OZY A;  4YCQ A;  3T9G A;  4C2L A;  1IB4 A;  2INU A;  4W8R A;  2XTX A;  4XN0 A;  2PYH A;  1EA0 A;  4YEI A;  1EZG A;  2X3H A;  3N90 A;  2QYU A;  4PMH A;  1WXR A;  2Z8G A;  1JRG A;  4XR6 A;  4XON A;  1H80 A;  3ZPP A;  1RWR A;  1O8L A;  2PYG A;  1LLZ A;  1BHE A;  4YZA A;  2O0W A;  3JUR A;  1O8M A;  2IOU G;  4YEJ A;  3GQ9 A;  1KCD A;  2NTB A;  3GQA A;  3SQV A;  1OOC A;  3SYJ A;  1QRB A;  1OFL A;  4XLA A;  3PET A;  1K4Z A;  2O04 A;  5AMV A;  2O17 A;  4OZZ A;  2VBK A;  1QA2 A;  2XT4 A;  1LLW A;  3EQN A;  4YEL A;  3TH0 A;  3B4N A;  1L1I A;  1K5C A;  4XLF A;  2BM6 A;  2VBE A;  5JMC B;  3JX8 A;  3KRG A; 
#chains in the Genus database with same CATH homology
 3SUC A;  1PE9 A;  1KCC A;  1DBO A;  4W8S A;  1IDK A;  3VST A;  1PLU A;  4EW9 A;  1QJV A;  1O8G A;  3VMW A;  2PEC A;  2NTQ A;  4I84 A;  4XKV A;  2NT9 A;  4XOP A;  4MR0 A;  4XOT A;  4Z05 A;  1O8E A;  2INV A;  3EQO A;  2BSP A;  4YZX A;  4AVZ A;  1PXZ A;  4NK8 A;  1QCX A;  2O1D A;  2EWE A;  1O8D A;  2NSP A;  2QY1 A;  4XM3 A;  4Z06 A;  3UW0 A;  2O0V A;  3GQ7 A;  5C1C A;  3FY3 A;  1IDJ A;  4XLC A;  2UVF A;  4YZQ A;  4XN3 A;  3ZSC A;  2NZM A;  4XL9 A;  4YZ0 A;  4XQF A;  1JTA A;  4OJ6 A;  2VJI A;  3VSU A;  1DBG A;  4XMY A;  1O8K A;  4W8T A;  4XKW A;  3VSV A;  1OGM X;  3GRH A;  1O8F A;  1RU4 A;  4URR A;  4OJP A;  4OJO A;  4OJ5 A;  4XOR A;  1NHC A;  1EE6 A;  1KTW A;  3B8Y A;  3LMW A;  1HG8 A;  2IQ7 A;  4NK6 A;  3WWG A;  4U49 A;  2UVE A;  4U4B A;  4XNF A;  1AIR A;  1IA5 A;  2ODL A;  1CZF A;  2X85 A;  2NST A;  3B90 A;  3GQ8 A;  4HWV A;  4MXN A;  1XG2 A;  1O8I A;  1OGO X;  4W8Q A;  1RMG A;  2QXZ A;  4XLE A;  1O8J A;  4OJL A;  1OFM A;  2X6W A;  5C1E A;  1BN8 A;  4Z03 A;  2NT6 A;  2VJJ A;  1O88 A;  1X0C A;  1WMR A;  1GQ8 A;  3VMV A;  2X6X A;  2VBM A;  2NTP A;  2QX3 A;  4XLH A;  1O8H A;  1VBL A;  2X6Y A;  4OZY A;  3T9G A;  4C2L A;  1IB4 A;  2INU A;  4W8R A;  4XN0 A;  2PYH A;  2X3H A;  4PMH A;  2Z8G A;  1JRG A;  4XR6 A;  4XON A;  1H80 A;  3ZPP A;  1RWR A;  1O8L A;  2PYG A;  1BHE A;  4YZA A;  2O0W A;  3JUR A;  1O8M A;  4YEJ A;  1KCD A;  3GQ9 A;  2NTB A;  3GQA A;  1OOC A;  1OFL A;  4XLA A;  2O04 A;  5AMV A;  2O17 A;  4OZZ A;  2VBK A;  3EQN A;  4YEL A;  3B4N A;  1K5C A;  4XLF A;  2VBE A;  3KRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...