1QJVA

Pectin methylesterase pema from erwinia chrysanthemi
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGAAVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-Dimensional Structure of Erwinia Chrysanthemi Pectin Methylesterase Reveals a Novel Esterase Active Site
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase (aspartyl esterase)
molecule keywords PECTIN METHYLESTERASE
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 1999-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1qjvA00
2X3HA 1RMGA 1RU4A 1GQ8A 1HG8A 4Z03A 1O8EA 4XORA 4YZ0A 4W8RA 4XOPA 4YELA 1PXZA 2IQ7A 2X85A 3T9GA 2QXZA 3ZSCA 4XQFA 4OZYA 1BHEA 3VMVA 1OGOX 1DBOA 1O8DA 1WMRA 4I84A 2VJIA 2X6YA 3B90A 1OGMX 4XLCA 2PECA 3VSUA 2X6WA 4MR0A 2NT6A 1DBGA 3JURA 4EW9A 4YZAA 3GQ9A 2O04A 1O8IA 4OZZA 2BSPA 1O8LA 3GQ7A 3SUCA 1KTWA 2PYGA 1NHCA 3B8YA 2NZMA 4U49A 2ODLA 2QX3A 1O8JA 2INUA 2O0VA 1AIRA 1PE9A 4XKVA 4OJ6A 5C1CA 4YZXA 3FY3A 1KCDA 4XLAA 2UVEA 4MXNA 2O1DA 2UVFA 1IDJA 2NTBA 2VJJA 1O8HA 2INVA 4XLFA 3ZPPA 1IDKA 1O8MA 1O8FA 2NSPA 2NTQA 3EQOA 2O0WA 4XM3A 2Z8GA 4YEJA 1IA5A 1CZFA 4NK8A 3GQ8A 2O17A 4XLEA 1K5CA 5C1EA 3GRHA 3B4NA 4W8TA 1H80A 4OJPA 1OOCA 4XL9A 1QJVA 3GQAA 3VSVA 1KCCA 2VBEA 4XLHA 4XOTA 2NT9A 4W8SA 4C2LA 3VSTA 4XR6A 4OJ5A 1XG2A 1VBLA 2PYHA 1EE6A 4HWVA 1O8KA 1QCXA 3UW0A 4Z05A 1IB4A 1OFLA 5AMVA 4U4BA 1RWRA 1O88A 4NK6A 2QY1A 4AVZA 4YZQA 4OJLA 1JTAA 3VMWA 4XMYA 2NTPA 1OFMA 4XN3A 4OJOA 1X0CA 1BN8A 4XNFA 1JRGA 2EWEA 4W8QA 4XN0A 4URRA 1PLUA 1O8GA 3LMWA 3KRGA 4Z06A 2VBKA 2VBMA 3EQNA 2X6XA 2NSTA 4XONA 4XKWA 3WWGA 4PMHA
chains in the Genus database with same CATH superfamily
2X3HA 1RMGA 1LLWA 3P4GA 3DU1X 1RU4A 1GQ8A 1HG8A 4Z03A 1O8EA 4YCQA 4XORA 4YZ0A 3AK5A 4W8RA 4XOPA 4YELA 1PXZA 2YUHA 2IQ7A 2X85A 3N90A 2QXZA 3T9GA 3ZSCA 4XQFA 4OZYA 1BHEA 4YFOA 3VMVA 1OGOX 3BH7B 1DBOA 1O8DA 1WMRA 2V5IA 4I84A 1QA3A 2VJIA 4OPWA 2X6YA 1EA0A 4JRAC 1QRCA 3B90A 2J8KA 1OGMX 4XLCA 2XT2A 2PECA 3VSUA 2X6WA 4MR0A 2NT6A 1DBGA 1KQ5A 1TYXA 3JURA 3PSSA 4YZAA 4EW9A 3GQ9A 2O04A 2J8IA 1CLWA 1O8IA 4OZZA 2BM6A 2BSPA 1O8LA 3GQ7A 3SUCA 1KTWA 2PYGA 1NHCA 3B8YA 2XTWA 2NZMA 4U49A 2ODLA 1OFEA 2QX3A 1O8JA 1K8FA 1WXRA 1OFDA 2INUA 2O0VA 2B0RA 1AIRA 1PE9A 4XKVA 3JX8A 4OJ6A 5C1CA 4YZXA 3FY3A 1KCDA 4XLAA 2UVEA 4MXNA 2O1DA 2UVFA 1IDJA 4YC5A 3TH0A 2NTBA 2VJJA 1O8HA 2INVA 4XLFA 3ZPPA 1QA2A 1IDKA 1O8MA 1O8FA 2NSPA 2NTQA 3EQOA 2O0WA 4XM3A 1L1IA 1TSPA 2Z8GA 4YEJA 1CZFA 4NK8A 3SY2A 1IA5A 3GQ8A 2O17A 2XT4A 4OM9A 4XLEA 1K5CA 5C1EA 3GRHA 3B4NA 5DNSA 4W8TA 1H80A 3LYCA 1LLZA 1TYUA 4OJPA 2VFPA 1OOCA 2BX6A 1QQ1A 2BM5A 4XL9A 1QJVA 3GQAA 4YDTA 3VSVA 5JLVC 2W7ZA 1KCCA 2VBEA 2XTYA 4XLHA 3PETA 3PSZA 1TYVA 4XOTA 2NT9A 4W8SA 1TYWA 3H09A 2BM4A 3ML3A 4C2LA 3VSTA 4XR6A 3LJYA 5JMCB 4OJ5A 1XG2A 1VBLA 2PYHA 1EE6A 2XC1A 4HWVA 1O8KA 1QCXA 3SQVA 3UW0A 4V02C 4Z05A 1IB4A 1EZGA 1OFLA 2VFMA 5AMVA 1LM1A 4U4BA 1RWRA 1O88A 4NK6A 2QY1A 4AVZA 4YZQA 4OJLA 1JTAA 2IOUG 2VFQA 3NB2A 4XMYA 2NTPA 3VMWA 1QA1A 1OFMA 1QRBA 3N6ZA 4OJOA 2BM7A 4XN3A 1X0CA 2VFOA 2O6WA 1K4ZA 3BH6B 1BN8A 2F3LA 4XNFA 1JRGA 1HF2A 2EWEA 4W8QA 4XN0A 4URRA 2QYUA 1PLUA 3NAWA 4KH3A 4YEIA 2QZAA 1O8GA 3LMWA 3KRGA 4Z06A 2VBKA 3SZEA 2G0YA 3RIQA 1DABA 2VBMA 3EQNA 2NSTA 2VFNA 2X6XA 4XONA 4XKWA 3SYJA 2XTXA 3WWGA 4PMHA
chains in the Genus database with same CATH topology
2X3HA 1RMGA 1RU4A 1GQ8A 1HG8A 4Z03A 1O8EA 4XORA 4YZ0A 4W8RA 4XOPA 4YELA 1PXZA 2IQ7A 2X85A 3T9GA 2QXZA 3ZSCA 4XQFA 4OZYA 1BHEA 3VMVA 1OGOX 1DBOA 1O8DA 1WMRA 4I84A 2VJIA 2X6YA 3B90A 1OGMX 4XLCA 2PECA 3VSUA 2X6WA 4MR0A 2NT6A 1DBGA 3JURA 4EW9A 4YZAA 3GQ9A 2O04A 1O8IA 4OZZA 2BSPA 1O8LA 3GQ7A 3SUCA 1KTWA 2PYGA 1NHCA 3B8YA 2NZMA 4U49A 2ODLA 2QX3A 1O8JA 2INUA 2O0VA 1AIRA 1PE9A 4XKVA 4OJ6A 5C1CA 4YZXA 3FY3A 1KCDA 4XLAA 2UVEA 4MXNA 2O1DA 2UVFA 1IDJA 2NTBA 2VJJA 1O8HA 2INVA 4XLFA 3ZPPA 1IDKA 1O8MA 1O8FA 2NSPA 2NTQA 3EQOA 2O0WA 4XM3A 2Z8GA 4YEJA 1IA5A 1CZFA 4NK8A 3GQ8A 2O17A 4XLEA 1K5CA 5C1EA 3GRHA 3B4NA 4W8TA 1H80A 4OJPA 1OOCA 4XL9A 1QJVA 3GQAA 3VSVA 1KCCA 2VBEA 4XLHA 4XOTA 2NT9A 4W8SA 4C2LA 3VSTA 4XR6A 4OJ5A 1XG2A 1VBLA 2PYHA 1EE6A 4HWVA 1O8KA 1QCXA 3UW0A 4Z05A 1IB4A 1OFLA 5AMVA 4U4BA 1RWRA 1O88A 4NK6A 2QY1A 4AVZA 4YZQA 4OJLA 1JTAA 3VMWA 4XMYA 2NTPA 1OFMA 4XN3A 4OJOA 1X0CA 1BN8A 4XNFA 1JRGA 2EWEA 4W8QA 4XN0A 4URRA 1PLUA 1O8GA 3LMWA 3KRGA 4Z06A 2VBKA 2VBMA 3EQNA 2X6XA 2NSTA 4XONA 4XKWA 3WWGA 4PMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3H A;  1RMG A;  1RU4 A;  1GQ8 A;  1HG8 A;  4Z03 A;  1O8E A;  4XOR A;  4YZ0 A;  4W8R A;  4XOP A;  4YEL A;  1PXZ A;  2IQ7 A;  2X85 A;  3T9G A;  2QXZ A;  3ZSC A;  4XQF A;  4OZY A;  1BHE A;  3VMV A;  1OGO X;  1DBO A;  1O8D A;  1WMR A;  4I84 A;  2VJI A;  2X6Y A;  3B90 A;  1OGM X;  4XLC A;  2PEC A;  3VSU A;  2X6W A;  4MR0 A;  2NT6 A;  1DBG A;  3JUR A;  4EW9 A;  4YZA A;  3GQ9 A;  2O04 A;  1O8I A;  4OZZ A;  2BSP A;  1O8L A;  3GQ7 A;  3SUC A;  1KTW A;  2PYG A;  1NHC A;  3B8Y A;  2NZM A;  4U49 A;  2ODL A;  2QX3 A;  1O8J A;  2INU A;  2O0V A;  1AIR A;  1PE9 A;  4XKV A;  4OJ6 A;  5C1C A;  4YZX A;  3FY3 A;  1KCD A;  4XLA A;  2UVE A;  4MXN A;  2O1D A;  2UVF A;  1IDJ A;  2NTB A;  2VJJ A;  1O8H A;  2INV A;  4XLF A;  3ZPP A;  1IDK A;  1O8M A;  1O8F A;  2NSP A;  2NTQ A;  3EQO A;  2O0W A;  4XM3 A;  2Z8G A;  4YEJ A;  1IA5 A;  1CZF A;  4NK8 A;  3GQ8 A;  2O17 A;  4XLE A;  1K5C A;  5C1E A;  3GRH A;  3B4N A;  4W8T A;  1H80 A;  4OJP A;  1OOC A;  4XL9 A;  1QJV A;  3GQA A;  3VSV A;  1KCC A;  2VBE A;  4XLH A;  4XOT A;  2NT9 A;  4W8S A;  4C2L A;  3VST A;  4XR6 A;  4OJ5 A;  1XG2 A;  1VBL A;  2PYH A;  1EE6 A;  4HWV A;  1O8K A;  1QCX A;  3UW0 A;  4Z05 A;  1IB4 A;  1OFL A;  5AMV A;  4U4B A;  1RWR A;  1O88 A;  4NK6 A;  2QY1 A;  4AVZ A;  4YZQ A;  4OJL A;  1JTA A;  3VMW A;  4XMY A;  2NTP A;  1OFM A;  4XN3 A;  4OJO A;  1X0C A;  1BN8 A;  4XNF A;  1JRG A;  2EWE A;  4W8Q A;  4XN0 A;  4URR A;  1PLU A;  1O8G A;  3LMW A;  3KRG A;  4Z06 A;  2VBK A;  2VBM A;  3EQN A;  2X6X A;  2NST A;  4XON A;  4XKW A;  3WWG A;  4PMH A; 
#chains in the Genus database with same CATH topology
 2X3H A;  1RMG A;  1LLW A;  3P4G A;  3DU1 X;  1RU4 A;  1GQ8 A;  1HG8 A;  4Z03 A;  1O8E A;  4YCQ A;  4XOR A;  4YZ0 A;  3AK5 A;  4W8R A;  4XOP A;  4YEL A;  1PXZ A;  2YUH A;  2IQ7 A;  2X85 A;  3N90 A;  2QXZ A;  3T9G A;  3ZSC A;  4XQF A;  4OZY A;  1BHE A;  4YFO A;  3VMV A;  1OGO X;  3BH7 B;  1DBO A;  1O8D A;  1WMR A;  2V5I A;  4I84 A;  1QA3 A;  2VJI A;  4OPW A;  2X6Y A;  1EA0 A;  4JRA C;  1QRC A;  3B90 A;  2J8K A;  1OGM X;  4XLC A;  2XT2 A;  2PEC A;  3VSU A;  2X6W A;  4MR0 A;  2NT6 A;  1DBG A;  1KQ5 A;  1TYX A;  3JUR A;  3PSS A;  4YZA A;  4EW9 A;  3GQ9 A;  2O04 A;  2J8I A;  1CLW A;  1O8I A;  4OZZ A;  2BM6 A;  2BSP A;  1O8L A;  3GQ7 A;  3SUC A;  1KTW A;  2PYG A;  1NHC A;  3B8Y A;  2XTW A;  2NZM A;  4U49 A;  2ODL A;  1OFE A;  2QX3 A;  1O8J A;  1K8F A;  1WXR A;  1OFD A;  2INU A;  2O0V A;  2B0R A;  1AIR A;  1PE9 A;  4XKV A;  3JX8 A;  4OJ6 A;  5C1C A;  4YZX A;  3FY3 A;  1KCD A;  4XLA A;  2UVE A;  4MXN A;  2O1D A;  2UVF A;  1IDJ A;  4YC5 A;  3TH0 A;  2NTB A;  2VJJ A;  1O8H A;  2INV A;  4XLF A;  3ZPP A;  1QA2 A;  1IDK A;  1O8M A;  1O8F A;  2NSP A;  2NTQ A;  3EQO A;  2O0W A;  4XM3 A;  1L1I A;  1TSP A;  2Z8G A;  4YEJ A;  1CZF A;  4NK8 A;  3SY2 A;  1IA5 A;  3GQ8 A;  2O17 A;  2XT4 A;  4OM9 A;  4XLE A;  1K5C A;  5C1E A;  3GRH A;  3B4N A;  5DNS A;  4W8T A;  1H80 A;  3LYC A;  1LLZ A;  1TYU A;  4OJP A;  2VFP A;  1OOC A;  2BX6 A;  1QQ1 A;  2BM5 A;  4XL9 A;  1QJV A;  3GQA A;  4YDT A;  3VSV A;  5JLV C;  2W7Z A;  1KCC A;  2VBE A;  2XTY A;  4XLH A;  3PET A;  3PSZ A;  1TYV A;  4XOT A;  2NT9 A;  4W8S A;  1TYW A;  3H09 A;  2BM4 A;  3ML3 A;  4C2L A;  3VST A;  4XR6 A;  3LJY A;  5JMC B;  4OJ5 A;  1XG2 A;  1VBL A;  2PYH A;  1EE6 A;  2XC1 A;  4HWV A;  1O8K A;  1QCX A;  3SQV A;  3UW0 A;  4V02 C;  4Z05 A;  1IB4 A;  1EZG A;  1OFL A;  2VFM A;  5AMV A;  1LM1 A;  4U4B A;  1RWR A;  1O88 A;  4NK6 A;  2QY1 A;  4AVZ A;  4YZQ A;  4OJL A;  1JTA A;  2IOU G;  2VFQ A;  3NB2 A;  4XMY A;  2NTP A;  3VMW A;  1QA1 A;  1OFM A;  1QRB A;  3N6Z A;  4OJO A;  2BM7 A;  4XN3 A;  1X0C A;  2VFO A;  2O6W A;  1K4Z A;  3BH6 B;  1BN8 A;  2F3L A;  4XNF A;  1JRG A;  1HF2 A;  2EWE A;  4W8Q A;  4XN0 A;  4URR A;  2QYU A;  1PLU A;  3NAW A;  4KH3 A;  4YEI A;  2QZA A;  1O8G A;  3LMW A;  3KRG A;  4Z06 A;  2VBK A;  3SZE A;  2G0Y A;  3RIQ A;  1DAB A;  2VBM A;  3EQN A;  2NST A;  2VFN A;  2X6X A;  4XON A;  4XKW A;  3SYJ A;  2XTX A;  3WWG A;  4PMH A; 
#chains in the Genus database with same CATH homology
 2X3H A;  1RMG A;  1RU4 A;  1GQ8 A;  1HG8 A;  4Z03 A;  1O8E A;  4XOR A;  4YZ0 A;  4W8R A;  4XOP A;  4YEL A;  1PXZ A;  2IQ7 A;  2X85 A;  3T9G A;  2QXZ A;  3ZSC A;  4XQF A;  4OZY A;  1BHE A;  3VMV A;  1OGO X;  1DBO A;  1O8D A;  1WMR A;  4I84 A;  2VJI A;  2X6Y A;  3B90 A;  1OGM X;  4XLC A;  2PEC A;  3VSU A;  2X6W A;  4MR0 A;  2NT6 A;  1DBG A;  3JUR A;  4EW9 A;  4YZA A;  3GQ9 A;  2O04 A;  1O8I A;  4OZZ A;  2BSP A;  1O8L A;  3GQ7 A;  3SUC A;  1KTW A;  2PYG A;  1NHC A;  3B8Y A;  2NZM A;  4U49 A;  2ODL A;  2QX3 A;  1O8J A;  2INU A;  2O0V A;  1AIR A;  1PE9 A;  4XKV A;  4OJ6 A;  5C1C A;  4YZX A;  3FY3 A;  1KCD A;  4XLA A;  2UVE A;  4MXN A;  2O1D A;  2UVF A;  1IDJ A;  2NTB A;  2VJJ A;  1O8H A;  2INV A;  4XLF A;  3ZPP A;  1IDK A;  1O8M A;  1O8F A;  2NSP A;  2NTQ A;  3EQO A;  2O0W A;  4XM3 A;  2Z8G A;  4YEJ A;  1IA5 A;  1CZF A;  4NK8 A;  3GQ8 A;  2O17 A;  4XLE A;  1K5C A;  5C1E A;  3GRH A;  3B4N A;  4W8T A;  1H80 A;  4OJP A;  1OOC A;  4XL9 A;  1QJV A;  3GQA A;  3VSV A;  1KCC A;  2VBE A;  4XLH A;  4XOT A;  2NT9 A;  4W8S A;  4C2L A;  3VST A;  4XR6 A;  4OJ5 A;  1XG2 A;  1VBL A;  2PYH A;  1EE6 A;  4HWV A;  1O8K A;  1QCX A;  3UW0 A;  4Z05 A;  1IB4 A;  1OFL A;  5AMV A;  4U4B A;  1RWR A;  1O88 A;  4NK6 A;  2QY1 A;  4AVZ A;  4YZQ A;  4OJL A;  1JTA A;  3VMW A;  4XMY A;  2NTP A;  1OFM A;  4XN3 A;  4OJO A;  1X0C A;  1BN8 A;  4XNF A;  1JRG A;  2EWE A;  4W8Q A;  4XN0 A;  4URR A;  1PLU A;  1O8G A;  3LMW A;  3KRG A;  4Z06 A;  2VBK A;  2VBM A;  3EQN A;  2X6X A;  2NST A;  4XON A;  4XKW A;  3WWG A;  4PMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...