1QJVA

Pectin methylesterase pema from erwinia chrysanthemi
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGAAVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PECTIN METHYLESTERASE
publication title Three-Dimensional Structure of Erwinia Chrysanthemi Pectin Methylesterase Reveals a Novel Esterase Active Site
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase (aspartyl esterase)
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 1999-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1qjvA00
3GQ9A 2NTQA 1PLUA 1JRGA 1IDKA 1O8EA 1VBLA 2NZMA 2VJJA 2UVEA 3VSTA 4NK8A 4XKWA 4XL9A 4Z05A 3B8YA 4XQFA 2QY1A 1RWRA 4XR6A 2O1DA 4OJ6A 3EQNA 2VBMA 4URRA 1NHCA 4NK6A 4YZAA 1K5CA 1O8DA 2O0VA 1GQ8A 3LMWA 2EWEA 1O8FA 1PXZA 1IA5A 3VSUA 2NT9A 4YZQA 1OFLA 1OFMA 2VJIA 2IQ7A 4XN0A 4YELA 1QJVA 1RU4A 3GRHA 2NTPA 2VBEA 3VMVA 1KTWA 1XG2A 4XN3A 2UVFA 3VSVA 3GQAA 2NSPA 2X85A 4XORA 1BHEA 4YEJA 4C2LA 3T9GA 4OZYA 4PMHA 4XLFA 3JURA 2Z8GA 3ZPPA 4XLAA 1CZFA 4I84A 1WMRA 1QCXA 4HWVA 3ZSCA 2X6WA 5AMVA 1OGMX 1OOCA 4OJLA 1IB4A 1DBGA 1O8MA 4W8TA 4OJPA 1O88A 2QXZA 2O04A 2PECA 1KCCA 4XLCA 2NTBA 4OJOA 4XOTA 3SUCA 3KRGA 3GQ8A 1HG8A 4Z06A 2QX3A 2O0WA 4W8QA 1JTAA 3UW0A 4W8RA 1O8KA 2BSPA 3B90A 3FY3A 4XMYA 2INVA 1RMGA 2VBKA 4U49A 1EE6A 1H80A 1OGOX 2PYGA 4XNFA 1O8LA 1KCDA 1PE9A 2X6XA 4EW9A 3WWGA 4OJ5A 4Z03A 1BN8A 4OZZA 3EQOA 3GQ7A 3VMWA 4XOPA 2X3HA 2PYHA 4XLHA 4XM3A 4MXNA 1IDJA 2INUA 1AIRA 1O8HA 4XLEA 1O8JA 2NSTA 4YZXA 2X6YA 4XONA 4U4BA 4W8SA 5C1EA 3B4NA 2O17A 2ODLA 4XKVA 2NT6A 1DBOA 4MR0A 1X0CA 5C1CA 4AVZA 4YZ0A 1O8GA 1O8IA
chains in the Genus database with same CATH superfamily
3GQ9A 2NTQA 2XT4A 3N6ZA 1PLUA 1JRGA 1IDKA 1O8EA 1VBLA 2NZMA 2VJJA 2UVEA 2YUHA 4OPWA 3VSTA 3SZEA 1OFDA 4NK8A 4XKWA 4XL9A 4Z05A 1QA2A 3B8YA 1LLWA 2G0YA 2QY1A 4XQFA 1RWRA 4XR6A 2O1DA 4OJ6A 3EQNA 2BM5A 2VBMA 4URRA 4YDTA 1NHCA 4NK6A 3ML3A 4YZAA 1LLZA 1K5CA 2QYUA 2XTYA 1O8DA 2VFPA 2O0VA 1GQ8A 3LMWA 2BM6A 2EWEA 3NB2A 1O8FA 1PXZA 2BM7A 2XT2A 1IA5A 3VSUA 2NT9A 4YZQA 2BX6A 5DNSA 1OFLA 1OFMA 2IQ7A 2VJIA 2XC1A 4XN0A 3RIQA 4YELA 3SY2A 1QJVA 1RU4A 3GRHA 2NTPA 1QRBA 2VBEA 3VMVA 1QA3A 1KTWA 1XG2A 4XN3A 1OFEA 1K8FA 2UVFA 2QZAA 3GQAA 2NSPA 2X85A 3VSVA 5JLVC 3SYJA 3BH6B 4XORA 1BHEA 4YEJA 4C2LA 3T9GA 4OZYA 4PMHA 4XLFA 3JURA 4YC5A 2Z8GA 3ZPPA 1TYVA 3P4GA 4XLAA 1CZFA 4I84A 1WMRA 1QCXA 4HWVA 3ZSCA 2BM4A 2X6WA 1OGMX 5AMVA 2J8KA 1OOCA 4KH3A 4OJLA 2J8IA 1WXRA 1IB4A 1DBGA 1O8MA 4W8TA 4OJPA 1O88A 2QXZA 2O04A 3DU1X 1CLWA 2PECA 3N90A 2XTXA 1KQ5A 1KCCA 4XLCA 5JMCB 2NTBA 2XTWA 4OJOA 4XOTA 3SUCA 1DABA 1L1IA 3KRGA 3GQ8A 1HG8A 4Z06A 3H09A 2QX3A 2O0WA 4W8QA 1TYUA 1JTAA 3LJYA 3UW0A 4W8RA 1O8KA 2BSPA 3B90A 3FY3A 4YFOA 1QA1A 1TYXA 4XMYA 3LYCA 2INVA 1RMGA 2VBKA 4U49A 1EE6A 1H80A 1OGOX 3BH7B 3SQVA 2PYGA 4XNFA 1O8LA 1KCDA 1K4ZA 1PE9A 3PETA 2F3LA 2B0RA 2X6XA 3WWGA 4EW9A 3NAWA 4OJ5A 2W7ZA 4Z03A 1BN8A 4JRAC 1LM1A 3EQOA 3GQ7A 4OZZA 4V02C 3VMWA 4YEIA 4XOPA 2X3HA 2PYHA 4XLHA 4XM3A 4MXNA 1IDJA 4OM9A 2INUA 2O6WA 1AIRA 1HF2A 1TYWA 1O8HA 2VFNA 4XLEA 1O8JA 2NSTA 4YZXA 2X6YA 4XONA 3PSSA 4U4BA 4W8SA 1QQ1A 3AK5A 1EA0A 2VFQA 1TSPA 5C1EA 4YCQA 3B4NA 3PSZA 2O17A 2VFMA 2ODLA 4XKVA 1QRCA 3JX8A 3TH0A 2NT6A 1DBOA 4MR0A 1X0CA 2V5IA 5C1CA 2VFOA 4AVZA 2IOUG 4YZ0A 1EZGA 1O8GA 1O8IA
chains in the Genus database with same CATH topology
3GQ9A 2NTQA 1PLUA 1JRGA 1IDKA 1O8EA 1VBLA 2NZMA 2VJJA 2UVEA 3VSTA 4NK8A 4XKWA 4XL9A 4Z05A 3B8YA 4XQFA 2QY1A 1RWRA 4XR6A 2O1DA 4OJ6A 3EQNA 2VBMA 4URRA 1NHCA 4NK6A 4YZAA 1K5CA 1O8DA 2O0VA 1GQ8A 3LMWA 2EWEA 1O8FA 1PXZA 1IA5A 3VSUA 2NT9A 4YZQA 1OFLA 1OFMA 2VJIA 2IQ7A 4XN0A 4YELA 1QJVA 1RU4A 3GRHA 2NTPA 2VBEA 3VMVA 1KTWA 1XG2A 4XN3A 2UVFA 3VSVA 3GQAA 2NSPA 2X85A 4XORA 1BHEA 4YEJA 4C2LA 3T9GA 4OZYA 4PMHA 4XLFA 3JURA 2Z8GA 3ZPPA 4XLAA 1CZFA 4I84A 1WMRA 1QCXA 4HWVA 3ZSCA 2X6WA 5AMVA 1OGMX 1OOCA 4OJLA 1IB4A 1DBGA 1O8MA 4W8TA 4OJPA 1O88A 2QXZA 2O04A 2PECA 1KCCA 4XLCA 2NTBA 4OJOA 4XOTA 3SUCA 3KRGA 3GQ8A 1HG8A 4Z06A 2QX3A 2O0WA 4W8QA 1JTAA 3UW0A 4W8RA 1O8KA 2BSPA 3B90A 3FY3A 4XMYA 2INVA 1RMGA 2VBKA 4U49A 1EE6A 1H80A 1OGOX 2PYGA 4XNFA 1O8LA 1KCDA 1PE9A 2X6XA 4EW9A 3WWGA 4OJ5A 4Z03A 1BN8A 4OZZA 3EQOA 3GQ7A 3VMWA 4XOPA 2X3HA 2PYHA 4XLHA 4XM3A 4MXNA 1IDJA 2INUA 1AIRA 1O8HA 4XLEA 1O8JA 2NSTA 4YZXA 2X6YA 4XONA 4U4BA 4W8SA 5C1EA 3B4NA 2O17A 2ODLA 4XKVA 2NT6A 1DBOA 4MR0A 1X0CA 5C1CA 4AVZA 4YZ0A 1O8GA 1O8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ9 A;  2NTQ A;  1PLU A;  1JRG A;  1IDK A;  1O8E A;  1VBL A;  2NZM A;  2VJJ A;  2UVE A;  3VST A;  4NK8 A;  4XKW A;  4XL9 A;  4Z05 A;  3B8Y A;  4XQF A;  2QY1 A;  1RWR A;  4XR6 A;  2O1D A;  4OJ6 A;  3EQN A;  2VBM A;  4URR A;  1NHC A;  4NK6 A;  4YZA A;  1K5C A;  1O8D A;  2O0V A;  1GQ8 A;  3LMW A;  2EWE A;  1O8F A;  1PXZ A;  1IA5 A;  3VSU A;  2NT9 A;  4YZQ A;  1OFL A;  1OFM A;  2VJI A;  2IQ7 A;  4XN0 A;  4YEL A;  1QJV A;  1RU4 A;  3GRH A;  2NTP A;  2VBE A;  3VMV A;  1KTW A;  1XG2 A;  4XN3 A;  2UVF A;  3VSV A;  3GQA A;  2NSP A;  2X85 A;  4XOR A;  1BHE A;  4YEJ A;  4C2L A;  3T9G A;  4OZY A;  4PMH A;  4XLF A;  3JUR A;  2Z8G A;  3ZPP A;  4XLA A;  1CZF A;  4I84 A;  1WMR A;  1QCX A;  4HWV A;  3ZSC A;  2X6W A;  5AMV A;  1OGM X;  1OOC A;  4OJL A;  1IB4 A;  1DBG A;  1O8M A;  4W8T A;  4OJP A;  1O88 A;  2QXZ A;  2O04 A;  2PEC A;  1KCC A;  4XLC A;  2NTB A;  4OJO A;  4XOT A;  3SUC A;  3KRG A;  3GQ8 A;  1HG8 A;  4Z06 A;  2QX3 A;  2O0W A;  4W8Q A;  1JTA A;  3UW0 A;  4W8R A;  1O8K A;  2BSP A;  3B90 A;  3FY3 A;  4XMY A;  2INV A;  1RMG A;  2VBK A;  4U49 A;  1EE6 A;  1H80 A;  1OGO X;  2PYG A;  4XNF A;  1O8L A;  1KCD A;  1PE9 A;  2X6X A;  4EW9 A;  3WWG A;  4OJ5 A;  4Z03 A;  1BN8 A;  4OZZ A;  3EQO A;  3GQ7 A;  3VMW A;  4XOP A;  2X3H A;  2PYH A;  4XLH A;  4XM3 A;  4MXN A;  1IDJ A;  2INU A;  1AIR A;  1O8H A;  4XLE A;  1O8J A;  2NST A;  4YZX A;  2X6Y A;  4XON A;  4U4B A;  4W8S A;  5C1E A;  3B4N A;  2O17 A;  2ODL A;  4XKV A;  2NT6 A;  1DBO A;  4MR0 A;  1X0C A;  5C1C A;  4AVZ A;  4YZ0 A;  1O8G A;  1O8I A; 
#chains in the Genus database with same CATH topology
 3GQ9 A;  2NTQ A;  2XT4 A;  3N6Z A;  1PLU A;  1JRG A;  1IDK A;  1O8E A;  1VBL A;  2NZM A;  2VJJ A;  2UVE A;  2YUH A;  4OPW A;  3VST A;  3SZE A;  1OFD A;  4NK8 A;  4XKW A;  4XL9 A;  4Z05 A;  1QA2 A;  3B8Y A;  1LLW A;  2G0Y A;  2QY1 A;  4XQF A;  1RWR A;  4XR6 A;  2O1D A;  4OJ6 A;  3EQN A;  2BM5 A;  2VBM A;  4URR A;  4YDT A;  1NHC A;  4NK6 A;  3ML3 A;  4YZA A;  1LLZ A;  1K5C A;  2QYU A;  2XTY A;  1O8D A;  2VFP A;  2O0V A;  1GQ8 A;  3LMW A;  2BM6 A;  2EWE A;  3NB2 A;  1O8F A;  1PXZ A;  2BM7 A;  2XT2 A;  1IA5 A;  3VSU A;  2NT9 A;  4YZQ A;  2BX6 A;  5DNS A;  1OFL A;  1OFM A;  2IQ7 A;  2VJI A;  2XC1 A;  4XN0 A;  3RIQ A;  4YEL A;  3SY2 A;  1QJV A;  1RU4 A;  3GRH A;  2NTP A;  1QRB A;  2VBE A;  3VMV A;  1QA3 A;  1KTW A;  1XG2 A;  4XN3 A;  1OFE A;  1K8F A;  2UVF A;  2QZA A;  3GQA A;  2NSP A;  2X85 A;  3VSV A;  5JLV C;  3SYJ A;  3BH6 B;  4XOR A;  1BHE A;  4YEJ A;  4C2L A;  3T9G A;  4OZY A;  4PMH A;  4XLF A;  3JUR A;  4YC5 A;  2Z8G A;  3ZPP A;  1TYV A;  3P4G A;  4XLA A;  1CZF A;  4I84 A;  1WMR A;  1QCX A;  4HWV A;  3ZSC A;  2BM4 A;  2X6W A;  1OGM X;  5AMV A;  2J8K A;  1OOC A;  4KH3 A;  4OJL A;  2J8I A;  1WXR A;  1IB4 A;  1DBG A;  1O8M A;  4W8T A;  4OJP A;  1O88 A;  2QXZ A;  2O04 A;  3DU1 X;  1CLW A;  2PEC A;  3N90 A;  2XTX A;  1KQ5 A;  1KCC A;  4XLC A;  5JMC B;  2NTB A;  2XTW A;  4OJO A;  4XOT A;  3SUC A;  1DAB A;  1L1I A;  3KRG A;  3GQ8 A;  1HG8 A;  4Z06 A;  3H09 A;  2QX3 A;  2O0W A;  4W8Q A;  1TYU A;  1JTA A;  3LJY A;  3UW0 A;  4W8R A;  1O8K A;  2BSP A;  3B90 A;  3FY3 A;  4YFO A;  1QA1 A;  1TYX A;  4XMY A;  3LYC A;  2INV A;  1RMG A;  2VBK A;  4U49 A;  1EE6 A;  1H80 A;  1OGO X;  3BH7 B;  3SQV A;  2PYG A;  4XNF A;  1O8L A;  1KCD A;  1K4Z A;  1PE9 A;  3PET A;  2F3L A;  2B0R A;  2X6X A;  3WWG A;  4EW9 A;  3NAW A;  4OJ5 A;  2W7Z A;  4Z03 A;  1BN8 A;  4JRA C;  1LM1 A;  3EQO A;  3GQ7 A;  4OZZ A;  4V02 C;  3VMW A;  4YEI A;  4XOP A;  2X3H A;  2PYH A;  4XLH A;  4XM3 A;  4MXN A;  1IDJ A;  4OM9 A;  2INU A;  2O6W A;  1AIR A;  1HF2 A;  1TYW A;  1O8H A;  2VFN A;  4XLE A;  1O8J A;  2NST A;  4YZX A;  2X6Y A;  4XON A;  3PSS A;  4U4B A;  4W8S A;  1QQ1 A;  3AK5 A;  1EA0 A;  2VFQ A;  1TSP A;  5C1E A;  4YCQ A;  3B4N A;  3PSZ A;  2O17 A;  2VFM A;  2ODL A;  4XKV A;  1QRC A;  3JX8 A;  3TH0 A;  2NT6 A;  1DBO A;  4MR0 A;  1X0C A;  2V5I A;  5C1C A;  2VFO A;  4AVZ A;  2IOU G;  4YZ0 A;  1EZG A;  1O8G A;  1O8I A; 
#chains in the Genus database with same CATH homology
 3GQ9 A;  2NTQ A;  1PLU A;  1JRG A;  1IDK A;  1O8E A;  1VBL A;  2NZM A;  2VJJ A;  2UVE A;  3VST A;  4NK8 A;  4XKW A;  4XL9 A;  4Z05 A;  3B8Y A;  4XQF A;  2QY1 A;  1RWR A;  4XR6 A;  2O1D A;  4OJ6 A;  3EQN A;  2VBM A;  4URR A;  1NHC A;  4NK6 A;  4YZA A;  1K5C A;  1O8D A;  2O0V A;  1GQ8 A;  3LMW A;  2EWE A;  1O8F A;  1PXZ A;  1IA5 A;  3VSU A;  2NT9 A;  4YZQ A;  1OFL A;  1OFM A;  2VJI A;  2IQ7 A;  4XN0 A;  4YEL A;  1QJV A;  1RU4 A;  3GRH A;  2NTP A;  2VBE A;  3VMV A;  1KTW A;  1XG2 A;  4XN3 A;  2UVF A;  3VSV A;  3GQA A;  2NSP A;  2X85 A;  4XOR A;  1BHE A;  4YEJ A;  4C2L A;  3T9G A;  4OZY A;  4PMH A;  4XLF A;  3JUR A;  2Z8G A;  3ZPP A;  4XLA A;  1CZF A;  4I84 A;  1WMR A;  1QCX A;  4HWV A;  3ZSC A;  2X6W A;  5AMV A;  1OGM X;  1OOC A;  4OJL A;  1IB4 A;  1DBG A;  1O8M A;  4W8T A;  4OJP A;  1O88 A;  2QXZ A;  2O04 A;  2PEC A;  1KCC A;  4XLC A;  2NTB A;  4OJO A;  4XOT A;  3SUC A;  3KRG A;  3GQ8 A;  1HG8 A;  4Z06 A;  2QX3 A;  2O0W A;  4W8Q A;  1JTA A;  3UW0 A;  4W8R A;  1O8K A;  2BSP A;  3B90 A;  3FY3 A;  4XMY A;  2INV A;  1RMG A;  2VBK A;  4U49 A;  1EE6 A;  1H80 A;  1OGO X;  2PYG A;  4XNF A;  1O8L A;  1KCD A;  1PE9 A;  2X6X A;  4EW9 A;  3WWG A;  4OJ5 A;  4Z03 A;  1BN8 A;  4OZZ A;  3EQO A;  3GQ7 A;  3VMW A;  4XOP A;  2X3H A;  2PYH A;  4XLH A;  4XM3 A;  4MXN A;  1IDJ A;  2INU A;  1AIR A;  1O8H A;  4XLE A;  1O8J A;  2NST A;  4YZX A;  2X6Y A;  4XON A;  4U4B A;  4W8S A;  5C1E A;  3B4N A;  2O17 A;  2ODL A;  4XKV A;  2NT6 A;  1DBO A;  4MR0 A;  1X0C A;  5C1C A;  4AVZ A;  4YZ0 A;  1O8G A;  1O8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...