1QJVA

Pectin methylesterase pema from erwinia chrysanthemi
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
b'ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGAAVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PECTIN METHYLESTERASE
publication title Three-Dimensional Structure of Erwinia Chrysanthemi Pectin Methylesterase Reveals a Novel Esterase Active Site
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase (aspartyl esterase)
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 1999-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1qjvA00
3GQ9A 1DBGA 2IQ7A 2O04A 1O8GA 2O0VA 4XLEA 2VJJA 2X6WA 3LMWA 1IB4A 1BN8A 4Z06A 3T9GA 1O8FA 2PYHA 1H80A 4OZYA 4XORA 2QXZA 4XR6A 3GQ7A 3VMVA 4OJOA 2O17A 2NSTA 2BSPA 4U4BA 1QJVA 4Z05A 1QCXA 1KCCA 2PYGA 4XKWA 1O8JA 2NSPA 1K5CA 2QY1A 4Z03A 4OJPA 2NTBA 3WWGA 1EE6A 4AVZA 5C1EA 4C2LA 3B4NA 3VMWA 1RMGA 2VBMA 1CZFA 1VBLA 1RU4A 4XOTA 4W8SA 1KCDA 4XONA 4XM3A 1WMRA 2INVA 4XN3A 1PXZA 1O8DA 4XLCA 3GQAA 1JTAA 3B90A 4XOPA 4W8RA 4OJLA 2VJIA 4YZXA 2X3HA 3ZSCA 2NT6A 1IA5A 4OZZA 1OFLA 2QX3A 2O0WA 4W8QA 4NK6A 4YELA 3JURA 3ZPPA 2X6YA 1O8MA 1O8EA 4OJ6A 4YZAA 3EQNA 3EQOA 1IDJA 1GQ8A 3GRHA 3FY3A 1O8IA 4XQFA 2Z8GA 4YZ0A 4XMYA 1PLUA 3VSVA 4XLFA 5AMVA 1HG8A 1OGOX 4NK8A 1NHCA 2NTQA 4EW9A 1IDKA 1OFMA 4YZQA 3B8YA 4OJ5A 2NTPA 2X6XA 2NT9A 1KTWA 1AIRA 2X85A 4XKVA 1RWRA 2NZMA 5C1CA 1O8LA 2INUA 4I84A 4XLAA 1OGMX 1O8KA 2O1DA 1BHEA 2VBEA 1X0CA 3SUCA 4MXNA 1JRGA 3UW0A 2VBKA 3VSTA 1O88A 2ODLA 2UVFA 2PECA 4XLHA 2EWEA 4URRA 4PMHA 4W8TA 4XN0A 3VSUA 4MR0A 4YEJA 1DBOA 1XG2A 3GQ8A 1PE9A 3KRGA 1O8HA 2UVEA 4XL9A 1OOCA 4XNFA 4HWVA 4U49A
chains in the Genus database with same CATH superfamily
3GQ9A 1DABA 1DBGA 2IQ7A 2O04A 1O8GA 2O0VA 4XLEA 2VJJA 2X6WA 3N6ZA 1TYVA 3LMWA 1IB4A 1BN8A 4Z06A 3T9GA 1O8FA 2PYHA 1QRBA 1H80A 1LLZA 4OZYA 4XORA 2QXZA 4XR6A 3GQ7A 2VFOA 3VMVA 2BM5A 2XTYA 2VFPA 3P4GA 4OJOA 2O17A 1OFDA 2XT2A 3AK5A 2NSTA 2BSPA 4U4BA 1QJVA 4Z05A 1TSPA 1QCXA 1KCCA 2PYGA 4XKWA 2QYUA 1K8FA 1O8JA 2NSPA 1K5CA 3BH7B 2QY1A 3DU1X 4Z03A 4OJPA 2NTBA 3WWGA 1EE6A 3PSZA 1LM1A 1KQ5A 5DNSA 5C1EA 4AVZA 4C2LA 3B4NA 3VMWA 3ML3A 1RMGA 3SYJA 2VBMA 3N90A 1CZFA 1VBLA 1RU4A 3RIQA 4XOTA 4W8SA 4YEIA 3TH0A 1KCDA 4XONA 2BM4A 4XM3A 1WMRA 2INVA 1QA1A 2F3LA 4XN3A 1PXZA 4V02C 1O8DA 4XLCA 3GQAA 1JTAA 3B90A 4XOPA 2QZAA 1QA2A 2XC1A 4W8RA 2YUHA 3SQVA 4OJLA 1QA3A 2XTXA 2O6WA 2VJIA 2VFQA 4YZXA 1QRCA 1TYXA 2X3HA 2G0YA 3ZSCA 2NT6A 2J8IA 1IA5A 4OZZA 3SY2A 3NB2A 3LJYA 1WXRA 1OFLA 2QX3A 2O0WA 4W8QA 4NK6A 4YELA 3JURA 2BM7A 3ZPPA 2X6YA 1O8MA 1K4ZA 1O8EA 1QQ1A 4OJ6A 4OM9A 3EQNA 4YC5A 4YZAA 4YDTA 3EQOA 1IDJA 1GQ8A 1HF2A 2BM6A 1O8IA 3FY3A 2Z8GA 3GRHA 4XQFA 1OFEA 4OPWA 4YZ0A 3PSSA 2VFNA 4XMYA 1PLUA 3VSVA 4XLFA 2B0RA 3JX8A 5AMVA 1HG8A 2XT4A 4YFOA 1OGOX 4JRAC 4NK8A 2VFMA 1NHCA 2NTQA 4EW9A 1EA0A 2J8KA 1IDKA 1OFMA 2W7ZA 4YZQA 5JMCB 3B8YA 3LYCA 4OJ5A 2NTPA 2X6XA 2NT9A 1KTWA 4KH3A 1AIRA 2X85A 4XKVA 1RWRA 2NZMA 1CLWA 5C1CA 1O8LA 2INUA 4I84A 4XLAA 2BX6A 1OGMX 1LLWA 1O8KA 2O1DA 1BHEA 2VBEA 4YCQA 1L1IA 1TYWA 1X0CA 3SUCA 4MXNA 1JRGA 1EZGA 3H09A 3UW0A 3BH6B 2V5IA 2VBKA 1TYUA 3VSTA 2IOUG 1O88A 2ODLA 2UVFA 2PECA 4XLHA 3SZEA 2EWEA 4URRA 4PMHA 4W8TA 4XN0A 3VSUA 4MR0A 3PETA 4YEJA 1DBOA 1XG2A 3GQ8A 1PE9A 3KRGA 5JLVC 1O8HA 2UVEA 2XTWA 4XL9A 1OOCA 4XNFA 4HWVA 3NAWA 4U49A
chains in the Genus database with same CATH topology
3GQ9A 1DBGA 2IQ7A 2O04A 1O8GA 2O0VA 4XLEA 2VJJA 2X6WA 3LMWA 1IB4A 1BN8A 4Z06A 3T9GA 1O8FA 2PYHA 1H80A 4OZYA 4XORA 2QXZA 4XR6A 3GQ7A 3VMVA 4OJOA 2O17A 2NSTA 2BSPA 4U4BA 1QJVA 4Z05A 1QCXA 1KCCA 2PYGA 4XKWA 1O8JA 2NSPA 1K5CA 2QY1A 4Z03A 4OJPA 2NTBA 3WWGA 1EE6A 4AVZA 5C1EA 4C2LA 3B4NA 3VMWA 1RMGA 2VBMA 1CZFA 1VBLA 1RU4A 4XOTA 4W8SA 1KCDA 4XONA 4XM3A 1WMRA 2INVA 4XN3A 1PXZA 1O8DA 4XLCA 3GQAA 1JTAA 3B90A 4XOPA 4W8RA 4OJLA 2VJIA 4YZXA 2X3HA 3ZSCA 2NT6A 1IA5A 4OZZA 1OFLA 2QX3A 2O0WA 4W8QA 4NK6A 4YELA 3JURA 3ZPPA 2X6YA 1O8MA 1O8EA 4OJ6A 4YZAA 3EQNA 3EQOA 1IDJA 1GQ8A 3GRHA 3FY3A 1O8IA 4XQFA 2Z8GA 4YZ0A 4XMYA 1PLUA 3VSVA 4XLFA 5AMVA 1HG8A 1OGOX 4NK8A 1NHCA 2NTQA 4EW9A 1IDKA 1OFMA 4YZQA 3B8YA 4OJ5A 2NTPA 2X6XA 2NT9A 1KTWA 1AIRA 2X85A 4XKVA 1RWRA 2NZMA 5C1CA 1O8LA 2INUA 4I84A 4XLAA 1OGMX 1O8KA 2O1DA 1BHEA 2VBEA 1X0CA 3SUCA 4MXNA 1JRGA 3UW0A 2VBKA 3VSTA 1O88A 2ODLA 2UVFA 2PECA 4XLHA 2EWEA 4URRA 4PMHA 4W8TA 4XN0A 3VSUA 4MR0A 4YEJA 1DBOA 1XG2A 3GQ8A 1PE9A 3KRGA 1O8HA 2UVEA 4XL9A 1OOCA 4XNFA 4HWVA 4U49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ9 A;  1DBG A;  2IQ7 A;  2O04 A;  1O8G A;  2O0V A;  4XLE A;  2VJJ A;  2X6W A;  3LMW A;  1IB4 A;  1BN8 A;  4Z06 A;  3T9G A;  1O8F A;  2PYH A;  1H80 A;  4OZY A;  4XOR A;  2QXZ A;  4XR6 A;  3GQ7 A;  3VMV A;  4OJO A;  2O17 A;  2NST A;  2BSP A;  4U4B A;  1QJV A;  4Z05 A;  1QCX A;  1KCC A;  2PYG A;  4XKW A;  1O8J A;  2NSP A;  1K5C A;  2QY1 A;  4Z03 A;  4OJP A;  2NTB A;  3WWG A;  1EE6 A;  4AVZ A;  5C1E A;  4C2L A;  3B4N A;  3VMW A;  1RMG A;  2VBM A;  1CZF A;  1VBL A;  1RU4 A;  4XOT A;  4W8S A;  1KCD A;  4XON A;  4XM3 A;  1WMR A;  2INV A;  4XN3 A;  1PXZ A;  1O8D A;  4XLC A;  3GQA A;  1JTA A;  3B90 A;  4XOP A;  4W8R A;  4OJL A;  2VJI A;  4YZX A;  2X3H A;  3ZSC A;  2NT6 A;  1IA5 A;  4OZZ A;  1OFL A;  2QX3 A;  2O0W A;  4W8Q A;  4NK6 A;  4YEL A;  3JUR A;  3ZPP A;  2X6Y A;  1O8M A;  1O8E A;  4OJ6 A;  4YZA A;  3EQN A;  3EQO A;  1IDJ A;  1GQ8 A;  3GRH A;  3FY3 A;  1O8I A;  4XQF A;  2Z8G A;  4YZ0 A;  4XMY A;  1PLU A;  3VSV A;  4XLF A;  5AMV A;  1HG8 A;  1OGO X;  4NK8 A;  1NHC A;  2NTQ A;  4EW9 A;  1IDK A;  1OFM A;  4YZQ A;  3B8Y A;  4OJ5 A;  2NTP A;  2X6X A;  2NT9 A;  1KTW A;  1AIR A;  2X85 A;  4XKV A;  1RWR A;  2NZM A;  5C1C A;  1O8L A;  2INU A;  4I84 A;  4XLA A;  1OGM X;  1O8K A;  2O1D A;  1BHE A;  2VBE A;  1X0C A;  3SUC A;  4MXN A;  1JRG A;  3UW0 A;  2VBK A;  3VST A;  1O88 A;  2ODL A;  2UVF A;  2PEC A;  4XLH A;  2EWE A;  4URR A;  4PMH A;  4W8T A;  4XN0 A;  3VSU A;  4MR0 A;  4YEJ A;  1DBO A;  1XG2 A;  3GQ8 A;  1PE9 A;  3KRG A;  1O8H A;  2UVE A;  4XL9 A;  1OOC A;  4XNF A;  4HWV A;  4U49 A; 
#chains in the Genus database with same CATH topology
 3GQ9 A;  1DAB A;  1DBG A;  2IQ7 A;  2O04 A;  1O8G A;  2O0V A;  4XLE A;  2VJJ A;  2X6W A;  3N6Z A;  1TYV A;  3LMW A;  1IB4 A;  1BN8 A;  4Z06 A;  3T9G A;  1O8F A;  2PYH A;  1QRB A;  1H80 A;  1LLZ A;  4OZY A;  4XOR A;  2QXZ A;  4XR6 A;  3GQ7 A;  2VFO A;  3VMV A;  2BM5 A;  2XTY A;  2VFP A;  3P4G A;  4OJO A;  2O17 A;  1OFD A;  2XT2 A;  3AK5 A;  2NST A;  2BSP A;  4U4B A;  1QJV A;  4Z05 A;  1TSP A;  1QCX A;  1KCC A;  2PYG A;  4XKW A;  2QYU A;  1K8F A;  1O8J A;  2NSP A;  1K5C A;  3BH7 B;  2QY1 A;  3DU1 X;  4Z03 A;  4OJP A;  2NTB A;  3WWG A;  1EE6 A;  3PSZ A;  1LM1 A;  1KQ5 A;  5DNS A;  5C1E A;  4AVZ A;  4C2L A;  3B4N A;  3VMW A;  3ML3 A;  1RMG A;  3SYJ A;  2VBM A;  3N90 A;  1CZF A;  1VBL A;  1RU4 A;  3RIQ A;  4XOT A;  4W8S A;  4YEI A;  3TH0 A;  1KCD A;  4XON A;  2BM4 A;  4XM3 A;  1WMR A;  2INV A;  1QA1 A;  2F3L A;  4XN3 A;  1PXZ A;  4V02 C;  1O8D A;  4XLC A;  3GQA A;  1JTA A;  3B90 A;  4XOP A;  2QZA A;  1QA2 A;  2XC1 A;  4W8R A;  2YUH A;  3SQV A;  4OJL A;  1QA3 A;  2XTX A;  2O6W A;  2VJI A;  2VFQ A;  4YZX A;  1QRC A;  1TYX A;  2X3H A;  2G0Y A;  3ZSC A;  2NT6 A;  2J8I A;  1IA5 A;  4OZZ A;  3SY2 A;  3NB2 A;  3LJY A;  1WXR A;  1OFL A;  2QX3 A;  2O0W A;  4W8Q A;  4NK6 A;  4YEL A;  3JUR A;  2BM7 A;  3ZPP A;  2X6Y A;  1O8M A;  1K4Z A;  1O8E A;  1QQ1 A;  4OJ6 A;  4OM9 A;  3EQN A;  4YC5 A;  4YZA A;  4YDT A;  3EQO A;  1IDJ A;  1GQ8 A;  1HF2 A;  2BM6 A;  1O8I A;  3FY3 A;  2Z8G A;  3GRH A;  4XQF A;  1OFE A;  4OPW A;  4YZ0 A;  3PSS A;  2VFN A;  4XMY A;  1PLU A;  3VSV A;  4XLF A;  2B0R A;  3JX8 A;  5AMV A;  1HG8 A;  2XT4 A;  4YFO A;  1OGO X;  4JRA C;  4NK8 A;  2VFM A;  1NHC A;  2NTQ A;  4EW9 A;  1EA0 A;  2J8K A;  1IDK A;  1OFM A;  2W7Z A;  4YZQ A;  5JMC B;  3B8Y A;  3LYC A;  4OJ5 A;  2NTP A;  2X6X A;  2NT9 A;  1KTW A;  4KH3 A;  1AIR A;  2X85 A;  4XKV A;  1RWR A;  2NZM A;  1CLW A;  5C1C A;  1O8L A;  2INU A;  4I84 A;  4XLA A;  2BX6 A;  1OGM X;  1LLW A;  1O8K A;  2O1D A;  1BHE A;  2VBE A;  4YCQ A;  1L1I A;  1TYW A;  1X0C A;  3SUC A;  4MXN A;  1JRG A;  1EZG A;  3H09 A;  3UW0 A;  3BH6 B;  2V5I A;  2VBK A;  1TYU A;  3VST A;  2IOU G;  1O88 A;  2ODL A;  2UVF A;  2PEC A;  4XLH A;  3SZE A;  2EWE A;  4URR A;  4PMH A;  4W8T A;  4XN0 A;  3VSU A;  4MR0 A;  3PET A;  4YEJ A;  1DBO A;  1XG2 A;  3GQ8 A;  1PE9 A;  3KRG A;  5JLV C;  1O8H A;  2UVE A;  2XTW A;  4XL9 A;  1OOC A;  4XNF A;  4HWV A;  3NAW A;  4U49 A; 
#chains in the Genus database with same CATH homology
 3GQ9 A;  1DBG A;  2IQ7 A;  2O04 A;  1O8G A;  2O0V A;  4XLE A;  2VJJ A;  2X6W A;  3LMW A;  1IB4 A;  1BN8 A;  4Z06 A;  3T9G A;  1O8F A;  2PYH A;  1H80 A;  4OZY A;  4XOR A;  2QXZ A;  4XR6 A;  3GQ7 A;  3VMV A;  4OJO A;  2O17 A;  2NST A;  2BSP A;  4U4B A;  1QJV A;  4Z05 A;  1QCX A;  1KCC A;  2PYG A;  4XKW A;  1O8J A;  2NSP A;  1K5C A;  2QY1 A;  4Z03 A;  4OJP A;  2NTB A;  3WWG A;  1EE6 A;  4AVZ A;  5C1E A;  4C2L A;  3B4N A;  3VMW A;  1RMG A;  2VBM A;  1CZF A;  1VBL A;  1RU4 A;  4XOT A;  4W8S A;  1KCD A;  4XON A;  4XM3 A;  1WMR A;  2INV A;  4XN3 A;  1PXZ A;  1O8D A;  4XLC A;  3GQA A;  1JTA A;  3B90 A;  4XOP A;  4W8R A;  4OJL A;  2VJI A;  4YZX A;  2X3H A;  3ZSC A;  2NT6 A;  1IA5 A;  4OZZ A;  1OFL A;  2QX3 A;  2O0W A;  4W8Q A;  4NK6 A;  4YEL A;  3JUR A;  3ZPP A;  2X6Y A;  1O8M A;  1O8E A;  4OJ6 A;  4YZA A;  3EQN A;  3EQO A;  1IDJ A;  1GQ8 A;  3GRH A;  3FY3 A;  1O8I A;  4XQF A;  2Z8G A;  4YZ0 A;  4XMY A;  1PLU A;  3VSV A;  4XLF A;  5AMV A;  1HG8 A;  1OGO X;  4NK8 A;  1NHC A;  2NTQ A;  4EW9 A;  1IDK A;  1OFM A;  4YZQ A;  3B8Y A;  4OJ5 A;  2NTP A;  2X6X A;  2NT9 A;  1KTW A;  1AIR A;  2X85 A;  4XKV A;  1RWR A;  2NZM A;  5C1C A;  1O8L A;  2INU A;  4I84 A;  4XLA A;  1OGM X;  1O8K A;  2O1D A;  1BHE A;  2VBE A;  1X0C A;  3SUC A;  4MXN A;  1JRG A;  3UW0 A;  2VBK A;  3VST A;  1O88 A;  2ODL A;  2UVF A;  2PEC A;  4XLH A;  2EWE A;  4URR A;  4PMH A;  4W8T A;  4XN0 A;  3VSU A;  4MR0 A;  4YEJ A;  1DBO A;  1XG2 A;  3GQ8 A;  1PE9 A;  3KRG A;  1O8H A;  2UVE A;  4XL9 A;  1OOC A;  4XNF A;  4HWV A;  4U49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...