4XMYA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
599
structure length
599
Chain Sequence
b'PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 235
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xmyA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xmyA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xmyA02
4Z05A 1O8MA 4MXNA 1O8EA 2VJJA 2VBMA 1XG2A 4OJOA 3GQ8A 3GQ9A 3GQAA 2INVA 4XLAA 4Z03A 2VBEA 4XKWA 3ZPPA 2PYHA 2Z8GA 2QX3A 1AIRA 3VMVA 4URRA 4YZAA 4U4BA 1IA5A 3T9GA 4YZXA 2NZMA 5C1CA 2NT6A 3EQOA 2NSTA 3LMWA 2O0WA 2QXZA 2O04A 1VBLA 3KRGA 4NK6A 2PECA 1GQ8A 2ODLA 5AMVA 4Z06A 2NSPA 1RWRA 1K5CA 4XONA 4XL9A 1WMRA 1IDKA 2O17A 3WWGA 1KCDA 4OJLA 2VJIA 4OZYA 1DBOA 3VSVA 4HWVA 1CZFA 2X85A 4W8QA 4XR6A 4PMHA 4I84A 1RMGA 2QY1A 4C2LA 4XQFA 1NHCA 1O8IA 2INUA 4W8RA 4XLEA 1KTWA 1OFMA 3SUCA 4XNFA 3JURA 4W8TA 1DBGA 3EQNA 1H80A 2X6YA 1OGMX 1OFLA 4OZZA 3GRHA 1QJVA 1JRGA 1QCXA 4XMYA 2NTPA 4YZQA 4YZ0A 1OOCA 2UVEA 1IB4A 3ZSCA 4XN3A 4AVZA 2NTBA 4YEJA 1O88A 4XORA 1OGOX 1PLUA 4OJ6A 3B90A 2O1DA 4XOPA 2VBKA 3B4NA 4XLHA 1PE9A 2IQ7A 4XM3A 4XKVA 4XLFA 1O8FA 1HG8A 2UVFA 1KCCA 3VMWA 3VSUA 2X3HA 4OJPA 1O8HA 4NK8A 4W8SA 4MR0A 1EE6A 1RU4A 1BHEA 4YELA 3GQ7A 4XN0A 4XOTA 1O8JA 4XLCA 1IDJA 1O8LA 2NT9A 4OJ5A 2X6WA 1O8KA 3FY3A 2O0VA 1X0CA 1JTAA 3VSTA 5C1EA 2BSPA 3B8YA 1PXZA 2PYGA 4EW9A 1O8DA 4U49A 2NTQA 3UW0A 1BN8A 1O8GA 2EWEA 2X6XA
chains in the Genus database with same CATH superfamily
2VKVA 2IGOA 4PCQA 1IZ1A 1G6NA 3CCRI 1IJWC 2LF8A 4HDVA 2LBFA 1DPRA 1ZR2A 1RIOH 1TWAJ 2VBMA 4OJOA 3TH0A 3PO3J 2L9VA 3I71A 4MHGA 3ONQA 2ZMEA 5CVJA 1ZM4A 2Q6KA 4P22A 3GUDA 2FOWA 4D7NA 5IP9J 3COAC 1XSXA 3BG5A 5EZHA 3L2QA 3H0DA 1Y0YA 3HC7A 3CCQB 2NSTA 1VQ6B 3AVWA 1CF7A 4BHPA 1IN4A 1PJ6A 1FBSA 2V7FA 2BXYA 2K85A 1T98A 1YE9A 4R71A 3FK6A 2EIXA 1QFJA 2JA2A 2HQRA 4KKUA 3CDHA 3FX3A 2CW8A 3DV8A 5K5QA 2VL8A 1XSVA 2DO7A 3FKSA 2V1DA 1ZM3A 3JQRA 1MMGA 2KKOA 3O6BB 3FMQA 3IWZA 3QRFF 3S15J 4Q7JB 5C4XJ 4RGRA 4Z4VA 1VQ8I 4CZZA 2HDNB 1TT0A 3LSHA 3MQ0A 3JAMZ 2DFEA 1IXCA 3CP8A 3SDGA 1U5TC 2STWA 4QFMA 3AVXA 4E7KA 1D1BA 5EJCA 1HOMA 4A3EJ 2Z5UA 3RIQA 2DMPA 3EQNA 3RQIA 1Y6IA 1E17A 1EFCA 4PABA 1U8RA 1TSPA 1E3OC 3S17J 4R79A 1MKMA 1H89C 1EV7A 2VPRA 3D0SA 3L1PA 4N3GA 4I01A 2ZSIB 1IW7F 3JX8A 3P4GA 4XORA 2DTZA 2XROA 4R8HA 4DK0A 4LLNA 3HM5A 1ON2A 3MCAA 1EWYA 1MSFC 3V76A 2XGXA 1VTNC 2VI6A 4XLHA 1G2HA 5B5EC 1ZH5A 3PVDA 2BW3B 1QA6A 1BI2A 3LWFA 4M9XA 2RKHA 4S04A 4MTDA 1KTVA 3BQJA 5F4OA 1ZAOA 4XICA 1MMSA 3BCBA 2V4DA 1Z77A 2JA7J 3FHNA 3HJEA 4GRIA 1UHMA 4AC9A 1BJAA 3H5NA 2TCTA 4HLXA 4F92B 1P7IA 2R9VA 4BDZA 1BW5A 4HX8A 2KQRA 2BEOA 3SZPA 4P9FA 1XQBA 2Y0SN 4L5JA 2Z9OA 2KMUA 1B9MA 1LVKA 1QHGA 4M3EA 3AVTA 1QGPA 1SFXA 3F8FA 1RR7A 1VQNB 1PXZA 5L3GA 5FLXZ 3OR1C 1VQ5I 1SFOJ 2O5RA 2J8KA 3F21A 2K3PA 3GBGA 4D5CA 3OZUA 4IPAA 4XRFA 1VF7A 1X3ZB 4RA2A 4A2UA 3K4LA 1X19A 3JRFA 4Z05A 3CUQC 3WTXC 1VFCA 4Y7NJ 1LE8A 3KEWA 4WWCA 4LBYA 5IYWA 4ENMA 3GQ8A 1GUUA 3QYEA 3CCSB 3HRMA 3D5RC 3HYIA 1SEUA 1TTTA 2H1LA 2EIKH 1XGMA 2F5CA 1YHQI 4I76A 2DU9A 3FMSA 4C2TA 1HKSA 3PETA 4ZZLA 4WZTA 3E1SA 2VBEA 2R5YA 2Z99A 2F1MA 1TW3A 4QV2A 2K02A 4PC2A 3CCUI 1ZREA 3FIWA 3KFWX 1PVEA 4DQ2A 3IRRA 4DNRB 5CQGA 1K6OA 4P1VA 4ZCLA 2O0WA 1KQ5A 2QF7A 4O5VA 1MGTA 2NSPA 2W4SA 1AOYA 3RYRA 1V3FA 2ADUA 3S2DJ 3GZNB 2LR8A 3HKZN 2CUZA 1CGPA 1UZCA 3BP8A 4G9YA 2VJIA 4QUZA 3EETA 3ZMSA 3AVVA 4ZZDA 2ZZFA 2KT0A 5LEJA 4MGRA 4HSRA 4RDKA 3J80Z 1IN8A 3F6VA 4HNTA 3LNQA 2R7OA 3Q0WA 3R6JA 3I0TA 4G6DA 1K4TA 3QFSA 1XC5A 2IGKA 3OW7A 3SJMA 1H0MA 1KK3A 1QX4A 3HL2A 2KL4A 3JR9A 2DJIA 4IZZA 2X9DA 1E0EA 2ZTGA 1ZUNB 2R7RA 4IL6C 1VQPI 1AHDP 1HCRA 4TMWA 2ZXWH 4BHBA 2DY1A 2X0KA 2H94A 4IF4A 2PFBA 4XKBA 3CJRB 4XLNF 4NBSA 5B6IA 1VI0A 3CRZA 1W34A 1SKQA 1YS6A 4IOCF 1XGNA 1TWHJ 2DFIA 4HF2A 3CCJB 3I1FA 4KICA 3SLDA 1N0VC 1ETOA 2E34A 1LKXA 3KP5A 3DFGA 2LD5A 3CMAB 4M71A 1QZEA 4PGHA 1TYVA 1MBKA 2C5BA 4RGUA 1I6XA 4C2MJ 3ELKA 3X2QH 1YIOA 1WOOA 1KA8A 1U2WA 2OYNA 2V9VA 3T8RA 3T56B 1X1CA 4XRSA 1R4NB 1BC8C 1QRBA 4M9SA 2PJPA 2PMDA 2EB7A 3A8IA 3PIOF 4ACBA 1IRXA 2E1CA 3IKVA 1Q1HA 3PQKA 1HKTA 4TSFA 4ZDOA 2Z2SB 4JP0A 1RU4A 3QYBA 4AD9A 3H0GJ 2CQNA 1YRNA 2Y48A 1QPMA 1D1AA 3U1DA 1QZYA 1R1VA 2DTRA 3E6BA 5E6TA 4G7XA 2XAGA 2GBYA 2AS5F 4FE4A 4BEHB 2FMYA 4L5IA 3A1PA 2BY1A 3DTKA 5KHDA 1IJFA 2C77A 2R0QC 4YAOA 5FO1A 2PYGA 2BY0A 2OQRA 3F8BA 3QP5A 4Y7CA 1QA3A 3BJOA 1VQOB 2CW0F 3WY9A 4BBSJ 4NCNA 4HOBA 1L3LA 3QPHA 3W6KB 2Q6OA 2BX6A 1YFHA 4J0QA 4PSXA 1YJNB 3HRSA 4Z4YA 2JQ7A 2CJJA 5GTIC 4BHCA 3M3YJ 4IHVA 4N3NA 3V8LA 5THXA 4B4DA 4JK1X 1DARA 3I4PA 1Z7UA 2JRTA 1DDNA 3EUAA 4U87A 2MG4A 3HOXJ 4M3DA 3BWGA 1RQPA 3G05A 2QWWA 1F20A 1LFPA 1K78B 3OWTA 1EP1B 3M7GA 4WK8F 3H9NA 4XKWA 2HXIA 2P81A 1OYYA 1R71A 2ETHA 3RKXA 1AIRA 1NK3P 3QSYA 4GYGA 4YAFA 1OR7C 5DN6A 3K4KA 1ZG1A 2YU3A 1S6LA 4HPQA 4PGGA 3WGGA 2QQ9A 4G12A 3AG3H 5TISC 4F93B 3F6OA 2O04A 4XLPF 2P5VA 5JR3A 1B6AA 1MBJA 5E8IA 2D1HA 4GO1A 1L0OC 3I64A 2B0LA 2X0LA 3M8EA 1YJWI 4A3BJ 4CZCA 1BQEA 5DUKA 1R6RA 1TLHB 2JUCA 2PG4A 3ASOH 4P96A 5FKLA 3V7RA 5H59A 5DYMA 5TJJA 4G6TB 2CQKA 1U5TB 2GWRA 2X1DA 2VOOA 2DOFA 1D8KA 2MYSA 2MD0A 2YR2A 4ON0A 4QVAA 4RM2A 3S1QJ 1CQXA 1N05A 4HDUA 2TDXA 3KP4A 3E1YE 5FA6A 4E7ZA 3GQAA 3R61A 4PJNA 2B7CA 3I4NJ 4O3MA 1OFDA 3CCMI 2WR8A 1FMWA 4A3FJ 1UJ8A 3U2QA 2K9QA 3N6ZA 5DTDA 1UD5A 2QYOA 3DLAA 2V26A 3N97A 2WAFA 1EA0A 1W36C 2KIMA 2IEKA 2C2WA 5JLXA 3J81K 3AG2H 2KP6A 4I6ZA 2NPFA 4BU2A 2P5LC 4AVZA 1FTTA 3B82A 4E6KG 2K4JA 1BW6A 1W5SA 2GIZA 2IVMA 1EFRA 3CPXA 3HOWJ 4RLFA 4LG0B 2WWYA 2EZKA 4RM0A 3W2FA 2YS9A 4L9JA 1E3XA 3ASTA 1SC7A 3Q5FA 4GFBA 1GVDA 2A6EF 4HW0A 5FJ8J 2KPMA 3LAJA 2L0KA 2JSCA 4DNCA 1G7TA 4A69C 1ETQA 3A03A 2UVFA 1VF9A 5LRRA 4Y52J 3OJXA 1IDZA 3G73A 1Q9SA 2WADA 1MBGA 5DM7F 3VSUA 3I4MJ 3ZMTA 2CV2A 3K4BA 3U9GA 2GREA 3W2EA 3P5JA 2QEXI 2Q8KA 4UB6C 2VONA 1GJRA 4K2EA 3DP7A 3H3ZA 4YELA 3IL2A 2GXAA 1KK0A 3WG7H 3E6MA 4M1KA 4WZLA 2CC2A 5ILSA 2YUSA 5KSWB 4OWRB 2ZBKA 4EJOA 4CQJA 2DK5A 5HVQC 2QTZA 2CNDA 1E1RA 4EMSA 2NS8A 1ZR4A 2CV0A 1Q86D 3VSTA 3CUQB 3PNVA 3IH3A 1K6YA 1H8EA 1COWA 5EMNA 1O8DA 3SHFA 2AQFA 3BR6A 2VXZA 5K7HA 1WSUA 2D3NA 3BZCA 1FIAA 1KYWA 2ZXHA 4NC8A 1IRZA 1XFOA 5FIUA 1ZGAA 5IYQA 3CCRB 5FD5A 4NQWB 3WODF 1KU7A 3QU3A 3HG9A 1MMNA 3ISXA 1W5CC 5IOYA 1JNYA 4FT8A 2HMAA 1O8MA 4M3FA 4F7DA 3D26A 2WA0A 3MMYB 1KU9A 2WTEA 4X7EA 2BM6A 2W6IA 1JGGA 2ZJQF 3RKWA 1B72B 2NNNA 1DGRM 1OHHA 4Q5SF 3JQPA 4Z03A 3TP3A 3VYTB 2OAZA 4EVIA 1QGAA 1HDDC 3VMVA 2O8XA 2M1BA 4WXDA 2PE3A 1DU0A 4YZXA 1X3WB 4EJVA 2CFOA 3WTVC 2R92J 4FN5A 1YQAA 1FNDA 3OMYA 4IRGA 4TMXA 5D5XB 5HLIA 1RETA 4DYRA 4GQNA 2F5EA 1K5CA 1QBJA 1HW5A 1NHAA 3H9QA 3ZMUA 3JRBA 2L5QA 2X8KA 4KYWA 4OPSA 3ZZUA 1IN5A 1H9TA 3KYDB 1W36D 1H8AC 2KLOA 4Y17A 3GTPJ 2BVNA 1UD6A 1VQ9I 3VSVA 3GVAA 1S4MA 1VQLI 2HYFA 1VQ8B 4N9IA 3T5XA 4RDUA 2J5OA 4RJLA 1LFBA 1YO5C 5L3DA 2VJ5A 3ZPNA 1HA8A 2M4GA 2BM4A 3NARA 3MEXA 3L2VA 3CMEI 2FQ3A 2JVHA 5AONA 4G1BA 1BLIA 1K4ZA 4B4CA 2P8TA 4HRIA 1T8IA 1FEXA 2M30A 3A0HC 2XNJA 2X48A 4HQEA 1BI1A 2FJ1A 3TOBA 2UWMA 4FETA 5F1JA 4EGYA 2DOGA 2OU2A 2O7OA 1K61A 2XV4S 4Y3OA 1YOVB 3AGQA 4KA4A 2XGEA 4H4KC 1MJAA 2XC7A 1XD7A 3LQQA 2DPDA 3I55B 3BPVA 3G6EI 1N25A 3HOUJ 2ZMEC 4HIZA 4MEYF 1MNEA 3WBJA 2DT5A 4M3GA 4M73A 2HOSA 1YG2A 2QVOA 1OGIA 1DDIA 2BGIA 2ME0A 2V4JC 4BXUA 3GFLA 1VZ0A 2FD5A 1ENHA 2ZJRF 5BOXA 4W1UA 2GQFA 3GTQJ 2EFPA 3M4OJ 4P2NA 3VYSB 2HQAA 4I09A 1JJ6C 2PJRB 1Q81D 3MFKA 5EG0A 3ZQQA 2IBDA 1XB2A 5DEQA 5E3MA 5L3EA 5GAEJ 3HIFA 1K8AD 4WWVA 2XRNA 4ASNA 1FNMA 2G9WA 1TZLA 2K4BA 3G3ZA 3GQ7A 1I1GA 4ZYEA 1O8JA 4XRMA 3W3CA 4GDFA 5J40A 1VQ5B 2CMPA 2WYRA 5B3SH 3H9GA 4JOMA 2DI3A 4EM0B 2O3FA 1V4RA 3FBIB 3K4NA 4G7WA 3SJZA 3ONYA 3HOSA 4JMQA 2L2OA 3F22A 4C2UA 5IP7J 2UUZA 1GR1A 3TGNA 3UW0A 4Q48A 1IXRC 1Z3YA 1FWZA 2VC0A 1YX5A 1UAAA 5CVUA 1MNMC 2OJED 3L2UA 2ZSHB 2X1CA 5BNGA 2H8RA 2R7SA 1YHQB 2R5ZB 2ZZEA 3HPHA 1ZGWA 4A3DJ 2MBFA 4IOAF 5GAGJ 1W4MA 2FF4A 2QDXA 2HPIA 3G1LA 3H92A 3P9CA 2V7VA 3CCUB 3D1NI 4ENNA 3ZPPA 3DLLF 5E3NA 1O3SA 1N07A 2KJBA 3K4MA 2K9SA 4B3GA 3QWLA 1H85A 2ID6A 2GXGA 3WNDA 1UD2A 2RNGA 1VQ4I 1KJZA 2VOPA 5H5JA 3ZQGA 3KRGA 3OE7A 2RV8A 2KFDA 5AMVA 3MN2A 4X7CA 1ZG3A 4MNUA 3VMFA 3H3VK 1WMRA 2DT6A 3K1MA 4G6QA 1R5BA 2JZYA 2XSJC 2R3SA 3LNNA 1S8NA 4OZYA 1DBOA 2E1RA 6PAXA 2Y9ZA 1YJ9I 3WGIA 4RB0A 4M3BA 4XR6A 3RKQA 4PMHA 1XN7A 4YHBA 4BQQA 2BM1A 1HA3A 4M4SA 5IYBJ 1BJKA 2JN9A 3DQVC 1WORA 3CQZJ 2FUG2 2EBIA 4OM9A 1ONVA 1S3JA 2M34A 2XB0X 2QBYB 4FK8A 4IVNA 5DS9A 4HE5A 1VQPB 4B1RA 5HDKA 1TBXA 2V9PA 1R49A 4CXFA 1K4SA 1RESA 2L7ZA 2FA5A 1XS9A 2NVXJ 3W2VA 4P26A 1H88C 4RGSA 2PLYA 1IGNA 2D1VA 1GV5A 1MDMA 3DKXA 4PC6A 1FSEA 3BG9A 3BY1A 1BR1A 3I5UA 4RDLA 2VQLA 4B3XA 1OFLA 2E35A 1PDNC 4RD4A 1D0XA 1JJ2B 2JJ2A 3DWLE 4LLLA 5M3FJ 1DG1G 1J9ZA 3OS1A 2NTBA 2L54A 3SFZA 1B1BA 4DIQA 3WTWC 3CJTB 3E5QA 3VYUB 4YFKF 1OGOX 1PLUA 4U88A 4L9VA 4OJ6A 3ZQ7A 1TNSA 4FWTA 1GVHA 4EATA 3SXYA 3IUOA 5CVIA 4OPOA 2X53S 2WZPP 3ZQIA 4S05A 2ZJ2A 3PUFA 5ICEA 1R1TA 2KRCA 2HZDA 1BPLA 2VBVA 1J9IA 1TT5B 1S72I 3LAPA 4AVPA 4Y13A 2XGCA 2JA6J 3R6KA 3V42A 4U9UA 2BYVE 5GPCA 1QA2A 5CLSA 4TMVA 3OY9A 4OJPA 2PEXA 1FYMA 3FXLA 5LGTA 5HODA 2GZWA 2N8GA 4H9GA 4P3YA 2LKSA 4U7DA 3V4GA 2BBYA 1VLOA 3GVLA 4C9YA 2IAIA 2M8GX 3DPTA 4IRHA 1D2EA 2MA3A 3FY3A 1X0CA 3TQNA 4QWQA 3NEUA 4P12A 1NDHA 3B8YA 4A0ZA 4BL0B 4DK1A 2J5PA 1IRFA 1ELOA 3FXUA 5JHFA 1FC3A 5DCMA 1M1EB 4TN1A 2RAEA 3T51B 2JWTA 3RYPA 2A5WA 1MJ9A 1MBFA 4R1HA 1DQUA 5BPDA 1JKPC 5IT9K 3Q6RA 1T6XA 2LSOA 1IAWA 2EA4A 3DDYA 1P2FA 1G3WA 4OIPF 3L2RA 3AG4H 2BGCA 5HZAA 1R1UA 2P6SA 3I59B 2H1KA 1NBMA 2K86A 1ORKA 5FO0A 2A05A 5GP9A 3C2GA 4YZAA 4YC5A 3L09A 1RZ4A 1Z1DA 2OTLI 3PNTA 1JE8A 2E71A 1BOBA 3KE2A 4LMYA 3BTLA 5D5VB 1YJWB 4FTHA 4C0SA 1W0TA 2ESNA 1KU2A 3KEQA 3O3KA 1EFUA 5FKOA 1WWXA 2DQLA 2EIJH 5KK1A 1G8XA 4B47A 3IH4A 2VLAA 2WPDA 2O17A 1R5ID 2EQRA 1AWCA 2ZFUA 4YIFA 1A6QA 3LA3A 3FK7A 2D45A 2DA5A 3ECOA 2HNHA 4V2FA 3MKWB 4E70A 1OB0A 1P92A 1W2BB 1FX0A 2VQGA 1RMGA 1WFXA 1QQIA 2CWEA 1WHUA 3SY2A 3CCMB 2BHYA 3BT9A 2LBFB 3GTOJ 1JTYA 3K6GA 2Q6LA 2CBXA 4UXNA 4FASD 4BJ5C 2GA2A 1PYVA 4LC0A 1UMKA 3AGPA 2AXLA 3CC4I 4CYCA 4NHJA 4IHSA 2IGNA 1GHCA 3MAJA 3NWTA 1ZGJA 4K1XA 1W35A 1K83J 1BR2A 2HI3A 3O8GA 4MTEA 3SYTA 2O8KA 3ZZ0A 5AIQA 1FOKA 2BVLA 2DYRH 1OGMX 3ZQLA 3GLLA 1OCCH 5FROA 4LIUA 2CQXA 4RS8A 4BJTA 1YIJB 4AIJA 1CF7B 2F1LA 2F48A 2MLKA 5CDFA 2HS5A 1G59A 4CSWA 1A35A 5J3LA 4FCYA 2QN6A 5A8AA 1XB4A 5DD8A 1D8TA 4RD2A 1X58A 5HKKA 3ZZTA 3B90A 5B1BH 2HOTA 2XEXA 3FXKA 1S0UA 3H1CA 2QM3A 3TO7A 3BDDA 3DCFA 2RQPA 2LY2A 1IUFA 2DDBA 4WXHA 2ZZQA 1Z9CA 1FOWA 2QEXB 3OKXA 2DERA 2IT0A 3T8TA 1ZN2A 1ZLKA 1I27A 4C3IJ 2EFNA 1T38A 4NC6A 5HLHA 2VKHA 3MZ8A 4P55A 2HVRA 3J7YJ 2HQ5A 2FX0A 4X8IA 1S7AA 4HF0A 1MBHA 1ZK8A 2EILH 3A8KA 3BCFA 1BHEA 2K9MA 2AHQA 1ETYA 4XOTA 2R7FA 4DBRA 3A01A 2E1BA 4ZDLA 1UHWA 2NT9A 2OZUA 2ISYA 2OPTA 3PM1A 1G7SA 4FXUA 4QIWN 2MH2A 3GLXA 4AIHA 4CCJA 3L00A 2ACJA 3LOCA 4A12A 2F5DA 2RC4A 1XGSA 1BA5A 5A89A 2HGCA 2F2EA 3IV5A 4M2LA 1ITYA 3ZOBA 2ZL7A 5TR9A 3OYEA 2XSDC 3KLNA 5TGTA 3IH2A 4DZJA 1HF0A 3CF2A 3E97A 4LD5A 4IHYA 5A2QK 2BV6A 3ULQB 1R23A 2R7VA 5FLXK 1OFEA 3JCUC 1GXPA 3PUBA 5F0FA 2VFNA 1O7FA 3FISA 2QYUA 2PMUA 4PFPA 2VNKA 1SKYB 2PBIA 2XTXA 5ILVA 2NNYA 4Z4RA 3DEEA 3LYCA 2EFGA 1ZHFA 4Y9RA 1XMAA 2CRGA 3ZUGA 2V7UA 2G0EA 1FNCA 3LFUA 5M3MJ 1MH3A 2ZNZA 2PX9A 3M1CA 1F43A 2WZNA 4YIRX 2OCCH 2RREA 3ZMDA 2J8IA 3DF8A 3SJPA 2OV7A 4KIBA 3JQQA 2Q0OA 4PJ0C 5DDGA 4OOSA 2JDIA 3BR1A 4NK6A 3H94A 4IHXA 3PENA 3A3GA 3RI4A 5IYNA 3GXOA 3NAWA 4RAFA 3ABKH 3C1DA 3TKYA 2KRHA 4ENJA 1IB0A 2VBUA 5H6RA 1VQ9B 1UB9A 3PFYA 1IDKA 1VQLB 2ECCA 4L9NA 3HEFA 4MQVA 1FOXA 4UY8I 3DPLC 2M0CA 3VWBA 2DMQA 4HX7A 4CCMA 4KITB 4P25A 1E62A 3CMEB 1YYVA 3KEOA 1KD1D 3B73A 1JUPA 5F04A 2F3LA 1Z21A 1RPWA 1LE8B 2WSSA 3S8PA 1JGSA 3JSPA 2BM5A 1JUMA 1U9OA 3CUOA 3KX2A 4M0LA 1JHHA 1WJAA 4IXAA 2L3DA 3J80K 2XT2A 2YWFA 2V5IA 3PNYA 2XVCA 4PJMA 4WX9A 2F4NA 2RGVA 3HHHA 2QSHX 2KIFA 2BVMA 3K4CA 5TRDA 1E3PA 2R5YB 3I56I 4A93J 1R5NA 3G6EB 5DS0A 1TYWA 1DABA 1BI3A 3K69A 3LSJA 4L5EA 5F64A 1ZRCA 2WJVA 3RPQA 4EEFG 2XPUA 3CDLA 4D0PA 1SMTA 1U9NA 3FXJA 4HG2A 5D5UB 5FRNA 3GRHA 1ACIA 4A3KJ 1BJZA 2NRAC 2IS4A 2IS2A 2HKOA 3HUGA 3MZYA 3QU6A 9ANTA 1GAWA 4YZ0A 1IB4A 1FYLA 4NC7A 4FX0A 5CYVA 2W57A 4X0GA 3WE2A 2VUMJ 2ZTNA 1LDKB 1TWFJ 1P9QC 1QRCA 5HLGA 1W9XA 1XMKA 2FRHA 2DA3A 2ICWG 5F4MA 2Q1ZB 1SAXA 1X1BA 3S3MA 4XOPA 2BN4A 1R9TJ 3LVBA 2WY7Q 4DQKA 4OIOF 3B4NA 1WJEA 3OYMA 3B78A 1ULYA 4QHYA 1YLFA 5J4VA 3CLQA 2V7WA 1O8FA 2HYJA 5J1YA 5F08A 3JTHA 1HG8A 3GX4X 4ZC3A 3WNCA 1W87A 1LVAA 2PIAA 1KQ0A 1D0YA 3PSSA 3U1KA 4W8SA 2ISZA 2CQ7A 4NUBA 4JRAC 4JQFA 2V1NA 2NVYJ 3LSPA 4WCGA 4XN0A 1YTYA 2JA5J 2W00A 5GV8A 1ZARA 4OJ5A 1U3EM 2JMWA 3I53A 3CXCB 1TYUA 4BBRJ 2OBPA 1IUYA 1U8BA 1VLYA 4G5GA 1F4KA 1F5TA 1F36A 2ZB9A 4LBVA 1SM4A 3W6JB 4B09A 5DD4A 4EW9A 2W24A 3LSMA 2OK8A 4U49A 2XAUA 2A69F 1QZZA 1OFCX 1R4MB 2YX4A 3H5RA 3OOUA 4TV7A 5FKNA 3OOPA 4NB5A 5J6XA 1KQSB 1P4WA 5J1RA 5FGMA 2FBKA 2Q2EA 3S93A 2XUBA 3JRCA 1XG2A 1D8JA 3G71I 3ASPA 4AIDA 3ZP5A 2R6HA 5J47A 4PJJA 4ETSA 3OV8A 3JRIA 1APLC 2GJPA 3ASRA 3HOTA 1B9NA 3S2HJ 1GDTA 2AHOA 4IQ4A 3CCEI 4B3FX 1LNWA 2BXZA 2VT3A 2HDDA 1YW9A 2ZFWA 2GXBA 4YFOA 2VFMA 2DA1A 2NZMA 1QUFA 1YRNB 4DJAA 4HV6A 5C1CA 2VIXA 2YSRA 3V7SA 3OIQA 1QVTA 3RCOA 3BTJA 1OB2A 3JRHA 3EYIA 1RNLA 1GQ8A 2ODLA 4XD7A 4DBQA 4Z06A 3JU4A 2WV0A 2E2HJ 4E7SA 5KVRA 4BEHA 4YEIA 3ZQHA 4QSHA 1EP3B 2NS7A 2ZNYA 2JIZA 3KZYA 1YJ9B 4D1QA 1FRQA 4I99C 1AKHA 1PJRA 2XNDA 4H0EA 1YLOA 2COMA 2KIUA 1ZRDA 4QVJA 1JKQC 3B6AA 3LL7A 2YUHA 3KP7A 3ML3A 4PFOA 2QY1A 4TMTA 2E1OA 5HDGA 2M9HA 4G94A 3BC8A 3PJRA 1VQMI 3F72A 2LF7A 4A0YA 4F91B 2VBTA 1OCOH 1QVFB 2BF4A 3P26A 1T56A 2CSOA 1M1KD 3VSLA 4LK0F 2V7QA 2HOEA 3TDZC 5IPAA 1NG7A 3F9KA 2AQEA 5JHUA 5L3BA 3A3BA 2Z6BD 4PC7A 4LJZF 2B0RA 1XPXA 1QJVA 3E20A 1IRGA 2VNIA 4XK4A 2QQ8A 1JI8A 1LFUP 1OOCA 5H6QA 2UVEA 4OIRF 3ZSCA 2GAUA 3Q0VA 2IRFG 3A0BC 2EPFA 1VHOA 1X2MA 1O88A 1POGA 4BQAA 2E1MC 3BY2A 2XZLA 2EWNA 5KNLA 3E5XA 2DMNA 2W7NA 3FWEA 1S72B 3M8JA 1OISA 1W1WE 2OZ6A 5KAFC 1FMVA 4U0WA 2CO5A 4CCOA 3B8HA 2I5UA 4XM3A 2HR3A 4MEXF 1IN6A 3SZTA 3GYHX 4UUVA 1BOAA 4Y9UA 1KQ8A 1W0UA 1CNEA 4NDLA 1I3QJ 5HLTA 1YX2A 3RIRA 3QOPA 4OOIA 2VPLA 2WY8Q 4ZTFA 4MR0A 3VNUA 1MMDA 1YS7A 4FISA 1W7PA 3TL4X 3ZQCA 4AU7A 1MMAA 4UUSA 4KUMA 1R7JA 2XF6A 1B23P 2X6WA 1I18A 5AN9A 2F4IA 3ABLH 1PJ5A 4I0BA 4JBAA 2K9NA 3BY6A 1MIJA 1DDGA 5JVTA 3HTUA 1HQCA 2L9RA 2ECBA 5IT3A 2VODA 1BX0A 2LG4A 1YI2I 4WZEA 2QZAA 3A02A 4GCVA 3RDIA 1LEAA 4I2OA 1O3TA 3IAS2 4X7FA 1DU6A 2XB5A 1ZLJA 2QSFX 2XF7A 1TQPA 4ZV4A 4HQMA 3T0YA 2GQQA 4Q4ZF 1HW2A 3EQLF 3BH6B 3FXOA 2D2WA 1D1CA 3MKLA 1SD5A 2DA6A 3U6KA 3QFRA 1NK2P 4KISA 3M1EA 2XAFA 2WV1A 1E43A 2OTLB 1HXDA 2EZIA 1Y1WJ 3V8KA 2Q6IA 2A61A 4HAMA 4L18B 3P7NA 2C78A 4BACA 3ESWB 1LB2A 2CF4A 1T6ZA 3VO1A 3W2AA 1F1ZA 2LVSA 2V7XA 2V6EA 1SD4A 1MRZA 3J81Z 4LITA 3DU6A 5EDNA 5EGOA 2BOLA 1J5YA 1WJ5A 4KT5C 3BQYA 3MWMA 4PAAA 2LTPA 2ZL6A 2BE5F 3ZR8X 3WWGA 1JA0A 4EM1A 4B48A 2R7DA 2ZJPF 1KQ9A 1LUJB 2IS1A 1SVOA 2R4GA 1I5ZA 4A3JJ 2GM4A 1JXSA 5CJ9A 1Z91A 1GAQA 1P4AA 5E20A 1RI7A 5BMZA 5HS8A 5FLMJ 3M07A 3BJ6A 3IWFA 2RNJA 1RUOA 4IQJA 3CC4B 4OAYA 4XRSG 1TVCA 3QE2A 5ICCA 1OJLA 1EFTA 1KYZA 2XHKA 2VYQA 4XLEA 4X05A 3DU1X 1USTA 4CGZA 3JURA 4IEJA 1IHMA 1ZM2A 4W97A 4RMNA 1DBGA 3VDXA 4AIKA 3CCSI 5BS6A 5FLVA 4LIVA 1I6HJ 3TDUC 4YDTA 4KT6A 5L3CA 3F3XA 4ZDPA 3HB9A 3ABUA 4B8XA 4UVCA 4DZPA 2C4UA 2F6CA 2VC1A 2W7ZA 3RPUA 5D8KB 1UHSA 1STZA 5LHIA 3VNVA 2XAQA 3OYCA 1K7AA 1MABA 1SAUA 2QTLA 5IOZA 1G7RA 2P0WA 2IGMA 3G1OA 2VQCA 4L0YB 5JLWA 3CF5F 2VASA 2XAHA 2YWGA 2VBKA 2K27A 2DXIA 4ZCIA 4UV8A 5F6FA 1EP2B 2EV0A 4PK4A 2E7WA 3AVUA 5BSXA 1BIAA 4YALA 5LRSA 4BNCA 2QMUA 1SVMA 2WAQA 4RD3A 1J7KA 2KZGA 2AO9A 3C2BA 1X1DA 4BUPA 3CC2I 3GTKJ 1OCRH 3OZWA 4X6AJ 1EE6A 1OKRA 4HF1A 4HA8A 1QO0D 1B59A 2KJCA 5CVVA 4D7MA 3S16J 1T6YA 2WJYA 1K73D 1MW7A 2HLDA 5DM6F 2QQBA 2X4HA 3K4JA 2DIEA 4MYUA 2A5YB 2O0VA 5FNZA 5GTHC 3LSTA 2MLGA 4OU0A 1CLWA 2BSPA 1U78A 1I3AA 2VKEA 3IHUA 3HOYJ 3P27A 5TY0A 1KONA 4KMFA 2NTQA 1WJDA 3BCAA 1Z67A 2M45A 3N90A 5D4SA 1T33A 1O8GA 2MSYA 3VEPA 4PDKA 3AVYA 3CW2A 2BM0A 2O03A 3G4SI 1OLTA 5FL7A 2QKLB 4JYKA 2ZITA 1I1SA 3K1NA 1PJ7A 1PUEE 1WOPA 2CFXA 3ZGKA 1J75A 3QPLA 2XRLA 2M0MA 1MD0A 3KPHA 1MZBA 5EG0B 1W5TA 4HEA2 3C7JA 3LSKA 3WGHA 4XIDA 1Y1VJ 1LM1A 3CB4A 4II3A 2A68F 2K9LA 4BXXJ 4URRA 3T9GA 3BC9A 5F1RA 1LEBA 2JA8J 4MFDA 4PSWA 3HGGA 5ICFA 3KYLA 2LFBA 2JK3A 3TO9A 2DJNA 2DOEA 4FHTA 4A5NA 3NAUA 1X1AA 4Z4ZA 3Q3SA 3QAHA 3JRDA 2QZ8A 3WTYC 2UZKA 1DPUA 1KC8D 2ZXIA 4BQOA 4U0YA 4C3HJ 2UXNA 3E7LA 1XCVA 2DOAA 2JPBA 2OCEA 3NE5B 4Z6YA 1YX3A 5FO5A 1VNDA 5F27A 3DBLB 4ANJA 3U2RA 1J59A 1BC7C 2FE3A 1CZFA 5FD6A 1QFYA 2BPOA 4E7LA 2DQRA 2V1XA 2QUFA 4ZTJA 2MC3A 2XAJA 2P7CB 3W5HA 3H5AA 2VBZA 2LMDA 3DEUA 1G4DA 4W8RA 2G0YA 3I56B 2BHZA 2Z3YA 5HOOA 2JRMA 3LA7A 3NQOA 3PFIA 1NH3A 4CA0A 1S29A 4PGOA 1TLLA 2VQHA 1JA1A 2YX7A 4PC3A 1ETVA 3W2IA 5DNSA 3J7AY 3O2PE 2F4MB 2OQGA 2R7TA 2VNJA 1G7CA 2H6BA 3BTIA 3FDYA 5K5RA 2LKXA 3OSFA 4CDGA 3BLYA 2HEOA 1XE1A 4OMYA 2NTPA 1S7EA 4XN3A 5M5XJ 2XGJA 1W0KA 1R22A 4UNOA 2LZJA 3BNWA 4P9SA 3VO2A 2Y30A 3CZ6A 3OYBA 4DGWB 2HPMA 3GW2A 2ZO4A 3NRVA 4OAZA 1FT9A 4AC0A 3SQVA 2WB1A 4UAJA 1REPC 2Y31A 5IP6A 1KRHA 2M8EA 3QOEA 3OYDA 1WTHD 3PSZA 3K70C 1KCCA 1OMIA 1FTZA 3QFTA 2IXSA 3E6CC 2X3HA 1SFKA 2DFFA 4F3QA 5C44J 4ASUA 2HVSA 1NB0A 4ZYHA 1WJFA 2FU4A 2JPCA 1YJNI 5LGUA 3RZOJ 3ASSA 1RUNA 1O8LA 1MDMB 4KNYA 2VBSA 4RD6A 3SDBA 5IYDJ 4F7ZA 3Q0UA 2B7BA 3KIOA 4RGXA 5E17F 3K2AA 4HE6A 5C1EA 4ZJZA 2HVQA 1EA3A 2EZLA 5EYRA 3U21A 2R7UA 3ERED 2ZZGA 2OTJI 3C3WA 2BZTA 1YW7A 4YIIA 1T0FC 1PUFA 2E2JJ 3S1NJ 1WOSA 3EUHA 4M6YA 1MSEC 4YXWA 3KL9A 4CUGA 2EWEA 5GADJ 3G71B 2YU9J 2JSPA 1E2XA 1WGXA 2L01A 5LGNA 3A35A 3OEHA 5D5WB 4RBOA 3K9TA 1LDDA 1O8EA 3W6VA 1K9MD 3FXQA 4RB1A 5CQEA 1FX7A 3CCEB 3ZN0A 2PN6A 3C18A 5M5WJ 5BPIA 1R5GA 5HNFA 3SEZA 3CCVI 1ZRFA 1V0FA 4Z4SA 4P3IA 1BIBA 4QLCU 3F8MA 3L7WA 3NWSA 3SZGA 3BH4A 5DV5A 1VQ7I 1EF4A 2IJLA 2EA2A 5L3FA 5GAHJ 5C3EJ 3FKIJ 1JKOC 5D6FA 2QE7A 3PQJA 2E5ZA 3RZDJ 5LMZA 4DYQA 4G8XA 4HNVA 4MO7A 4TT3A 2XGDA 2I8DA 4Q47A 3FKJA 2VB6A 1WI9A 2XF5A 1I7PA 2OBSA 3HXLA 3GO5A 4OOVA 4DQLA 3H09A 1RWRA 3TO6A 3CO6C 1F60A 4PZJA 5H20A 4A3IJ 2VXDA 2EIMH 3GF2A 1B8IA 4NNJA 5DCMB 3KETA 5IYPA 4BQNA 1VJSA 2ESHA 3JW4A 1T5EA 3I9V2 3E5UA 3LQ6A 3TP0A 2DFHA 1JUSA 3IC7A 4RLZA 1UG0A 2JUGA 3E6DA 4N0BA 5K7ZA 5DSZA 4C2LA 2B63J 2J7KA 3GZ5A 3LSIA 1BBYA 4ENKA 3SYJA 3HBLA 3JREA 3WBKA 1OFMA 2JN6A 4B44A 2F4OB 4DW6A 3PA1A 3FZVA 3ZN1A 1SMYF 3LFKA 3SQNA 1UELB 2CW5A 3ZIAA 4W8TA 3FM3A 3K70D 2X6YA 4N9HA 1KK1A 2CGPA 1RKTA 4ESFA 5ILUA 1X1PA 3CCLI 3S3OA 4LB5A 1Y0RA 3OJWA 4BJ6C 2RC5A 4XMYA 3SZEA 5DCFA 4P1WA 3AAFA 2EJRA 1B2RA 1UG2A 2LH9A 2B7EA 5J8CA 3CC7I 3BG7A 3OOCA 1DUXC 4CCNA 5LD2C 2MH9A 2VT2A 2ME6A 2NV4A 3T53B 3TMOA 1M90D 3VR6A 4RAGA 4J01A 3KYCB 4L9TA 1XDSA 4MIMA 1NRKA 4IW3B 1MH4A 2IA0A 2ZMEB 3R4KA 3S14J 2W84A 1WXRA 2VZLA 2CQQA 1O3QA 2XASA 4IHWA 1QVUA 3W2WA 3DKYA 1FZPB 3B6CA 3F0CA 3SKBA 2HCJB 3JAMK 2BGJA 1QQ1A 4RB3C 4G6IA 1D5YA 1D0ZA 4CYCB 3K10A 1QPIA 1EH7A 3ONUA 3ERMA 2IW5A 1YW8A 3QPTA 4AF6A 2GK7A 1YI2B 2GK6A 2LYCA 2Y69H 1R5HA 1SVLA 2DLLA 2P4WA 2QGUA 4MLOA 3CMYA 1HSTA 2F43A 2LRDA 2YWHA 4MYTA 2B9SA 2ELKA 5IK2A 1TC3C 5D8LB 3OYNA 3L9FA 2DEUA 4UV9A 2V9KA 3CJNA 4CICA 2RC6A 2W82A 3HGYA 3HDDA 2XT4A 1P7JA 3MKZA 2OBTA 2LP0A 2HTJA 3OR2C 2DT7B 1Z6RA 2OC6A 2GJKA 4MXNA 3W2HA 2XKPA 1AMOA 2VJJA 4BGDA 3D5LA 4UZEA 3LA2A 3GIRA 4B3AA 2O9LA 3LO8A 2E1NA 3TOAA 4BDYA 3LSGA 3FXRA 4E7IA 1IDYA 4XKCA 1C0WA 3KP6A 1BL0A 1N77A 5A88A 2LREA 1A31A 4RD0A 4UB8C 2BY2A 2QX3A 1TWCJ 3WQZA 2MD5A 2LDUA 3A01B 4ACAA 4KN4X 3ZBTA 3PSFA 3WG9A 1KZHA 1E63A 2E60A 4A3CJ 4FX4A 1KK2A 2ZKZA 1QNTA 2WAQN 1ZG5A 4QPOA 1J09A 3GCMA 5HXBA 2MFZA 2OUMA 3BTCA 2IS6A 4G1VA 4UZFA 3DBHB 4S0HB 4XL9A 3GTMJ 2HZTA 3OYIA 4ZCMA 3L2CA 3ASQA 3KP2A 1Y8QB 2DCUA 1GXQA 2G7UA 2HU9A 3F8CA 4BE2A 2EV5A 3CPWB 5B66C 3W2GA 3I55I 1N06A 1JTXA 3M8FA 2BW3A 2Z1DA 1UD3A 2NXNB 3OYFA 2O6GE 4A3GJ 5AIPA 5IYRA 1ETXA 2KIQA 3HHGA 3LQRA 2INUA 3Q38A 1D5VA 5JI6A 3J81k 4LLGF 4AYBA 3AKZA 4KH3A 3SUCA 1SFEA 3WTSC 4RAYA 4EM2A 2X1EA 1QG0A 3MD2A 1H80A 1K79A 2NAZA 2O0YA 3VODA 2FXAA 1WJBA 2UV1A 3FXMA 2KHMA 3PL8A 1HC8A 1QA1A 2FNAA 2CV1A 1LLWA 2HOAA 1NB9A 5JVGF 4HV5A 3K2ZA 2FBHA 4YCQA 4E7HA 2HDWA 4A5MA 3TW7A 3WTTC 3IKTA 4L0ZB 2M5WA 1PP8F 5A2QZ 1O57A 1S7OA 2EINH 2QLZA 3DEWA 1CQTA 3HTSB 1TWGJ 2EFOA 5GPAA 5LBQA 5E3OA 4KFCA 1UD8A 4EJWA 1XTAA 1Y56A 1BM9A 3PIPF 3CC2B 2Y0MA 5JMCB 2K5CA 2COBA 2A3SA 2CH0A 3KEYA 3A1YA 4XLFA 2P3MA 1N0UA 2YPRA 1WP6A 2OK7A 4X1EA 1N08A 4C3JJ 1WPCA 2BSAA 1T0FA 2KDZA 3BROA 3H36A 1PKVA 4BKXA 2PMZA 4HSTA 4GYIA 2M7AA 2FBIA 1WKMA 4OPVA 2QQAA 4HBLA 2Z16A 1IDJA 4LB6B 1JT6A 4GGGA 3M9AA 1ETKA 1O4XA 1HZEA 2HXOA 3QQAA 4V19K 4J00A 1QUEA 1A6IA 2L7MP 2LNBA 4OOXA 2W6JA 3HUGB 4ZYAA 3OPOA 4RCZA 1E3HA 3GWZA 5FKMA 3G4SB 2OA4A 5J35A 3GFIA 1DGWY 4M53A 1IO2A 3LMMA 2R7ZJ 3VYRB 2W25A 3BJAA 2M5SA 2K3FA 5CPRB 3GQBA 4RD1A 2D3LA 4HZFA 3UNGC 1UMQA 2LY1A 2H27A 1W7PD 3ZMVA 4BXFA 1E1QA 1XCBA 1ZTRA 5EF6A 1V54H 4XLAA 4KIFA 2DK8A 4Y4RA 4BE1A 2P7VB 4A0XA 2X6OA 3OS2A 4LBWA 3BG6A 2WB1N 3OYHA 3DPUA 3ABMH 3GTGJ 5FKKA 4TMZA 2NT6A 4FE7A 5F0HA 2DPUA 1V5FA 1WU8A 2QXZA 2ID3A 3Q6QA 1X4PA 3ABTA 1FOYA 2R93J 5E1ZB 1E64A 5LHGA 2E36A 1HKQA 2V31A 1X3UA 1OCPA 4EJTA 5CKTA 2DAOA 4XONA 5KAIC 3R6SA 4CCLA 1QHHD 1SFUA 5TV2A 5HZBA 3G1MA 3BQZA 1FNBA 3J7AO 5HDNA 2A6HF 2QENA 1QGZA 3P9IA 4HWVA 1IG7A 5J3OA 2TRTA 4W8QA 5K1YA 3OYGA 1QU3A 3S2WA 1L1IA 2Q2EB 4ABZA 2QA4I 1S5LC 4LK1F 3S1MJ 3OIPA 3OW2B 3MKYB 5EEAA 1VQ4B 1P4MA 1TUIA 4AF7A 2JTVA 4X7DA 2RDPA 2R7XA 2LC2A 1Z3XA 3HSFA 1X4OA 2V7TA 1UCRA 3OL4A 3AG1H 2B5OA 4WZKA 2XZOA 3WU1B 4WXCA 1T6SA 4KJZA 4BPRA 2CK3A 4I02A 1WRJA 2W85A 5J4YA 4A3MJ 1FYKA 2L02A 1FP1D 3LSRA 2JJ1A 5ED4A 4F52A 3CD6I 1TP4A 4YZQA 2PQ8A 4YFXF 4A6DA 3F23A 3HOVJ 3G2BA 1B4AA 1WVRA 1WI3A 4CHUA 2HYGD 3MCZA 3ROUA 4JX6A 2CRVA 5F4JA 2ZL5A 1HF2A 3GEZA 3KCCA 1AKHB 3WHCA 2D5VA 3E0JB 2NVTJ 3FHZA 2QGGA 1FIPA 3AL0C 1N75A 1AU7A 4IKFA 2CW7A 3I54A 5LFAA 4BH9A 3IRQA 3OSGA 4Z4TA 1HLVA 1DP3A 5E1XA 3ZCOA 1IF1A 3HSRA 1YITI 1K78A 1OQYA 4NK8A 2VBYA 3OYLA 4IX7A 1AA7A 4RM3A 3IAM2 2XTYA 2NYXA 2WAEA 4I7HA 2R7WA 2FSWA 4XLCA 2XOKA 1ON1A 2CS3A 3RPUD 1S9HA 1Q82D 1KZLA 1E79A 2LY9A 5D6EA 1DP7P 2IA2A 3AFHA 3S3NA 2OTJB 1HSJA 2I10A 2KDOA 4Y15A 3WU0A 4F55A 1JTAA 2P6TA 2Y75A 3BZ6A 3OP1A 3L2WA 3KZZA 3CO7C 1CNFA 4E4HA 1H9GA 3FPKA 3UR3C 3WE3A 4X06A 1U5TA 1IC8A 2VFQA 5K7FA 2HFHA 3K7AJ 3VB2A 3CCVB 1VQKI 1RQRA 4RLQA 3GQ9A 3IP4B 3JRAA 2D74A 2VBWA 1Z05A 3OS0A 2HKXA 2LKPA 1GV2A 1VQ7B 2DW4A 5LHHA 2PLFA 3JRGA 1OYIA 1TQIA 5L46A 1RR8C 3A2KA 3P9KA 5EEHA 2BMWA 3BCDA 3PO2J 4ZGNB 1EJ9A 5E8GA 1W7PB 1WSVA 1LDJA 4M72A 4UUSB 3ZBUA 3DBRB 1X2NA 4BS9A 3CP2A 3BR2A 2DODA 1FY7A 1OYWA 1XG1A 2MW8A 2A6TA 3KZIC 4P9UA 4G7OF 1WSRA 1JKRC 2PECA 2DMTA 2XNCA 4ZH4F 1A04A 4C30A 2VE8A 4PUSA 3CCQI 2K40A 1VQ6I 5E3LA 1Y0UA 3SLNA 2DCEA 4QTRA 3QODA 5HS7A 4LG0A 3VFZA 4OJLA 2FQ4A 4M6XA 4U7BA 1V5EA 2A07F 1QGYA 4PJLA 1J0RA 3CLOA 5FFZA 2JJ7A 1T2KA 4G7ZF 1YIJI 1ZQ3P 2KISA 3OAAA 2DDAA 2VBXA 3DTIA 4RB2C 3DKWA 3WHBA 1OCTC 5FRMA 4EQQA 3FJOA 4P6YA 3EUHC 4X0CA 1K28D 3WTUC 1SANA 1KTWA 3REOA 2DA7A 2KRFA 4XNFA 1Z0XA 2V79A 1R00A 3N05A 2OF7A 4DNTB 5GV7A 3CCLB 4KIGA 4G7HF 2D9RA 2GLOA 4YG2F 2EV6A 3CC7B 1OPCA 1TQMA 4OZZA 1G3SA 3CUQA 5LEKA 1I8DA 5EGOB 4Z4WA 3JSOA 3RTRA 4CCKA 4Z4UA 4HX4A 1N78A 1XX5A 2IPQX 1IV8A 1G3YA 3OIOA 4NQWA 4M74A 4EH1A 2O61A 2CG4A 1G3TA 2O1DA 2H6CA 5F0CA 2IA1A 3ML6A 4D5FA 3Q39A 1BX1A 4EGZA 4QPQA 4P6VF 1H42A 3CMMA 3Q9VA 1TTYA 2GIVA 1PE9A 2M3AA 3GZ6A 3AK5A 1BN5A 1B72A 3WTZA 4ZGQB 1Q1VA 4BY7J 1FJLA 4UHTA 1FPQA 4KDPA 3S32A 1O8HA 1T95A 3PUMA 3MMPA 3DTEA 1BMFA 4AUXA 5M5YJ 2AXTC 1Z6TA 4BYYA 1Y39A 3RY8A 3R0JA 2DMUA 1JB9A 2GA1A 4E7JA 1U2RA 1EZGA 3FBNB 3I3LA 5HNHA 2XPVA 4YRVA 2E7XA 4TKOB 2KVOA 2DA2A 2CUEA 2VE9A 3W5UA 1NJID 4C43A 4N4OB 5ERIA 4AYBN 4FQGA 3HRUA 4AM3A 4Y33A 2RN7A 4XBFA 4WF2A 4CH7A 1V0EA 2M87A 1OGJA 1LLZA 5JLVC 1TW2A 3KP3A 4RDJA 2M7BA 2MC4A 3RQ4A 3A8JA 3I58A 4LG3A 3EYYA 2QCOA 3ZQFA 3BH7B 1VQNI 2NVUB 1BN8A 3BOQA 2VN2A 5EEGA 1E3ZA 2VFPA 1D1NA 1H8HA 1NHCA 2XIGA 4BE0A 1TL8A 2NOJB 1HBXG 4L8JA 1LJ9A 4OMZA 1V5VA 3DU5A 1WQ2A 2W48A 2P5KA 2L7FP 1KMHA 2EK5A 2O6WA 2VNHA 1HW1A 1OCZH 3BR0A 2C5HA 2Z33A 4LBZA 4WQMA 3F8NA 4BAYA 2INVA 3R0AA 3ZC3A 1MNDA 2JVGA 2DA4A 3ES9A 2QKMB 4UVAA 2ZXJA 2PYHA 3CJQB 4B43A 2DBBA 4II2A 1QVGB 3E3VA 4V02C 2CYYA 5C4JJ 3UKGA 2JT1A 3TBIA 4JX5A 3BZKA 1VBLA 3WU2C 1O7LA 2HTSA 3BR5A 4OINF 1A8PA 5IY5H 1RKWA 5HS9A 2ZBVA 1HDPA 1V55H 2PMZN 5E79C 1IN7A 1P6RA 3FM5A 2CU7A 2W1OA 2DETA 2K7LA 1JHFA 1MBEA 2F5VA 3K1PA 3VOEA 3O8HA 4EV0A 2DYIA 1KCDA 4IRIA 1WH7A 2VJ4A 3JTGA 2HDCA 5J8FA 4ZYGA 3CCYA 4I84A 3GVJA 2PJRA 1ZM9A 1Y0NA 1Z7LA 1W0JA 2Y0SA 1NG6A 4MFEA 1FRNA 5E18F 5EZGA 3D5SC 2GOMA 3QPSA 1XSDA 2MGQA 2XZPA 1N8RD 2WC2A 1J2XA 2IOUG 3C2HA 4UUTA 3W5VA 1FBUA 3MZHA 3EUKL 5KCMA 3TEDA 1ZYRF 2GPJA 4MQ9F 3ZMZA 5B1AH 1WDTA 2KZVA 2F5FA 3FMRA 1LPQA 1JRGA 4RCYA 2X3UA 1QCXA 2HWVA 1WJCA 2IP2A 1FNNA 4Z1MA 3AL0B 1T39A 2ELJA 4E0FA 2M2EA 2EH3A 4I0AA 4YEJA 3CCJI 2I1LA 4RPDA 1RC9A 4LFUA 1FDRA 3HPGA 1NTCA 3QYFA 1O3RA 1TYXA 3KLOA 4UVBA 3CMAI 2XDVA 4KN7X 2ZC2A 1OR7A 3QFCA 2R5ZA 1EKEA 1WCMJ 2IQ7A 4XKVA 1QH0A 2CUJA 2DN0A 3HOZJ 2BM7A 5BQTA 4IJAA 2VFOA 1SD6A 1EXMA 2H8WA 2E1MB 3GTJJ 3QP6A 1T08B 2QSGX 2XC1A 3HKZA 4D9JA 4IO9F 4KKTA 4OP7A 4OIQF 2EFWA 3Q3AA 3ASNH 1O8KA 5J1UA 1A36A 2C6YA 4IHTA 2E2IJ 1Y8RB 2WBMA 1F9NA 2DYSH 4XSXF 4HNUA 2OBRA 2ELHA 1LQ1A 4HLYA 2L4MA 2GJRA 3GSIA 3RJPA 1VQOI 1IV6A 4BY1J 2NVQJ 3CDIA 3GFJA 3SFIA 2V1UA 4J19A 3RSNA 1IXSB 1R5OA 3FF5A 2VKDA 1FP2A 1ZELA 2LLKA 5FB2A 3N4MA 4DYCA 4O6JA 4XSZF 3HRTA 2QBYA 1KGSA 1FLIA 3WXMA 1GVJA 3WNBA 3HZJA 5ICGA 3OYKA 4A3LJ 3HAGA 1V5GA 2ZBUA 4ITVA 1QRYA 3HSEA 4OPWA 4JX4A 2Z8GA 4DOZA 3FPPA 2X51A 2V6CA 4ZYDA 4U4BA 4ESJA 5JBQA 1IA5A 2FMLA 1GT0C 2BV3A 4KKSA 1ERDA 3MVPA 3V7CA 3EQOA 5CVRA 3LMWA 2MABA 3GMEA 4Z2YA 3ECHA 2RVCA 3H35A 2C4TA 3BG3A 3ISPA 1MJBA 1JJ8C 2EZHA 4GXOA 3Q9SA 5H2FC 1R58A 3SEJA 3PUNA 1R36A 1WH5A 2BY3A 2G7HA 3J7ZI 4RPBA 1PUFB 4ROXA 4YAUA 2CUFA 2QA4B 4HYEA 3LQEA 4U0VA 4PC1A 3TW6A 2L9NA 3ZRGA 2LK2A 2E5NA 2X85A 3B02A 3PA2A 3ZPLA 5KW9A 4A6EA 1KU3A 3MHPA 1XMXA 4NBQA 3GVKA 2FX3A 2XKOA 3V8JA 1ETWA 2E19A 2GOXB 4XQFA 2FVGA 1O8IA 4YFNF 3OL3A 3EPZA 4X07A 4CO8A 2OD5A 2ZCWA 3A4CA 4EJUA 1JT0A 1P4XA 3LJYA 2HQNA 4YAWA 1D3YA 1OB5A 2L9SA 3K0LA 5D4RA 3CTAA 2M4KA 1GLNA 3CD6B 3OFNA 4ESBA 1HVXA 1I39A 3EDPA 3PSIA 3ZXSA 3OZVA 2NOGA 4UZUA 1FSHA 3SEQA 5JFRA 1AIPA 2L7KA 2LOOA 4CYDA 3S1RJ 3NB2A 1FBQA 1ODDA 1Q7YD 4LGWA 2PI0A 3GTLJ 1VQMB 1B8IB 4P5OA 2PMHA 2STTA 2UXXA 4RAZA 3WYAA 5IYCJ 2XTWA 5LLQA 1I50J 5K5OA 2FNPA 3OYAA 1RRJA 1ZKGA 2FEZA 1YITB 2FOKA 3I59A 2Y2ZA 1EH6A 1BR4A 5DUIA 1UFMA 3VSKA 1U6GA 3VMWA 2H09A 3BR3A 4M6VA 3T1BA 1EH8A 1VHEA 3BPXA 3H3UA 1UD4A 3CESA 1QFZA 3U6BA 3H9JA 1USSA 5FFXA 2RQQA 3OEEA 3RKYA 1K8FA 3R60A 3V7AA 4M9ZA 2Y9YA 4I98B 4N4NB 1WZ2A 2XPWA 2R7QA 3VPRA 1A5JA 1WPKA 2L4AA 4V2GA 1SD7A 1U0JA 3DXJF 1TNTA 1IJEA 1BI0A 4AWXB 5IT9Z 2YWEA 1XGOA 3GFMA 2NS0A 1GO2A 5E1WA 2EFQA 4KMUX 3OYJA 5BSYA 4LOCA 1VQKB 1XDUA 1PP7U 2X6XA
chains in the Genus database with same CATH topology
2IGOA 3VYRB 3L2UA 2M5SA 5CPRB 3GQBA 2D3LA 2ZSHB 2LBFA 2X1CA 3UNGC 2R7SA 2VBMA 4OJOA 1D1CA 2LY1A 2ZZEA 3HPHA 4BXFA 1E1QA 4KISA 4XLAA 3ONQA 2HPIA 1E43A 4Y4RA 4P22A 4BE1A 3ZPPA 3OS2A 3BG6A 3L2QA 3K4MA 3OYHA 3DPUA 4BACA 3H0DA 4B3GA 3W2AA 1UD2A 2V6EA 2RNGA 2NT6A 1V5FA 3HC7A 2NSTA 2QXZA 3KRGA 4LITA 1X4PA 3OE7A 3DU6A 5AMVA 2BOLA 1WJ5A 2V7FA 2V31A 1YE9A 5CKTA 4CCLA 4XONA 1WMRA 1QHHD 2DT6A 2JA2A 3ZR8X 4KKUA 3WWGA 2XSJC 4B48A 3LNNA 2IS1A 2R4GA 2CW8A 4OZYA 1DBOA 2VL8A 3FKSA 4HWVA 1MMGA 4W8QA 4XR6A 4PMHA 3OYGA 1QU3A 4BQQA 2Q2EB 3OIPA 3MKYB 3DQVC 4IQJA 2FUG2 4OAYA 1TT0A 3LSHA 3CP8A 4XLEA 2R7XA 4E7KA 2LC2A 1D1BA 1Z3XA 1X4OA 3W2VA 3OL4A 3JURA 2XZOA 4RMNA 1DBGA 4KJZA 3DKXA 3VDXA 2CK3A 3EQNA 1Y6IA 4LIVA 1BR1A 4KT6A 4ZDPA 2VQLA 4B3XA 2JJ1A 1OFLA 4R79A 1D0XA 2JJ2A 4F52A 3DWLE 4YZQA 3OS1A 2F6CA 2ZSIB 3G2BA 2NTBA 4DIQA 3VYUB 4XORA 1OGOX 1PLUA 3OYCA 1MABA 1SAUA 4OJ6A 4DK0A 2P0WA 2IGMA 3IUOA 4EATA 2WZPP 2X53S 2VQCA 3E0JB 2VASA 2KRCA 2VBKA 2HZDA 2DXIA 1BPLA 4XLHA 3AL0C 1N75A 2BW3B 4PK4A 4IKFA 2CW7A 5LFAA 1DP3A 3BCBA 3V42A 3ZCOA 2V4DA 2WAQA 4OJPA 3OY9A 4BUPA 4NK8A 1X1DA 3FHNA 3OYLA 4GRIA 4IX7A 1AA7A 3H5NA 3IAM2 4RM3A 4F92B 1EE6A 2R9VA 2WJYA 4BDZA 2WAEA 2R7WA 1MW7A 2HLDA 4XLCA 2KQRA 2XOKA 3GVLA 4C9YA 3RPUD 2CS3A 3DPTA 1S9HA 3K4JA 2DIEA 1KZLA 1E79A 2KMUA 3FY3A 1LVKA 1QHGA 2O0VA 1X0CA 3AFHA 3S3NA 1JTAA 2KDOA 4F55A 2BSPA 3B8YA 4BL0B 4DK1A 1PXZA 3L2WA 3OR1C 2O5RA 4E4HA 5JHFA 1KONA 2K3PA 3GBGA 3UR3C 2NTQA 1WJDA 3BCAA 3T51B 1VF7A 2A5WA 1O8GA 1DQUA 3K4LA 1X19A 4Z05A 5FL7A 1OLTA 3DDYA 3KEWA 3L2RA 2QKLB 3GQ8A 4RLQA 3GQ9A 3IP4B 3QYEA 3ZGKA 3OS0A 1NBMA 3D5RC 2M0MA 4HEA2 3LSKA 4C2TA 3E1SA 2VBEA 3A2KA 4II3A 3BCDA 3C2GA 2K9LA 2F1MA 4URRA 4YZAA 3T9GA 3BC9A 3PNTA 4BS9A 4DNRB 4PSWA 5CQGA 1BOBA 3CP2A 2O0WA 2A6TA 3KYLA 2PECA 2NSPA 4C30A 4PUSA 2W4SA 1X1AA 1G8XA 4B47A 2O17A 2VLAA 2WPDA 2DCEA 2ZXIA 2CUZA 3QODA 4BQOA 4OJLA 2ZFUA 3NE5B 2DOAA 2VJIA 4U7BA 1V5EA 1YX3A 4ANJA 2ZZFA 4PJLA 2HNHA 4HSRA 3MKWB 1CZFA 1OB0A 4HNTA 2R7OA 2VQGA 4E7LA 1FX0A 3OAAA 1RMGA 1WFXA 3DTIA 4ZTJA 2LBFB 3K6GA 2IGKA 4FASD 5FRMA 4BJ5C 3H5AA 3OW7A 3HL2A 4W8RA 3EUHC 1K28D 5HOOA 2KL4A 1KTWA 1PYVA 2DJIA 4IZZA 4CA0A 4XNFA 1E0EA 2ZTGA 2IGNA 3N05A 3NWTA 2R7RA 4DNTB 1BR2A 2VQHA 3SYTA 4XKBA 3CJRB 3J7AY 2BVLA 2R7TA 1OGMX 5FROA 4OZZA 4LIUA 4BJTA 3FDYA 1I8DA 3BLYA 5CDFA 2NTPA 1G59A 1LKXA 4CSWA 4XN3A 3RTRA 4CCKA 2XGJA 1W0KA 1N78A 5HKKA 2LZJA 3B90A 3CZ6A 3OYBA 4DGWB 2HPMA 2O1DA 4OAZA 4QPQA 2WB1A 2LY2A 2ZZQA 3CMMA 3OYDA 3QOEA 1PE9A 1WTHD 3T56B 1X1CA 2M3AA 3K70C 1KCCA 2IXSA 2X3HA 1SFKA 4F3QA 3S32A 1O8HA 1T95A 2VKHA 1IRXA 2HVRA 2HVSA 4ASUA 1WJFA 3DTEA 4TSFA 1BMFA 4ZDOA 2Z2SB 1RU4A 3BCFA 3QYBA 1BHEA 2K9MA 4XOTA 4DBRA 4E7JA 2E1BA 3FBNB 3I3LA 4ZDLA 1D1AA 5HNHA 1O8LA 2NT9A 3SDBA 4YRVA 4FXUA 4G7XA 4TKOB 2KVOA 4CCJA 4BEHB 3DTKA 4N4OB 5KHDA 5C1EA 4ZJZA 4Y33A 2HVQA 4CH7A 1EA3A 1V0EA 2PYGA 3U21A 2R7UA 3OYEA 2M7BA 2ZZGA 2MC4A 3RQ4A 5TGTA 4LG3A 1T0FC 3CF2A 1BN8A 4YXWA 4CUGA 2R7VA 1E3ZA 2EWEA 1H8HA 1NHCA 3PUBA 2JSPA 4PSXA 2NOJB 4BE0A 3A35A 3OEHA 4L8JA 3DU5A 4PFPA 1SKYB 1O8EA 3DEEA 1KMHA 5CQEA 3GQAA 3EUAA 4U87A 3G05A 2INVA 5HNFA 3SEZA 1V0FA 3LFUA 1MNDA 2JVGA 1LFPA 3OWTA 3M1CA 2QKMB 4XKWA 2RREA 3NWSA 2PYHA 3SZGA 3BH4A 3CJQB 1AIRA 4B43A 4II2A 1OR7C 2OV7A 5DN6A 3K4KA 2QE7A 2E5ZA 4HPQA 2JDIA 3TBIA 4TT3A 4F93B 3H94A 2O04A 1VBLA 4NK6A 3A3GA 2I8DA 3FKJA 2VB6A 2XF5A 3HXLA 1RWRA 2KRHA 2VXDA 3PFYA 1IDKA 4CZCA 2W1OA 4NNJA 2F5VA 1KCDA 1R6RA 3DPLC 4BQNA 2VJ4A 3VWBA 1VJSA 4CCMA 4KITB 1T5EA 4G6TB 2X1DA 3I9V2 4I84A 2MYSA 2MD0A 3GVJA 1UG0A 2JUGA 1Z21A 2PJRA 4RM2A 2WSSA 3S8PA 4C2LA 1Z7LA 1W0JA 3KX2A 2Y0SA 3LSIA 1NG6A 1WJAA 4E7ZA 3D5SC 4PJNA 2GOMA 3PNYA 4PJMA 1OFMA 1FMWA 2XZPA 2BVMA 3C2HA 3K4CA 4B44A 1UD5A 3DLAA 4W8TA 2V26A 3EUKL 3ZIAA 1UELB 2WAFA 5KCMA 1W36C 3K70D 2X6YA 2WJVA 3S3OA 3GRHA 2KZVA 4HG2A 5FRNA 1JRGA 4BJ6C 2IS2A 1QCXA 2IS4A 2KP6A 1WJCA 4XMYA 4Z1MA 4BU2A 4P1WA 4YZ0A 1IB4A 3AL0B 4AVZA 2LH9A 4NC7A 2ELJA 4E6KG 3BG7A 3OOCA 4X0GA 4YEJA 4E0FA 1EFRA 4CCNA 1LDKB 5LD2C 2ZTNA 1P9QC 4RLFA 1W9XA 3TMOA 3T53B 3HPGA 3VR6A 3QYFA 1E3XA 4J01A 2Q1ZB 1X1BA 3S3MA 4XOPA 2XDVA 1NRKA 2KPMA 2WY7Q 3B4NA 1WJEA 3OYMA 2IQ7A 4XKVA 2CUJA 1HG8A 1O8FA 2UVFA 3W2WA 3DKYA 2WADA 4ZC3A 3VSUA 1D0YA 2CV2A 3K4BA 4W8SA 2E1MB 4NUBA 4JQFA 4G6IA 1D0ZA 2V1NA 4YELA 3K10A 4XN0A 2W00A 3HKZA 4D9JA 4KKTA 4OWRB 4OJ5A 1O8KA 2GK7A 5HVQC 2GK6A 1E1RA 2LYCA 3VSTA 2CV0A 4MLOA 2WBMA 3PNVA 1VLYA 2LRDA 1K6YA 2F43A 1H8EA 5IK2A 1COWA 4HNUA 3OYNA 3LSMA 1O8DA 4EW9A 2AQFA 2VXZA 2D3NA 4U49A 2XAUA 2V9KA 2ZXHA 3H5RA 4NC8A 2W82A 3OOUA 2GJRA 4NQWB 3MKZA 3OR2C 3HG9A 2DT7B 1MMNA 2OC6A 2GJKA 3RSNA 1O8MA 4MXNA 2VJJA 2WA0A 2VKDA 3D5LA 1ZELA 3MMYB 3S93A 4BGDA 1XG2A 2W6IA 4BDYA 3LSGA 4E7IA 4XKCA 4PJJA 1N77A 1DGRM 1OHHA 3OYKA 2GJPA 3HOTA 3HAGA 2LREA 1V5GA 4IQ4A 4Z03A 4ITVA 3VYTB 4B3FX 2Z8GA 2QX3A 4DOZA 3VMVA 3FPPA 2X51A 4U4BA 1IA5A 3WQZA 4YZXA 2NZMA 4KKSA 1ERDA 2CFOA 3PSFA 4DJAA 3EQOA 2VIXA 2E60A 5C1CA 3LMWA 2MABA 3OIQA 3RCOA 3OMYA 4QPOA 1J09A 1GQ8A 2ODLA 3H35A 4DBQA 2MFZA 2OUMA 2IS6A 3JU4A 4GQNA 4XD7A 4Z06A 1K5CA 4E7SA 4BEHA 3H9QA 4XL9A 2L5QA 2X8KA 3OYIA 2JIZA 4D1QA 1W36D 2KLOA 2HU9A 1PJRA 4BE2A 1UD6A 2XNDA 3VSVA 2L9NA 3ZRGA 2E5NA 2X85A 3LL7A 2BW3A 2VJ5A 2Z1DA 1HA8A 1UD3A 2M4GA 4PFOA 3L2VA 3ZPNA 3GVKA 2QY1A 3OYFA 2JVHA 1BLIA 2GOXB 4XQFA 3BC8A 1O8IA 3PJRA 2INUA 3OL3A 3EPZA 4F91B 4HRIA 3A4CA 4AYBA 3AKZA 3SUCA 3VSLA 2X1EA 2V7QA 2UWMA 4FETA 2L9SA 1NG7A 3MD2A 1H80A 2M4KA 1GLNA 4Y3OA 3F9KA 3OFNA 1HVXA 1WJBA 2UV1A 4H4KC 2AQEA 3PSIA 3ZXSA 2KHMA 3PL8A 2XC7A 2Z6BD 2CV1A 3A3BA 1QJVA 4UZUA 3SEQA 4HIZA 2L7KA 2LOOA 1MNEA 1OOCA 1JI8A 2UVEA 3ZSCA 4E7HA 2HDWA 1O88A 2E1MC 2XZLA 4P5OA 5KNLA 2V4JC 2W7NA 1VZ0A 3M8JA 1FMVA 1UD8A 3OYAA 4CCOA 1Y56A 3VYSB 2HQAA 4XM3A 2K5CA 2PJRB 2CH0A 3KEYA 4XLFA 3A1YA 1BR4A 3VSKA 1WP6A 3VMWA 3ZQQA 5HLTA 1WPCA 2VPLA 2WY8Q 4ZTFA 1PKVA 4MR0A 1UD4A 3CESA 2PMZA 4HSTA 1MMDA 3H9JA 3TL4X 2M7AA 1MMAA 1TZLA 4AU7A 3GQ7A 2RQQA 3OEEA 1O8JA 2Z16A 1IDJA 3W3CA 2XF6A 2X6WA 1I18A 2CMPA 4N4NB 2F4IA 2R7QA 3H9GA 4JOMA 1HZEA 3FBIB 3K4NA 4G7WA 1U0JA 4J00A 3HOSA 3HUGB 4ZYAA 2L2OA 2LG4A 4C2UA 2W6JA 3OPOA 4JMQA 2UUZA 3UW0A 3IAS2 1Z3YA 3OYJA 1DGWY 1YX5A 1UAAA 2XF7A 2X6XA 3LMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z05 A;  1O8M A;  4MXN A;  1O8E A;  2VJJ A;  2VBM A;  1XG2 A;  4OJO A;  3GQ8 A;  3GQ9 A;  3GQA A;  2INV A;  4XLA A;  4Z03 A;  2VBE A;  4XKW A;  3ZPP A;  2PYH A;  2Z8G A;  2QX3 A;  1AIR A;  3VMV A;  4URR A;  4YZA A;  4U4B A;  1IA5 A;  3T9G A;  4YZX A;  2NZM A;  5C1C A;  2NT6 A;  3EQO A;  2NST A;  3LMW A;  2O0W A;  2QXZ A;  2O04 A;  1VBL A;  3KRG A;  4NK6 A;  2PEC A;  1GQ8 A;  2ODL A;  5AMV A;  4Z06 A;  2NSP A;  1RWR A;  1K5C A;  4XON A;  4XL9 A;  1WMR A;  1IDK A;  2O17 A;  3WWG A;  1KCD A;  4OJL A;  2VJI A;  4OZY A;  1DBO A;  3VSV A;  4HWV A;  1CZF A;  2X85 A;  4W8Q A;  4XR6 A;  4PMH A;  4I84 A;  1RMG A;  2QY1 A;  4C2L A;  4XQF A;  1NHC A;  1O8I A;  2INU A;  4W8R A;  4XLE A;  1KTW A;  1OFM A;  3SUC A;  4XNF A;  3JUR A;  4W8T A;  1DBG A;  3EQN A;  1H80 A;  2X6Y A;  1OGM X;  1OFL A;  4OZZ A;  3GRH A;  1QJV A;  1JRG A;  1QCX A;  4XMY A;  2NTP A;  4YZQ A;  4YZ0 A;  1OOC A;  2UVE A;  1IB4 A;  3ZSC A;  4XN3 A;  4AVZ A;  2NTB A;  4YEJ A;  1O88 A;  4XOR A;  1OGO X;  1PLU A;  4OJ6 A;  3B90 A;  2O1D A;  4XOP A;  2VBK A;  3B4N A;  4XLH A;  1PE9 A;  2IQ7 A;  4XM3 A;  4XKV A;  4XLF A;  1O8F A;  1HG8 A;  2UVF A;  1KCC A;  3VMW A;  3VSU A;  2X3H A;  4OJP A;  1O8H A;  4NK8 A;  4W8S A;  4MR0 A;  1EE6 A;  1RU4 A;  1BHE A;  4YEL A;  3GQ7 A;  4XN0 A;  4XOT A;  1O8J A;  4XLC A;  1IDJ A;  1O8L A;  2NT9 A;  4OJ5 A;  2X6W A;  1O8K A;  3FY3 A;  2O0V A;  1X0C A;  1JTA A;  3VST A;  5C1E A;  2BSP A;  3B8Y A;  1PXZ A;  2PYG A;  4EW9 A;  1O8D A;  4U49 A;  2NTQ A;  3UW0 A;  1BN8 A;  1O8G A;  2EWE A;  2X6X A; 
#chains in the Genus database with same CATH topology
 2VKV A;  2IGO A;  4PCQ A;  1IZ1 A;  1G6N A;  3CCR I;  1IJW C;  2LF8 A;  4HDV A;  2LBF A;  1DPR A;  1ZR2 A;  1RIO H;  1TWA J;  2VBM A;  4OJO A;  3TH0 A;  3PO3 J;  2L9V A;  3I71 A;  4MHG A;  3ONQ A;  2ZME A;  5CVJ A;  1ZM4 A;  2Q6K A;  4P22 A;  3GUD A;  2FOW A;  4D7N A;  5IP9 J;  3COA C;  1XSX A;  3BG5 A;  5EZH A;  3L2Q A;  3H0D A;  1Y0Y A;  3HC7 A;  3CCQ B;  2NST A;  1VQ6 B;  3AVW A;  1CF7 A;  4BHP A;  1IN4 A;  1PJ6 A;  1FBS A;  2V7F A;  2BXY A;  2K85 A;  1T98 A;  1YE9 A;  4R71 A;  3FK6 A;  2EIX A;  1QFJ A;  2JA2 A;  2HQR A;  4KKU A;  3CDH A;  3FX3 A;  2CW8 A;  3DV8 A;  5K5Q A;  2VL8 A;  1XSV A;  2DO7 A;  3FKS A;  2V1D A;  1ZM3 A;  3JQR A;  1MMG A;  2KKO A;  3O6B B;  3FMQ A;  3IWZ A;  3QRF F;  3S15 J;  4Q7J B;  5C4X J;  4RGR A;  4Z4V A;  1VQ8 I;  4CZZ A;  2HDN B;  1TT0 A;  3LSH A;  3MQ0 A;  3JAM Z;  2DFE A;  1IXC A;  3CP8 A;  3SDG A;  1U5T C;  2STW A;  4QFM A;  3AVX A;  4E7K A;  1D1B A;  5EJC A;  1HOM A;  4A3E J;  2Z5U A;  3RIQ A;  2DMP A;  3EQN A;  3RQI A;  1Y6I A;  1E17 A;  1EFC A;  4PAB A;  1U8R A;  1TSP A;  1E3O C;  3S17 J;  4R79 A;  1MKM A;  1H89 C;  1EV7 A;  2VPR A;  3D0S A;  3L1P A;  4N3G A;  4I01 A;  2ZSI B;  1IW7 F;  3JX8 A;  3P4G A;  4XOR A;  2DTZ A;  2XRO A;  4R8H A;  4DK0 A;  4LLN A;  3HM5 A;  1ON2 A;  3MCA A;  1EWY A;  1MSF C;  3V76 A;  2XGX A;  1VTN C;  2VI6 A;  4XLH A;  1G2H A;  5B5E C;  1ZH5 A;  3PVD A;  2BW3 B;  1QA6 A;  1BI2 A;  3LWF A;  4M9X A;  2RKH A;  4S04 A;  4MTD A;  1KTV A;  3BQJ A;  5F4O A;  1ZAO A;  4XIC A;  1MMS A;  3BCB A;  2V4D A;  1Z77 A;  2JA7 J;  3FHN A;  3HJE A;  4GRI A;  1UHM A;  4AC9 A;  1BJA A;  3H5N A;  2TCT A;  4HLX A;  4F92 B;  1P7I A;  2R9V A;  4BDZ A;  1BW5 A;  4HX8 A;  2KQR A;  2BEO A;  3SZP A;  4P9F A;  1XQB A;  2Y0S N;  4L5J A;  2Z9O A;  2KMU A;  1B9M A;  1LVK A;  1QHG A;  4M3E A;  3AVT A;  1QGP A;  1SFX A;  3F8F A;  1RR7 A;  1VQN B;  1PXZ A;  5L3G A;  5FLX Z;  3OR1 C;  1VQ5 I;  1SFO J;  2O5R A;  2J8K A;  3F21 A;  2K3P A;  3GBG A;  4D5C A;  3OZU A;  4IPA A;  4XRF A;  1VF7 A;  1X3Z B;  4RA2 A;  4A2U A;  3K4L A;  1X19 A;  3JRF A;  4Z05 A;  3CUQ C;  3WTX C;  1VFC A;  4Y7N J;  1LE8 A;  3KEW A;  4WWC A;  4LBY A;  5IYW A;  4ENM A;  3GQ8 A;  1GUU A;  3QYE A;  3CCS B;  3HRM A;  3D5R C;  3HYI A;  1SEU A;  1TTT A;  2H1L A;  2EIK H;  1XGM A;  2F5C A;  1YHQ I;  4I76 A;  2DU9 A;  3FMS A;  4C2T A;  1HKS A;  3PET A;  4ZZL A;  4WZT A;  3E1S A;  2VBE A;  2R5Y A;  2Z99 A;  2F1M A;  1TW3 A;  4QV2 A;  2K02 A;  4PC2 A;  3CCU I;  1ZRE A;  3FIW A;  3KFW X;  1PVE A;  4DQ2 A;  3IRR A;  4DNR B;  5CQG A;  1K6O A;  4P1V A;  4ZCL A;  2O0W A;  1KQ5 A;  2QF7 A;  4O5V A;  1MGT A;  2NSP A;  2W4S A;  1AOY A;  3RYR A;  1V3F A;  2ADU A;  3S2D J;  3GZN B;  2LR8 A;  3HKZ N;  2CUZ A;  1CGP A;  1UZC A;  3BP8 A;  4G9Y A;  2VJI A;  4QUZ A;  3EET A;  3ZMS A;  3AVV A;  4ZZD A;  2ZZF A;  2KT0 A;  5LEJ A;  4MGR A;  4HSR A;  4RDK A;  3J80 Z;  1IN8 A;  3F6V A;  4HNT A;  3LNQ A;  2R7O A;  3Q0W A;  3R6J A;  3I0T A;  4G6D A;  1K4T A;  3QFS A;  1XC5 A;  2IGK A;  3OW7 A;  3SJM A;  1H0M A;  1KK3 A;  1QX4 A;  3HL2 A;  2KL4 A;  3JR9 A;  2DJI A;  4IZZ A;  2X9D A;  1E0E A;  2ZTG A;  1ZUN B;  2R7R A;  4IL6 C;  1VQP I;  1AHD P;  1HCR A;  4TMW A;  2ZXW H;  4BHB A;  2DY1 A;  2X0K A;  2H94 A;  4IF4 A;  2PFB A;  4XKB A;  3CJR B;  4XLN F;  4NBS A;  5B6I A;  1VI0 A;  3CRZ A;  1W34 A;  1SKQ A;  1YS6 A;  4IOC F;  1XGN A;  1TWH J;  2DFI A;  4HF2 A;  3CCJ B;  3I1F A;  4KIC A;  3SLD A;  1N0V C;  1ETO A;  2E34 A;  1LKX A;  3KP5 A;  3DFG A;  2LD5 A;  3CMA B;  4M71 A;  1QZE A;  4PGH A;  1TYV A;  1MBK A;  2C5B A;  4RGU A;  1I6X A;  4C2M J;  3ELK A;  3X2Q H;  1YIO A;  1WOO A;  1KA8 A;  1U2W A;  2OYN A;  2V9V A;  3T8R A;  3T56 B;  1X1C A;  4XRS A;  1R4N B;  1BC8 C;  1QRB A;  4M9S A;  2PJP A;  2PMD A;  2EB7 A;  3A8I A;  3PIO F;  4ACB A;  1IRX A;  2E1C A;  3IKV A;  1Q1H A;  3PQK A;  1HKT A;  4TSF A;  4ZDO A;  2Z2S B;  4JP0 A;  1RU4 A;  3QYB A;  4AD9 A;  3H0G J;  2CQN A;  1YRN A;  2Y48 A;  1QPM A;  1D1A A;  3U1D A;  1QZY A;  1R1V A;  2DTR A;  3E6B A;  5E6T A;  4G7X A;  2XAG A;  2GBY A;  2AS5 F;  4FE4 A;  4BEH B;  2FMY A;  4L5I A;  3A1P A;  2BY1 A;  3DTK A;  5KHD A;  1IJF A;  2C77 A;  2R0Q C;  4YAO A;  5FO1 A;  2PYG A;  2BY0 A;  2OQR A;  3F8B A;  3QP5 A;  4Y7C A;  1QA3 A;  3BJO A;  1VQO B;  2CW0 F;  3WY9 A;  4BBS J;  4NCN A;  4HOB A;  1L3L A;  3QPH A;  3W6K B;  2Q6O A;  2BX6 A;  1YFH A;  4J0Q A;  4PSX A;  1YJN B;  3HRS A;  4Z4Y A;  2JQ7 A;  2CJJ A;  5GTI C;  4BHC A;  3M3Y J;  4IHV A;  4N3N A;  3V8L A;  5THX A;  4B4D A;  4JK1 X;  1DAR A;  3I4P A;  1Z7U A;  2JRT A;  1DDN A;  3EUA A;  4U87 A;  2MG4 A;  3HOX J;  4M3D A;  3BWG A;  1RQP A;  3G05 A;  2QWW A;  1F20 A;  1LFP A;  1K78 B;  3OWT A;  1EP1 B;  3M7G A;  4WK8 F;  3H9N A;  4XKW A;  2HXI A;  2P81 A;  1OYY A;  1R71 A;  2ETH A;  3RKX A;  1AIR A;  1NK3 P;  3QSY A;  4GYG A;  4YAF A;  1OR7 C;  5DN6 A;  3K4K A;  1ZG1 A;  2YU3 A;  1S6L A;  4HPQ A;  4PGG A;  3WGG A;  2QQ9 A;  4G12 A;  3AG3 H;  5TIS C;  4F93 B;  3F6O A;  2O04 A;  4XLP F;  2P5V A;  5JR3 A;  1B6A A;  1MBJ A;  5E8I A;  2D1H A;  4GO1 A;  1L0O C;  3I64 A;  2B0L A;  2X0L A;  3M8E A;  1YJW I;  4A3B J;  4CZC A;  1BQE A;  5DUK A;  1R6R A;  1TLH B;  2JUC A;  2PG4 A;  3ASO H;  4P96 A;  5FKL A;  3V7R A;  5H59 A;  5DYM A;  5TJJ A;  4G6T B;  2CQK A;  1U5T B;  2GWR A;  2X1D A;  2VOO A;  2DOF A;  1D8K A;  2MYS A;  2MD0 A;  2YR2 A;  4ON0 A;  4QVA A;  4RM2 A;  3S1Q J;  1CQX A;  1N05 A;  4HDU A;  2TDX A;  3KP4 A;  3E1Y E;  5FA6 A;  4E7Z A;  3GQA A;  3R61 A;  4PJN A;  2B7C A;  3I4N J;  4O3M A;  1OFD A;  3CCM I;  2WR8 A;  1FMW A;  4A3F J;  1UJ8 A;  3U2Q A;  2K9Q A;  3N6Z A;  5DTD A;  1UD5 A;  2QYO A;  3DLA A;  2V26 A;  3N97 A;  2WAF A;  1EA0 A;  1W36 C;  2KIM A;  2IEK A;  2C2W A;  5JLX A;  3J81 K;  3AG2 H;  2KP6 A;  4I6Z A;  2NPF A;  4BU2 A;  2P5L C;  4AVZ A;  1FTT A;  3B82 A;  4E6K G;  2K4J A;  1BW6 A;  1W5S A;  2GIZ A;  2IVM A;  1EFR A;  3CPX A;  3HOW J;  4RLF A;  4LG0 B;  2WWY A;  2EZK A;  4RM0 A;  3W2F A;  2YS9 A;  4L9J A;  1E3X A;  3AST A;  1SC7 A;  3Q5F A;  4GFB A;  1GVD A;  2A6E F;  4HW0 A;  5FJ8 J;  2KPM A;  3LAJ A;  2L0K A;  2JSC A;  4DNC A;  1G7T A;  4A69 C;  1ETQ A;  3A03 A;  2UVF A;  1VF9 A;  5LRR A;  4Y52 J;  3OJX A;  1IDZ A;  3G73 A;  1Q9S A;  2WAD A;  1MBG A;  5DM7 F;  3VSU A;  3I4M J;  3ZMT A;  2CV2 A;  3K4B A;  3U9G A;  2GRE A;  3W2E A;  3P5J A;  2QEX I;  2Q8K A;  4UB6 C;  2VON A;  1GJR A;  4K2E A;  3DP7 A;  3H3Z A;  4YEL A;  3IL2 A;  2GXA A;  1KK0 A;  3WG7 H;  3E6M A;  4M1K A;  4WZL A;  2CC2 A;  5ILS A;  2YUS A;  5KSW B;  4OWR B;  2ZBK A;  4EJO A;  4CQJ A;  2DK5 A;  5HVQ C;  2QTZ A;  2CND A;  1E1R A;  4EMS A;  2NS8 A;  1ZR4 A;  2CV0 A;  1Q86 D;  3VST A;  3CUQ B;  3PNV A;  3IH3 A;  1K6Y A;  1H8E A;  1COW A;  5EMN A;  1O8D A;  3SHF A;  2AQF A;  3BR6 A;  2VXZ A;  5K7H A;  1WSU A;  2D3N A;  3BZC A;  1FIA A;  1KYW A;  2ZXH A;  4NC8 A;  1IRZ A;  1XFO A;  5FIU A;  1ZGA A;  5IYQ A;  3CCR B;  5FD5 A;  4NQW B;  3WOD F;  1KU7 A;  3QU3 A;  3HG9 A;  1MMN A;  3ISX A;  1W5C C;  5IOY A;  1JNY A;  4FT8 A;  2HMA A;  1O8M A;  4M3F A;  4F7D A;  3D26 A;  2WA0 A;  3MMY B;  1KU9 A;  2WTE A;  4X7E A;  2BM6 A;  2W6I A;  1JGG A;  2ZJQ F;  3RKW A;  1B72 B;  2NNN A;  1DGR M;  1OHH A;  4Q5S F;  3JQP A;  4Z03 A;  3TP3 A;  3VYT B;  2OAZ A;  4EVI A;  1QGA A;  1HDD C;  3VMV A;  2O8X A;  2M1B A;  4WXD A;  2PE3 A;  1DU0 A;  4YZX A;  1X3W B;  4EJV A;  2CFO A;  3WTV C;  2R92 J;  4FN5 A;  1YQA A;  1FND A;  3OMY A;  4IRG A;  4TMX A;  5D5X B;  5HLI A;  1RET A;  4DYR A;  4GQN A;  2F5E A;  1K5C A;  1QBJ A;  1HW5 A;  1NHA A;  3H9Q A;  3ZMU A;  3JRB A;  2L5Q A;  2X8K A;  4KYW A;  4OPS A;  3ZZU A;  1IN5 A;  1H9T A;  3KYD B;  1W36 D;  1H8A C;  2KLO A;  4Y17 A;  3GTP J;  2BVN A;  1UD6 A;  1VQ9 I;  3VSV A;  3GVA A;  1S4M A;  1VQL I;  2HYF A;  1VQ8 B;  4N9I A;  3T5X A;  4RDU A;  2J5O A;  4RJL A;  1LFB A;  1YO5 C;  5L3D A;  2VJ5 A;  3ZPN A;  1HA8 A;  2M4G A;  2BM4 A;  3NAR A;  3MEX A;  3L2V A;  3CME I;  2FQ3 A;  2JVH A;  5AON A;  4G1B A;  1BLI A;  1K4Z A;  4B4C A;  2P8T A;  4HRI A;  1T8I A;  1FEX A;  2M30 A;  3A0H C;  2XNJ A;  2X48 A;  4HQE A;  1BI1 A;  2FJ1 A;  3TOB A;  2UWM A;  4FET A;  5F1J A;  4EGY A;  2DOG A;  2OU2 A;  2O7O A;  1K61 A;  2XV4 S;  4Y3O A;  1YOV B;  3AGQ A;  4KA4 A;  2XGE A;  4H4K C;  1MJA A;  2XC7 A;  1XD7 A;  3LQQ A;  2DPD A;  3I55 B;  3BPV A;  3G6E I;  1N25 A;  3HOU J;  2ZME C;  4HIZ A;  4MEY F;  1MNE A;  3WBJ A;  2DT5 A;  4M3G A;  4M73 A;  2HOS A;  1YG2 A;  2QVO A;  1OGI A;  1DDI A;  2BGI A;  2ME0 A;  2V4J C;  4BXU A;  3GFL A;  1VZ0 A;  2FD5 A;  1ENH A;  2ZJR F;  5BOX A;  4W1U A;  2GQF A;  3GTQ J;  2EFP A;  3M4O J;  4P2N A;  3VYS B;  2HQA A;  4I09 A;  1JJ6 C;  2PJR B;  1Q81 D;  3MFK A;  5EG0 A;  3ZQQ A;  2IBD A;  1XB2 A;  5DEQ A;  5E3M A;  5L3E A;  5GAE J;  3HIF A;  1K8A D;  4WWV A;  2XRN A;  4ASN A;  1FNM A;  2G9W A;  1TZL A;  2K4B A;  3G3Z A;  3GQ7 A;  1I1G A;  4ZYE A;  1O8J A;  4XRM A;  3W3C A;  4GDF A;  5J40 A;  1VQ5 B;  2CMP A;  2WYR A;  5B3S H;  3H9G A;  4JOM A;  2DI3 A;  4EM0 B;  2O3F A;  1V4R A;  3FBI B;  3K4N A;  4G7W A;  3SJZ A;  3ONY A;  3HOS A;  4JMQ A;  2L2O A;  3F22 A;  4C2U A;  5IP7 J;  2UUZ A;  1GR1 A;  3TGN A;  3UW0 A;  4Q48 A;  1IXR C;  1Z3Y A;  1FWZ A;  2VC0 A;  1YX5 A;  1UAA A;  5CVU A;  1MNM C;  2OJE D;  3L2U A;  2ZSH B;  2X1C A;  5BNG A;  2H8R A;  2R7S A;  1YHQ B;  2R5Z B;  2ZZE A;  3HPH A;  1ZGW A;  4A3D J;  2MBF A;  4IOA F;  5GAG J;  1W4M A;  2FF4 A;  2QDX A;  2HPI A;  3G1L A;  3H92 A;  3P9C A;  2V7V A;  3CCU B;  3D1N I;  4ENN A;  3ZPP A;  3DLL F;  5E3N A;  1O3S A;  1N07 A;  2KJB A;  3K4M A;  2K9S A;  4B3G A;  3QWL A;  1H85 A;  2ID6 A;  2GXG A;  3WND A;  1UD2 A;  2RNG A;  1VQ4 I;  1KJZ A;  2VOP A;  5H5J A;  3ZQG A;  3KRG A;  3OE7 A;  2RV8 A;  2KFD A;  5AMV A;  3MN2 A;  4X7C A;  1ZG3 A;  4MNU A;  3VMF A;  3H3V K;  1WMR A;  2DT6 A;  3K1M A;  4G6Q A;  1R5B A;  2JZY A;  2XSJ C;  2R3S A;  3LNN A;  1S8N A;  4OZY A;  1DBO A;  2E1R A;  6PAX A;  2Y9Z A;  1YJ9 I;  3WGI A;  4RB0 A;  4M3B A;  4XR6 A;  3RKQ A;  4PMH A;  1XN7 A;  4YHB A;  4BQQ A;  2BM1 A;  1HA3 A;  4M4S A;  5IYB J;  1BJK A;  2JN9 A;  3DQV C;  1WOR A;  3CQZ J;  2FUG 2;  2EBI A;  4OM9 A;  1ONV A;  1S3J A;  2M34 A;  2XB0 X;  2QBY B;  4FK8 A;  4IVN A;  5DS9 A;  4HE5 A;  1VQP B;  4B1R A;  5HDK A;  1TBX A;  2V9P A;  1R49 A;  4CXF A;  1K4S A;  1RES A;  2L7Z A;  2FA5 A;  1XS9 A;  2NVX J;  3W2V A;  4P26 A;  1H88 C;  4RGS A;  2PLY A;  1IGN A;  2D1V A;  1GV5 A;  1MDM A;  3DKX A;  4PC6 A;  1FSE A;  3BG9 A;  3BY1 A;  1BR1 A;  3I5U A;  4RDL A;  2VQL A;  4B3X A;  1OFL A;  2E35 A;  1PDN C;  4RD4 A;  1D0X A;  1JJ2 B;  2JJ2 A;  3DWL E;  4LLL A;  5M3F J;  1DG1 G;  1J9Z A;  3OS1 A;  2NTB A;  2L54 A;  3SFZ A;  1B1B A;  4DIQ A;  3WTW C;  3CJT B;  3E5Q A;  3VYU B;  4YFK F;  1OGO X;  1PLU A;  4U88 A;  4L9V A;  4OJ6 A;  3ZQ7 A;  1TNS A;  4FWT A;  1GVH A;  4EAT A;  3SXY A;  3IUO A;  5CVI A;  4OPO A;  2X53 S;  2WZP P;  3ZQI A;  4S05 A;  2ZJ2 A;  3PUF A;  5ICE A;  1R1T A;  2KRC A;  2HZD A;  1BPL A;  2VBV A;  1J9I A;  1TT5 B;  1S72 I;  3LAP A;  4AVP A;  4Y13 A;  2XGC A;  2JA6 J;  3R6K A;  3V42 A;  4U9U A;  2BYV E;  5GPC A;  1QA2 A;  5CLS A;  4TMV A;  3OY9 A;  4OJP A;  2PEX A;  1FYM A;  3FXL A;  5LGT A;  5HOD A;  2GZW A;  2N8G A;  4H9G A;  4P3Y A;  2LKS A;  4U7D A;  3V4G A;  2BBY A;  1VLO A;  3GVL A;  4C9Y A;  2IAI A;  2M8G X;  3DPT A;  4IRH A;  1D2E A;  2MA3 A;  3FY3 A;  1X0C A;  3TQN A;  4QWQ A;  3NEU A;  4P12 A;  1NDH A;  3B8Y A;  4A0Z A;  4BL0 B;  4DK1 A;  2J5P A;  1IRF A;  1ELO A;  3FXU A;  5JHF A;  1FC3 A;  5DCM A;  1M1E B;  4TN1 A;  2RAE A;  3T51 B;  2JWT A;  3RYP A;  2A5W A;  1MJ9 A;  1MBF A;  4R1H A;  1DQU A;  5BPD A;  1JKP C;  5IT9 K;  3Q6R A;  1T6X A;  2LSO A;  1IAW A;  2EA4 A;  3DDY A;  1P2F A;  1G3W A;  4OIP F;  3L2R A;  3AG4 H;  2BGC A;  5HZA A;  1R1U A;  2P6S A;  3I59 B;  2H1K A;  1NBM A;  2K86 A;  1ORK A;  5FO0 A;  2A05 A;  5GP9 A;  3C2G A;  4YZA A;  4YC5 A;  3L09 A;  1RZ4 A;  1Z1D A;  2OTL I;  3PNT A;  1JE8 A;  2E71 A;  1BOB A;  3KE2 A;  4LMY A;  3BTL A;  5D5V B;  1YJW B;  4FTH A;  4C0S A;  1W0T A;  2ESN A;  1KU2 A;  3KEQ A;  3O3K A;  1EFU A;  5FKO A;  1WWX A;  2DQL A;  2EIJ H;  5KK1 A;  1G8X A;  4B47 A;  3IH4 A;  2VLA A;  2WPD A;  2O17 A;  1R5I D;  2EQR A;  1AWC A;  2ZFU A;  4YIF A;  1A6Q A;  3LA3 A;  3FK7 A;  2D45 A;  2DA5 A;  3ECO A;  2HNH A;  4V2F A;  3MKW B;  4E70 A;  1OB0 A;  1P92 A;  1W2B B;  1FX0 A;  2VQG A;  1RMG A;  1WFX A;  1QQI A;  2CWE A;  1WHU A;  3SY2 A;  3CCM B;  2BHY A;  3BT9 A;  2LBF B;  3GTO J;  1JTY A;  3K6G A;  2Q6L A;  2CBX A;  4UXN A;  4FAS D;  4BJ5 C;  2GA2 A;  1PYV A;  4LC0 A;  1UMK A;  3AGP A;  2AXL A;  3CC4 I;  4CYC A;  4NHJ A;  4IHS A;  2IGN A;  1GHC A;  3MAJ A;  3NWT A;  1ZGJ A;  4K1X A;  1W35 A;  1K83 J;  1BR2 A;  2HI3 A;  3O8G A;  4MTE A;  3SYT A;  2O8K A;  3ZZ0 A;  5AIQ A;  1FOK A;  2BVL A;  2DYR H;  1OGM X;  3ZQL A;  3GLL A;  1OCC H;  5FRO A;  4LIU A;  2CQX A;  4RS8 A;  4BJT A;  1YIJ B;  4AIJ A;  1CF7 B;  2F1L A;  2F48 A;  2MLK A;  5CDF A;  2HS5 A;  1G59 A;  4CSW A;  1A35 A;  5J3L A;  4FCY A;  2QN6 A;  5A8A A;  1XB4 A;  5DD8 A;  1D8T A;  4RD2 A;  1X58 A;  5HKK A;  3ZZT A;  3B90 A;  5B1B H;  2HOT A;  2XEX A;  3FXK A;  1S0U A;  3H1C A;  2QM3 A;  3TO7 A;  3BDD A;  3DCF A;  2RQP A;  2LY2 A;  1IUF A;  2DDB A;  4WXH A;  2ZZQ A;  1Z9C A;  1FOW A;  2QEX B;  3OKX A;  2DER A;  2IT0 A;  3T8T A;  1ZN2 A;  1ZLK A;  1I27 A;  4C3I J;  2EFN A;  1T38 A;  4NC6 A;  5HLH A;  2VKH A;  3MZ8 A;  4P55 A;  2HVR A;  3J7Y J;  2HQ5 A;  2FX0 A;  4X8I A;  1S7A A;  4HF0 A;  1MBH A;  1ZK8 A;  2EIL H;  3A8K A;  3BCF A;  1BHE A;  2K9M A;  2AHQ A;  1ETY A;  4XOT A;  2R7F A;  4DBR A;  3A01 A;  2E1B A;  4ZDL A;  1UHW A;  2NT9 A;  2OZU A;  2ISY A;  2OPT A;  3PM1 A;  1G7S A;  4FXU A;  4QIW N;  2MH2 A;  3GLX A;  4AIH A;  4CCJ A;  3L00 A;  2ACJ A;  3LOC A;  4A12 A;  2F5D A;  2RC4 A;  1XGS A;  1BA5 A;  5A89 A;  2HGC A;  2F2E A;  3IV5 A;  4M2L A;  1ITY A;  3ZOB A;  2ZL7 A;  5TR9 A;  3OYE A;  2XSD C;  3KLN A;  5TGT A;  3IH2 A;  4DZJ A;  1HF0 A;  3CF2 A;  3E97 A;  4LD5 A;  4IHY A;  5A2Q K;  2BV6 A;  3ULQ B;  1R23 A;  2R7V A;  5FLX K;  1OFE A;  3JCU C;  1GXP A;  3PUB A;  5F0F A;  2VFN A;  1O7F A;  3FIS A;  2QYU A;  2PMU A;  4PFP A;  2VNK A;  1SKY B;  2PBI A;  2XTX A;  5ILV A;  2NNY A;  4Z4R A;  3DEE A;  3LYC A;  2EFG A;  1ZHF A;  4Y9R A;  1XMA A;  2CRG A;  3ZUG A;  2V7U A;  2G0E A;  1FNC A;  3LFU A;  5M3M J;  1MH3 A;  2ZNZ A;  2PX9 A;  3M1C A;  1F43 A;  2WZN A;  4YIR X;  2OCC H;  2RRE A;  3ZMD A;  2J8I A;  3DF8 A;  3SJP A;  2OV7 A;  4KIB A;  3JQQ A;  2Q0O A;  4PJ0 C;  5DDG A;  4OOS A;  2JDI A;  3BR1 A;  4NK6 A;  3H94 A;  4IHX A;  3PEN A;  3A3G A;  3RI4 A;  5IYN A;  3GXO A;  3NAW A;  4RAF A;  3ABK H;  3C1D A;  3TKY A;  2KRH A;  4ENJ A;  1IB0 A;  2VBU A;  5H6R A;  1VQ9 B;  1UB9 A;  3PFY A;  1IDK A;  1VQL B;  2ECC A;  4L9N A;  3HEF A;  4MQV A;  1FOX A;  4UY8 I;  3DPL C;  2M0C A;  3VWB A;  2DMQ A;  4HX7 A;  4CCM A;  4KIT B;  4P25 A;  1E62 A;  3CME B;  1YYV A;  3KEO A;  1KD1 D;  3B73 A;  1JUP A;  5F04 A;  2F3L A;  1Z21 A;  1RPW A;  1LE8 B;  2WSS A;  3S8P A;  1JGS A;  3JSP A;  2BM5 A;  1JUM A;  1U9O A;  3CUO A;  3KX2 A;  4M0L A;  1JHH A;  1WJA A;  4IXA A;  2L3D A;  3J80 K;  2XT2 A;  2YWF A;  2V5I A;  3PNY A;  2XVC A;  4PJM A;  4WX9 A;  2F4N A;  2RGV A;  3HHH A;  2QSH X;  2KIF A;  2BVM A;  3K4C A;  5TRD A;  1E3P A;  2R5Y B;  3I56 I;  4A93 J;  1R5N A;  3G6E B;  5DS0 A;  1TYW A;  1DAB A;  1BI3 A;  3K69 A;  3LSJ A;  4L5E A;  5F64 A;  1ZRC A;  2WJV A;  3RPQ A;  4EEF G;  2XPU A;  3CDL A;  4D0P A;  1SMT A;  1U9N A;  3FXJ A;  4HG2 A;  5D5U B;  5FRN A;  3GRH A;  1ACI A;  4A3K J;  1BJZ A;  2NRA C;  2IS4 A;  2IS2 A;  2HKO A;  3HUG A;  3MZY A;  3QU6 A;  9ANT A;  1GAW A;  4YZ0 A;  1IB4 A;  1FYL A;  4NC7 A;  4FX0 A;  5CYV A;  2W57 A;  4X0G A;  3WE2 A;  2VUM J;  2ZTN A;  1LDK B;  1TWF J;  1P9Q C;  1QRC A;  5HLG A;  1W9X A;  1XMK A;  2FRH A;  2DA3 A;  2ICW G;  5F4M A;  2Q1Z B;  1SAX A;  1X1B A;  3S3M A;  4XOP A;  2BN4 A;  1R9T J;  3LVB A;  2WY7 Q;  4DQK A;  4OIO F;  3B4N A;  1WJE A;  3OYM A;  3B78 A;  1ULY A;  4QHY A;  1YLF A;  5J4V A;  3CLQ A;  2V7W A;  1O8F A;  2HYJ A;  5J1Y A;  5F08 A;  3JTH A;  1HG8 A;  3GX4 X;  4ZC3 A;  3WNC A;  1W87 A;  1LVA A;  2PIA A;  1KQ0 A;  1D0Y A;  3PSS A;  3U1K A;  4W8S A;  2ISZ A;  2CQ7 A;  4NUB A;  4JRA C;  4JQF A;  2V1N A;  2NVY J;  3LSP A;  4WCG A;  4XN0 A;  1YTY A;  2JA5 J;  2W00 A;  5GV8 A;  1ZAR A;  4OJ5 A;  1U3E M;  2JMW A;  3I53 A;  3CXC B;  1TYU A;  4BBR J;  2OBP A;  1IUY A;  1U8B A;  1VLY A;  4G5G A;  1F4K A;  1F5T A;  1F36 A;  2ZB9 A;  4LBV A;  1SM4 A;  3W6J B;  4B09 A;  5DD4 A;  4EW9 A;  2W24 A;  3LSM A;  2OK8 A;  4U49 A;  2XAU A;  2A69 F;  1QZZ A;  1OFC X;  1R4M B;  2YX4 A;  3H5R A;  3OOU A;  4TV7 A;  5FKN A;  3OOP A;  4NB5 A;  5J6X A;  1KQS B;  1P4W A;  5J1R A;  5FGM A;  2FBK A;  2Q2E A;  3S93 A;  2XUB A;  3JRC A;  1XG2 A;  1D8J A;  3G71 I;  3ASP A;  4AID A;  3ZP5 A;  2R6H A;  5J47 A;  4PJJ A;  4ETS A;  3OV8 A;  3JRI A;  1APL C;  2GJP A;  3ASR A;  3HOT A;  1B9N A;  3S2H J;  1GDT A;  2AHO A;  4IQ4 A;  3CCE I;  4B3F X;  1LNW A;  2BXZ A;  2VT3 A;  2HDD A;  1YW9 A;  2ZFW A;  2GXB A;  4YFO A;  2VFM A;  2DA1 A;  2NZM A;  1QUF A;  1YRN B;  4DJA A;  4HV6 A;  5C1C A;  2VIX A;  2YSR A;  3V7S A;  3OIQ A;  1QVT A;  3RCO A;  3BTJ A;  1OB2 A;  3JRH A;  3EYI A;  1RNL A;  1GQ8 A;  2ODL A;  4XD7 A;  4DBQ A;  4Z06 A;  3JU4 A;  2WV0 A;  2E2H J;  4E7S A;  5KVR A;  4BEH A;  4YEI A;  3ZQH A;  4QSH A;  1EP3 B;  2NS7 A;  2ZNY A;  2JIZ A;  3KZY A;  1YJ9 B;  4D1Q A;  1FRQ A;  4I99 C;  1AKH A;  1PJR A;  2XND A;  4H0E A;  1YLO A;  2COM A;  2KIU A;  1ZRD A;  4QVJ A;  1JKQ C;  3B6A A;  3LL7 A;  2YUH A;  3KP7 A;  3ML3 A;  4PFO A;  2QY1 A;  4TMT A;  2E1O A;  5HDG A;  2M9H A;  4G94 A;  3BC8 A;  3PJR A;  1VQM I;  3F72 A;  2LF7 A;  4A0Y A;  4F91 B;  2VBT A;  1OCO H;  1QVF B;  2BF4 A;  3P26 A;  1T56 A;  2CSO A;  1M1K D;  3VSL A;  4LK0 F;  2V7Q A;  2HOE A;  3TDZ C;  5IPA A;  1NG7 A;  3F9K A;  2AQE A;  5JHU A;  5L3B A;  3A3B A;  2Z6B D;  4PC7 A;  4LJZ F;  2B0R A;  1XPX A;  1QJV A;  3E20 A;  1IRG A;  2VNI A;  4XK4 A;  2QQ8 A;  1JI8 A;  1LFU P;  1OOC A;  5H6Q A;  2UVE A;  4OIR F;  3ZSC A;  2GAU A;  3Q0V A;  2IRF G;  3A0B C;  2EPF A;  1VHO A;  1X2M A;  1O88 A;  1POG A;  4BQA A;  2E1M C;  3BY2 A;  2XZL A;  2EWN A;  5KNL A;  3E5X A;  2DMN A;  2W7N A;  3FWE A;  1S72 B;  3M8J A;  1OIS A;  1W1W E;  2OZ6 A;  5KAF C;  1FMV A;  4U0W A;  2CO5 A;  4CCO A;  3B8H A;  2I5U A;  4XM3 A;  2HR3 A;  4MEX F;  1IN6 A;  3SZT A;  3GYH X;  4UUV A;  1BOA A;  4Y9U A;  1KQ8 A;  1W0U A;  1CNE A;  4NDL A;  1I3Q J;  5HLT A;  1YX2 A;  3RIR A;  3QOP A;  4OOI A;  2VPL A;  2WY8 Q;  4ZTF A;  4MR0 A;  3VNU A;  1MMD A;  1YS7 A;  4FIS A;  1W7P A;  3TL4 X;  3ZQC A;  4AU7 A;  1MMA A;  4UUS A;  4KUM A;  1R7J A;  2XF6 A;  1B23 P;  2X6W A;  1I18 A;  5AN9 A;  2F4I A;  3ABL H;  1PJ5 A;  4I0B A;  4JBA A;  2K9N A;  3BY6 A;  1MIJ A;  1DDG A;  5JVT A;  3HTU A;  1HQC A;  2L9R A;  2ECB A;  5IT3 A;  2VOD A;  1BX0 A;  2LG4 A;  1YI2 I;  4WZE A;  2QZA A;  3A02 A;  4GCV A;  3RDI A;  1LEA A;  4I2O A;  1O3T A;  3IAS 2;  4X7F A;  1DU6 A;  2XB5 A;  1ZLJ A;  2QSF X;  2XF7 A;  1TQP A;  4ZV4 A;  4HQM A;  3T0Y A;  2GQQ A;  4Q4Z F;  1HW2 A;  3EQL F;  3BH6 B;  3FXO A;  2D2W A;  1D1C A;  3MKL A;  1SD5 A;  2DA6 A;  3U6K A;  3QFR A;  1NK2 P;  4KIS A;  3M1E A;  2XAF A;  2WV1 A;  1E43 A;  2OTL B;  1HXD A;  2EZI A;  1Y1W J;  3V8K A;  2Q6I A;  2A61 A;  4HAM A;  4L18 B;  3P7N A;  2C78 A;  4BAC A;  3ESW B;  1LB2 A;  2CF4 A;  1T6Z A;  3VO1 A;  3W2A A;  1F1Z A;  2LVS A;  2V7X A;  2V6E A;  1SD4 A;  1MRZ A;  3J81 Z;  4LIT A;  3DU6 A;  5EDN A;  5EGO A;  2BOL A;  1J5Y A;  1WJ5 A;  4KT5 C;  3BQY A;  3MWM A;  4PAA A;  2LTP A;  2ZL6 A;  2BE5 F;  3ZR8 X;  3WWG A;  1JA0 A;  4EM1 A;  4B48 A;  2R7D A;  2ZJP F;  1KQ9 A;  1LUJ B;  2IS1 A;  1SVO A;  2R4G A;  1I5Z A;  4A3J J;  2GM4 A;  1JXS A;  5CJ9 A;  1Z91 A;  1GAQ A;  1P4A A;  5E20 A;  1RI7 A;  5BMZ A;  5HS8 A;  5FLM J;  3M07 A;  3BJ6 A;  3IWF A;  2RNJ A;  1RUO A;  4IQJ A;  3CC4 B;  4OAY A;  4XRS G;  1TVC A;  3QE2 A;  5ICC A;  1OJL A;  1EFT A;  1KYZ A;  2XHK A;  2VYQ A;  4XLE A;  4X05 A;  3DU1 X;  1UST A;  4CGZ A;  3JUR A;  4IEJ A;  1IHM A;  1ZM2 A;  4W97 A;  4RMN A;  1DBG A;  3VDX A;  4AIK A;  3CCS I;  5BS6 A;  5FLV A;  4LIV A;  1I6H J;  3TDU C;  4YDT A;  4KT6 A;  5L3C A;  3F3X A;  4ZDP A;  3HB9 A;  3ABU A;  4B8X A;  4UVC A;  4DZP A;  2C4U A;  2F6C A;  2VC1 A;  2W7Z A;  3RPU A;  5D8K B;  1UHS A;  1STZ A;  5LHI A;  3VNV A;  2XAQ A;  3OYC A;  1K7A A;  1MAB A;  1SAU A;  2QTL A;  5IOZ A;  1G7R A;  2P0W A;  2IGM A;  3G1O A;  2VQC A;  4L0Y B;  5JLW A;  3CF5 F;  2VAS A;  2XAH A;  2YWG A;  2VBK A;  2K27 A;  2DXI A;  4ZCI A;  4UV8 A;  5F6F A;  1EP2 B;  2EV0 A;  4PK4 A;  2E7W A;  3AVU A;  5BSX A;  1BIA A;  4YAL A;  5LRS A;  4BNC A;  2QMU A;  1SVM A;  2WAQ A;  4RD3 A;  1J7K A;  2KZG A;  2AO9 A;  3C2B A;  1X1D A;  4BUP A;  3CC2 I;  3GTK J;  1OCR H;  3OZW A;  4X6A J;  1EE6 A;  1OKR A;  4HF1 A;  4HA8 A;  1QO0 D;  1B59 A;  2KJC A;  5CVV A;  4D7M A;  3S16 J;  1T6Y A;  2WJY A;  1K73 D;  1MW7 A;  2HLD A;  5DM6 F;  2QQB A;  2X4H A;  3K4J A;  2DIE A;  4MYU A;  2A5Y B;  2O0V A;  5FNZ A;  5GTH C;  3LST A;  2MLG A;  4OU0 A;  1CLW A;  2BSP A;  1U78 A;  1I3A A;  2VKE A;  3IHU A;  3HOY J;  3P27 A;  5TY0 A;  1KON A;  4KMF A;  2NTQ A;  1WJD A;  3BCA A;  1Z67 A;  2M45 A;  3N90 A;  5D4S A;  1T33 A;  1O8G A;  2MSY A;  3VEP A;  4PDK A;  3AVY A;  3CW2 A;  2BM0 A;  2O03 A;  3G4S I;  1OLT A;  5FL7 A;  2QKL B;  4JYK A;  2ZIT A;  1I1S A;  3K1N A;  1PJ7 A;  1PUE E;  1WOP A;  2CFX A;  3ZGK A;  1J75 A;  3QPL A;  2XRL A;  2M0M A;  1MD0 A;  3KPH A;  1MZB A;  5EG0 B;  1W5T A;  4HEA 2;  3C7J A;  3LSK A;  3WGH A;  4XID A;  1Y1V J;  1LM1 A;  3CB4 A;  4II3 A;  2A68 F;  2K9L A;  4BXX J;  4URR A;  3T9G A;  3BC9 A;  5F1R A;  1LEB A;  2JA8 J;  4MFD A;  4PSW A;  3HGG A;  5ICF A;  3KYL A;  2LFB A;  2JK3 A;  3TO9 A;  2DJN A;  2DOE A;  4FHT A;  4A5N A;  3NAU A;  1X1A A;  4Z4Z A;  3Q3S A;  3QAH A;  3JRD A;  2QZ8 A;  3WTY C;  2UZK A;  1DPU A;  1KC8 D;  2ZXI A;  4BQO A;  4U0Y A;  4C3H J;  2UXN A;  3E7L A;  1XCV A;  2DOA A;  2JPB A;  2OCE A;  3NE5 B;  4Z6Y A;  1YX3 A;  5FO5 A;  1VND A;  5F27 A;  3DBL B;  4ANJ A;  3U2R A;  1J59 A;  1BC7 C;  2FE3 A;  1CZF A;  5FD6 A;  1QFY A;  2BPO A;  4E7L A;  2DQR A;  2V1X A;  2QUF A;  4ZTJ A;  2MC3 A;  2XAJ A;  2P7C B;  3W5H A;  3H5A A;  2VBZ A;  2LMD A;  3DEU A;  1G4D A;  4W8R A;  2G0Y A;  3I56 B;  2BHZ A;  2Z3Y A;  5HOO A;  2JRM A;  3LA7 A;  3NQO A;  3PFI A;  1NH3 A;  4CA0 A;  1S29 A;  4PGO A;  1TLL A;  2VQH A;  1JA1 A;  2YX7 A;  4PC3 A;  1ETV A;  3W2I A;  5DNS A;  3J7A Y;  3O2P E;  2F4M B;  2OQG A;  2R7T A;  2VNJ A;  1G7C A;  2H6B A;  3BTI A;  3FDY A;  5K5R A;  2LKX A;  3OSF A;  4CDG A;  3BLY A;  2HEO A;  1XE1 A;  4OMY A;  2NTP A;  1S7E A;  4XN3 A;  5M5X J;  2XGJ A;  1W0K A;  1R22 A;  4UNO A;  2LZJ A;  3BNW A;  4P9S A;  3VO2 A;  2Y30 A;  3CZ6 A;  3OYB A;  4DGW B;  2HPM A;  3GW2 A;  2ZO4 A;  3NRV A;  4OAZ A;  1FT9 A;  4AC0 A;  3SQV A;  2WB1 A;  4UAJ A;  1REP C;  2Y31 A;  5IP6 A;  1KRH A;  2M8E A;  3QOE A;  3OYD A;  1WTH D;  3PSZ A;  3K70 C;  1KCC A;  1OMI A;  1FTZ A;  3QFT A;  2IXS A;  3E6C C;  2X3H A;  1SFK A;  2DFF A;  4F3Q A;  5C44 J;  4ASU A;  2HVS A;  1NB0 A;  4ZYH A;  1WJF A;  2FU4 A;  2JPC A;  1YJN I;  5LGU A;  3RZO J;  3ASS A;  1RUN A;  1O8L A;  1MDM B;  4KNY A;  2VBS A;  4RD6 A;  3SDB A;  5IYD J;  4F7Z A;  3Q0U A;  2B7B A;  3KIO A;  4RGX A;  5E17 F;  3K2A A;  4HE6 A;  5C1E A;  4ZJZ A;  2HVQ A;  1EA3 A;  2EZL A;  5EYR A;  3U21 A;  2R7U A;  3ERE D;  2ZZG A;  2OTJ I;  3C3W A;  2BZT A;  1YW7 A;  4YII A;  1T0F C;  1PUF A;  2E2J J;  3S1N J;  1WOS A;  3EUH A;  4M6Y A;  1MSE C;  4YXW A;  3KL9 A;  4CUG A;  2EWE A;  5GAD J;  3G71 B;  2YU9 J;  2JSP A;  1E2X A;  1WGX A;  2L01 A;  5LGN A;  3A35 A;  3OEH A;  5D5W B;  4RBO A;  3K9T A;  1LDD A;  1O8E A;  3W6V A;  1K9M D;  3FXQ A;  4RB1 A;  5CQE A;  1FX7 A;  3CCE B;  3ZN0 A;  2PN6 A;  3C18 A;  5M5W J;  5BPI A;  1R5G A;  5HNF A;  3SEZ A;  3CCV I;  1ZRF A;  1V0F A;  4Z4S A;  4P3I A;  1BIB A;  4QLC U;  3F8M A;  3L7W A;  3NWS A;  3SZG A;  3BH4 A;  5DV5 A;  1VQ7 I;  1EF4 A;  2IJL A;  2EA2 A;  5L3F A;  5GAH J;  5C3E J;  3FKI J;  1JKO C;  5D6F A;  2QE7 A;  3PQJ A;  2E5Z A;  3RZD J;  5LMZ A;  4DYQ A;  4G8X A;  4HNV A;  4MO7 A;  4TT3 A;  2XGD A;  2I8D A;  4Q47 A;  3FKJ A;  2VB6 A;  1WI9 A;  2XF5 A;  1I7P A;  2OBS A;  3HXL A;  3GO5 A;  4OOV A;  4DQL A;  3H09 A;  1RWR A;  3TO6 A;  3CO6 C;  1F60 A;  4PZJ A;  5H20 A;  4A3I J;  2VXD A;  2EIM H;  3GF2 A;  1B8I A;  4NNJ A;  5DCM B;  3KET A;  5IYP A;  4BQN A;  1VJS A;  2ESH A;  3JW4 A;  1T5E A;  3I9V 2;  3E5U A;  3LQ6 A;  3TP0 A;  2DFH A;  1JUS A;  3IC7 A;  4RLZ A;  1UG0 A;  2JUG A;  3E6D A;  4N0B A;  5K7Z A;  5DSZ A;  4C2L A;  2B63 J;  2J7K A;  3GZ5 A;  3LSI A;  1BBY A;  4ENK A;  3SYJ A;  3HBL A;  3JRE A;  3WBK A;  1OFM A;  2JN6 A;  4B44 A;  2F4O B;  4DW6 A;  3PA1 A;  3FZV A;  3ZN1 A;  1SMY F;  3LFK A;  3SQN A;  1UEL B;  2CW5 A;  3ZIA A;  4W8T A;  3FM3 A;  3K70 D;  2X6Y A;  4N9H A;  1KK1 A;  2CGP A;  1RKT A;  4ESF A;  5ILU A;  1X1P A;  3CCL I;  3S3O A;  4LB5 A;  1Y0R A;  3OJW A;  4BJ6 C;  2RC5 A;  4XMY A;  3SZE A;  5DCF A;  4P1W A;  3AAF A;  2EJR A;  1B2R A;  1UG2 A;  2LH9 A;  2B7E A;  5J8C A;  3CC7 I;  3BG7 A;  3OOC A;  1DUX C;  4CCN A;  5LD2 C;  2MH9 A;  2VT2 A;  2ME6 A;  2NV4 A;  3T53 B;  3TMO A;  1M90 D;  3VR6 A;  4RAG A;  4J01 A;  3KYC B;  4L9T A;  1XDS A;  4MIM A;  1NRK A;  4IW3 B;  1MH4 A;  2IA0 A;  2ZME B;  3R4K A;  3S14 J;  2W84 A;  1WXR A;  2VZL A;  2CQQ A;  1O3Q A;  2XAS A;  4IHW A;  1QVU A;  3W2W A;  3DKY A;  1FZP B;  3B6C A;  3F0C A;  3SKB A;  2HCJ B;  3JAM K;  2BGJ A;  1QQ1 A;  4RB3 C;  4G6I A;  1D5Y A;  1D0Z A;  4CYC B;  3K10 A;  1QPI A;  1EH7 A;  3ONU A;  3ERM A;  2IW5 A;  1YW8 A;  3QPT A;  4AF6 A;  2GK7 A;  1YI2 B;  2GK6 A;  2LYC A;  2Y69 H;  1R5H A;  1SVL A;  2DLL A;  2P4W A;  2QGU A;  4MLO A;  3CMY A;  1HST A;  2F43 A;  2LRD A;  2YWH A;  4MYT A;  2B9S A;  2ELK A;  5IK2 A;  1TC3 C;  5D8L B;  3OYN A;  3L9F A;  2DEU A;  4UV9 A;  2V9K A;  3CJN A;  4CIC A;  2RC6 A;  2W82 A;  3HGY A;  3HDD A;  2XT4 A;  1P7J A;  3MKZ A;  2OBT A;  2LP0 A;  2HTJ A;  3OR2 C;  2DT7 B;  1Z6R A;  2OC6 A;  2GJK A;  4MXN A;  3W2H A;  2XKP A;  1AMO A;  2VJJ A;  4BGD A;  3D5L A;  4UZE A;  3LA2 A;  3GIR A;  4B3A A;  2O9L A;  3LO8 A;  2E1N A;  3TOA A;  4BDY A;  3LSG A;  3FXR A;  4E7I A;  1IDY A;  4XKC A;  1C0W A;  3KP6 A;  1BL0 A;  1N77 A;  5A88 A;  2LRE A;  1A31 A;  4RD0 A;  4UB8 C;  2BY2 A;  2QX3 A;  1TWC J;  3WQZ A;  2MD5 A;  2LDU A;  3A01 B;  4ACA A;  4KN4 X;  3ZBT A;  3PSF A;  3WG9 A;  1KZH A;  1E63 A;  2E60 A;  4A3C J;  4FX4 A;  1KK2 A;  2ZKZ A;  1QNT A;  2WAQ N;  1ZG5 A;  4QPO A;  1J09 A;  3GCM A;  5HXB A;  2MFZ A;  2OUM A;  3BTC A;  2IS6 A;  4G1V A;  4UZF A;  3DBH B;  4S0H B;  4XL9 A;  3GTM J;  2HZT A;  3OYI A;  4ZCM A;  3L2C A;  3ASQ A;  3KP2 A;  1Y8Q B;  2DCU A;  1GXQ A;  2G7U A;  2HU9 A;  3F8C A;  4BE2 A;  2EV5 A;  3CPW B;  5B66 C;  3W2G A;  3I55 I;  1N06 A;  1JTX A;  3M8F A;  2BW3 A;  2Z1D A;  1UD3 A;  2NXN B;  3OYF A;  2O6G E;  4A3G J;  5AIP A;  5IYR A;  1ETX A;  2KIQ A;  3HHG A;  3LQR A;  2INU A;  3Q38 A;  1D5V A;  5JI6 A;  3J81 k;  4LLG F;  4AYB A;  3AKZ A;  4KH3 A;  3SUC A;  1SFE A;  3WTS C;  4RAY A;  4EM2 A;  2X1E A;  1QG0 A;  3MD2 A;  1H80 A;  1K79 A;  2NAZ A;  2O0Y A;  3VOD A;  2FXA A;  1WJB A;  2UV1 A;  3FXM A;  2KHM A;  3PL8 A;  1HC8 A;  1QA1 A;  2FNA A;  2CV1 A;  1LLW A;  2HOA A;  1NB9 A;  5JVG F;  4HV5 A;  3K2Z A;  2FBH A;  4YCQ A;  4E7H A;  2HDW A;  4A5M A;  3TW7 A;  3WTT C;  3IKT A;  4L0Z B;  2M5W A;  1PP8 F;  5A2Q Z;  1O57 A;  1S7O A;  2EIN H;  2QLZ A;  3DEW A;  1CQT A;  3HTS B;  1TWG J;  2EFO A;  5GPA A;  5LBQ A;  5E3O A;  4KFC A;  1UD8 A;  4EJW A;  1XTA A;  1Y56 A;  1BM9 A;  3PIP F;  3CC2 B;  2Y0M A;  5JMC B;  2K5C A;  2COB A;  2A3S A;  2CH0 A;  3KEY A;  3A1Y A;  4XLF A;  2P3M A;  1N0U A;  2YPR A;  1WP6 A;  2OK7 A;  4X1E A;  1N08 A;  4C3J J;  1WPC A;  2BSA A;  1T0F A;  2KDZ A;  3BRO A;  3H36 A;  1PKV A;  4BKX A;  2PMZ A;  4HST A;  4GYI A;  2M7A A;  2FBI A;  1WKM A;  4OPV A;  2QQA A;  4HBL A;  2Z16 A;  1IDJ A;  4LB6 B;  1JT6 A;  4GGG A;  3M9A A;  1ETK A;  1O4X A;  1HZE A;  2HXO A;  3QQA A;  4V19 K;  4J00 A;  1QUE A;  1A6I A;  2L7M P;  2LNB A;  4OOX A;  2W6J A;  3HUG B;  4ZYA A;  3OPO A;  4RCZ A;  1E3H A;  3GWZ A;  5FKM A;  3G4S B;  2OA4 A;  5J35 A;  3GFI A;  1DGW Y;  4M53 A;  1IO2 A;  3LMM A;  2R7Z J;  3VYR B;  2W25 A;  3BJA A;  2M5S A;  2K3F A;  5CPR B;  3GQB A;  4RD1 A;  2D3L A;  4HZF A;  3UNG C;  1UMQ A;  2LY1 A;  2H27 A;  1W7P D;  3ZMV A;  4BXF A;  1E1Q A;  1XCB A;  1ZTR A;  5EF6 A;  1V54 H;  4XLA A;  4KIF A;  2DK8 A;  4Y4R A;  4BE1 A;  2P7V B;  4A0X A;  2X6O A;  3OS2 A;  4LBW A;  3BG6 A;  2WB1 N;  3OYH A;  3DPU A;  3ABM H;  3GTG J;  5FKK A;  4TMZ A;  2NT6 A;  4FE7 A;  5F0H A;  2DPU A;  1V5F A;  1WU8 A;  2QXZ A;  2ID3 A;  3Q6Q A;  1X4P A;  3ABT A;  1FOY A;  2R93 J;  5E1Z B;  1E64 A;  5LHG A;  2E36 A;  1HKQ A;  2V31 A;  1X3U A;  1OCP A;  4EJT A;  5CKT A;  2DAO A;  4XON A;  5KAI C;  3R6S A;  4CCL A;  1QHH D;  1SFU A;  5TV2 A;  5HZB A;  3G1M A;  3BQZ A;  1FNB A;  3J7A O;  5HDN A;  2A6H F;  2QEN A;  1QGZ A;  3P9I A;  4HWV A;  1IG7 A;  5J3O A;  2TRT A;  4W8Q A;  5K1Y A;  3OYG A;  1QU3 A;  3S2W A;  1L1I A;  2Q2E B;  4ABZ A;  2QA4 I;  1S5L C;  4LK1 F;  3S1M J;  3OIP A;  3OW2 B;  3MKY B;  5EEA A;  1VQ4 B;  1P4M A;  1TUI A;  4AF7 A;  2JTV A;  4X7D A;  2RDP A;  2R7X A;  2LC2 A;  1Z3X A;  3HSF A;  1X4O A;  2V7T A;  1UCR A;  3OL4 A;  3AG1 H;  2B5O A;  4WZK A;  2XZO A;  3WU1 B;  4WXC A;  1T6S A;  4KJZ A;  4BPR A;  2CK3 A;  4I02 A;  1WRJ A;  2W85 A;  5J4Y A;  4A3M J;  1FYK A;  2L02 A;  1FP1 D;  3LSR A;  2JJ1 A;  5ED4 A;  4F52 A;  3CD6 I;  1TP4 A;  4YZQ A;  2PQ8 A;  4YFX F;  4A6D A;  3F23 A;  3HOV J;  3G2B A;  1B4A A;  1WVR A;  1WI3 A;  4CHU A;  2HYG D;  3MCZ A;  3ROU A;  4JX6 A;  2CRV A;  5F4J A;  2ZL5 A;  1HF2 A;  3GEZ A;  3KCC A;  1AKH B;  3WHC A;  2D5V A;  3E0J B;  2NVT J;  3FHZ A;  2QGG A;  1FIP A;  3AL0 C;  1N75 A;  1AU7 A;  4IKF A;  2CW7 A;  3I54 A;  5LFA A;  4BH9 A;  3IRQ A;  3OSG A;  4Z4T A;  1HLV A;  1DP3 A;  5E1X A;  3ZCO A;  1IF1 A;  3HSR A;  1YIT I;  1K78 A;  1OQY A;  4NK8 A;  2VBY A;  3OYL A;  4IX7 A;  1AA7 A;  4RM3 A;  3IAM 2;  2XTY A;  2NYX A;  2WAE A;  4I7H A;  2R7W A;  2FSW A;  4XLC A;  2XOK A;  1ON1 A;  2CS3 A;  3RPU D;  1S9H A;  1Q82 D;  1KZL A;  1E79 A;  2LY9 A;  5D6E A;  1DP7 P;  2IA2 A;  3AFH A;  3S3N A;  2OTJ B;  1HSJ A;  2I10 A;  2KDO A;  4Y15 A;  3WU0 A;  4F55 A;  1JTA A;  2P6T A;  2Y75 A;  3BZ6 A;  3OP1 A;  3L2W A;  3KZZ A;  3CO7 C;  1CNF A;  4E4H A;  1H9G A;  3FPK A;  3UR3 C;  3WE3 A;  4X06 A;  1U5T A;  1IC8 A;  2VFQ A;  5K7F A;  2HFH A;  3K7A J;  3VB2 A;  3CCV B;  1VQK I;  1RQR A;  4RLQ A;  3GQ9 A;  3IP4 B;  3JRA A;  2D74 A;  2VBW A;  1Z05 A;  3OS0 A;  2HKX A;  2LKP A;  1GV2 A;  1VQ7 B;  2DW4 A;  5LHH A;  2PLF A;  3JRG A;  1OYI A;  1TQI A;  5L46 A;  1RR8 C;  3A2K A;  3P9K A;  5EEH A;  2BMW A;  3BCD A;  3PO2 J;  4ZGN B;  1EJ9 A;  5E8G A;  1W7P B;  1WSV A;  1LDJ A;  4M72 A;  4UUS B;  3ZBU A;  3DBR B;  1X2N A;  4BS9 A;  3CP2 A;  3BR2 A;  2DOD A;  1FY7 A;  1OYW A;  1XG1 A;  2MW8 A;  2A6T A;  3KZI C;  4P9U A;  4G7O F;  1WSR A;  1JKR C;  2PEC A;  2DMT A;  2XNC A;  4ZH4 F;  1A04 A;  4C30 A;  2VE8 A;  4PUS A;  3CCQ I;  2K40 A;  1VQ6 I;  5E3L A;  1Y0U A;  3SLN A;  2DCE A;  4QTR A;  3QOD A;  5HS7 A;  4LG0 A;  3VFZ A;  4OJL A;  2FQ4 A;  4M6X A;  4U7B A;  1V5E A;  2A07 F;  1QGY A;  4PJL A;  1J0R A;  3CLO A;  5FFZ A;  2JJ7 A;  1T2K A;  4G7Z F;  1YIJ I;  1ZQ3 P;  2KIS A;  3OAA A;  2DDA A;  2VBX A;  3DTI A;  4RB2 C;  3DKW A;  3WHB A;  1OCT C;  5FRM A;  4EQQ A;  3FJO A;  4P6Y A;  3EUH C;  4X0C A;  1K28 D;  3WTU C;  1SAN A;  1KTW A;  3REO A;  2DA7 A;  2KRF A;  4XNF A;  1Z0X A;  2V79 A;  1R00 A;  3N05 A;  2OF7 A;  4DNT B;  5GV7 A;  3CCL B;  4KIG A;  4G7H F;  2D9R A;  2GLO A;  4YG2 F;  2EV6 A;  3CC7 B;  1OPC A;  1TQM A;  4OZZ A;  1G3S A;  3CUQ A;  5LEK A;  1I8D A;  5EGO B;  4Z4W A;  3JSO A;  3RTR A;  4CCK A;  4Z4U A;  4HX4 A;  1N78 A;  1XX5 A;  2IPQ X;  1IV8 A;  1G3Y A;  3OIO A;  4NQW A;  4M74 A;  4EH1 A;  2O61 A;  2CG4 A;  1G3T A;  2O1D A;  2H6C A;  5F0C A;  2IA1 A;  3ML6 A;  4D5F A;  3Q39 A;  1BX1 A;  4EGZ A;  4QPQ A;  4P6V F;  1H42 A;  3CMM A;  3Q9V A;  1TTY A;  2GIV A;  1PE9 A;  2M3A A;  3GZ6 A;  3AK5 A;  1BN5 A;  1B72 A;  3WTZ A;  4ZGQ B;  1Q1V A;  4BY7 J;  1FJL A;  4UHT A;  1FPQ A;  4KDP A;  3S32 A;  1O8H A;  1T95 A;  3PUM A;  3MMP A;  3DTE A;  1BMF A;  4AUX A;  5M5Y J;  2AXT C;  1Z6T A;  4BYY A;  1Y39 A;  3RY8 A;  3R0J A;  2DMU A;  1JB9 A;  2GA1 A;  4E7J A;  1U2R A;  1EZG A;  3FBN B;  3I3L A;  5HNH A;  2XPV A;  4YRV A;  2E7X A;  4TKO B;  2KVO A;  2DA2 A;  2CUE A;  2VE9 A;  3W5U A;  1NJI D;  4C43 A;  4N4O B;  5ERI A;  4AYB N;  4FQG A;  3HRU A;  4AM3 A;  4Y33 A;  2RN7 A;  4XBF A;  4WF2 A;  4CH7 A;  1V0E A;  2M87 A;  1OGJ A;  1LLZ A;  5JLV C;  1TW2 A;  3KP3 A;  4RDJ A;  2M7B A;  2MC4 A;  3RQ4 A;  3A8J A;  3I58 A;  4LG3 A;  3EYY A;  2QCO A;  3ZQF A;  3BH7 B;  1VQN I;  2NVU B;  1BN8 A;  3BOQ A;  2VN2 A;  5EEG A;  1E3Z A;  2VFP A;  1D1N A;  1H8H A;  1NHC A;  2XIG A;  4BE0 A;  1TL8 A;  2NOJ B;  1HBX G;  4L8J A;  1LJ9 A;  4OMZ A;  1V5V A;  3DU5 A;  1WQ2 A;  2W48 A;  2P5K A;  2L7F P;  1KMH A;  2EK5 A;  2O6W A;  2VNH A;  1HW1 A;  1OCZ H;  3BR0 A;  2C5H A;  2Z33 A;  4LBZ A;  4WQM A;  3F8N A;  4BAY A;  2INV A;  3R0A A;  3ZC3 A;  1MND A;  2JVG A;  2DA4 A;  3ES9 A;  2QKM B;  4UVA A;  2ZXJ A;  2PYH A;  3CJQ B;  4B43 A;  2DBB A;  4II2 A;  1QVG B;  3E3V A;  4V02 C;  2CYY A;  5C4J J;  3UKG A;  2JT1 A;  3TBI A;  4JX5 A;  3BZK A;  1VBL A;  3WU2 C;  1O7L A;  2HTS A;  3BR5 A;  4OIN F;  1A8P A;  5IY5 H;  1RKW A;  5HS9 A;  2ZBV A;  1HDP A;  1V55 H;  2PMZ N;  5E79 C;  1IN7 A;  1P6R A;  3FM5 A;  2CU7 A;  2W1O A;  2DET A;  2K7L A;  1JHF A;  1MBE A;  2F5V A;  3K1P A;  3VOE A;  3O8H A;  4EV0 A;  2DYI A;  1KCD A;  4IRI A;  1WH7 A;  2VJ4 A;  3JTG A;  2HDC A;  5J8F A;  4ZYG A;  3CCY A;  4I84 A;  3GVJ A;  2PJR A;  1ZM9 A;  1Y0N A;  1Z7L A;  1W0J A;  2Y0S A;  1NG6 A;  4MFE A;  1FRN A;  5E18 F;  5EZG A;  3D5S C;  2GOM A;  3QPS A;  1XSD A;  2MGQ A;  2XZP A;  1N8R D;  2WC2 A;  1J2X A;  2IOU G;  3C2H A;  4UUT A;  3W5V A;  1FBU A;  3MZH A;  3EUK L;  5KCM A;  3TED A;  1ZYR F;  2GPJ A;  4MQ9 F;  3ZMZ A;  5B1A H;  1WDT A;  2KZV A;  2F5F A;  3FMR A;  1LPQ A;  1JRG A;  4RCY A;  2X3U A;  1QCX A;  2HWV A;  1WJC A;  2IP2 A;  1FNN A;  4Z1M A;  3AL0 B;  1T39 A;  2ELJ A;  4E0F A;  2M2E A;  2EH3 A;  4I0A A;  4YEJ A;  3CCJ I;  2I1L A;  4RPD A;  1RC9 A;  4LFU A;  1FDR A;  3HPG A;  1NTC A;  3QYF A;  1O3R A;  1TYX A;  3KLO A;  4UVB A;  3CMA I;  2XDV A;  4KN7 X;  2ZC2 A;  1OR7 A;  3QFC A;  2R5Z A;  1EKE A;  1WCM J;  2IQ7 A;  4XKV A;  1QH0 A;  2CUJ A;  2DN0 A;  3HOZ J;  2BM7 A;  5BQT A;  4IJA A;  2VFO A;  1SD6 A;  1EXM A;  2H8W A;  2E1M B;  3GTJ J;  3QP6 A;  1T08 B;  2QSG X;  2XC1 A;  3HKZ A;  4D9J A;  4IO9 F;  4KKT A;  4OP7 A;  4OIQ F;  2EFW A;  3Q3A A;  3ASN H;  1O8K A;  5J1U A;  1A36 A;  2C6Y A;  4IHT A;  2E2I J;  1Y8R B;  2WBM A;  1F9N A;  2DYS H;  4XSX F;  4HNU A;  2OBR A;  2ELH A;  1LQ1 A;  4HLY A;  2L4M A;  2GJR A;  3GSI A;  3RJP A;  1VQO I;  1IV6 A;  4BY1 J;  2NVQ J;  3CDI A;  3GFJ A;  3SFI A;  2V1U A;  4J19 A;  3RSN A;  1IXS B;  1R5O A;  3FF5 A;  2VKD A;  1FP2 A;  1ZEL A;  2LLK A;  5FB2 A;  3N4M A;  4DYC A;  4O6J A;  4XSZ F;  3HRT A;  2QBY A;  1KGS A;  1FLI A;  3WXM A;  1GVJ A;  3WNB A;  3HZJ A;  5ICG A;  3OYK A;  4A3L J;  3HAG A;  1V5G A;  2ZBU A;  4ITV A;  1QRY A;  3HSE A;  4OPW A;  4JX4 A;  2Z8G A;  4DOZ A;  3FPP A;  2X51 A;  2V6C A;  4ZYD A;  4U4B A;  4ESJ A;  5JBQ A;  1IA5 A;  2FML A;  1GT0 C;  2BV3 A;  4KKS A;  1ERD A;  3MVP A;  3V7C A;  3EQO A;  5CVR A;  3LMW A;  2MAB A;  3GME A;  4Z2Y A;  3ECH A;  2RVC A;  3H35 A;  2C4T A;  3BG3 A;  3ISP A;  1MJB A;  1JJ8 C;  2EZH A;  4GXO A;  3Q9S A;  5H2F C;  1R58 A;  3SEJ A;  3PUN A;  1R36 A;  1WH5 A;  2BY3 A;  2G7H A;  3J7Z I;  4RPB A;  1PUF B;  4ROX A;  4YAU A;  2CUF A;  2QA4 B;  4HYE A;  3LQE A;  4U0V A;  4PC1 A;  3TW6 A;  2L9N A;  3ZRG A;  2LK2 A;  2E5N A;  2X85 A;  3B02 A;  3PA2 A;  3ZPL A;  5KW9 A;  4A6E A;  1KU3 A;  3MHP A;  1XMX A;  4NBQ A;  3GVK A;  2FX3 A;  2XKO A;  3V8J A;  1ETW A;  2E19 A;  2GOX B;  4XQF A;  2FVG A;  1O8I A;  4YFN F;  3OL3 A;  3EPZ A;  4X07 A;  4CO8 A;  2OD5 A;  2ZCW A;  3A4C A;  4EJU A;  1JT0 A;  1P4X A;  3LJY A;  2HQN A;  4YAW A;  1D3Y A;  1OB5 A;  2L9S A;  3K0L A;  5D4R A;  3CTA A;  2M4K A;  1GLN A;  3CD6 B;  3OFN A;  4ESB A;  1HVX A;  1I39 A;  3EDP A;  3PSI A;  3ZXS A;  3OZV A;  2NOG A;  4UZU A;  1FSH A;  3SEQ A;  5JFR A;  1AIP A;  2L7K A;  2LOO A;  4CYD A;  3S1R J;  3NB2 A;  1FBQ A;  1ODD A;  1Q7Y D;  4LGW A;  2PI0 A;  3GTL J;  1VQM B;  1B8I B;  4P5O A;  2PMH A;  2STT A;  2UXX A;  4RAZ A;  3WYA A;  5IYC J;  2XTW A;  5LLQ A;  1I50 J;  5K5O A;  2FNP A;  3OYA A;  1RRJ A;  1ZKG A;  2FEZ A;  1YIT B;  2FOK A;  3I59 A;  2Y2Z A;  1EH6 A;  1BR4 A;  5DUI A;  1UFM A;  3VSK A;  1U6G A;  3VMW A;  2H09 A;  3BR3 A;  4M6V A;  3T1B A;  1EH8 A;  1VHE A;  3BPX A;  3H3U A;  1UD4 A;  3CES A;  1QFZ A;  3U6B A;  3H9J A;  1USS A;  5FFX A;  2RQQ A;  3OEE A;  3RKY A;  1K8F A;  3R60 A;  3V7A A;  4M9Z A;  2Y9Y A;  4I98 B;  4N4N B;  1WZ2 A;  2XPW A;  2R7Q A;  3VPR A;  1A5J A;  1WPK A;  2L4A A;  4V2G A;  1SD7 A;  1U0J A;  3DXJ F;  1TNT A;  1IJE A;  1BI0 A;  4AWX B;  5IT9 Z;  2YWE A;  1XGO A;  3GFM A;  2NS0 A;  1GO2 A;  5E1W A;  2EFQ A;  4KMU X;  3OYJ A;  5BSY A;  4LOC A;  1VQK B;  1XDU A;  1PP7 U;  2X6X A; 
#chains in the Genus database with same CATH homology
 2IGO A;  3VYR B;  3L2U A;  2M5S A;  5CPR B;  3GQB A;  2D3L A;  2ZSH B;  2LBF A;  2X1C A;  3UNG C;  2R7S A;  2VBM A;  4OJO A;  1D1C A;  2LY1 A;  2ZZE A;  3HPH A;  4BXF A;  1E1Q A;  4KIS A;  4XLA A;  3ONQ A;  2HPI A;  1E43 A;  4Y4R A;  4P22 A;  4BE1 A;  3ZPP A;  3OS2 A;  3BG6 A;  3L2Q A;  3K4M A;  3OYH A;  3DPU A;  4BAC A;  3H0D A;  4B3G A;  3W2A A;  1UD2 A;  2V6E A;  2RNG A;  2NT6 A;  1V5F A;  3HC7 A;  2NST A;  2QXZ A;  3KRG A;  4LIT A;  1X4P A;  3OE7 A;  3DU6 A;  5AMV A;  2BOL A;  1WJ5 A;  2V7F A;  2V31 A;  1YE9 A;  5CKT A;  4CCL A;  4XON A;  1WMR A;  1QHH D;  2DT6 A;  2JA2 A;  3ZR8 X;  4KKU A;  3WWG A;  2XSJ C;  4B48 A;  3LNN A;  2IS1 A;  2R4G A;  2CW8 A;  4OZY A;  1DBO A;  2VL8 A;  3FKS A;  4HWV A;  1MMG A;  4W8Q A;  4XR6 A;  4PMH A;  3OYG A;  1QU3 A;  4BQQ A;  2Q2E B;  3OIP A;  3MKY B;  3DQV C;  4IQJ A;  2FUG 2;  4OAY A;  1TT0 A;  3LSH A;  3CP8 A;  4XLE A;  2R7X A;  4E7K A;  2LC2 A;  1D1B A;  1Z3X A;  1X4O A;  3W2V A;  3OL4 A;  3JUR A;  2XZO A;  4RMN A;  1DBG A;  4KJZ A;  3DKX A;  3VDX A;  2CK3 A;  3EQN A;  1Y6I A;  4LIV A;  1BR1 A;  4KT6 A;  4ZDP A;  2VQL A;  4B3X A;  2JJ1 A;  1OFL A;  4R79 A;  1D0X A;  2JJ2 A;  4F52 A;  3DWL E;  4YZQ A;  3OS1 A;  2F6C A;  2ZSI B;  3G2B A;  2NTB A;  4DIQ A;  3VYU B;  4XOR A;  1OGO X;  1PLU A;  3OYC A;  1MAB A;  1SAU A;  4OJ6 A;  4DK0 A;  2P0W A;  2IGM A;  3IUO A;  4EAT A;  2WZP P;  2X53 S;  2VQC A;  3E0J B;  2VAS A;  2KRC A;  2VBK A;  2HZD A;  2DXI A;  1BPL A;  4XLH A;  3AL0 C;  1N75 A;  2BW3 B;  4PK4 A;  4IKF A;  2CW7 A;  5LFA A;  1DP3 A;  3BCB A;  3V42 A;  3ZCO A;  2V4D A;  2WAQ A;  4OJP A;  3OY9 A;  4BUP A;  4NK8 A;  1X1D A;  3FHN A;  3OYL A;  4GRI A;  4IX7 A;  1AA7 A;  3H5N A;  3IAM 2;  4RM3 A;  4F92 B;  1EE6 A;  2R9V A;  2WJY A;  4BDZ A;  2WAE A;  2R7W A;  1MW7 A;  2HLD A;  4XLC A;  2KQR A;  2XOK A;  3GVL A;  4C9Y A;  3RPU D;  2CS3 A;  3DPT A;  1S9H A;  3K4J A;  2DIE A;  1KZL A;  1E79 A;  2KMU A;  3FY3 A;  1LVK A;  1QHG A;  2O0V A;  1X0C A;  3AFH A;  3S3N A;  1JTA A;  2KDO A;  4F55 A;  2BSP A;  3B8Y A;  4BL0 B;  4DK1 A;  1PXZ A;  3L2W A;  3OR1 C;  2O5R A;  4E4H A;  5JHF A;  1KON A;  2K3P A;  3GBG A;  3UR3 C;  2NTQ A;  1WJD A;  3BCA A;  3T51 B;  1VF7 A;  2A5W A;  1O8G A;  1DQU A;  3K4L A;  1X19 A;  4Z05 A;  5FL7 A;  1OLT A;  3DDY A;  3KEW A;  3L2R A;  2QKL B;  3GQ8 A;  4RLQ A;  3GQ9 A;  3IP4 B;  3QYE A;  3ZGK A;  3OS0 A;  1NBM A;  3D5R C;  2M0M A;  4HEA 2;  3LSK A;  4C2T A;  3E1S A;  2VBE A;  3A2K A;  4II3 A;  3BCD A;  3C2G A;  2K9L A;  2F1M A;  4URR A;  4YZA A;  3T9G A;  3BC9 A;  3PNT A;  4BS9 A;  4DNR B;  4PSW A;  5CQG A;  1BOB A;  3CP2 A;  2O0W A;  2A6T A;  3KYL A;  2PEC A;  2NSP A;  4C30 A;  4PUS A;  2W4S A;  1X1A A;  1G8X A;  4B47 A;  2O17 A;  2VLA A;  2WPD A;  2DCE A;  2ZXI A;  2CUZ A;  3QOD A;  4BQO A;  4OJL A;  2ZFU A;  3NE5 B;  2DOA A;  2VJI A;  4U7B A;  1V5E A;  1YX3 A;  4ANJ A;  2ZZF A;  4PJL A;  2HNH A;  4HSR A;  3MKW B;  1CZF A;  1OB0 A;  4HNT A;  2R7O A;  2VQG A;  4E7L A;  1FX0 A;  3OAA A;  1RMG A;  1WFX A;  3DTI A;  4ZTJ A;  2LBF B;  3K6G A;  2IGK A;  4FAS D;  5FRM A;  4BJ5 C;  3H5A A;  3OW7 A;  3HL2 A;  4W8R A;  3EUH C;  1K28 D;  5HOO A;  2KL4 A;  1KTW A;  1PYV A;  2DJI A;  4IZZ A;  4CA0 A;  4XNF A;  1E0E A;  2ZTG A;  2IGN A;  3N05 A;  3NWT A;  2R7R A;  4DNT B;  1BR2 A;  2VQH A;  3SYT A;  4XKB A;  3CJR B;  3J7A Y;  2BVL A;  2R7T A;  1OGM X;  5FRO A;  4OZZ A;  4LIU A;  4BJT A;  3FDY A;  1I8D A;  3BLY A;  5CDF A;  2NTP A;  1G59 A;  1LKX A;  4CSW A;  4XN3 A;  3RTR A;  4CCK A;  2XGJ A;  1W0K A;  1N78 A;  5HKK A;  2LZJ A;  3B90 A;  3CZ6 A;  3OYB A;  4DGW B;  2HPM A;  2O1D A;  4OAZ A;  4QPQ A;  2WB1 A;  2LY2 A;  2ZZQ A;  3CMM A;  3OYD A;  3QOE A;  1PE9 A;  1WTH D;  3T56 B;  1X1C A;  2M3A A;  3K70 C;  1KCC A;  2IXS A;  2X3H A;  1SFK A;  4F3Q A;  3S32 A;  1O8H A;  1T95 A;  2VKH A;  1IRX A;  2HVR A;  2HVS A;  4ASU A;  1WJF A;  3DTE A;  4TSF A;  1BMF A;  4ZDO A;  2Z2S B;  1RU4 A;  3BCF A;  3QYB A;  1BHE A;  2K9M A;  4XOT A;  4DBR A;  4E7J A;  2E1B A;  3FBN B;  3I3L A;  4ZDL A;  1D1A A;  5HNH A;  1O8L A;  2NT9 A;  3SDB A;  4YRV A;  4FXU A;  4G7X A;  4TKO B;  2KVO A;  4CCJ A;  4BEH B;  3DTK A;  4N4O B;  5KHD A;  5C1E A;  4ZJZ A;  4Y33 A;  2HVQ A;  4CH7 A;  1EA3 A;  1V0E A;  2PYG A;  3U21 A;  2R7U A;  3OYE A;  2M7B A;  2ZZG A;  2MC4 A;  3RQ4 A;  5TGT A;  4LG3 A;  1T0F C;  3CF2 A;  1BN8 A;  4YXW A;  4CUG A;  2R7V A;  1E3Z A;  2EWE A;  1H8H A;  1NHC A;  3PUB A;  2JSP A;  4PSX A;  2NOJ B;  4BE0 A;  3A35 A;  3OEH A;  4L8J A;  3DU5 A;  4PFP A;  1SKY B;  1O8E A;  3DEE A;  1KMH A;  5CQE A;  3GQA A;  3EUA A;  4U87 A;  3G05 A;  2INV A;  5HNF A;  3SEZ A;  1V0F A;  3LFU A;  1MND A;  2JVG A;  1LFP A;  3OWT A;  3M1C A;  2QKM B;  4XKW A;  2RRE A;  3NWS A;  2PYH A;  3SZG A;  3BH4 A;  3CJQ B;  1AIR A;  4B43 A;  4II2 A;  1OR7 C;  2OV7 A;  5DN6 A;  3K4K A;  2QE7 A;  2E5Z A;  4HPQ A;  2JDI A;  3TBI A;  4TT3 A;  4F93 B;  3H94 A;  2O04 A;  1VBL A;  4NK6 A;  3A3G A;  2I8D A;  3FKJ A;  2VB6 A;  2XF5 A;  3HXL A;  1RWR A;  2KRH A;  2VXD A;  3PFY A;  1IDK A;  4CZC A;  2W1O A;  4NNJ A;  2F5V A;  1KCD A;  1R6R A;  3DPL C;  4BQN A;  2VJ4 A;  3VWB A;  1VJS A;  4CCM A;  4KIT B;  1T5E A;  4G6T B;  2X1D A;  3I9V 2;  4I84 A;  2MYS A;  2MD0 A;  3GVJ A;  1UG0 A;  2JUG A;  1Z21 A;  2PJR A;  4RM2 A;  2WSS A;  3S8P A;  4C2L A;  1Z7L A;  1W0J A;  3KX2 A;  2Y0S A;  3LSI A;  1NG6 A;  1WJA A;  4E7Z A;  3D5S C;  4PJN A;  2GOM A;  3PNY A;  4PJM A;  1OFM A;  1FMW A;  2XZP A;  2BVM A;  3C2H A;  3K4C A;  4B44 A;  1UD5 A;  3DLA A;  4W8T A;  2V26 A;  3EUK L;  3ZIA A;  1UEL B;  2WAF A;  5KCM A;  1W36 C;  3K70 D;  2X6Y A;  2WJV A;  3S3O A;  3GRH A;  2KZV A;  4HG2 A;  5FRN A;  1JRG A;  4BJ6 C;  2IS2 A;  1QCX A;  2IS4 A;  2KP6 A;  1WJC A;  4XMY A;  4Z1M A;  4BU2 A;  4P1W A;  4YZ0 A;  1IB4 A;  3AL0 B;  4AVZ A;  2LH9 A;  4NC7 A;  2ELJ A;  4E6K G;  3BG7 A;  3OOC A;  4X0G A;  4YEJ A;  4E0F A;  1EFR A;  4CCN A;  1LDK B;  5LD2 C;  2ZTN A;  1P9Q C;  4RLF A;  1W9X A;  3TMO A;  3T53 B;  3HPG A;  3VR6 A;  3QYF A;  1E3X A;  4J01 A;  2Q1Z B;  1X1B A;  3S3M A;  4XOP A;  2XDV A;  1NRK A;  2KPM A;  2WY7 Q;  3B4N A;  1WJE A;  3OYM A;  2IQ7 A;  4XKV A;  2CUJ A;  1HG8 A;  1O8F A;  2UVF A;  3W2W A;  3DKY A;  2WAD A;  4ZC3 A;  3VSU A;  1D0Y A;  2CV2 A;  3K4B A;  4W8S A;  2E1M B;  4NUB A;  4JQF A;  4G6I A;  1D0Z A;  2V1N A;  4YEL A;  3K10 A;  4XN0 A;  2W00 A;  3HKZ A;  4D9J A;  4KKT A;  4OWR B;  4OJ5 A;  1O8K A;  2GK7 A;  5HVQ C;  2GK6 A;  1E1R A;  2LYC A;  3VST A;  2CV0 A;  4MLO A;  2WBM A;  3PNV A;  1VLY A;  2LRD A;  1K6Y A;  2F43 A;  1H8E A;  5IK2 A;  1COW A;  4HNU A;  3OYN A;  3LSM A;  1O8D A;  4EW9 A;  2AQF A;  2VXZ A;  2D3N A;  4U49 A;  2XAU A;  2V9K A;  2ZXH A;  3H5R A;  4NC8 A;  2W82 A;  3OOU A;  2GJR A;  4NQW B;  3MKZ A;  3OR2 C;  3HG9 A;  2DT7 B;  1MMN A;  2OC6 A;  2GJK A;  3RSN A;  1O8M A;  4MXN A;  2VJJ A;  2WA0 A;  2VKD A;  3D5L A;  1ZEL A;  3MMY B;  3S93 A;  4BGD A;  1XG2 A;  2W6I A;  4BDY A;  3LSG A;  4E7I A;  4XKC A;  4PJJ A;  1N77 A;  1DGR M;  1OHH A;  3OYK A;  2GJP A;  3HOT A;  3HAG A;  2LRE A;  1V5G A;  4IQ4 A;  4Z03 A;  4ITV A;  3VYT B;  4B3F X;  2Z8G A;  2QX3 A;  4DOZ A;  3VMV A;  3FPP A;  2X51 A;  4U4B A;  1IA5 A;  3WQZ A;  4YZX A;  2NZM A;  4KKS A;  1ERD A;  2CFO A;  3PSF A;  4DJA A;  3EQO A;  2VIX A;  2E60 A;  5C1C A;  3LMW A;  2MAB A;  3OIQ A;  3RCO A;  3OMY A;  4QPO A;  1J09 A;  1GQ8 A;  2ODL A;  3H35 A;  4DBQ A;  2MFZ A;  2OUM A;  2IS6 A;  3JU4 A;  4GQN A;  4XD7 A;  4Z06 A;  1K5C A;  4E7S A;  4BEH A;  3H9Q A;  4XL9 A;  2L5Q A;  2X8K A;  3OYI A;  2JIZ A;  4D1Q A;  1W36 D;  2KLO A;  2HU9 A;  1PJR A;  4BE2 A;  1UD6 A;  2XND A;  3VSV A;  2L9N A;  3ZRG A;  2E5N A;  2X85 A;  3LL7 A;  2BW3 A;  2VJ5 A;  2Z1D A;  1HA8 A;  1UD3 A;  2M4G A;  4PFO A;  3L2V A;  3ZPN A;  3GVK A;  2QY1 A;  3OYF A;  2JVH A;  1BLI A;  2GOX B;  4XQF A;  3BC8 A;  1O8I A;  3PJR A;  2INU A;  3OL3 A;  3EPZ A;  4F91 B;  4HRI A;  3A4C A;  4AYB A;  3AKZ A;  3SUC A;  3VSL A;  2X1E A;  2V7Q A;  2UWM A;  4FET A;  2L9S A;  1NG7 A;  3MD2 A;  1H80 A;  2M4K A;  1GLN A;  4Y3O A;  3F9K A;  3OFN A;  1HVX A;  1WJB A;  2UV1 A;  4H4K C;  2AQE A;  3PSI A;  3ZXS A;  2KHM A;  3PL8 A;  2XC7 A;  2Z6B D;  2CV1 A;  3A3B A;  1QJV A;  4UZU A;  3SEQ A;  4HIZ A;  2L7K A;  2LOO A;  1MNE A;  1OOC A;  1JI8 A;  2UVE A;  3ZSC A;  4E7H A;  2HDW A;  1O88 A;  2E1M C;  2XZL A;  4P5O A;  5KNL A;  2V4J C;  2W7N A;  1VZ0 A;  3M8J A;  1FMV A;  1UD8 A;  3OYA A;  4CCO A;  1Y56 A;  3VYS B;  2HQA A;  4XM3 A;  2K5C A;  2PJR B;  2CH0 A;  3KEY A;  4XLF A;  3A1Y A;  1BR4 A;  3VSK A;  1WP6 A;  3VMW A;  3ZQQ A;  5HLT A;  1WPC A;  2VPL A;  2WY8 Q;  4ZTF A;  1PKV A;  4MR0 A;  1UD4 A;  3CES A;  2PMZ A;  4HST A;  1MMD A;  3H9J A;  3TL4 X;  2M7A A;  1MMA A;  1TZL A;  4AU7 A;  3GQ7 A;  2RQQ A;  3OEE A;  1O8J A;  2Z16 A;  1IDJ A;  3W3C A;  2XF6 A;  2X6W A;  1I18 A;  2CMP A;  4N4N B;  2F4I A;  2R7Q A;  3H9G A;  4JOM A;  1HZE A;  3FBI B;  3K4N A;  4G7W A;  1U0J A;  4J00 A;  3HOS A;  3HUG B;  4ZYA A;  2L2O A;  2LG4 A;  4C2U A;  2W6J A;  3OPO A;  4JMQ A;  2UUZ A;  3UW0 A;  3IAS 2;  1Z3Y A;  3OYJ A;  1DGW Y;  1YX5 A;  1UAA A;  2XF7 A;  2X6X A;  3LMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...