4XMYA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 235
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xmyA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xmyA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xmyA02
2ODLA 3T9GA 3GRHA 4U4BA 4OZZA 5AMVA 3B8YA 4XR6A 1X0CA 1O8EA 4NK8A 1EE6A 2O17A 4OJPA 4XONA 4Z06A 1OOCA 2NSTA 2VJIA 3WWGA 4MR0A 1PXZA 2EWEA 4YEJA 3VSTA 2X6YA 1O8MA 4Z03A 3VMWA 3VMVA 1IB4A 4XKVA 4XQFA 1QJVA 4EW9A 2PYHA 2UVEA 4MXNA 3EQNA 2NT6A 2O0VA 3ZPPA 2BSPA 1RMGA 1O8JA 3B4NA 4XLHA 4Z05A 2PYGA 1PE9A 1WMRA 4AVZA 2NZMA 4C2LA 4XLEA 4XKWA 1KTWA 4OJ5A 3SUCA 1KCDA 1BN8A 2NSPA 1O8IA 4YZQA 1OGOX 1JTAA 2VBMA 3B90A 2QXZA 2X85A 4W8SA 4XL9A 4XMYA 3GQAA 1IA5A 1OGMX 1GQ8A 2NT9A 3FY3A 4OJLA 4OZYA 4XOTA 4XNFA 2UVFA 1O88A 2O0WA 2NTPA 2INUA 3EQOA 4XLCA 1O8DA 2O1DA 2QY1A 3GQ7A 2X6WA 2O04A 4XOPA 4YZXA 2IQ7A 2INVA 1DBGA 4YELA 1IDKA 1OFLA 1DBOA 1O8FA 3VSVA 1QCXA 4XN3A 3ZSCA 2NTQA 4I84A 1JRGA 1O8HA 4XLFA 1K5CA 1BHEA 2VJJA 3KRGA 4OJOA 3UW0A 1O8KA 3LMWA 2VBEA 1CZFA 4YZ0A 1O8GA 4URRA 4W8RA 1RU4A 2NTBA 4XN0A 2X6XA 4W8TA 3GQ9A 1KCCA 1H80A 1XG2A 2X3HA 4XORA 4U49A 1AIRA 1PLUA 3JURA 3GQ8A 1OFMA 1RWRA 4OJ6A 4XM3A 1VBLA 2VBKA 2Z8GA 1O8LA 4YZAA 1IDJA 4XLAA 2PECA 4W8QA 5C1EA 2QX3A 3VSUA 4HWVA 4PMHA 1HG8A 1NHCA 5C1CA 4NK6A
chains in the Genus database with same CATH superfamily
2A61A 2ODLA 1JUMA 3GRHA 2MBFA 4JBAA 3CTAA 5L3FA 2DA5A 3MKWB 1B2RA 1TVCA 3WTYC 1VQPB 3ECOA 3CCEB 1XGOA 1U9OA 4KN7X 2P5LC 3CPXA 3N90A 1Z1DA 4A5MA 1WJDA 3RKXA 1B72A 3RI4A 1AKHA 2VIXA 1ZHFA 3BG7A 4MLOA 3ML6A 1ZLKA 1WU8A 2M5WA 4NC7A 3TGNA 2HTSA 2F5VA 4WX9A 4Y52J 1YIJI 1QO0D 2JUCA 2EZIA 5L3CA 2KIMA 5H6RA 3HOUJ 4HDUA 2NXNB 1V5FA 2CQKA 3BC8A 3HSEA 5KK1A 5E8IA 1VLOA 1NHAA 3OZVA 3CPWB 2PYGA 1S7AA 2BW3A 5DCMB 3A1PA 1LVKA 3CCRB 3DDYA 3NAUA 1LE8A 1VQKI 3H9GA 1KCDA 3WODF 1D8JA 2RQPA 1WJ5A 1ZKGA 2ADUA 3K4MA 3T51B 4DNCA 4HV6A 2RDPA 1WJFA 4ANJA 3KEYA 1IA5A 3FF5A 4BJ6C 1N06A 4PJJA 3K4KA 1F9NA 2OA4A 4ON0A 3ZZUA 1Q86D 4EM2A 3KP4A 1OFCX 2VFOA 1I39A 4YAOA 2KZVA 2WBMA 4ESBA 3EYYA 2BHYA 4ITVA 2ISYA 1CQXA 4X7CA 1VTNC 1TLHB 2MFZA 1Y0NA 2QY1A 3ZZTA 4Q47A 3E5UA 2BN4A 2BGJA 2IQ7A 2EINH 3A2KA 4YAFA 3K4JA 2LKXA 3QRFF 1WORA 2QUFA 1MMSA 3BQJA 3ZQQA 4RDJA 2HLDA 2W6IA 2HFHA 4CCJA 4R8HA 4RA2A 2VZLA 4U87A 2P81A 3ZGKA 2MH9A 3KCCA 3DFGA 4KT5C 2BVLA 5K7HA 2F1LA 2BM5A 5EEGA 4BE2A 4M3BA 5B66C 5LEJA 1BJAA 3FK6A 2L9NA 2Y0MA 2Y2ZA 4ZH4F 4IRIA 2Z6BD 5F0HA 5IP7J 4A3MJ 2JA7J 4JYKA 2VN2A 4HG2A 3S2HJ 3E6MA 3RYRA 2DYSH 3IRQA 1J09A 1ETXA 4OMZA 5JI6A 3CO7C 1H0MA 1K79A 2ZB9A 1KK1A 3Q0UA 5EEAA 2V1DA 1K4SA 1MJ9A 4CCKA 5LD2C 1QU3A 2XPWA 2ZXIA 4PC2A 1Y0RA 3ES9A 3KP5A 2R5ZA 2E5ZA 2RNJA 5A88A 1WXRA 3H0DA 3H0GJ 3Q6RA 4OJ6A 1GVDA 3AK5A 1IN7A 2K86A 3G4SB 1NTCA 2WC2A 3GMEA 1BMFA 3LA2A 3QFCA 2F5EA 5HS9A 2NYXA 3VYTB 1FYKA 4F93B 2KRFA 1FPQA 5FROA 1N75A 3E0JB 1JA0A 4A6DA 2EZLA 4NK6A 3FKIJ 4U4BA 4OPWA 3MKZA 3VYUB 2D5VA 2DTZA 1O8EA 4NK8A 5D5WB 4FCYA 1A6QA 1QVUA 2IGKA 2VFMA 3SJPA 4CZCA 4G1BA 4RD1A 5A8AA 3KP6A 1ZYRF 1QA3A 3RKQA 4LOCA 1G59A 3MZYA 2K9SA 2XAHA 3BTIA 5BMZA 2A6EF 4K1XA 1W35A 4UZUA 5ERIA 1N05A 3VMWA 4F55A 1BI0A 3TKYA 1P7JA 2COBA 3A01B 5D5VB 4EW9A 3V42A 4E4HA 1YIJB 1D8KA 4QPQA 4RM3A 4D9JA 4C9YA 4Y4RA 3V76A 3EUHC 1QA1A 2O5RA 4A6EA 3EDPA 2JA5J 2YU3A 3DP7A 4K2EA 1ETKA 1UMKA 3LNQA 5BPIA 1B1BA 1PYVA 2G9WA 4BGDA 2VQHA 4XKWA 1QGZA 2BMWA 2GJKA 3GIRA 1W5SA 3OYBA 1H42A 2M5SA 4V19K 2QENA 2DT7B 3EQLF 2HDDA 3CCVB 2A3SA 2LYCA 3D0SA 3I59B 3LSIA 1FOWA 2Y0SN 4W8SA 2IW5A 2OU2A 3OOUA 1VQ7I 5JBQA 5CQEA 5JLXA 3OYNA 2BGCA 2PFBA 3BQYA 3ZCOA 4OJLA 4M3GA 1P4AA 2ID6A 4CSWA 1YJWI 3CB4A 2AQEA 3PSIA 1ZG3A 3EETA 5F64A 2TDXA 1TNSA 5F1RA 3ASSA 4ZJZA 2W48A 4R1HA 2DODA 4XKCA 2V31A 2FBKA 3BCDA 3CCLB 3TDZC 2F4MB 3V8LA 3LMMA 2DFEA 3WGGA 4EGZA 4X6AJ 1OFLA 4I98B 4OAYA 1VQKB 1HKSA 3BJOA 5LRRA 5D5UB 2NTQA 2DMUA 4YEIA 3F6VA 2A6HF 2LKPA 4XLFA 5CKTA 3WHCA 3RZDJ 5JVTA 1N07A 3JRFA 3OSFA 2MLGA 4J0QA 2V7WA 4UVBA 1CF7B 2JRMA 4EJTA 3PUNA 5GAHJ 1K78B 2GIVA 1U3EM 1HA8A 2VNJA 2YX4A 4HW0A 3HOXJ 1LFUP 2WYRA 1O8GA 4QV2A 1UD3A 1YYVA 3HGYA 4NNJA 3SZGA 3U1KA 5ICEA 3PUMA 1QX4A 3QOEA 1ORKA 4DNRB 3F9KA 2HDCA 2XSDC 2QBYB 3L2RA 2V7FA 4XRMA 1ETVA 1JTYA 1K6OA 3W5VA 2LF7A 3CCEI 1IRGA 2WB1A 3MWMA 4L5IA 1JB9A 1EP1B 3GQ8A 1TYVA 4Y7CA 2QZAA 2H6CA 4RAFA 4XM3A 1QUFA 4DQLA 1YJNI 3WTXC 2KJBA 5HS8A 3W3CA 5LBQA 3NWTA 5A2QK 2K9LA 5GV7A 5C1EA 1QZYA 2WAEA 5CYVA 2GK7A 1R23A 3U9GA 2M8GX 1W7PA 3JR9A 4MO7A 2NV4A 3WXMA 2IXSA 3HOVJ 1AMOA 3MD2A 5E1WA 1BPLA 4DW6A 3ASPA 3OZWA 4V2FA 2OUMA 2HDNB 1TTTA 3JRBA 1JI8A 1R5GA 3IP4B 1BIAA 1ZARA 3GEZA 5K7ZA 4NBQA 4ZZDA 2C6YA 4ASNA 3CMYA 3D1NI 4UVAA 4F7ZA 1JJ8C 3CCLI 1BIBA 1XCBA 2VFNA 2FJ1A 5F04A 4FWTA 5H6QA 1FMWA 3IWFA 1MBEA 3MEXA 2LFBA 1CF7A 2N8GA 1KU3A 2ZNYA 1IW7F 4AVPA 3AGPA 3IC7A 4A93J 3IAM2 1YJWB 2X6YA 1H9TA 2BHZA 1O8MA 4Z03A 4XKVA 3ERMA 3WNDA 1LDDA 3RQ4A 3I64A 2X8KA 4A3CJ 4M72A 4FT8A 4E7SA 2HEOA 3CRZA 2LY9A 1Y0UA 2KMUA 1W2BB 1KRHA 2EFOA 4HNTA 2NT6A 4LG3A 1OFDA 1IN6A 3OWTA 4XLHA 3G2BA 2F5CA 4YFOA 1EV7A 3ESWB 2O6GE 4MGRA 4UUTA 4LBZA 4HNUA 1WPKA 2ELJA 2OQRA 3CDHA 1W0UA 2RC6A 2HVQA 3I56I 2CJJA 4PGOA 4ROXA 1AA7A 1UCRA 4FE7A 4AIJA 2NVYJ 2XKOA 3WG7H 5CVIA 1IXCA 1MH3A 2CS3A 3OMYA 3FJOA 3FXUA 3OOPA 5FKMA 2XTXA 4BY7J 3CXCB 4AUXA 3E1SA 4RGSA 5HDGA 2ZTGA 4E7JA 1VHOA 2R7TA 1JJ6C 4LK0F 5BSYA 2E2IJ 4CQJA 1NK2P 1WJBA 2QBYA 4C0SA 5DD8A 3LAJA 2FX0A 1JE8A 1Y8RB 1IXSB 4H0EA 2VODA 1FNNA 4XLCA 3EQOA 1QA2A 3GFMA 2H09A 2EIJH 2XIGA 5F4MA 1OKRA 1XFOA 1A5JA 3WU0A 2C5HA 1MDMA 1LNWA 3W2GA 2W82A 2CQ7A 2X48A 4Q4ZF 3BCBA 2V1NA 2VBSA 2MC4A 1PVEA 3U21A 2XC1A 2WB1N 2DMNA 3ZQ7A 1P92A 3PL8A 3J7ZI 2JA8J 2ZITA 3OPOA 3AVWA 4N3NA 4TKOB 1SAUA 2P3MA 1MSFC 3EPZA 1GLNA 3JQPA 3K1MA 2IP2A 2NVTJ 3M1CA 4HRIA 4TT3A 1A31A 4YG2F 4W8RA 2QYOA 3BPVA 3A03A 2LK2A 2XT2A 3CF5F 1SM4A 3ZQHA 4BACA 3GW2A 2M45A 4UZEA 4OMYA 4BBSJ 2Y9ZA 1YW9A 2AO9A 2L9VA 5EGOA 2PJRA 4RCZA 1W36C 1FJLA 2BXZA 3F3XA 1WVRA 2B0LA 3RPQA 4OWRB 3CDLA 1UELB 4CDGA 2DLLA 2RV8A 1PLUA 2JSCA 5DTDA 2ZJQF 1NH3A 4PZJA 4YAWA 3K2ZA 1BC8C 2IGNA 2O6WA 3BR5A 3CP8A 2ME6A 4A5NA 4IEJA 5D6FA 5K7FA 5CVUA 2K27A 2XRLA 3JREA 1IAWA 3VSUA 1LFPA 1IRFA 4TMWA 2E7WA 2K4BA 5GV8A 4DQ2A 5E18F 2ZZFA 5EG0B 1STZA 3N05A 1F5TA 2JVHA 2K3FA 1NG7A 3JW4A 3VEPA 1USSA 2DOEA 4EV0A 1X0CA 1DG1G 3CW2A 3KL9A 1OPCA 1S4MA 2K5CA 4RPBA 1G7CA 3CDIA 1GUUA 4BUPA 2E2HJ 5EJCA 2VE8A 3RQIA 5KAFC 3P26A 2ZFWA 1RIOH 2QF7A 4EEFG 2VFPA 2W24A 4L9VA 2HMAA 3E7LA 3OS0A 4LIUA 3V4GA 4OIPF 3H5RA 4S04A 2IS4A 4P2NA 3WY9A 3KETA 1O7FA 3CMEB 2WTEA 2P8TA 1HKQA 3QQAA 3LSPA 3BCAA 2GJPA 2M4KA 2CF4A 2DJIA 2GQQA 3QPSA 3OYDA 2WWYA 3OE7A 2GJRA 1DP3A 1HDDC 2FQ4A 4IXAA 3CJTB 1UD6A 3H3VK 3FXLA 1WTHD 4RAYA 3DEUA 4JX4A 1SKQA 4O6JA 3G1LA 4YZQA 3M4OJ 3DKWA 4ZCMA 3FXKA 2LMDA 2FD5A 4KIGA 4XL9A 4PFPA 1GR1A 2BXYA 3GQAA 4YIIA 3TP0A 5GAGJ 3FBNB 1WI9A 1OGMX 2NT9A 3V7CA 1HW2A 3GLLA 5C4XJ 2HOSA 1R1VA 3PJRA 5L46A 1SVOA 1S72B 3ZMUA 1RQPA 4QUZA 4A2UA 4BXFA 3ROUA 5IYPA 4HNVA 1KK2A 2DA3A 3B6CA 3IHUA 3LYCA 4M3EA 1K73D 4Y9UA 1RRJA 4G6QA 2DMPA 4BEHB 3BY6A 2IOUG 5IK2A 3P5JA 2CH0A 3KE2A 4MFEA 1REPC 3R6JA 2R7WA 4AWXB 2ZZQA 2HZTA 4PK4A 1JGGA 4I2OA 5E17F 4KMUX 3TEDA 2DERA 3C1DA 1XS9A 2XROA 2QSGX 1K9MD 1YX2A 5E6TA 1KQ9A 5IY5H 4FQGA 4RLFA 3SKBA 3MMYB 4WF2A 4OOSA 3PO2J 1D0ZA 3U6BA 4UUVA 2BEOA 3A0HC 3RYPA 1CLWA 3G71B 3O8GA 3F8BA 2FOWA 4M1KA 1H80A 1HXDA 3OEEA 2E1RA 4NCNA 4ZTJA 2QEXB 3TQNA 1Z21A 3F23A 2KZGA 3K6GA 1NB9A 3RPUD 1ZGJA 2PJPA 3HUGB 4A3EJ 1UHWA 1Z6TA 1PJRA 1KU9A 1WP6A 4GRIA 3VWBA 4B3FX 1TZLA 4EJOA 3N4MA 1DDNA 3W2AA 3M07A 5FO0A 3CC7I 4IX7A 4ZYHA 2DMTA 3IKTA 1GHCA 4RAZA 1ZREA 2F3LA 1MMAA 1MRZA 1HG8A 2EFQA 2ZZGA 3BQZA 1N0VC 1G7SA 2WAQA 1HSTA 1QFYA 5HDKA 2DMQA 4HIZA 2VC1A 3EUAA 3AG2H 1V5EA 1JHHA 3W6JB 4BHCA 5FO1A 4CCMA 3ASNH 3MKYB 1PUFA 4XONA 2OCEA 5EZHA 2KRHA 3WGHA 3Q0VA 1AIPA 2A5WA 1QVFB 1MNDA 1OOCA 3HRSA 4HSRA 2ELHA 2LH9A 3DU5A 1J9ZA 2DIEA 1X2NA 5KCMA 2H8RA 5ILVA 5TRDA 4MR0A 1I18A 1MBGA 2Z1DA 2OTJI 4OIRF 2XZPA 4M2LA 4LD5A 2FEZA 1XG1A 2BE5F 3OYMA 1UG2A 1W0KA 1TNTA 1KYWA 2ZTNA 1YX5A 3BH4A 4E70A 1ZM2A 1WQ2A 2BY0A 3HC7A 3JAMZ 5E3OA 3S3MA 1OMIA 2IEKA 2X4HA 1NK3P 5IT9Z 2V1UA 1E62A 1VQMB 2OK7A 3VOEA 5B5EC 1QQ1A 3HSFA 1X1DA 4UHTA 2JZYA 2ZKZA 2ZO4A 2XZOA 3K0LA 4HAMA 3I58A 1G8XA 3KLNA 3SUCA 3PFIA 1NB0A 1U5TC 2FX3A 2GZWA 1JTXA 2VJ5A 1BR4A 3WTWC 3L09A 1JKRC 4M6XA 2VJ4A 3QU3A 4NQWB 3DU6A 1HW5A 5FD5A 3IUOA 3SZEA 1LDKB 1M1EB 3AGQA 4IRGA 4P6VF 3GCMA 1Q9SA 3GVLA 1VLYA 1SFKA 1XMAA 1KMHA 3C2GA 1BOAA 3FXQA 2F4IA 1GXPA 5TV2A 2IT0A 4AF6A 3F8NA 4II2A 2INUA 1YW8A 4JP0A 2FBIA 2R0QC 1QRBA 1S29A 2O04A 3ZQLA 2B7CA 1V0FA 2EV6A 2XB0X 4E7ZA 3CMAI 2JJ7A 1FTZA 3S32A 5E8GA 3U1DA 3GYHX 1DBOA 1EJ9A 4NUBA 3LAPA 4MYUA 2OBSA 3VSVA 4EJVA 3F22A 3CC4I 3Q3SA 3RPUA 4Z4VA 4XSXF 3CMAB 3CC7B 3RIRA 5HOOA 4U0YA 3CC4B 1JRGA 4RPDA 1SC7A 1YITB 3KRGA 5D8KB 1BM9A 2V7TA 1QQIA 1X3UA 3LSJA 1B8IB 4ACBA 3HL2A 1XGNA 3C2BA 3LO8A 4OM9A 2HQ5A 3LSRA 2XRNA 2Y0SA 2QQ8A 2NTBA 4G6TB 2BOLA 3E20A 2EWNA 2YSRA 2AXLA 4YDTA 4ZDPA 4Q48A 1TL8A 1QZZA 3DLAA 2UZKA 1EF4A 1XG2A 1O57A 2ZC2A 2LNBA 1OR7C 4F92B 3K1NA 1OGJA 1J0RA 2COMA 2IAIA 4BYYA 3OYEA 2F4NA 3ZIAA 4UZFA 3RTRA 1TUIA 2CFOA 3PM1A 2L4MA 4G7ZF 4X7EA 4YZAA 2ACJA 1K8AD 3GTJJ 5EDNA 1S72I 2V79A 1JKOC 4PABA 5FA6A 1IDJA 3BT9A 5E79C 2QX3A 4M71A 4HYEA 1MBHA 2DK5A 4BQAA 3PETA 3MFKA 4P6YA 1I3QJ 3IWZA 3PA2A 1Q1HA 2NS8A 3J81Z 2KVOA 5E20A 1Z67A 3FIWA 1XDUA 2JQ7A 1HW1A 5EZGA 5J8CA 1Z91A 1MSEC 1XQBA 3OYCA 2VBYA 3P9KA 1BW5A 2O0YA 3ABKH 4KKUA 2QEXI 4OJPA 1FSEA 2OJED 2VJIA 3ABUA 3K69A 4P55A 4A0ZA 2R7XA 1I3AA 4CYDA 2XPVA 2CW5A 2VKVA 3GBGA 3KLOA 2V6CA 3A01A 1A35A 4X05A 3QU6A 1OFEA 1PXZA 5F08A 5HLTA 2ZSIB 1B72B 1PKVA 2QGGA 5H59A 3SLNA 4BY1J 3KIOA 3AVXA 3AVTA 4IHYA 2GXBA 4NHJA 1BJKA 2FF4A 5H20A 1MD0A 2HPMA 3L9FA 3RY8A 2BSAA 2Z9OA 3E5XA 2QSFX 3A4CA 1HCRA 3CUQA 1IJFA 2NAZA 1SFXA 1IV8A 3QPTA 1BBYA 1HBXG 1R22A 1VQPI 1KK3A 4ZV4A 1ULYA 2ZBUA 2WJYA 2NSPA 1GDTA 3V7RA 5FRMA 1OGOX 2D9RA 3FISA 2JN9A 5A89A 3DBHB 4RB0A 1EFTA 4ESFA 3K7AJ 1I7PA 4X0CA 2HYFA 2DPUA 5FKLA 5H2FC 4KKSA 3QP5A 2JA6J 1D8TA 2PIAA 1FDRA 3GZ5A 4RGRA 3SEQA 1ZN2A 1QFZA 2NNNA 3UNGC 3ZP5A 1VQ9I 2CQNA 3OIOA 2EQRA 4M0LA 4PJ0C 2ZCWA 2ZJRF 2HTJA 3TMOA 5LFAA 3H36A 1IDKA 3FHZA 1M1KD 2ECBA 3OV8A 3TW6A 3CC2I 1ZTRA 3KX2A 2NS0A 5F0CA 3VPRA 1BR1A 2FE3A 2ZJ2A 3RJPA 1IZ1A 5L3GA 2DBBA 4WCGA 1U5TA 3Q5FA 2D3LA 3TL4X 4L9JA 4R79A 2I8DA 2PBIA 3B6AA 1YG2A 3CLQA 4HEA2 2BY3A 5CVJA 4GO1A 2PG4A 5F6FA 3CMEI 4KH3A 2Z33A 1E17A 4Z1MA 2FSWA 4RB2C 3J81K 4HOBA 2DI3A 3CCJI 1T8IA 3ASTA 5B6IA 4PAAA 3HXLA 3FXRA 3SZTA 3S1QJ 4I0AA 1X1BA 1R5NA 5J35A 4M73A 1JGSA 1JKQC 5B1BH 5HZBA 3BJAA 4A3LJ 3CJQB 5KW9A 1CNEA 1D1NA 3DTKA 5FO5A 2LRDA 2HOEA 2BV6A 4ZCLA 3HG9A 1N77A 5JHFA 3BZ6A 2R7RA 2FMYA 1T6SA 1QA6A 4B43A 5D4RA 3BWGA 1UD8A 3EUKL 3FXOA 1T95A 2R5ZB 2DEUA 2QLZA 3CD6B 4B8XA 3GTPJ 1LEBA 5FIUA 1DGRM 4RAGA 1EA3A 1G4DA 1WJCA 2W85A 3D26A 4M9XA 2XNDA 4I76A 5GPAA 4MEXF 4B48A 5CDFA 4W1UA 2I10A 1XSXA 1RR8C 1JHFA 3ZPLA 4NBSA 3QFRA 2VL8A 4E0FA 4BH9A 4OZZA 2D1HA 4U0WA 4N3GA 1WOSA 1XC5A 3I54A 2VNIA 3QYBA 4HX7A 3WU2C 3H5NA 2DPDA 3Q3AA 2XVCA 4BAYA 2KT0A 5F1JA 2KDZA 5DYMA 3T56B 4I6ZA 2W00A 5TGTA 2EILH 3ZN0A 4A3IJ 2HGCA 4D5FA 3B78A 2KFDA 4QHYA 1I5ZA 1IB4A 1DDGA 1WJAA 3HM5A 4XIDA 2XAUA 3OW2B 2XDVA 5M3FJ 4XRSG 5TR9A 4WZTA 3D5LA 2HPIA 2EV5A 2QA4I 3GTGJ 2O0VA 3SQNA 4TV7A 4O5VA 1ZM9A 3U6KA 1G6NA 3GVJA 2QWWA 4ZYAA 1NBMA 3CCMI 4PUSA 2XGEA 4MNUA 3VO2A 5M5YJ 3OL3A 3WE3A 3DPLC 4P1WA 1R1UA 4HE6A 4C43A 5JLVC 3B73A 4HLYA 2CK3A 3J80Z 1ZM3A 2LP0A 2R7SA 2JA2A 3ABTA 3VSLA 3F8MA 2QQAA 2M30A 4RM0A 4YALA 3PQKA 1B6AA 3GTMJ 1R5BA 4Y17A 4G6IA 2RC4A 4UNOA 3IV5A 4TMXA 3I59A 4WXHA 2Q2EA 4G12A 4PSWA 3DBLB 4PC1A 2V6EA 2CC2A 3G6EB 3AL0C 2HWVA 4OZYA 2A5YB 2J7KA 3LA3A 3GTLJ 1AOYA 1ZK8A 4L5EA 1E43A 1U8BA 4MEYF 3F72A 4N4NB 3R0AA 1IF1A 2CYYA 2ZMEC 3GQ7A 1R36A 2A05A 1LKXA 2JVGA 2VXZA 1ETWA 2DOGA 3LWFA 3W5UA 1TC3C 1YIOA 2PE3A 4GFBA 4LB6B 4G5GA 2IVMA 3CC2B 1JT6A 3PFYA 5F27A 2L7ZA 1UB9A 2IRFG 2VC0A 5HNFA 3LFKA 1BX1A 2Q6IA 5ILSA 1MH4A 4NC8A 3BOQA 3ZC3A 1IHMA 4F91B 4FETA 1PUEE 2OBRA 4RDLA 3HRMA 3DLLF 3LMWA 2VBEA 3R6SA 2L4AA 5HVQC 4L18B 1Y56A 1FSHA 3HPGA 3H9NA 2C5BA 4I01A 1R4MB 2BY1A 2L2OA 1RU4A 4RBOA 5HLHA 4D7MA 3G71I 4H9GA 3BG3A 4BHPA 2BF4A 2M34A 4AC9A 4G6DA 3OEHA 4CHUA 3V8JA 1SFEA 2CV1A 1ZGAA 1ZAOA 1TWCJ 1XCVA 3FKJA 2IA2A 5M3MJ 3L2CA 3BR6A 3W2IA 2P5KA 1YRNA 3LJYA 2VKDA 3G3ZA 5J8FA 4LB5A 1ACIA 2K85A 1ONVA 4CUGA 5IOZA 3VNVA 4G7OF 3ZUGA 2EJRA 3AVYA 2GWRA 1YI2I 6PAXA 2EK5A 3QWLA 4JQFA 2QA4B 2CUFA 3GZ6A 2BM0A 1RUOA 3KEWA 3I4PA 4BQNA 1ON2A 1E3PA 4A0YA 2F2EA 1VQ9B 4HWVA 5HS7A 2CRGA 3FWEA 4Y15A 4CZZA 4N9HA 1KYZA 2WJVA 1DQUA 4AYBA 3DEWA 4YFNF 3FKSA 4M6VA 2XC7A 1BI3A 1LLWA 2DFFA 1AHDP 4XR6A 1VQ5I 4P22A 4G1VA 1YHQB 2WV0A 1JXSA 3JSPA 4C3JJ 4IKFA 1RZ4A 2VUMJ 3CCSB 1XB2A 1BX0A 2FNAA 4DZPA 1WDTA 4II3A 3VFZA 1T0FC 1YQAA 3CCUI 1J5YA 2PLFA 4M53A 4Z4YA 2EWEA 4TSFA 3BNWA 2HKOA 4Y7NJ 2AHQA 2WPDA 3GSIA 5DUKA 3HOYJ 2PYHA 1W1WE 5LGTA 2DW4A 1Q7YD 4KT6A 1G2HA 4MTDA 1E79A 3EQNA 1OCPA 5A2QZ 2ISZA 3EYIA 2CBXA 3OS2A 4LGWA 2QCOA 2ZXJA 3OYLA 1ITYA 1U8RA 4YCQA 1I27A 1TWFJ 5F4OA 3KEOA 4CH7A 3S1MJ 2DYIA 2P5VA 3ZR8X 3CCRI 3WE2A 1X58A 2HZDA 2A68F 1FTTA 1H8HA 5J3OA 4FXUA 5BSXA 1HSJA 3OYHA 4MQ9F 1W0JA 4OIQF 1TTYA 1HQCA 2KJCA 3LQRA 3H94A 4ZCIA 3FY3A 5J3LA 1FYMA 4XOTA 2DOAA 3GF2A 3GZNB 3TP3A 3T8RA 2W25A 2W7NA 2XNCA 2FRHA 4RD0A 5FKNA 3W2WA 4PC6A 2D2WA 3P7NA 1UG0A 1G3SA 1OYIA 4ZYGA 1OCTC 4XOPA 2HS5A 5D6EA 1VF9A 3M8EA 3JX8A 4YELA 1OHHA 4HZFA 1LFBA 4PDKA 4UUSA 1ZG1A 1FYLA 2F1MA 5DS0A 4HBLA 4V2GA 1D5VA 5C44J 2Y75A 4I84A 5CLSA 3OYIA 4KUMA 4KFCA 1A8PA 3M3YJ 2VLAA 2VFQA 5DEQA 1VQ8B 3CUQC 1E63A 4OJOA 1VQNI 1FNDA 1Y1VJ 2CUJA 3T53B 5L3BA 5E3LA 5M5WJ 4UY8I 1IDYA 3AVVA 3L00A 4JOMA 5FB2A 4ENMA 4O3MA 1KK0A 3EUHA 3VODA 5IP6A 3R60A 1PJ7A 3HHGA 2OV7A 3JQQA 4WQMA 3FMQA 1MIJA 2JT1A 1ZH5A 1LUJB 4V02C 2KLOA 2YR2A 2NVQJ 2OQGA 4A3GJ 1VZ0A 2JJ2A 4RD4A 2HI3A 1N25A 1IN8A 2MA3A 4GQNA 1PP8F 3GTOJ 3RZOJ 1I1GA 4WWVA 3JURA 5IT3A 4CO8A 4QVJA 4XRFA 1QHGA 3K4BA 1YLFA 3LOCA 3PUFA 5KNLA 2MSYA 3S15J 5J47A 3KZIC 4KIBA 3GO5A 1B23P 1R4NB 2FXAA 2Q6KA 1KGSA 2XGCA 2XGXA 3L2UA 2VOOA 2E35A 3MKLA 2OTLI 5IYDJ 1MGTA 3OYGA 4DNTB 1NHCA 5LHGA 1FC3A 4OP7A 4OINF 2QMUA 4W8TA 1UHMA 5BS6A 2OTLB 3Q0WA 1IG7A 5FLVA 2EA4A 1S7OA 3HB9A 1IN4A 3FHNA 4JRAC 3CD6I 1SFOJ 4GDFA 2UV1A 4FASD 2XKPA 2UUZA 2NNYA 3M8FA 4PSXA 2DCEA 4AD9A 3CLOA 2QM3A 3T1BA 5ICCA 3E3VA 2BX6A 2RN7A 1T38A 4DZJA 1RETA 3SLDA 4IPAA 1USTA 1W34A 1QFJA 1VQ8I 1QUEA 1TYUA 2ZXHA 1I6HJ 1VQOB 4EM1A 4CGZA 3Q38A 3SY2A 4YC5A 2EFGA 3CUOA 4PC7A 1VQOI 1YS6A 3CUQB 1FMVA 1ZRFA 4PCQA 3OW7A 3SYTA 2WAQN 3KP3A 3B8HA 2EFNA 5FKOA 3SJMA 2G7UA 2NZMA 3TH0A 2F6CA 3I3LA 1D2EA 2DFHA 1VQ6I 1NG6A 1ELOA 5EYRA 3DKXA 2HVRA 3ZQGA 2MYSA 3TOAA 4KNYA 2VBMA 2W7ZA 4KISA 2W1OA 2L7FP 2X85A 4XMYA 3KPHA 3CCJB 2UXNA 1A04A 3WTSC 2V26A 3LQ6A 1IN5A 2E1MC 1TQPA 4B44A 1FX0A 2V7XA 1Z6RA 1QZEA 5ICGA 4F7DA 3PA1A 1WH5A 4UUSB 1BR2A 1POGA 1YLOA 2Q8KA 4BQOA 4HF0A 4RS8A 2X3UA 1KQ0A 4QVAA 3LNNA 2XGDA 3BG6A 1YTYA 2FUG2 2LY2A 1IJEA 5H5JA 4D0PA 1V3FA 1ZLJA 3NQOA 4XN3A 3ZSCA 3A1YA 3ASOH 2FVGA 1U6GA 4KN4X 4P1VA 3PQJA 1GJRA 2EFPA 5FJ8J 2EZHA 5FFZA 2XUBA 1OISA 3R0JA 3BR3A 2R5YA 1EFRA 3PSZA 4BU2A 1HOMA 2DJNA 2CU7A 2QYUA 1YS7A 1BOBA 2NOGA 4FHTA 4BKXA 2ZBVA 2KL4A 2VNHA 2E1OA 1B9MA 2GK6A 1XGMA 3S1RJ 4WZLA 3BJ6A 4A3FJ 3QSYA 4F52A 1Z7UA 2VPLA 5HDNA 3WTTC 2W6JA 2HR3A 1V5GA 1IO2A 4L5JA 2AQFA 3DTIA 2ECCA 1OGIA 2DA1A 3K2AA 3ASQA 2O7OA 3FBIB 2VQCA 4C30A 5TY0A 2DFIA 2DAOA 2Z8GA 3HPHA 2CWEA 2BYVE 4BEHA 3L7WA 4HSTA 2DTRA 1W7PD 1VQ4I 1OCCH 3FZVA 2DYRH 1ZR4A 1WFXA 1WPCA 5FRNA 1K4ZA 4IHWA 4R71A 2RAEA 3QPHA 1FY7A 2XSJC 3NARA 2GA1A 3O3KA 1ZQ3P 2C4UA 3DXJF 3AG4H 3HYIA 1FRNA 3BTCA 5TISC 5BQTA 1B9NA 2PQ8A 4QWQA 1K78A 1KC8D 1ZR2A 2YUSA 3CCQI 1EE6A 5EG0A 1BC7C 2CSOA 4Z06A 1SD7A 3GXOA 2RGVA 2KRCA 3FMSA 4AU7A 2X1EA 3F21A 1XPXA 1YHQI 2EIKH 2NSTA 4ENKA 4FK8A 3PNTA 2Z16A 3VDXA 3HZJA 4KA4A 2XTWA 3ZQCA 2CW7A 3C7JA 1N08A 1X1PA 5DUIA 5JVGF 1OCOH 1UAAA 3BTJA 3DKYA 3HOSA 4HX8A 1B59A 3NB2A 4FE4A 2M3AA 4CYCA 4MXNA 5HODA 1S5LC 5FFXA 2BSPA 3B4NA 2KDOA 1VI0A 3I4NJ 3X2QH 1D0XA 3TDUC 3ZMVA 4IHTA 2XHKA 2OZUA 1KU2A 2E60A 1BLIA 4BDZA 4OJ5A 1SD4A 4ZTFA 4ENNA 1COWA 2DQRA 2FA5A 4RJLA 2M0MA 4C2MJ 3WU1B 2WZNA 1BN8A 2G0EA 3SFIA 2R5YB 4J00A 1BJZA 4Y3OA 2LBFA 1JTAA 2JPCA 2Z5UA 4A0XA 3GUDA 1LVAA 3VB2A 2AHOA 1DU0A 5IT9K 2PMDA 3ZN1A 2HXIA 5D4SA 4A3BJ 2ICWG 2STTA 4RB3C 3MCAA 1QRCA 2QSHX 3W2HA 1XX5A 3NWSA 3NE5B 3DU1X 3BH7B 3JU4A 1GV5A 1J9IA 2L9SA 4GYGA 3OYJA 4CXFA 2XTYA 2H1KA 4BQQA 1JNYA 2E1MB 2V7VA 2OF7A 1F20A 4W97A 4DIQA 1BL0A 4ASUA 4HLXA 1EP3B 2XV4S 2R4GA 1GVHA 4OOVA 5IYCJ 4N9IA 4HPQA 2RNGA 3SDGA 2RVCA 1OLTA 3I5UA 3WG9A 4I99C 3CCUB 2XNJA 3FK7A 1KTVA 1QGPA 2ZZEA 3DF8A 2C77A 4LBVA 1O8KA 3OYKA 4M74A 1R00A 2JRTA 1E3OC 3H3ZA 3QFSA 2Z99A 1FNBA 4U9UA 4URRA 2CFXA 2B0RA 1V0EA 3SJZA 1T6YA 2ZBKA 4JX5A 1VJSA 1DGWY 1MJAA 1TW2A 2XAGA 3PVDA 1W9XA 1ZGWA 2JIZA 3GQBA 2QTLA 1LEAA 1IUFA 1CQTA 3VYSB 5DS9A 1WI3A 1Z3XA 2IBDA 1X1CA 2L54A 2R7DA 3BTLA 3G1OA 3E6DA 3S3OA 2HOAA 1GXQA 5DCFA 4LIVA 2WR8A 4Q7JB 3A02A 2H1LA 1Q81D 3FMRA 3WTVC 4G9YA 2E2JJ 3H92A 2CW8A 5LLQA 4LJZF 4XLAA 1D5YA 4HQEA 3PIPF 3A8KA 2O8XA 3BG5A 3COAC 4PMHA 2V1XA 3DPUA 2JUGA 4RMNA 2D74A 3BY1A 4Z2YA 2IS6A 2XAFA 2ZJPF 1YW7A 2F5FA 1WOOA 1X3WB 4B4DA 3MQ0A 5IYNA 2BY2A 3Q9SA 4KMFA 1NRKA 2HKXA 4U88A 1SAXA 2O17A 2P4WA 4P3YA 4XICA 2H27A 2K02A 3I9V2 1QBJA 1UD4A 5HXBA 4CYCB 2J8KA 4C3IJ 1TW3A 3H1CA 5AIQA 1O3QA 1TYXA 2VOPA 4ZGQB 3ASRA 2QDXA 5TJJA 3CF2A 3KYLA 3J7AO 2LOOA 2M1BA 4N0BA 3ONYA 1MKMA 2A69F 4XRSA 2DXIA 2NVXJ 1NDHA 1E1RA 2GPJA 3ISPA 4Z4RA 4GCVA 5J40A 4WZEA 4OOIA 3KEQA 2R7OA 3FM5A 3MVPA 3DCFA 1LPQA 2E1CA 2CGPA 3S17J 1DARA 3U2RA 1OCRH 3IH2A 3QFTA 4HE5A 2XGJA 3PSSA 4MQVA 1N8RD 5F4JA 2GREA 2EZKA 1H9GA 1XMXA 2KHMA 2JJ1A 1O8IA 3VSKA 2D3NA 3J7AY 4ZYEA 4DBQA 2Q2EB 3B90A 5DNSA 2DT6A 1R58A 3M8JA 4IF4A 3GVKA 4RD6A 3SEJA 4HA8A 4EJUA 4AC0A 3OJWA 4XK4A 1ETQA 1G3YA 1QHHD 3WTUC 4B3XA 3HKZN 3I1FA 4FN5A 3L2WA 2VQGA 3JQRA 3JAMK 2ZSHB 4LMYA 3HSRA 4RLZA 2BBYA 3GTQJ 1IDZA 3DPTA 1SMTA 4B3AA 2STWA 1OQYA 1P4XA 1IB0A 1EKEA 1DBGA 2R7VA 2YWFA 3GFLA 2QVOA 1UD2A 2IS2A 2BPOA 2Q0OA 3JTHA 2MW8A 4D1QA 1OB0A 2GQFA 2JSPA 3W2EA 4RDKA 1LQ1A 3SEZA 1M90D 3QODA 2CUEA 5KHDA 1W7PB 5LHIA 3W5HA 2LF8A 2BV3A 5AN9A 1O8HA 3JRAA 2QTZA 3R61A 4OPVA 1QVGB 5IYQA 4QLCU 3ZQIA 3L2QA 4Z4ZA 4QTRA 5DDGA 1CZFA 1DPUA 2YWHA 4P96A 4IRHA 2B7BA 1HZEA 3K9TA 1GV2A 1PP7U 1TLLA 2DU9A 5J6XA 1V5VA 1BI2A 3DQVC 2C2WA 2VQLA 1X19A 4BJTA 3JRDA 1W87A 2ZFUA 4P9UA 1FZPB 2PMZN 4U49A 1Y8QB 3H9JA 1ZELA 1FBQA 1MMGA 1XSVA 2CW0F 1P6RA 2EA2A 2OBPA 4AM3A 2VBZA 1QGAA 2JK3A 3CJNA 3MMPA 1OFMA 4GXOA 3ZMTA 1P4MA 5J1RA 2O61A 5DN6A 4CCOA 4OPSA 1UD5A 3OOCA 4W8QA 1P2FA 3VMFA 3G4SI 1U5TB 3O2PE 4U0VA 2EFWA 2M7AA 2MGQA 2CV0A 2EH3A 3HTUA 3QAHA 3AKZA 2VE9A 4I0BA 2XEXA 3HAGA 5CPRB 4MYTA 1WJEA 3P9CA 2K7LA 2Q6OA 2Y31A 5FD6A 3E1YE 3ECHA 2ZL6A 2MLKA 2HQNA 3A8JA 4LITA 2QQBA 4RD3A 2VYQA 3SZPA 3N6ZA 2XF5A 1HC8A 3VYRB 3WHBA 4FX4A 2L7MP 4YHBA 1P9QC 4N4OB 1X1AA 4M6YA 2LD5A 5FLXZ 1K83J 2CQXA 3G73A 3MHPA 3VO1A 4P12A 1RKWA 2LVSA 1JUPA 2O03A 3LSMA 4YEJA 3WTZA 2WA0A 1TBXA 3CESA 3VSTA 1ON1A 1D3YA 4X06A 4M9SA 1WKMA 1E3HA 3T0YA 3CQZJ 1U9NA 3B82A 4DQKA 5GADJ 1T2KA 5JMCB 1TQMA 3TO7A 1WH7A 5EGOB 1VQMI 4BBRJ 1RR7A 3J81k 3OSGA 4P9FA 5IPAA 3T5XA 5GTIC 1FWZA 5AONA 4A3KJ 1LE8B 3HEFA 4AVZA 2IA0A 1IJWC 1IV6A 5K5QA 1OB2A 2UXXA 1WSVA 1IGNA 4IHVA 2DT5A 3OAAA 4A12A 3ML3A 1ENHA 3ZBUA 4TMZA 4P9SA 4IZZA 2R7UA 1S9HA 4IHXA 1VQLB 2DOFA 4RB1A 2KIFA 2YX7A 3I4MJ 2FOKA 2O3FA 3ZMZA 3LSGA 5B3SH 2H8WA 2VXDA 2BM7A 5F0FA 1HKTA 3HDDA 3TW7A 3OS1A 2F43A 2V9KA 2LC2A 2RKHA 3S8PA 2UVFA 2O0WA 4X0GA 2DY1A 2NTPA 1PJ5A 2L7KA 1SD5A 3PNVA 4PJLA 1G3TA 3MCZA 3E5QA 2X6WA 1HF0A 3K10A 5JLWA 3R4KA 5FLXK 3MN2A 4Y33A 5BPDA 4C2TA 2GAUA 2YWEA 3CCQB 2W4SA 3AL0B 4BJ5C 2X0KA 1XD7A 2XOKA 2NOJB 3ONUA 4DYCA 3B02A 4IOCF 1TQIA 3GWZA 1FRQA 3A3GA 4B09A 1SKYB 1DU6A 1U2RA 5J4YA 3LVBA 3JRCA 1MBFA 2ID3A 2J5PA 1AWCA 1J59A 1LLZA 2X1DA 3GX4X 1EFCA 1KZHA 4HDVA 1IXRC 2LDUA 1H85A 4TMVA 2VT2A 3BH6B 3IAS2 3BZKA 4NQWA 4XN0A 2VASA 2A6TA 2M4GA 5GP9A 4XBFA 1DDIA 2KKOA 4PFOA 4YIFA 3FXJA 3OL4A 3I56B 5DV5A 5GTHC 3C18A 1BN5A 2HQAA 4YXWA 3F8CA 3CO6C 4G94A 2C78A 3SXYA 1O3TA 4OAZA 3K70C 3D5RC 1RPWA 1W4MA 4EJWA 2E5NA 2WZPP 3WNCA 2CMPA 2ZMEA 2LREA 1FEXA 2DK8A 1O7LA 4WXDA 1W5CC 1E0EA 1PDNC 2NS7A 4OIOF 3FDYA 5K1YA 4G7HF 4BXUA 4Z4TA 4B1RA 1Q82D 2OC6A 1X2MA 3QOPA 3QP6A 3UR3C 3I55I 3HOTA 4BE1A 4WXCA 2P6TA 4HF1A 3T9GA 5AMVA 3T8TA 1WHUA 5IOYA 4S0HB 4BE0A 1S6LA 2O8KA 4Z6YA 2KISA 2MC3A 3RSNA 1Y1WJ 3FPKA 2CG4A 4XLNF 5FGMA 4MHGA 2K9MA 1EA0A 1VQ7B 1MBJA 2TCTA 4GGGA 5LGUA 1YITI 4Z4SA 2WY7Q 4IHSA 3WWGA 4LFUA 1H8EA 4ACAA 1SEUA 4WWCA 1P7IA 2HDWA 2V9PA 1F1ZA 1W5TA 1W0TA 2R92J 3BR1A 1QNTA 5DM7F 1E3XA 1U78A 4IOAF 4LBWA 1TWHJ 2DQLA 2LTPA 2H94A 1KONA 3OYFA 1L1IA 1DABA 4PJMA 2EV0A 2GBYA 2RC5A 1KU7A 5FL7A 5D8LB 4Z4WA 1O8JA 5DM6F 4CICA 2E36A 3BG9A 1HA3A 3HUGA 1YX3A 4G8XA 1KQ5A 1WOPA 1OCZH 2VBWA 1Z05A 1ETYA 4LG0A 2YWGA 4XLEA 1CGPA 3CP2A 2BM6A 1IC8A 1FP1D 2L02A 5JHUA 3E6BA 2FNPA 2Q1ZB 1HVXA 3P27A 3CCVI 3TBIA 1GVJA 3OJXA 1XMKA 2R7QA 3BZCA 1JJ2B 4EM0B 1RUNA 1D1AA 4NB5A 2JDIA 3OIQA 4RCYA 1E3ZA 1VQ4B 2Y30A 2E1BA 5LMZA 3HJEA 2VNKA 2GOMA 1Z3YA 1RNLA 4XNFA 4ZDLA 4UXNA 1XB4A 5J1YA 2NRAC 2PI0A 3A8IA 3DEEA 5IYWA 2VPRA 1C0WA 2L0KA 2LG4A 3ELKA 4P26A 3WNBA 1O8DA 2HNHA 3LSKA 3P9IA 3AFHA 1UJ8A 4M9ZA 4E7KA 1KQ8A 1T5EA 2X6OA 4L9TA 3BROA 1YJ9I 1QCXA 1R5HA 5J4VA 1OYYA 4UV8A 3J80K 1YFHA 2DETA 1MMNA 2P6SA 3TO9A 9ANTA 1ZUNB 1K5CA 4RLQA 3HTSB 3HHHA 3M7GA 1K4TA 2QQ9A 1TWAJ 4I02A 2ZXWH 2CUZA 4IL6C 2V9VA 3JSOA 4D5CA 3NAWA 2VBUA 3LQEA 1FLIA 5AIPA 2WY8Q 2R93J 4NC6A 1WWXA 3S2WA 4Y13A 3GTKJ 1WSRA 1R6RA 3FM3A 5DD4A 1FNCA 1G7RA 1IUYA 1B4AA 3RKYA 4S05A 1NJID 3L1PA 2G7HA 1TWGJ 2B5OA 2YU9J 2WSSA 2OZ6A 4DK1A 3H3UA 3DBRB 1YRNB 2VBKA 4G7WA 1J2XA 1Y39A 1A6IA 1T98A 2F5DA 3IH3A 1QPIA 3IRRA 4A3DJ 2G0YA 5FKKA 2OTJB 1MDMB 2DO7A 3TO6A 1I8DA 1HDPA 2EPFA 3PSFA 4YIRX 1V54H 3O6BB 2M87A 2XASA 3LFUA 2BM4A 2KQRA 4XLPF 2L9RA 1K8FA 2Z3YA 1LDJA 4P5OA 4AF7A 1ZRCA 2JWTA 2IGOA 4DYRA 4DBRA 2YPRA 3ZRGA 5BOXA 1L3LA 2X1CA 4RGUA 4Z4UA 3P4GA 3S2DJ 3V8KA 5CJ9A 1AU7A 1K28D 1E1QA 2YUHA 2QZ8A 2EIMH 1BI1A 2X53S 5ICFA 2VONA 1T39A 1BQEA 2BVMA 5HZAA 3DV8A 2FU4A 1XGSA 4XQFA 1Q1VA 1YO5C 1QJVA 1O4XA 1Z9CA 2A07F 2XT4A 2F48A 3JRGA 1F4KA 3L2VA 2Y48A 1RI7A 4UB8C 3ZPPA 4AIKA 5C3EJ 4RD2A 4HV5A 1UFMA 2ESNA 3ONQA 4LG0B 1QVTA 4P3IA 1DUXC 1PE9A 4ZDOA 3E97A 4CCLA 4XKBA 2V5IA 5IP9J 5ED4A 2DDAA 4DJAA 3CCYA 2LZJA 2HOTA 1FBUA 1ZM4A 3Q6QA 1R5ID 3DWLE 4X1EA 4QPOA 2CQQA 3W2FA 1DP7P 1VFCA 4DK0A 4KJZA 2FMLA 3TOBA 5C4JJ 3K1PA 2DA2A 3K4LA 5HLGA 1D0YA 1VNDA 3HGGA 5BNGA 2L01A 2HVSA 4BXXJ 2LY1A 3W2VA 4YFKF 4NDLA 4U7DA 3CJRB 4IQJA 2ESHA 4IQ4A 3R6KA 4L9NA 1AKHB 2D1VA 1KQSB 1R71A 4M4SA 2DA4A 4LLLA 3HKZA 2ZL7A 3WBKA 4YZXA 2DCUA 3GFIA 4ZZLA 4OU0A 4HQMA 2OBTA 5E1XA 1MZBA 3LQQA 2KIQA 3OY9A 3QE2A 5HKKA 1OR7A 2PEXA 4M3DA 2K9NA 2D45A 4TMTA 2XPUA 2AXTC 2IJLA 1O3RA 3MZ8A 1B8IA 3ZBTA 1SANA 4UVCA 5E3NA 4KYWA 1BHEA 2R7ZJ 1GO2A 2V7QA 5GPCA 2LSOA 2VKEA 3OR2C 1HF2A 1FT9A 4X07A 2GXGA 3RCOA 3A3BA 5GAEJ 1K6YA 4X8IA 1WGXA 3GFJA 2M0CA 2VT3A 1S8NA 2NVUB 3O8HA 3ZXSA 2I1LA 1T08B 1YI2B 4Q5SF 1SMYF 2X6XA 1E64A 4YFXF 3GQ9A 2M9HA 1Z7LA 2PJRB 2YS9A 3FPPA 3QYFA 3K70D 2RQQA 1EZGA 1R1TA 1XN7A 3BDDA 2HYJA 4KKTA 3ZPNA 1LJ9A 3UKGA 5CVRA 1EP2B 3NRVA 1AIRA 1YOVB 1VQ5B 3I71A 5L3EA 3I53A 4FTHA 1VQLI 1F60A 1RWRA 2RREA 2E19A 3KZYA 1I50J 2R6HA 3GVAA 4DYQA 3Q39A 2MD0A 4RM2A 1OB5A 3HOZJ 3BCFA 2PECA 3IKVA 2IPQX 3S93A 3GLXA 3SYJA 1HLVA 1S0UA 1GT0C 3A35A 1D1CA 1MBKA 1LB2A 3RIQA 5EMNA 1T6XA 2W57A 2Y69H 5E1ZB 2OAZA 3BY2A 1DPRA 1EWYA 4DOZA 1N78A 2E34A 3H35A 1BW6A 2W84A 1PJ6A 4I7HA 3CZ6A 3V7SA 4CCNA 2M8EA 3ZOBA 1TYWA 2GIZA 1LM1A 2BM1A 1K61A 3BPXA 3KYCB 1IRZA 5DSZA 2DDBA 3RDIA 3M1EA 3C2HA 3KFWX 3PNYA 1MMDA 2OK8A 3H9QA 5LEKA 2C4TA 1Y0YA 1G7TA 1WSUA 5J1UA 2QN6A 1MNMC 2M7BA 1H88C 2CNDA 3VMVA 4L0YB 2Y9YA 2R7FA 2MD5A 5LGNA 1H8AC 4ENJA 2OCCH 3G05A 3VNUA 4KITB 5LHHA 4EGYA 1O3SA 3AVUA 4A69C 2R3SA 1J75A 1FOKA 3A0BC 2X9DA 4J19A 5L3DA 2GM4A 2HU9A 1I6XA 1KJZA 2V4DA 3PIOF 2R9VA 1P4WA 3LA7A 4ETSA 1R9TJ 3VR6A 4QSHA 4RDUA 3OIPA 3CCMB 1E2XA 2WAFA 1T33A 1QPMA 3HRTA 1TT0A 1XSDA 2PLYA 2Z2SB 2KP6A 1RQRA 4AIDA 2ETHA 3W6KB 4X7FA 3SQVA 2LLKA 1R49A 3CCSI 2Q6LA 3H5AA 2QE7A 2PN6A 3CMMA 4EMSA 1FX7A 2L3DA 3C3WA 2E7XA 1T6ZA 2DN0A 5JFRA 1V4RA 3PUBA 1O88A 3KP2A 2K40A 2VBXA 2VI6A 2IGMA 4EQQA 4F3QA 1PUFB 5THXA 3I55B 2OYNA 3IH4A 1S7EA 2INVA 4E7IA 4PC3A 1U0JA 2CO5A 3Q9VA 3BLYA 1S3JA 1I1SA 3OP1A 4XD7A 2GA2A 3WGIA 4JMQA 3WBJA 4H4KC 1EH8A 4WK8F 1J7KA 2HXOA 3PO3J 5CQGA 2BZTA 3D5SC 4QIWN 1FOXA 2ZL5A 3U2QA 4B3GA 1RESA 1U2WA 2VJJA 4AIHA 1V55H 5LRSA 3UW0A 2VB6A 4KDPA 2EBIA 3JRIA 2VKHA 3ZMDA 4E7HA 2B7EA 1JKPC 5KSWB 1MABA 4D7NA 4BDYA 2GLOA 3MZHA 1EXMA 4YZ0A 2XZLA 2X51A 3JRHA 1EH6A 1RC9A 3KYDB 1FP2A 2JN6A 1IRXA 1QRYA 1UZCA 2FQ3A 2X0LA 1N0UA 3F6OA 3K4NA 2F4OB 2HYGD 2K4JA 2OD5A 4XORA 1JT0A 2V4JC 1T0FA 2DA7A 3I0TA 1R5OA 1W36D 3ERED 1VQNB 2ZNZA 2KIUA 2ZMEB 1FOYA 3AG3H 5B1AH 1X4OA 2JPBA 3S3NA 2JTVA 4OPOA 3W6VA 2CRVA 1VBLA 1O8LA 4A3JJ 3ZZ0A 2B63J 5FNZA 1OJLA 1ODDA 1H89C 2O9LA 4E6KG 4LLGF 2ELKA 2FBHA 4J01A 1Z0XA 4IO9F 3DTEA 4PGHA 3QYEA 2WV1A 1RKTA 5C1CA 2KPMA 4PGGA 1UMQA 3MAJA 3ZQFA 2BGIA 1F43A 2NPFA 3SFZA 1FIAA 5EF6A 1TT5B 1XE1A 3WQZA 3B8YA 3OFNA 2P7VB 2DA6A 4PJNA 3J7YJ 4BPRA 1D1BA 3G1MA 1VHEA 1T56A 4JK1X 1FNMA 4LBYA 4L0ZB 4C3HJ 1CNFA 1FIPA 3REOA 3F0CA 1SFUA 1WZ2A 3S14J 3S1NJ 1QG0A 1QGYA 4EH1A 4HX4A 1ETOA 4OOXA 4LLNA 3FX3A 1A36A 5K5OA 2IS1A 4UAJA 4EATA 2UVEA 4QFMA 5FLMJ 4B4CA 4IJAA 2XB5A 1ZRDA 4ZGNB 4IVNA 1SD6A 4TN1A 4WZKA 1RMGA 1WCMJ 1GAQA 3BR2A 1KD1D 4Z05A 1YJ9B 2PMHA 4ZC3A 3QPLA 4BHBA 1WMRA 3ZMSA 5HLIA 3OYAA 5EEHA 2XAQA 4C2LA 4JX6A 1KTWA 3V7AA 2GOXB 4LK1F 5DCMA 2PMUA 3NEUA 4U7BA 3ULQB 2K9QA 1JUSA 3ISXA 1KZLA 1TP4A 1SVLA 1G3WA 1MW7A 2TRTA 4ABZA 4Y9RA 4G7XA 1FBSA 3OKXA 2QXZA 3LSHA 4I09A 1OYWA 2K3PA 2M2EA 5IYBJ 3H09A 2EB7A 3AAFA 1XDSA 3F8FA 2ME0A 3LL7A 2LBFB 2VBTA 3ABLH 3BC9A 4YAUA 1GQ8A 5M5XJ 1GAWA 3G6EI 4YRVA 4BL0B 3WYAA 1F36A 3SHFA 5IYRA 4KIFA 2AS5F 5JR3A 4ZYDA 1TSPA 2XF6A 5HNHA 3M9AA 5ILUA 2GXAA 2BVNA 4L8JA 5E3MA 2E1NA 4P25A 1SVMA 4CA0A 2O1DA 4BS9A 1ERDA 2HQRA 1VQ6B 2MG4A 1L0OC 4MFDA 1X4PA 2P7CB 3K4CA 1EFUA 4C2UA 2L5QA 4IW3B 2QKMB 3HBLA 2V7UA 1Y6IA 1O8FA 3HRUA 2J5OA 2XF7A 2P0WA 3HIFA 3KZZA 1YE9A 4UB6C 5D5XB 2WADA 3BP8A 1EH7A 4XSZF 2IA1A 4E7LA 1ZG5A 2PX9A 3FXMA 3JTGA 3E6CC 1MNEA 4HF2A 3AG1H 1JA1A 4KICA 2I5UA 2LKSA 2QGUA 4DGWB 1APLC 1XTAA 3N97A 2QKLB 4AYBN 4UV9A 4EVIA 4MTEA 3JCUC 1VF7A 3RKWA 4FX0A 4MIMA 2JMWA 2J8IA 1KCCA 3PENA 4FISA 3ABMH 3BR0A 1K7AA 2X3HA 4GYIA 3OR1C 2OPTA 1Z77A 2MABA 5KAIC 2LR8A 1BA5A 5K5RA 3IL2A 2B9SA 2BW3B 3HOWJ 1KA8A 1YJNB 1UHSA 2E71A 4LC0A 3KP7A 3OZUA 2VBVA 4BNCA 2MH2A 3LSTA 4RGXA 1MJBA 2PMZA 2CV2A 2EIXA 2XAJA 4M3FA 4X7DA 5CVVA 2H6BA 4B47A 1QH0A 2HCJB 3S16J 1R7JA 3SDBA 4ESJA 1WRJA 2UWMA 5KVRA 1X3ZB
chains in the Genus database with same CATH topology
3UR3C 4BE1A 2WAQA 2ODLA 3T9GA 3GRHA 5AMVA 3MKWB 4BE0A 3EUAA 4HIZA 3FHNA 1V5EA 4CCMA 3RSNA 2UV1A 4FASD 3MKYB 4XONA 2K9MA 2KRHA 1OOCA 2UUZA 2A5WA 1MNDA 4PSXA 2DCEA 4HSRA 2WY7Q 1WJDA 2LH9A 3DU5A 3WWGA 1H8EA 2DIEA 4MR0A 5KCMA 2HDWA 1I18A 2VIXA 2Z1DA 3BG7A 4MLOA 2XZPA 1E3XA 4NC7A 2F5VA 3OYMA 1W0KA 1KONA 3OYFA 2ZTNA 1YX5A 2ZXHA 4PJMA 3BH4A 3HC7A 3S3MA 5FL7A 1V5FA 1O8JA 3BC8A 1FMVA 1X1DA 2PYGA 2BW3A 3OW7A 1YX3A 3SYTA 2XZOA 1LVKA 2NZMA 3DDYA 1G8XA 4XLEA 2F6CA 3CP2A 3H9GA 3I3LA 3SUCA 1KCDA 1NG6A 1WJ5A 3DKXA 2HVRA 2Q1ZB 3K4MA 1BR4A 2MYSA 2VJ5A 1HVXA 3T51B 2VBMA 3TBIA 4KISA 2VJ4A 2W1OA 1WJFA 2X85A 4NQWB 2R7QA 3DU6A 4XMYA 4ANJA 3KEYA 1IA5A 3IUOA 1D1AA 4BJ6C 4PJJA 1LDKB 2JDIA 2V26A 3K4KA 3OIQA 1E3ZA 3GVLA 2E1MC 4B44A 1VLYA 1SFKA 1KMHA 2E1BA 2KZVA 2WBMA 3C2GA 1FX0A 2GOMA 1Z3YA 2F4IA 4ITVA 4XNFA 4ZDLA 3DEEA 4II2A 2INUA 2LG4A 1O8DA 2MFZA 2QY1A 1BR2A 2O04A 2HNHA 3LSKA 4BQOA 1V0FA 3A2KA 2IQ7A 3AFHA 4E7ZA 4E7KA 3S32A 1T5EA 3K4JA 3LNNA 1DBOA 3BG6A 4NUBA 2FUG2 2LY2A 3VSVA 1QCXA 3ZQQA 4XN3A 3ZSCA 2HLDA 2W6IA 3A1YA 4CCJA 1MMNA 1JRGA 4U87A 5HOOA 1K5CA 4RLQA 3ZGKA 3KRGA 2BVLA 2CUZA 3HL2A 4BE2A 1EFRA 4BU2A 2Y0SA 2L9NA 2NTBA 4G6TB 2Z6BD 2BOLA 1BOBA 2WY8Q 4W8TA 4HG2A 2KL4A 4ZDPA 2GK6A 1R6RA 1J09A 3DLAA 4F52A 2VPLA 2W6JA 1XG2A 1V5GA 2AQFA 3DTIA 1OR7C 4F92B 5LD2C 4CCKA 1QU3A 2ZXIA 3OYEA 3ZIAA 2E5ZA 3FBIB 3RTRA 2WSSA 2VQCA 4C30A 3H0DA 4OJ6A 4DK1A 2CFOA 2VBKA 2Z8GA 3HPHA 4G7WA 4YZAA 1IDJA 4BEHA 1BMFA 4HSTA 2QX3A 3VYTB 1WFXA 4F93B 5FRNA 1WPCA 5FROA 1N75A 3E0JB 2KVOA 1I8DA 4NK6A 2XSJC 3PSFA 4U4BA 3MKZA 3LFUA 3VYUB 1O8EA 2KQRA 4NK8A 1EE6A 3OYCA 4P5OA 2IGKA 2IGOA 4DBRA 3ZRGA 4CZCA 4OJPA 4KKUA 4Z06A 2X1CA 2R7XA 2NSTA 2KRCA 2VJIA 4AU7A 2X1EA 1G59A 1K28D 1E1QA 3GBGA 2Z16A 3PNTA 3VDXA 1PXZA 5HLTA 2CW7A 2X53S 4UZUA 3VMWA 4F55A 2ZSIB 2BVMA 1UAAA 4XQFA 3DKYA 3HOSA 1PKVA 1QJVA 4EW9A 3V42A 4E4HA 4QPQA 2M3AA 4MXNA 4RM3A 4D9JA 4C9YA 3L2VA 4Y4RA 3ZPPA 3EUHC 2BSPA 2O5RA 2KDOA 2HPMA 3B4NA 3ONQA 1D0XA 1PE9A 4ZDOA 4CCLA 4XKBA 3A4CA 1PYVA 2E60A 4DJAA 2LZJA 4BGDA 2VQHA 4XKWA 1BLIA 4BDZA 2GJKA 4OJ5A 4ZTFA 3OYBA 1COWA 3DWLE 2M5SA 2M0MA 1BN8A 4QPOA 2WJYA 2NSPA 4J00A 2DT7B 4Y3OA 5FRMA 2LBFA 4DK0A 4KJZA 2LYCA 1JTAA 1OGOX 3LSIA 4W8SA 3K4LA 3OOUA 1D0YA 5CQEA 3OYNA 2HVSA 2LY1A 3NWSA 3ZCOA 3NE5B 3W2VA 4CSWA 4IQJA 4KKSA 3CJRB 4OJLA 2AQEA 4IQ4A 3JU4A 3SEQA 2L9SA 3PSIA 3OYJA 3UNGC 4ZJZA 4BQQA 3HKZA 2E1MB 2V31A 4XKCA 3BCDA 4YZXA 3TMOA 5LFAA 3LMMA 4DIQA 1IDKA 1OFLA 4ASUA 3OY9A 4OAYA 2R4GA 5HKKA 3KX2A 1BR1A 4HPQA 2RNGA 2D3LA 2NTQA 1OLTA 3TL4X 4R79A 4XLFA 5CKTA 2I8DA 1BHEA 2V7QA 3OR2C 4HEA2 2ZZEA 1O8KA 3RCOA 3A3BA 3OYKA 1K6YA 4Z1MA 1HA8A 3ZXSA 1O8GA 4URRA 1V0EA 2X6XA 3HXLA 3SZGA 4NNJA 1UD3A 1VJSA 3GQ9A 1DGWY 1Z7LA 2PJRB 1X1BA 3QOEA 3FPPA 4DNRB 1W9XA 3QYFA 3K70D 2RQQA 3F9KA 3GQBA 2JIZA 3L2RA 2V7FA 3CJQB 3VYSB 4KKTA 3ZPNA 3DTKA 1Z3XA 1X1CA 2LRDA 2WB1A 3S3OA 1AIRA 3HG9A 1N77A 5JHFA 3GQ8A 2R7RA 1RWRA 1UD8A 4B43A 4LIVA 2RREA 3EUKL 1T95A 4XM3A 3W3CA 2CW8A 3NWTA 4XLAA 2K9LA 2MD0A 4RM2A 2PECA 1DGRM 2WAEA 2GK7A 1EA3A 3BCFA 3S93A 5C1EA 1WJCA 3A35A 1D1CA 2XNDA 5CDFA 4B48A 4PMHA 2IXSA 3DPUA 2JUGA 3MD2A 4RMNA 1BPLA 2IS6A 4DOZA 1N78A 3H35A 2OUMA 2VL8A 4E0FA 1JI8A 4OZZA 3IP4B 1NRKA 3CZ6A 3QYBA 4CCNA 2O17A 3H5NA 1FMWA 3T56B 2W00A 5TGTA 3PNYA 3C2HA 1MMDA 3H9QA 3IAM2 3I9V2 2X6YA 1O8MA 4Z03A 2M7BA 1UD4A 3VMVA 1IB4A 1WJAA 4XKVA 2XAUA 2XDVA 3RQ4A 2X8KA 4E7SA 3G05A 2KMUA 3D5LA 4KITB 2HPIA 3CF2A 3KYLA 2LOOA 4HNTA 2NT6A 4LG3A 2O0VA 2DXIA 3OWTA 4XLHA 3G2BA 1E1RA 3GVJA 1NBMA 2HU9A 4ZYAA 4PUSA 2V4DA 2R9VA 3VR6A 2R7OA 2ELJA 3OL3A 3DPLC 4P1WA 4HNUA 2XGJA 3OIPA 2HVQA 2CK3A 2WAFA 1AA7A 1TT0A 2JJ1A 2Z2SB 2KP6A 2KHMA 2R7SA 1O8IA 2JA2A 3VSKA 3VSLA 3J7AY 2D3NA 4DBQA 2Q2EB 3B90A 2DT6A 2CS3A 3M8JA 3OMYA 4G6IA 3GVKA 3H5AA 2QE7A 4PSWA 3E1SA 3CMMA 2V6EA 4E7JA 2ZTGA 3AL0C 2R7TA 4OZYA 1QHHD 4B3XA 1WJBA 3PUBA 1O88A 3L2WA 2VQGA 2ZSHB 2IGMA 4F3QA 1E43A 3EQOA 4XLCA 4N4NB 3DPTA 3GQ7A 1LKXA 2JVGA 2INVA 2VXZA 4E7IA 1DBGA 2R7VA 1U0JA 2W82A 3BLYA 2IS2A 1UD2A 4XD7A 4JMQA 1OB0A 4D1QA 3PFYA 2JSPA 3BCBA 2V1NA 4H4KC 3SEZA 2MC4A 3U21A 3QODA 5KHDA 5HNFA 3PL8A 5CQGA 3OPOA 3D5SC 4NC8A 4TKOB 4B3GA 1SAUA 1O8HA 2VJJA 4F91B 4FETA 3UW0A 2VB6A 4E7HA 2VKHA 3EPZA 1GLNA 3LMWA 2VBEA 3L2QA 1MABA 3M1CA 5HVQC 1Y56A 4HRIA 4BDYA 3HPGA 1CZFA 4TT3A 4YZ0A 2L2OA 4W8RA 2XZLA 2X51A 1RU4A 1HZEA 4BACA 3DQVC 1IRXA 2VQLA 1X19A 4BJTA 3OEHA 2ZFUA 2PJRA 3K4NA 1W36C 2CV1A 4XORA 2V4JC 4OWRB 3FKJA 4U49A 1W36D 1UELB 3H9JA 1ZELA 1MMGA 2VKDA 1PLUA 4CUGA 1X4OA 1OFMA 3S3NA 2IGNA 3CP8A 1VBLA 1O8LA 4JQFA 5DN6A 4CCOA 1UD5A 3OOCA 4W8QA 3KEWA 4E6KG 4BQNA 2M7AA 2CV0A 4J01A 3AKZA 4HWVA 3VSUA 1LFPA 3HAGA 3DTEA 3QYEA 5CPRB 5C1CA 2KPMA 1WJEA 2WJVA 1DQUA 4AYBA 2ZZFA 3FKSA 2XC7A 3N05A 3WQZA 3B8YA 3OFNA 2JVHA 4XR6A 1NG7A 4P22A 1X0CA 4LITA 4PJNA 1D1BA 2XF5A 3VYRB 4IKFA 1P9QC 2K5CA 4N4OB 1X1AA 4BUPA 4II3A 1T0FC 3LSMA 2EWEA 4YEJA 2IS1A 4TSFA 3VSTA 2WA0A 3CESA 3OS0A 2WPDA 4LIUA 4EATA 3H5RA 2IS4A 2PYHA 2UVEA 4KT6A 1E79A 3EQNA 3BCAA 1RMGA 2GJPA 2M4KA 3OS2A 3OYLA 4Z05A 2DJIA 4ZC3A 3OYDA 3OE7A 1WMRA 2GJRA 4AVZA 4CH7A 1DP3A 3OYAA 3ZR8X 1UD6A 4C2LA 1KTWA 2GOXB 2HZDA 1WTHD 1H8HA 3OAAA 4U7BA 4FXUA 1KZLA 3OYHA 1MW7A 4IZZA 1S9HA 2R7UA 4G7XA 4YZQA 2QXZA 1W0JA 3LSHA 4XL9A 4PFPA 2K3PA 3GQAA 3BC9A 3LL7A 3H94A 3FBNB 2LBFB 3LSGA 1GQ8A 1OGMX 2NT9A 3FY3A 2VXDA 4YRVA 4BL0B 3OS1A 3PJRA 4XOTA 2F43A 2DOAA 2V9KA 2LC2A 2XF6A 3S8PA 5HNHA 2UVFA 2O0WA 4X0GA 2W7NA 4L8JA 2NTPA 4BXFA 2L7KA 3W2WA 4CA0A 3PNVA 4PJLA 1UG0A 2O1DA 4BS9A 1ERDA 2X6WA 3K10A 4XOPA 1X4PA 3K4CA 4Y33A 4YELA 4C2TA 4C2UA 1OHHA 2L5QA 2W4SA 3AL0B 2F1MA 4BJ5C 2QKMB 2XOKA 1Y6IA 2NOJB 4BEHB 1O8FA 5IK2A 2CH0A 2XF7A 2P0WA 2R7WA 3A3GA 4I84A 1YE9A 1SKYB 2WADA 3OYIA 4PK4A 4E7LA 2ZZQA 2VLAA 1MNEA 4OJOA 2X1DA 2CUJA 3T53B 4DGWB 4JOMA 4RLFA 3MMYB 2QKLB 1D0ZA 3IAS2 4XN0A 2VASA 2A6TA 2M4GA 2OV7A 4PFOA 1VF7A 1KCCA 1H80A 3OEEA 3OL4A 2KLOA 4ZTJA 2JJ2A 1VZ0A 2X3HA 1Z21A 2HQAA 3OR1C 2MABA 4YXWA 3K6GA 3RPUD 4GQNA 2BW3B 3HUGB 4OAZA 3K70C 3D5RC 3JURA 1PJRA 2E5NA 4GRIA 1WP6A 2WZPP 1QHGA 2CMPA 3K4BA 5KNLA 3VWBA 1TZLA 2LREA 4B3FX 3W2AA 2PMZA 2CV2A 4IX7A 1E0EA 4B47A 3FDYA 3L2UA 1MMAA 3SDBA 2UWMA 4DNTB 3OYGA 2ZZGA 1HG8A 1NHCA 2OC6A 3HOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODL A;  3T9G A;  3GRH A;  4U4B A;  4OZZ A;  5AMV A;  3B8Y A;  4XR6 A;  1X0C A;  1O8E A;  4NK8 A;  1EE6 A;  2O17 A;  4OJP A;  4XON A;  4Z06 A;  1OOC A;  2NST A;  2VJI A;  3WWG A;  4MR0 A;  1PXZ A;  2EWE A;  4YEJ A;  3VST A;  2X6Y A;  1O8M A;  4Z03 A;  3VMW A;  3VMV A;  1IB4 A;  4XKV A;  4XQF A;  1QJV A;  4EW9 A;  2PYH A;  2UVE A;  4MXN A;  3EQN A;  2NT6 A;  2O0V A;  3ZPP A;  2BSP A;  1RMG A;  1O8J A;  3B4N A;  4XLH A;  4Z05 A;  2PYG A;  1PE9 A;  1WMR A;  4AVZ A;  2NZM A;  4C2L A;  4XLE A;  4XKW A;  1KTW A;  4OJ5 A;  3SUC A;  1KCD A;  1BN8 A;  2NSP A;  1O8I A;  4YZQ A;  1OGO X;  1JTA A;  2VBM A;  3B90 A;  2QXZ A;  2X85 A;  4W8S A;  4XL9 A;  4XMY A;  3GQA A;  1IA5 A;  1OGM X;  1GQ8 A;  2NT9 A;  3FY3 A;  4OJL A;  4OZY A;  4XOT A;  4XNF A;  2UVF A;  1O88 A;  2O0W A;  2NTP A;  2INU A;  3EQO A;  4XLC A;  1O8D A;  2O1D A;  2QY1 A;  3GQ7 A;  2X6W A;  2O04 A;  4XOP A;  4YZX A;  2IQ7 A;  2INV A;  1DBG A;  4YEL A;  1IDK A;  1OFL A;  1DBO A;  1O8F A;  3VSV A;  1QCX A;  4XN3 A;  3ZSC A;  2NTQ A;  4I84 A;  1JRG A;  1O8H A;  4XLF A;  1K5C A;  1BHE A;  2VJJ A;  3KRG A;  4OJO A;  3UW0 A;  1O8K A;  3LMW A;  2VBE A;  1CZF A;  4YZ0 A;  1O8G A;  4URR A;  4W8R A;  1RU4 A;  2NTB A;  4XN0 A;  2X6X A;  4W8T A;  3GQ9 A;  1KCC A;  1H80 A;  1XG2 A;  2X3H A;  4XOR A;  4U49 A;  1AIR A;  1PLU A;  3JUR A;  3GQ8 A;  1OFM A;  1RWR A;  4OJ6 A;  4XM3 A;  1VBL A;  2VBK A;  2Z8G A;  1O8L A;  4YZA A;  1IDJ A;  4XLA A;  2PEC A;  4W8Q A;  5C1E A;  2QX3 A;  3VSU A;  4HWV A;  4PMH A;  1HG8 A;  1NHC A;  5C1C A;  4NK6 A; 
#chains in the Genus database with same CATH topology
 2A61 A;  2ODL A;  1JUM A;  3GRH A;  2MBF A;  4JBA A;  3CTA A;  5L3F A;  2DA5 A;  3MKW B;  1B2R A;  1TVC A;  3WTY C;  1VQP B;  3ECO A;  3CCE B;  1XGO A;  1U9O A;  4KN7 X;  2P5L C;  3CPX A;  3N90 A;  1Z1D A;  4A5M A;  1WJD A;  3RKX A;  1B72 A;  3RI4 A;  1AKH A;  2VIX A;  1ZHF A;  3BG7 A;  4MLO A;  3ML6 A;  1ZLK A;  1WU8 A;  2M5W A;  4NC7 A;  3TGN A;  2HTS A;  2F5V A;  4WX9 A;  4Y52 J;  1YIJ I;  1QO0 D;  2JUC A;  2EZI A;  5L3C A;  2KIM A;  5H6R A;  3HOU J;  4HDU A;  2NXN B;  1V5F A;  2CQK A;  3BC8 A;  3HSE A;  5KK1 A;  5E8I A;  1VLO A;  1NHA A;  3OZV A;  3CPW B;  2PYG A;  1S7A A;  2BW3 A;  5DCM B;  3A1P A;  1LVK A;  3CCR B;  3DDY A;  3NAU A;  1LE8 A;  1VQK I;  3H9G A;  1KCD A;  3WOD F;  1D8J A;  2RQP A;  1WJ5 A;  1ZKG A;  2ADU A;  3K4M A;  3T51 B;  4DNC A;  4HV6 A;  2RDP A;  1WJF A;  4ANJ A;  3KEY A;  1IA5 A;  3FF5 A;  4BJ6 C;  1N06 A;  4PJJ A;  3K4K A;  1F9N A;  2OA4 A;  4ON0 A;  3ZZU A;  1Q86 D;  4EM2 A;  3KP4 A;  1OFC X;  2VFO A;  1I39 A;  4YAO A;  2KZV A;  2WBM A;  4ESB A;  3EYY A;  2BHY A;  4ITV A;  2ISY A;  1CQX A;  4X7C A;  1VTN C;  1TLH B;  2MFZ A;  1Y0N A;  2QY1 A;  3ZZT A;  4Q47 A;  3E5U A;  2BN4 A;  2BGJ A;  2IQ7 A;  2EIN H;  3A2K A;  4YAF A;  3K4J A;  2LKX A;  3QRF F;  1WOR A;  2QUF A;  1MMS A;  3BQJ A;  3ZQQ A;  4RDJ A;  2HLD A;  2W6I A;  2HFH A;  4CCJ A;  4R8H A;  4RA2 A;  2VZL A;  4U87 A;  2P81 A;  3ZGK A;  2MH9 A;  3KCC A;  3DFG A;  4KT5 C;  2BVL A;  5K7H A;  2F1L A;  2BM5 A;  5EEG A;  4BE2 A;  4M3B A;  5B66 C;  5LEJ A;  1BJA A;  3FK6 A;  2L9N A;  2Y0M A;  2Y2Z A;  4ZH4 F;  4IRI A;  2Z6B D;  5F0H A;  5IP7 J;  4A3M J;  2JA7 J;  4JYK A;  2VN2 A;  4HG2 A;  3S2H J;  3E6M A;  3RYR A;  2DYS H;  3IRQ A;  1J09 A;  1ETX A;  4OMZ A;  5JI6 A;  3CO7 C;  1H0M A;  1K79 A;  2ZB9 A;  1KK1 A;  3Q0U A;  5EEA A;  2V1D A;  1K4S A;  1MJ9 A;  4CCK A;  5LD2 C;  1QU3 A;  2XPW A;  2ZXI A;  4PC2 A;  1Y0R A;  3ES9 A;  3KP5 A;  2R5Z A;  2E5Z A;  2RNJ A;  5A88 A;  1WXR A;  3H0D A;  3H0G J;  3Q6R A;  4OJ6 A;  1GVD A;  3AK5 A;  1IN7 A;  2K86 A;  3G4S B;  1NTC A;  2WC2 A;  3GME A;  1BMF A;  3LA2 A;  3QFC A;  2F5E A;  5HS9 A;  2NYX A;  3VYT B;  1FYK A;  4F93 B;  2KRF A;  1FPQ A;  5FRO A;  1N75 A;  3E0J B;  1JA0 A;  4A6D A;  2EZL A;  4NK6 A;  3FKI J;  4U4B A;  4OPW A;  3MKZ A;  3VYU B;  2D5V A;  2DTZ A;  1O8E A;  4NK8 A;  5D5W B;  4FCY A;  1A6Q A;  1QVU A;  2IGK A;  2VFM A;  3SJP A;  4CZC A;  4G1B A;  4RD1 A;  5A8A A;  3KP6 A;  1ZYR F;  1QA3 A;  3RKQ A;  4LOC A;  1G59 A;  3MZY A;  2K9S A;  2XAH A;  3BTI A;  5BMZ A;  2A6E F;  4K1X A;  1W35 A;  4UZU A;  5ERI A;  1N05 A;  3VMW A;  4F55 A;  1BI0 A;  3TKY A;  1P7J A;  2COB A;  3A01 B;  5D5V B;  4EW9 A;  3V42 A;  4E4H A;  1YIJ B;  1D8K A;  4QPQ A;  4RM3 A;  4D9J A;  4C9Y A;  4Y4R A;  3V76 A;  3EUH C;  1QA1 A;  2O5R A;  4A6E A;  3EDP A;  2JA5 J;  2YU3 A;  3DP7 A;  4K2E A;  1ETK A;  1UMK A;  3LNQ A;  5BPI A;  1B1B A;  1PYV A;  2G9W A;  4BGD A;  2VQH A;  4XKW A;  1QGZ A;  2BMW A;  2GJK A;  3GIR A;  1W5S A;  3OYB A;  1H42 A;  2M5S A;  4V19 K;  2QEN A;  2DT7 B;  3EQL F;  2HDD A;  3CCV B;  2A3S A;  2LYC A;  3D0S A;  3I59 B;  3LSI A;  1FOW A;  2Y0S N;  4W8S A;  2IW5 A;  2OU2 A;  3OOU A;  1VQ7 I;  5JBQ A;  5CQE A;  5JLX A;  3OYN A;  2BGC A;  2PFB A;  3BQY A;  3ZCO A;  4OJL A;  4M3G A;  1P4A A;  2ID6 A;  4CSW A;  1YJW I;  3CB4 A;  2AQE A;  3PSI A;  1ZG3 A;  3EET A;  5F64 A;  2TDX A;  1TNS A;  5F1R A;  3ASS A;  4ZJZ A;  2W48 A;  4R1H A;  2DOD A;  4XKC A;  2V31 A;  2FBK A;  3BCD A;  3CCL B;  3TDZ C;  2F4M B;  3V8L A;  3LMM A;  2DFE A;  3WGG A;  4EGZ A;  4X6A J;  1OFL A;  4I98 B;  4OAY A;  1VQK B;  1HKS A;  3BJO A;  5LRR A;  5D5U B;  2NTQ A;  2DMU A;  4YEI A;  3F6V A;  2A6H F;  2LKP A;  4XLF A;  5CKT A;  3WHC A;  3RZD J;  5JVT A;  1N07 A;  3JRF A;  3OSF A;  2MLG A;  4J0Q A;  2V7W A;  4UVB A;  1CF7 B;  2JRM A;  4EJT A;  3PUN A;  5GAH J;  1K78 B;  2GIV A;  1U3E M;  1HA8 A;  2VNJ A;  2YX4 A;  4HW0 A;  3HOX J;  1LFU P;  2WYR A;  1O8G A;  4QV2 A;  1UD3 A;  1YYV A;  3HGY A;  4NNJ A;  3SZG A;  3U1K A;  5ICE A;  3PUM A;  1QX4 A;  3QOE A;  1ORK A;  4DNR B;  3F9K A;  2HDC A;  2XSD C;  2QBY B;  3L2R A;  2V7F A;  4XRM A;  1ETV A;  1JTY A;  1K6O A;  3W5V A;  2LF7 A;  3CCE I;  1IRG A;  2WB1 A;  3MWM A;  4L5I A;  1JB9 A;  1EP1 B;  3GQ8 A;  1TYV A;  4Y7C A;  2QZA A;  2H6C A;  4RAF A;  4XM3 A;  1QUF A;  4DQL A;  1YJN I;  3WTX C;  2KJB A;  5HS8 A;  3W3C A;  5LBQ A;  3NWT A;  5A2Q K;  2K9L A;  5GV7 A;  5C1E A;  1QZY A;  2WAE A;  5CYV A;  2GK7 A;  1R23 A;  3U9G A;  2M8G X;  1W7P A;  3JR9 A;  4MO7 A;  2NV4 A;  3WXM A;  2IXS A;  3HOV J;  1AMO A;  3MD2 A;  5E1W A;  1BPL A;  4DW6 A;  3ASP A;  3OZW A;  4V2F A;  2OUM A;  2HDN B;  1TTT A;  3JRB A;  1JI8 A;  1R5G A;  3IP4 B;  1BIA A;  1ZAR A;  3GEZ A;  5K7Z A;  4NBQ A;  4ZZD A;  2C6Y A;  4ASN A;  3CMY A;  3D1N I;  4UVA A;  4F7Z A;  1JJ8 C;  3CCL I;  1BIB A;  1XCB A;  2VFN A;  2FJ1 A;  5F04 A;  4FWT A;  5H6Q A;  1FMW A;  3IWF A;  1MBE A;  3MEX A;  2LFB A;  1CF7 A;  2N8G A;  1KU3 A;  2ZNY A;  1IW7 F;  4AVP A;  3AGP A;  3IC7 A;  4A93 J;  3IAM 2;  1YJW B;  2X6Y A;  1H9T A;  2BHZ A;  1O8M A;  4Z03 A;  4XKV A;  3ERM A;  3WND A;  1LDD A;  3RQ4 A;  3I64 A;  2X8K A;  4A3C J;  4M72 A;  4FT8 A;  4E7S A;  2HEO A;  3CRZ A;  2LY9 A;  1Y0U A;  2KMU A;  1W2B B;  1KRH A;  2EFO A;  4HNT A;  2NT6 A;  4LG3 A;  1OFD A;  1IN6 A;  3OWT A;  4XLH A;  3G2B A;  2F5C A;  4YFO A;  1EV7 A;  3ESW B;  2O6G E;  4MGR A;  4UUT A;  4LBZ A;  4HNU A;  1WPK A;  2ELJ A;  2OQR A;  3CDH A;  1W0U A;  2RC6 A;  2HVQ A;  3I56 I;  2CJJ A;  4PGO A;  4ROX A;  1AA7 A;  1UCR A;  4FE7 A;  4AIJ A;  2NVY J;  2XKO A;  3WG7 H;  5CVI A;  1IXC A;  1MH3 A;  2CS3 A;  3OMY A;  3FJO A;  3FXU A;  3OOP A;  5FKM A;  2XTX A;  4BY7 J;  3CXC B;  4AUX A;  3E1S A;  4RGS A;  5HDG A;  2ZTG A;  4E7J A;  1VHO A;  2R7T A;  1JJ6 C;  4LK0 F;  5BSY A;  2E2I J;  4CQJ A;  1NK2 P;  1WJB A;  2QBY A;  4C0S A;  5DD8 A;  3LAJ A;  2FX0 A;  1JE8 A;  1Y8R B;  1IXS B;  4H0E A;  2VOD A;  1FNN A;  4XLC A;  3EQO A;  1QA2 A;  3GFM A;  2H09 A;  2EIJ H;  2XIG A;  5F4M A;  1OKR A;  1XFO A;  1A5J A;  3WU0 A;  2C5H A;  1MDM A;  1LNW A;  3W2G A;  2W82 A;  2CQ7 A;  2X48 A;  4Q4Z F;  3BCB A;  2V1N A;  2VBS A;  2MC4 A;  1PVE A;  3U21 A;  2XC1 A;  2WB1 N;  2DMN A;  3ZQ7 A;  1P92 A;  3PL8 A;  3J7Z I;  2JA8 J;  2ZIT A;  3OPO A;  3AVW A;  4N3N A;  4TKO B;  1SAU A;  2P3M A;  1MSF C;  3EPZ A;  1GLN A;  3JQP A;  3K1M A;  2IP2 A;  2NVT J;  3M1C A;  4HRI A;  4TT3 A;  1A31 A;  4YG2 F;  4W8R A;  2QYO A;  3BPV A;  3A03 A;  2LK2 A;  2XT2 A;  3CF5 F;  1SM4 A;  3ZQH A;  4BAC A;  3GW2 A;  2M45 A;  4UZE A;  4OMY A;  4BBS J;  2Y9Z A;  1YW9 A;  2AO9 A;  2L9V A;  5EGO A;  2PJR A;  4RCZ A;  1W36 C;  1FJL A;  2BXZ A;  3F3X A;  1WVR A;  2B0L A;  3RPQ A;  4OWR B;  3CDL A;  1UEL B;  4CDG A;  2DLL A;  2RV8 A;  1PLU A;  2JSC A;  5DTD A;  2ZJQ F;  1NH3 A;  4PZJ A;  4YAW A;  3K2Z A;  1BC8 C;  2IGN A;  2O6W A;  3BR5 A;  3CP8 A;  2ME6 A;  4A5N A;  4IEJ A;  5D6F A;  5K7F A;  5CVU A;  2K27 A;  2XRL A;  3JRE A;  1IAW A;  3VSU A;  1LFP A;  1IRF A;  4TMW A;  2E7W A;  2K4B A;  5GV8 A;  4DQ2 A;  5E18 F;  2ZZF A;  5EG0 B;  1STZ A;  3N05 A;  1F5T A;  2JVH A;  2K3F A;  1NG7 A;  3JW4 A;  3VEP A;  1USS A;  2DOE A;  4EV0 A;  1X0C A;  1DG1 G;  3CW2 A;  3KL9 A;  1OPC A;  1S4M A;  2K5C A;  4RPB A;  1G7C A;  3CDI A;  1GUU A;  4BUP A;  2E2H J;  5EJC A;  2VE8 A;  3RQI A;  5KAF C;  3P26 A;  2ZFW A;  1RIO H;  2QF7 A;  4EEF G;  2VFP A;  2W24 A;  4L9V A;  2HMA A;  3E7L A;  3OS0 A;  4LIU A;  3V4G A;  4OIP F;  3H5R A;  4S04 A;  2IS4 A;  4P2N A;  3WY9 A;  3KET A;  1O7F A;  3CME B;  2WTE A;  2P8T A;  1HKQ A;  3QQA A;  3LSP A;  3BCA A;  2GJP A;  2M4K A;  2CF4 A;  2DJI A;  2GQQ A;  3QPS A;  3OYD A;  2WWY A;  3OE7 A;  2GJR A;  1DP3 A;  1HDD C;  2FQ4 A;  4IXA A;  3CJT B;  1UD6 A;  3H3V K;  3FXL A;  1WTH D;  4RAY A;  3DEU A;  4JX4 A;  1SKQ A;  4O6J A;  3G1L A;  4YZQ A;  3M4O J;  3DKW A;  4ZCM A;  3FXK A;  2LMD A;  2FD5 A;  4KIG A;  4XL9 A;  4PFP A;  1GR1 A;  2BXY A;  3GQA A;  4YII A;  3TP0 A;  5GAG J;  3FBN B;  1WI9 A;  1OGM X;  2NT9 A;  3V7C A;  1HW2 A;  3GLL A;  5C4X J;  2HOS A;  1R1V A;  3PJR A;  5L46 A;  1SVO A;  1S72 B;  3ZMU A;  1RQP A;  4QUZ A;  4A2U A;  4BXF A;  3ROU A;  5IYP A;  4HNV A;  1KK2 A;  2DA3 A;  3B6C A;  3IHU A;  3LYC A;  4M3E A;  1K73 D;  4Y9U A;  1RRJ A;  4G6Q A;  2DMP A;  4BEH B;  3BY6 A;  2IOU G;  5IK2 A;  3P5J A;  2CH0 A;  3KE2 A;  4MFE A;  1REP C;  3R6J A;  2R7W A;  4AWX B;  2ZZQ A;  2HZT A;  4PK4 A;  1JGG A;  4I2O A;  5E17 F;  4KMU X;  3TED A;  2DER A;  3C1D A;  1XS9 A;  2XRO A;  2QSG X;  1K9M D;  1YX2 A;  5E6T A;  1KQ9 A;  5IY5 H;  4FQG A;  4RLF A;  3SKB A;  3MMY B;  4WF2 A;  4OOS A;  3PO2 J;  1D0Z A;  3U6B A;  4UUV A;  2BEO A;  3A0H C;  3RYP A;  1CLW A;  3G71 B;  3O8G A;  3F8B A;  2FOW A;  4M1K A;  1H80 A;  1HXD A;  3OEE A;  2E1R A;  4NCN A;  4ZTJ A;  2QEX B;  3TQN A;  1Z21 A;  3F23 A;  2KZG A;  3K6G A;  1NB9 A;  3RPU D;  1ZGJ A;  2PJP A;  3HUG B;  4A3E J;  1UHW A;  1Z6T A;  1PJR A;  1KU9 A;  1WP6 A;  4GRI A;  3VWB A;  4B3F X;  1TZL A;  4EJO A;  3N4M A;  1DDN A;  3W2A A;  3M07 A;  5FO0 A;  3CC7 I;  4IX7 A;  4ZYH A;  2DMT A;  3IKT A;  1GHC A;  4RAZ A;  1ZRE A;  2F3L A;  1MMA A;  1MRZ A;  1HG8 A;  2EFQ A;  2ZZG A;  3BQZ A;  1N0V C;  1G7S A;  2WAQ A;  1HST A;  1QFY A;  5HDK A;  2DMQ A;  4HIZ A;  2VC1 A;  3EUA A;  3AG2 H;  1V5E A;  1JHH A;  3W6J B;  4BHC A;  5FO1 A;  4CCM A;  3ASN H;  3MKY B;  1PUF A;  4XON A;  2OCE A;  5EZH A;  2KRH A;  3WGH A;  3Q0V A;  1AIP A;  2A5W A;  1QVF B;  1MND A;  1OOC A;  3HRS A;  4HSR A;  2ELH A;  2LH9 A;  3DU5 A;  1J9Z A;  2DIE A;  1X2N A;  5KCM A;  2H8R A;  5ILV A;  5TRD A;  4MR0 A;  1I18 A;  1MBG A;  2Z1D A;  2OTJ I;  4OIR F;  2XZP A;  4M2L A;  4LD5 A;  2FEZ A;  1XG1 A;  2BE5 F;  3OYM A;  1UG2 A;  1W0K A;  1TNT A;  1KYW A;  2ZTN A;  1YX5 A;  3BH4 A;  4E70 A;  1ZM2 A;  1WQ2 A;  2BY0 A;  3HC7 A;  3JAM Z;  5E3O A;  3S3M A;  1OMI A;  2IEK A;  2X4H A;  1NK3 P;  5IT9 Z;  2V1U A;  1E62 A;  1VQM B;  2OK7 A;  3VOE A;  5B5E C;  1QQ1 A;  3HSF A;  1X1D A;  4UHT A;  2JZY A;  2ZKZ A;  2ZO4 A;  2XZO A;  3K0L A;  4HAM A;  3I58 A;  1G8X A;  3KLN A;  3SUC A;  3PFI A;  1NB0 A;  1U5T C;  2FX3 A;  2GZW A;  1JTX A;  2VJ5 A;  1BR4 A;  3WTW C;  3L09 A;  1JKR C;  4M6X A;  2VJ4 A;  3QU3 A;  4NQW B;  3DU6 A;  1HW5 A;  5FD5 A;  3IUO A;  3SZE A;  1LDK B;  1M1E B;  3AGQ A;  4IRG A;  4P6V F;  3GCM A;  1Q9S A;  3GVL A;  1VLY A;  1SFK A;  1XMA A;  1KMH A;  3C2G A;  1BOA A;  3FXQ A;  2F4I A;  1GXP A;  5TV2 A;  2IT0 A;  4AF6 A;  3F8N A;  4II2 A;  2INU A;  1YW8 A;  4JP0 A;  2FBI A;  2R0Q C;  1QRB A;  1S29 A;  2O04 A;  3ZQL A;  2B7C A;  1V0F A;  2EV6 A;  2XB0 X;  4E7Z A;  3CMA I;  2JJ7 A;  1FTZ A;  3S32 A;  5E8G A;  3U1D A;  3GYH X;  1DBO A;  1EJ9 A;  4NUB A;  3LAP A;  4MYU A;  2OBS A;  3VSV A;  4EJV A;  3F22 A;  3CC4 I;  3Q3S A;  3RPU A;  4Z4V A;  4XSX F;  3CMA B;  3CC7 B;  3RIR A;  5HOO A;  4U0Y A;  3CC4 B;  1JRG A;  4RPD A;  1SC7 A;  1YIT B;  3KRG A;  5D8K B;  1BM9 A;  2V7T A;  1QQI A;  1X3U A;  3LSJ A;  1B8I B;  4ACB A;  3HL2 A;  1XGN A;  3C2B A;  3LO8 A;  4OM9 A;  2HQ5 A;  3LSR A;  2XRN A;  2Y0S A;  2QQ8 A;  2NTB A;  4G6T B;  2BOL A;  3E20 A;  2EWN A;  2YSR A;  2AXL A;  4YDT A;  4ZDP A;  4Q48 A;  1TL8 A;  1QZZ A;  3DLA A;  2UZK A;  1EF4 A;  1XG2 A;  1O57 A;  2ZC2 A;  2LNB A;  1OR7 C;  4F92 B;  3K1N A;  1OGJ A;  1J0R A;  2COM A;  2IAI A;  4BYY A;  3OYE A;  2F4N A;  3ZIA A;  4UZF A;  3RTR A;  1TUI A;  2CFO A;  3PM1 A;  2L4M A;  4G7Z F;  4X7E A;  4YZA A;  2ACJ A;  1K8A D;  3GTJ J;  5EDN A;  1S72 I;  2V79 A;  1JKO C;  4PAB A;  5FA6 A;  1IDJ A;  3BT9 A;  5E79 C;  2QX3 A;  4M71 A;  4HYE A;  1MBH A;  2DK5 A;  4BQA A;  3PET A;  3MFK A;  4P6Y A;  1I3Q J;  3IWZ A;  3PA2 A;  1Q1H A;  2NS8 A;  3J81 Z;  2KVO A;  5E20 A;  1Z67 A;  3FIW A;  1XDU A;  2JQ7 A;  1HW1 A;  5EZG A;  5J8C A;  1Z91 A;  1MSE C;  1XQB A;  3OYC A;  2VBY A;  3P9K A;  1BW5 A;  2O0Y A;  3ABK H;  4KKU A;  2QEX I;  4OJP A;  1FSE A;  2OJE D;  2VJI A;  3ABU A;  3K69 A;  4P55 A;  4A0Z A;  2R7X A;  1I3A A;  4CYD A;  2XPV A;  2CW5 A;  2VKV A;  3GBG A;  3KLO A;  2V6C A;  3A01 A;  1A35 A;  4X05 A;  3QU6 A;  1OFE A;  1PXZ A;  5F08 A;  5HLT A;  2ZSI B;  1B72 B;  1PKV A;  2QGG A;  5H59 A;  3SLN A;  4BY1 J;  3KIO A;  3AVX A;  3AVT A;  4IHY A;  2GXB A;  4NHJ A;  1BJK A;  2FF4 A;  5H20 A;  1MD0 A;  2HPM A;  3L9F A;  3RY8 A;  2BSA A;  2Z9O A;  3E5X A;  2QSF X;  3A4C A;  1HCR A;  3CUQ A;  1IJF A;  2NAZ A;  1SFX A;  1IV8 A;  3QPT A;  1BBY A;  1HBX G;  1R22 A;  1VQP I;  1KK3 A;  4ZV4 A;  1ULY A;  2ZBU A;  2WJY A;  2NSP A;  1GDT A;  3V7R A;  5FRM A;  1OGO X;  2D9R A;  3FIS A;  2JN9 A;  5A89 A;  3DBH B;  4RB0 A;  1EFT A;  4ESF A;  3K7A J;  1I7P A;  4X0C A;  2HYF A;  2DPU A;  5FKL A;  5H2F C;  4KKS A;  3QP5 A;  2JA6 J;  1D8T A;  2PIA A;  1FDR A;  3GZ5 A;  4RGR A;  3SEQ A;  1ZN2 A;  1QFZ A;  2NNN A;  3UNG C;  3ZP5 A;  1VQ9 I;  2CQN A;  3OIO A;  2EQR A;  4M0L A;  4PJ0 C;  2ZCW A;  2ZJR F;  2HTJ A;  3TMO A;  5LFA A;  3H36 A;  1IDK A;  3FHZ A;  1M1K D;  2ECB A;  3OV8 A;  3TW6 A;  3CC2 I;  1ZTR A;  3KX2 A;  2NS0 A;  5F0C A;  3VPR A;  1BR1 A;  2FE3 A;  2ZJ2 A;  3RJP A;  1IZ1 A;  5L3G A;  2DBB A;  4WCG A;  1U5T A;  3Q5F A;  2D3L A;  3TL4 X;  4L9J A;  4R79 A;  2I8D A;  2PBI A;  3B6A A;  1YG2 A;  3CLQ A;  4HEA 2;  2BY3 A;  5CVJ A;  4GO1 A;  2PG4 A;  5F6F A;  3CME I;  4KH3 A;  2Z33 A;  1E17 A;  4Z1M A;  2FSW A;  4RB2 C;  3J81 K;  4HOB A;  2DI3 A;  3CCJ I;  1T8I A;  3AST A;  5B6I A;  4PAA A;  3HXL A;  3FXR A;  3SZT A;  3S1Q J;  4I0A A;  1X1B A;  1R5N A;  5J35 A;  4M73 A;  1JGS A;  1JKQ C;  5B1B H;  5HZB A;  3BJA A;  4A3L J;  3CJQ B;  5KW9 A;  1CNE A;  1D1N A;  3DTK A;  5FO5 A;  2LRD A;  2HOE A;  2BV6 A;  4ZCL A;  3HG9 A;  1N77 A;  5JHF A;  3BZ6 A;  2R7R A;  2FMY A;  1T6S A;  1QA6 A;  4B43 A;  5D4R A;  3BWG A;  1UD8 A;  3EUK L;  3FXO A;  1T95 A;  2R5Z B;  2DEU A;  2QLZ A;  3CD6 B;  4B8X A;  3GTP J;  1LEB A;  5FIU A;  1DGR M;  4RAG A;  1EA3 A;  1G4D A;  1WJC A;  2W85 A;  3D26 A;  4M9X A;  2XND A;  4I76 A;  5GPA A;  4MEX F;  4B48 A;  5CDF A;  4W1U A;  2I10 A;  1XSX A;  1RR8 C;  1JHF A;  3ZPL A;  4NBS A;  3QFR A;  2VL8 A;  4E0F A;  4BH9 A;  4OZZ A;  2D1H A;  4U0W A;  4N3G A;  1WOS A;  1XC5 A;  3I54 A;  2VNI A;  3QYB A;  4HX7 A;  3WU2 C;  3H5N A;  2DPD A;  3Q3A A;  2XVC A;  4BAY A;  2KT0 A;  5F1J A;  2KDZ A;  5DYM A;  3T56 B;  4I6Z A;  2W00 A;  5TGT A;  2EIL H;  3ZN0 A;  4A3I J;  2HGC A;  4D5F A;  3B78 A;  2KFD A;  4QHY A;  1I5Z A;  1IB4 A;  1DDG A;  1WJA A;  3HM5 A;  4XID A;  2XAU A;  3OW2 B;  2XDV A;  5M3F J;  4XRS G;  5TR9 A;  4WZT A;  3D5L A;  2HPI A;  2EV5 A;  2QA4 I;  3GTG J;  2O0V A;  3SQN A;  4TV7 A;  4O5V A;  1ZM9 A;  3U6K A;  1G6N A;  3GVJ A;  2QWW A;  4ZYA A;  1NBM A;  3CCM I;  4PUS A;  2XGE A;  4MNU A;  3VO2 A;  5M5Y J;  3OL3 A;  3WE3 A;  3DPL C;  4P1W A;  1R1U A;  4HE6 A;  4C43 A;  5JLV C;  3B73 A;  4HLY A;  2CK3 A;  3J80 Z;  1ZM3 A;  2LP0 A;  2R7S A;  2JA2 A;  3ABT A;  3VSL A;  3F8M A;  2QQA A;  2M30 A;  4RM0 A;  4YAL A;  3PQK A;  1B6A A;  3GTM J;  1R5B A;  4Y17 A;  4G6I A;  2RC4 A;  4UNO A;  3IV5 A;  4TMX A;  3I59 A;  4WXH A;  2Q2E A;  4G12 A;  4PSW A;  3DBL B;  4PC1 A;  2V6E A;  2CC2 A;  3G6E B;  3AL0 C;  2HWV A;  4OZY A;  2A5Y B;  2J7K A;  3LA3 A;  3GTL J;  1AOY A;  1ZK8 A;  4L5E A;  1E43 A;  1U8B A;  4MEY F;  3F72 A;  4N4N B;  3R0A A;  1IF1 A;  2CYY A;  2ZME C;  3GQ7 A;  1R36 A;  2A05 A;  1LKX A;  2JVG A;  2VXZ A;  1ETW A;  2DOG A;  3LWF A;  3W5U A;  1TC3 C;  1YIO A;  2PE3 A;  4GFB A;  4LB6 B;  4G5G A;  2IVM A;  3CC2 B;  1JT6 A;  3PFY A;  5F27 A;  2L7Z A;  1UB9 A;  2IRF G;  2VC0 A;  5HNF A;  3LFK A;  1BX1 A;  2Q6I A;  5ILS A;  1MH4 A;  4NC8 A;  3BOQ A;  3ZC3 A;  1IHM A;  4F91 B;  4FET A;  1PUE E;  2OBR A;  4RDL A;  3HRM A;  3DLL F;  3LMW A;  2VBE A;  3R6S A;  2L4A A;  5HVQ C;  4L18 B;  1Y56 A;  1FSH A;  3HPG A;  3H9N A;  2C5B A;  4I01 A;  1R4M B;  2BY1 A;  2L2O A;  1RU4 A;  4RBO A;  5HLH A;  4D7M A;  3G71 I;  4H9G A;  3BG3 A;  4BHP A;  2BF4 A;  2M34 A;  4AC9 A;  4G6D A;  3OEH A;  4CHU A;  3V8J A;  1SFE A;  2CV1 A;  1ZGA A;  1ZAO A;  1TWC J;  1XCV A;  3FKJ A;  2IA2 A;  5M3M J;  3L2C A;  3BR6 A;  3W2I A;  2P5K A;  1YRN A;  3LJY A;  2VKD A;  3G3Z A;  5J8F A;  4LB5 A;  1ACI A;  2K85 A;  1ONV A;  4CUG A;  5IOZ A;  3VNV A;  4G7O F;  3ZUG A;  2EJR A;  3AVY A;  2GWR A;  1YI2 I;  6PAX A;  2EK5 A;  3QWL A;  4JQF A;  2QA4 B;  2CUF A;  3GZ6 A;  2BM0 A;  1RUO A;  3KEW A;  3I4P A;  4BQN A;  1ON2 A;  1E3P A;  4A0Y A;  2F2E A;  1VQ9 B;  4HWV A;  5HS7 A;  2CRG A;  3FWE A;  4Y15 A;  4CZZ A;  4N9H A;  1KYZ A;  2WJV A;  1DQU A;  4AYB A;  3DEW A;  4YFN F;  3FKS A;  4M6V A;  2XC7 A;  1BI3 A;  1LLW A;  2DFF A;  1AHD P;  4XR6 A;  1VQ5 I;  4P22 A;  4G1V A;  1YHQ B;  2WV0 A;  1JXS A;  3JSP A;  4C3J J;  4IKF A;  1RZ4 A;  2VUM J;  3CCS B;  1XB2 A;  1BX0 A;  2FNA A;  4DZP A;  1WDT A;  4II3 A;  3VFZ A;  1T0F C;  1YQA A;  3CCU I;  1J5Y A;  2PLF A;  4M53 A;  4Z4Y A;  2EWE A;  4TSF A;  3BNW A;  2HKO A;  4Y7N J;  2AHQ A;  2WPD A;  3GSI A;  5DUK A;  3HOY J;  2PYH A;  1W1W E;  5LGT A;  2DW4 A;  1Q7Y D;  4KT6 A;  1G2H A;  4MTD A;  1E79 A;  3EQN A;  1OCP A;  5A2Q Z;  2ISZ A;  3EYI A;  2CBX A;  3OS2 A;  4LGW A;  2QCO A;  2ZXJ A;  3OYL A;  1ITY A;  1U8R A;  4YCQ A;  1I27 A;  1TWF J;  5F4O A;  3KEO A;  4CH7 A;  3S1M J;  2DYI A;  2P5V A;  3ZR8 X;  3CCR I;  3WE2 A;  1X58 A;  2HZD A;  2A68 F;  1FTT A;  1H8H A;  5J3O A;  4FXU A;  5BSX A;  1HSJ A;  3OYH A;  4MQ9 F;  1W0J A;  4OIQ F;  1TTY A;  1HQC A;  2KJC A;  3LQR A;  3H94 A;  4ZCI A;  3FY3 A;  5J3L A;  1FYM A;  4XOT A;  2DOA A;  3GF2 A;  3GZN B;  3TP3 A;  3T8R A;  2W25 A;  2W7N A;  2XNC A;  2FRH A;  4RD0 A;  5FKN A;  3W2W A;  4PC6 A;  2D2W A;  3P7N A;  1UG0 A;  1G3S A;  1OYI A;  4ZYG A;  1OCT C;  4XOP A;  2HS5 A;  5D6E A;  1VF9 A;  3M8E A;  3JX8 A;  4YEL A;  1OHH A;  4HZF A;  1LFB A;  4PDK A;  4UUS A;  1ZG1 A;  1FYL A;  2F1M A;  5DS0 A;  4HBL A;  4V2G A;  1D5V A;  5C44 J;  2Y75 A;  4I84 A;  5CLS A;  3OYI A;  4KUM A;  4KFC A;  1A8P A;  3M3Y J;  2VLA A;  2VFQ A;  5DEQ A;  1VQ8 B;  3CUQ C;  1E63 A;  4OJO A;  1VQN I;  1FND A;  1Y1V J;  2CUJ A;  3T53 B;  5L3B A;  5E3L A;  5M5W J;  4UY8 I;  1IDY A;  3AVV A;  3L00 A;  4JOM A;  5FB2 A;  4ENM A;  4O3M A;  1KK0 A;  3EUH A;  3VOD A;  5IP6 A;  3R60 A;  1PJ7 A;  3HHG A;  2OV7 A;  3JQQ A;  4WQM A;  3FMQ A;  1MIJ A;  2JT1 A;  1ZH5 A;  1LUJ B;  4V02 C;  2KLO A;  2YR2 A;  2NVQ J;  2OQG A;  4A3G J;  1VZ0 A;  2JJ2 A;  4RD4 A;  2HI3 A;  1N25 A;  1IN8 A;  2MA3 A;  4GQN A;  1PP8 F;  3GTO J;  3RZO J;  1I1G A;  4WWV A;  3JUR A;  5IT3 A;  4CO8 A;  4QVJ A;  4XRF A;  1QHG A;  3K4B A;  1YLF A;  3LOC A;  3PUF A;  5KNL A;  2MSY A;  3S15 J;  5J47 A;  3KZI C;  4KIB A;  3GO5 A;  1B23 P;  1R4N B;  2FXA A;  2Q6K A;  1KGS A;  2XGC A;  2XGX A;  3L2U A;  2VOO A;  2E35 A;  3MKL A;  2OTL I;  5IYD J;  1MGT A;  3OYG A;  4DNT B;  1NHC A;  5LHG A;  1FC3 A;  4OP7 A;  4OIN F;  2QMU A;  4W8T A;  1UHM A;  5BS6 A;  2OTL B;  3Q0W A;  1IG7 A;  5FLV A;  2EA4 A;  1S7O A;  3HB9 A;  1IN4 A;  3FHN A;  4JRA C;  3CD6 I;  1SFO J;  4GDF A;  2UV1 A;  4FAS D;  2XKP A;  2UUZ A;  2NNY A;  3M8F A;  4PSX A;  2DCE A;  4AD9 A;  3CLO A;  2QM3 A;  3T1B A;  5ICC A;  3E3V A;  2BX6 A;  2RN7 A;  1T38 A;  4DZJ A;  1RET A;  3SLD A;  4IPA A;  1UST A;  1W34 A;  1QFJ A;  1VQ8 I;  1QUE A;  1TYU A;  2ZXH A;  1I6H J;  1VQO B;  4EM1 A;  4CGZ A;  3Q38 A;  3SY2 A;  4YC5 A;  2EFG A;  3CUO A;  4PC7 A;  1VQO I;  1YS6 A;  3CUQ B;  1FMV A;  1ZRF A;  4PCQ A;  3OW7 A;  3SYT A;  2WAQ N;  3KP3 A;  3B8H A;  2EFN A;  5FKO A;  3SJM A;  2G7U A;  2NZM A;  3TH0 A;  2F6C A;  3I3L A;  1D2E A;  2DFH A;  1VQ6 I;  1NG6 A;  1ELO A;  5EYR A;  3DKX A;  2HVR A;  3ZQG A;  2MYS A;  3TOA A;  4KNY A;  2VBM A;  2W7Z A;  4KIS A;  2W1O A;  2L7F P;  2X85 A;  4XMY A;  3KPH A;  3CCJ B;  2UXN A;  1A04 A;  3WTS C;  2V26 A;  3LQ6 A;  1IN5 A;  2E1M C;  1TQP A;  4B44 A;  1FX0 A;  2V7X A;  1Z6R A;  1QZE A;  5ICG A;  4F7D A;  3PA1 A;  1WH5 A;  4UUS B;  1BR2 A;  1POG A;  1YLO A;  2Q8K A;  4BQO A;  4HF0 A;  4RS8 A;  2X3U A;  1KQ0 A;  4QVA A;  3LNN A;  2XGD A;  3BG6 A;  1YTY A;  2FUG 2;  2LY2 A;  1IJE A;  5H5J A;  4D0P A;  1V3F A;  1ZLJ A;  3NQO A;  4XN3 A;  3ZSC A;  3A1Y A;  3ASO H;  2FVG A;  1U6G A;  4KN4 X;  4P1V A;  3PQJ A;  1GJR A;  2EFP A;  5FJ8 J;  2EZH A;  5FFZ A;  2XUB A;  1OIS A;  3R0J A;  3BR3 A;  2R5Y A;  1EFR A;  3PSZ A;  4BU2 A;  1HOM A;  2DJN A;  2CU7 A;  2QYU A;  1YS7 A;  1BOB A;  2NOG A;  4FHT A;  4BKX A;  2ZBV A;  2KL4 A;  2VNH A;  2E1O A;  1B9M A;  2GK6 A;  1XGM A;  3S1R J;  4WZL A;  3BJ6 A;  4A3F J;  3QSY A;  4F52 A;  1Z7U A;  2VPL A;  5HDN A;  3WTT C;  2W6J A;  2HR3 A;  1V5G A;  1IO2 A;  4L5J A;  2AQF A;  3DTI A;  2ECC A;  1OGI A;  2DA1 A;  3K2A A;  3ASQ A;  2O7O A;  3FBI B;  2VQC A;  4C30 A;  5TY0 A;  2DFI A;  2DAO A;  2Z8G A;  3HPH A;  2CWE A;  2BYV E;  4BEH A;  3L7W A;  4HST A;  2DTR A;  1W7P D;  1VQ4 I;  1OCC H;  3FZV A;  2DYR H;  1ZR4 A;  1WFX A;  1WPC A;  5FRN A;  1K4Z A;  4IHW A;  4R71 A;  2RAE A;  3QPH A;  1FY7 A;  2XSJ C;  3NAR A;  2GA1 A;  3O3K A;  1ZQ3 P;  2C4U A;  3DXJ F;  3AG4 H;  3HYI A;  1FRN A;  3BTC A;  5TIS C;  5BQT A;  1B9N A;  2PQ8 A;  4QWQ A;  1K78 A;  1KC8 D;  1ZR2 A;  2YUS A;  3CCQ I;  1EE6 A;  5EG0 A;  1BC7 C;  2CSO A;  4Z06 A;  1SD7 A;  3GXO A;  2RGV A;  2KRC A;  3FMS A;  4AU7 A;  2X1E A;  3F21 A;  1XPX A;  1YHQ I;  2EIK H;  2NST A;  4ENK A;  4FK8 A;  3PNT A;  2Z16 A;  3VDX A;  3HZJ A;  4KA4 A;  2XTW A;  3ZQC A;  2CW7 A;  3C7J A;  1N08 A;  1X1P A;  5DUI A;  5JVG F;  1OCO H;  1UAA A;  3BTJ A;  3DKY A;  3HOS A;  4HX8 A;  1B59 A;  3NB2 A;  4FE4 A;  2M3A A;  4CYC A;  4MXN A;  5HOD A;  1S5L C;  5FFX A;  2BSP A;  3B4N A;  2KDO A;  1VI0 A;  3I4N J;  3X2Q H;  1D0X A;  3TDU C;  3ZMV A;  4IHT A;  2XHK A;  2OZU A;  1KU2 A;  2E60 A;  1BLI A;  4BDZ A;  4OJ5 A;  1SD4 A;  4ZTF A;  4ENN A;  1COW A;  2DQR A;  2FA5 A;  4RJL A;  2M0M A;  4C2M J;  3WU1 B;  2WZN A;  1BN8 A;  2G0E A;  3SFI A;  2R5Y B;  4J00 A;  1BJZ A;  4Y3O A;  2LBF A;  1JTA A;  2JPC A;  2Z5U A;  4A0X A;  3GUD A;  1LVA A;  3VB2 A;  2AHO A;  1DU0 A;  5IT9 K;  2PMD A;  3ZN1 A;  2HXI A;  5D4S A;  4A3B J;  2ICW G;  2STT A;  4RB3 C;  3MCA A;  1QRC A;  2QSH X;  3W2H A;  1XX5 A;  3NWS A;  3NE5 B;  3DU1 X;  3BH7 B;  3JU4 A;  1GV5 A;  1J9I A;  2L9S A;  4GYG A;  3OYJ A;  4CXF A;  2XTY A;  2H1K A;  4BQQ A;  1JNY A;  2E1M B;  2V7V A;  2OF7 A;  1F20 A;  4W97 A;  4DIQ A;  1BL0 A;  4ASU A;  4HLX A;  1EP3 B;  2XV4 S;  2R4G A;  1GVH A;  4OOV A;  5IYC J;  4N9I A;  4HPQ A;  2RNG A;  3SDG A;  2RVC A;  1OLT A;  3I5U A;  3WG9 A;  4I99 C;  3CCU B;  2XNJ A;  3FK7 A;  1KTV A;  1QGP A;  2ZZE A;  3DF8 A;  2C77 A;  4LBV A;  1O8K A;  3OYK A;  4M74 A;  1R00 A;  2JRT A;  1E3O C;  3H3Z A;  3QFS A;  2Z99 A;  1FNB A;  4U9U A;  4URR A;  2CFX A;  2B0R A;  1V0E A;  3SJZ A;  1T6Y A;  2ZBK A;  4JX5 A;  1VJS A;  1DGW Y;  1MJA A;  1TW2 A;  2XAG A;  3PVD A;  1W9X A;  1ZGW A;  2JIZ A;  3GQB A;  2QTL A;  1LEA A;  1IUF A;  1CQT A;  3VYS B;  5DS9 A;  1WI3 A;  1Z3X A;  2IBD A;  1X1C A;  2L54 A;  2R7D A;  3BTL A;  3G1O A;  3E6D A;  3S3O A;  2HOA A;  1GXQ A;  5DCF A;  4LIV A;  2WR8 A;  4Q7J B;  3A02 A;  2H1L A;  1Q81 D;  3FMR A;  3WTV C;  4G9Y A;  2E2J J;  3H92 A;  2CW8 A;  5LLQ A;  4LJZ F;  4XLA A;  1D5Y A;  4HQE A;  3PIP F;  3A8K A;  2O8X A;  3BG5 A;  3COA C;  4PMH A;  2V1X A;  3DPU A;  2JUG A;  4RMN A;  2D74 A;  3BY1 A;  4Z2Y A;  2IS6 A;  2XAF A;  2ZJP F;  1YW7 A;  2F5F A;  1WOO A;  1X3W B;  4B4D A;  3MQ0 A;  5IYN A;  2BY2 A;  3Q9S A;  4KMF A;  1NRK A;  2HKX A;  4U88 A;  1SAX A;  2O17 A;  2P4W A;  4P3Y A;  4XIC A;  2H27 A;  2K02 A;  3I9V 2;  1QBJ A;  1UD4 A;  5HXB A;  4CYC B;  2J8K A;  4C3I J;  1TW3 A;  3H1C A;  5AIQ A;  1O3Q A;  1TYX A;  2VOP A;  4ZGQ B;  3ASR A;  2QDX A;  5TJJ A;  3CF2 A;  3KYL A;  3J7A O;  2LOO A;  2M1B A;  4N0B A;  3ONY A;  1MKM A;  2A69 F;  4XRS A;  2DXI A;  2NVX J;  1NDH A;  1E1R A;  2GPJ A;  3ISP A;  4Z4R A;  4GCV A;  5J40 A;  4WZE A;  4OOI A;  3KEQ A;  2R7O A;  3FM5 A;  3MVP A;  3DCF A;  1LPQ A;  2E1C A;  2CGP A;  3S17 J;  1DAR A;  3U2R A;  1OCR H;  3IH2 A;  3QFT A;  4HE5 A;  2XGJ A;  3PSS A;  4MQV A;  1N8R D;  5F4J A;  2GRE A;  2EZK A;  1H9G A;  1XMX A;  2KHM A;  2JJ1 A;  1O8I A;  3VSK A;  2D3N A;  3J7A Y;  4ZYE A;  4DBQ A;  2Q2E B;  3B90 A;  5DNS A;  2DT6 A;  1R58 A;  3M8J A;  4IF4 A;  3GVK A;  4RD6 A;  3SEJ A;  4HA8 A;  4EJU A;  4AC0 A;  3OJW A;  4XK4 A;  1ETQ A;  1G3Y A;  1QHH D;  3WTU C;  4B3X A;  3HKZ N;  3I1F A;  4FN5 A;  3L2W A;  2VQG A;  3JQR A;  3JAM K;  2ZSH B;  4LMY A;  3HSR A;  4RLZ A;  2BBY A;  3GTQ J;  1IDZ A;  3DPT A;  1SMT A;  4B3A A;  2STW A;  1OQY A;  1P4X A;  1IB0 A;  1EKE A;  1DBG A;  2R7V A;  2YWF A;  3GFL A;  2QVO A;  1UD2 A;  2IS2 A;  2BPO A;  2Q0O A;  3JTH A;  2MW8 A;  4D1Q A;  1OB0 A;  2GQF A;  2JSP A;  3W2E A;  4RDK A;  1LQ1 A;  3SEZ A;  1M90 D;  3QOD A;  2CUE A;  5KHD A;  1W7P B;  5LHI A;  3W5H A;  2LF8 A;  2BV3 A;  5AN9 A;  1O8H A;  3JRA A;  2QTZ A;  3R61 A;  4OPV A;  1QVG B;  5IYQ A;  4QLC U;  3ZQI A;  3L2Q A;  4Z4Z A;  4QTR A;  5DDG A;  1CZF A;  1DPU A;  2YWH A;  4P96 A;  4IRH A;  2B7B A;  1HZE A;  3K9T A;  1GV2 A;  1PP7 U;  1TLL A;  2DU9 A;  5J6X A;  1V5V A;  1BI2 A;  3DQV C;  2C2W A;  2VQL A;  1X19 A;  4BJT A;  3JRD A;  1W87 A;  2ZFU A;  4P9U A;  1FZP B;  2PMZ N;  4U49 A;  1Y8Q B;  3H9J A;  1ZEL A;  1FBQ A;  1MMG A;  1XSV A;  2CW0 F;  1P6R A;  2EA2 A;  2OBP A;  4AM3 A;  2VBZ A;  1QGA A;  2JK3 A;  3CJN A;  3MMP A;  1OFM A;  4GXO A;  3ZMT A;  1P4M A;  5J1R A;  2O61 A;  5DN6 A;  4CCO A;  4OPS A;  1UD5 A;  3OOC A;  4W8Q A;  1P2F A;  3VMF A;  3G4S I;  1U5T B;  3O2P E;  4U0V A;  2EFW A;  2M7A A;  2MGQ A;  2CV0 A;  2EH3 A;  3HTU A;  3QAH A;  3AKZ A;  2VE9 A;  4I0B A;  2XEX A;  3HAG A;  5CPR B;  4MYT A;  1WJE A;  3P9C A;  2K7L A;  2Q6O A;  2Y31 A;  5FD6 A;  3E1Y E;  3ECH A;  2ZL6 A;  2MLK A;  2HQN A;  3A8J A;  4LIT A;  2QQB A;  4RD3 A;  2VYQ A;  3SZP A;  3N6Z A;  2XF5 A;  1HC8 A;  3VYR B;  3WHB A;  4FX4 A;  2L7M P;  4YHB A;  1P9Q C;  4N4O B;  1X1A A;  4M6Y A;  2LD5 A;  5FLX Z;  1K83 J;  2CQX A;  3G73 A;  3MHP A;  3VO1 A;  4P12 A;  1RKW A;  2LVS A;  1JUP A;  2O03 A;  3LSM A;  4YEJ A;  3WTZ A;  2WA0 A;  1TBX A;  3CES A;  3VST A;  1ON1 A;  1D3Y A;  4X06 A;  4M9S A;  1WKM A;  1E3H A;  3T0Y A;  3CQZ J;  1U9N A;  3B82 A;  4DQK A;  5GAD J;  1T2K A;  5JMC B;  1TQM A;  3TO7 A;  1WH7 A;  5EGO B;  1VQM I;  4BBR J;  1RR7 A;  3J81 k;  3OSG A;  4P9F A;  5IPA A;  3T5X A;  5GTI C;  1FWZ A;  5AON A;  4A3K J;  1LE8 B;  3HEF A;  4AVZ A;  2IA0 A;  1IJW C;  1IV6 A;  5K5Q A;  1OB2 A;  2UXX A;  1WSV A;  1IGN A;  4IHV A;  2DT5 A;  3OAA A;  4A12 A;  3ML3 A;  1ENH A;  3ZBU A;  4TMZ A;  4P9S A;  4IZZ A;  2R7U A;  1S9H A;  4IHX A;  1VQL B;  2DOF A;  4RB1 A;  2KIF A;  2YX7 A;  3I4M J;  2FOK A;  2O3F A;  3ZMZ A;  3LSG A;  5B3S H;  2H8W A;  2VXD A;  2BM7 A;  5F0F A;  1HKT A;  3HDD A;  3TW7 A;  3OS1 A;  2F43 A;  2V9K A;  2LC2 A;  2RKH A;  3S8P A;  2UVF A;  2O0W A;  4X0G A;  2DY1 A;  2NTP A;  1PJ5 A;  2L7K A;  1SD5 A;  3PNV A;  4PJL A;  1G3T A;  3MCZ A;  3E5Q A;  2X6W A;  1HF0 A;  3K10 A;  5JLW A;  3R4K A;  5FLX K;  3MN2 A;  4Y33 A;  5BPD A;  4C2T A;  2GAU A;  2YWE A;  3CCQ B;  2W4S A;  3AL0 B;  4BJ5 C;  2X0K A;  1XD7 A;  2XOK A;  2NOJ B;  3ONU A;  4DYC A;  3B02 A;  4IOC F;  1TQI A;  3GWZ A;  1FRQ A;  3A3G A;  4B09 A;  1SKY B;  1DU6 A;  1U2R A;  5J4Y A;  3LVB A;  3JRC A;  1MBF A;  2ID3 A;  2J5P A;  1AWC A;  1J59 A;  1LLZ A;  2X1D A;  3GX4 X;  1EFC A;  1KZH A;  4HDV A;  1IXR C;  2LDU A;  1H85 A;  4TMV A;  2VT2 A;  3BH6 B;  3IAS 2;  3BZK A;  4NQW A;  4XN0 A;  2VAS A;  2A6T A;  2M4G A;  5GP9 A;  4XBF A;  1DDI A;  2KKO A;  4PFO A;  4YIF A;  3FXJ A;  3OL4 A;  3I56 B;  5DV5 A;  5GTH C;  3C18 A;  1BN5 A;  2HQA A;  4YXW A;  3F8C A;  3CO6 C;  4G94 A;  2C78 A;  3SXY A;  1O3T A;  4OAZ A;  3K70 C;  3D5R C;  1RPW A;  1W4M A;  4EJW A;  2E5N A;  2WZP P;  3WNC A;  2CMP A;  2ZME A;  2LRE A;  1FEX A;  2DK8 A;  1O7L A;  4WXD A;  1W5C C;  1E0E A;  1PDN C;  2NS7 A;  4OIO F;  3FDY A;  5K1Y A;  4G7H F;  4BXU A;  4Z4T A;  4B1R A;  1Q82 D;  2OC6 A;  1X2M A;  3QOP A;  3QP6 A;  3UR3 C;  3I55 I;  3HOT A;  4BE1 A;  4WXC A;  2P6T A;  4HF1 A;  3T9G A;  5AMV A;  3T8T A;  1WHU A;  5IOY A;  4S0H B;  4BE0 A;  1S6L A;  2O8K A;  4Z6Y A;  2KIS A;  2MC3 A;  3RSN A;  1Y1W J;  3FPK A;  2CG4 A;  4XLN F;  5FGM A;  4MHG A;  2K9M A;  1EA0 A;  1VQ7 B;  1MBJ A;  2TCT A;  4GGG A;  5LGU A;  1YIT I;  4Z4S A;  2WY7 Q;  4IHS A;  3WWG A;  4LFU A;  1H8E A;  4ACA A;  1SEU A;  4WWC A;  1P7I A;  2HDW A;  2V9P A;  1F1Z A;  1W5T A;  1W0T A;  2R92 J;  3BR1 A;  1QNT A;  5DM7 F;  1E3X A;  1U78 A;  4IOA F;  4LBW A;  1TWH J;  2DQL A;  2LTP A;  2H94 A;  1KON A;  3OYF A;  1L1I A;  1DAB A;  4PJM A;  2EV0 A;  2GBY A;  2RC5 A;  1KU7 A;  5FL7 A;  5D8L B;  4Z4W A;  1O8J A;  5DM6 F;  4CIC A;  2E36 A;  3BG9 A;  1HA3 A;  3HUG A;  1YX3 A;  4G8X A;  1KQ5 A;  1WOP A;  1OCZ H;  2VBW A;  1Z05 A;  1ETY A;  4LG0 A;  2YWG A;  4XLE A;  1CGP A;  3CP2 A;  2BM6 A;  1IC8 A;  1FP1 D;  2L02 A;  5JHU A;  3E6B A;  2FNP A;  2Q1Z B;  1HVX A;  3P27 A;  3CCV I;  3TBI A;  1GVJ A;  3OJX A;  1XMK A;  2R7Q A;  3BZC A;  1JJ2 B;  4EM0 B;  1RUN A;  1D1A A;  4NB5 A;  2JDI A;  3OIQ A;  4RCY A;  1E3Z A;  1VQ4 B;  2Y30 A;  2E1B A;  5LMZ A;  3HJE A;  2VNK A;  2GOM A;  1Z3Y A;  1RNL A;  4XNF A;  4ZDL A;  4UXN A;  1XB4 A;  5J1Y A;  2NRA C;  2PI0 A;  3A8I A;  3DEE A;  5IYW A;  2VPR A;  1C0W A;  2L0K A;  2LG4 A;  3ELK A;  4P26 A;  3WNB A;  1O8D A;  2HNH A;  3LSK A;  3P9I A;  3AFH A;  1UJ8 A;  4M9Z A;  4E7K A;  1KQ8 A;  1T5E A;  2X6O A;  4L9T A;  3BRO A;  1YJ9 I;  1QCX A;  1R5H A;  5J4V A;  1OYY A;  4UV8 A;  3J80 K;  1YFH A;  2DET A;  1MMN A;  2P6S A;  3TO9 A;  9ANT A;  1ZUN B;  1K5C A;  4RLQ A;  3HTS B;  3HHH A;  3M7G A;  1K4T A;  2QQ9 A;  1TWA J;  4I02 A;  2ZXW H;  2CUZ A;  4IL6 C;  2V9V A;  3JSO A;  4D5C A;  3NAW A;  2VBU A;  3LQE A;  1FLI A;  5AIP A;  2WY8 Q;  2R93 J;  4NC6 A;  1WWX A;  3S2W A;  4Y13 A;  3GTK J;  1WSR A;  1R6R A;  3FM3 A;  5DD4 A;  1FNC A;  1G7R A;  1IUY A;  1B4A A;  3RKY A;  4S05 A;  1NJI D;  3L1P A;  2G7H A;  1TWG J;  2B5O A;  2YU9 J;  2WSS A;  2OZ6 A;  4DK1 A;  3H3U A;  3DBR B;  1YRN B;  2VBK A;  4G7W A;  1J2X A;  1Y39 A;  1A6I A;  1T98 A;  2F5D A;  3IH3 A;  1QPI A;  3IRR A;  4A3D J;  2G0Y A;  5FKK A;  2OTJ B;  1MDM B;  2DO7 A;  3TO6 A;  1I8D A;  1HDP A;  2EPF A;  3PSF A;  4YIR X;  1V54 H;  3O6B B;  2M87 A;  2XAS A;  3LFU A;  2BM4 A;  2KQR A;  4XLP F;  2L9R A;  1K8F A;  2Z3Y A;  1LDJ A;  4P5O A;  4AF7 A;  1ZRC A;  2JWT A;  2IGO A;  4DYR A;  4DBR A;  2YPR A;  3ZRG A;  5BOX A;  1L3L A;  2X1C A;  4RGU A;  4Z4U A;  3P4G A;  3S2D J;  3V8K A;  5CJ9 A;  1AU7 A;  1K28 D;  1E1Q A;  2YUH A;  2QZ8 A;  2EIM H;  1BI1 A;  2X53 S;  5ICF A;  2VON A;  1T39 A;  1BQE A;  2BVM A;  5HZA A;  3DV8 A;  2FU4 A;  1XGS A;  4XQF A;  1Q1V A;  1YO5 C;  1QJV A;  1O4X A;  1Z9C A;  2A07 F;  2XT4 A;  2F48 A;  3JRG A;  1F4K A;  3L2V A;  2Y48 A;  1RI7 A;  4UB8 C;  3ZPP A;  4AIK A;  5C3E J;  4RD2 A;  4HV5 A;  1UFM A;  2ESN A;  3ONQ A;  4LG0 B;  1QVT A;  4P3I A;  1DUX C;  1PE9 A;  4ZDO A;  3E97 A;  4CCL A;  4XKB A;  2V5I A;  5IP9 J;  5ED4 A;  2DDA A;  4DJA A;  3CCY A;  2LZJ A;  2HOT A;  1FBU A;  1ZM4 A;  3Q6Q A;  1R5I D;  3DWL E;  4X1E A;  4QPO A;  2CQQ A;  3W2F A;  1DP7 P;  1VFC A;  4DK0 A;  4KJZ A;  2FML A;  3TOB A;  5C4J J;  3K1P A;  2DA2 A;  3K4L A;  5HLG A;  1D0Y A;  1VND A;  3HGG A;  5BNG A;  2L01 A;  2HVS A;  4BXX J;  2LY1 A;  3W2V A;  4YFK F;  4NDL A;  4U7D A;  3CJR B;  4IQJ A;  2ESH A;  4IQ4 A;  3R6K A;  4L9N A;  1AKH B;  2D1V A;  1KQS B;  1R71 A;  4M4S A;  2DA4 A;  4LLL A;  3HKZ A;  2ZL7 A;  3WBK A;  4YZX A;  2DCU A;  3GFI A;  4ZZL A;  4OU0 A;  4HQM A;  2OBT A;  5E1X A;  1MZB A;  3LQQ A;  2KIQ A;  3OY9 A;  3QE2 A;  5HKK A;  1OR7 A;  2PEX A;  4M3D A;  2K9N A;  2D45 A;  4TMT A;  2XPU A;  2AXT C;  2IJL A;  1O3R A;  3MZ8 A;  1B8I A;  3ZBT A;  1SAN A;  4UVC A;  5E3N A;  4KYW A;  1BHE A;  2R7Z J;  1GO2 A;  2V7Q A;  5GPC A;  2LSO A;  2VKE A;  3OR2 C;  1HF2 A;  1FT9 A;  4X07 A;  2GXG A;  3RCO A;  3A3B A;  5GAE J;  1K6Y A;  4X8I A;  1WGX A;  3GFJ A;  2M0C A;  2VT3 A;  1S8N A;  2NVU B;  3O8H A;  3ZXS A;  2I1L A;  1T08 B;  1YI2 B;  4Q5S F;  1SMY F;  2X6X A;  1E64 A;  4YFX F;  3GQ9 A;  2M9H A;  1Z7L A;  2PJR B;  2YS9 A;  3FPP A;  3QYF A;  3K70 D;  2RQQ A;  1EZG A;  1R1T A;  1XN7 A;  3BDD A;  2HYJ A;  4KKT A;  3ZPN A;  1LJ9 A;  3UKG A;  5CVR A;  1EP2 B;  3NRV A;  1AIR A;  1YOV B;  1VQ5 B;  3I71 A;  5L3E A;  3I53 A;  4FTH A;  1VQL I;  1F60 A;  1RWR A;  2RRE A;  2E19 A;  3KZY A;  1I50 J;  2R6H A;  3GVA A;  4DYQ A;  3Q39 A;  2MD0 A;  4RM2 A;  1OB5 A;  3HOZ J;  3BCF A;  2PEC A;  3IKV A;  2IPQ X;  3S93 A;  3GLX A;  3SYJ A;  1HLV A;  1S0U A;  1GT0 C;  3A35 A;  1D1C A;  1MBK A;  1LB2 A;  3RIQ A;  5EMN A;  1T6X A;  2W57 A;  2Y69 H;  5E1Z B;  2OAZ A;  3BY2 A;  1DPR A;  1EWY A;  4DOZ A;  1N78 A;  2E34 A;  3H35 A;  1BW6 A;  2W84 A;  1PJ6 A;  4I7H A;  3CZ6 A;  3V7S A;  4CCN A;  2M8E A;  3ZOB A;  1TYW A;  2GIZ A;  1LM1 A;  2BM1 A;  1K61 A;  3BPX A;  3KYC B;  1IRZ A;  5DSZ A;  2DDB A;  3RDI A;  3M1E A;  3C2H A;  3KFW X;  3PNY A;  1MMD A;  2OK8 A;  3H9Q A;  5LEK A;  2C4T A;  1Y0Y A;  1G7T A;  1WSU A;  5J1U A;  2QN6 A;  1MNM C;  2M7B A;  1H88 C;  2CND A;  3VMV A;  4L0Y B;  2Y9Y A;  2R7F A;  2MD5 A;  5LGN A;  1H8A C;  4ENJ A;  2OCC H;  3G05 A;  3VNU A;  4KIT B;  5LHH A;  4EGY A;  1O3S A;  3AVU A;  4A69 C;  2R3S A;  1J75 A;  1FOK A;  3A0B C;  2X9D A;  4J19 A;  5L3D A;  2GM4 A;  2HU9 A;  1I6X A;  1KJZ A;  2V4D A;  3PIO F;  2R9V A;  1P4W A;  3LA7 A;  4ETS A;  1R9T J;  3VR6 A;  4QSH A;  4RDU A;  3OIP A;  3CCM B;  1E2X A;  2WAF A;  1T33 A;  1QPM A;  3HRT A;  1TT0 A;  1XSD A;  2PLY A;  2Z2S B;  2KP6 A;  1RQR A;  4AID A;  2ETH A;  3W6K B;  4X7F A;  3SQV A;  2LLK A;  1R49 A;  3CCS I;  2Q6L A;  3H5A A;  2QE7 A;  2PN6 A;  3CMM A;  4EMS A;  1FX7 A;  2L3D A;  3C3W A;  2E7X A;  1T6Z A;  2DN0 A;  5JFR A;  1V4R A;  3PUB A;  1O88 A;  3KP2 A;  2K40 A;  2VBX A;  2VI6 A;  2IGM A;  4EQQ A;  4F3Q A;  1PUF B;  5THX A;  3I55 B;  2OYN A;  3IH4 A;  1S7E A;  2INV A;  4E7I A;  4PC3 A;  1U0J A;  2CO5 A;  3Q9V A;  3BLY A;  1S3J A;  1I1S A;  3OP1 A;  4XD7 A;  2GA2 A;  3WGI A;  4JMQ A;  3WBJ A;  4H4K C;  1EH8 A;  4WK8 F;  1J7K A;  2HXO A;  3PO3 J;  5CQG A;  2BZT A;  3D5S C;  4QIW N;  1FOX A;  2ZL5 A;  3U2Q A;  4B3G A;  1RES A;  1U2W A;  2VJJ A;  4AIH A;  1V55 H;  5LRS A;  3UW0 A;  2VB6 A;  4KDP A;  2EBI A;  3JRI A;  2VKH A;  3ZMD A;  4E7H A;  2B7E A;  1JKP C;  5KSW B;  1MAB A;  4D7N A;  4BDY A;  2GLO A;  3MZH A;  1EXM A;  4YZ0 A;  2XZL A;  2X51 A;  3JRH A;  1EH6 A;  1RC9 A;  3KYD B;  1FP2 A;  2JN6 A;  1IRX A;  1QRY A;  1UZC A;  2FQ3 A;  2X0L A;  1N0U A;  3F6O A;  3K4N A;  2F4O B;  2HYG D;  2K4J A;  2OD5 A;  4XOR A;  1JT0 A;  2V4J C;  1T0F A;  2DA7 A;  3I0T A;  1R5O A;  1W36 D;  3ERE D;  1VQN B;  2ZNZ A;  2KIU A;  2ZME B;  1FOY A;  3AG3 H;  5B1A H;  1X4O A;  2JPB A;  3S3N A;  2JTV A;  4OPO A;  3W6V A;  2CRV A;  1VBL A;  1O8L A;  4A3J J;  3ZZ0 A;  2B63 J;  5FNZ A;  1OJL A;  1ODD A;  1H89 C;  2O9L A;  4E6K G;  4LLG F;  2ELK A;  2FBH A;  4J01 A;  1Z0X A;  4IO9 F;  3DTE A;  4PGH A;  3QYE A;  2WV1 A;  1RKT A;  5C1C A;  2KPM A;  4PGG A;  1UMQ A;  3MAJ A;  3ZQF A;  2BGI A;  1F43 A;  2NPF A;  3SFZ A;  1FIA A;  5EF6 A;  1TT5 B;  1XE1 A;  3WQZ A;  3B8Y A;  3OFN A;  2P7V B;  2DA6 A;  4PJN A;  3J7Y J;  4BPR A;  1D1B A;  3G1M A;  1VHE A;  1T56 A;  4JK1 X;  1FNM A;  4LBY A;  4L0Z B;  4C3H J;  1CNF A;  1FIP A;  3REO A;  3F0C A;  1SFU A;  1WZ2 A;  3S14 J;  3S1N J;  1QG0 A;  1QGY A;  4EH1 A;  4HX4 A;  1ETO A;  4OOX A;  4LLN A;  3FX3 A;  1A36 A;  5K5O A;  2IS1 A;  4UAJ A;  4EAT A;  2UVE A;  4QFM A;  5FLM J;  4B4C A;  4IJA A;  2XB5 A;  1ZRD A;  4ZGN B;  4IVN A;  1SD6 A;  4TN1 A;  4WZK A;  1RMG A;  1WCM J;  1GAQ A;  3BR2 A;  1KD1 D;  4Z05 A;  1YJ9 B;  2PMH A;  4ZC3 A;  3QPL A;  4BHB A;  1WMR A;  3ZMS A;  5HLI A;  3OYA A;  5EEH A;  2XAQ A;  4C2L A;  4JX6 A;  1KTW A;  3V7A A;  2GOX B;  4LK1 F;  5DCM A;  2PMU A;  3NEU A;  4U7B A;  3ULQ B;  2K9Q A;  1JUS A;  3ISX A;  1KZL A;  1TP4 A;  1SVL A;  1G3W A;  1MW7 A;  2TRT A;  4ABZ A;  4Y9R A;  4G7X A;  1FBS A;  3OKX A;  2QXZ A;  3LSH A;  4I09 A;  1OYW A;  2K3P A;  2M2E A;  5IYB J;  3H09 A;  2EB7 A;  3AAF A;  1XDS A;  3F8F A;  2ME0 A;  3LL7 A;  2LBF B;  2VBT A;  3ABL H;  3BC9 A;  4YAU A;  1GQ8 A;  5M5X J;  1GAW A;  3G6E I;  4YRV A;  4BL0 B;  3WYA A;  1F36 A;  3SHF A;  5IYR A;  4KIF A;  2AS5 F;  5JR3 A;  4ZYD A;  1TSP A;  2XF6 A;  5HNH A;  3M9A A;  5ILU A;  2GXA A;  2BVN A;  4L8J A;  5E3M A;  2E1N A;  4P25 A;  1SVM A;  4CA0 A;  2O1D A;  4BS9 A;  1ERD A;  2HQR A;  1VQ6 B;  2MG4 A;  1L0O C;  4MFD A;  1X4P A;  2P7C B;  3K4C A;  1EFU A;  4C2U A;  2L5Q A;  4IW3 B;  2QKM B;  3HBL A;  2V7U A;  1Y6I A;  1O8F A;  3HRU A;  2J5O A;  2XF7 A;  2P0W A;  3HIF A;  3KZZ A;  1YE9 A;  4UB6 C;  5D5X B;  2WAD A;  3BP8 A;  1EH7 A;  4XSZ F;  2IA1 A;  4E7L A;  1ZG5 A;  2PX9 A;  3FXM A;  3JTG A;  3E6C C;  1MNE A;  4HF2 A;  3AG1 H;  1JA1 A;  4KIC A;  2I5U A;  2LKS A;  2QGU A;  4DGW B;  1APL C;  1XTA A;  3N97 A;  2QKL B;  4AYB N;  4UV9 A;  4EVI A;  4MTE A;  3JCU C;  1VF7 A;  3RKW A;  4FX0 A;  4MIM A;  2JMW A;  2J8I A;  1KCC A;  3PEN A;  4FIS A;  3ABM H;  3BR0 A;  1K7A A;  2X3H A;  4GYI A;  3OR1 C;  2OPT A;  1Z77 A;  2MAB A;  5KAI C;  2LR8 A;  1BA5 A;  5K5R A;  3IL2 A;  2B9S A;  2BW3 B;  3HOW J;  1KA8 A;  1YJN B;  1UHS A;  2E71 A;  4LC0 A;  3KP7 A;  3OZU A;  2VBV A;  4BNC A;  2MH2 A;  3LST A;  4RGX A;  1MJB A;  2PMZ A;  2CV2 A;  2EIX A;  2XAJ A;  4M3F A;  4X7D A;  5CVV A;  2H6B A;  4B47 A;  1QH0 A;  2HCJ B;  3S16 J;  1R7J A;  3SDB A;  4ESJ A;  1WRJ A;  2UWM A;  5KVR A;  1X3Z B; 
#chains in the Genus database with same CATH homology
 3UR3 C;  4BE1 A;  2WAQ A;  2ODL A;  3T9G A;  3GRH A;  5AMV A;  3MKW B;  4BE0 A;  3EUA A;  4HIZ A;  3FHN A;  1V5E A;  4CCM A;  3RSN A;  2UV1 A;  4FAS D;  3MKY B;  4XON A;  2K9M A;  2KRH A;  1OOC A;  2UUZ A;  2A5W A;  1MND A;  4PSX A;  2DCE A;  4HSR A;  2WY7 Q;  1WJD A;  2LH9 A;  3DU5 A;  3WWG A;  1H8E A;  2DIE A;  4MR0 A;  5KCM A;  2HDW A;  1I18 A;  2VIX A;  2Z1D A;  3BG7 A;  4MLO A;  2XZP A;  1E3X A;  4NC7 A;  2F5V A;  3OYM A;  1W0K A;  1KON A;  3OYF A;  2ZTN A;  1YX5 A;  2ZXH A;  4PJM A;  3BH4 A;  3HC7 A;  3S3M A;  5FL7 A;  1V5F A;  1O8J A;  3BC8 A;  1FMV A;  1X1D A;  2PYG A;  2BW3 A;  3OW7 A;  1YX3 A;  3SYT A;  2XZO A;  1LVK A;  2NZM A;  3DDY A;  1G8X A;  4XLE A;  2F6C A;  3CP2 A;  3H9G A;  3I3L A;  3SUC A;  1KCD A;  1NG6 A;  1WJ5 A;  3DKX A;  2HVR A;  2Q1Z B;  3K4M A;  1BR4 A;  2MYS A;  2VJ5 A;  1HVX A;  3T51 B;  2VBM A;  3TBI A;  4KIS A;  2VJ4 A;  2W1O A;  1WJF A;  2X85 A;  4NQW B;  2R7Q A;  3DU6 A;  4XMY A;  4ANJ A;  3KEY A;  1IA5 A;  3IUO A;  1D1A A;  4BJ6 C;  4PJJ A;  1LDK B;  2JDI A;  2V26 A;  3K4K A;  3OIQ A;  1E3Z A;  3GVL A;  2E1M C;  4B44 A;  1VLY A;  1SFK A;  1KMH A;  2E1B A;  2KZV A;  2WBM A;  3C2G A;  1FX0 A;  2GOM A;  1Z3Y A;  2F4I A;  4ITV A;  4XNF A;  4ZDL A;  3DEE A;  4II2 A;  2INU A;  2LG4 A;  1O8D A;  2MFZ A;  2QY1 A;  1BR2 A;  2O04 A;  2HNH A;  3LSK A;  4BQO A;  1V0F A;  3A2K A;  2IQ7 A;  3AFH A;  4E7Z A;  4E7K A;  3S32 A;  1T5E A;  3K4J A;  3LNN A;  1DBO A;  3BG6 A;  4NUB A;  2FUG 2;  2LY2 A;  3VSV A;  1QCX A;  3ZQQ A;  4XN3 A;  3ZSC A;  2HLD A;  2W6I A;  3A1Y A;  4CCJ A;  1MMN A;  1JRG A;  4U87 A;  5HOO A;  1K5C A;  4RLQ A;  3ZGK A;  3KRG A;  2BVL A;  2CUZ A;  3HL2 A;  4BE2 A;  1EFR A;  4BU2 A;  2Y0S A;  2L9N A;  2NTB A;  4G6T B;  2Z6B D;  2BOL A;  1BOB A;  2WY8 Q;  4W8T A;  4HG2 A;  2KL4 A;  4ZDP A;  2GK6 A;  1R6R A;  1J09 A;  3DLA A;  4F52 A;  2VPL A;  2W6J A;  1XG2 A;  1V5G A;  2AQF A;  3DTI A;  1OR7 C;  4F92 B;  5LD2 C;  4CCK A;  1QU3 A;  2ZXI A;  3OYE A;  3ZIA A;  2E5Z A;  3FBI B;  3RTR A;  2WSS A;  2VQC A;  4C30 A;  3H0D A;  4OJ6 A;  4DK1 A;  2CFO A;  2VBK A;  2Z8G A;  3HPH A;  4G7W A;  4YZA A;  1IDJ A;  4BEH A;  1BMF A;  4HST A;  2QX3 A;  3VYT B;  1WFX A;  4F93 B;  5FRN A;  1WPC A;  5FRO A;  1N75 A;  3E0J B;  2KVO A;  1I8D A;  4NK6 A;  2XSJ C;  3PSF A;  4U4B A;  3MKZ A;  3LFU A;  3VYU B;  1O8E A;  2KQR A;  4NK8 A;  1EE6 A;  3OYC A;  4P5O A;  2IGK A;  2IGO A;  4DBR A;  3ZRG A;  4CZC A;  4OJP A;  4KKU A;  4Z06 A;  2X1C A;  2R7X A;  2NST A;  2KRC A;  2VJI A;  4AU7 A;  2X1E A;  1G59 A;  1K28 D;  1E1Q A;  3GBG A;  2Z16 A;  3PNT A;  3VDX A;  1PXZ A;  5HLT A;  2CW7 A;  2X53 S;  4UZU A;  3VMW A;  4F55 A;  2ZSI B;  2BVM A;  1UAA A;  4XQF A;  3DKY A;  3HOS A;  1PKV A;  1QJV A;  4EW9 A;  3V42 A;  4E4H A;  4QPQ A;  2M3A A;  4MXN A;  4RM3 A;  4D9J A;  4C9Y A;  3L2V A;  4Y4R A;  3ZPP A;  3EUH C;  2BSP A;  2O5R A;  2KDO A;  2HPM A;  3B4N A;  3ONQ A;  1D0X A;  1PE9 A;  4ZDO A;  4CCL A;  4XKB A;  3A4C A;  1PYV A;  2E60 A;  4DJA A;  2LZJ A;  4BGD A;  2VQH A;  4XKW A;  1BLI A;  4BDZ A;  2GJK A;  4OJ5 A;  4ZTF A;  3OYB A;  1COW A;  3DWL E;  2M5S A;  2M0M A;  1BN8 A;  4QPO A;  2WJY A;  2NSP A;  4J00 A;  2DT7 B;  4Y3O A;  5FRM A;  2LBF A;  4DK0 A;  4KJZ A;  2LYC A;  1JTA A;  1OGO X;  3LSI A;  4W8S A;  3K4L A;  3OOU A;  1D0Y A;  5CQE A;  3OYN A;  2HVS A;  2LY1 A;  3NWS A;  3ZCO A;  3NE5 B;  3W2V A;  4CSW A;  4IQJ A;  4KKS A;  3CJR B;  4OJL A;  2AQE A;  4IQ4 A;  3JU4 A;  3SEQ A;  2L9S A;  3PSI A;  3OYJ A;  3UNG C;  4ZJZ A;  4BQQ A;  3HKZ A;  2E1M B;  2V31 A;  4XKC A;  3BCD A;  4YZX A;  3TMO A;  5LFA A;  3LMM A;  4DIQ A;  1IDK A;  1OFL A;  4ASU A;  3OY9 A;  4OAY A;  2R4G A;  5HKK A;  3KX2 A;  1BR1 A;  4HPQ A;  2RNG A;  2D3L A;  2NTQ A;  1OLT A;  3TL4 X;  4R79 A;  4XLF A;  5CKT A;  2I8D A;  1BHE A;  2V7Q A;  3OR2 C;  4HEA 2;  2ZZE A;  1O8K A;  3RCO A;  3A3B A;  3OYK A;  1K6Y A;  4Z1M A;  1HA8 A;  3ZXS A;  1O8G A;  4URR A;  1V0E A;  2X6X A;  3HXL A;  3SZG A;  4NNJ A;  1UD3 A;  1VJS A;  3GQ9 A;  1DGW Y;  1Z7L A;  2PJR B;  1X1B A;  3QOE A;  3FPP A;  4DNR B;  1W9X A;  3QYF A;  3K70 D;  2RQQ A;  3F9K A;  3GQB A;  2JIZ A;  3L2R A;  2V7F A;  3CJQ B;  3VYS B;  4KKT A;  3ZPN A;  3DTK A;  1Z3X A;  1X1C A;  2LRD A;  2WB1 A;  3S3O A;  1AIR A;  3HG9 A;  1N77 A;  5JHF A;  3GQ8 A;  2R7R A;  1RWR A;  1UD8 A;  4B43 A;  4LIV A;  2RRE A;  3EUK L;  1T95 A;  4XM3 A;  3W3C A;  2CW8 A;  3NWT A;  4XLA A;  2K9L A;  2MD0 A;  4RM2 A;  2PEC A;  1DGR M;  2WAE A;  2GK7 A;  1EA3 A;  3BCF A;  3S93 A;  5C1E A;  1WJC A;  3A35 A;  1D1C A;  2XND A;  5CDF A;  4B48 A;  4PMH A;  2IXS A;  3DPU A;  2JUG A;  3MD2 A;  4RMN A;  1BPL A;  2IS6 A;  4DOZ A;  1N78 A;  3H35 A;  2OUM A;  2VL8 A;  4E0F A;  1JI8 A;  4OZZ A;  3IP4 B;  1NRK A;  3CZ6 A;  3QYB A;  4CCN A;  2O17 A;  3H5N A;  1FMW A;  3T56 B;  2W00 A;  5TGT A;  3PNY A;  3C2H A;  1MMD A;  3H9Q A;  3IAM 2;  3I9V 2;  2X6Y A;  1O8M A;  4Z03 A;  2M7B A;  1UD4 A;  3VMV A;  1IB4 A;  1WJA A;  4XKV A;  2XAU A;  2XDV A;  3RQ4 A;  2X8K A;  4E7S A;  3G05 A;  2KMU A;  3D5L A;  4KIT B;  2HPI A;  3CF2 A;  3KYL A;  2LOO A;  4HNT A;  2NT6 A;  4LG3 A;  2O0V A;  2DXI A;  3OWT A;  4XLH A;  3G2B A;  1E1R A;  3GVJ A;  1NBM A;  2HU9 A;  4ZYA A;  4PUS A;  2V4D A;  2R9V A;  3VR6 A;  2R7O A;  2ELJ A;  3OL3 A;  3DPL C;  4P1W A;  4HNU A;  2XGJ A;  3OIP A;  2HVQ A;  2CK3 A;  2WAF A;  1AA7 A;  1TT0 A;  2JJ1 A;  2Z2S B;  2KP6 A;  2KHM A;  2R7S A;  1O8I A;  2JA2 A;  3VSK A;  3VSL A;  3J7A Y;  2D3N A;  4DBQ A;  2Q2E B;  3B90 A;  2DT6 A;  2CS3 A;  3M8J A;  3OMY A;  4G6I A;  3GVK A;  3H5A A;  2QE7 A;  4PSW A;  3E1S A;  3CMM A;  2V6E A;  4E7J A;  2ZTG A;  3AL0 C;  2R7T A;  4OZY A;  1QHH D;  4B3X A;  1WJB A;  3PUB A;  1O88 A;  3L2W A;  2VQG A;  2ZSH B;  2IGM A;  4F3Q A;  1E43 A;  3EQO A;  4XLC A;  4N4N B;  3DPT A;  3GQ7 A;  1LKX A;  2JVG A;  2INV A;  2VXZ A;  4E7I A;  1DBG A;  2R7V A;  1U0J A;  2W82 A;  3BLY A;  2IS2 A;  1UD2 A;  4XD7 A;  4JMQ A;  1OB0 A;  4D1Q A;  3PFY A;  2JSP A;  3BCB A;  2V1N A;  4H4K C;  3SEZ A;  2MC4 A;  3U21 A;  3QOD A;  5KHD A;  5HNF A;  3PL8 A;  5CQG A;  3OPO A;  3D5S C;  4NC8 A;  4TKO B;  4B3G A;  1SAU A;  1O8H A;  2VJJ A;  4F91 B;  4FET A;  3UW0 A;  2VB6 A;  4E7H A;  2VKH A;  3EPZ A;  1GLN A;  3LMW A;  2VBE A;  3L2Q A;  1MAB A;  3M1C A;  5HVQ C;  1Y56 A;  4HRI A;  4BDY A;  3HPG A;  1CZF A;  4TT3 A;  4YZ0 A;  2L2O A;  4W8R A;  2XZL A;  2X51 A;  1RU4 A;  1HZE A;  4BAC A;  3DQV C;  1IRX A;  2VQL A;  1X19 A;  4BJT A;  3OEH A;  2ZFU A;  2PJR A;  3K4N A;  1W36 C;  2CV1 A;  4XOR A;  2V4J C;  4OWR B;  3FKJ A;  4U49 A;  1W36 D;  1UEL B;  3H9J A;  1ZEL A;  1MMG A;  2VKD A;  1PLU A;  4CUG A;  1X4O A;  1OFM A;  3S3N A;  2IGN A;  3CP8 A;  1VBL A;  1O8L A;  4JQF A;  5DN6 A;  4CCO A;  1UD5 A;  3OOC A;  4W8Q A;  3KEW A;  4E6K G;  4BQN A;  2M7A A;  2CV0 A;  4J01 A;  3AKZ A;  4HWV A;  3VSU A;  1LFP A;  3HAG A;  3DTE A;  3QYE A;  5CPR B;  5C1C A;  2KPM A;  1WJE A;  2WJV A;  1DQU A;  4AYB A;  2ZZF A;  3FKS A;  2XC7 A;  3N05 A;  3WQZ A;  3B8Y A;  3OFN A;  2JVH A;  4XR6 A;  1NG7 A;  4P22 A;  1X0C A;  4LIT A;  4PJN A;  1D1B A;  2XF5 A;  3VYR B;  4IKF A;  1P9Q C;  2K5C A;  4N4O B;  1X1A A;  4BUP A;  4II3 A;  1T0F C;  3LSM A;  2EWE A;  4YEJ A;  2IS1 A;  4TSF A;  3VST A;  2WA0 A;  3CES A;  3OS0 A;  2WPD A;  4LIU A;  4EAT A;  3H5R A;  2IS4 A;  2PYH A;  2UVE A;  4KT6 A;  1E79 A;  3EQN A;  3BCA A;  1RMG A;  2GJP A;  2M4K A;  3OS2 A;  3OYL A;  4Z05 A;  2DJI A;  4ZC3 A;  3OYD A;  3OE7 A;  1WMR A;  2GJR A;  4AVZ A;  4CH7 A;  1DP3 A;  3OYA A;  3ZR8 X;  1UD6 A;  4C2L A;  1KTW A;  2GOX B;  2HZD A;  1WTH D;  1H8H A;  3OAA A;  4U7B A;  4FXU A;  1KZL A;  3OYH A;  1MW7 A;  4IZZ A;  1S9H A;  2R7U A;  4G7X A;  4YZQ A;  2QXZ A;  1W0J A;  3LSH A;  4XL9 A;  4PFP A;  2K3P A;  3GQA A;  3BC9 A;  3LL7 A;  3H94 A;  3FBN B;  2LBF B;  3LSG A;  1GQ8 A;  1OGM X;  2NT9 A;  3FY3 A;  2VXD A;  4YRV A;  4BL0 B;  3OS1 A;  3PJR A;  4XOT A;  2F43 A;  2DOA A;  2V9K A;  2LC2 A;  2XF6 A;  3S8P A;  5HNH A;  2UVF A;  2O0W A;  4X0G A;  2W7N A;  4L8J A;  2NTP A;  4BXF A;  2L7K A;  3W2W A;  4CA0 A;  3PNV A;  4PJL A;  1UG0 A;  2O1D A;  4BS9 A;  1ERD A;  2X6W A;  3K10 A;  4XOP A;  1X4P A;  3K4C A;  4Y33 A;  4YEL A;  4C2T A;  4C2U A;  1OHH A;  2L5Q A;  2W4S A;  3AL0 B;  2F1M A;  4BJ5 C;  2QKM B;  2XOK A;  1Y6I A;  2NOJ B;  4BEH B;  1O8F A;  5IK2 A;  2CH0 A;  2XF7 A;  2P0W A;  2R7W A;  3A3G A;  4I84 A;  1YE9 A;  1SKY B;  2WAD A;  3OYI A;  4PK4 A;  4E7L A;  2ZZQ A;  2VLA A;  1MNE A;  4OJO A;  2X1D A;  2CUJ A;  3T53 B;  4DGW B;  4JOM A;  4RLF A;  3MMY B;  2QKL B;  1D0Z A;  3IAS 2;  4XN0 A;  2VAS A;  2A6T A;  2M4G A;  2OV7 A;  4PFO A;  1VF7 A;  1KCC A;  1H80 A;  3OEE A;  3OL4 A;  2KLO A;  4ZTJ A;  2JJ2 A;  1VZ0 A;  2X3H A;  1Z21 A;  2HQA A;  3OR1 C;  2MAB A;  4YXW A;  3K6G A;  3RPU D;  4GQN A;  2BW3 B;  3HUG B;  4OAZ A;  3K70 C;  3D5R C;  3JUR A;  1PJR A;  2E5N A;  4GRI A;  1WP6 A;  2WZP P;  1QHG A;  2CMP A;  3K4B A;  5KNL A;  3VWB A;  1TZL A;  2LRE A;  4B3F X;  3W2A A;  2PMZ A;  2CV2 A;  4IX7 A;  1E0E A;  4B47 A;  3FDY A;  3L2U A;  1MMA A;  3SDB A;  2UWM A;  4DNT B;  3OYG A;  2ZZG A;  1HG8 A;  1NHC A;  2OC6 A;  3HOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...