1QJVA

Pectin methylesterase pema from erwinia chrysanthemi
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGAAVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (aspartyl esterase)
molecule keywords PECTIN METHYLESTERASE
publication title Three-Dimensional Structure of Erwinia Chrysanthemi Pectin Methylesterase Reveals a Novel Esterase Active Site
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 1999-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1qjvA00
1RU4A 4OJPA 4XL9A 1DBGA 2UVFA 4OJ5A 3ZPPA 1HG8A 2INUA 2VBKA 3VSTA 2VBMA 4YZ0A 4XORA 2PYHA 1O8KA 3VMVA 2X85A 2INVA 2VJJA 1KCCA 4XOTA 4C2LA 2NTBA 1RWRA 3GQAA 1O8HA 1KTWA 2PYGA 3GQ8A 4Z03A 4PMHA 2QX3A 1IDJA 1O8IA 1XG2A 2O0VA 2O1DA 4I84A 2PECA 4W8RA 3JURA 4YZAA 4W8QA 4NK8A 2NTPA 1JRGA 1O88A 4XLCA 2O17A 2X6WA 2X6YA 1OGMX 2NSTA 1BN8A 2NSPA 3B8YA 3FY3A 3GQ9A 1H80A 4OZZA 4U4BA 3ZSCA 4XMYA 4W8SA 2VJIA 1VBLA 1O8GA 2NT6A 1OGOX 3VMWA 1OFLA 4XNFA 2Z8GA 4U49A 4XKVA 2QXZA 2O0WA 3VSVA 1EE6A 5C1EA 1GQ8A 3UW0A 1QJVA 2QY1A 4YZQA 4MXNA 1O8FA 4NK6A 4YZXA 1QCXA 3GRHA 4Z05A 4XN3A 4EW9A 4XLHA 3B4NA 1PXZA 2UVEA 1WMRA 4XN0A 1IB4A 2X3HA 3B90A 3KRGA 4MR0A 4OJLA 4XONA 1DBOA 5C1CA 2NT9A 3SUCA 4Z06A 4OZYA 4OJOA 4XLEA 4AVZA 1O8LA 3VSUA 1RMGA 4XM3A 2NZMA 2IQ7A 1K5CA 3EQNA 4HWVA 4OJ6A 1CZFA 1O8JA 4XLAA 1BHEA 4URRA 3WWGA 2EWEA 4XR6A 4YELA 2BSPA 2NTQA 4XQFA 4W8TA 1AIRA 3T9GA 1OFMA 1X0CA 1PLUA 2O04A 4XLFA 1IA5A 3EQOA 4YEJA 1O8EA 2VBEA 1O8MA 2ODLA 1JTAA 4XKWA 4XOPA 1KCDA 1IDKA 1PE9A 1O8DA 1OOCA 5AMVA 3LMWA 1NHCA 2X6XA 3GQ7A
chains in the Genus database with same CATH superfamily
1RU4A 5JLVC 4OJPA 2J8IA 1TYXA 4XL9A 1DBGA 2UVFA 4OJ5A 3AK5A 2IOUG 3ZPPA 1DABA 1HG8A 4YEIA 3LJYA 2INUA 2VBKA 3VSTA 2VBMA 2BX6A 2O6WA 2J8KA 3LYCA 4YZ0A 3JX8A 4XORA 2PYHA 1O8KA 2XT4A 1LLWA 2X85A 2V5IA 3VMVA 2INVA 2VJJA 1LLZA 1KCCA 4XOTA 4C2LA 2NTBA 5DNSA 1RWRA 3GQAA 4OM9A 3PSSA 1LM1A 1O8HA 1KTWA 3ZSCA 2PYGA 3GQ8A 1EA0A 4Z03A 4PMHA 2QX3A 3SYJA 1IDJA 1O8IA 1QRCA 1XG2A 2O0VA 2O1DA 4I84A 2PECA 4W8RA 3JURA 4YC5A 2XC1A 4W8QA 4YZAA 4NK8A 2NTPA 2BM7A 2XTXA 1JRGA 1O88A 4XLCA 2O17A 2X6WA 1OGMX 2X6YA 2NSTA 1BN8A 1EZGA 2NSPA 2XT2A 3B8YA 1H80A 3GQ9A 3NB2A 2W7ZA 4OZZA 4U4BA 3N6ZA 4W8SA 4XMYA 2QYUA 2VJIA 1VBLA 1K8FA 1O8GA 2NT6A 1OGOX 3BH7B 3SQVA 3VMWA 1OFLA 4XNFA 1QA3A 2Z8GA 4U49A 4XKVA 3SY2A 4V02C 2QXZA 2VFOA 3BH6B 2O0WA 2XTYA 1EE6A 1HF2A 5C1EA 3VSVA 3P4GA 2VFPA 1GQ8A 3ML3A 3UW0A 1QJVA 1TSPA 2QY1A 4YDTA 4YZQA 4JRAC 3NAWA 4MXNA 1O8FA 4NK6A 4YZXA 1QCXA 3GRHA 4Z05A 4XN3A 4EW9A 4XLHA 3B4NA 1PXZA 2UVEA 1WMRA 4KH3A 4XN0A 1IB4A 2X3HA 1TYUA 3B90A 2B0RA 3KRGA 2VFNA 3FY3A 4MR0A 4OJLA 1DBOA 4XONA 5C1CA 2NT9A 3N90A 3SUCA 1QRBA 4Z06A 4OZYA 3DU1X 4OJOA 1OFEA 2F3LA 4XLEA 4AVZA 1O8LA 2BM5A 4OPWA 3PSZA 1QA2A 3VSUA 1RMGA 1WXRA 3PETA 4XM3A 1CLWA 2YUHA 2QZAA 3TH0A 2NZMA 2IQ7A 1K5CA 3EQNA 4HWVA 3H09A 1KQ5A 4OJ6A 1CZFA 1O8JA 1QQ1A 4XLAA 1BHEA 4URRA 3WWGA 2EWEA 4XR6A 4YELA 2BM4A 2BSPA 2NTQA 2VFMA 4XQFA 4W8TA 1AIRA 1OFDA 3T9GA 1OFMA 4YFOA 1X0CA 1PLUA 2O04A 4XLFA 1IA5A 3EQOA 1TYVA 4YEJA 1O8EA 2VBEA 1O8MA 4YCQA 2ODLA 1JTAA 4XKWA 4XOPA 3SZEA 1KCDA 1L1IA 1IDKA 1TYWA 1PE9A 1O8DA 1OOCA 2BM6A 5AMVA 3RIQA 5JMCB 1QA1A 2G0YA 3LMWA 1NHCA 1K4ZA 2X6XA 2XTWA 2VFQA 3GQ7A
chains in the Genus database with same CATH topology
1RU4A 4OJPA 4XL9A 1DBGA 2UVFA 4OJ5A 3ZPPA 1HG8A 2INUA 2VBKA 3VSTA 2VBMA 4YZ0A 4XORA 2PYHA 1O8KA 3VMVA 2X85A 2INVA 2VJJA 1KCCA 4XOTA 4C2LA 2NTBA 1RWRA 3GQAA 1O8HA 1KTWA 2PYGA 3GQ8A 4Z03A 4PMHA 2QX3A 1IDJA 1O8IA 1XG2A 2O0VA 2O1DA 4I84A 2PECA 4W8RA 3JURA 4YZAA 4W8QA 4NK8A 2NTPA 1JRGA 1O88A 4XLCA 2O17A 2X6WA 2X6YA 1OGMX 2NSTA 1BN8A 2NSPA 3B8YA 3FY3A 3GQ9A 1H80A 4OZZA 4U4BA 3ZSCA 4XMYA 4W8SA 2VJIA 1VBLA 1O8GA 2NT6A 1OGOX 3VMWA 1OFLA 4XNFA 2Z8GA 4U49A 4XKVA 2QXZA 2O0WA 3VSVA 1EE6A 5C1EA 1GQ8A 3UW0A 1QJVA 2QY1A 4YZQA 4MXNA 1O8FA 4NK6A 4YZXA 1QCXA 3GRHA 4Z05A 4XN3A 4EW9A 4XLHA 3B4NA 1PXZA 2UVEA 1WMRA 4XN0A 1IB4A 2X3HA 3B90A 3KRGA 4MR0A 4OJLA 4XONA 1DBOA 5C1CA 2NT9A 3SUCA 4Z06A 4OZYA 4OJOA 4XLEA 4AVZA 1O8LA 3VSUA 1RMGA 4XM3A 2NZMA 2IQ7A 1K5CA 3EQNA 4HWVA 4OJ6A 1CZFA 1O8JA 4XLAA 1BHEA 4URRA 3WWGA 2EWEA 4XR6A 4YELA 2BSPA 2NTQA 4XQFA 4W8TA 1AIRA 3T9GA 1OFMA 1X0CA 1PLUA 2O04A 4XLFA 1IA5A 3EQOA 4YEJA 1O8EA 2VBEA 1O8MA 2ODLA 1JTAA 4XKWA 4XOPA 1KCDA 1IDKA 1PE9A 1O8DA 1OOCA 5AMVA 3LMWA 1NHCA 2X6XA 3GQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU4 A;  4OJP A;  4XL9 A;  1DBG A;  2UVF A;  4OJ5 A;  3ZPP A;  1HG8 A;  2INU A;  2VBK A;  3VST A;  2VBM A;  4YZ0 A;  4XOR A;  2PYH A;  1O8K A;  3VMV A;  2X85 A;  2INV A;  2VJJ A;  1KCC A;  4XOT A;  4C2L A;  2NTB A;  1RWR A;  3GQA A;  1O8H A;  1KTW A;  2PYG A;  3GQ8 A;  4Z03 A;  4PMH A;  2QX3 A;  1IDJ A;  1O8I A;  1XG2 A;  2O0V A;  2O1D A;  4I84 A;  2PEC A;  4W8R A;  3JUR A;  4YZA A;  4W8Q A;  4NK8 A;  2NTP A;  1JRG A;  1O88 A;  4XLC A;  2O17 A;  2X6W A;  2X6Y A;  1OGM X;  2NST A;  1BN8 A;  2NSP A;  3B8Y A;  3FY3 A;  3GQ9 A;  1H80 A;  4OZZ A;  4U4B A;  3ZSC A;  4XMY A;  4W8S A;  2VJI A;  1VBL A;  1O8G A;  2NT6 A;  1OGO X;  3VMW A;  1OFL A;  4XNF A;  2Z8G A;  4U49 A;  4XKV A;  2QXZ A;  2O0W A;  3VSV A;  1EE6 A;  5C1E A;  1GQ8 A;  3UW0 A;  1QJV A;  2QY1 A;  4YZQ A;  4MXN A;  1O8F A;  4NK6 A;  4YZX A;  1QCX A;  3GRH A;  4Z05 A;  4XN3 A;  4EW9 A;  4XLH A;  3B4N A;  1PXZ A;  2UVE A;  1WMR A;  4XN0 A;  1IB4 A;  2X3H A;  3B90 A;  3KRG A;  4MR0 A;  4OJL A;  4XON A;  1DBO A;  5C1C A;  2NT9 A;  3SUC A;  4Z06 A;  4OZY A;  4OJO A;  4XLE A;  4AVZ A;  1O8L A;  3VSU A;  1RMG A;  4XM3 A;  2NZM A;  2IQ7 A;  1K5C A;  3EQN A;  4HWV A;  4OJ6 A;  1CZF A;  1O8J A;  4XLA A;  1BHE A;  4URR A;  3WWG A;  2EWE A;  4XR6 A;  4YEL A;  2BSP A;  2NTQ A;  4XQF A;  4W8T A;  1AIR A;  3T9G A;  1OFM A;  1X0C A;  1PLU A;  2O04 A;  4XLF A;  1IA5 A;  3EQO A;  4YEJ A;  1O8E A;  2VBE A;  1O8M A;  2ODL A;  1JTA A;  4XKW A;  4XOP A;  1KCD A;  1IDK A;  1PE9 A;  1O8D A;  1OOC A;  5AMV A;  3LMW A;  1NHC A;  2X6X A;  3GQ7 A; 
#chains in the Genus database with same CATH topology
 1RU4 A;  5JLV C;  4OJP A;  2J8I A;  1TYX A;  4XL9 A;  1DBG A;  2UVF A;  4OJ5 A;  3AK5 A;  2IOU G;  3ZPP A;  1DAB A;  1HG8 A;  4YEI A;  3LJY A;  2INU A;  2VBK A;  3VST A;  2VBM A;  2BX6 A;  2O6W A;  2J8K A;  3LYC A;  4YZ0 A;  3JX8 A;  4XOR A;  2PYH A;  1O8K A;  2XT4 A;  1LLW A;  2X85 A;  2V5I A;  3VMV A;  2INV A;  2VJJ A;  1LLZ A;  1KCC A;  4XOT A;  4C2L A;  2NTB A;  5DNS A;  1RWR A;  3GQA A;  4OM9 A;  3PSS A;  1LM1 A;  1O8H A;  1KTW A;  3ZSC A;  2PYG A;  3GQ8 A;  1EA0 A;  4Z03 A;  4PMH A;  2QX3 A;  3SYJ A;  1IDJ A;  1O8I A;  1QRC A;  1XG2 A;  2O0V A;  2O1D A;  4I84 A;  2PEC A;  4W8R A;  3JUR A;  4YC5 A;  2XC1 A;  4W8Q A;  4YZA A;  4NK8 A;  2NTP A;  2BM7 A;  2XTX A;  1JRG A;  1O88 A;  4XLC A;  2O17 A;  2X6W A;  1OGM X;  2X6Y A;  2NST A;  1BN8 A;  1EZG A;  2NSP A;  2XT2 A;  3B8Y A;  1H80 A;  3GQ9 A;  3NB2 A;  2W7Z A;  4OZZ A;  4U4B A;  3N6Z A;  4W8S A;  4XMY A;  2QYU A;  2VJI A;  1VBL A;  1K8F A;  1O8G A;  2NT6 A;  1OGO X;  3BH7 B;  3SQV A;  3VMW A;  1OFL A;  4XNF A;  1QA3 A;  2Z8G A;  4U49 A;  4XKV A;  3SY2 A;  4V02 C;  2QXZ A;  2VFO A;  3BH6 B;  2O0W A;  2XTY A;  1EE6 A;  1HF2 A;  5C1E A;  3VSV A;  3P4G A;  2VFP A;  1GQ8 A;  3ML3 A;  3UW0 A;  1QJV A;  1TSP A;  2QY1 A;  4YDT A;  4YZQ A;  4JRA C;  3NAW A;  4MXN A;  1O8F A;  4NK6 A;  4YZX A;  1QCX A;  3GRH A;  4Z05 A;  4XN3 A;  4EW9 A;  4XLH A;  3B4N A;  1PXZ A;  2UVE A;  1WMR A;  4KH3 A;  4XN0 A;  1IB4 A;  2X3H A;  1TYU A;  3B90 A;  2B0R A;  3KRG A;  2VFN A;  3FY3 A;  4MR0 A;  4OJL A;  1DBO A;  4XON A;  5C1C A;  2NT9 A;  3N90 A;  3SUC A;  1QRB A;  4Z06 A;  4OZY A;  3DU1 X;  4OJO A;  1OFE A;  2F3L A;  4XLE A;  4AVZ A;  1O8L A;  2BM5 A;  4OPW A;  3PSZ A;  1QA2 A;  3VSU A;  1RMG A;  1WXR A;  3PET A;  4XM3 A;  1CLW A;  2YUH A;  2QZA A;  3TH0 A;  2NZM A;  2IQ7 A;  1K5C A;  3EQN A;  4HWV A;  3H09 A;  1KQ5 A;  4OJ6 A;  1CZF A;  1O8J A;  1QQ1 A;  4XLA A;  1BHE A;  4URR A;  3WWG A;  2EWE A;  4XR6 A;  4YEL A;  2BM4 A;  2BSP A;  2NTQ A;  2VFM A;  4XQF A;  4W8T A;  1AIR A;  1OFD A;  3T9G A;  1OFM A;  4YFO A;  1X0C A;  1PLU A;  2O04 A;  4XLF A;  1IA5 A;  3EQO A;  1TYV A;  4YEJ A;  1O8E A;  2VBE A;  1O8M A;  4YCQ A;  2ODL A;  1JTA A;  4XKW A;  4XOP A;  3SZE A;  1KCD A;  1L1I A;  1IDK A;  1TYW A;  1PE9 A;  1O8D A;  1OOC A;  2BM6 A;  5AMV A;  3RIQ A;  5JMC B;  1QA1 A;  2G0Y A;  3LMW A;  1NHC A;  1K4Z A;  2X6X A;  2XTW A;  2VFQ A;  3GQ7 A; 
#chains in the Genus database with same CATH homology
 1RU4 A;  4OJP A;  4XL9 A;  1DBG A;  2UVF A;  4OJ5 A;  3ZPP A;  1HG8 A;  2INU A;  2VBK A;  3VST A;  2VBM A;  4YZ0 A;  4XOR A;  2PYH A;  1O8K A;  3VMV A;  2X85 A;  2INV A;  2VJJ A;  1KCC A;  4XOT A;  4C2L A;  2NTB A;  1RWR A;  3GQA A;  1O8H A;  1KTW A;  2PYG A;  3GQ8 A;  4Z03 A;  4PMH A;  2QX3 A;  1IDJ A;  1O8I A;  1XG2 A;  2O0V A;  2O1D A;  4I84 A;  2PEC A;  4W8R A;  3JUR A;  4YZA A;  4W8Q A;  4NK8 A;  2NTP A;  1JRG A;  1O88 A;  4XLC A;  2O17 A;  2X6W A;  2X6Y A;  1OGM X;  2NST A;  1BN8 A;  2NSP A;  3B8Y A;  3FY3 A;  3GQ9 A;  1H80 A;  4OZZ A;  4U4B A;  3ZSC A;  4XMY A;  4W8S A;  2VJI A;  1VBL A;  1O8G A;  2NT6 A;  1OGO X;  3VMW A;  1OFL A;  4XNF A;  2Z8G A;  4U49 A;  4XKV A;  2QXZ A;  2O0W A;  3VSV A;  1EE6 A;  5C1E A;  1GQ8 A;  3UW0 A;  1QJV A;  2QY1 A;  4YZQ A;  4MXN A;  1O8F A;  4NK6 A;  4YZX A;  1QCX A;  3GRH A;  4Z05 A;  4XN3 A;  4EW9 A;  4XLH A;  3B4N A;  1PXZ A;  2UVE A;  1WMR A;  4XN0 A;  1IB4 A;  2X3H A;  3B90 A;  3KRG A;  4MR0 A;  4OJL A;  4XON A;  1DBO A;  5C1C A;  2NT9 A;  3SUC A;  4Z06 A;  4OZY A;  4OJO A;  4XLE A;  4AVZ A;  1O8L A;  3VSU A;  1RMG A;  4XM3 A;  2NZM A;  2IQ7 A;  1K5C A;  3EQN A;  4HWV A;  4OJ6 A;  1CZF A;  1O8J A;  4XLA A;  1BHE A;  4URR A;  3WWG A;  2EWE A;  4XR6 A;  4YEL A;  2BSP A;  2NTQ A;  4XQF A;  4W8T A;  1AIR A;  3T9G A;  1OFM A;  1X0C A;  1PLU A;  2O04 A;  4XLF A;  1IA5 A;  3EQO A;  4YEJ A;  1O8E A;  2VBE A;  1O8M A;  2ODL A;  1JTA A;  4XKW A;  4XOP A;  1KCD A;  1IDK A;  1PE9 A;  1O8D A;  1OOC A;  5AMV A;  3LMW A;  1NHC A;  2X6X A;  3GQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...