4XMYA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 235
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xmyA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xmyA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xmyA02
1QJVA 1GQ8A 4OJ6A 3VSUA 1PXZA 4XOTA 4XOPA 2O1DA 4XKWA 3UW0A 1DBOA 1QCXA 1KCCA 1O8KA 4Z06A 2NTBA 1VBLA 4Z05A 4XONA 4YEJA 1O8EA 2X3HA 4XMYA 2VJIA 1NHCA 2X6XA 2X85A 4W8QA 4XKVA 2INUA 4PMHA 3B4NA 4I84A 3VMVA 3KRGA 3GQ9A 1O8MA 2PYHA 4YZ0A 1IB4A 4XLEA 3ZSCA 3GRHA 1RMGA 3WWGA 1OFLA 2NSPA 4NK6A 1BHEA 4OJOA 4XLFA 1O88A 2QXZA 4YELA 4XN3A 4XLCA 1O8GA 3GQ8A 3SUCA 1DBGA 2UVFA 2VBKA 2ODLA 1XG2A 4OZYA 4XNFA 1IDJA 3FY3A 4OJLA 4XR6A 1OGMX 2O0WA 1RWRA 4XQFA 1PE9A 1WMRA 1O8JA 1OFMA 3B8YA 2VBEA 1JTAA 4W8RA 1JRGA 1EE6A 4XN0A 1O8HA 2PYGA 2PECA 3ZPPA 4U4BA 4YZXA 3EQNA 2X6YA 2IQ7A 2NT9A 4NK8A 4W8SA 3VSVA 2VJJA 2INVA 2BSPA 1KTWA 4OJ5A 3VSTA 1KCDA 4OZZA 2VBMA 1IA5A 1CZFA 4U49A 3VMWA 1K5CA 2EWEA 2QX3A 3GQ7A 3GQAA 2O17A 4XORA 4XM3A 1O8LA 1H80A 2NT6A 4Z03A 5C1CA 3LMWA 5C1EA 4EW9A 4XLHA 2O0VA 4MR0A 4YZAA 1O8IA 5AMVA 3T9GA 4W8TA 2QY1A 4AVZA 1BN8A 1OOCA 2Z8GA 3EQOA 3B90A 1PLUA 2NSTA 1IDKA 1HG8A 4URRA 4MXNA 2NZMA 2NTQA 2UVEA 2NTPA 4OJPA 1X0CA 2O04A 4HWVA 4YZQA 1RU4A 1O8DA 1OGOX 4C2LA 4XLAA 1AIRA 1O8FA 3JURA 2X6WA 4XL9A
chains in the Genus database with same CATH superfamily
1B1BA 1WH5A 2X9DA 1UD6A 3VSUA 2FOWA 5DTDA 4JP0A 1J59A 1I6HJ 2MG4A 4D5FA 4CYDA 1KQSB 1J0RA 3KE2A 3QFRA 4P3IA 4GXOA 3D5SC 2DEUA 4BHCA 5HS9A 2GJKA 1GDTA 3GZNB 3JU4A 4WZKA 4R8HA 1XDUA 2BY2A 1IRXA 1Y8RB 2PG4A 2HR3A 1YW7A 4N4NB 2P7VB 2ZCWA 4W1UA 1VI0A 2COBA 4PZJA 2Z2SB 1N08A 4MYTA 3KZZA 1YS6A 2CQNA 4R71A 3QFSA 2M7BA 1PJ5A 2F1LA 1BM9A 2XRNA 4D1QA 3U21A 3GQ9A 4M71A 1O8MA 3VSKA 1ZRCA 1DP3A 2CWEA 3JX8A 3DEWA 3J81k 1EXMA 1XE1A 1VQ8B 4L0ZB 1HSTA 3BZKA 4U0WA 1K4SA 1U5TC 1QPIA 2ZBUA 3KCCA 3AG4H 4HV5A 3ZR8X 4C3HJ 1R7JA 4QPOA 1JJ2B 4UB8C 2Z9OA 4RCZA 2HZTA 5E17F 3N6ZA 2P8TA 1XD7A 1UHWA 1F20A 1MH4A 5J47A 2LRDA 3PSIA 2O3FA 3AGPA 2LDUA 1V3FA 2RC5A 1IUYA 3ISXA 4LBWA 3F8MA 1FOXA 3SYJA 5LMZA 2R7VA 1H8EA 4IHWA 1WMRA 1HDDC 4WZLA 1S0UA 5FIUA 1ZAOA 4RDUA 2FNAA 2ZBVA 4RD2A 4IX7A 3KEOA 3KEYA 1JRGA 4U87A 1XB2A 3HPGA 3IUOA 4WF2A 3CC4I 2PJRA 1O8HA 5DV5A 2G7UA 3DEUA 2KLOA 3L7WA 5F0FA 2IS4A 1PVEA 1D1NA 1D8TA 3L09A 2W1OA 3IWZA 4G94A 5JHFA 3KIOA 4QUZA 1E3OC 1KCDA 3CC7B 3SLDA 5H6QA 1FNNA 3RKYA 4BEHA 2CG4A 3I0TA 1GR1A 3MMYB 2Y31A 4HF2A 2R7TA 1XMAA 1QFZA 4DJAA 3ASTA 3F3XA 4Z4YA 3GFJA 2VXDA 1JXSA 1RPWA 1Z7LA 1X4PA 4OIRF 3RPQA 1UMQA 1TQIA 2F4IA 5LBQA 2WAFA 2DDAA 3M07A 2CK3A 2L4AA 2GWRA 2P5KA 3AKZA 2RC6A 5A8AA 1BJZA 1MSFC 1VNDA 1I27A 3K1MA 3WBKA 2EFPA 4QTRA 1YW9A 1Z91A 1FJLA 3ERED 1S7OA 1UJ8A 1FMWA 1U5TA 2CW0F 1IHMA 3SJZA 3DFGA 4HLXA 1XCVA 3T0YA 2OQRA 1H88C 2BOLA 5HDGA 1JGGA 1JHHA 1CF7B 3DU1X 2KFDA 3HKZA 2KKOA 3F8BA 3BOQA 3T53B 4KKSA 1TW2A 1UB9A 2JRMA 3KP2A 2GZWA 4LG3A 2V26A 2M3AA 3J7YJ 2VONA 2XEXA 4OJPA 1VQ4B 4HWVA 4FETA 1VTNC 3AL0C 3PIOF 3CCEB 4B48A 4YXWA 2IXSA 1ZGAA 2AXTC 4B3GA 2HNHA 2EIJH 1SFKA 2OPTA 3A0BC 4D9JA 4BPRA 4A3DJ 5J3LA 4PAAA 4X6AJ 2DETA 4HPQA 2IAIA 2D45A 3G4SB 4OIOF 2V7XA 1B9MA 4N9IA 3CLOA 1TLLA 1DBOA 3FXLA 3O2PE 4MQ9F 1FYLA 5C1EA 2FQ3A 2HGCA 4Z06A 2I8DA 1PKVA 1VBLA 4Z05A 3FPKA 3KP6A 3OW7A 4XMYA 5H6RA 1BI2A 3W3CA 2PI0A 4BXUA 2L0KA 3MKYB 4RD3A 4LG0B 2R7FA 1FEXA 2KIMA 4QLCU 4R79A 4NNJA 1PP8F 1Y39A 5IT3A 2EINH 3WTYC 1ZM2A 1ZG5A 2PIAA 4LOCA 3VMVA 3KRGA 4G12A 3I59A 4BE2A 5D8KB 3JRGA 4C2MJ 5D4RA 1Y0RA 3OOPA 4X07A 4G8XA 1NG6A 4OOXA 1W5SA 2DK8A 1YO5C 2BVLA 2Q2EA 2XIGA 5IYNA 3CDLA 4XN3A 4XLCA 3GXOA 2L9NA 1TWFJ 4KT6A 2VQLA 5CVRA 4BE0A 3HTSB 1VQNI 1QGAA 1O8GA 3U6BA 2X4HA 4B4DA 2QLZA 2UVFA 3DV8A 2ID3A 3ZMDA 2QENA 2LK2A 3HGGA 4XNFA 3JAMZ 4E7ZA 3BPVA 1I50J 4LD5A 4Q47A 3I3LA 3E0JB 4P3YA 3SKBA 2E5ZA 3BROA 3WTTC 2DA7A 2V79A 2QSFX 3CCLI 2P6SA 5H5JA 3CCQB 2K9SA 1V5EA 2R7ZJ 2PYGA 2MD5A 5CLSA 3QFCA 3M9AA 1S4MA 1MD0A 3H09A 2B7EA 3GTLJ 4JBAA 2K9MA 5KCMA 4OINF 2KIFA 3OKXA 4OP7A 2FE3A 4ESFA 4RJLA 3D5RC 2F5EA 3FF5A 2BY3A 2R7RA 5EMNA 1R49A 1NB9A 3VMWA 2QX3A 2NRAC 4ZCLA 3SHFA 2OC6A 1LDDA 3HXLA 1VF7A 1OYYA 1T56A 1U2RA 3IH2A 1STZA 4Q48A 1G8XA 4UZUA 4M3BA 2NT6A 4HNUA 4I0BA 3RQ4A 5D6FA 3ES9A 5BSXA 3G6EB 1W0TA 2JN6A 2O0VA 4RM2A 3BTJA 4CGZA 4IHSA 4HEA2 5JR3A 1YIJI 5F4MA 3V8LA 1YITB 4AVZA 1VQKI 3KPHA 1S6LA 3WGGA 4GRIA 5HLHA 4ZDPA 2PJRB 5LGUA 4FHTA 1VQ5B 2Z3YA 4JX4A 2M30A 4I99C 3SZPA 2F4MB 4GYIA 1DUXC 2R9VA 4LC0A 2H1KA 2ZFWA 1U6GA 4RDKA 4MXNA 3QE2A 5TRDA 2EH3A 1X19A 2NTPA 4BS9A 2X1EA 1YHQB 2RNGA 4YZQA 1MKMA 3OPOA 1X1PA 2VQCA 1E2XA 2M8GX 4EATA 5BPDA 4UY8I 2VIXA 4ABZA 1DPUA 1ZM4A 3ZP5A 5LD2C 2XNDA 2X6WA 1HOMA 2B7CA 1FY7A 1O8FA 3N90A 5B5EC 2FU4A 2TCTA 5IPAA 2ZL5A 4XOPA 4Y52J 1ZR4A 2O1DA 4N3GA 2Y75A 3S3MA 1HW5A 4KMFA 2ZZGA 1O57A 3OYIA 4BDZA 3OEHA 2NTBA 1I6XA 1ERDA 3LSGA 3LL7A 3SJMA 4C2TA 2X3HA 1QHHD 1W35A 2XROA 3CMAB 5TV2A 1RUOA 4P2NA 2FF4A 4IRGA 4ZYEA 1WORA 2XAQA 1G7TA 4MHGA 5KVRA 4W8QA 2BW3A 1EP2B 2Y0SA 1D0XA 1OCCH 2ZMEA 3DTKA 1U9OA 5EF6A 4DZJA 5E79C 3AVUA 4EJUA 4GCVA 4XRFA 2O03A 3ZQGA 4TMTA 1IUFA 3HOYJ 3GRHA 1OB2A 1RMGA 3WWGA 1YITI 2V6EA 5FNZA 4XK4A 2DO7A 1FT9A 1X3UA 2HI3A 2ICWG 1IW7F 3HYIA 2HPIA 1O88A 1CQXA 5ICCA 5F08A 3GO5A 4RM3A 4WXHA 3A2KA 3D0SA 4F52A 1SD7A 3QPTA 1IDJA 2LVSA 2CGPA 3W2VA 3M8EA 1YHQI 4KDPA 3I9V2 2LTPA 1SAXA 3WTZA 1OHHA 2D1HA 2JN9A 3J80Z 3OIQA 2M8EA 3PNVA 2VBEA 1K4TA 4CZZA 4JOMA 3PIPF 4XN0A 2DQLA 3A0HC 3CPWB 9ANTA 3S2WA 4YIRX 3VNUA 3BY6A 1ETVA 4O5VA 2V1XA 4L18B 1K83J 3WGHA 2MC4A 2VJJA 2F4NA 4NC6A 4NQWB 5M5XJ 1YG2A 4YFXF 2VBMA 2KDZA 2F5FA 4LK0F 1IA5A 2DMUA 2R7QA 3GFLA 2BHZA 1CZFA 4U49A 3MZ8A 4QWQA 1XG1A 1K5CA 2KQRA 5FD5A 3CCRB 2HDWA 3VSLA 3B82A 3TH0A 1KK2A 3QPHA 4E7LA 3GTGJ 5F04A 3GUDA 2L3DA 2JJ1A 4XRMA 1YJ9B 4Q7JB 3NB2A 1BC7C 2J8IA 3OP1A 2OF7A 3IHUA 3CPXA 2ZO4A 3CUQA 1GXQA 2HTJA 3FDYA 1VQPB 3E6CC 4HOBA 2CU7A 2Z1DA 1TNTA 4MTEA 3S1RJ 2UZKA 3CMEB 2A6HF 5D6EA 4P96A 4I2OA 1C0WA 3DKXA 2JZYA 2W24A 3LQQA 3QU3A 4WCGA 4ESJA 2QZAA 2GOXB 3B90A 4XKCA 1T5EA 1PLUA 4AYBA 2VE8A 2WAQN 3OYKA 3BR3A 3PFYA 5IY5H 4MEXF 3BPXA 4XSXF 3HJEA 2HKOA 1QGPA 2W48A 1SVMA 4HF0A 2DT7B 1VF9A 4BQNA 5IP7J 3PM1A 2J5PA 1CNFA 4OOVA 3TBIA 4DBRA 5FLXZ 2MBFA 1TUIA 3LSTA 3R4KA 1OCPA 4S05A 2B0LA 3BJOA 5LHIA 2BM5A 1V55H 3V7RA 5FD6A 1OB0A 1YX2A 5HS8A 3HAGA 3BC8A 3DPUA 4D0PA 2XKOA 5B3SH 3H35A 1B23P 2Y0SN 4Y17A 4ZGNB 1JJ8C 2E7WA 2VBTA 4BJTA 1E1RA 2UXXA 3CCYA 4YEJA 2HS5A 4Y15A 2E1MB 1AHDP 2C77A 1XN7A 4ZV4A 1U0JA 2R5ZB 1GVHA 1VQMB 1LVKA 4NBSA 3GFIA 1JUMA 2DW4A 3EUHC 1SMTA 4B8XA 3JRCA 2ZTNA 4OPOA 3N05A 2KJCA 3A35A 3LA2A 3ZZ0A 2DPDA 3HSEA 2O5RA 4Y9UA 4DQLA 1V5VA 5A2QK 2KIQA 1W36C 4CYCA 3H36A 3I56I 1ON1A 2RN7A 2OA4A 3WTXC 3P7NA 3Q0WA 1M1EB 4UNOA 4AIKA 1BJKA 3I59B 5EJCA 4G7HF 1BPLA 3ABLH 5TR9A 1ZRFA 2QTLA 4ZZDA 5ILVA 3KP3A 4BXXJ 1IXCA 4PJNA 5E6TA 3OYNA 1Z7UA 2DT6A 2E1RA 2XZLA 3FKJA 3FY3A 5HKKA 3TOAA 3DP7A 4IQ4A 4UVCA 2KHMA 5IK2A 3HOVJ 3VOEA 1RWRA 4B09A 2ZITA 2Y9YA 3EUAA 3E1SA 2YWGA 3NARA 4BKXA 1QPMA 4J00A 2B63J 1Q7YD 4U0VA 1R5GA 3FX3A 1J7KA 4MGRA 3IRRA 1MDMB 2D3LA 1YRNA 3HDDA 1BLIA 3OAAA 3MZYA 4AUXA 4G5GA 3OZUA 4U4BA 3GEZA 3SZTA 2QKMB 3EUHA 5DDGA 3M8FA 4NK8A 3WNBA 3CC2B 2BSAA 1X2NA 2WA0A 2ECCA 1GAQA 5J3OA 1REPC 4RAZA 1TYXA 2ZTGA 5B66C 2X48A 1CNEA 1SVLA 3GQ7A 4AWXB 2CFXA 3TO6A 2NXNB 2DA1A 4HIZA 4S0HB 4CYCB 2CW7A 3CO7C 4UAJA 3OZVA 2PEXA 1PYVA 2L54A 2XGXA 1XB4A 5F0HA 1LM1A 3SFZA 2Q6LA 4EJOA 3A01A 2BW3B 1E3HA 4B4CA 4W8TA 2LYCA 2V1NA 2ISYA 2YX7A 4PK4A 1FBQA 2KZVA 3G71I 3HRTA 5KW9A 1ACIA 5M5WJ 2BV3A 2PMHA 1EH8A 3GLLA 1WP6A 4ENNA 1YIJB 5F27A 3L2QA 3M7GA 3HB9A 5CYVA 2GXBA 3V42A 1ZLJA 5FKNA 4ZDLA 4IF4A 2DA6A 1S9HA 2DFEA 2MGQA 2XAGA 2FBIA 2VL8A 2XV4S 1GXPA 1V0EA 1WSRA 3AK5A 5A89A 1RQPA 1O8DA 2JJ2A 2ZNZA 4YDTA 4QSHA 4JX6A 5DNSA 1UAAA 1BN5A 1XCBA 2X6OA 1UG0A 3WTVC 3BWGA 3V4GA 4OMYA 3F23A 5HDKA 3H3ZA 4P26A 1KU3A 1O4XA 2LG4A 4CO8A 3GF2A 2W00A 1DP7P 4HG2A 2J7KA 4HBLA 2DXIA 4UUVA 3G1LA 3HEFA 4PC1A 3JRAA 5AONA 4A3LJ 2W7NA 1FX7A 1N05A 4RLFA 1OLTA 4HLYA 2BE5F 1UHSA 2KRHA 3MVPA 5CQGA 2EIXA 3ZGKA 2K40A 1B8IB 4KN4X 3OFNA 2IA2A 4XKVA 4C43A 3OYAA 3ASRA 4JRAC 1IN8A 4QVAA 5ICFA 4A3MJ 2GJPA 2EV5A 2I5UA 5FRNA 4IPAA 3T56B 4U7BA 2QKLB 4YIIA 5LGNA 1DU6A 4E7IA 2J8KA 3TOBA 1FIAA 3K4CA 1LFUP 3H9NA 1I39A 1WGXA 5FLVA 2HTSA 4TMXA 3CMMA 1UFMA 2F6CA 3TEDA 2NVXJ 1TT5B 1PUFB 4UZEA 1TLHB 1J09A 1D5YA 2VBKA 1J9ZA 1G7SA 4OZYA 3TMOA 2IA0A 3E5UA 3MEXA 4OIPF 4LLGF 1Y6IA 1F4KA 3PA2A 1TYVA 5KAIC 1QZZA 4BGDA 1N0UA 2XAFA 2M5WA 2KT0A 2Z99A 3T51B 1TZLA 2DOFA 1ZGWA 1E3ZA 2QSHX 2EWNA 5TISC 1HSJA 2XAJA 2QQ8A 1HLVA 1QVUA 2VNHA 3OEEA 2FBKA 2INVA 3GBGA 1KRHA 4TMZA 2F48A 4M2LA 2GXAA 3CCVB 2JT1A 4HQEA 3H5RA 4YCQA 1ETKA 3GW2A 2YWEA 2IGMA 3C2HA 2DFIA 5E18F 5GTIC 2D2WA 2X8KA 3CMAI 3EYIA 2AHQA 4P1WA 3TGNA 1K78B 1FIPA 1KU2A 1SC7A 5KAFC 4AC9A 2VOPA 3OY9A 3QP5A 4BY1J 3BC9A 2E2IJ 2Y2ZA 1VQLI 1SFXA 1OFEA 2VQHA 5L3BA 1D1CA 1FNCA 1WVRA 1BBYA 3QPSA 3HOSA 1VZ0A 2WPDA 5E3MA 1UCRA 1PP7U 3RKQA 2LY9A 1QRCA 1S7EA 1LDKB 2DOAA 3WXMA 3FMQA 4KNYA 2FX3A 3A02A 2NS8A 4JX5A 2GK7A 3K0LA 3SFIA 2V7VA 3CP8A 3Q0VA 1P4WA 1N77A 1A31A 2HLDA 3C18A 3CMYA 3HGYA 3QPLA 3BR2A 3AVWA 2QGUA 1T6ZA 3TP0A 3FBNB 2D1VA 4UV8A 2BXYA 1X1CA 2ME6A 2G0YA 2XRLA 1IC8A 2RAEA 2CYYA 3T5XA 3LQ6A 3SEZA 1IJWC 1R5NA 4FX4A 4ASUA 3QOPA 1R5OA 2HQRA 1LFBA 2DT5A 5E3LA 2O6GE 3VMFA 5M5YJ 1UD2A 2CF4A 3F21A 2XC7A 4P9SA 2PMUA 2K27A 3IH4A 3GIRA 4Z1MA 3ERMA 1N75A 2IS1A 5IT9K 4P55A 4ZYAA 1KQ9A 1MBEA 2H09A 5LEKA 1V5FA 4ROXA 1TWGJ 2Y30A 1GO2A 1HXDA 3OMYA 1FWZA 5BPIA 2FRHA 4LITA 5AN9A 5IYQA 3BTLA 3EETA 3B6AA 4HW0A 5KNLA 4X0GA 2KPMA 3BY2A 3MMPA 1Z6RA 5HXBA 3A8IA 1RNLA 3ZBTA 1JJ6C 4NHJA 4M3FA 3LSPA 1EFTA 1WSUA 2YWFA 2E36A 4EJVA 3GCMA 3HKZN 4B3XA 1ZHFA 3ZSCA 2GJRA 2XT2A 3MHPA 4FN5A 2NSPA 4NK6A 1KD1D 1BHEA 2CQQA 1K28D 1IRGA 1WJ5A 2F5DA 2OCEA 2Y69H 4DW6A 2W25A 3CCMI 4KA4A 4A3GJ 4AIHA 2K3FA 1HF0A 3E97A 1JTXA 3H5NA 3LSRA 3EYYA 2EFGA 2JMWA 1F9NA 3S3NA 2H27A 1NDHA 1OGJA 2NV4A 1VQ7B 3JQQA 2RVCA 3K9TA 4EMSA 4A3EJ 4B3AA 5GAGJ 2Q6KA 2VKVA 3KLOA 4UXNA 2K9QA 4ON0A 4OMZA 2HVRA 1N25A 5JI6A 1Q81D 2O6WA 1SM4A 2UUZA 1Y1WJ 1VQKB 4CH7A 3L2RA 2WY8Q 3A8KA 5GV8A 3QQAA 4Y7NJ 1T6SA 2M2EA 2WC2A 3ZCOA 2IQ7A 3HBLA 4FASD 1QFYA 2VKEA 4J19A 1GJRA 3FXKA 4LIUA 5A2QZ 2X53S 3ONUA 4Z4UA 3S16J 1WI3A 1E17A 2A5YB 2OZ6A 3DLLF 2CV0A 1P9QC 2CUZA 3GTMJ 1ETXA 3PO3J 3HSFA 1FOYA 1NTCA 2JPBA 3HOXJ 1H89C 1VQ4I 2OTJI 4XORA 5IYPA 2O17A 4M3GA 2EA2A 1VQMI 2IT0A 1A8PA 1X3ZB 4EH1A 2V7TA 4TT3A 2MC3A 1JKRC 4DBQA 4YHBA 5M3MJ 2CS3A 3CLQA 2QN6A 2V9KA 5C3EJ 1EH7A 4YAFA 2OTLI 4CDGA 3HZJA 1U8BA 3BDDA 2W57A 3ZUGA 2K02A 2I10A 3J81K 3WE3A 4TKOB 3G05A 4CZCA 4PC2A 1JTYA 1MJBA 4GGGA 3KYLA 4QVJA 1NJID 2XTWA 2LBFB 1UD3A 3ASQA 3SZEA 3F72A 5FKKA 4KN7X 3WBJA 2DERA 1T2KA 1K4ZA 1X0CA 3JRIA 1JHFA 2DPUA 1XPXA 1RESA 3C3WA 3D5LA 1RU4A 1ZR2A 2O9LA 2MYSA 4LB6B 1LJ9A 2WZPP 2WY7Q 2P81A 3NEUA 1SANA 2GXGA 2LF8A 2XPVA 3JURA 2ZSHB 3F8FA 3CO6C 2L4MA 1CQTA 2XZOA 2WB1N 4RDLA 3DWLE 4OOSA 1J9IA 1O3TA 2LD5A 4C3IJ 3E7LA 4FE4A 1PUEE 3P4GA 1SMYF 1KMHA 3A3BA 2HEOA 2QSGX 4KIBA 3PUNA 3DPLC 1QA3A 2K4JA 2XB0X 1O8EA 1WSVA 1VQ9B 1NRKA 2H1LA 1LEAA 1RUNA 4XLPF 4KH3A 3R6KA 3A8JA 1MRZA 3LAPA 1OCRH 1N78A 1K8AD 5FO0A 2DODA 5FKMA 1I1GA 3ABMH 3MQ0A 4P9UA 2DN0A 4WK8F 2YS9A 3MKLA 1Z1DA 2QCOA 1U78A 1H9TA 2D5VA 4I84A 1YJWB 5B6IA 3PFIA 4BH9A 3SDBA 1S72B 4AC0A 1IXSB 1IRZA 1BI1A 3I58A 3FPPA 2L5QA 3CCRI 1FP1D 4XLFA 2HQNA 5E8GA 1Y0NA 3VR6A 2HOAA 2NNYA 3HIFA 2DY1A 1CLWA 3RPUA 1DG1G 4LIVA 3Q6RA 2FSWA 4GDFA 1VQOB 1JGSA 4PDKA 3TW7A 1KGSA 4IHTA 5FO1A 3LJYA 1KQ0A 3LQRA 2NS0A 2OD5A 2QVOA 2E2HJ 3ASPA 2NVTJ 1K73D 1KA8A 3E5QA 2EZIA 5DCMA 2WSSA 1ZARA 5EEGA 3G1MA 5K7HA 2VKHA 1G3TA 4RD4A 2EFWA 3OL4A 4HDUA 3QYFA 2BX6A 2PFBA 2BM7A 2FJ1A 4RD1A 4ZTJA 3T8RA 3H92A 1QX4A 2LKSA 3M1EA 4HSRA 4BXFA 5EDNA 1E64A 3E1YE 3FWEA 4HX7A 1H9GA 3S3OA 2QEXB 2K9NA 2VJ4A 3ZIAA 2EWEA 3UR3C 3ZMZA 4OAZA 4ITVA 2IEKA 2EZHA 4X7DA 1F36A 3ONQA 2XTYA 3PO2J 2X1CA 1BL0A 1O8LA 3AGQA 4II2A 2F3LA 2LC2A 4TV7A 2ZB9A 2FQ4A 3JSOA 3K70D 3CTAA 2BGCA 5IYBJ 1VJSA 4MR0A 1W7PD 1I18A 2NVUB 2MSYA 3PUBA 2KVOA 3M3YJ 2QY1A 5BMZA 3BG3A 3QU6A 5FGMA 1I8DA 3W5HA 1VQOI 2HWVA 1D0YA 1EA3A 2FUG2 4XRSG 1KYWA 2LY1A 4ZYGA 2C4TA 3FXUA 3ECHA 1TQPA 3ML6A 1JA0A 1HDPA 2JSCA 3PUFA 1FMVA 2VODA 3DDYA 3DTIA 3I56B 2QUFA 3C2BA 3SJPA 3ZQHA 3CJNA 1HKTA 2QQAA 4PSWA 2EV6A 2VC1A 1WPKA 4FXUA 1EH6A 3MAJA 3DBRB 4XL9A 1T8IA 1QJVA 1GQ8A 1YE9A 2Z5UA 3H9QA 1BOBA 3FJOA 4V19K 2K9LA 4DZPA 1ON2A 4EGYA 1V0FA 4IW3B 1FSHA 4Y13A 4X06A 3U1KA 3BY1A 5KSWB 3W6VA 4X8IA 1XQBA 2OU2A 3V8JA 1W0UA 4B1RA 1K6OA 1XGNA 2YX4A 2Q6IA 1NHCA 1T33A 3OS0A 1QG0A 1HW2A 3KYCB 5J4YA 4OM9A 1W1WE 1QU3A 1HA8A 2V31A 3GSIA 1TSPA 3OIPA 1MJAA 3W2WA 1MMNA 2DTRA 3I5UA 2A68F 3JTGA 5IP6A 2ACJA 1G6NA 2VUMJ 1HF2A 3W2HA 2EJRA 3RIRA 3J81Z 3S2HJ 5E8IA 1HA3A 4I6ZA 2PMDA 3GQBA 1OQYA 2ECBA 2QZ8A 4MEYF 3L00A 5CPRB 4A0XA 4OJOA 2FD5A 3OYDA 4MLOA 1XX5A 3PSZA 1LE8A 2H94A 3KX2A 5FO5A 4IHXA 3I55I 1VQ6B 2CFOA 2LF7A 1DBGA 2QMUA 4ZYHA 2XGEA 3WE2A 3MFKA 5EYRA 1P2FA 2VBYA 4AD9A 3J7AY 5HLGA 1FYMA 1OGMX 2BM4A 2VQGA 4IL6C 4Y4RA 3PSFA 3V8KA 2WJYA 4EM2A 3ML3A 2BXZA 1ZREA 4F93B 1JTAA 2ESNA 3D1NI 4FE7A 1EE6A 5D8LB 1G3WA 3G71B 2LZJA 2V7FA 3F0CA 5DN6A 4G6TB 4JQFA 4BUPA 3CXCB 4Z4WA 1JB9A 4WX9A 2R6HA 3Q3SA 1MMGA 3CZ6A 3VSTA 5GPCA 4A3BJ 1H85A 3ZZTA 4DK1A 1OCOH 1K9MD 1W87A 2B7BA 3ZPNA 2M7AA 2DMTA 2L01A 5FKOA 2PQ8A 1R36A 4LBYA 2BM0A 1KC8D 2HDCA 3BH4A 1K6YA 3LSKA 1FPQA 2P0WA 3E6DA 2X0LA 1KU7A 3EPZA 5CDFA 1WPCA 2CO5A 4PFPA 2MA3A 1XMXA 4G6IA 1WFXA 2V6CA 2L7MP 2CSOA 4AU7A 2L7FP 3ABKH 1H8HA 1WU8A 1A6QA 2G7HA 3FXOA 1T98A 3RSNA 5LRSA 2F4OB 1G59A 2VYQA 1P6RA 2OBTA 4B47A 4E7SA 2R7OA 3CP2A 3WG9A 5L3CA 2JVGA 2HOEA 2ELHA 1JE8A 1B9NA 3FIWA 2FMYA 2PMZA 3O6BB 4HA8A 5GAEJ 3BJAA 3IV5A 3U1DA 1S8NA 5AIPA 1WJDA 3CCMB 2ZMEC 5DD8A 5FLMJ 2Z6BD 2VOOA 4URRA 1HG8A 1YLFA 4UUSA 4IOCF 2HKXA 3O8HA 3S8PA 1AKHA 2G9WA 2OBPA 5FRMA 2NZMA 4KIGA 1R5ID 2DYSH 5AIQA 2DA3A 4AF6A 4BQQA 1ZH5A 3OYJA 2QE7A 3MCAA 2PJPA 1BJAA 5LGTA 3AFHA 1WOPA 4GO1A 3W2FA 1QFJA 2Z16A 3SLNA 4XLAA 2A6TA 1EFCA 4LFUA 3RIQA 2HMAA 3VYSB 3OE7A 2IA1A 1LE8B 3TDZC 3TL4X 2W6IA 2XPUA 3O8GA 1PDNC 3WTSC 1IXRC 5E20A 4RM0A 2ZXHA 2IGOA 1IDZA 4C9YA 1A5JA 1QCXA 1K7AA 3B02A 1X4OA 3JR9A 1D3YA 1R4MB 2VT3A 3CCLB 1W7PA 2E1CA 2YWHA 2HYGD 4E6KG 5DS0A 3H94A 1R23A 3HRSA 1QQ1A 2IRFG 4I76A 2DYIA 2DCUA 2YU9J 3UKGA 4P22A 4X0CA 3QSYA 3B73A 3NE5B 3C7JA 4U9UA 1FZPB 1R4NB 3BCBA 1GHCA 3I1FA 2VNJA 3QFTA 3GYHX 1YJNI 2PYHA 1TP4A 1FRNA 3BH7B 1EP3B 1OFLA 1Y0YA 3VYUB 4L0YB 1GLNA 1YJWI 5K5QA 5K1YA 4DK0A 5LFAA 3JREA 4KT5C 2ZJPF 3H0DA 3E5XA 4MQVA 4BU2A 2N8GA 3R60A 2K7LA 1W34A 2WAQA 4RD6A 3RZOJ 3U2QA 2TRTA 2M5SA 1DARA 3AVXA 2NVQJ 1TQMA 1BX1A 1U8RA 3BQZA 1XGMA 3V76A 2O0WA 1PE9A 3U2RA 1O8JA 2K3PA 1CF7A 3RYRA 1SKYB 1IZ1A 4P25A 4M3DA 3LWFA 2A5WA 2MFZA 5EZGA 5LRRA 1O3QA 5ILUA 3DEEA 3CF5F 2VFPA 2UWMA 1TVCA 1K79A 2PECA 1RR8C 1T38A 1NG7A 2M4GA 4EM0B 1JUSA 1OISA 3FBIB 4EJWA 2X6YA 4F55A 5ILSA 1BQEA 1DDIA 1EKEA 4W8SA 4QIWN 3BLYA 2MLGA 2V9VA 3VSVA 5J40A 5B1AH 1FNDA 3BCFA 4OZZA 1FRQA 2R7DA 1BC8C 4IHYA 2CC2A 1IV8A 1YX5A 4V2GA 2L02A 1ZRDA 2XGCA 1UG2A 5FFZA 4PCQA 5E1XA 5JLWA 2LLKA 3A3GA 4PFOA 4J0QA 1MW7A 3W2IA 1D0ZA 1EF4A 2DLLA 4PJ0C 2EV0A 4UVBA 4KITB 2QQ9A 2YSRA 1YS7A 3LSIA 4X1EA 2I1LA 2E1MC 1H80A 3HRUA 1YTYA 5C1CA 4HNVA 1YJNB 3ISPA 3HC7A 5E1ZB 4RGSA 3S14J 2FVGA 5J1RA 3VEPA 2GPJA 2JUGA 3T9GA 1JNYA 1SVOA 4A2UA 1XSDA 2JPCA 3ZMSA 2B0RA 1LVAA 5CVJA 4IZZA 4C2UA 1Y8QB 3OW2B 2D74A 2WJVA 5BS6A 1AWCA 5M3FJ 1R71A 3HRMA 1GUUA 1X1DA 3VO1A 3BR6A 1N07A 1DDGA 4RAFA 1R00A 3R0AA 1V5GA 4XIDA 3AG3H 4M0LA 2OBSA 2LP0A 1MZBA 2WADA 2GBYA 3J7AO 2DFHA 1Y56A 2ZJRF 1G2HA 3JQRA 2O8XA 4V02C 4HYEA 2JUCA 2WBMA 5GPAA 2VFNA 4OU0A 2R5YA 2RKHA 5FROA 2OBRA 2F1MA 5HVQC 2JTVA 2EZKA 4XKWA 1I1SA 2EQRA 3H3VK 1JUPA 3K70C 1LLWA 4WXCA 2R7WA 5KK1A 1OKRA 5LHGA 3R6JA 2DU9A 3CCUB 4A0ZA 2EFOA 1JKOC 4BHPA 1G7CA 4EQQA 3LNNA 1H0MA 1I3AA 2X6XA 1WKMA 1WCMJ 4BBRJ 4BBSJ 5EG0B 2Q6OA 1AA7A 1E0EA 3RYPA 1J2XA 5J1UA 2FBHA 5CQEA 1A36A 1UD8A 5JMCB 1M90D 4MIMA 4ZH4F 1YI2B 1Q1HA 2Q8KA 4ASNA 3MCZA 4CCJA 4M53A 3K6GA 3OYCA 2STWA 2H6CA 1GVJA 2ZXIA 4G7XA 1TNSA 1IB4A 2ZSIB 2IP2A 4P9FA 3BG5A 1GVDA 4G6DA 2DMQA 3S1MJ 3BH6B 3CESA 3J7ZI 4M6VA 3LYCA 2Y9ZA 3SUCA 5JLVC 4IKFA 2OZUA 2W84A 1XS9A 1ZN2A 4B3FX 1OFDA 3FXMA 5IYCJ 2IS2A 3SXYA 3V7SA 3RKWA 3VFZA 1KQ8A 4M4SA 2NS7A 4XQFA 1P7IA 4RCYA 2DFFA 4KJZA 1VQ6I 2GA1A 1KTVA 5DUKA 2WTEA 2A6EF 4W8RA 1Q1VA 3R0JA 2XGDA 3ZPLA 1Z9CA 1A35A 2CW5A 3CRZA 2RDPA 4Z2YA 4EEFG 3ZQLA 3CQZJ 2L9SA 4YAUA 4LMYA 2ZZQA 5EGOA 4RD0A 1QZYA 3CF2A 3NQOA 2JWTA 2V7QA 2XHKA 1JKQC 2P4WA 5HLIA 2ME0A 2XUBA 2O0YA 3X2QH 3K4BA 4NC8A 3K4NA 2DTZA 1U3EM 1FC3A 3BCDA 2DA2A 2L7ZA 4I02A 4KKTA 1QUFA 4G9YA 4BACA 2V4DA 3SEQA 3OIOA 4XLHA 1ZK8A 3CCJB 1S7AA 5F0CA 3W2EA 1SKQA 1V4RA 3BR5A 2BM1A 3CCQI 5FL7A 3V7CA 2P7CB 3IAS2 4X05A 3RI4A 3VNVA 4DYQA 1EZGA 1QRBA 2JRTA 1R1VA 4DQKA 1LB2A 3ZC3A 3EQOA 2P5VA 3DKYA 4BYYA 3BR0A 2LSOA 1WJCA 4XBFA 2PBIA 3J80K 2GK6A 2JA2A 4EV0A 2NVYJ 3H0GJ 1T6XA 1WZ2A 1S72I 1WH7A 2BGJA 2J5OA 2R0QC 3KP7A 1OYWA 1ETYA 4ANJA 5JVTA 1OR7C 2CH0A 4RGUA 2CRGA 1RRJA 3GMEA 4BHBA 4C2LA 4KKUA 1IO2A 2VBSA 4IQJA 3AVVA 1B72A 3MD2A 4PGHA 1PXZA 4ENMA 3W5VA 1LFPA 1QH0A 2DBBA 1WJAA 5JFRA 4PGGA 3UW0A 1G7RA 1Z77A 2IBDA 2ID6A 4A93J 1WWXA 4H4KC 2BM6A 3ZBUA 2RQQA 4HAMA 3GLXA 4CCMA 2KP6A 2PLFA 1IG7A 3DQVC 3A01B 4OIQF 3FK7A 1HC8A 2INUA 5JBQA 1EV7A 2HYFA 4QHYA 3ECOA 4ENKA 3DLAA 5IYDJ 2AQEA 3M8JA 3L1PA 4L9VA 4WWVA 1FBSA 1I5ZA 1MBKA 1YOVB 4K2EA 4XLEA 3AG2H 3EUKL 1WRJA 3VYTB 5E3NA 5THXA 2ELJA 1X1BA 3I71A 4I09A 2VBZA 2GA2A 3FK6A 1X58A 3OYHA 4L9NA 3WQZA 1DGRM 1UZCA 1SD4A 4FISA 4KUMA 1QO0D 2E71A 2WAEA 3OS1A 4F7DA 3LOCA 4NB5A 4OAYA 2L7KA 4X7CA 3C2GA 3ZQFA 2AQFA 5TJJA 4A3CJ 2PN6A 3CW2A 2VXZA 3Q9SA 4Z4TA 3I53A 3I4MJ 4XR6A 1Z21A 5F1JA 1W5TA 2EK5A 3WNDA 3GZ5A 3ZQ7A 1DU0A 1ITYA 2CRVA 5A88A 3F8NA 2E1OA 3B8YA 1SFOJ 1T0FA 5D5UB 5CVVA 2LKXA 1XGSA 4D7MA 1IN6A 4CCKA 3KETA 1G4DA 1ZQ3P 1WJBA 1FSEA 2VPRA 1MBGA 4M9SA 4EGZA 1FNMA 1GAWA 2RC4A 1Y0UA 2M87A 3U9GA 1S3JA 1ZGJA 3PUMA 3PVDA 4YZXA 1Z3YA 2DMNA 4FX0A 4PJLA 3WU2C 5J6XA 2NT9A 3FM5A 1B72B 5J8CA 2HVQA 2XDVA 2VNKA 5TY0A 3IC7A 3WGIA 1HZEA 3VDXA 3GTOJ 4ZDOA 3Q38A 1OJLA 5JLXA 2NYXA 1MNEA 2XASA 4A5NA 3A03A 4MO7A 1AIPA 4DNTB 1SAUA 2E5NA 1X3WB 5ICGA 4IEJA 1ZTRA 5DM6F 3CCSB 1NK3P 2VPLA 4L5EA 1OCZH 1PJRA 3P5JA 5L3DA 4E70A 1ZKGA 3LMWA 1QZEA 3CJRB 1U9NA 4NBQA 2OYNA 2ZMEB 1UD4A 2VNIA 3M4OJ 1W2BB 2OTJB 1MMAA 3IKVA 1FP2A 4EM1A 1EA0A 4O6JA 4K1XA 1BR2A 2E35A 4YZAA 1EFRA 3TO7A 1TYWA 4V2FA 4J01A 4XSZF 5D5XB 3W2AA 1E63A 2M0CA 4MFEA 3NRVA 4XLNF 1XC5A 2AS5F 1RC9A 1Z67A 2KRCA 2DA5A 2VB6A 4HSTA 4RGRA 3R6SA 3AL0B 1VHEA 1XGOA 3OJXA 1K8FA 1IB0A 2KIUA 4M73A 5J35A 1OR7A 3A1YA 1W36D 3OOCA 1MBFA 3BT9A 2VKDA 5DD4A 3ZQIA 1AOYA 4ACBA 3JRBA 3QP6A 2JA7J 3K1PA 5FB2A 1FOKA 3ELKA 4YC5A 2V1UA 1KK3A 1ZLKA 2HVSA 2JQ7A 2V7UA 2STTA 4L5JA 2QA4B 4OJ6A 2WV1A 3ASOH 3CUOA 4TN1A 3NAUA 4XICA 1AKHB 2WR8A 2LBFA 3CJQB 2CUEA 3G6EI 2ISZA 3FMRA 3GWZA 3WHBA 1IDYA 1ZG3A 4KFCA 4HX4A 1N0VC 2RV8A 1W4MA 4TSFA 3FXQA 4O3MA 3N97A 4PJMA 1W0KA 4PJJA 4RB0A 3BQJA 2Z33A 1E43A 1BOAA 5LEJA 2ZJ2A 3CB4A 3SEJA 1YX3A 2WWYA 3QOEA 1Q86D 3SQNA 4NDLA 5C4XJ 1TWHJ 3K4KA 3LQEA 1IRFA 4PMHA 1E62A 4BY7J 1VQ9I 1ETQA 2ZBKA 1OB5A 4DIQA 2IOUG 3LSHA 4C0SA 2V5IA 1DDNA 1LNWA 3W2GA 1U5TB 3FHNA 3Q0UA 3T8TA 1RIOH 3AG1H 2XSJC 2XAHA 1OGIA 2DCEA 3ESWB 5HODA 3OL3A 2ZJQF 5L46A 1Z05A 4IOAF 4FQGA 3OYGA 3A1PA 2IJLA 3Q5FA 4G7WA 4KYWA 5HS7A 5IYWA 1M1KD 3GQ8A 2QTZA 3RDIA 5F1RA 3PENA 5CJ9A 2BV6A 2ODLA 1TT0A 1XG2A 2A69F 2CNDA 1P4AA 4OJLA 4NC7A 1F60A 1YJ9I 4S04A 1Q82D 2IW5A 1N8RD 1QRYA 2LMDA 5LHHA 1WHUA 1OFMA 2FA5A 2FOKA 4DOZA 4UHTA 5L3GA 2P5LC 4BEHB 2XGJA 1HW1A 1E3PA 2QA4I 3MN2A 2O7OA 2W85A 3H9GA 4YFKF 5D4SA 3HOZJ 5EEHA 4CCLA 1IAWA 1V54H 1HVXA 5D5WB 3KEWA 3TW6A 5GP9A 1L0OC 3LFKA 3U6KA 2DK5A 5BNGA 3OOUA 3WODF 4DYRA 4F91B 1D1AA 4UZFA 5F4OA 1USTA 2F5VA 1W9XA 2K5CA 2PX9A 3B78A 1R22A 1ULYA 2WV0A 1O3RA 1HKSA 2DOEA 1ZM9A 2A61A 4ZTFA 3DCFA 1QVTA 3WTUC 2W4SA 4F3QA 3FXRA 4UVAA 1IF1A 5DEQA 4Z03A 3RCOA 5LLQA 4M6XA 2BGIA 5IYRA 2QYUA 2XC1A 1QUEA 4GYGA 3S93A 1WI9A 3QYBA 1Z0XA 2GM4A 1P92A 2RGVA 1WXRA 3F22A 3LA7A 3L2WA 2C4UA 2R92J 4IJAA 2F5CA 2HQAA 3HOWJ 2HYJA 1B8IA 3BZCA 4HX8A 3QRFF 1OPCA 4DGWB 3VWBA 4YAWA 1LDJA 1OOCA 2Z8GA 2UXNA 4FK8A 3TQNA 1VLOA 1QBJA 3CC7I 1MDMA 1W0JA 2OQGA 2B5OA 2V1DA 1EFUA 2NSTA 4GFBA 2QGGA 1IDKA 4DYCA 2YR2A 1BIBA 3GVLA 4UV9A 2EILH 2C5HA 3OSFA 4YEIA 1ZM3A 4IRIA 1T6YA 1LLZA 1BA5A 4BDYA 2E19A 2FXAA 2MD0A 2DQRA 4CUGA 4PC6A 3QYEA 2CQXA 1D8KA 5H59A 2M4KA 1RZ4A 3CD6B 4BAYA 1MGTA 5DS9A 1QVGB 2JIZA 4P6YA 2K86A 2DOGA 1WTHD 1ZELA 1VQPI 3PQJA 3KL9A 1FTTA 2E1NA 1WJFA 2Y0MA 2VJIA 1UD5A 4BJ5C 4AVPA 4YFOA 3H1CA 3PETA 2X0KA 1ZYRF 2FX0A 4P5OA 3B8HA 4I7HA 1XSXA 3P26A 4KIFA 1VLYA 1MJ9A 2OJED 3WHCA 2KJBA 1T0FC 3WY9A 4CCNA 4YZ0A 4NUBA 4L9JA 4CSWA 3AVYA 2XF5A 2R5ZA 1R5HA 4OPVA 1SFEA 2HDDA 4F7ZA 1D2EA 3KEQA 4M9ZA 4YG2F 2QBYB 3CCVI 3G4SI 1IJEA 2XSDC 3I4NJ 1ELOA 4L8JA 3ASNH 4QV2A 3TDUC 2KRFA 3HTUA 4OOIA 1W5CC 2A05A 4A12A 1TW3A 1XMKA 3M1CA 1FX0A 1BIAA 4H0EA 4ZCMA 1EWYA 2LNBA 1FBUA 2X3UA 1R9TJ 3OJWA 4P1VA 3K10A 2FEZA 3WG7H 2JSPA 3K4JA 4RPDA 3F8CA 5ICEA 3AAFA 2MH9A 4E7KA 1WOSA 5H2FC 3WYAA 1VFCA 1BI3A 1AU7A 1LQ1A 2PE3A 2W6JA 3ZPPA 4CHUA 2BYVE 1IN5A 2X51A 2PLYA 2ELKA 4N3NA 4MYUA 4ACAA 3LNQA 2P6TA 4RA2A 2O61A 3HOTA 4PUSA 2NNNA 4RB1A 4G7OF 4M3EA 3HHGA 1JT6A 2VN2A 2BHYA 4ZJZA 2EFQA 2LR8A 2Q2EB 2HCJB 3Q39A 4GQNA 2EBIA 3GTJJ 2NPFA 3L2UA 1SFUA 1E1QA 3GQAA 1P4XA 1A04A 4MNUA 2KISA 4G1BA 3OWTA 3JSPA 1KONA 4XM3A 2LOOA 3FKSA 4LGWA 3IL2A 2E1BA 4EW9A 5JHUA 4C30A 4OWRB 1XSVA 2QBYA 5GV7A 3MWMA 2HOTA 5EG0A 2JA5J 2ZZFA 1R6RA 5IT9Z 1XDSA 2C6YA 4EVIA 2C5BA 1MMSA 4LG0A 3RJPA 4HDVA 1O8IA 5AMVA 2XNJA 4EJTA 2YUHA 1MIJA 2CQKA 4MTDA 1FTZA 3OYMA 3P27A 2LY2A 4L9TA 4A6DA 4TMVA 3V7AA 3CC4B 1NHAA 3B6CA 2LREA 4CICA 1T95A 3JCUC 2C2WA 3P9KA 3E6MA 1Q9SA 2QDXA 1J5YA 4RS8A 4LLNA 3K7AJ 4B43A 2OK7A 2ZXWH 4PGOA 3ZN0A 3CC2I 1E79A 4BL0B 1RR7A 2KZGA 2RQPA 2X1DA 3CDIA 4L5IA 2A3SA 1DABA 1D1BA 1OGOX 1QNTA 3ZZUA 2CUFA 3MKZA 2DJIA 2EFNA 2XAUA 5IOYA 4Z4VA 1MSEC 3S1NJ 2IGNA 5FJ8J 3C1DA 1L3LA 1D5VA 3I54A 5BSYA 1QA2A 1MABA 1B4AA 1OCTC 3GX4X 1OYIA 1PJ6A 3S15J 1X2MA 3BZ6A 4A3FJ 1VQLB 2O8KA 4WQMA 1O8KA 2ZL6A 1VQ7I 1U2WA 2Q1ZB 1VQ5I 2HXIA 2VBXA 4X7FA 2JK3A 3K4MA 2QM3A 4AIDA 5L3FA 3N4MA 3PNTA 1FDRA 2R4GA 3DF8A 2JA8J 4FWTA 3K1NA 3F6OA 4XRSA 4HZFA 1TL8A 2YU3A 1K61A 3OYBA 3KFWX 2CJJA 4W97A 1NBMA 4TMWA 4YAOA 2CMPA 4Z4RA 2RREA 1SD6A 1UMKA 4PC3A 5L3EA 4RPBA 2E2JJ 4I01A 3SZGA 1GV2A 3E6BA 1QGYA 5GTHC 2RNJA 4FCYA 3SY2A 2M0MA 2IGKA 2AO9A 5K5RA 4A3JJ 4NCNA 2DMPA 3OZWA 2V4JC 2R7SA 4YELA 3FM3A 4D7NA 2VLAA 4QFMA 1BW6A 4M6YA 5DUIA 1KU9A 2ZNYA 5HZBA 3ZQQA 1UHMA 5EGOB 1NH3A 1FLIA 3SQVA 3GVJA 3K2AA 5C4JJ 1JI8A 1QVFB 4OPWA 2V9PA 5DCMB 2PMZN 3VO2A 4JMQA 3IWFA 3Q6QA 3L2VA 2GIVA 1RETA 4U0YA 3FMSA 4IVNA 2IPQX 1S5LC 3W6KB 3RTRA 3OR2C 1F1ZA 1S29A 3EQNA 2B9SA 2H6BA 2CUJA 4DNCA 1H42A 1TWAJ 2TDXA 5D5VB 3HPHA 1KYZA 3HOUJ 2D3NA 3IH3A 3CJTB 3FISA 3BQYA 2GQQA 4HRIA 1O7LA 3BG6A 1RI7A 1IJFA 3FHZA 2CW8A 2FMLA 4U7DA 2XZPA 1LUJB 4IRHA 2D9RA 2F43A 3ULQB 2R93J 1G3YA 1TYUA 4X7EA 1FYKA 2HFHA 4BQAA 3BTIA 3CMEI 1D8JA 2C78A 2BY0A 3F6VA 4N4OB 4ETSA 1ETWA 2Y48A 4G1VA 1K78A 4DNRB 1RQRA 3H5AA 2OCCH 1WQ2A 3RY8A 1VQ8I 3S1QJ 2QQBA 4UUTA 3OYLA 4MFDA 4RLQA 3CUQC 2DI3A 3LFUA 4FTHA 2W7ZA 2VT2A 2DYRH 3A4CA 2VFQA 3DBHB 4RB2C 2BVNA 3BTCA 3ASSA 4XD7A 2XPWA 3HM5A 3DU5A 1YYVA 5CKTA 3CCUI 4FT8A 5E3OA 1PJ7A 4KISA 4Z4SA 2GOMA 3F9KA 2FNPA 4I98B 3JTHA 3BP8A 3RPUD 4UB6C 4CA0A 1DGWY 3FXJA 4Q4ZF 1QA1A 1MBJA 4A6EA 3KZYA 2K4BA 3RQIA 2QWWA 2DJNA 3FKIJ 3VYRB 3ZMVA 3ZOBA 3P9IA 1YFHA 4P6VF 2L9RA 3K69A 4BQOA 4P12A 1YI2I 2EIMH 3ABTA 2NOGA 5K7FA 1I3QJ 1AIRA 4ZGQB 2P3MA 1BR1A 4ZYDA 4YIFA 2CV2A 4HF1A 1BMFA 2NOJB 5E1WA 1R58A 3Q9VA 2H8WA 3KZIC 5FKLA 3RKXA 4HE5A 3I55B 5EZHA 5IOZA 4RDJA 1HBXG 2A07F 2OTLB 3GVAA 1OFCX 3CUQB 3DPTA 2DA4A 3R61A 3L2CA 1F5TA 1H8AC 3KP4A 2HXOA 4XONA 2E7XA 1BR4A 3VODA 1GV5A 4Z6YA 3KYDB 2BPOA 2ZKZA 2WB1A 3IAM2 4R1HA 2VC0A 3JW4A 1RKWA 2M34A 3TP3A 3CD6I 3GVKA 1POGA 2X85A 1LKXA 4N0BA 3BCAA 3PNYA 2WYRA 3RZDJ 1ENHA 4BNCA 2ADUA 3EQLF 3P9CA 4C3JJ 5JVGF 2CBXA 3G2BA 4A69C 2JJ7A 4WWCA 3PSSA 1TWCJ 4ESBA 4RBOA 1ODDA 5FFXA 5ERIA 2M1BA 2VBWA 4LBVA 1KK0A 1O3SA 2EIKH 4G6QA 1T08B 3OYEA 2BY1A 3PQKA 3REOA 3VB2A 3NWSA 4HQMA 4ZZLA 4YFNF 3TO9A 1APLC 2XVCA 3ZMTA 4ZC3A 2QXZA 3HUGB 4CCOA 3PA1A 2VJ5A 3JRFA 1OMIA 2H8RA 1MNDA 3HSRA 1B6AA 5KHDA 3HL2A 1T39A 1FNBA 4CQJA 4AYBN 2KMUA 3MKWB 4A5MA 1FOWA 1ORKA 3ZQCA 1MH3A 1Z3XA 1N06A 3K4LA 1J75A 2YPRA 1G3SA 3CCEI 3ONYA 1KQ5A 3OV8A 2XKPA 3CCJI 1EJ9A 4YALA 3DBLB 1HKQA 4LB5A 3OS2A 5FLXK 3O3KA 2V7WA 2BEOA 4II3A 1ONVA 5BOXA 4PSXA 5K5OA 5FA6A 2MLKA 3LO8A 2HQ5A 2BSPA 1KTWA 1XTAA 3PL8A 3E20A 1DQUA 2GIZA 2XF6A 5GAHJ 1BW5A 1Z6TA 4BE1A 1R1TA 2E34A 2LKPA 2Q0OA 4WZEA 5HNFA 4RAGA 5ED4A 3GTPJ 4AF7A 3NAWA 2G0EA 1USSA 3IRQA 3E3VA 2VZLA 2BN4A 2XOKA 4WZTA 3W5UA 5J1YA 1YLOA 1PUFA 1HQCA 2IS6A 2XTXA 3KLNA 3BNWA 4A3IJ 1L1IA 2HPMA 1SEUA 1E3XA 4Y33A 4E4HA 4YRVA 1EP1B 2DDBA 2GQFA 5DCFA 1LPQA 2DIEA 4QPQA 4A3KJ 2VI6A 4WXDA 3ZXSA 1I7PA 2UV1A 2ETHA 1KZLA 4IHVA 3WU0A 4JK1X 5GADJ 4KMUX 2VBVA 3H9JA 3DXJF 2JA6J 1TBXA 4Q5SF 2CV1A 5HLTA 3SDGA 1WOOA 1R1UA 2HOSA 3JQPA 2COMA 1JKPC 2CQ7A 2NTQA 2LH9A 3IP4B 4B44A 4IXAA 2WZNA 2EB7A 1KK1A 1A6IA 5HNHA 2O04A 1MMDA 4HE6A 2VFMA 1YRNB 3D26A 1F43A 1R5BA 5HZAA 4JYKA 4OPSA 2KDOA 4NQWA 4E7HA 3PJRA 1HCRA 4Y7CA 2W82A 1ZG1A 4XOTA 2XNCA 3JRHA 1DPRA 3BG7A 3G73A 1JT0A 1ZUNB 3DU6A 1QA6A 2AXLA 4I0AA 3DTEA 3GTQJ 4CXFA 1KCCA 2JVHA 5HDNA 2M9HA 2QYOA 3ZMUA 1GT0C 2OAZA 4BJ6C 2E60A 1MNMC 4D5CA 1IN4A 1VHOA 1COWA 3LMMA 2EA4A 2HZDA 3IKTA 4E7JA 3WNCA 5K7ZA 2ZL7A 3B4NA 1B59A 4PC7A 4LK1F 1IGNA 4E0FA 1QHGA 1P4MA 1UELB 4KICA 4M72A 1MBHA 1VQNB 2EPFA 2YUSA 4HV6A 4RAYA 1KZHA 4IO9F 1JA1A 4F92B 4LBZA 2VBUA 3OSGA 4AIJA 5C44J 2R7UA 1Y1VJ 2ESHA 5DSZA 2ZXJA 1WDTA 3QWLA 3DKWA 2VASA 3GZ6A 5TGTA 5F6FA 3GTKJ 3TKYA 1CGPA 2AHOA 5F4JA 5DYMA 2ZZEA 3QAHA 4Y3OA 3CCSI 2XT4A 3HG9A 3ZN1A 2KL4A 3OYFA 2F2EA 2R5YB 3LVBA 3AVTA 3HHHA 1W7PB 3GFMA 2BBYA 2DAOA 3G1OA 1WJEA 1BI0A 2VE9A 1QQIA 3BR1A 3MZHA 1QGZA 3CDHA 2BZTA 2K85A 2XF7A 4Z4ZA 6PAXA 2JDIA 1TC3C 2MW8A 3HUGA 1BX0A 3ZRGA 2OV7A 1NB0A 2GAUA 3LA3A 2OK8A 4N9HA 4LLLA 2EZLA 1RKTA 4U88A 3SYTA 3LAJA 3QODA 4M1KA 4OJ5A 4G7ZF 2VFOA 3UNGC 3K2ZA 3WTWC 3COAC 3S2DJ 2BMWA 1IN7A 5HOOA 3G3ZA 5F64A 3T1BA 2R7XA 3FZVA 2GREA 5IP9J 3S17J 5CVIA 3JRDA 3EDPA 3NWTA 4XKBA 4AM3A 3ROUA 4UUSB 4RGXA 2OUMA 3H3UA 3S32A 2GLOA 1YQAA 2BVMA 3ABUA 3OR1C 4RB3C 5BQTA 2NAZA 4RMNA 3W6JB 3L9FA 4ENJA 1YW8A 2MABA 1ETOA 2R3SA 3VPRA 1LEBA 4Y9RA 5EEAA 4ZCIA 1IV6A 5DM7F 3WU1B 2HDNB 4M9XA 2L2OA 1O7FA 5CVUA 2M45A 1BN8A 4PABA 1X1AA 2ZFUA 1B2RA 5B1BH 3Q3AA 2ZC2A 3LSJA 4A0YA 2XB5A 1SD5A 5H20A 1TTTA 2QF7A 2HU9A 3I64A 1NK2P 1AMOA 1YIOA 4H9GA 4RLZA 2UVEA 2MH2A 3BJ6A 2L9VA 1XFOA 2QEXI 3KP5A 4HNTA 4DQ2A 5J8FA 4LJZF 1KJZA 1TTYA 3JAMK 2IVMA 5J4VA 2LFBA 3LSMA 3BG9A 1P7JA 4M74A 3I4PA 2BF4A
chains in the Genus database with same CATH topology
1UG0A 3TL4X 3QYEA 2W6IA 1UD6A 3VSUA 2M4KA 2LG4A 2ZXHA 2JIZA 2IGOA 4C9YA 2W00A 1QCXA 3D5SC 4HG2A 2DXIA 1X4OA 1ZELA 1WTHD 2GJKA 3JU4A 2W7NA 1WJFA 4N4NB 4RLFA 1IRXA 1OLTA 2VJIA 4E6KG 2KRHA 5CQGA 3H94A 1UD5A 3ZGKA 2Z2SB 3OFNA 4BJ5C 4XKVA 3OYAA 2M7BA 4P22A 2GJPA 4P5OA 3NE5B 5FRNA 3BCBA 4D1QA 4U7BA 2QKLB 3U21A 1VLYA 3T56B 3GQ9A 1O8MA 1T0FC 3VSKA 1DP3A 4CCNA 2PYHA 4YZ0A 4NUBA 4CSWA 2XF5A 1OFLA 4E7IA 3VYUB 3K4CA 1GLNA 3ZR8X 4DK0A 4QPOA 5LFAA 4L8JA 3CMMA 2F6CA 3H0DA 2LRDA 3PSIA 4BU2A 1J09A 2WAQA 2VBKA 3M1CA 4OZYA 3TMOA 1FX0A 2M5SA 1Y6IA 2R7VA 1H8EA 2O0WA 1WMRA 1PE9A 1O8JA 2K3PA 4BGDA 3K10A 1SKYB 3T51B 2JSPA 3K4JA 2A5WA 1TZLA 2MFZA 4IX7A 3KEYA 1JRGA 4E7KA 4U87A 3DEEA 1E3ZA 3HPGA 3IUOA 2PJRA 1O8HA 2UWMA 2PECA 3ZPPA 1I18A 1NG7A 2M4GA 4F55A 3FBIB 2W6JA 2X6YA 2KLOA 2IS4A 2X51A 3OEEA 4W8SA 3BLYA 2W1OA 3VSVA 2INVA 5JHFA 3HOTA 3GBGA 4PUSA 1KCDA 3BCFA 4OZZA 4BEHA 1YX5A 4ZJZA 3H5RA 2Q2EB 2IGMA 3C2HA 4GQNA 3MMYB 3A3GA 4PFOA 3L2UA 1MW7A 2R7TA 1E1QA 2X8KA 3GQAA 1D0ZA 4KITB 3OWTA 4DJAA 4P1WA 1KONA 3LSIA 2LOOA 4XM3A 2VXDA 2E1MC 3FKSA 1H80A 1Z7LA 2E1BA 1X4PA 5C1CA 4EW9A 2F4IA 4C30A 2WAFA 4OWRB 3HC7A 2CK3A 3OY9A 3AKZA 2ZZFA 1R6RA 3BC9A 2JUGA 2VQHA 1O8IA 5AMVA 1D1CA 3T9GA 3HOSA 1VZ0A 2WPDA 4C2UA 3OYMA 4IZZA 2LY2A 1FMWA 2LREA 2WJVA 1T95A 1LDKB 2DOAA 1X1DA 2GK7A 2BOLA 4B43A 3HKZA 1V5GA 3CP8A 1E79A 3T53B 4KKSA 4BL0B 1N77A 2HLDA 4OJPA 4LG3A 2V26A 2M3AA 2X1DA 4HWVA 1D1BA 2WADA 4FETA 3AL0C 1Y56A 3FBNB 1OGOX 3MKZA 2DJIA 1X1CA 2IXSA 2XAUA 4B48A 4YXWA 4B3GA 2WBMA 2HNHA 1SFKA 2IGNA 3SEZA 4D9JA 4ASUA 5FROA 2F1MA 5HVQC 1MABA 4HPQA 4XKWA 1DBOA 1UD2A 2XC7A 3K70C 1O8KA 2R7WA 4Z1MA 2I8DA 1PKVA 1VBLA 2Q1ZB 4Z06A 4Z05A 1N75A 2IS1A 4ZYAA 1V5FA 3K4MA 3OW7A 3OMYA 3PNTA 4XMYA 3W3CA 3LNNA 2R4GA 3MKYB 2X6XA 4LITA 4R79A 4X0GA 4NNJA 5KNLA 2KPMA 1AA7A 1E0EA 1UD8A 3OYBA 5CQEA 1NBMA 3VMVA 2CMPA 3KRGA 2RREA 4CCJA 4BE2A 3K6GA 3OYCA 4G7XA 2ZXIA 1IB4A 4B3XA 3SZGA 3ZSCA 2GJRA 2ZSIB 1NG6A 2M0MA 2NSPA 2IGKA 1BHEA 1K28D 4NK6A 2V4JC 1WJ5A 2BVLA 3CESA 2R7SA 4YELA 4XN3A 4XLCA 2VLAA 2L9NA 4KT6A 2VQLA 4BE0A 1O8GA 3SUCA 3H5NA 3ZQQA 4IKFA 3S3NA 2UVFA 3GVJA 4XNFA 1JI8A 4B3FX 4E7ZA 2IS2A 4XQFA 3I3LA 3E0JB 3L2VA 4KJZA 2E5ZA 2HVRA 4W8RA 2UUZA 4CH7A 3L2RA 2WY8Q 1V5EA 2PYGA 3RTRA 3OR2C 3EQNA 3ZCOA 2IQ7A 2CUJA 2K9MA 5KCMA 4FASD 2L9SA 3HPHA 2D3NA 3D5RC 2ZZQA 4LIUA 2X53S 3CF2A 2R7RA 4HRIA 3BG6A 2V7QA 3VMWA 2CW8A 2CV0A 2QX3A 1P9QC 2CUZA 2XZPA 2F43A 2OC6A 3K4BA 3HXLA 4NC8A 1VF7A 2O17A 4XORA 3K4NA 3BCDA 4KKTA 4BACA 2V4DA 1G8XA 4N4OB 3SEQA 4UZUA 2NT6A 4HNUA 4TT3A 3RQ4A 4XLHA 3H5AA 4DBQA 3OYLA 2CS3A 4RLQA 5FL7A 2O0VA 2V9KA 4RM2A 3LFUA 3IAS2 3A4CA 4XD7A 4HEA2 4AVZA 3DU5A 5CKTA 4GRIA 2PJRB 4ZDPA 4TKOB 3EQOA 4KISA 3G05A 2GOMA 3F9KA 4CZCA 3DKYA 2R9VA 3KYLA 3RPUD 1WJCA 4CA0A 1DGWY 2LBFB 1UD3A 2GK6A 2JA2A 4MXNA 1X19A 2NTPA 3VYRB 4BS9A 1X0CA 2X1EA 2RNGA 4BQOA 4ANJA 4YZQA 1OR7C 2CH0A 3D5LA 1RU4A 3OPOA 2MYSA 2WZPP 2VQCA 4EATA 2WY7Q 2XNDA 4JMQA 4KKUA 2VIXA 1AIRA 4C2LA 1O8FA 1BR1A 5LD2C 3JURA 2X6WA 2CV2A 4IQJA 1BMFA 2NOJB 2ZSHB 2XZOA 3MD2A 1PXZA 3DWLE 4XOPA 1LFPA 2O1DA 3S3MA 1WJAA 3UW0A 2ZZGA 3DPTA 3OYIA 1KMHA 3A3BA 4H4KC 3OEHA 2NTBA 4XONA 3DPLC 1BR4A 1ERDA 3LSGA 1O8EA 3LL7A 1NRKA 4C2TA 2WB1A 1QHHD 3IAM2 2RQQA 2X3HA 3GVKA 4CCMA 1N78A 2KP6A 2X85A 4W8QA 1LKXA 3DQVC 3BCAA 2BW3A 3PNYA 2INUA 2Y0SA 1D0XA 3DTKA 3DLAA 4I84A 3G2BA 2AQEA 3M8JA 3SDBA 4XLEA 3VYTB 3EUKL 3GRHA 1RMGA 2ELJA 1X1BA 3OYEA 3FPPA 2L5QA 2V6EA 3WWGA 3NWSA 4XLFA 3OYHA 3WQZA 3VR6A 1O88A 4ZC3A 2QXZA 1DGRM 2HPIA 3HUGB 4LIVA 2WAEA 3OS1A 4CCOA 2VJ5A 4OAYA 2L7KA 3C2GA 4RM3A 1MNDA 5KHDA 3A2KA 3HL2A 2AQFA 4F52A 2KMUA 1IDJA 2VXZA 3W2VA 3MKWB 4XR6A 1Z21A 2WSSA 3I9V2 1Z3XA 3K4LA 1OHHA 3B8YA 3OIQA 3PNVA 2VBEA 4JOMA 2VKHA 4CCKA 4XN0A 1WJBA 3OL4A 3QYFA 3OS2A 4YZXA 1Z3YA 4II3A 4PJLA 2NT9A 4PSXA 2MC4A 2VJJA 2HVQA 4ZTJA 2BSPA 1KTWA 2XDVA 3PL8A 4NQWB 1DQUA 2VBMA 4HSRA 2XF6A 4BXFA 1IA5A 1HZEA 3VDXA 4ZDOA 2R7QA 3S3OA 4BE1A 1CZFA 4U49A 2VJ4A 5HNFA 3ZIAA 2EWEA 1MNEA 2KQRA 3UR3C 1K5CA 2HDWA 4OAZA 3VSLA 4DNTB 1SAUA 2E5NA 4ITVA 4E7LA 3ONQA 2XOKA 2VPLA 2JJ1A 2X1CA 1O8LA 1PJRA 4II2A 2IS6A 3LMWA 2LC2A 3CJRB 1UD4A 3K70D 2HPMA 1MMAA 1E3XA 4Y33A 3FDYA 4E4HA 4YRVA 1VJSA 1BR2A 4MR0A 4YZAA 2Z1DA 3PUBA 1EFRA 2DIEA 2KVOA 4QPQA 4J01A 3ZXSA 2QY1A 2UV1A 1I8DA 1KZLA 3DKXA 3W2AA 2GOXB 1D0YA 1EA3A 2FUG2 4XKCA 1T5EA 4AYBA 3H9JA 1PLUA 3B90A 2LY1A 2KRCA 2VB6A 4HSTA 3OYKA 2CV1A 5HLTA 3PFYA 3AL0B 2NTQA 4BDZA 2LH9A 3IP4B 2DT7B 1FMVA 3A1YA 4B44A 3DTIA 4BQNA 1W36D 3DDYA 3TBIA 4DBRA 5HNHA 3OOCA 1MMDA 2O04A 2VKDA 4PSWA 2KDOA 4E7HA 3PJRA 1OB0A 4FXUA 4XL9A 3HAGA 3BC8A 1GQ8A 3DPUA 2HVSA 1YE9A 2W82A 3H9QA 4XOTA 1QJVA 4OJ6A 1BOBA 3BG7A 3H35A 3DU6A 2K9LA 2LBFA 1V0FA 3CJQB 3DTEA 4TSFA 1KCCA 2JVHA 4BJTA 1E1RA 4YEJA 4PJMA 1W0KA 4PJJA 2E1MB 1E43A 4BJ6C 1NHCA 3OS0A 1YX3A 2E60A 1QU3A 1HA8A 1U0JA 1COWA 3LMMA 2V31A 1LVKA 2HZDA 3OIPA 3QOEA 3W2WA 1MMNA 3EUHC 3K4KA 4E7JA 4PMHA 2ZTNA 3N05A 3A35A 3B4NA 4DIQA 3LSHA 4E0FA 2O5RA 1QHGA 3FHNA 1UELB 1W36C 3GQBA 4DNRB 2XSJC 4F92B 2DCEA 5CPRB 3OL3A 4OJOA 2R7UA 3OYDA 4MLOA 3OYGA 1BPLA 4G7WA 2VASA 3KX2A 5TGTA 3GQ8A 4PJNA 2CFOA 3OYNA 2DT6A 1DBGA 2ODLA 2XZLA 1TT0A 1XG2A 3FKJA 2ZZEA 3FY3A 4Y3OA 3J7AY 4OJLA 3HG9A 5HKKA 4IQ4A 4NC7A 5IK2A 2KHMA 2KL4A 3OYFA 1OGMX 1RWRA 2VQGA 4Y4RA 3PSFA 2WJYA 1WJEA 1OFMA 3EUAA 3E1SA 4DOZA 4F93B 4J00A 2XGJA 4BEHB 2D3LA 1JTAA 1EE6A 3OAAA 2XF7A 1BLIA 2JDIA 2LZJA 2V7FA 3ZRGA 2OV7A 3H9GA 5DN6A 4U4BA 4G6TB 4JQFA 2QKMB 4BUPA 4CCLA 4NK8A 1MMGA 3CZ6A 1HVXA 4OJ5A 3SYTA 3QODA 3KEWA 3VSTA 2WA0A 3UNGC 4DK1A 5HOOA 3ZPNA 3OOUA 2M7AA 4F91B 1D1AA 2R7XA 2ZTGA 2F5VA 1W9XA 3BH4A 1K6YA 2K5CA 3LSKA 2P0WA 3NWTA 3GQ7A 4XKBA 3EPZA 5CDFA 1WPCA 4ZTFA 4PFPA 2W4SA 2OUMA 3S32A 4F3QA 2CW7A 2BVMA 4G6IA 4HIZA 1WFXA 3OR1C 3OE7A 4Z03A 3RCOA 4AU7A 1H8HA 1PYVA 4RMNA 5C1EA 2MABA 3S93A 3QYBA 3RSNA 1G59A 3L2WA 2BW3B 4B47A 4E7SA 2HQAA 2L2OA 2R7OA 3CP2A 4W8TA 2LYCA 2V1NA 4DGWB 4PK4A 3VWBA 2JVGA 2KZVA 1BN8A 1OOCA 1X1AA 2PMZA 2ZFUA 2Z8GA 1W0JA 1WJDA 1WP6A 2NSTA 2Z6BD 1IDKA 1HG8A 4URRA 2HU9A 3S8PA 5FRMA 3L2QA 2NZMA 3GVLA 3V42A 2UVEA 4ZDLA 1S9HA 4BQQA 3OYJA 2QE7A 2VL8A 4HNTA 1V0EA 3AFHA 1O8DA 2Z16A 3LSMA 4BDYA 4XLAA 2A6TA 2JJ2A 2MD0A 1UAAA 3VYSB 4CUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJV A;  1GQ8 A;  4OJ6 A;  3VSU A;  1PXZ A;  4XOT A;  4XOP A;  2O1D A;  4XKW A;  3UW0 A;  1DBO A;  1QCX A;  1KCC A;  1O8K A;  4Z06 A;  2NTB A;  1VBL A;  4Z05 A;  4XON A;  4YEJ A;  1O8E A;  2X3H A;  4XMY A;  2VJI A;  1NHC A;  2X6X A;  2X85 A;  4W8Q A;  4XKV A;  2INU A;  4PMH A;  3B4N A;  4I84 A;  3VMV A;  3KRG A;  3GQ9 A;  1O8M A;  2PYH A;  4YZ0 A;  1IB4 A;  4XLE A;  3ZSC A;  3GRH A;  1RMG A;  3WWG A;  1OFL A;  2NSP A;  4NK6 A;  1BHE A;  4OJO A;  4XLF A;  1O88 A;  2QXZ A;  4YEL A;  4XN3 A;  4XLC A;  1O8G A;  3GQ8 A;  3SUC A;  1DBG A;  2UVF A;  2VBK A;  2ODL A;  1XG2 A;  4OZY A;  4XNF A;  1IDJ A;  3FY3 A;  4OJL A;  4XR6 A;  1OGM X;  2O0W A;  1RWR A;  4XQF A;  1PE9 A;  1WMR A;  1O8J A;  1OFM A;  3B8Y A;  2VBE A;  1JTA A;  4W8R A;  1JRG A;  1EE6 A;  4XN0 A;  1O8H A;  2PYG A;  2PEC A;  3ZPP A;  4U4B A;  4YZX A;  3EQN A;  2X6Y A;  2IQ7 A;  2NT9 A;  4NK8 A;  4W8S A;  3VSV A;  2VJJ A;  2INV A;  2BSP A;  1KTW A;  4OJ5 A;  3VST A;  1KCD A;  4OZZ A;  2VBM A;  1IA5 A;  1CZF A;  4U49 A;  3VMW A;  1K5C A;  2EWE A;  2QX3 A;  3GQ7 A;  3GQA A;  2O17 A;  4XOR A;  4XM3 A;  1O8L A;  1H80 A;  2NT6 A;  4Z03 A;  5C1C A;  3LMW A;  5C1E A;  4EW9 A;  4XLH A;  2O0V A;  4MR0 A;  4YZA A;  1O8I A;  5AMV A;  3T9G A;  4W8T A;  2QY1 A;  4AVZ A;  1BN8 A;  1OOC A;  2Z8G A;  3EQO A;  3B90 A;  1PLU A;  2NST A;  1IDK A;  1HG8 A;  4URR A;  4MXN A;  2NZM A;  2NTQ A;  2UVE A;  2NTP A;  4OJP A;  1X0C A;  2O04 A;  4HWV A;  4YZQ A;  1RU4 A;  1O8D A;  1OGO X;  4C2L A;  4XLA A;  1AIR A;  1O8F A;  3JUR A;  2X6W A;  4XL9 A; 
#chains in the Genus database with same CATH topology
 1B1B A;  1WH5 A;  2X9D A;  1UD6 A;  3VSU A;  2FOW A;  5DTD A;  4JP0 A;  1J59 A;  1I6H J;  2MG4 A;  4D5F A;  4CYD A;  1KQS B;  1J0R A;  3KE2 A;  3QFR A;  4P3I A;  4GXO A;  3D5S C;  2DEU A;  4BHC A;  5HS9 A;  2GJK A;  1GDT A;  3GZN B;  3JU4 A;  4WZK A;  4R8H A;  1XDU A;  2BY2 A;  1IRX A;  1Y8R B;  2PG4 A;  2HR3 A;  1YW7 A;  4N4N B;  2P7V B;  2ZCW A;  4W1U A;  1VI0 A;  2COB A;  4PZJ A;  2Z2S B;  1N08 A;  4MYT A;  3KZZ A;  1YS6 A;  2CQN A;  4R71 A;  3QFS A;  2M7B A;  1PJ5 A;  2F1L A;  1BM9 A;  2XRN A;  4D1Q A;  3U21 A;  3GQ9 A;  4M71 A;  1O8M A;  3VSK A;  1ZRC A;  1DP3 A;  2CWE A;  3JX8 A;  3DEW A;  3J81 k;  1EXM A;  1XE1 A;  1VQ8 B;  4L0Z B;  1HST A;  3BZK A;  4U0W A;  1K4S A;  1U5T C;  1QPI A;  2ZBU A;  3KCC A;  3AG4 H;  4HV5 A;  3ZR8 X;  4C3H J;  1R7J A;  4QPO A;  1JJ2 B;  4UB8 C;  2Z9O A;  4RCZ A;  2HZT A;  5E17 F;  3N6Z A;  2P8T A;  1XD7 A;  1UHW A;  1F20 A;  1MH4 A;  5J47 A;  2LRD A;  3PSI A;  2O3F A;  3AGP A;  2LDU A;  1V3F A;  2RC5 A;  1IUY A;  3ISX A;  4LBW A;  3F8M A;  1FOX A;  3SYJ A;  5LMZ A;  2R7V A;  1H8E A;  4IHW A;  1WMR A;  1HDD C;  4WZL A;  1S0U A;  5FIU A;  1ZAO A;  4RDU A;  2FNA A;  2ZBV A;  4RD2 A;  4IX7 A;  3KEO A;  3KEY A;  1JRG A;  4U87 A;  1XB2 A;  3HPG A;  3IUO A;  4WF2 A;  3CC4 I;  2PJR A;  1O8H A;  5DV5 A;  2G7U A;  3DEU A;  2KLO A;  3L7W A;  5F0F A;  2IS4 A;  1PVE A;  1D1N A;  1D8T A;  3L09 A;  2W1O A;  3IWZ A;  4G94 A;  5JHF A;  3KIO A;  4QUZ A;  1E3O C;  1KCD A;  3CC7 B;  3SLD A;  5H6Q A;  1FNN A;  3RKY A;  4BEH A;  2CG4 A;  3I0T A;  1GR1 A;  3MMY B;  2Y31 A;  4HF2 A;  2R7T A;  1XMA A;  1QFZ A;  4DJA A;  3AST A;  3F3X A;  4Z4Y A;  3GFJ A;  2VXD A;  1JXS A;  1RPW A;  1Z7L A;  1X4P A;  4OIR F;  3RPQ A;  1UMQ A;  1TQI A;  2F4I A;  5LBQ A;  2WAF A;  2DDA A;  3M07 A;  2CK3 A;  2L4A A;  2GWR A;  2P5K A;  3AKZ A;  2RC6 A;  5A8A A;  1BJZ A;  1MSF C;  1VND A;  1I27 A;  3K1M A;  3WBK A;  2EFP A;  4QTR A;  1YW9 A;  1Z91 A;  1FJL A;  3ERE D;  1S7O A;  1UJ8 A;  1FMW A;  1U5T A;  2CW0 F;  1IHM A;  3SJZ A;  3DFG A;  4HLX A;  1XCV A;  3T0Y A;  2OQR A;  1H88 C;  2BOL A;  5HDG A;  1JGG A;  1JHH A;  1CF7 B;  3DU1 X;  2KFD A;  3HKZ A;  2KKO A;  3F8B A;  3BOQ A;  3T53 B;  4KKS A;  1TW2 A;  1UB9 A;  2JRM A;  3KP2 A;  2GZW A;  4LG3 A;  2V26 A;  2M3A A;  3J7Y J;  2VON A;  2XEX A;  4OJP A;  1VQ4 B;  4HWV A;  4FET A;  1VTN C;  3AL0 C;  3PIO F;  3CCE B;  4B48 A;  4YXW A;  2IXS A;  1ZGA A;  2AXT C;  4B3G A;  2HNH A;  2EIJ H;  1SFK A;  2OPT A;  3A0B C;  4D9J A;  4BPR A;  4A3D J;  5J3L A;  4PAA A;  4X6A J;  2DET A;  4HPQ A;  2IAI A;  2D45 A;  3G4S B;  4OIO F;  2V7X A;  1B9M A;  4N9I A;  3CLO A;  1TLL A;  1DBO A;  3FXL A;  3O2P E;  4MQ9 F;  1FYL A;  5C1E A;  2FQ3 A;  2HGC A;  4Z06 A;  2I8D A;  1PKV A;  1VBL A;  4Z05 A;  3FPK A;  3KP6 A;  3OW7 A;  4XMY A;  5H6R A;  1BI2 A;  3W3C A;  2PI0 A;  4BXU A;  2L0K A;  3MKY B;  4RD3 A;  4LG0 B;  2R7F A;  1FEX A;  2KIM A;  4QLC U;  4R79 A;  4NNJ A;  1PP8 F;  1Y39 A;  5IT3 A;  2EIN H;  3WTY C;  1ZM2 A;  1ZG5 A;  2PIA A;  4LOC A;  3VMV A;  3KRG A;  4G12 A;  3I59 A;  4BE2 A;  5D8K B;  3JRG A;  4C2M J;  5D4R A;  1Y0R A;  3OOP A;  4X07 A;  4G8X A;  1NG6 A;  4OOX A;  1W5S A;  2DK8 A;  1YO5 C;  2BVL A;  2Q2E A;  2XIG A;  5IYN A;  3CDL A;  4XN3 A;  4XLC A;  3GXO A;  2L9N A;  1TWF J;  4KT6 A;  2VQL A;  5CVR A;  4BE0 A;  3HTS B;  1VQN I;  1QGA A;  1O8G A;  3U6B A;  2X4H A;  4B4D A;  2QLZ A;  2UVF A;  3DV8 A;  2ID3 A;  3ZMD A;  2QEN A;  2LK2 A;  3HGG A;  4XNF A;  3JAM Z;  4E7Z A;  3BPV A;  1I50 J;  4LD5 A;  4Q47 A;  3I3L A;  3E0J B;  4P3Y A;  3SKB A;  2E5Z A;  3BRO A;  3WTT C;  2DA7 A;  2V79 A;  2QSF X;  3CCL I;  2P6S A;  5H5J A;  3CCQ B;  2K9S A;  1V5E A;  2R7Z J;  2PYG A;  2MD5 A;  5CLS A;  3QFC A;  3M9A A;  1S4M A;  1MD0 A;  3H09 A;  2B7E A;  3GTL J;  4JBA A;  2K9M A;  5KCM A;  4OIN F;  2KIF A;  3OKX A;  4OP7 A;  2FE3 A;  4ESF A;  4RJL A;  3D5R C;  2F5E A;  3FF5 A;  2BY3 A;  2R7R A;  5EMN A;  1R49 A;  1NB9 A;  3VMW A;  2QX3 A;  2NRA C;  4ZCL A;  3SHF A;  2OC6 A;  1LDD A;  3HXL A;  1VF7 A;  1OYY A;  1T56 A;  1U2R A;  3IH2 A;  1STZ A;  4Q48 A;  1G8X A;  4UZU A;  4M3B A;  2NT6 A;  4HNU A;  4I0B A;  3RQ4 A;  5D6F A;  3ES9 A;  5BSX A;  3G6E B;  1W0T A;  2JN6 A;  2O0V A;  4RM2 A;  3BTJ A;  4CGZ A;  4IHS A;  4HEA 2;  5JR3 A;  1YIJ I;  5F4M A;  3V8L A;  1YIT B;  4AVZ A;  1VQK I;  3KPH A;  1S6L A;  3WGG A;  4GRI A;  5HLH A;  4ZDP A;  2PJR B;  5LGU A;  4FHT A;  1VQ5 B;  2Z3Y A;  4JX4 A;  2M30 A;  4I99 C;  3SZP A;  2F4M B;  4GYI A;  1DUX C;  2R9V A;  4LC0 A;  2H1K A;  2ZFW A;  1U6G A;  4RDK A;  4MXN A;  3QE2 A;  5TRD A;  2EH3 A;  1X19 A;  2NTP A;  4BS9 A;  2X1E A;  1YHQ B;  2RNG A;  4YZQ A;  1MKM A;  3OPO A;  1X1P A;  2VQC A;  1E2X A;  2M8G X;  4EAT A;  5BPD A;  4UY8 I;  2VIX A;  4ABZ A;  1DPU A;  1ZM4 A;  3ZP5 A;  5LD2 C;  2XND A;  2X6W A;  1HOM A;  2B7C A;  1FY7 A;  1O8F A;  3N90 A;  5B5E C;  2FU4 A;  2TCT A;  5IPA A;  2ZL5 A;  4XOP A;  4Y52 J;  1ZR4 A;  2O1D A;  4N3G A;  2Y75 A;  3S3M A;  1HW5 A;  4KMF A;  2ZZG A;  1O57 A;  3OYI A;  4BDZ A;  3OEH A;  2NTB A;  1I6X A;  1ERD A;  3LSG A;  3LL7 A;  3SJM A;  4C2T A;  2X3H A;  1QHH D;  1W35 A;  2XRO A;  3CMA B;  5TV2 A;  1RUO A;  4P2N A;  2FF4 A;  4IRG A;  4ZYE A;  1WOR A;  2XAQ A;  1G7T A;  4MHG A;  5KVR A;  4W8Q A;  2BW3 A;  1EP2 B;  2Y0S A;  1D0X A;  1OCC H;  2ZME A;  3DTK A;  1U9O A;  5EF6 A;  4DZJ A;  5E79 C;  3AVU A;  4EJU A;  4GCV A;  4XRF A;  2O03 A;  3ZQG A;  4TMT A;  1IUF A;  3HOY J;  3GRH A;  1OB2 A;  1RMG A;  3WWG A;  1YIT I;  2V6E A;  5FNZ A;  4XK4 A;  2DO7 A;  1FT9 A;  1X3U A;  2HI3 A;  2ICW G;  1IW7 F;  3HYI A;  2HPI A;  1O88 A;  1CQX A;  5ICC A;  5F08 A;  3GO5 A;  4RM3 A;  4WXH A;  3A2K A;  3D0S A;  4F52 A;  1SD7 A;  3QPT A;  1IDJ A;  2LVS A;  2CGP A;  3W2V A;  3M8E A;  1YHQ I;  4KDP A;  3I9V 2;  2LTP A;  1SAX A;  3WTZ A;  1OHH A;  2D1H A;  2JN9 A;  3J80 Z;  3OIQ A;  2M8E A;  3PNV A;  2VBE A;  1K4T A;  4CZZ A;  4JOM A;  3PIP F;  4XN0 A;  2DQL A;  3A0H C;  3CPW B;  9ANT A;  3S2W A;  4YIR X;  3VNU A;  3BY6 A;  1ETV A;  4O5V A;  2V1X A;  4L18 B;  1K83 J;  3WGH A;  2MC4 A;  2VJJ A;  2F4N A;  4NC6 A;  4NQW B;  5M5X J;  1YG2 A;  4YFX F;  2VBM A;  2KDZ A;  2F5F A;  4LK0 F;  1IA5 A;  2DMU A;  2R7Q A;  3GFL A;  2BHZ A;  1CZF A;  4U49 A;  3MZ8 A;  4QWQ A;  1XG1 A;  1K5C A;  2KQR A;  5FD5 A;  3CCR B;  2HDW A;  3VSL A;  3B82 A;  3TH0 A;  1KK2 A;  3QPH A;  4E7L A;  3GTG J;  5F04 A;  3GUD A;  2L3D A;  2JJ1 A;  4XRM A;  1YJ9 B;  4Q7J B;  3NB2 A;  1BC7 C;  2J8I A;  3OP1 A;  2OF7 A;  3IHU A;  3CPX A;  2ZO4 A;  3CUQ A;  1GXQ A;  2HTJ A;  3FDY A;  1VQP B;  3E6C C;  4HOB A;  2CU7 A;  2Z1D A;  1TNT A;  4MTE A;  3S1R J;  2UZK A;  3CME B;  2A6H F;  5D6E A;  4P96 A;  4I2O A;  1C0W A;  3DKX A;  2JZY A;  2W24 A;  3LQQ A;  3QU3 A;  4WCG A;  4ESJ A;  2QZA A;  2GOX B;  3B90 A;  4XKC A;  1T5E A;  1PLU A;  4AYB A;  2VE8 A;  2WAQ N;  3OYK A;  3BR3 A;  3PFY A;  5IY5 H;  4MEX F;  3BPX A;  4XSX F;  3HJE A;  2HKO A;  1QGP A;  2W48 A;  1SVM A;  4HF0 A;  2DT7 B;  1VF9 A;  4BQN A;  5IP7 J;  3PM1 A;  2J5P A;  1CNF A;  4OOV A;  3TBI A;  4DBR A;  5FLX Z;  2MBF A;  1TUI A;  3LST A;  3R4K A;  1OCP A;  4S05 A;  2B0L A;  3BJO A;  5LHI A;  2BM5 A;  1V55 H;  3V7R A;  5FD6 A;  1OB0 A;  1YX2 A;  5HS8 A;  3HAG A;  3BC8 A;  3DPU A;  4D0P A;  2XKO A;  5B3S H;  3H35 A;  1B23 P;  2Y0S N;  4Y17 A;  4ZGN B;  1JJ8 C;  2E7W A;  2VBT A;  4BJT A;  1E1R A;  2UXX A;  3CCY A;  4YEJ A;  2HS5 A;  4Y15 A;  2E1M B;  1AHD P;  2C77 A;  1XN7 A;  4ZV4 A;  1U0J A;  2R5Z B;  1GVH A;  1VQM B;  1LVK A;  4NBS A;  3GFI A;  1JUM A;  2DW4 A;  3EUH C;  1SMT A;  4B8X A;  3JRC A;  2ZTN A;  4OPO A;  3N05 A;  2KJC A;  3A35 A;  3LA2 A;  3ZZ0 A;  2DPD A;  3HSE A;  2O5R A;  4Y9U A;  4DQL A;  1V5V A;  5A2Q K;  2KIQ A;  1W36 C;  4CYC A;  3H36 A;  3I56 I;  1ON1 A;  2RN7 A;  2OA4 A;  3WTX C;  3P7N A;  3Q0W A;  1M1E B;  4UNO A;  4AIK A;  1BJK A;  3I59 B;  5EJC A;  4G7H F;  1BPL A;  3ABL H;  5TR9 A;  1ZRF A;  2QTL A;  4ZZD A;  5ILV A;  3KP3 A;  4BXX J;  1IXC A;  4PJN A;  5E6T A;  3OYN A;  1Z7U A;  2DT6 A;  2E1R A;  2XZL A;  3FKJ A;  3FY3 A;  5HKK A;  3TOA A;  3DP7 A;  4IQ4 A;  4UVC A;  2KHM A;  5IK2 A;  3HOV J;  3VOE A;  1RWR A;  4B09 A;  2ZIT A;  2Y9Y A;  3EUA A;  3E1S A;  2YWG A;  3NAR A;  4BKX A;  1QPM A;  4J00 A;  2B63 J;  1Q7Y D;  4U0V A;  1R5G A;  3FX3 A;  1J7K A;  4MGR A;  3IRR A;  1MDM B;  2D3L A;  1YRN A;  3HDD A;  1BLI A;  3OAA A;  3MZY A;  4AUX A;  4G5G A;  3OZU A;  4U4B A;  3GEZ A;  3SZT A;  2QKM B;  3EUH A;  5DDG A;  3M8F A;  4NK8 A;  3WNB A;  3CC2 B;  2BSA A;  1X2N A;  2WA0 A;  2ECC A;  1GAQ A;  5J3O A;  1REP C;  4RAZ A;  1TYX A;  2ZTG A;  5B66 C;  2X48 A;  1CNE A;  1SVL A;  3GQ7 A;  4AWX B;  2CFX A;  3TO6 A;  2NXN B;  2DA1 A;  4HIZ A;  4S0H B;  4CYC B;  2CW7 A;  3CO7 C;  4UAJ A;  3OZV A;  2PEX A;  1PYV A;  2L54 A;  2XGX A;  1XB4 A;  5F0H A;  1LM1 A;  3SFZ A;  2Q6L A;  4EJO A;  3A01 A;  2BW3 B;  1E3H A;  4B4C A;  4W8T A;  2LYC A;  2V1N A;  2ISY A;  2YX7 A;  4PK4 A;  1FBQ A;  2KZV A;  3G71 I;  3HRT A;  5KW9 A;  1ACI A;  5M5W J;  2BV3 A;  2PMH A;  1EH8 A;  3GLL A;  1WP6 A;  4ENN A;  1YIJ B;  5F27 A;  3L2Q A;  3M7G A;  3HB9 A;  5CYV A;  2GXB A;  3V42 A;  1ZLJ A;  5FKN A;  4ZDL A;  4IF4 A;  2DA6 A;  1S9H A;  2DFE A;  2MGQ A;  2XAG A;  2FBI A;  2VL8 A;  2XV4 S;  1GXP A;  1V0E A;  1WSR A;  3AK5 A;  5A89 A;  1RQP A;  1O8D A;  2JJ2 A;  2ZNZ A;  4YDT A;  4QSH A;  4JX6 A;  5DNS A;  1UAA A;  1BN5 A;  1XCB A;  2X6O A;  1UG0 A;  3WTV C;  3BWG A;  3V4G A;  4OMY A;  3F23 A;  5HDK A;  3H3Z A;  4P26 A;  1KU3 A;  1O4X A;  2LG4 A;  4CO8 A;  3GF2 A;  2W00 A;  1DP7 P;  4HG2 A;  2J7K A;  4HBL A;  2DXI A;  4UUV A;  3G1L A;  3HEF A;  4PC1 A;  3JRA A;  5AON A;  4A3L J;  2W7N A;  1FX7 A;  1N05 A;  4RLF A;  1OLT A;  4HLY A;  2BE5 F;  1UHS A;  2KRH A;  3MVP A;  5CQG A;  2EIX A;  3ZGK A;  2K40 A;  1B8I B;  4KN4 X;  3OFN A;  2IA2 A;  4XKV A;  4C43 A;  3OYA A;  3ASR A;  4JRA C;  1IN8 A;  4QVA A;  5ICF A;  4A3M J;  2GJP A;  2EV5 A;  2I5U A;  5FRN A;  4IPA A;  3T56 B;  4U7B A;  2QKL B;  4YII A;  5LGN A;  1DU6 A;  4E7I A;  2J8K A;  3TOB A;  1FIA A;  3K4C A;  1LFU P;  3H9N A;  1I39 A;  1WGX A;  5FLV A;  2HTS A;  4TMX A;  3CMM A;  1UFM A;  2F6C A;  3TED A;  2NVX J;  1TT5 B;  1PUF B;  4UZE A;  1TLH B;  1J09 A;  1D5Y A;  2VBK A;  1J9Z A;  1G7S A;  4OZY A;  3TMO A;  2IA0 A;  3E5U A;  3MEX A;  4OIP F;  4LLG F;  1Y6I A;  1F4K A;  3PA2 A;  1TYV A;  5KAI C;  1QZZ A;  4BGD A;  1N0U A;  2XAF A;  2M5W A;  2KT0 A;  2Z99 A;  3T51 B;  1TZL A;  2DOF A;  1ZGW A;  1E3Z A;  2QSH X;  2EWN A;  5TIS C;  1HSJ A;  2XAJ A;  2QQ8 A;  1HLV A;  1QVU A;  2VNH A;  3OEE A;  2FBK A;  2INV A;  3GBG A;  1KRH A;  4TMZ A;  2F48 A;  4M2L A;  2GXA A;  3CCV B;  2JT1 A;  4HQE A;  3H5R A;  4YCQ A;  1ETK A;  3GW2 A;  2YWE A;  2IGM A;  3C2H A;  2DFI A;  5E18 F;  5GTI C;  2D2W A;  2X8K A;  3CMA I;  3EYI A;  2AHQ A;  4P1W A;  3TGN A;  1K78 B;  1FIP A;  1KU2 A;  1SC7 A;  5KAF C;  4AC9 A;  2VOP A;  3OY9 A;  3QP5 A;  4BY1 J;  3BC9 A;  2E2I J;  2Y2Z A;  1VQL I;  1SFX A;  1OFE A;  2VQH A;  5L3B A;  1D1C A;  1FNC A;  1WVR A;  1BBY A;  3QPS A;  3HOS A;  1VZ0 A;  2WPD A;  5E3M A;  1UCR A;  1PP7 U;  3RKQ A;  2LY9 A;  1QRC A;  1S7E A;  1LDK B;  2DOA A;  3WXM A;  3FMQ A;  4KNY A;  2FX3 A;  3A02 A;  2NS8 A;  4JX5 A;  2GK7 A;  3K0L A;  3SFI A;  2V7V A;  3CP8 A;  3Q0V A;  1P4W A;  1N77 A;  1A31 A;  2HLD A;  3C18 A;  3CMY A;  3HGY A;  3QPL A;  3BR2 A;  3AVW A;  2QGU A;  1T6Z A;  3TP0 A;  3FBN B;  2D1V A;  4UV8 A;  2BXY A;  1X1C A;  2ME6 A;  2G0Y A;  2XRL A;  1IC8 A;  2RAE A;  2CYY A;  3T5X A;  3LQ6 A;  3SEZ A;  1IJW C;  1R5N A;  4FX4 A;  4ASU A;  3QOP A;  1R5O A;  2HQR A;  1LFB A;  2DT5 A;  5E3L A;  2O6G E;  3VMF A;  5M5Y J;  1UD2 A;  2CF4 A;  3F21 A;  2XC7 A;  4P9S A;  2PMU A;  2K27 A;  3IH4 A;  3GIR A;  4Z1M A;  3ERM A;  1N75 A;  2IS1 A;  5IT9 K;  4P55 A;  4ZYA A;  1KQ9 A;  1MBE A;  2H09 A;  5LEK A;  1V5F A;  4ROX A;  1TWG J;  2Y30 A;  1GO2 A;  1HXD A;  3OMY A;  1FWZ A;  5BPI A;  2FRH A;  4LIT A;  5AN9 A;  5IYQ A;  3BTL A;  3EET A;  3B6A A;  4HW0 A;  5KNL A;  4X0G A;  2KPM A;  3BY2 A;  3MMP A;  1Z6R A;  5HXB A;  3A8I A;  1RNL A;  3ZBT A;  1JJ6 C;  4NHJ A;  4M3F A;  3LSP A;  1EFT A;  1WSU A;  2YWF A;  2E36 A;  4EJV A;  3GCM A;  3HKZ N;  4B3X A;  1ZHF A;  3ZSC A;  2GJR A;  2XT2 A;  3MHP A;  4FN5 A;  2NSP A;  4NK6 A;  1KD1 D;  1BHE A;  2CQQ A;  1K28 D;  1IRG A;  1WJ5 A;  2F5D A;  2OCE A;  2Y69 H;  4DW6 A;  2W25 A;  3CCM I;  4KA4 A;  4A3G J;  4AIH A;  2K3F A;  1HF0 A;  3E97 A;  1JTX A;  3H5N A;  3LSR A;  3EYY A;  2EFG A;  2JMW A;  1F9N A;  3S3N A;  2H27 A;  1NDH A;  1OGJ A;  2NV4 A;  1VQ7 B;  3JQQ A;  2RVC A;  3K9T A;  4EMS A;  4A3E J;  4B3A A;  5GAG J;  2Q6K A;  2VKV A;  3KLO A;  4UXN A;  2K9Q A;  4ON0 A;  4OMZ A;  2HVR A;  1N25 A;  5JI6 A;  1Q81 D;  2O6W A;  1SM4 A;  2UUZ A;  1Y1W J;  1VQK B;  4CH7 A;  3L2R A;  2WY8 Q;  3A8K A;  5GV8 A;  3QQA A;  4Y7N J;  1T6S A;  2M2E A;  2WC2 A;  3ZCO A;  2IQ7 A;  3HBL A;  4FAS D;  1QFY A;  2VKE A;  4J19 A;  1GJR A;  3FXK A;  4LIU A;  5A2Q Z;  2X53 S;  3ONU A;  4Z4U A;  3S16 J;  1WI3 A;  1E17 A;  2A5Y B;  2OZ6 A;  3DLL F;  2CV0 A;  1P9Q C;  2CUZ A;  3GTM J;  1ETX A;  3PO3 J;  3HSF A;  1FOY A;  1NTC A;  2JPB A;  3HOX J;  1H89 C;  1VQ4 I;  2OTJ I;  4XOR A;  5IYP A;  2O17 A;  4M3G A;  2EA2 A;  1VQM I;  2IT0 A;  1A8P A;  1X3Z B;  4EH1 A;  2V7T A;  4TT3 A;  2MC3 A;  1JKR C;  4DBQ A;  4YHB A;  5M3M J;  2CS3 A;  3CLQ A;  2QN6 A;  2V9K A;  5C3E J;  1EH7 A;  4YAF A;  2OTL I;  4CDG A;  3HZJ A;  1U8B A;  3BDD A;  2W57 A;  3ZUG A;  2K02 A;  2I10 A;  3J81 K;  3WE3 A;  4TKO B;  3G05 A;  4CZC A;  4PC2 A;  1JTY A;  1MJB A;  4GGG A;  3KYL A;  4QVJ A;  1NJI D;  2XTW A;  2LBF B;  1UD3 A;  3ASQ A;  3SZE A;  3F72 A;  5FKK A;  4KN7 X;  3WBJ A;  2DER A;  1T2K A;  1K4Z A;  1X0C A;  3JRI A;  1JHF A;  2DPU A;  1XPX A;  1RES A;  3C3W A;  3D5L A;  1RU4 A;  1ZR2 A;  2O9L A;  2MYS A;  4LB6 B;  1LJ9 A;  2WZP P;  2WY7 Q;  2P81 A;  3NEU A;  1SAN A;  2GXG A;  2LF8 A;  2XPV A;  3JUR A;  2ZSH B;  3F8F A;  3CO6 C;  2L4M A;  1CQT A;  2XZO A;  2WB1 N;  4RDL A;  3DWL E;  4OOS A;  1J9I A;  1O3T A;  2LD5 A;  4C3I J;  3E7L A;  4FE4 A;  1PUE E;  3P4G A;  1SMY F;  1KMH A;  3A3B A;  2HEO A;  2QSG X;  4KIB A;  3PUN A;  3DPL C;  1QA3 A;  2K4J A;  2XB0 X;  1O8E A;  1WSV A;  1VQ9 B;  1NRK A;  2H1L A;  1LEA A;  1RUN A;  4XLP F;  4KH3 A;  3R6K A;  3A8J A;  1MRZ A;  3LAP A;  1OCR H;  1N78 A;  1K8A D;  5FO0 A;  2DOD A;  5FKM A;  1I1G A;  3ABM H;  3MQ0 A;  4P9U A;  2DN0 A;  4WK8 F;  2YS9 A;  3MKL A;  1Z1D A;  2QCO A;  1U78 A;  1H9T A;  2D5V A;  4I84 A;  1YJW B;  5B6I A;  3PFI A;  4BH9 A;  3SDB A;  1S72 B;  4AC0 A;  1IXS B;  1IRZ A;  1BI1 A;  3I58 A;  3FPP A;  2L5Q A;  3CCR I;  1FP1 D;  4XLF A;  2HQN A;  5E8G A;  1Y0N A;  3VR6 A;  2HOA A;  2NNY A;  3HIF A;  2DY1 A;  1CLW A;  3RPU A;  1DG1 G;  4LIV A;  3Q6R A;  2FSW A;  4GDF A;  1VQO B;  1JGS A;  4PDK A;  3TW7 A;  1KGS A;  4IHT A;  5FO1 A;  3LJY A;  1KQ0 A;  3LQR A;  2NS0 A;  2OD5 A;  2QVO A;  2E2H J;  3ASP A;  2NVT J;  1K73 D;  1KA8 A;  3E5Q A;  2EZI A;  5DCM A;  2WSS A;  1ZAR A;  5EEG A;  3G1M A;  5K7H A;  2VKH A;  1G3T A;  4RD4 A;  2EFW A;  3OL4 A;  4HDU A;  3QYF A;  2BX6 A;  2PFB A;  2BM7 A;  2FJ1 A;  4RD1 A;  4ZTJ A;  3T8R A;  3H92 A;  1QX4 A;  2LKS A;  3M1E A;  4HSR A;  4BXF A;  5EDN A;  1E64 A;  3E1Y E;  3FWE A;  4HX7 A;  1H9G A;  3S3O A;  2QEX B;  2K9N A;  2VJ4 A;  3ZIA A;  2EWE A;  3UR3 C;  3ZMZ A;  4OAZ A;  4ITV A;  2IEK A;  2EZH A;  4X7D A;  1F36 A;  3ONQ A;  2XTY A;  3PO2 J;  2X1C A;  1BL0 A;  1O8L A;  3AGQ A;  4II2 A;  2F3L A;  2LC2 A;  4TV7 A;  2ZB9 A;  2FQ4 A;  3JSO A;  3K70 D;  3CTA A;  2BGC A;  5IYB J;  1VJS A;  4MR0 A;  1W7P D;  1I18 A;  2NVU B;  2MSY A;  3PUB A;  2KVO A;  3M3Y J;  2QY1 A;  5BMZ A;  3BG3 A;  3QU6 A;  5FGM A;  1I8D A;  3W5H A;  1VQO I;  2HWV A;  1D0Y A;  1EA3 A;  2FUG 2;  4XRS G;  1KYW A;  2LY1 A;  4ZYG A;  2C4T A;  3FXU A;  3ECH A;  1TQP A;  3ML6 A;  1JA0 A;  1HDP A;  2JSC A;  3PUF A;  1FMV A;  2VOD A;  3DDY A;  3DTI A;  3I56 B;  2QUF A;  3C2B A;  3SJP A;  3ZQH A;  3CJN A;  1HKT A;  2QQA A;  4PSW A;  2EV6 A;  2VC1 A;  1WPK A;  4FXU A;  1EH6 A;  3MAJ A;  3DBR B;  4XL9 A;  1T8I A;  1QJV A;  1GQ8 A;  1YE9 A;  2Z5U A;  3H9Q A;  1BOB A;  3FJO A;  4V19 K;  2K9L A;  4DZP A;  1ON2 A;  4EGY A;  1V0F A;  4IW3 B;  1FSH A;  4Y13 A;  4X06 A;  3U1K A;  3BY1 A;  5KSW B;  3W6V A;  4X8I A;  1XQB A;  2OU2 A;  3V8J A;  1W0U A;  4B1R A;  1K6O A;  1XGN A;  2YX4 A;  2Q6I A;  1NHC A;  1T33 A;  3OS0 A;  1QG0 A;  1HW2 A;  3KYC B;  5J4Y A;  4OM9 A;  1W1W E;  1QU3 A;  1HA8 A;  2V31 A;  3GSI A;  1TSP A;  3OIP A;  1MJA A;  3W2W A;  1MMN A;  2DTR A;  3I5U A;  2A68 F;  3JTG A;  5IP6 A;  2ACJ A;  1G6N A;  2VUM J;  1HF2 A;  3W2H A;  2EJR A;  3RIR A;  3J81 Z;  3S2H J;  5E8I A;  1HA3 A;  4I6Z A;  2PMD A;  3GQB A;  1OQY A;  2ECB A;  2QZ8 A;  4MEY F;  3L00 A;  5CPR B;  4A0X A;  4OJO A;  2FD5 A;  3OYD A;  4MLO A;  1XX5 A;  3PSZ A;  1LE8 A;  2H94 A;  3KX2 A;  5FO5 A;  4IHX A;  3I55 I;  1VQ6 B;  2CFO A;  2LF7 A;  1DBG A;  2QMU A;  4ZYH A;  2XGE A;  3WE2 A;  3MFK A;  5EYR A;  1P2F A;  2VBY A;  4AD9 A;  3J7A Y;  5HLG A;  1FYM A;  1OGM X;  2BM4 A;  2VQG A;  4IL6 C;  4Y4R A;  3PSF A;  3V8K A;  2WJY A;  4EM2 A;  3ML3 A;  2BXZ A;  1ZRE A;  4F93 B;  1JTA A;  2ESN A;  3D1N I;  4FE7 A;  1EE6 A;  5D8L B;  1G3W A;  3G71 B;  2LZJ A;  2V7F A;  3F0C A;  5DN6 A;  4G6T B;  4JQF A;  4BUP A;  3CXC B;  4Z4W A;  1JB9 A;  4WX9 A;  2R6H A;  3Q3S A;  1MMG A;  3CZ6 A;  3VST A;  5GPC A;  4A3B J;  1H85 A;  3ZZT A;  4DK1 A;  1OCO H;  1K9M D;  1W87 A;  2B7B A;  3ZPN A;  2M7A A;  2DMT A;  2L01 A;  5FKO A;  2PQ8 A;  1R36 A;  4LBY A;  2BM0 A;  1KC8 D;  2HDC A;  3BH4 A;  1K6Y A;  3LSK A;  1FPQ A;  2P0W A;  3E6D A;  2X0L A;  1KU7 A;  3EPZ A;  5CDF A;  1WPC A;  2CO5 A;  4PFP A;  2MA3 A;  1XMX A;  4G6I A;  1WFX A;  2V6C A;  2L7M P;  2CSO A;  4AU7 A;  2L7F P;  3ABK H;  1H8H A;  1WU8 A;  1A6Q A;  2G7H A;  3FXO A;  1T98 A;  3RSN A;  5LRS A;  2F4O B;  1G59 A;  2VYQ A;  1P6R A;  2OBT A;  4B47 A;  4E7S A;  2R7O A;  3CP2 A;  3WG9 A;  5L3C A;  2JVG A;  2HOE A;  2ELH A;  1JE8 A;  1B9N A;  3FIW A;  2FMY A;  2PMZ A;  3O6B B;  4HA8 A;  5GAE J;  3BJA A;  3IV5 A;  3U1D A;  1S8N A;  5AIP A;  1WJD A;  3CCM B;  2ZME C;  5DD8 A;  5FLM J;  2Z6B D;  2VOO A;  4URR A;  1HG8 A;  1YLF A;  4UUS A;  4IOC F;  2HKX A;  3O8H A;  3S8P A;  1AKH A;  2G9W A;  2OBP A;  5FRM A;  2NZM A;  4KIG A;  1R5I D;  2DYS H;  5AIQ A;  2DA3 A;  4AF6 A;  4BQQ A;  1ZH5 A;  3OYJ A;  2QE7 A;  3MCA A;  2PJP A;  1BJA A;  5LGT A;  3AFH A;  1WOP A;  4GO1 A;  3W2F A;  1QFJ A;  2Z16 A;  3SLN A;  4XLA A;  2A6T A;  1EFC A;  4LFU A;  3RIQ A;  2HMA A;  3VYS B;  3OE7 A;  2IA1 A;  1LE8 B;  3TDZ C;  3TL4 X;  2W6I A;  2XPU A;  3O8G A;  1PDN C;  3WTS C;  1IXR C;  5E20 A;  4RM0 A;  2ZXH A;  2IGO A;  1IDZ A;  4C9Y A;  1A5J A;  1QCX A;  1K7A A;  3B02 A;  1X4O A;  3JR9 A;  1D3Y A;  1R4M B;  2VT3 A;  3CCL B;  1W7P A;  2E1C A;  2YWH A;  2HYG D;  4E6K G;  5DS0 A;  3H94 A;  1R23 A;  3HRS A;  1QQ1 A;  2IRF G;  4I76 A;  2DYI A;  2DCU A;  2YU9 J;  3UKG A;  4P22 A;  4X0C A;  3QSY A;  3B73 A;  3NE5 B;  3C7J A;  4U9U A;  1FZP B;  1R4N B;  3BCB A;  1GHC A;  3I1F A;  2VNJ A;  3QFT A;  3GYH X;  1YJN I;  2PYH A;  1TP4 A;  1FRN A;  3BH7 B;  1EP3 B;  1OFL A;  1Y0Y A;  3VYU B;  4L0Y B;  1GLN A;  1YJW I;  5K5Q A;  5K1Y A;  4DK0 A;  5LFA A;  3JRE A;  4KT5 C;  2ZJP F;  3H0D A;  3E5X A;  4MQV A;  4BU2 A;  2N8G A;  3R60 A;  2K7L A;  1W34 A;  2WAQ A;  4RD6 A;  3RZO J;  3U2Q A;  2TRT A;  2M5S A;  1DAR A;  3AVX A;  2NVQ J;  1TQM A;  1BX1 A;  1U8R A;  3BQZ A;  1XGM A;  3V76 A;  2O0W A;  1PE9 A;  3U2R A;  1O8J A;  2K3P A;  1CF7 A;  3RYR A;  1SKY B;  1IZ1 A;  4P25 A;  4M3D A;  3LWF A;  2A5W A;  2MFZ A;  5EZG A;  5LRR A;  1O3Q A;  5ILU A;  3DEE A;  3CF5 F;  2VFP A;  2UWM A;  1TVC A;  1K79 A;  2PEC A;  1RR8 C;  1T38 A;  1NG7 A;  2M4G A;  4EM0 B;  1JUS A;  1OIS A;  3FBI B;  4EJW A;  2X6Y A;  4F55 A;  5ILS A;  1BQE A;  1DDI A;  1EKE A;  4W8S A;  4QIW N;  3BLY A;  2MLG A;  2V9V A;  3VSV A;  5J40 A;  5B1A H;  1FND A;  3BCF A;  4OZZ A;  1FRQ A;  2R7D A;  1BC8 C;  4IHY A;  2CC2 A;  1IV8 A;  1YX5 A;  4V2G A;  2L02 A;  1ZRD A;  2XGC A;  1UG2 A;  5FFZ A;  4PCQ A;  5E1X A;  5JLW A;  2LLK A;  3A3G A;  4PFO A;  4J0Q A;  1MW7 A;  3W2I A;  1D0Z A;  1EF4 A;  2DLL A;  4PJ0 C;  2EV0 A;  4UVB A;  4KIT B;  2QQ9 A;  2YSR A;  1YS7 A;  3LSI A;  4X1E A;  2I1L A;  2E1M C;  1H80 A;  3HRU A;  1YTY A;  5C1C A;  4HNV A;  1YJN B;  3ISP A;  3HC7 A;  5E1Z B;  4RGS A;  3S14 J;  2FVG A;  5J1R A;  3VEP A;  2GPJ A;  2JUG A;  3T9G A;  1JNY A;  1SVO A;  4A2U A;  1XSD A;  2JPC A;  3ZMS A;  2B0R A;  1LVA A;  5CVJ A;  4IZZ A;  4C2U A;  1Y8Q B;  3OW2 B;  2D74 A;  2WJV A;  5BS6 A;  1AWC A;  5M3F J;  1R71 A;  3HRM A;  1GUU A;  1X1D A;  3VO1 A;  3BR6 A;  1N07 A;  1DDG A;  4RAF A;  1R00 A;  3R0A A;  1V5G A;  4XID A;  3AG3 H;  4M0L A;  2OBS A;  2LP0 A;  1MZB A;  2WAD A;  2GBY A;  3J7A O;  2DFH A;  1Y56 A;  2ZJR F;  1G2H A;  3JQR A;  2O8X A;  4V02 C;  4HYE A;  2JUC A;  2WBM A;  5GPA A;  2VFN A;  4OU0 A;  2R5Y A;  2RKH A;  5FRO A;  2OBR A;  2F1M A;  5HVQ C;  2JTV A;  2EZK A;  4XKW A;  1I1S A;  2EQR A;  3H3V K;  1JUP A;  3K70 C;  1LLW A;  4WXC A;  2R7W A;  5KK1 A;  1OKR A;  5LHG A;  3R6J A;  2DU9 A;  3CCU B;  4A0Z A;  2EFO A;  1JKO C;  4BHP A;  1G7C A;  4EQQ A;  3LNN A;  1H0M A;  1I3A A;  2X6X A;  1WKM A;  1WCM J;  4BBR J;  4BBS J;  5EG0 B;  2Q6O A;  1AA7 A;  1E0E A;  3RYP A;  1J2X A;  5J1U A;  2FBH A;  5CQE A;  1A36 A;  1UD8 A;  5JMC B;  1M90 D;  4MIM A;  4ZH4 F;  1YI2 B;  1Q1H A;  2Q8K A;  4ASN A;  3MCZ A;  4CCJ A;  4M53 A;  3K6G A;  3OYC A;  2STW A;  2H6C A;  1GVJ A;  2ZXI A;  4G7X A;  1TNS A;  1IB4 A;  2ZSI B;  2IP2 A;  4P9F A;  3BG5 A;  1GVD A;  4G6D A;  2DMQ A;  3S1M J;  3BH6 B;  3CES A;  3J7Z I;  4M6V A;  3LYC A;  2Y9Z A;  3SUC A;  5JLV C;  4IKF A;  2OZU A;  2W84 A;  1XS9 A;  1ZN2 A;  4B3F X;  1OFD A;  3FXM A;  5IYC J;  2IS2 A;  3SXY A;  3V7S A;  3RKW A;  3VFZ A;  1KQ8 A;  4M4S A;  2NS7 A;  4XQF A;  1P7I A;  4RCY A;  2DFF A;  4KJZ A;  1VQ6 I;  2GA1 A;  1KTV A;  5DUK A;  2WTE A;  2A6E F;  4W8R A;  1Q1V A;  3R0J A;  2XGD A;  3ZPL A;  1Z9C A;  1A35 A;  2CW5 A;  3CRZ A;  2RDP A;  4Z2Y A;  4EEF G;  3ZQL A;  3CQZ J;  2L9S A;  4YAU A;  4LMY A;  2ZZQ A;  5EGO A;  4RD0 A;  1QZY A;  3CF2 A;  3NQO A;  2JWT A;  2V7Q A;  2XHK A;  1JKQ C;  2P4W A;  5HLI A;  2ME0 A;  2XUB A;  2O0Y A;  3X2Q H;  3K4B A;  4NC8 A;  3K4N A;  2DTZ A;  1U3E M;  1FC3 A;  3BCD A;  2DA2 A;  2L7Z A;  4I02 A;  4KKT A;  1QUF A;  4G9Y A;  4BAC A;  2V4D A;  3SEQ A;  3OIO A;  4XLH A;  1ZK8 A;  3CCJ B;  1S7A A;  5F0C A;  3W2E A;  1SKQ A;  1V4R A;  3BR5 A;  2BM1 A;  3CCQ I;  5FL7 A;  3V7C A;  2P7C B;  3IAS 2;  4X05 A;  3RI4 A;  3VNV A;  4DYQ A;  1EZG A;  1QRB A;  2JRT A;  1R1V A;  4DQK A;  1LB2 A;  3ZC3 A;  3EQO A;  2P5V A;  3DKY A;  4BYY A;  3BR0 A;  2LSO A;  1WJC A;  4XBF A;  2PBI A;  3J80 K;  2GK6 A;  2JA2 A;  4EV0 A;  2NVY J;  3H0G J;  1T6X A;  1WZ2 A;  1S72 I;  1WH7 A;  2BGJ A;  2J5O A;  2R0Q C;  3KP7 A;  1OYW A;  1ETY A;  4ANJ A;  5JVT A;  1OR7 C;  2CH0 A;  4RGU A;  2CRG A;  1RRJ A;  3GME A;  4BHB A;  4C2L A;  4KKU A;  1IO2 A;  2VBS A;  4IQJ A;  3AVV A;  1B72 A;  3MD2 A;  4PGH A;  1PXZ A;  4ENM A;  3W5V A;  1LFP A;  1QH0 A;  2DBB A;  1WJA A;  5JFR A;  4PGG A;  3UW0 A;  1G7R A;  1Z77 A;  2IBD A;  2ID6 A;  4A93 J;  1WWX A;  4H4K C;  2BM6 A;  3ZBU A;  2RQQ A;  4HAM A;  3GLX A;  4CCM A;  2KP6 A;  2PLF A;  1IG7 A;  3DQV C;  3A01 B;  4OIQ F;  3FK7 A;  1HC8 A;  2INU A;  5JBQ A;  1EV7 A;  2HYF A;  4QHY A;  3ECO A;  4ENK A;  3DLA A;  5IYD J;  2AQE A;  3M8J A;  3L1P A;  4L9V A;  4WWV A;  1FBS A;  1I5Z A;  1MBK A;  1YOV B;  4K2E A;  4XLE A;  3AG2 H;  3EUK L;  1WRJ A;  3VYT B;  5E3N A;  5THX A;  2ELJ A;  1X1B A;  3I71 A;  4I09 A;  2VBZ A;  2GA2 A;  3FK6 A;  1X58 A;  3OYH A;  4L9N A;  3WQZ A;  1DGR M;  1UZC A;  1SD4 A;  4FIS A;  4KUM A;  1QO0 D;  2E71 A;  2WAE A;  3OS1 A;  4F7D A;  3LOC A;  4NB5 A;  4OAY A;  2L7K A;  4X7C A;  3C2G A;  3ZQF A;  2AQF A;  5TJJ A;  4A3C J;  2PN6 A;  3CW2 A;  2VXZ A;  3Q9S A;  4Z4T A;  3I53 A;  3I4M J;  4XR6 A;  1Z21 A;  5F1J A;  1W5T A;  2EK5 A;  3WND A;  3GZ5 A;  3ZQ7 A;  1DU0 A;  1ITY A;  2CRV A;  5A88 A;  3F8N A;  2E1O A;  3B8Y A;  1SFO J;  1T0F A;  5D5U B;  5CVV A;  2LKX A;  1XGS A;  4D7M A;  1IN6 A;  4CCK A;  3KET A;  1G4D A;  1ZQ3 P;  1WJB A;  1FSE A;  2VPR A;  1MBG A;  4M9S A;  4EGZ A;  1FNM A;  1GAW A;  2RC4 A;  1Y0U A;  2M87 A;  3U9G A;  1S3J A;  1ZGJ A;  3PUM A;  3PVD A;  4YZX A;  1Z3Y A;  2DMN A;  4FX0 A;  4PJL A;  3WU2 C;  5J6X A;  2NT9 A;  3FM5 A;  1B72 B;  5J8C A;  2HVQ A;  2XDV A;  2VNK A;  5TY0 A;  3IC7 A;  3WGI A;  1HZE A;  3VDX A;  3GTO J;  4ZDO A;  3Q38 A;  1OJL A;  5JLX A;  2NYX A;  1MNE A;  2XAS A;  4A5N A;  3A03 A;  4MO7 A;  1AIP A;  4DNT B;  1SAU A;  2E5N A;  1X3W B;  5ICG A;  4IEJ A;  1ZTR A;  5DM6 F;  3CCS B;  1NK3 P;  2VPL A;  4L5E A;  1OCZ H;  1PJR A;  3P5J A;  5L3D A;  4E70 A;  1ZKG A;  3LMW A;  1QZE A;  3CJR B;  1U9N A;  4NBQ A;  2OYN A;  2ZME B;  1UD4 A;  2VNI A;  3M4O J;  1W2B B;  2OTJ B;  1MMA A;  3IKV A;  1FP2 A;  4EM1 A;  1EA0 A;  4O6J A;  4K1X A;  1BR2 A;  2E35 A;  4YZA A;  1EFR A;  3TO7 A;  1TYW A;  4V2F A;  4J01 A;  4XSZ F;  5D5X B;  3W2A A;  1E63 A;  2M0C A;  4MFE A;  3NRV A;  4XLN F;  1XC5 A;  2AS5 F;  1RC9 A;  1Z67 A;  2KRC A;  2DA5 A;  2VB6 A;  4HST A;  4RGR A;  3R6S A;  3AL0 B;  1VHE A;  1XGO A;  3OJX A;  1K8F A;  1IB0 A;  2KIU A;  4M73 A;  5J35 A;  1OR7 A;  3A1Y A;  1W36 D;  3OOC A;  1MBF A;  3BT9 A;  2VKD A;  5DD4 A;  3ZQI A;  1AOY A;  4ACB A;  3JRB A;  3QP6 A;  2JA7 J;  3K1P A;  5FB2 A;  1FOK A;  3ELK A;  4YC5 A;  2V1U A;  1KK3 A;  1ZLK A;  2HVS A;  2JQ7 A;  2V7U A;  2STT A;  4L5J A;  2QA4 B;  4OJ6 A;  2WV1 A;  3ASO H;  3CUO A;  4TN1 A;  3NAU A;  4XIC A;  1AKH B;  2WR8 A;  2LBF A;  3CJQ B;  2CUE A;  3G6E I;  2ISZ A;  3FMR A;  3GWZ A;  3WHB A;  1IDY A;  1ZG3 A;  4KFC A;  4HX4 A;  1N0V C;  2RV8 A;  1W4M A;  4TSF A;  3FXQ A;  4O3M A;  3N97 A;  4PJM A;  1W0K A;  4PJJ A;  4RB0 A;  3BQJ A;  2Z33 A;  1E43 A;  1BOA A;  5LEJ A;  2ZJ2 A;  3CB4 A;  3SEJ A;  1YX3 A;  2WWY A;  3QOE A;  1Q86 D;  3SQN A;  4NDL A;  5C4X J;  1TWH J;  3K4K A;  3LQE A;  1IRF A;  4PMH A;  1E62 A;  4BY7 J;  1VQ9 I;  1ETQ A;  2ZBK A;  1OB5 A;  4DIQ A;  2IOU G;  3LSH A;  4C0S A;  2V5I A;  1DDN A;  1LNW A;  3W2G A;  1U5T B;  3FHN A;  3Q0U A;  3T8T A;  1RIO H;  3AG1 H;  2XSJ C;  2XAH A;  1OGI A;  2DCE A;  3ESW B;  5HOD A;  3OL3 A;  2ZJQ F;  5L46 A;  1Z05 A;  4IOA F;  4FQG A;  3OYG A;  3A1P A;  2IJL A;  3Q5F A;  4G7W A;  4KYW A;  5HS7 A;  5IYW A;  1M1K D;  3GQ8 A;  2QTZ A;  3RDI A;  5F1R A;  3PEN A;  5CJ9 A;  2BV6 A;  2ODL A;  1TT0 A;  1XG2 A;  2A69 F;  2CND A;  1P4A A;  4OJL A;  4NC7 A;  1F60 A;  1YJ9 I;  4S04 A;  1Q82 D;  2IW5 A;  1N8R D;  1QRY A;  2LMD A;  5LHH A;  1WHU A;  1OFM A;  2FA5 A;  2FOK A;  4DOZ A;  4UHT A;  5L3G A;  2P5L C;  4BEH B;  2XGJ A;  1HW1 A;  1E3P A;  2QA4 I;  3MN2 A;  2O7O A;  2W85 A;  3H9G A;  4YFK F;  5D4S A;  3HOZ J;  5EEH A;  4CCL A;  1IAW A;  1V54 H;  1HVX A;  5D5W B;  3KEW A;  3TW6 A;  5GP9 A;  1L0O C;  3LFK A;  3U6K A;  2DK5 A;  5BNG A;  3OOU A;  3WOD F;  4DYR A;  4F91 B;  1D1A A;  4UZF A;  5F4O A;  1UST A;  2F5V A;  1W9X A;  2K5C A;  2PX9 A;  3B78 A;  1R22 A;  1ULY A;  2WV0 A;  1O3R A;  1HKS A;  2DOE A;  1ZM9 A;  2A61 A;  4ZTF A;  3DCF A;  1QVT A;  3WTU C;  2W4S A;  4F3Q A;  3FXR A;  4UVA A;  1IF1 A;  5DEQ A;  4Z03 A;  3RCO A;  5LLQ A;  4M6X A;  2BGI A;  5IYR A;  2QYU A;  2XC1 A;  1QUE A;  4GYG A;  3S93 A;  1WI9 A;  3QYB A;  1Z0X A;  2GM4 A;  1P92 A;  2RGV A;  1WXR A;  3F22 A;  3LA7 A;  3L2W A;  2C4U A;  2R92 J;  4IJA A;  2F5C A;  2HQA A;  3HOW J;  2HYJ A;  1B8I A;  3BZC A;  4HX8 A;  3QRF F;  1OPC A;  4DGW B;  3VWB A;  4YAW A;  1LDJ A;  1OOC A;  2Z8G A;  2UXN A;  4FK8 A;  3TQN A;  1VLO A;  1QBJ A;  3CC7 I;  1MDM A;  1W0J A;  2OQG A;  2B5O A;  2V1D A;  1EFU A;  2NST A;  4GFB A;  2QGG A;  1IDK A;  4DYC A;  2YR2 A;  1BIB A;  3GVL A;  4UV9 A;  2EIL H;  2C5H A;  3OSF A;  4YEI A;  1ZM3 A;  4IRI A;  1T6Y A;  1LLZ A;  1BA5 A;  4BDY A;  2E19 A;  2FXA A;  2MD0 A;  2DQR A;  4CUG A;  4PC6 A;  3QYE A;  2CQX A;  1D8K A;  5H59 A;  2M4K A;  1RZ4 A;  3CD6 B;  4BAY A;  1MGT A;  5DS9 A;  1QVG B;  2JIZ A;  4P6Y A;  2K86 A;  2DOG A;  1WTH D;  1ZEL A;  1VQP I;  3PQJ A;  3KL9 A;  1FTT A;  2E1N A;  1WJF A;  2Y0M A;  2VJI A;  1UD5 A;  4BJ5 C;  4AVP A;  4YFO A;  3H1C A;  3PET A;  2X0K A;  1ZYR F;  2FX0 A;  4P5O A;  3B8H A;  4I7H A;  1XSX A;  3P26 A;  4KIF A;  1VLY A;  1MJ9 A;  2OJE D;  3WHC A;  2KJB A;  1T0F C;  3WY9 A;  4CCN A;  4YZ0 A;  4NUB A;  4L9J A;  4CSW A;  3AVY A;  2XF5 A;  2R5Z A;  1R5H A;  4OPV A;  1SFE A;  2HDD A;  4F7Z A;  1D2E A;  3KEQ A;  4M9Z A;  4YG2 F;  2QBY B;  3CCV I;  3G4S I;  1IJE A;  2XSD C;  3I4N J;  1ELO A;  4L8J A;  3ASN H;  4QV2 A;  3TDU C;  2KRF A;  3HTU A;  4OOI A;  1W5C C;  2A05 A;  4A12 A;  1TW3 A;  1XMK A;  3M1C A;  1FX0 A;  1BIA A;  4H0E A;  4ZCM A;  1EWY A;  2LNB A;  1FBU A;  2X3U A;  1R9T J;  3OJW A;  4P1V A;  3K10 A;  2FEZ A;  3WG7 H;  2JSP A;  3K4J A;  4RPD A;  3F8C A;  5ICE A;  3AAF A;  2MH9 A;  4E7K A;  1WOS A;  5H2F C;  3WYA A;  1VFC A;  1BI3 A;  1AU7 A;  1LQ1 A;  2PE3 A;  2W6J A;  3ZPP A;  4CHU A;  2BYV E;  1IN5 A;  2X51 A;  2PLY A;  2ELK A;  4N3N A;  4MYU A;  4ACA A;  3LNQ A;  2P6T A;  4RA2 A;  2O61 A;  3HOT A;  4PUS A;  2NNN A;  4RB1 A;  4G7O F;  4M3E A;  3HHG A;  1JT6 A;  2VN2 A;  2BHY A;  4ZJZ A;  2EFQ A;  2LR8 A;  2Q2E B;  2HCJ B;  3Q39 A;  4GQN A;  2EBI A;  3GTJ J;  2NPF A;  3L2U A;  1SFU A;  1E1Q A;  3GQA A;  1P4X A;  1A04 A;  4MNU A;  2KIS A;  4G1B A;  3OWT A;  3JSP A;  1KON A;  4XM3 A;  2LOO A;  3FKS A;  4LGW A;  3IL2 A;  2E1B A;  4EW9 A;  5JHU A;  4C30 A;  4OWR B;  1XSV A;  2QBY A;  5GV7 A;  3MWM A;  2HOT A;  5EG0 A;  2JA5 J;  2ZZF A;  1R6R A;  5IT9 Z;  1XDS A;  2C6Y A;  4EVI A;  2C5B A;  1MMS A;  4LG0 A;  3RJP A;  4HDV A;  1O8I A;  5AMV A;  2XNJ A;  4EJT A;  2YUH A;  1MIJ A;  2CQK A;  4MTD A;  1FTZ A;  3OYM A;  3P27 A;  2LY2 A;  4L9T A;  4A6D A;  4TMV A;  3V7A A;  3CC4 B;  1NHA A;  3B6C A;  2LRE A;  4CIC A;  1T95 A;  3JCU C;  2C2W A;  3P9K A;  3E6M A;  1Q9S A;  2QDX A;  1J5Y A;  4RS8 A;  4LLN A;  3K7A J;  4B43 A;  2OK7 A;  2ZXW H;  4PGO A;  3ZN0 A;  3CC2 I;  1E79 A;  4BL0 B;  1RR7 A;  2KZG A;  2RQP A;  2X1D A;  3CDI A;  4L5I A;  2A3S A;  1DAB A;  1D1B A;  1OGO X;  1QNT A;  3ZZU A;  2CUF A;  3MKZ A;  2DJI A;  2EFN A;  2XAU A;  5IOY A;  4Z4V A;  1MSE C;  3S1N J;  2IGN A;  5FJ8 J;  3C1D A;  1L3L A;  1D5V A;  3I54 A;  5BSY A;  1QA2 A;  1MAB A;  1B4A A;  1OCT C;  3GX4 X;  1OYI A;  1PJ6 A;  3S15 J;  1X2M A;  3BZ6 A;  4A3F J;  1VQL B;  2O8K A;  4WQM A;  1O8K A;  2ZL6 A;  1VQ7 I;  1U2W A;  2Q1Z B;  1VQ5 I;  2HXI A;  2VBX A;  4X7F A;  2JK3 A;  3K4M A;  2QM3 A;  4AID A;  5L3F A;  3N4M A;  3PNT A;  1FDR A;  2R4G A;  3DF8 A;  2JA8 J;  4FWT A;  3K1N A;  3F6O A;  4XRS A;  4HZF A;  1TL8 A;  2YU3 A;  1K61 A;  3OYB A;  3KFW X;  2CJJ A;  4W97 A;  1NBM A;  4TMW A;  4YAO A;  2CMP A;  4Z4R A;  2RRE A;  1SD6 A;  1UMK A;  4PC3 A;  5L3E A;  4RPB A;  2E2J J;  4I01 A;  3SZG A;  1GV2 A;  3E6B A;  1QGY A;  5GTH C;  2RNJ A;  4FCY A;  3SY2 A;  2M0M A;  2IGK A;  2AO9 A;  5K5R A;  4A3J J;  4NCN A;  2DMP A;  3OZW A;  2V4J C;  2R7S A;  4YEL A;  3FM3 A;  4D7N A;  2VLA A;  4QFM A;  1BW6 A;  4M6Y A;  5DUI A;  1KU9 A;  2ZNY A;  5HZB A;  3ZQQ A;  1UHM A;  5EGO B;  1NH3 A;  1FLI A;  3SQV A;  3GVJ A;  3K2A A;  5C4J J;  1JI8 A;  1QVF B;  4OPW A;  2V9P A;  5DCM B;  2PMZ N;  3VO2 A;  4JMQ A;  3IWF A;  3Q6Q A;  3L2V A;  2GIV A;  1RET A;  4U0Y A;  3FMS A;  4IVN A;  2IPQ X;  1S5L C;  3W6K B;  3RTR A;  3OR2 C;  1F1Z A;  1S29 A;  3EQN A;  2B9S A;  2H6B A;  2CUJ A;  4DNC A;  1H42 A;  1TWA J;  2TDX A;  5D5V B;  3HPH A;  1KYZ A;  3HOU J;  2D3N A;  3IH3 A;  3CJT B;  3FIS A;  3BQY A;  2GQQ A;  4HRI A;  1O7L A;  3BG6 A;  1RI7 A;  1IJF A;  3FHZ A;  2CW8 A;  2FML A;  4U7D A;  2XZP A;  1LUJ B;  4IRH A;  2D9R A;  2F43 A;  3ULQ B;  2R93 J;  1G3Y A;  1TYU A;  4X7E A;  1FYK A;  2HFH A;  4BQA A;  3BTI A;  3CME I;  1D8J A;  2C78 A;  2BY0 A;  3F6V A;  4N4O B;  4ETS A;  1ETW A;  2Y48 A;  4G1V A;  1K78 A;  4DNR B;  1RQR A;  3H5A A;  2OCC H;  1WQ2 A;  3RY8 A;  1VQ8 I;  3S1Q J;  2QQB A;  4UUT A;  3OYL A;  4MFD A;  4RLQ A;  3CUQ C;  2DI3 A;  3LFU A;  4FTH A;  2W7Z A;  2VT2 A;  2DYR H;  3A4C A;  2VFQ A;  3DBH B;  4RB2 C;  2BVN A;  3BTC A;  3ASS A;  4XD7 A;  2XPW A;  3HM5 A;  3DU5 A;  1YYV A;  5CKT A;  3CCU I;  4FT8 A;  5E3O A;  1PJ7 A;  4KIS A;  4Z4S A;  2GOM A;  3F9K A;  2FNP A;  4I98 B;  3JTH A;  3BP8 A;  3RPU D;  4UB6 C;  4CA0 A;  1DGW Y;  3FXJ A;  4Q4Z F;  1QA1 A;  1MBJ A;  4A6E A;  3KZY A;  2K4B A;  3RQI A;  2QWW A;  2DJN A;  3FKI J;  3VYR B;  3ZMV A;  3ZOB A;  3P9I A;  1YFH A;  4P6V F;  2L9R A;  3K69 A;  4BQO A;  4P12 A;  1YI2 I;  2EIM H;  3ABT A;  2NOG A;  5K7F A;  1I3Q J;  1AIR A;  4ZGQ B;  2P3M A;  1BR1 A;  4ZYD A;  4YIF A;  2CV2 A;  4HF1 A;  1BMF A;  2NOJ B;  5E1W A;  1R58 A;  3Q9V A;  2H8W A;  3KZI C;  5FKL A;  3RKX A;  4HE5 A;  3I55 B;  5EZH A;  5IOZ A;  4RDJ A;  1HBX G;  2A07 F;  2OTL B;  3GVA A;  1OFC X;  3CUQ B;  3DPT A;  2DA4 A;  3R61 A;  3L2C A;  1F5T A;  1H8A C;  3KP4 A;  2HXO A;  4XON A;  2E7X A;  1BR4 A;  3VOD A;  1GV5 A;  4Z6Y A;  3KYD B;  2BPO A;  2ZKZ A;  2WB1 A;  3IAM 2;  4R1H A;  2VC0 A;  3JW4 A;  1RKW A;  2M34 A;  3TP3 A;  3CD6 I;  3GVK A;  1POG A;  2X85 A;  1LKX A;  4N0B A;  3BCA A;  3PNY A;  2WYR A;  3RZD J;  1ENH A;  4BNC A;  2ADU A;  3EQL F;  3P9C A;  4C3J J;  5JVG F;  2CBX A;  3G2B A;  4A69 C;  2JJ7 A;  4WWC A;  3PSS A;  1TWC J;  4ESB A;  4RBO A;  1ODD A;  5FFX A;  5ERI A;  2M1B A;  2VBW A;  4LBV A;  1KK0 A;  1O3S A;  2EIK H;  4G6Q A;  1T08 B;  3OYE A;  2BY1 A;  3PQK A;  3REO A;  3VB2 A;  3NWS A;  4HQM A;  4ZZL A;  4YFN F;  3TO9 A;  1APL C;  2XVC A;  3ZMT A;  4ZC3 A;  2QXZ A;  3HUG B;  4CCO A;  3PA1 A;  2VJ5 A;  3JRF A;  1OMI A;  2H8R A;  1MND A;  3HSR A;  1B6A A;  5KHD A;  3HL2 A;  1T39 A;  1FNB A;  4CQJ A;  4AYB N;  2KMU A;  3MKW B;  4A5M A;  1FOW A;  1ORK A;  3ZQC A;  1MH3 A;  1Z3X A;  1N06 A;  3K4L A;  1J75 A;  2YPR A;  1G3S A;  3CCE I;  3ONY A;  1KQ5 A;  3OV8 A;  2XKP A;  3CCJ I;  1EJ9 A;  4YAL A;  3DBL B;  1HKQ A;  4LB5 A;  3OS2 A;  5FLX K;  3O3K A;  2V7W A;  2BEO A;  4II3 A;  1ONV A;  5BOX A;  4PSX A;  5K5O A;  5FA6 A;  2MLK A;  3LO8 A;  2HQ5 A;  2BSP A;  1KTW A;  1XTA A;  3PL8 A;  3E20 A;  1DQU A;  2GIZ A;  2XF6 A;  5GAH J;  1BW5 A;  1Z6T A;  4BE1 A;  1R1T A;  2E34 A;  2LKP A;  2Q0O A;  4WZE A;  5HNF A;  4RAG A;  5ED4 A;  3GTP J;  4AF7 A;  3NAW A;  2G0E A;  1USS A;  3IRQ A;  3E3V A;  2VZL A;  2BN4 A;  2XOK A;  4WZT A;  3W5U A;  5J1Y A;  1YLO A;  1PUF A;  1HQC A;  2IS6 A;  2XTX A;  3KLN A;  3BNW A;  4A3I J;  1L1I A;  2HPM A;  1SEU A;  1E3X A;  4Y33 A;  4E4H A;  4YRV A;  1EP1 B;  2DDB A;  2GQF A;  5DCF A;  1LPQ A;  2DIE A;  4QPQ A;  4A3K J;  2VI6 A;  4WXD A;  3ZXS A;  1I7P A;  2UV1 A;  2ETH A;  1KZL A;  4IHV A;  3WU0 A;  4JK1 X;  5GAD J;  4KMU X;  2VBV A;  3H9J A;  3DXJ F;  2JA6 J;  1TBX A;  4Q5S F;  2CV1 A;  5HLT A;  3SDG A;  1WOO A;  1R1U A;  2HOS A;  3JQP A;  2COM A;  1JKP C;  2CQ7 A;  2NTQ A;  2LH9 A;  3IP4 B;  4B44 A;  4IXA A;  2WZN A;  2EB7 A;  1KK1 A;  1A6I A;  5HNH A;  2O04 A;  1MMD A;  4HE6 A;  2VFM A;  1YRN B;  3D26 A;  1F43 A;  1R5B A;  5HZA A;  4JYK A;  4OPS A;  2KDO A;  4NQW A;  4E7H A;  3PJR A;  1HCR A;  4Y7C A;  2W82 A;  1ZG1 A;  4XOT A;  2XNC A;  3JRH A;  1DPR A;  3BG7 A;  3G73 A;  1JT0 A;  1ZUN B;  3DU6 A;  1QA6 A;  2AXL A;  4I0A A;  3DTE A;  3GTQ J;  4CXF A;  1KCC A;  2JVH A;  5HDN A;  2M9H A;  2QYO A;  3ZMU A;  1GT0 C;  2OAZ A;  4BJ6 C;  2E60 A;  1MNM C;  4D5C A;  1IN4 A;  1VHO A;  1COW A;  3LMM A;  2EA4 A;  2HZD A;  3IKT A;  4E7J A;  3WNC A;  5K7Z A;  2ZL7 A;  3B4N A;  1B59 A;  4PC7 A;  4LK1 F;  1IGN A;  4E0F A;  1QHG A;  1P4M A;  1UEL B;  4KIC A;  4M72 A;  1MBH A;  1VQN B;  2EPF A;  2YUS A;  4HV6 A;  4RAY A;  1KZH A;  4IO9 F;  1JA1 A;  4F92 B;  4LBZ A;  2VBU A;  3OSG A;  4AIJ A;  5C44 J;  2R7U A;  1Y1V J;  2ESH A;  5DSZ A;  2ZXJ A;  1WDT A;  3QWL A;  3DKW A;  2VAS A;  3GZ6 A;  5TGT A;  5F6F A;  3GTK J;  3TKY A;  1CGP A;  2AHO A;  5F4J A;  5DYM A;  2ZZE A;  3QAH A;  4Y3O A;  3CCS I;  2XT4 A;  3HG9 A;  3ZN1 A;  2KL4 A;  3OYF A;  2F2E A;  2R5Y B;  3LVB A;  3AVT A;  3HHH A;  1W7P B;  3GFM A;  2BBY A;  2DAO A;  3G1O A;  1WJE A;  1BI0 A;  2VE9 A;  1QQI A;  3BR1 A;  3MZH A;  1QGZ A;  3CDH A;  2BZT A;  2K85 A;  2XF7 A;  4Z4Z A;  6PAX A;  2JDI A;  1TC3 C;  2MW8 A;  3HUG A;  1BX0 A;  3ZRG A;  2OV7 A;  1NB0 A;  2GAU A;  3LA3 A;  2OK8 A;  4N9H A;  4LLL A;  2EZL A;  1RKT A;  4U88 A;  3SYT A;  3LAJ A;  3QOD A;  4M1K A;  4OJ5 A;  4G7Z F;  2VFO A;  3UNG C;  3K2Z A;  3WTW C;  3COA C;  3S2D J;  2BMW A;  1IN7 A;  5HOO A;  3G3Z A;  5F64 A;  3T1B A;  2R7X A;  3FZV A;  2GRE A;  5IP9 J;  3S17 J;  5CVI A;  3JRD A;  3EDP A;  3NWT A;  4XKB A;  4AM3 A;  3ROU A;  4UUS B;  4RGX A;  2OUM A;  3H3U A;  3S32 A;  2GLO A;  1YQA A;  2BVM A;  3ABU A;  3OR1 C;  4RB3 C;  5BQT A;  2NAZ A;  4RMN A;  3W6J B;  3L9F A;  4ENJ A;  1YW8 A;  2MAB A;  1ETO A;  2R3S A;  3VPR A;  1LEB A;  4Y9R A;  5EEA A;  4ZCI A;  1IV6 A;  5DM7 F;  3WU1 B;  2HDN B;  4M9X A;  2L2O A;  1O7F A;  5CVU A;  2M45 A;  1BN8 A;  4PAB A;  1X1A A;  2ZFU A;  1B2R A;  5B1B H;  3Q3A A;  2ZC2 A;  3LSJ A;  4A0Y A;  2XB5 A;  1SD5 A;  5H20 A;  1TTT A;  2QF7 A;  2HU9 A;  3I64 A;  1NK2 P;  1AMO A;  1YIO A;  4H9G A;  4RLZ A;  2UVE A;  2MH2 A;  3BJ6 A;  2L9V A;  1XFO A;  2QEX I;  3KP5 A;  4HNT A;  4DQ2 A;  5J8F A;  4LJZ F;  1KJZ A;  1TTY A;  3JAM K;  2IVM A;  5J4V A;  2LFB A;  3LSM A;  3BG9 A;  1P7J A;  4M74 A;  3I4P A;  2BF4 A; 
#chains in the Genus database with same CATH homology
 1UG0 A;  3TL4 X;  3QYE A;  2W6I A;  1UD6 A;  3VSU A;  2M4K A;  2LG4 A;  2ZXH A;  2JIZ A;  2IGO A;  4C9Y A;  2W00 A;  1QCX A;  3D5S C;  4HG2 A;  2DXI A;  1X4O A;  1ZEL A;  1WTH D;  2GJK A;  3JU4 A;  2W7N A;  1WJF A;  4N4N B;  4RLF A;  1IRX A;  1OLT A;  2VJI A;  4E6K G;  2KRH A;  5CQG A;  3H94 A;  1UD5 A;  3ZGK A;  2Z2S B;  3OFN A;  4BJ5 C;  4XKV A;  3OYA A;  2M7B A;  4P22 A;  2GJP A;  4P5O A;  3NE5 B;  5FRN A;  3BCB A;  4D1Q A;  4U7B A;  2QKL B;  3U21 A;  1VLY A;  3T56 B;  3GQ9 A;  1O8M A;  1T0F C;  3VSK A;  1DP3 A;  4CCN A;  2PYH A;  4YZ0 A;  4NUB A;  4CSW A;  2XF5 A;  1OFL A;  4E7I A;  3VYU B;  3K4C A;  1GLN A;  3ZR8 X;  4DK0 A;  4QPO A;  5LFA A;  4L8J A;  3CMM A;  2F6C A;  3H0D A;  2LRD A;  3PSI A;  4BU2 A;  1J09 A;  2WAQ A;  2VBK A;  3M1C A;  4OZY A;  3TMO A;  1FX0 A;  2M5S A;  1Y6I A;  2R7V A;  1H8E A;  2O0W A;  1WMR A;  1PE9 A;  1O8J A;  2K3P A;  4BGD A;  3K10 A;  1SKY B;  3T51 B;  2JSP A;  3K4J A;  2A5W A;  1TZL A;  2MFZ A;  4IX7 A;  3KEY A;  1JRG A;  4E7K A;  4U87 A;  3DEE A;  1E3Z A;  3HPG A;  3IUO A;  2PJR A;  1O8H A;  2UWM A;  2PEC A;  3ZPP A;  1I18 A;  1NG7 A;  2M4G A;  4F55 A;  3FBI B;  2W6J A;  2X6Y A;  2KLO A;  2IS4 A;  2X51 A;  3OEE A;  4W8S A;  3BLY A;  2W1O A;  3VSV A;  2INV A;  5JHF A;  3HOT A;  3GBG A;  4PUS A;  1KCD A;  3BCF A;  4OZZ A;  4BEH A;  1YX5 A;  4ZJZ A;  3H5R A;  2Q2E B;  2IGM A;  3C2H A;  4GQN A;  3MMY B;  3A3G A;  4PFO A;  3L2U A;  1MW7 A;  2R7T A;  1E1Q A;  2X8K A;  3GQA A;  1D0Z A;  4KIT B;  3OWT A;  4DJA A;  4P1W A;  1KON A;  3LSI A;  2LOO A;  4XM3 A;  2VXD A;  2E1M C;  3FKS A;  1H80 A;  1Z7L A;  2E1B A;  1X4P A;  5C1C A;  4EW9 A;  2F4I A;  4C30 A;  2WAF A;  4OWR B;  3HC7 A;  2CK3 A;  3OY9 A;  3AKZ A;  2ZZF A;  1R6R A;  3BC9 A;  2JUG A;  2VQH A;  1O8I A;  5AMV A;  1D1C A;  3T9G A;  3HOS A;  1VZ0 A;  2WPD A;  4C2U A;  3OYM A;  4IZZ A;  2LY2 A;  1FMW A;  2LRE A;  2WJV A;  1T95 A;  1LDK B;  2DOA A;  1X1D A;  2GK7 A;  2BOL A;  4B43 A;  3HKZ A;  1V5G A;  3CP8 A;  1E79 A;  3T53 B;  4KKS A;  4BL0 B;  1N77 A;  2HLD A;  4OJP A;  4LG3 A;  2V26 A;  2M3A A;  2X1D A;  4HWV A;  1D1B A;  2WAD A;  4FET A;  3AL0 C;  1Y56 A;  3FBN B;  1OGO X;  3MKZ A;  2DJI A;  1X1C A;  2IXS A;  2XAU A;  4B48 A;  4YXW A;  4B3G A;  2WBM A;  2HNH A;  1SFK A;  2IGN A;  3SEZ A;  4D9J A;  4ASU A;  5FRO A;  2F1M A;  5HVQ C;  1MAB A;  4HPQ A;  4XKW A;  1DBO A;  1UD2 A;  2XC7 A;  3K70 C;  1O8K A;  2R7W A;  4Z1M A;  2I8D A;  1PKV A;  1VBL A;  2Q1Z B;  4Z06 A;  4Z05 A;  1N75 A;  2IS1 A;  4ZYA A;  1V5F A;  3K4M A;  3OW7 A;  3OMY A;  3PNT A;  4XMY A;  3W3C A;  3LNN A;  2R4G A;  3MKY B;  2X6X A;  4LIT A;  4R79 A;  4X0G A;  4NNJ A;  5KNL A;  2KPM A;  1AA7 A;  1E0E A;  1UD8 A;  3OYB A;  5CQE A;  1NBM A;  3VMV A;  2CMP A;  3KRG A;  2RRE A;  4CCJ A;  4BE2 A;  3K6G A;  3OYC A;  4G7X A;  2ZXI A;  1IB4 A;  4B3X A;  3SZG A;  3ZSC A;  2GJR A;  2ZSI B;  1NG6 A;  2M0M A;  2NSP A;  2IGK A;  1BHE A;  1K28 D;  4NK6 A;  2V4J C;  1WJ5 A;  2BVL A;  3CES A;  2R7S A;  4YEL A;  4XN3 A;  4XLC A;  2VLA A;  2L9N A;  4KT6 A;  2VQL A;  4BE0 A;  1O8G A;  3SUC A;  3H5N A;  3ZQQ A;  4IKF A;  3S3N A;  2UVF A;  3GVJ A;  4XNF A;  1JI8 A;  4B3F X;  4E7Z A;  2IS2 A;  4XQF A;  3I3L A;  3E0J B;  3L2V A;  4KJZ A;  2E5Z A;  2HVR A;  4W8R A;  2UUZ A;  4CH7 A;  3L2R A;  2WY8 Q;  1V5E A;  2PYG A;  3RTR A;  3OR2 C;  3EQN A;  3ZCO A;  2IQ7 A;  2CUJ A;  2K9M A;  5KCM A;  4FAS D;  2L9S A;  3HPH A;  2D3N A;  3D5R C;  2ZZQ A;  4LIU A;  2X53 S;  3CF2 A;  2R7R A;  4HRI A;  3BG6 A;  2V7Q A;  3VMW A;  2CW8 A;  2CV0 A;  2QX3 A;  1P9Q C;  2CUZ A;  2XZP A;  2F43 A;  2OC6 A;  3K4B A;  3HXL A;  4NC8 A;  1VF7 A;  2O17 A;  4XOR A;  3K4N A;  3BCD A;  4KKT A;  4BAC A;  2V4D A;  1G8X A;  4N4O B;  3SEQ A;  4UZU A;  2NT6 A;  4HNU A;  4TT3 A;  3RQ4 A;  4XLH A;  3H5A A;  4DBQ A;  3OYL A;  2CS3 A;  4RLQ A;  5FL7 A;  2O0V A;  2V9K A;  4RM2 A;  3LFU A;  3IAS 2;  3A4C A;  4XD7 A;  4HEA 2;  4AVZ A;  3DU5 A;  5CKT A;  4GRI A;  2PJR B;  4ZDP A;  4TKO B;  3EQO A;  4KIS A;  3G05 A;  2GOM A;  3F9K A;  4CZC A;  3DKY A;  2R9V A;  3KYL A;  3RPU D;  1WJC A;  4CA0 A;  1DGW Y;  2LBF B;  1UD3 A;  2GK6 A;  2JA2 A;  4MXN A;  1X19 A;  2NTP A;  3VYR B;  4BS9 A;  1X0C A;  2X1E A;  2RNG A;  4BQO A;  4ANJ A;  4YZQ A;  1OR7 C;  2CH0 A;  3D5L A;  1RU4 A;  3OPO A;  2MYS A;  2WZP P;  2VQC A;  4EAT A;  2WY7 Q;  2XND A;  4JMQ A;  4KKU A;  2VIX A;  1AIR A;  4C2L A;  1O8F A;  1BR1 A;  5LD2 C;  3JUR A;  2X6W A;  2CV2 A;  4IQJ A;  1BMF A;  2NOJ B;  2ZSH B;  2XZO A;  3MD2 A;  1PXZ A;  3DWL E;  4XOP A;  1LFP A;  2O1D A;  3S3M A;  1WJA A;  3UW0 A;  2ZZG A;  3DPT A;  3OYI A;  1KMH A;  3A3B A;  4H4K C;  3OEH A;  2NTB A;  4XON A;  3DPL C;  1BR4 A;  1ERD A;  3LSG A;  1O8E A;  3LL7 A;  1NRK A;  4C2T A;  2WB1 A;  1QHH D;  3IAM 2;  2RQQ A;  2X3H A;  3GVK A;  4CCM A;  1N78 A;  2KP6 A;  2X85 A;  4W8Q A;  1LKX A;  3DQV C;  3BCA A;  2BW3 A;  3PNY A;  2INU A;  2Y0S A;  1D0X A;  3DTK A;  3DLA A;  4I84 A;  3G2B A;  2AQE A;  3M8J A;  3SDB A;  4XLE A;  3VYT B;  3EUK L;  3GRH A;  1RMG A;  2ELJ A;  1X1B A;  3OYE A;  3FPP A;  2L5Q A;  2V6E A;  3WWG A;  3NWS A;  4XLF A;  3OYH A;  3WQZ A;  3VR6 A;  1O88 A;  4ZC3 A;  2QXZ A;  1DGR M;  2HPI A;  3HUG B;  4LIV A;  2WAE A;  3OS1 A;  4CCO A;  2VJ5 A;  4OAY A;  2L7K A;  3C2G A;  4RM3 A;  1MND A;  5KHD A;  3A2K A;  3HL2 A;  2AQF A;  4F52 A;  2KMU A;  1IDJ A;  2VXZ A;  3W2V A;  3MKW B;  4XR6 A;  1Z21 A;  2WSS A;  3I9V 2;  1Z3X A;  3K4L A;  1OHH A;  3B8Y A;  3OIQ A;  3PNV A;  2VBE A;  4JOM A;  2VKH A;  4CCK A;  4XN0 A;  1WJB A;  3OL4 A;  3QYF A;  3OS2 A;  4YZX A;  1Z3Y A;  4II3 A;  4PJL A;  2NT9 A;  4PSX A;  2MC4 A;  2VJJ A;  2HVQ A;  4ZTJ A;  2BSP A;  1KTW A;  2XDV A;  3PL8 A;  4NQW B;  1DQU A;  2VBM A;  4HSR A;  2XF6 A;  4BXF A;  1IA5 A;  1HZE A;  3VDX A;  4ZDO A;  2R7Q A;  3S3O A;  4BE1 A;  1CZF A;  4U49 A;  2VJ4 A;  5HNF A;  3ZIA A;  2EWE A;  1MNE A;  2KQR A;  3UR3 C;  1K5C A;  2HDW A;  4OAZ A;  3VSL A;  4DNT B;  1SAU A;  2E5N A;  4ITV A;  4E7L A;  3ONQ A;  2XOK A;  2VPL A;  2JJ1 A;  2X1C A;  1O8L A;  1PJR A;  4II2 A;  2IS6 A;  3LMW A;  2LC2 A;  3CJR B;  1UD4 A;  3K70 D;  2HPM A;  1MMA A;  1E3X A;  4Y33 A;  3FDY A;  4E4H A;  4YRV A;  1VJS A;  1BR2 A;  4MR0 A;  4YZA A;  2Z1D A;  3PUB A;  1EFR A;  2DIE A;  2KVO A;  4QPQ A;  4J01 A;  3ZXS A;  2QY1 A;  2UV1 A;  1I8D A;  1KZL A;  3DKX A;  3W2A A;  2GOX B;  1D0Y A;  1EA3 A;  2FUG 2;  4XKC A;  1T5E A;  4AYB A;  3H9J A;  1PLU A;  3B90 A;  2LY1 A;  2KRC A;  2VB6 A;  4HST A;  3OYK A;  2CV1 A;  5HLT A;  3PFY A;  3AL0 B;  2NTQ A;  4BDZ A;  2LH9 A;  3IP4 B;  2DT7 B;  1FMV A;  3A1Y A;  4B44 A;  3DTI A;  4BQN A;  1W36 D;  3DDY A;  3TBI A;  4DBR A;  5HNH A;  3OOC A;  1MMD A;  2O04 A;  2VKD A;  4PSW A;  2KDO A;  4E7H A;  3PJR A;  1OB0 A;  4FXU A;  4XL9 A;  3HAG A;  3BC8 A;  1GQ8 A;  3DPU A;  2HVS A;  1YE9 A;  2W82 A;  3H9Q A;  4XOT A;  1QJV A;  4OJ6 A;  1BOB A;  3BG7 A;  3H35 A;  3DU6 A;  2K9L A;  2LBF A;  1V0F A;  3CJQ B;  3DTE A;  4TSF A;  1KCC A;  2JVH A;  4BJT A;  1E1R A;  4YEJ A;  4PJM A;  1W0K A;  4PJJ A;  2E1M B;  1E43 A;  4BJ6 C;  1NHC A;  3OS0 A;  1YX3 A;  2E60 A;  1QU3 A;  1HA8 A;  1U0J A;  1COW A;  3LMM A;  2V31 A;  1LVK A;  2HZD A;  3OIP A;  3QOE A;  3W2W A;  1MMN A;  3EUH C;  3K4K A;  4E7J A;  4PMH A;  2ZTN A;  3N05 A;  3A35 A;  3B4N A;  4DIQ A;  3LSH A;  4E0F A;  2O5R A;  1QHG A;  3FHN A;  1UEL B;  1W36 C;  3GQB A;  4DNR B;  2XSJ C;  4F92 B;  2DCE A;  5CPR B;  3OL3 A;  4OJO A;  2R7U A;  3OYD A;  4MLO A;  3OYG A;  1BPL A;  4G7W A;  2VAS A;  3KX2 A;  5TGT A;  3GQ8 A;  4PJN A;  2CFO A;  3OYN A;  2DT6 A;  1DBG A;  2ODL A;  2XZL A;  1TT0 A;  1XG2 A;  3FKJ A;  2ZZE A;  3FY3 A;  4Y3O A;  3J7A Y;  4OJL A;  3HG9 A;  5HKK A;  4IQ4 A;  4NC7 A;  5IK2 A;  2KHM A;  2KL4 A;  3OYF A;  1OGM X;  1RWR A;  2VQG A;  4Y4R A;  3PSF A;  2WJY A;  1WJE A;  1OFM A;  3EUA A;  3E1S A;  4DOZ A;  4F93 B;  4J00 A;  2XGJ A;  4BEH B;  2D3L A;  1JTA A;  1EE6 A;  3OAA A;  2XF7 A;  1BLI A;  2JDI A;  2LZJ A;  2V7F A;  3ZRG A;  2OV7 A;  3H9G A;  5DN6 A;  4U4B A;  4G6T B;  4JQF A;  2QKM B;  4BUP A;  4CCL A;  4NK8 A;  1MMG A;  3CZ6 A;  1HVX A;  4OJ5 A;  3SYT A;  3QOD A;  3KEW A;  3VST A;  2WA0 A;  3UNG C;  4DK1 A;  5HOO A;  3ZPN A;  3OOU A;  2M7A A;  4F91 B;  1D1A A;  2R7X A;  2ZTG A;  2F5V A;  1W9X A;  3BH4 A;  1K6Y A;  2K5C A;  3LSK A;  2P0W A;  3NWT A;  3GQ7 A;  4XKB A;  3EPZ A;  5CDF A;  1WPC A;  4ZTF A;  4PFP A;  2W4S A;  2OUM A;  3S32 A;  4F3Q A;  2CW7 A;  2BVM A;  4G6I A;  4HIZ A;  1WFX A;  3OR1 C;  3OE7 A;  4Z03 A;  3RCO A;  4AU7 A;  1H8H A;  1PYV A;  4RMN A;  5C1E A;  2MAB A;  3S93 A;  3QYB A;  3RSN A;  1G59 A;  3L2W A;  2BW3 B;  4B47 A;  4E7S A;  2HQA A;  2L2O A;  2R7O A;  3CP2 A;  4W8T A;  2LYC A;  2V1N A;  4DGW B;  4PK4 A;  3VWB A;  2JVG A;  2KZV A;  1BN8 A;  1OOC A;  1X1A A;  2PMZ A;  2ZFU A;  2Z8G A;  1W0J A;  1WJD A;  1WP6 A;  2NST A;  2Z6B D;  1IDK A;  1HG8 A;  4URR A;  2HU9 A;  3S8P A;  5FRM A;  3L2Q A;  2NZM A;  3GVL A;  3V42 A;  2UVE A;  4ZDL A;  1S9H A;  4BQQ A;  3OYJ A;  2QE7 A;  2VL8 A;  4HNT A;  1V0E A;  3AFH A;  1O8D A;  2Z16 A;  3LSM A;  4BDY A;  4XLA A;  2A6T A;  2JJ2 A;  2MD0 A;  1UAA A;  3VYS B;  4CUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...