4XMYA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 235
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xmyA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xmyA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xmyA02
1O8MA 2X6YA 4W8TA 4W8RA 2IQ7A 1O8FA 1OGMX 1RWRA 2O0WA 1WMRA 2O0VA 2VJJA 4XLAA 2EWEA 2O1DA 1O8GA 4XN3A 1X0CA 2PYGA 4XLFA 4OZYA 4XOTA 1DBOA 1OFMA 1O8DA 4W8SA 2VBEA 4YZXA 3VSTA 1RU4A 1AIRA 5AMVA 3ZPPA 1BN8A 2NT9A 2X85A 2X6WA 1O8HA 2BSPA 3ZSCA 3EQNA 4YZQA 4XLCA 3GQ8A 2NSTA 2NZMA 1HG8A 1PE9A 4XKWA 4XMYA 2X3HA 4MR0A 3VMWA 4Z03A 2NTBA 2PECA 4W8QA 2NTQA 4XM3A 4Z06A 2VBMA 3VSUA 1CZFA 1H80A 4I84A 2NT6A 3GQAA 1VBLA 5C1EA 1GQ8A 1O8JA 2QY1A 4PMHA 1BHEA 2VBKA 4AVZA 3GQ7A 3GRHA 1EE6A 4U4BA 1QJVA 4XLHA 4U49A 2O04A 4XN0A 4XR6A 1DBGA 1OFLA 2INUA 3B4NA 1OOCA 2X6XA 2PYHA 1PLUA 4XLEA 3GQ9A 4OJLA 1IDJA 1KCDA 1O8IA 3KRGA 1PXZA 4OJPA 4OJ5A 2UVEA 4URRA 1O8LA 1XG2A 2INVA 2QXZA 2UVFA 3B8YA 4YZAA 4HWVA 4OJOA 3T9GA 3EQOA 1O8EA 4EW9A 4OJ6A 4NK6A 2O17A 3FY3A 3VSVA 1KCCA 3VMVA 4NK8A 4XL9A 4XORA 1IA5A 3SUCA 3WWGA 3LMWA 4YZ0A 2QX3A 1K5CA 4XQFA 4XONA 4YEJA 4XOPA 1O8KA 4Z05A 1IDKA 3JURA 4C2LA 5C1CA 1KTWA 1JTAA 1OGOX 3UW0A 1QCXA 1O88A 2NSPA 4MXNA 2Z8GA 4YELA 2NTPA 4OZZA 1RMGA 3B90A 2VJIA 2ODLA 1IB4A 1NHCA 4XKVA 4XNFA 1JRGA
chains in the Genus database with same CATH superfamily
2LYCA 2E1NA 5LHHA 5FO5A 1OHHA 3BT9A 3VYUB 1ZRCA 3ULQB 2C2WA 5FGMA 4ESBA 3HUGA 3GXOA 3G71I 1WMRA 1VQKI 1OFCX 4UV8A 2O1DA 1MBHA 2HOEA 2LD5A 3HOZJ 5DN6A 4EGYA 2VYQA 1DDGA 1S3JA 1QA1A 1ZTRA 5HDKA 2Z6BD 2M3AA 3GFMA 4C3JJ 3A8JA 2A61A 3PQKA 2ID3A 4IQJA 4DQLA 4BAYA 2DBBA 2H1LA 5CVVA 2D74A 3W6VA 5L3EA 1O3TA 1H89C 4U0WA 1E3ZA 3F22A 4UB8C 1DG1G 1FOKA 3M8FA 1ON2A 2OQRA 4WZLA 2BXZA 1K4ZA 2ZNYA 2V6EA 3L00A 4RBOA 2NSTA 2KZVA 2W7NA 3EUHC 3QAHA 3J80K 2FD5A 2KZGA 3O2PE 1N0UA 4MR0A 5L3BA 3M8EA 1W87A 1F60A 4E7KA 1HA8A 1K7AA 1YLFA 2IGKA 4QHYA 3FMQA 3HOWJ 2VXDA 5KCMA 2VNIA 2NTQA 5DD4A 1K6OA 1BI3A 1W1WE 3FXMA 1S9HA 4C3HJ 4HE5A 5CVUA 3RQIA 4IX7A 2M5WA 3QYFA 3OYJA 1SKYB 3G05A 5B6IA 1UD4A 1IC8A 1JUSA 4P1VA 1R5BA 3GWZA 2FMYA 4Q48A 3MAJA 1SC7A 5FNZA 2P0WA 2R7ZJ 4A0XA 4AVZA 3W2FA 2M2EA 4W1UA 2CJJA 4ZDPA 1EE6A 5M3MJ 3OFNA 1YX3A 1VF7A 1KQ5A 3GZNB 2XAUA 3CCMI 3N05A 1NH3A 1P2FA 3AVWA 1OYIA 4A93J 3ASTA 3G3ZA 1HW1A 1DBGA 1RZ4A 2ACJA 4P55A 1WP6A 1VQ4I 3E6BA 2X6XA 3MZ8A 1V4RA 2CFXA 3KL9A 4TMWA 3H3ZA 1S72B 1AHDP 4X7DA 4N3GA 1IDJA 4A5NA 3M8JA 2LRDA 1IV6A 3DTIA 4LITA 2IS1A 2VBXA 2O9LA 2PI0A 5FL7A 2JN9A 1XMAA 2XAQA 3HRTA 4ABZA 1LEBA 3L7WA 3CCLI 1YITB 2INVA 3F3XA 3CD6B 3J7AO 1TNTA 4X7FA 2IW5A 1IXCA 3BR0A 4FASD 4ZC3A 4DNTB 3CQZJ 2CQ7A 2E7WA 3FXLA 1TYUA 4EW9A 4C30A 5IYDJ 1FMWA 3ZCOA 2F4IA 4BYYA 1UB9A 1TQIA 2ELJA 5LGUA 1DU6A 1QQIA 1IXSB 2DYIA 1VQMB 2BM6A 3FY3A 4CICA 1VQKB 5HS9A 3I0TA 4RGRA 1SFUA 1U2RA 3TOBA 4NK8A 2DOAA 5HS8A 1R5NA 3M07A 3BG5A 4D0PA 4R8HA 1T0FC 3FBIB 1CF7B 2IGOA 2YWEA 2VQHA 4B3XA 3D1NI 2ELKA 5IOZA 1HF0A 3CF5F 5EYRA 5DM6F 2IS4A 3MFKA 2OPTA 4MXNA 4WXCA 3I9V2 4KIFA 3V8KA 3MKWB 2L7KA 3HKZA 2IGNA 1U8RA 1W36C 1MNMC 4KN7X 4XKVA 3UR3C 1KK1A 1YW7A 1XDSA 4KIGA 2WC2A 4U87A 3E97A 1EFCA 1O8FA 1BW6A 2DYSH 2LKSA 2PFBA 2VJ4A 1V5EA 1DPUA 1L1IA 2VJJA 2X1EA 3PFIA 2KHMA 3CJNA 5A89A 3R61A 2O03A 1GXPA 2JT1A 1YX5A 2WBMA 4IL6C 2PYGA 1P7JA 1VJSA 3I71A 1SVMA 4UB6C 2JMWA 1N78A 2BHYA 1F5TA 1BL0A 1O8DA 2STTA 2ZNZA 4RAFA 3JTGA 1H8EA 3S14J 3VSTA 2F4MB 4Z4YA 1TVCA 5JI6A 2BSPA 3TKYA 3J7YJ 1QA2A 4RDJA 2JPCA 1L0OC 2ECBA 3D5LA 4G8XA 2O8KA 3LSTA 3BC9A 2F4OB 4Z4VA 4MFEA 4AM3A 3CCJB 1OR7A 2C6YA 1Z3YA 3Q38A 3LQQA 4X8IA 2AHOA 4II3A 1DARA 1YI2B 2VFMA 1SEUA 2O6GE 2EH3A 1P4MA 4GQNA 4UVCA 1KZHA 2CFOA 2QKMB 3B6AA 4UNOA 2VBMA 3FPKA 1OCCH 2XASA 1IAWA 3V7AA 1Z0XA 1ODDA 1IG7A 5D8KB 1VBLA 1E0EA 2CMPA 4ROXA 2HZDA 3LOCA 2V4DA 5ICFA 4D1QA 1SAXA 2BM4A 3CUOA 4M2LA 4QWQA 2EFWA 3RJPA 1R9TJ 5J4YA 3LNQA 2E5ZA 4ETSA 3KP7A 2R92J 4LGWA 5E3MA 4H0EA 2V26A 2O61A 5M5XJ 3FMSA 5D4SA 3IRQA 3JREA 3BG3A 1I27A 4RGUA 2LBFB 1RNLA 4TMZA 1EWYA 1R7JA 3B4NA 2Y75A 5GTIC 2PX9A 2IS2A 1R1TA 4Z4WA 3S1QJ 3FXOA 5BMZA 1O8IA 2ZZFA 2R5ZA 1PXZA 5F0HA 3FWEA 1U0JA 2BSAA 3CLQA 2ME6A 2EB7A 3OYCA 2MSYA 2X6OA 2HTSA 4IHXA 1XG2A 2EFPA 1IZ1A 2XKPA 4HWVA 2DETA 3OYBA 1R6RA 1FTZA 4BJ5C 4XLPF 3OS1A 3E3VA 3F8BA 4PGGA 3VYRB 2BGCA 4ZJZA 2D2WA 4RD1A 2E1RA 2QZ8A 2IA1A 2G9WA 1BJKA 3DTKA 5GV7A 5HKKA 2G7HA 2VFQA 5AONA 2MW8A 5EGOA 2HKOA 2W25A 2K9QA 4BKXA 3GO5A 1HA3A 3VSKA 2RNJA 3EPZA 3PIPF 3EYYA 1W36D 2EPFA 1QZZA 3EYIA 4TMXA 1UD8A 1DGWY 1Q1HA 5F64A 2H8RA 3ABKH 3MQ0A 1QFYA 2M0MA 1WJFA 3H92A 4WWVA 1WSVA 3K4BA 4MQ9F 4YIRX 4LBYA 3SZTA 2CW0F 3KX2A 2ESHA 2Q6IA 2V7UA 2X1CA 2VBTA 2HGCA 4P6YA 4EH1A 4WXHA 1MIJA 3MVPA 1V55H 3ASSA 2RDPA 4W8TA 1RWRA 2MA3A 3B8HA 3FXRA 2QEXB 3BC8A 1B8IA 2P7CB 2QUFA 1E3OC 4BY1J 3O3KA 1ZHFA 2P5VA 2J5PA 2W57A 1ETWA 1WWXA 1FOWA 2Q8KA 2ZXHA 5GTHC 2EFQA 1JKOC 9ANTA 1NDHA 1X1PA 3ONYA 4BPRA 1EA0A 1FOXA 1KZLA 3HPHA 3A35A 1D8KA 4Q47A 3DEWA 1KQ9A 3F8CA 1A6IA 1MNEA 1QG0A 5GV8A 2JJ2A 4ZZDA 1WZ2A 3A0HC 3HTUA 3H3VK 3CDLA 2QM3A 4RLQA 4HA8A 3PUBA 2EV5A 4OIOF 1WTHD 1N8RD 3HBLA 3J81Z 4C9YA 3RKYA 1PYVA 1JA1A 3QYBA 2WA0A 3AL0C 3JTHA 2DPUA 4G7OF 3DBRB 4CCOA 1T33A 1P6RA 2CBXA 1XSDA 1ZGAA 2L0KA 3CZ6A 5IYBJ 1UMKA 2HZTA 4UUSB 2M7BA 5B66C 2YSRA 2R9VA 4PCQA 1TWCJ 1R4MB 2OQGA 1B4AA 4EATA 3VSUA 1E1RA 2GXAA 1K8FA 1MDMB 3CO7C 4PSWA 1RIOH 1TT0A 4ENMA 3DF8A 5GADJ 3W3CA 2QY1A 1K6YA 2VL8A 3OYHA 1Z7UA 1I5ZA 4KKTA 2IXSA 2N8GA 2QA4B 5HNHA 1DDIA 1EFUA 3BDDA 2GPJA 3B02A 5LBQA 2O04A 4LBZA 1OFLA 3KEQA 3K69A 1B6AA 1XX5A 2OK7A 4EM2A 4Y13A 1G6NA 4WWCA 4NHJA 4H4KC 1LNWA 1KCDA 3OIQA 2CW5A 3GZ5A 1JHHA 3OZUA 4DK0A 5FFXA 2HYGD 2RGVA 4JP0A 2E1OA 4F52A 2ZITA 1NBMA 4IRGA 3T1BA 3IWZA 3FDYA 2NOGA 2IVMA 2H27A 4TN1A 2DMTA 2V7XA 3ZMUA 1BJAA 5DCFA 5J4VA 1MMAA 1LDDA 3BOQA 1MJ9A 2W48A 2JZYA 1D1BA 3K70C 1TC3C 2H1KA 1JJ8C 3S16J 3UKGA 3EUAA 3C2HA 4DOZA 1IN5A 1ZGJA 4DZJA 4UZFA 5GPAA 3H0DA 3WWGA 1G4DA 1W0UA 4KNYA 2OCEA 4KA4A 1HKQA 1K61A 3LFKA 3RCOA 2HXIA 3CMAB 1HXDA 3DKXA 3JRCA 4KKSA 3NB2A 5C1CA 3ZOBA 3KZYA 4OPWA 5IYPA 2A69F 3C2GA 1E43A 3M1EA 4OWRB 4F55A 5CVIA 4KMUX 5EEAA 1PJ7A 1HKSA 2IP2A 5LHIA 1QPMA 1XGSA 2ZMEC 4C3IJ 3RYPA 1IB4A 4Y9RA 4ZYGA 1RI7A 2Y0MA 4MHGA 1FBUA 2DO7A 3SHFA 1ETKA 4AU7A 4BEHA 1MKMA 3AAFA 1OGMX 3CP2A 4HBLA 3ZXSA 2JQ7A 2HVRA 1FYMA 2JTVA 3TDUC 1FWZA 2KRFA 1IDYA 3M4OJ 3BR1A 1XMXA 2F1MA 4XLAA 4X7CA 1O8GA 2EJRA 2QN6A 2HQAA 4RM3A 2FVGA 2CSOA 4EJUA 2WAQN 3UNGC 3JU4A 2GA1A 5D4RA 4PC7A 2M5SA 2MD0A 4PJNA 4LC0A 2GOMA 2KKOA 5JMCB 2L7ZA 2EFOA 3DBLB 3RTRA 2GJRA 3H9NA 4Q5SF 4HV5A 3AG3H 4OOXA 2GIZA 3TW6A 4BBSJ 3F8NA 1SFKA 3MKZA 4A3IJ 4A3GJ 1HOMA 4HEA2 3A8KA 3BCBA 3HSRA 4KT5C 5J3OA 4WXDA 4B1RA 3VMWA 4DW6A 2H6BA 5FRMA 1K28D 3OSFA 2XC1A 3BR6A 2RAEA 3OY9A 1UD3A 3DEUA 2VQCA 1I3AA 4P5OA 1WJBA 1JUMA 4YAFA 3A01B 4N9IA 1SVOA 1CQXA 1ZGWA 4G9YA 5A2QZ 2DFIA 2CK3A 1I50J 1MBJA 1QZYA 3DPLC 3D26A 4HSRA 3CCQB 1W35A 3LFUA 3KYCB 3GQ7A 2KIQA 4U4BA 3ZN0A 1QJVA 3NEUA 1ZG1A 3CCRI 2G0EA 1XMKA 5FKNA 4LIVA 3LSIA 4YHBA 1Z3XA 1OJLA 3Q5FA 5J35A 3L09A 2W85A 3ZQLA 5FLXK 1LDKB 4M9SA 2Y30A 3K1MA 1XC5A 3MN2A 4N0BA 5IPAA 3OEEA 2VFNA 1TBXA 2JVGA 5ED4A 3F23A 4AIKA 1IJFA 1CNFA 1HZEA 5IYQA 2WYRA 2R0QC 2JSPA 2LBFA 3TH0A 3ZUGA 1I8DA 2WB1N 4X06A 4CXFA 4MLOA 3SY2A 3V7RA 2OTLB 3NAUA 1EV7A 3ZMZA 3FKSA 3ISXA 2AHQA 3FF5A 1DP3A 4OP7A 2FA5A 1D8JA 2FE3A 2W24A 4I02A 4LK1F 2RKHA 4BHPA 1XB2A 5LGTA 3LQEA 3A3GA 1FZPB 4RD4A 1KTVA 2HYFA 4U7BA 4UZEA 3L2WA 3CMEI 1USTA 3LNNA 4ACBA 2L02A 1UD2A 3DFGA 5LRSA 3OP1A 3TOAA 1XPXA 1JKPC 2GZWA 4AYBN 4Y7NJ 4RD6A 3K7AJ 2UXNA 3KP6A 2XGCA 4OZZA 2V9KA 2GK7A 1VQ6B 1TSPA 2NS8A 4PC3A 1KK0A 3K1NA 4P1WA 4EM0B 5ERIA 2QENA 3WODF 1H9TA 1D0XA 3KLNA 4KFCA 2D3LA 1UZCA 4LJZF 4M6YA 1UCRA 3ZMVA 4KKUA 4G94A 4S05A 1EP3B 2AO9A 2PLYA 2VQLA 5EMNA 1MNDA 4RD2A 3G6EI 3P27A 2CQNA 5F4OA 1MBFA 3IL2A 2DYRH 3F9KA 4IRIA 4IHTA 4X1EA 1GAQA 4OIQF 2VOPA 3JAMK 4I7HA 3GF2A 3WXMA 2OBTA 3OYNA 1MW7A 1MRZA 2O0YA 3GUDA 2V7FA 1H9GA 4BXFA 5FJ8J 1K78A 2PQ8A 1VHOA 4LLGF 1JT6A 2V1XA 4KT6A 5FKMA 3OOUA 4BQNA 3BCFA 1HG8A 1SMTA 1HLVA 1JB9A 5HOOA 1W9XA 4DNCA 2E1CA 2XSDC 4YAWA 3IHUA 5B1BH 4KISA 2B0RA 2XTWA 1SD4A 2MLGA 3DU6A 3CO6C 1X3ZB 2AXLA 2M45A 4Y4RA 4MEXF 4ZTJA 4L9VA 5DS0A 1T6XA 4S04A 3QWLA 1T38A 1BI1A 1QVUA 3D0SA 1QQ1A 5ICGA 2FBKA 4PMHA 2GQQA 4A6EA 1BA5A 2VODA 3CB4A 2PJRA 3QPTA 2DPDA 3Q3SA 3QU6A 3BWGA 3ZPNA 1W5SA 4GRIA 4N4NB 1HSTA 2F43A 5E1ZB 1TWAJ 4E4HA 1ZYRF 3WG9A 1M1EB 3I59B 2R5YB 4TMVA 4AD9A 2E2JJ 1Y0NA 1IF1A 4WZKA 5EEHA 1SFOJ 1OOCA 4RA2A 1J2XA 5BPIA 2K4JA 3K9TA 2QYUA 3U1DA 2DA7A 4KIBA 2AQEA 1BR2A 1VI0A 1ZG5A 4IXAA 5DS9A 2EILH 1YJ9B 2UWMA 1MABA 2AS5F 4PC6A 5F0FA 1LVKA 3ZGKA 3HUGB 5AIQA 1T0FA 5K7HA 3BNWA 4ZYHA 4KMFA 4YEIA 4JQFA 4PJMA 1Y0YA 4YZAA 3RIRA 3OV8A 5M3FJ 4PC2A 1RPWA 1S6LA 1YJNI 5H5JA 3H0GJ 2L4AA 4UAJA 3CC2B 3K6GA 1UJ8A 2R7SA 3PNYA 1WSRA 2VBVA 3FMRA 4XL9A 1HDDC 3F0CA 5H6QA 4XORA 2VFPA 3PSZA 2DT5A 5AIPA 5F1RA 3QYEA 3OAAA 2D9RA 4E70A 4L0ZB 5DYMA 4Y9UA 2AXTC 2M87A 1Q1VA 2EK5A 3G73A 1QBJA 2BYVE 3CC7I 1O8KA 3VYTB 3JURA 2M0CA 3E6DA 3I59A 2LF8A 1OGOX 1A6QA 2QQ9A 4RJLA 2VBWA 1B72A 1JT0A 2X48A 4JX6A 5ILVA 3S1RJ 2Z8GA 3G1LA 3WTSC 5JR3A 2COMA 2C5HA 2O3FA 2Y9ZA 3QPLA 5D5VB 4A3DJ 2L2OA 2XAJA 1QHHD 1YS6A 5J1UA 3SFIA 3I56B 4PZJA 1GV2A 1JRGA 1YE9A 4E7SA 2L7FP 1JTYA 4C2MJ 4BQQA 5BSXA 1OPCA 3TP3A 3ERMA 1N07A 2RNGA 2L9SA 3L2UA 4ENNA 4IOCF 2O0VA 5F1JA 4LG3A 1IRGA 1QZEA 1VQNI 3IUOA 5HS7A 2XROA 2L54A 4OZYA 1W5TA 3BR5A 3ABTA 3PA2A 4G7XA 2E1MC 2VC1A 1CF7A 3W5VA 1X1CA 1HW5A 5DEQA 4HDVA 2XSJC 4HLXA 4RS8A 2PEXA 5E3NA 2ZJRF 1O7FA 4D5FA 4KH3A 3T5XA 2L9VA 1Z67A 1WJDA 5F04A 3OYMA 2JJ7A 2ME0A 4CCLA 3I1FA 1XGMA 1XSVA 2E7XA 1S7OA 2X6WA 3I5UA 4M3BA 4P26A 2K40A 4N3NA 3W2IA 3HSEA 1UG0A 4G12A 2Q1ZB 5HODA 2B63J 4AIHA 2EA4A 1VQPI 3JQQA 4X05A 4FCYA 2CUZA 2TRTA 2Q6KA 1ZELA 3BY1A 1R5OA 2LKPA 4XM3A 4BH9A 2C5BA 5CQGA 1TTYA 2DLLA 2IA0A 3ESWB 5F08A 1K83J 3HHHA 4DGWB 3D5SC 3QFTA 2XNJA 3G6EB 2JA5J 2QF7A 5AN9A 1BHEA 5CVJA 1VQLB 5D6FA 3Q0UA 1LLZA 2K9LA 1STZA 3BG7A 4WX9A 3L2VA 3LSPA 1W2BB 3H9GA 3E20A 2DI3A 3A4CA 3LO8A 1IGNA 1XN7A 1IUFA 1J7KA 1Y56A 2JSCA 2XHKA 1VQ7I 2ZZQA 2VIXA 3CCUB 2INUA 2ADUA 1P9QC 2BGJA 4HV6A 2D1VA 4E7ZA 2PG4A 2Y9YA 3DU1X 4EMSA 3EUHA 3KCCA 3P5JA 3ASNH 5D5UB 2RC6A 1UMQA 3DXJF 2HOSA 3DCFA 2QMUA 1IDZA 3LL7A 4WCGA 1YIOA 2UZKA 2YWFA 2PBIA 4HF2A 3Q6RA 3AG1H 1R71A 4EEFG 1EH6A 2L9RA 4X6AJ 4DYRA 4MGRA 2GJKA 1ONVA 1O8EA 4QTRA 3T9GA 5TR9A 4L0YB 1IN4A 1ZREA 1KU9A 1KYWA 2CW8A 3ABLH 4FT8A 1LKXA 3I53A 4ESFA 3TQNA 4YG2F 1QGYA 1B59A 1D1NA 3VMVA 3HOTA 2X4HA 5ILSA 3FJOA 1QGPA 1PVEA 2OBPA 4P3YA 1UELB 3RZOJ 4AUXA 3JSOA 2NPFA 4AF7A 4WF2A 3HGYA 2HLDA 1LJ9A 3PNTA 3AG2H 3OJXA 2QSFX 3ZRGA 3D5RC 2F5EA 1MBKA 2R7WA 4BXXJ 4Z1MA 1BM9A 3RPUA 2F6CA 4A3JJ 1VQLI 1KONA 4HAMA 1YW8A 2CV2A 2C77A 2DERA 4RAYA 2NXNB 2BM5A 3WTYC 2YX7A 5B1AH 3V7CA 1EFRA 4XKBA 4P9FA 5DUIA 1O3QA 2NTPA 3GTQJ 1Z9CA 3BG9A 1WJAA 2ODLA 1LB2A 2RQQA 2IPQX 3FKJA 3ZQGA 1QRYA 1E62A 3P9KA 3K4MA 2I1LA 2WTEA 3BH6B 4Z4ZA 1Z6TA 1X4PA 2BV6A 4S0HB 1P92A 1WI9A 2VBSA 4RDLA 1ACIA 3KP5A 4WZTA 1H0MA 1T56A 1AU7A 4XN3A 3COAC 2JDIA 1FIPA 3ERED 3VWBA 1ZR4A 4M0LA 1U5TA 2J8KA 1OFMA 4DZPA 4Y3OA 1BPLA 1YHQI 5DM7F 2KRHA 4F3QA 4P6VF 2M8EA 5DCMB 1QH0A 3KE2A 2LY1A 4NC8A 2V5IA 1VQOI 3DU5A 1GUUA 2LSOA 4ANJA 3P4GA 4BE1A 1A31A 1O8HA 3EQNA 3SYJA 1WDTA 3V76A 3B82A 1SFXA 1O57A 2KFDA 1IW7F 3OR1C 4RD0A 1F1ZA 3CC4I 5K5RA 3DP7A 3A0BC 4FTHA 1N77A 4G1VA 3I56I 3OZWA 4HQMA 4JRAC 2IT0A 3RKWA 1VQ9I 4PC1A 1S8NA 4ZTFA 1X58A 2GAUA 3WYAA 4W8QA 1KU7A 3E5QA 3HDDA 1XCBA 1SD6A 5E20A 1LUJB 2E19A 3IH4A 2V4JC 1LE8B 2FUG2 2QYOA 2XAGA 2EFGA 2ID6A 3QRFF 4IHSA 2KPMA 2Z1DA 3CC7B 3BQJA 3MHPA 1K9MD 4UUTA 1X1DA 2GLOA 4PABA 2X1DA 2K85A 4KJZA 3RY8A 4JK1X 1W0KA 2JUCA 1NRKA 3OWTA 5EZHA 4HSTA 2VE8A 4E7IA 2EA2A 1GDTA 5J8CA 3S17J 3ZQHA 3IH2A 1T39A 3CC2I 2B7CA 1PLUA 3OYIA 3ZP5A 3KRGA 1OB5A 5IP9J 3LSJA 3CDIA 4QPQA 4J0QA 4CYCB 1PUEE 1OISA 2CUFA 3KP2A 2ZXWH 1JHFA 3WTVC 1ZRFA 3BZCA 1DPRA 3WTTC 1GT0C 3H5RA 4C2UA 4IZZA 1WPCA 2GWRA 2ZC2A 4XRFA 1TTTA 2OZ6A 2BEOA 4Q7JB 1XDUA 1E2XA 4MYTA 1WQ2A 3LQRA 2Y48A 3LSRA 2X53S 3I55B 2CWEA 3EUKL 3VSVA 3FKIJ 1Y39A 2ZMEB 2QE7A 2VBYA 2V7VA 5F6FA 5HLHA 2QEXI 2Q6OA 1IA5A 1U2WA 1JXSA 3WTWC 4YEJA 2KDZA 4XOPA 2LVSA 2PLFA 2NOJB 4X7EA 4A0ZA 3S3NA 1WCMJ 3W6JB 2ZTNA 5E3LA 1XG1A 3QFCA 4NC6A 1UHSA 3OL4A 1FNDA 1ON1A 1XE1A 4KDPA 4P9UA 3ABMH 2Z33A 4MEYF 2DT6A 5A2QK 3GTPJ 2XOKA 1HKTA 3CJRB 1D0YA 3ELKA 2MC4A 3IWFA 4A3FJ 2ECCA 4HX8A 1B23P 3ZPLA 1O8MA 2ELHA 2X6YA 2VN2A 2W6JA 4W8RA 1VQ5B 2FU4A 5DUKA 2P5LC 5M5WJ 4X0CA 1SMYF 3F8FA 1EP1B 3KYDB 2HYJA 1R58A 5THXA 1ZN2A 2ZFUA 4IEJA 4A3KJ 3RPQA 1G7SA 1JTXA 5H20A 1UHWA 1QFZA 4ENJA 2WZPP 2LH9A 4XOTA 2TDXA 1YJNB 1KU3A 1Q9SA 1PJRA 2JPBA 2LK2A 1B9NA 1W4MA 3DWLE 3ROUA 1H8AC 1ORKA 3OZVA 1IB0A 2VBUA 4D5CA 2CQXA 2PE3A 3DTEA 1KQSB 2ISYA 2KL4A 5J6XA 2GREA 3OSGA 3TP0A 4V2FA 1XGOA 5F4MA 2OU2A 3GX4X 4YZQA 4HG2A 4QUZA 4N4OB 4XLNF 2D5VA 3SLNA 2FF4A 2X3HA 5TRDA 3OYAA 2K4BA 2BPOA 1RKWA 2LDUA 3HOSA 3BQZA 2E2IJ 2XB5A 4YXWA 1GV5A 1FEXA 3WNCA 1RKTA 2QQBA 1UHMA 4F7ZA 3BCDA 3HPGA 4R79A 4YCQA 2NT6A 3DKYA 4ESJA 4Y52J 1S29A 2Z16A 2YR2A 2ZL7A 4ZDLA 5IT3A 2OV7A 5FKLA 2Y2ZA 4M74A 4D7MA 3CMEB 2ZL5A 5FLMJ 3O8HA 1YRNA 3RKQA 1KRHA 3OW2B 1OCRH 2DK8A 4FE7A 3LWFA 4XN0A 5DV5A 4WK8F 4PAAA 3V8LA 2XRNA 4RM0A 3G4SB 2B7BA 3A02A 2OJED 1BN5A 1TWHJ 3PL8A 4MQVA 4FISA 1G8XA 2NVQJ 1F20A 2BW3A 2V1DA 1LM1A 1BMFA 2VBZA 3FHNA 3GVAA 3H35A 2ESNA 5HDGA 2WY7Q 5DD8A 1G59A 4OJPA 4NC7A 1B72B 1K8AD 3VR6A 2HNHA 4C0SA 3N6ZA 5JLVC 3TO9A 2QXZA 1NK3P 4EJTA 3E5UA 4F7DA 5FKKA 1KJZA 1IUYA 3KP3A 1RQPA 4M6XA 1MD0A 1OMIA 2RV8A 2CQQA 3RSNA 4RB0A 1EH7A 4CCJA 1H88C 4CSWA 2O6WA 1GHCA 4V2GA 1D3YA 4NBQA 3U6BA 2OBRA 4U88A 4RCZA 1X19A 4O5VA 3VNVA 1TL8A 4DYQA 4ASUA 3U2QA 3LMWA 3S2WA 5B3SH 4M3DA 4HLYA 5L3FA 1OGIA 2QVOA 5LMZA 3RIQA 1XSXA 4CZZA 1G3YA 3ZN1A 4Z4RA 5CYVA 1K73D 5M5YJ 1V0EA 3I54A 2BN4A 5J47A 3CLOA 2XZLA 2K27A 4EV0A 1QVTA 3OYFA 3VO2A 2VONA 2IEKA 4CO8A 1V54H 2JRTA 2PIAA 3PM1A 2WZNA 3WU1B 4MO7A 4GYGA 1ETYA 4CCKA 3S3MA 2F3LA 5ILUA 3RYRA 1WJ5A 5K7ZA 3JRHA 1AA7A 1REPC 2MC3A 4XBFA 2F1LA 3CC4B 1HF2A 2EQRA 1FX0A 3SKBA 2RVCA 4RAGA 1JI8A 3J81k 3LMMA 1XS9A 2LF7A 2MH9A 3KPHA 4BL0B 2JIZA 2DDBA 3GQBA 1SFEA 2V79A 1U3EM 1CQTA 1X3WB 1MJAA 1NTCA 3RDIA 4CQJA 1VQOB 2V9PA 2W82A 2DTZA 2KJBA 4ON0A 2PMZA 1DUXC 2XZOA 3GYHX 3SYTA 1J0RA 3LAJA 3V4GA 4I2OA 2VNJA 2VBEA 4G7HF 2VKHA 2XKOA 5FD5A 1ELOA 1E79A 5FKOA 4B3AA 3ZPPA 2BVMA 2BHZA 3GVLA 4YFKF 1BN8A 1FDRA 2NT9A 4R1HA 2E36A 2DA1A 2EZLA 3SXYA 1D8TA 2FNPA 4DQKA 3ZMTA 4RDUA 2HVSA 1JNYA 4B4CA 5D8LB 4Z03A 4A3MJ 3QFRA 1J59A 3DPTA 3JQPA 4XICA 3S2DJ 1SAUA 2IBDA 1FPQA 1Y1VJ 4BS9A 1FBQA 3PJRA 3FBNB 3BR2A 4TKOB 1FSHA 3T53B 1UAAA 4EGZA 3U9GA 2QSGX 1TUIA 2DY1A 3NWSA 2XZPA 1BI2A 2VBKA 1V5GA 5K1YA 2DIEA 2A5WA 1U6GA 2VFOA 3QSYA 4KUMA 4ITVA 2R7RA 1D5VA 4U49A 1HDPA 2CF4A 1UD5A 2H6CA 4J01A 1S7AA 3ZC3A 4XR6A 5LLQA 2VKEA 2FQ3A 3P9IA 3PUFA 3BY2A 3DLLF 2I10A 2AQFA 2K7LA 2JWTA 5KAIC 5F27A 4MTEA 1D1AA 4OIPF 3LJYA 1IN7A 2CRVA 1J9IA 1WRJA 2DA5A 3L9FA 2HDNB 3PQJA 2VPRA 2OYNA 4RGXA 4XRSG 2ZJQF 3K4CA 1UFMA 3QOEA 2XPWA 3I64A 1YYVA 1KGSA 3JRGA 2UVFA 5TGTA 2FBIA 2I8DA 2Y69H 4UVBA 1VNDA 2PMUA 4CH7A 1DABA 4YDTA 4FWTA 2GBYA 3KEOA 1IN8A 2I5UA 2IAIA 3FK7A 5BNGA 5KHDA 4L5JA 1WSUA 1PUFB 2STWA 4X07A 4Z4UA 4C2TA 3Q9SA 3H5AA 1JGGA 3GBGA 4NB5A 3ZQCA 4ZYAA 2XGJA 2V1UA 4R71A 2P6SA 2PJPA 1EA3A 3MMYB 2V7QA 4JMQA 1ZKGA 2NAZA 2IA2A 4XQFA 4E6KG 2KIFA 1YITI 3ZR8X 2Z5UA 1D2EA 3SFZA 4DJAA 3EETA 3HAGA 3P26A 4ZYEA 5FO0A 4G6DA 1GVJA 5LHGA 5IT9K 2F48A 1GVHA 1CLWA 4GYIA 3JRDA 5E1WA 2NS0A 4ZGQB 1TT5B 4CHUA 3OKXA 3OYEA 1T5EA 1VQ4B 3ZQ7A 1RRJA 2KQRA 2MH2A 3U2RA 3PETA 1J75A 1I7PA 2XPUA 2BY1A 3OMYA 4UUVA 1RUNA 5BPDA 2WAEA 2XUBA 3MEXA 3QPSA 2NNYA 4IKFA 2CNDA 1SKQA 3QE2A 1JKRC 2Z9OA 4M6VA 3N4MA 3FPPA 3HZJA 2H94A 1LDJA 1EF4A 3I4PA 2KRCA 3PFYA 3CCQI 1VQ8I 2EWEA 1GR1A 4OM9A 1IO2A 3ONUA 1LFBA 4XLFA 5DNSA 4RGSA 1U78A 3OYGA 1KMHA 2W6IA 4G5GA 2XNDA 4AF6A 2VJ5A 1FRNA 4AC0A 3S2HJ 4YAUA 3I3LA 4EQQA 3H09A 2OCCH 2DW4A 5F0CA 3TMOA 3QODA 4G6IA 1GJRA 1OYYA 2XAHA 2MBFA 2X85A 2DA6A 4M72A 4NDLA 5IYCJ 4Y15A 1FRQA 3JX8A 2JJ1A 2CUJA 2W7ZA 1FNBA 2B5OA 5EG0B 2P4WA 2EV0A 1O4XA 1XB4A 2DTRA 2D3NA 5FLVA 4Y33A 4XMYA 3MKYB 4QPOA 1E1QA 2WJVA 1FP2A 1YFHA 4B4DA 1HW2A 5LEJA 1YQAA 2C78A 2QGGA 1FP1D 2DU9A 5BS6A 2XGDA 4UVAA 2QBYA 1QGZA 2JK3A 1PJ6A 3AVXA 2VE9A 2BM1A 4RMNA 3KEYA 2BM7A 5KAFC 1M90D 2XT4A 1Z77A 1T98A 4K2EA 4FK8A 4M71A 2YUSA 4EM1A 1PP8F 5H59A 1LVAA 4ASNA 2WJYA 2A05A 4BQAA 2VT3A 1Z1DA 2R7QA 3CF2A 5GAHJ 3PSFA 3E1YE 2DQLA 2GIVA 5IP7J 4I09A 2DA4A 2W00A 2PMHA 2DA3A 1W7PD 3QP5A 2DMUA 2YWHA 3CCUI 1HCRA 2BX6A 4HNVA 1TQMA 2CGPA 4FXUA 1R4NB 1Z7LA 3MD2A 3CTAA 3EQLF 5EG0A 3CCMB 1PP7U 3NARA 2P8TA 4HYEA 2JRMA 4Q4ZF 2NVYJ 4PDKA 3CMYA 3PENA 4OPOA 4A2UA 2HS5A 4YIFA 2EWNA 4E7HA 1N0VC 1W0JA 2F4NA 2QWWA 3VB2A 4ZZLA 3ASQA 1MMNA 1QO0D 2ZO4A 3T51B 2ZZGA 1K4SA 1IRZA 2MABA 4G6QA 1LEAA 2DFHA 3CESA 3O6BB 2KIMA 2NYXA 2VQGA 3PSIA 5HVQC 2WSSA 1VHEA 2O8XA 1K79A 2MG4A 1U8BA 4UUSA 2OUMA 2KLOA 2QTZA 2ZBUA 2ZL6A 3G2BA 5E79C 1AOYA 5IK2A 2DOEA 2CQKA 3IAS2 4GO1A 1WOOA 1FX7A 2PJRB 2GOXB 2KJCA 2M4KA 3CCSB 1LE8A 2DT7B 1RETA 2GA2A 5E8IA 5J1YA 1KYZA 4FX0A 3WU0A 1CGPA 1EKEA 4M3GA 3TL4X 2NVTJ 3OYLA 1NG7A 3KFWX 4XONA 2QX3A 2VPLA 2QGUA 3WE3A 2CG4A 1MH3A 4CUGA 1ZG3A 2HOAA 3H36A 3BZKA 1MSEC 2R7TA 3DV8A 3ZMSA 3PA1A 1I39A 2YPRA 1FBSA 1ZM2A 2DK5A 3Q39A 5DSZA 4QIWN 4LOCA 3V8JA 1O88A 5D5XB 2WV0A 4D9JA 4BY7J 2LP0A 4LLLA 1Q81D 2Z2SB 3F6OA 5IYWA 3CW2A 2GJPA 3REOA 2KIUA 1MMGA 4MNUA 3V7SA 3BCAA 3N90A 4AWXB 4LK0F 1YI2I 1S0UA 3A1PA 4I0AA 1BJZA 4OOIA 2D45A 2ETHA 2QA4I 4IVNA 1MZBA 1F43A 5J8FA 3CRZA 3W5UA 3A01A 3BY6A 1OFDA 2EIMH 4IRHA 4LBWA 4RAZA 4XIDA 3W2WA 5L3CA 4NBSA 2KP6A 3CCSI 2X51A 2XGEA 3ZZTA 3GVJA 3R6KA 2QQAA 3WE2A 2IRFG 4TT3A 1UD6A 3K2AA 2LR8A 1R1VA 1YRNB 4AC9A 1ETXA 1XGNA 1AIRA 4AIJA 4O3MA 2KMUA 3DEEA 3E0JB 3HSFA 4ZDOA 3ZSCA 1I18A 3TEDA 2E1MB 2OC6A 3QU3A 4LG0B 4XLCA 4XRMA 2IS6A 1V3FA 1F4KA 1B2RA 3ZIAA 1TZLA 1WGXA 2EV6A 1S5LC 2Y31A 3PNVA 3VEPA 4BDYA 3S1NJ 2QLZA 4M9XA 1M1KD 1T2KA 5EDNA 3M9AA 3VYSB 1O7LA 5KW9A 4EJOA 1ZARA 3WHBA 2VI6A 3WNBA 1H80A 1PJ5A 2XT2A 1POGA 1U9NA 3W2HA 1TP4A 1G7CA 4FE4A 1QGAA 3BTJA 4TV7A 2CV0A 3J7AY 2M34A 2RQPA 2L4MA 5LFAA 1QUEA 2NVUB 2P81A 2PMZN 3BJ6A 3GTKJ 5E6TA 5D6EA 3G1MA 1OYWA 4TMTA 2E34A 2ZJ2A 1WFXA 3K4JA 2A6EF 1T6SA 5JFRA 1WPKA 1VQ9B 3GEZA 4LLNA 1VQMI 3FM5A 3TO6A 1V0FA 2E5NA 4XLEA 1Q82D 3SJZA 3GQ9A 4OJLA 3HJEA 3LA2A 3CCJI 1TQPA 1AKHA 2FOKA 4RD3A 2A6TA 4RM2A 2MFZA 3OIOA 3OYKA 1VFCA 2WADA 5CPRB 2OTLI 1V5FA 1WHUA 3ZBUA 4XSXF 3CD6I 3HRUA 4B44A 4F92B 4OU0A 1MSFC 3R4KA 1WORA 4DBQA 3HRMA 4QVAA 5GPCA 2DQRA 1ZM9A 1ZK8A 2L01A 4XKCA 3HL2A 2VKVA 4XK4A 2DXIA 1YHQB 4OJOA 1S72I 4B43A 3I55I 4A3LJ 5A8AA 2C4TA 3R6SA 1JA0A 2HQRA 5FA6A 5F4JA 3HOUJ 4UV9A 1VQ8B 1EFTA 3ML6A 3CCRB 1OCOH 2OAZA 1Y0RA 4HE6A 4YZ0A 4Y17A 1IN6A 1B1BA 2LOOA 2NVXJ 2JA8J 3SJMA 2RC5A 3ASRA 4P22A 3PUNA 2VNKA 4HDUA 2LG4A 3E7LA 5BOXA 3CUQC 3R6JA 2JA2A 1F9NA 2Q2EA 4C2LA 1FC3A 3UW0A 1P7IA 4ZCMA 2BGIA 2OTJB 2NSPA 3PSSA 1XCVA 3I4NJ 1AIPA 2K86A 1QPIA 2D1HA 3RPUD 1NHAA 1C0WA 5K5OA 4QV2A 3B90A 4DK1A 5L46A 2G0YA 3JCUC 2CH0A 3S93A 1D0ZA 4BXUA 4OMZA 2BMWA 4H9GA 5HZAA 1E63A 1U5TB 1G2HA 1TNSA 5C4XJ 3PO2J 3SDBA 4JBAA 1YW9A 1X2MA 3HC7A 1R49A 3CCVI 1Z05A 3ASPA 2GK6A 1X0CA 1ZLJA 3ZMDA 4DQ2A 3H9JA 5H2FC 4OIRF 4UHTA 4L18B 3VPRA 4UY8I 4UXNA 3AGQA 4YC5A 3H9QA 3HOXJ 3KIOA 4YZXA 3SZEA 5HLIA 1RU4A 1QFJA 3LSMA 4JX4A 1QA6A 1ETOA 1WJCA 4DNRB 3JRFA 1OCPA 5KNLA 2EIKH 2R7VA 4RLFA 3IKVA 3GQ8A 3KZZA 3CPWB 2MLKA 2RREA 1YJWI 3HRSA 3HKZN 2DCEA 4HPQA 3GMEA 3S32A 1ENHA 2QQ8A 4DIQA 1ZAOA 5EZGA 3AK5A 4E0FA 2EINH 4CA0A 3QPHA 4FHTA 1F36A 3L1PA 4A69C 4B09A 2EZKA 2Q0OA 1WVRA 3JRIA 1BLIA 3WBKA 4Z06A 3G1OA 5CKTA 4A3CJ 4I84A 2E60A 2ZJPF 2HDWA 2K9SA 3Q0WA 4KITB 4ZGNB 1GQ8A 2DAOA 3KZIC 2P3MA 1HSJA 2M9HA 1TLLA 4P3IA 4A0YA 4M3FA 5KK1A 3OS2A 4U0VA 3LYCA 2BE5F 2DOFA 1G7RA 3MWMA 4IHYA 5B5EC 2NS7A 3WG7H 1S4MA 3HM5A 4A12A 3C2BA 1ZLKA 4QSHA 4B3GA 3NRVA 3HIFA 4LG0A 3FHZA 3ABUA 2K3PA 4CCMA 2CO5A 4YAOA 2R7OA 3A1YA 2V7TA 4HIZA 4BE2A 1KK3A 3ML3A 2DMQA 1WU8A 1I3QJ 2FBHA 1KC8D 2XVCA 4P2NA 1ETQA 1N75A 2L5QA 2ZXIA 4HNTA 4MYUA 1BX0A 4URRA 3IV5A 4GFBA 1E3HA 4G1BA 3CUQA 2FNAA 3HG9A 5JBQA 3ZQFA 1ZQ3P 3Q3AA 4FQGA 3ZQIA 2VLAA 2R7DA 3T8TA 3JAMZ 3EQOA 3FXUA 4OJ6A 2O17A 3FM3A 5FRNA 2Y0SA 2ZB9A 2FX0A 4I76A 4KICA 2VOOA 2EZIA 4QLCU 1I1SA 1VQNB 2JN6A 4P9SA 5FD6A 2HWVA 4HF1A 2BY3A 5A88A 2M8GX 2WWYA 1APLC 3VO1A 3IRRA 4IHWA 4LD5A 3BTLA 4BHCA 4XRSA 3I58A 2Y0SN 3OPOA 1IDKA 2ZTGA 2W1OA 5TISC 2PN6A 3MMPA 3WBJA 2HQ5A 3R60A 2HEOA 3TW7A 5EGOB 4CYCA 2NV4A 2HDDA 1W34A 1T95A 4IJAA 3A3BA 3CUQB 1ZM3A 2XF5A 5JLWA 5IY5H 3CCLB 1K5CA 2BZTA 3R0AA 1D5YA 1IJEA 3DPUA 1N05A 2KDOA 5GAEJ 1FYKA 1XFOA 3E1SA 2XTYA 3T0YA 1Y6IA 2J8IA 2YU9J 4BHBA 3JSPA 3WTXC 1YTYA 2J5OA 3W6KB 1NB0A 1A04A 1R36A 2LFBA 4BBRJ 2QKLB 3NAWA 2LY9A 4BQOA 2OTJI 4BGDA 5JHFA 2V31A 1DBOA 4W8SA 1B8IB 3BPXA 2HI3A 1S7EA 3ECHA 5BSYA 5HNFA 2P5KA 3F21A 1I6HJ 2Q6LA 3LA3A 1ZH5A 3WGIA 1IRXA 2LTPA 2UXXA 3RZDJ 2VT2A 3BQYA 5H6RA 4II2A 1KK2A 4M53A 3WU2C 1TYVA 3SQNA 3LSHA 3W2VA 2ZBKA 2Z3YA 2VUMJ 3B73A 1OB0A 1Z6RA 3BROA 2ZFWA 2F2EA 3JQRA 3X2QH 1Y0UA 4JX5A 2O7OA 3JRAA 1DU0A 2CRGA 2PECA 3TO7A 5E3OA 5GP9A 2CV1A 1KQ8A 1JJ2B 3KP4A 1RR7A 2M1BA 5DCMA 1XTAA 1MBEA 4X0GA 5C1EA 1DQUA 2YU3A 1O8JA 3PUMA 1KA8A 4Z2YA 2R5ZB 3AGPA 4PJ0C 1BQEA 4CYDA 3CXCB 2VXZA 4PK4A 1O3SA 1GXQA 4DYCA 1RR8C 3FIWA 5LEKA 2FSWA 1Z21A 2NNNA 5JVTA 5C44J 3B78A 2HOTA 4NQWA 3WNDA 4G7WA 1OGJA 4UZUA 3WTUC 3OS0A 5DTDA 4Z4SA 2B0LA 1R22A 4FETA 1TYWA 4DBRA 3CPXA 5LGNA 3L2CA 1ZR2A 2XB0X 3Q9VA 4OPVA 4BUPA 2KVOA 2P7VB 2XIGA 1OCTC 3C18A 2RN7A 5BQTA 1E64A 3B8YA 2QDXA 5CVRA 5E17F 1BBYA 3SDGA 2BVNA 5LD2C 5KSWB 3HOVJ 2QZAA 4ZH4F 4CCNA 3FXKA 4JOMA 3K0LA 4MFDA 1E3PA 4I6ZA 1HBXG 5FO1A 4IF4A 1EZGA 2DFEA 3K2ZA 3K4NA 1G3SA 3LQ6A 2G7UA 4I99C 2QTLA 1RESA 2E35A 4GGGA 1J5YA 1KCCA 1ETVA 3MZYA 1A8PA 3OEHA 4GXOA 4NQWB 1BW5A 3Q0VA 1VF9A 4EJVA 3OL3A 2COBA 5J3LA 1VQ5I 1SM4A 2PMDA 3ES9A 1YS7A 1WH5A 3AFHA 1EJ9A 1E17A 3C3WA 1WXRA 1N06A 2XPVA 2DOGA 3BP8A 3P7NA 2E2HJ 3SQVA 1SVLA 3BLYA 1DGRM 3FK6A 3FX3A 4GDFA 3A2KA 4A3BJ 4B3FX 1QCXA 1NJID 4HQEA 4I0BA 2VJIA 3G4SI 1BC7C 1NHCA 5J1RA 3N97A 3KETA 1JKQC 1HVXA 5EJCA 3WY9A 2XEXA 2IQ7A 4LFUA 1QUFA 3WQZA 4D7NA 3WHCA 1NB9A 1BR4A 1R5HA 4I98B 4LIUA 4L9JA 1FNMA 3Q6QA 4BJ6C 3J7ZI 5TV2A 2FJ1A 1BOAA 3DQVC 1W0TA 2M30A 4O6JA 5CJ9A 1X2NA 3MKLA 1K78B 3M3YJ 4P96A 4A5MA 4PUSA 1LPQA 4L5EA 1ZRDA 1YOVB 2WAFA 2LLKA 5ICCA 3HEFA 2BV3A 1SD5A 4ZCIA 2A68F 3H3UA 3L2QA 4QVJA 2CU7A 2TCTA 2XRLA 3L2RA 2FMLA 2YS9A 2JA6J 2R7XA 4YIIA 4OPSA 5AMVA 4XD7A 4HZFA 3CJTB 2F5CA 3ZQQA 2K5CA 4U9UA 4G7ZF 3DLAA 5CLSA 5KVRA 3SJPA 3K70D 3M1CA 2BY2A 4M3EA 1FYLA 3ISPA 5E1XA 1QU3A 1UG2A 2DEUA 2R6HA 3WTZA 4XKWA 2IJLA 4RDKA 2C4UA 4M4SA 3OR2C 5J40A 3BH7B 1FJLA 2BY0A 1YLOA 1QVGB 2OD5A 3FISA 3GFIA 5IT9Z 3ECOA 1YIJB 3E6MA 1GVDA 3TBIA 4BJTA 1ERDA 4WZEA 1LLWA 2R3SA 3O8GA 4PJJA 4F93B 1ZM4A 3NWTA 2E1BA 3VFZA 1N08A 4YFNF 2J7KA 4LBVA 2HMAA 1BR1A 4Y7CA 1XD7A 1QX4A 5FIUA 3SEQA 1R23A 4I01A 4NCNA 3GRHA 2V1NA 3VDXA 5CQEA 5E8GA 1MMSA 1H42A 4XLHA 1GLNA 3GFJA 1MH4A 3WGGA 4NNJA 5HDNA 1GO2A 5K7FA 4FX4A 3K4LA 3ZBTA 2OBSA 2HPIA 2BBYA 3RI4A 1OFEA 1TWFJ 3QOPA 2XTXA 1OCZH 5D5WB 2VZLA 2X0LA 3GW2A 1YJWB 4L5IA 1EH8A 4AYBA 2K3FA 2CYYA 5FB2A 2R93J 4G6TB 1FLIA 3OIPA 3OOCA 2IOUG 3LVBA 1HQCA 4N9HA 1L3LA 3GZ6A 4BDZA 2FX3A 1O8LA 1A35A 5CDFA 3K10A 4W97A 1JGSA 5C4JJ 4BNCA 3HGGA 3GTOJ 2K9NA 4ZCLA 1H8HA 5HLTA 2LC2A 1J9ZA 1QHGA 4PGHA 1RUOA 2LREA 3ZZUA 4KYWA 2A5YB 5TY0A 2HU9A 3OOPA 1YX2A 1ZUNB 5FFZA 3CCVB 2MD5A 2OK8A 1FIAA 3W2GA 3J81K 2YX4A 2V7WA 1BX1A 1Y8QB 1V5VA 2ZBVA 4C43A 1OQYA 4WQMA 3AVYA 3SUCA 2WR8A 4LB6B 2FXAA 1VLYA 1SANA 2EIXA 1QA3A 3GCMA 3OE7A 5JLXA 2FQ4A 1MBGA 1TW2A 1EXMA 1IHMA 1VZ0A 4Z6YA 4HNUA 4A3EJ 4NUBA 1RC9A 3M7GA 2WY8Q 3KYLA 3BR3A 2NRAC 2H09A 2FEZA 4PSXA 4RLZA 1N25A 3AG4H 2WB1A 3MZHA 5TJJA 1TWGJ 1VQPB 1SD7A 1QNTA 2F5VA 1WH7A 3E5XA 3HXLA 2XAFA 4IO9F 3IH3A 4KN4X 1FOYA 4B8XA 2CC2A 3F6VA 1I1GA 4LB5A 1NK2P 3GTGJ 1WJEA 1WOPA 3I4MJ 1T8IA 1AWCA 1FT9A 1WOSA 3A8IA 3CP8A 3CMMA 3QFSA 3BH4A 1U9OA 3KLOA 1Y1WJ 1OB2A 3P9CA 3HHGA 2ZMEA 1I6XA 5IOYA 2XC7A 3BZ6A 1FMVA 1P4WA 1AKHB 3H94A 4LMYA 3CDHA 3DBHB 3SZGA 2X0KA 3G71B 3BTIA 2NZMA 2XGXA 3FXQA 1PE9A 4PFOA 3F8MA 4J00A 2A6HF 4RB2C 3S1MJ 2EBIA 4Z4TA 2HKXA 2A3SA 3JRBA 2R5YA 2EZHA 3S15J 3GTMJ 2H8WA 4IOAF 1D1CA 1R5GA 2DJIA 2R7FA 2X9DA 2ICWG 1VQ7B 2VASA 4TSFA 1FNNA 3OYDA 1CZFA 2W4SA 2BOLA 2HVQA 3K4KA 3SZPA 2HCJB 4L9TA 2OF7A 1LFPA 1H85A 2B7EA 3MCAA 2YWGA 3R0JA 2HQNA 5JVGF 1USSA 3QQAA 3E6CC 1ITYA 4ZV4A 2Q2EB 3GTJJ 3JR9A 4IHVA 3SEJA 2F5DA 5C3EJ 3AVUA 4YFXF 1TW3A 2CW7A 3NQOA 2ZKZA 3BPVA 4RPBA 2RC4A 4P25A 4M73A 2EIJH 1OR7C 3C1DA 3LSGA 4F91B 2HPMA 2MGQA 3BJOA 4OJ5A 3MCZA 3H1CA 3VOEA 2F5FA 1WI3A 3C7JA 1VLOA 2DCUA 2WPDA 4OOSA 1COWA 3HTSB 3CCYA 1KU2A 2K02A 2ZCWA 3JW4A 1IV8A 4RB1A 1R5ID 1YJ9I 2GXBA 2VB6A 4OAZA 4HRIA 1K4TA 2ZZEA 2ZXJA 1X1AA 3BTCA 3U21A 3AL0B 1PDNC 4GCVA 1G3TA 3PVDA 2HFHA 3WGHA 4AVPA 2HR3A 2X3UA 1Q7YD 1X4OA 3DDYA 2BVLA 1JUPA 1FY7A 1U5TC 1B9MA 2XV4S 4Z05A 1WKMA 2OA4A 3GLLA 2XF6A 1KD1D 1KTWA 4B47A 1KQ0A 1BC8C 1PUFA 3GLXA 2V9VA 4M9ZA 5FROA 1TLHB 5HZBA 2P6TA 4YELA 3HYIA 3VSLA 4CZCA 3BJAA 4OMYA 3GTLJ 5IYNA 2ISZA 1VTNC 1MDMA 1BI0A 2XDVA 1R00A 4EVIA 4XNFA 2WAQA 4U0YA 4HX7A 6PAXA 2DA2A 2DJNA 2Z99A 4RPDA 4A6DA 3FZVA 4J19A 3AVVA 3AVTA 1QRCA 2VNHA 1A5JA 5L3GA 2DDAA 1JE8A 2O0WA 2FRHA 5L3DA 1PKVA 2CS3A 1T08B 4BU2A 1YG2A 4MIMA 5E18F 5IYRA 3ASOH 1JJ6C 1LFUP 1Z91A 3RKXA 3RQ4A 3V42A 4AIDA 5FLXZ 3BG6A 3LA7A 5DDGA 4P12A 3W5HA 1J09A 3PIOF 1CNEA 4HW0A 3TGNA 2HDCA 2LZJA 2JUGA 4B48A 1W5CC 3SEZA 4RB3C 4EJWA 2L9NA 2V6CA 2KISA 3IAM2 5EF6A 1YIJI 1X3UA 3LAPA 4CGZA 5EEGA 1G7TA 2VC0A 4FN5A 2R4GA 1W7PA 2XF7A 2L3DA 4OOVA 1MGTA 1O3RA 1E3XA 3GIRA 1HC8A 1MMDA 3U1KA 2KT0A 3W2EA 2GXGA 2MYSA 3LSKA 4YFOA 4K1XA 1BIAA 2EFNA 2XNCA 2OZUA 4YALA 2HXOA 2LY2A 2ZSIB 5LRRA 4BEHB 2NTBA 1FTTA 4ZYDA 1T6YA 2FOWA 2DMPA 4PGOA 2UV1A 3GFLA 3GQAA 1GAWA 5IP6A 5JHUA 3T56B 1DDNA 5HXBA 3K1PA 4JYKA 4BE0A 1EP2B 2JA7J 3S3OA 1TYXA 1FSEA 2JVHA 3QP6A 1P4XA 2QBYB 1Q86D 4XSZF 4PFPA 3ZZ0A 1IXRC 4M1KA 2O5RA 3CCEB 2BM0A 1W7PB 2ZSHB 1X1BA 2LKXA 3HB9A 3OW7A 2QCOA 3HOYJ 4E7JA 1ULYA 3KEWA 3CCEI 1LQ1A 2PYHA 2LNBA 1RQRA 4V02C 2DMNA 2CUEA 2E71A 3VNUA 2X8KA 2BF4A 4MTDA 4RCYA 2A07F 2R7UA 1MJBA 3W2AA 2VKDA 3H5NA 2IGMA 3ONQA 1P4AA 4HX4A 2M4GA 3CMAI 4L8JA 4HF0A 2L7MP 3S8PA 3T8RA 4PJLA 4OINF 2UVEA 1IRFA 5HLGA 3IKTA 1DP7P 3SLDA 1QRBA 1IJWC 2YUHA 4IW3B 4U7DA 1FNCA 1T6ZA 4IPAA 1QVFB 4IQ4A 3IC7A 3IP4B 4YRVA 4NK6A 3AKZA 1AMOA 4E7LA 3VODA 1R1UA 2K9MA 3U6KA 4BACA 3VMFA 1NG6A 4OAYA 1Y8RB 1BOBA 1OLTA 2DN0A 2LMDA 1BIBA 3FXJA 5ICEA 3J80Z 2DODA 1G3WA 4L9NA 1A36A 2W84A 4ENKA 4CDGA 2BW3B 2GM4A 3NE5B 5GAGJ 2B9SA 2GQFA 1VQ6I 3OJWA 1JTAA 4HOBA 2M7AA 4V19K 3CJQB 2QSHX 1XQBA 2UUZA 3TDZC 3GVKA 2BXYA 2WV1A 3GSIA 2DFFA 3F72A 4QFMA 1RMGA 3PO3J 2HTJA 3B6CA 1OKRA 3DKWA 5K5QA 3A03A 1YO5C 3EDPA 4ACAA
chains in the Genus database with same CATH topology
1AA7A 2LYCA 3DPUA 2KDOA 1D0XA 1OHHA 2D3LA 3E1SA 3VYUB 1FX0A 1Y6IA 1JI8A 3LMMA 4KKUA 1WMRA 4BL0B 2O1DA 2VQLA 1MNDA 5DN6A 2QKLB 2JIZA 3GQBA 4BQOA 2Z6BD 2W82A 3F9KA 4BGDA 2M3AA 2PMZA 2XZOA 5JHFA 4IQJA 3SYTA 2V31A 1DBOA 2VBEA 4W8SA 2VKHA 1E79A 5HNFA 1E3ZA 3ZPPA 2BVMA 3GVLA 1BN8A 3OYNA 1MW7A 1IRXA 2NT9A 2V7FA 4BXFA 4II2A 2V6EA 2NSTA 3T9GA 2KZVA 2W7NA 4KT6A 3EUHC 3OOUA 4BQNA 2HVSA 3BCFA 1HG8A 3LSHA 4MR0A 3W2VA 5HOOA 1OB0A 4Z03A 4E7KA 1HA8A 1W9XA 2IGKA 3DPTA 2PECA 1SAUA 4KISA 2VXDA 5KCMA 2NTQA 4BS9A 2CV1A 3PJRA 1S9HA 3DU6A 3FBNB 4TKOB 3T53B 1UAAA 4Y4RA 3QYFA 4IX7A 4ZTJA 3OYJA 1SKYB 3G05A 4X0GA 5C1EA 1DQUA 1O8JA 3NWSA 1UD4A 2XZPA 4PMHA 2VBKA 1V5GA 2P0WA 2VXZA 4AVZA 4PK4A 2A5WA 4ZDPA 2PJRA 2DIEA 1EE6A 3OFNA 4ITVA 2R7RA 1YX3A 1VF7A 3ZPNA 4U49A 1Z21A 2XAUA 4GRIA 4N4NB 1UD5A 3N05A 2F43A 4E4HA 4J01A 4XR6A 1DBGA 4G7WA 2AQFA 1WP6A 4UZUA 1OOCA 2X6XA 3OS0A 1D1AA 4FETA 2AQEA 1BR2A 4DBRA 1IDJA 3M8JA 2LRDA 3DTIA 4LITA 4BUPA 3K4CA 2IS1A 2UWMA 2KVOA 3QOEA 1MABA 5FL7A 3ZGKA 1LVKA 3HUGB 2UVFA 2INVA 3B8YA 5TGTA 4JQFA 4PJMA 2I8DA 4CH7A 4YZAA 5LD2C 4FASD 4ZC3A 4DNTB 5KHDA 4CCNA 4EW9A 4C30A 4JOMA 1FMWA 3ZCOA 4C2TA 2F4IA 3H5AA 2ELJA 3K6GA 3GBGA 2R7SA 3FY3A 3K4NA 4ZYAA 3PNYA 2XGJA 1KCCA 1EA3A 3MMYB 2V7QA 3OEHA 4JMQA 4XL9A 2DOAA 4NQWB 4NK8A 4XORA 3OL3A 1K5CA 1T0FC 3FBIB 4XQFA 2IGOA 4E6KG 4OJPA 3ZR8X 3QYEA 4DJAA 3HAGA 2VQHA 3OAAA 4B3XA 3AFHA 1O8KA 3JURA 3VYTB 2IS4A 1OGOX 3BLYA 1DGRM 3A2KA 1QCXA 4B3FX 4MXNA 2Z8GA 3I9V2 3OYEA 3MKWB 1T5EA 2L7KA 3HKZA 2IGNA 1W36C 2KQRA 2VJIA 1NHCA 2L2OA 1QHHD 4XKVA 3UR3C 3OMYA 1JRGA 1YE9A 2WAEA 4E7SA 1HVXA 4U87A 4IKFA 2IQ7A 1O8FA 4BQQA 2VJ4A 3WQZA 1V5EA 2L9SA 2RNGA 3L2UA 3FPPA 1BR4A 2VJJA 2X1EA 4LG3A 2KHMA 4LIUA 3PFYA 2KRCA 2EWEA 2O0VA 4BJ6C 3IUOA 1YX5A 2WBMA 2PYGA 3DQVC 1VJSA 4XLFA 4OZYA 1N78A 4G7XA 2E1MC 3OYGA 1KMHA 2W6IA 4PUSA 1X1CA 2VJ5A 2XNDA 2WAFA 4HIZA 2XSJC 3I3LA 1O8DA 3VSTA 1H8EA 3L2QA 3TMOA 2R7XA 3QODA 3L2RA 5AMVA 4G6IA 1WJDA 3OYMA 4XD7A 4CCLA 2X85A 2BSPA 2X6WA 3ZQQA 2K5CA 3DLAA 2JJ1A 3D5LA 2CUJA 3K70D 3M1CA 3BC9A 1QU3A 2D3NA 1UG0A 4XKWA 4Y33A 2Q1ZB 4XMYA 4QPOA 3MKYB 1Z3YA 1E1QA 2WJVA 3OR2C 4II3A 2CUZA 1ZELA 4GQNA 2CFOA 2QKMB 4XM3A 3TBIA 4BJTA 1ERDA 5CQGA 2VBMA 4RMNA 3KEYA 4PJJA 4F93B 2E1BA 3NWTA 4DGWB 3D5SC 1VBLA 1E0EA 2CMPA 2HZDA 2V4DA 1BHEA 4D1QA 1BR1A 2WJYA 3SEQA 2K9LA 2V1NA 3VDXA 2R7QA 2E5ZA 3CF2A 5CQEA 3BG7A 3PSFA 3GRHA 4XLHA 1GLNA 3L2VA 3H9GA 2W00A 4NNJA 3A4CA 2V26A 3K4LA 2HPIA 1Y56A 4FXUA 2INUA 1Z7LA 2LBFB 2ZZQA 2VIXA 3MD2A 3B4NA 1P9QC 2IS2A 4E7ZA 1W0JA 4E7HA 4AYBA 2ZZFA 1O8IA 1PXZA 4G6TB 3OOCA 1MMNA 3OIPA 1U0JA 3T51B 2ZZGA 3OYCA 3LL7A 4BDZA 2MABA 1O8LA 1XG2A 2WSSA 3CESA 5CDFA 2VQGA 3K10A 3PSIA 5HVQC 4HWVA 3OYBA 1R6RA 2OUMA 2KLOA 4BJ5C 5HLTA 3OS1A 2LC2A 3G2BA 1H8HA 3VYRB 2GJKA 1QHGA 5IK2A 3IAS2 2LREA 4ZJZA 2PJRB 2CW8A 2GOXB 2M4KA 1LKXA 2HU9A 3DTKA 5HKKA 3VMVA 3HOTA 2DT7B 1UELB 3SUCA 3VSKA 3TL4X 2QX3A 3OYLA 1NG7A 2HLDA 4XONA 3EPZA 3PNTA 2VPLA 1W36D 4CUGA 1VLYA 3ZRGA 3D5RC 2R7WA 4Z1MA 2R7TA 1UD8A 2F6CA 1DGWY 1KONA 3OE7A 2CV2A 2M0MA 1VZ0A 1WJFA 4HNUA 1O88A 4NUBA 3K4BA 1EFRA 4D9JA 4XKBA 2WY8Q 3KX2A 3KYLA 2Z2SB 2NTPA 4PSXA 2ODLA 1WJAA 2X1CA 2GJPA 2RQQA 1MMGA 2WB1A 3FKJA 3BCAA 3K4MA 2F5VA 4W8TA 3HXLA 1X4PA 1RWRA 3BC8A 3W2WA 1WJEA 2ZXHA 4XN3A 2KP6A 2JDIA 2X51A 3VWBA 3CP8A 3CMMA 1KZLA 3A35A 3HPHA 1OFMA 4Y3OA 1BPLA 3GVJA 3BH4A 2KRHA 4F3QA 4TT3A 1UD6A 1MNEA 1AIRA 2JJ2A 2LY1A 4NC8A 2KMUA 3DEEA 3DU5A 2XC7A 1FMVA 4RLQA 3E0JB 4ANJA 3PUBA 4BE1A 4ZDOA 1WTHD 3H94A 3SZGA 1O8HA 1I18A 3EQNA 2E1MB 2OC6A 3ZSCA 4XLCA 4C9YA 2IS6A 1PYVA 3QYBA 2WA0A 3AL0C 2NZMA 3ZIAA 1PE9A 1TZLA 4PFOA 4CCOA 1O8EA 4J00A 3OR1C 3PNVA 4BDYA 3CZ6A 1D1CA 2DJIA 1N77A 2M7BA 2R9VA 2VASA 4TSFA 4W8QA 4ZTFA 3OYDA 3VYSB 4EATA 3VSUA 1E1RA 1CZFA 1H80A 2W4SA 2BOLA 4PSWA 2HVQA 3K4KA 1TT0A 2V4JC 2FUG2 3W3CA 2QY1A 1K6YA 1LFPA 2VL8A 2KPMA 3OYHA 2CV0A 2Z1DA 3J7AY 5LFAA 4KKTA 2IXSA 1X1DA 5HNHA 2X1DA 2O04A 4KJZA 2Q2EB 1W0KA 1NRKA 3OWTA 4HSTA 3K4JA 1WFXA 4E7IA 1OFLA 2CW7A 1V0FA 2E5NA 4XLEA 1PLUA 3GQ9A 4OJLA 4H4KC 1KCDA 3OYIA 3KRGA 3OIQA 1OR7C 2A6TA 3LSGA 2MFZA 4RM2A 4QPQA 4F91B 2WADA 5CPRB 3OYKA 1V5FA 2HPMA 4DK0A 4OJ5A 4B44A 4F92B 4F52A 1NBMA 4C2UA 3FDYA 4DBQA 3H5RA 1COWA 4IZZA 1WPCA 2WPDA 2ZZEA 2VB6A 4OAZA 4XKCA 3HL2A 4HRIA 2DXIA 4OJOA 1X1AA 3AL0B 3U21A 4B43A 1MMAA 2X53S 1D1BA 3K70C 3EUKL 3VSVA 3EUAA 3C2HA 2QE7A 4DOZA 1IA5A 3H0DA 3WWGA 4YZ0A 1X4OA 2LOOA 3DDYA 2BVLA 4YEJA 4XOPA 4P22A 2NOJB 3S3NA 2LG4A 2ZTNA 4Z05A 3RCOA 3DKXA 4KKSA 4C2LA 2JA2A 2XF6A 3OL4A 1KTWA 5C1CA 4B47A 3UW0A 3C2GA 1E43A 5FROA 2NSPA 4OWRB 4F55A 2DT6A 2XOKA 3RPUD 3CJRB 1D0YA 4YELA 3VSLA 4CZCA 2MC4A 1IB4A 3B90A 4DK1A 2XDVA 4XNFA 2WAQA 2CH0A 1O8MA 3S93A 1D0ZA 2X6YA 2W6JA 4W8RA 4AU7A 4BEHA 1OGMX 3CP2A 3ZXSA 2HVRA 2O0WA 3SDBA 1PKVA 2CS3A 3HC7A 4XLAA 4BU2A 2F1MA 1O8GA 2ZFUA 2HQAA 2GK6A 1X0CA 3RQ4A 4RM3A 3V42A 3H9JA 2WZPP 3BG6A 3JU4A 1J09A 3UNGC 2LZJA 2LH9A 4XOTA 2JUGA 1PJRA 3DWLE 3H9QA 4B48A 3SEZA 2MD0A 4PJNA 2M5SA 4YZXA 2L9NA 2GOMA 3IAM2 3DTEA 3RTRA 2GJRA 2KL4A 1RU4A 3LSMA 1WJCA 4DNRB 2R4GA 2XF7A 5KNLA 2R7VA 1E3XA 4RLFA 4YZQA 3MKZA 1SFKA 3GQ8A 4HEA2 4HG2A 1MMDA 2RREA 4N4OB 2DCEA 3BCBA 2MYSA 3LSKA 4HPQA 3S32A 4DIQA 3OYAA 5FRMA 1K28D 2X3HA 3VMWA 3HOSA 4YXWA 2LY2A 2ZSIB 4BEHB 3OY9A 1UD3A 4E0FA 2NTBA 4CA0A 2VQCA 4P5OA 1WJBA 1BLIA 4Z06A 2UV1A 3BCDA 3HPGA 5CKTA 4R79A 4I84A 2E60A 3DKYA 2NT6A 3GQAA 2Z16A 2HDWA 4KITB 1GQ8A 3T56B 2CK3A 4ZDLA 3DPLC 2OV7A 4BE0A 4HSRA 3S3OA 3LFUA 2JVHA 3GQ7A 3OS2A 4U4BA 4PFPA 1QJVA 2O5RA 4XN0A 2ZSHB 1X1BA 3OW7A 4LIVA 4B3GA 3LSIA 4E7JA 2K3PA 3PL8A 4CCMA 1Z3XA 3KEWA 2PYHA 1G8XA 2R7OA 3A1YA 2BW3A 4BE2A 1BMFA 3FHNA 1LDKB 2X8KA 3H35A 2R7UA 2WY7Q 3W2AA 3OEEA 2VKDA 1G59A 3H5NA 2IGMA 3ONQA 1N75A 2JVGA 2M4GA 2L5QA 2ZXIA 4NC7A 3S8PA 2HNHA 4HNTA 1HZEA 4L8JA 4PJLA 3VR6A 2JSPA 2LBFA 2UVEA 4URRA 1I8DA 2QXZA 4MLOA 3HG9A 3FKSA 2VLAA 4IQ4A 3IP4B 3EQOA 1DP3A 4YRVA 4NK6A 2O17A 5FRNA 4OJ6A 2Y0SA 3RSNA 3AKZA 4CCJA 4CSWA 4E7LA 2K9MA 4BACA 1NG6A 4OAYA 1X19A 1BOBA 1OLTA 3A3GA 4ASUA 3LMWA 4U7BA 3NE5B 2BW3B 3L2WA 3LNNA 3OPOA 1V0EA 1IDKA 2ZTGA 2W1OA 1UD2A 1JTAA 2M7AA 2XZLA 3OYFA 3CJQB 2UUZA 3GVKA 1T95A 3A3BA 4OZZA 1RMGA 2V9KA 2GK7A 2XF5A 4CCKA 3S3MA 4P1WA 1WJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8M A;  2X6Y A;  4W8T A;  4W8R A;  2IQ7 A;  1O8F A;  1OGM X;  1RWR A;  2O0W A;  1WMR A;  2O0V A;  2VJJ A;  4XLA A;  2EWE A;  2O1D A;  1O8G A;  4XN3 A;  1X0C A;  2PYG A;  4XLF A;  4OZY A;  4XOT A;  1DBO A;  1OFM A;  1O8D A;  4W8S A;  2VBE A;  4YZX A;  3VST A;  1RU4 A;  1AIR A;  5AMV A;  3ZPP A;  1BN8 A;  2NT9 A;  2X85 A;  2X6W A;  1O8H A;  2BSP A;  3ZSC A;  3EQN A;  4YZQ A;  4XLC A;  3GQ8 A;  2NST A;  2NZM A;  1HG8 A;  1PE9 A;  4XKW A;  4XMY A;  2X3H A;  4MR0 A;  3VMW A;  4Z03 A;  2NTB A;  2PEC A;  4W8Q A;  2NTQ A;  4XM3 A;  4Z06 A;  2VBM A;  3VSU A;  1CZF A;  1H80 A;  4I84 A;  2NT6 A;  3GQA A;  1VBL A;  5C1E A;  1GQ8 A;  1O8J A;  2QY1 A;  4PMH A;  1BHE A;  2VBK A;  4AVZ A;  3GQ7 A;  3GRH A;  1EE6 A;  4U4B A;  1QJV A;  4XLH A;  4U49 A;  2O04 A;  4XN0 A;  4XR6 A;  1DBG A;  1OFL A;  2INU A;  3B4N A;  1OOC A;  2X6X A;  2PYH A;  1PLU A;  4XLE A;  3GQ9 A;  4OJL A;  1IDJ A;  1KCD A;  1O8I A;  3KRG A;  1PXZ A;  4OJP A;  4OJ5 A;  2UVE A;  4URR A;  1O8L A;  1XG2 A;  2INV A;  2QXZ A;  2UVF A;  3B8Y A;  4YZA A;  4HWV A;  4OJO A;  3T9G A;  3EQO A;  1O8E A;  4EW9 A;  4OJ6 A;  4NK6 A;  2O17 A;  3FY3 A;  3VSV A;  1KCC A;  3VMV A;  4NK8 A;  4XL9 A;  4XOR A;  1IA5 A;  3SUC A;  3WWG A;  3LMW A;  4YZ0 A;  2QX3 A;  1K5C A;  4XQF A;  4XON A;  4YEJ A;  4XOP A;  1O8K A;  4Z05 A;  1IDK A;  3JUR A;  4C2L A;  5C1C A;  1KTW A;  1JTA A;  1OGO X;  3UW0 A;  1QCX A;  1O88 A;  2NSP A;  4MXN A;  2Z8G A;  4YEL A;  2NTP A;  4OZZ A;  1RMG A;  3B90 A;  2VJI A;  2ODL A;  1IB4 A;  1NHC A;  4XKV A;  4XNF A;  1JRG A; 
#chains in the Genus database with same CATH topology
 2LYC A;  2E1N A;  5LHH A;  5FO5 A;  1OHH A;  3BT9 A;  3VYU B;  1ZRC A;  3ULQ B;  2C2W A;  5FGM A;  4ESB A;  3HUG A;  3GXO A;  3G71 I;  1WMR A;  1VQK I;  1OFC X;  4UV8 A;  2O1D A;  1MBH A;  2HOE A;  2LD5 A;  3HOZ J;  5DN6 A;  4EGY A;  2VYQ A;  1DDG A;  1S3J A;  1QA1 A;  1ZTR A;  5HDK A;  2Z6B D;  2M3A A;  3GFM A;  4C3J J;  3A8J A;  2A61 A;  3PQK A;  2ID3 A;  4IQJ A;  4DQL A;  4BAY A;  2DBB A;  2H1L A;  5CVV A;  2D74 A;  3W6V A;  5L3E A;  1O3T A;  1H89 C;  4U0W A;  1E3Z A;  3F22 A;  4UB8 C;  1DG1 G;  1FOK A;  3M8F A;  1ON2 A;  2OQR A;  4WZL A;  2BXZ A;  1K4Z A;  2ZNY A;  2V6E A;  3L00 A;  4RBO A;  2NST A;  2KZV A;  2W7N A;  3EUH C;  3QAH A;  3J80 K;  2FD5 A;  2KZG A;  3O2P E;  1N0U A;  4MR0 A;  5L3B A;  3M8E A;  1W87 A;  1F60 A;  4E7K A;  1HA8 A;  1K7A A;  1YLF A;  2IGK A;  4QHY A;  3FMQ A;  3HOW J;  2VXD A;  5KCM A;  2VNI A;  2NTQ A;  5DD4 A;  1K6O A;  1BI3 A;  1W1W E;  3FXM A;  1S9H A;  4C3H J;  4HE5 A;  5CVU A;  3RQI A;  4IX7 A;  2M5W A;  3QYF A;  3OYJ A;  1SKY B;  3G05 A;  5B6I A;  1UD4 A;  1IC8 A;  1JUS A;  4P1V A;  1R5B A;  3GWZ A;  2FMY A;  4Q48 A;  3MAJ A;  1SC7 A;  5FNZ A;  2P0W A;  2R7Z J;  4A0X A;  4AVZ A;  3W2F A;  2M2E A;  4W1U A;  2CJJ A;  4ZDP A;  1EE6 A;  5M3M J;  3OFN A;  1YX3 A;  1VF7 A;  1KQ5 A;  3GZN B;  2XAU A;  3CCM I;  3N05 A;  1NH3 A;  1P2F A;  3AVW A;  1OYI A;  4A93 J;  3AST A;  3G3Z A;  1HW1 A;  1DBG A;  1RZ4 A;  2ACJ A;  4P55 A;  1WP6 A;  1VQ4 I;  3E6B A;  2X6X A;  3MZ8 A;  1V4R A;  2CFX A;  3KL9 A;  4TMW A;  3H3Z A;  1S72 B;  1AHD P;  4X7D A;  4N3G A;  1IDJ A;  4A5N A;  3M8J A;  2LRD A;  1IV6 A;  3DTI A;  4LIT A;  2IS1 A;  2VBX A;  2O9L A;  2PI0 A;  5FL7 A;  2JN9 A;  1XMA A;  2XAQ A;  3HRT A;  4ABZ A;  1LEB A;  3L7W A;  3CCL I;  1YIT B;  2INV A;  3F3X A;  3CD6 B;  3J7A O;  1TNT A;  4X7F A;  2IW5 A;  1IXC A;  3BR0 A;  4FAS D;  4ZC3 A;  4DNT B;  3CQZ J;  2CQ7 A;  2E7W A;  3FXL A;  1TYU A;  4EW9 A;  4C30 A;  5IYD J;  1FMW A;  3ZCO A;  2F4I A;  4BYY A;  1UB9 A;  1TQI A;  2ELJ A;  5LGU A;  1DU6 A;  1QQI A;  1IXS B;  2DYI A;  1VQM B;  2BM6 A;  3FY3 A;  4CIC A;  1VQK B;  5HS9 A;  3I0T A;  4RGR A;  1SFU A;  1U2R A;  3TOB A;  4NK8 A;  2DOA A;  5HS8 A;  1R5N A;  3M07 A;  3BG5 A;  4D0P A;  4R8H A;  1T0F C;  3FBI B;  1CF7 B;  2IGO A;  2YWE A;  2VQH A;  4B3X A;  3D1N I;  2ELK A;  5IOZ A;  1HF0 A;  3CF5 F;  5EYR A;  5DM6 F;  2IS4 A;  3MFK A;  2OPT A;  4MXN A;  4WXC A;  3I9V 2;  4KIF A;  3V8K A;  3MKW B;  2L7K A;  3HKZ A;  2IGN A;  1U8R A;  1W36 C;  1MNM C;  4KN7 X;  4XKV A;  3UR3 C;  1KK1 A;  1YW7 A;  1XDS A;  4KIG A;  2WC2 A;  4U87 A;  3E97 A;  1EFC A;  1O8F A;  1BW6 A;  2DYS H;  2LKS A;  2PFB A;  2VJ4 A;  1V5E A;  1DPU A;  1L1I A;  2VJJ A;  2X1E A;  3PFI A;  2KHM A;  3CJN A;  5A89 A;  3R61 A;  2O03 A;  1GXP A;  2JT1 A;  1YX5 A;  2WBM A;  4IL6 C;  2PYG A;  1P7J A;  1VJS A;  3I71 A;  1SVM A;  4UB6 C;  2JMW A;  1N78 A;  2BHY A;  1F5T A;  1BL0 A;  1O8D A;  2STT A;  2ZNZ A;  4RAF A;  3JTG A;  1H8E A;  3S14 J;  3VST A;  2F4M B;  4Z4Y A;  1TVC A;  5JI6 A;  2BSP A;  3TKY A;  3J7Y J;  1QA2 A;  4RDJ A;  2JPC A;  1L0O C;  2ECB A;  3D5L A;  4G8X A;  2O8K A;  3LST A;  3BC9 A;  2F4O B;  4Z4V A;  4MFE A;  4AM3 A;  3CCJ B;  1OR7 A;  2C6Y A;  1Z3Y A;  3Q38 A;  3LQQ A;  4X8I A;  2AHO A;  4II3 A;  1DAR A;  1YI2 B;  2VFM A;  1SEU A;  2O6G E;  2EH3 A;  1P4M A;  4GQN A;  4UVC A;  1KZH A;  2CFO A;  2QKM B;  3B6A A;  4UNO A;  2VBM A;  3FPK A;  1OCC H;  2XAS A;  1IAW A;  3V7A A;  1Z0X A;  1ODD A;  1IG7 A;  5D8K B;  1VBL A;  1E0E A;  2CMP A;  4ROX A;  2HZD A;  3LOC A;  2V4D A;  5ICF A;  4D1Q A;  1SAX A;  2BM4 A;  3CUO A;  4M2L A;  4QWQ A;  2EFW A;  3RJP A;  1R9T J;  5J4Y A;  3LNQ A;  2E5Z A;  4ETS A;  3KP7 A;  2R92 J;  4LGW A;  5E3M A;  4H0E A;  2V26 A;  2O61 A;  5M5X J;  3FMS A;  5D4S A;  3IRQ A;  3JRE A;  3BG3 A;  1I27 A;  4RGU A;  2LBF B;  1RNL A;  4TMZ A;  1EWY A;  1R7J A;  3B4N A;  2Y75 A;  5GTI C;  2PX9 A;  2IS2 A;  1R1T A;  4Z4W A;  3S1Q J;  3FXO A;  5BMZ A;  1O8I A;  2ZZF A;  2R5Z A;  1PXZ A;  5F0H A;  3FWE A;  1U0J A;  2BSA A;  3CLQ A;  2ME6 A;  2EB7 A;  3OYC A;  2MSY A;  2X6O A;  2HTS A;  4IHX A;  1XG2 A;  2EFP A;  1IZ1 A;  2XKP A;  4HWV A;  2DET A;  3OYB A;  1R6R A;  1FTZ A;  4BJ5 C;  4XLP F;  3OS1 A;  3E3V A;  3F8B A;  4PGG A;  3VYR B;  2BGC A;  4ZJZ A;  2D2W A;  4RD1 A;  2E1R A;  2QZ8 A;  2IA1 A;  2G9W A;  1BJK A;  3DTK A;  5GV7 A;  5HKK A;  2G7H A;  2VFQ A;  5AON A;  2MW8 A;  5EGO A;  2HKO A;  2W25 A;  2K9Q A;  4BKX A;  3GO5 A;  1HA3 A;  3VSK A;  2RNJ A;  3EPZ A;  3PIP F;  3EYY A;  1W36 D;  2EPF A;  1QZZ A;  3EYI A;  4TMX A;  1UD8 A;  1DGW Y;  1Q1H A;  5F64 A;  2H8R A;  3ABK H;  3MQ0 A;  1QFY A;  2M0M A;  1WJF A;  3H92 A;  4WWV A;  1WSV A;  3K4B A;  4MQ9 F;  4YIR X;  4LBY A;  3SZT A;  2CW0 F;  3KX2 A;  2ESH A;  2Q6I A;  2V7U A;  2X1C A;  2VBT A;  2HGC A;  4P6Y A;  4EH1 A;  4WXH A;  1MIJ A;  3MVP A;  1V55 H;  3ASS A;  2RDP A;  4W8T A;  1RWR A;  2MA3 A;  3B8H A;  3FXR A;  2QEX B;  3BC8 A;  1B8I A;  2P7C B;  2QUF A;  1E3O C;  4BY1 J;  3O3K A;  1ZHF A;  2P5V A;  2J5P A;  2W57 A;  1ETW A;  1WWX A;  1FOW A;  2Q8K A;  2ZXH A;  5GTH C;  2EFQ A;  1JKO C;  9ANT A;  1NDH A;  1X1P A;  3ONY A;  4BPR A;  1EA0 A;  1FOX A;  1KZL A;  3HPH A;  3A35 A;  1D8K A;  4Q47 A;  3DEW A;  1KQ9 A;  3F8C A;  1A6I A;  1MNE A;  1QG0 A;  5GV8 A;  2JJ2 A;  4ZZD A;  1WZ2 A;  3A0H C;  3HTU A;  3H3V K;  3CDL A;  2QM3 A;  4RLQ A;  4HA8 A;  3PUB A;  2EV5 A;  4OIO F;  1WTH D;  1N8R D;  3HBL A;  3J81 Z;  4C9Y A;  3RKY A;  1PYV A;  1JA1 A;  3QYB A;  2WA0 A;  3AL0 C;  3JTH A;  2DPU A;  4G7O F;  3DBR B;  4CCO A;  1T33 A;  1P6R A;  2CBX A;  1XSD A;  1ZGA A;  2L0K A;  3CZ6 A;  5IYB J;  1UMK A;  2HZT A;  4UUS B;  2M7B A;  5B66 C;  2YSR A;  2R9V A;  4PCQ A;  1TWC J;  1R4M B;  2OQG A;  1B4A A;  4EAT A;  3VSU A;  1E1R A;  2GXA A;  1K8F A;  1MDM B;  3CO7 C;  4PSW A;  1RIO H;  1TT0 A;  4ENM A;  3DF8 A;  5GAD J;  3W3C A;  2QY1 A;  1K6Y A;  2VL8 A;  3OYH A;  1Z7U A;  1I5Z A;  4KKT A;  2IXS A;  2N8G A;  2QA4 B;  5HNH A;  1DDI A;  1EFU A;  3BDD A;  2GPJ A;  3B02 A;  5LBQ A;  2O04 A;  4LBZ A;  1OFL A;  3KEQ A;  3K69 A;  1B6A A;  1XX5 A;  2OK7 A;  4EM2 A;  4Y13 A;  1G6N A;  4WWC A;  4NHJ A;  4H4K C;  1LNW A;  1KCD A;  3OIQ A;  2CW5 A;  3GZ5 A;  1JHH A;  3OZU A;  4DK0 A;  5FFX A;  2HYG D;  2RGV A;  4JP0 A;  2E1O A;  4F52 A;  2ZIT A;  1NBM A;  4IRG A;  3T1B A;  3IWZ A;  3FDY A;  2NOG A;  2IVM A;  2H27 A;  4TN1 A;  2DMT A;  2V7X A;  3ZMU A;  1BJA A;  5DCF A;  5J4V A;  1MMA A;  1LDD A;  3BOQ A;  1MJ9 A;  2W48 A;  2JZY A;  1D1B A;  3K70 C;  1TC3 C;  2H1K A;  1JJ8 C;  3S16 J;  3UKG A;  3EUA A;  3C2H A;  4DOZ A;  1IN5 A;  1ZGJ A;  4DZJ A;  4UZF A;  5GPA A;  3H0D A;  3WWG A;  1G4D A;  1W0U A;  4KNY A;  2OCE A;  4KA4 A;  1HKQ A;  1K61 A;  3LFK A;  3RCO A;  2HXI A;  3CMA B;  1HXD A;  3DKX A;  3JRC A;  4KKS A;  3NB2 A;  5C1C A;  3ZOB A;  3KZY A;  4OPW A;  5IYP A;  2A69 F;  3C2G A;  1E43 A;  3M1E A;  4OWR B;  4F55 A;  5CVI A;  4KMU X;  5EEA A;  1PJ7 A;  1HKS A;  2IP2 A;  5LHI A;  1QPM A;  1XGS A;  2ZME C;  4C3I J;  3RYP A;  1IB4 A;  4Y9R A;  4ZYG A;  1RI7 A;  2Y0M A;  4MHG A;  1FBU A;  2DO7 A;  3SHF A;  1ETK A;  4AU7 A;  4BEH A;  1MKM A;  3AAF A;  1OGM X;  3CP2 A;  4HBL A;  3ZXS A;  2JQ7 A;  2HVR A;  1FYM A;  2JTV A;  3TDU C;  1FWZ A;  2KRF A;  1IDY A;  3M4O J;  3BR1 A;  1XMX A;  2F1M A;  4XLA A;  4X7C A;  1O8G A;  2EJR A;  2QN6 A;  2HQA A;  4RM3 A;  2FVG A;  2CSO A;  4EJU A;  2WAQ N;  3UNG C;  3JU4 A;  2GA1 A;  5D4R A;  4PC7 A;  2M5S A;  2MD0 A;  4PJN A;  4LC0 A;  2GOM A;  2KKO A;  5JMC B;  2L7Z A;  2EFO A;  3DBL B;  3RTR A;  2GJR A;  3H9N A;  4Q5S F;  4HV5 A;  3AG3 H;  4OOX A;  2GIZ A;  3TW6 A;  4BBS J;  3F8N A;  1SFK A;  3MKZ A;  4A3I J;  4A3G J;  1HOM A;  4HEA 2;  3A8K A;  3BCB A;  3HSR A;  4KT5 C;  5J3O A;  4WXD A;  4B1R A;  3VMW A;  4DW6 A;  2H6B A;  5FRM A;  1K28 D;  3OSF A;  2XC1 A;  3BR6 A;  2RAE A;  3OY9 A;  1UD3 A;  3DEU A;  2VQC A;  1I3A A;  4P5O A;  1WJB A;  1JUM A;  4YAF A;  3A01 B;  4N9I A;  1SVO A;  1CQX A;  1ZGW A;  4G9Y A;  5A2Q Z;  2DFI A;  2CK3 A;  1I50 J;  1MBJ A;  1QZY A;  3DPL C;  3D26 A;  4HSR A;  3CCQ B;  1W35 A;  3LFU A;  3KYC B;  3GQ7 A;  2KIQ A;  4U4B A;  3ZN0 A;  1QJV A;  3NEU A;  1ZG1 A;  3CCR I;  2G0E A;  1XMK A;  5FKN A;  4LIV A;  3LSI A;  4YHB A;  1Z3X A;  1OJL A;  3Q5F A;  5J35 A;  3L09 A;  2W85 A;  3ZQL A;  5FLX K;  1LDK B;  4M9S A;  2Y30 A;  3K1M A;  1XC5 A;  3MN2 A;  4N0B A;  5IPA A;  3OEE A;  2VFN A;  1TBX A;  2JVG A;  5ED4 A;  3F23 A;  4AIK A;  1IJF A;  1CNF A;  1HZE A;  5IYQ A;  2WYR A;  2R0Q C;  2JSP A;  2LBF A;  3TH0 A;  3ZUG A;  1I8D A;  2WB1 N;  4X06 A;  4CXF A;  4MLO A;  3SY2 A;  3V7R A;  2OTL B;  3NAU A;  1EV7 A;  3ZMZ A;  3FKS A;  3ISX A;  2AHQ A;  3FF5 A;  1DP3 A;  4OP7 A;  2FA5 A;  1D8J A;  2FE3 A;  2W24 A;  4I02 A;  4LK1 F;  2RKH A;  4BHP A;  1XB2 A;  5LGT A;  3LQE A;  3A3G A;  1FZP B;  4RD4 A;  1KTV A;  2HYF A;  4U7B A;  4UZE A;  3L2W A;  3CME I;  1UST A;  3LNN A;  4ACB A;  2L02 A;  1UD2 A;  3DFG A;  5LRS A;  3OP1 A;  3TOA A;  1XPX A;  1JKP C;  2GZW A;  4AYB N;  4Y7N J;  4RD6 A;  3K7A J;  2UXN A;  3KP6 A;  2XGC A;  4OZZ A;  2V9K A;  2GK7 A;  1VQ6 B;  1TSP A;  2NS8 A;  4PC3 A;  1KK0 A;  3K1N A;  4P1W A;  4EM0 B;  5ERI A;  2QEN A;  3WOD F;  1H9T A;  1D0X A;  3KLN A;  4KFC A;  2D3L A;  1UZC A;  4LJZ F;  4M6Y A;  1UCR A;  3ZMV A;  4KKU A;  4G94 A;  4S05 A;  1EP3 B;  2AO9 A;  2PLY A;  2VQL A;  5EMN A;  1MND A;  4RD2 A;  3G6E I;  3P27 A;  2CQN A;  5F4O A;  1MBF A;  3IL2 A;  2DYR H;  3F9K A;  4IRI A;  4IHT A;  4X1E A;  1GAQ A;  4OIQ F;  2VOP A;  3JAM K;  4I7H A;  3GF2 A;  3WXM A;  2OBT A;  3OYN A;  1MW7 A;  1MRZ A;  2O0Y A;  3GUD A;  2V7F A;  1H9G A;  4BXF A;  5FJ8 J;  1K78 A;  2PQ8 A;  1VHO A;  4LLG F;  1JT6 A;  2V1X A;  4KT6 A;  5FKM A;  3OOU A;  4BQN A;  3BCF A;  1HG8 A;  1SMT A;  1HLV A;  1JB9 A;  5HOO A;  1W9X A;  4DNC A;  2E1C A;  2XSD C;  4YAW A;  3IHU A;  5B1B H;  4KIS A;  2B0R A;  2XTW A;  1SD4 A;  2MLG A;  3DU6 A;  3CO6 C;  1X3Z B;  2AXL A;  2M45 A;  4Y4R A;  4MEX F;  4ZTJ A;  4L9V A;  5DS0 A;  1T6X A;  4S04 A;  3QWL A;  1T38 A;  1BI1 A;  1QVU A;  3D0S A;  1QQ1 A;  5ICG A;  2FBK A;  4PMH A;  2GQQ A;  4A6E A;  1BA5 A;  2VOD A;  3CB4 A;  2PJR A;  3QPT A;  2DPD A;  3Q3S A;  3QU6 A;  3BWG A;  3ZPN A;  1W5S A;  4GRI A;  4N4N B;  1HST A;  2F43 A;  5E1Z B;  1TWA J;  4E4H A;  1ZYR F;  3WG9 A;  1M1E B;  3I59 B;  2R5Y B;  4TMV A;  4AD9 A;  2E2J J;  1Y0N A;  1IF1 A;  4WZK A;  5EEH A;  1SFO J;  1OOC A;  4RA2 A;  1J2X A;  5BPI A;  2K4J A;  3K9T A;  2QYU A;  3U1D A;  2DA7 A;  4KIB A;  2AQE A;  1BR2 A;  1VI0 A;  1ZG5 A;  4IXA A;  5DS9 A;  2EIL H;  1YJ9 B;  2UWM A;  1MAB A;  2AS5 F;  4PC6 A;  5F0F A;  1LVK A;  3ZGK A;  3HUG B;  5AIQ A;  1T0F A;  5K7H A;  3BNW A;  4ZYH A;  4KMF A;  4YEI A;  4JQF A;  4PJM A;  1Y0Y A;  4YZA A;  3RIR A;  3OV8 A;  5M3F J;  4PC2 A;  1RPW A;  1S6L A;  1YJN I;  5H5J A;  3H0G J;  2L4A A;  4UAJ A;  3CC2 B;  3K6G A;  1UJ8 A;  2R7S A;  3PNY A;  1WSR A;  2VBV A;  3FMR A;  4XL9 A;  1HDD C;  3F0C A;  5H6Q A;  4XOR A;  2VFP A;  3PSZ A;  2DT5 A;  5AIP A;  5F1R A;  3QYE A;  3OAA A;  2D9R A;  4E70 A;  4L0Z B;  5DYM A;  4Y9U A;  2AXT C;  2M87 A;  1Q1V A;  2EK5 A;  3G73 A;  1QBJ A;  2BYV E;  3CC7 I;  1O8K A;  3VYT B;  3JUR A;  2M0C A;  3E6D A;  3I59 A;  2LF8 A;  1OGO X;  1A6Q A;  2QQ9 A;  4RJL A;  2VBW A;  1B72 A;  1JT0 A;  2X48 A;  4JX6 A;  5ILV A;  3S1R J;  2Z8G A;  3G1L A;  3WTS C;  5JR3 A;  2COM A;  2C5H A;  2O3F A;  2Y9Z A;  3QPL A;  5D5V B;  4A3D J;  2L2O A;  2XAJ A;  1QHH D;  1YS6 A;  5J1U A;  3SFI A;  3I56 B;  4PZJ A;  1GV2 A;  1JRG A;  1YE9 A;  4E7S A;  2L7F P;  1JTY A;  4C2M J;  4BQQ A;  5BSX A;  1OPC A;  3TP3 A;  3ERM A;  1N07 A;  2RNG A;  2L9S A;  3L2U A;  4ENN A;  4IOC F;  2O0V A;  5F1J A;  4LG3 A;  1IRG A;  1QZE A;  1VQN I;  3IUO A;  5HS7 A;  2XRO A;  2L54 A;  4OZY A;  1W5T A;  3BR5 A;  3ABT A;  3PA2 A;  4G7X A;  2E1M C;  2VC1 A;  1CF7 A;  3W5V A;  1X1C A;  1HW5 A;  5DEQ A;  4HDV A;  2XSJ C;  4HLX A;  4RS8 A;  2PEX A;  5E3N A;  2ZJR F;  1O7F A;  4D5F A;  4KH3 A;  3T5X A;  2L9V A;  1Z67 A;  1WJD A;  5F04 A;  3OYM A;  2JJ7 A;  2ME0 A;  4CCL A;  3I1F A;  1XGM A;  1XSV A;  2E7X A;  1S7O A;  2X6W A;  3I5U A;  4M3B A;  4P26 A;  2K40 A;  4N3N A;  3W2I A;  3HSE A;  1UG0 A;  4G12 A;  2Q1Z B;  5HOD A;  2B63 J;  4AIH A;  2EA4 A;  1VQP I;  3JQQ A;  4X05 A;  4FCY A;  2CUZ A;  2TRT A;  2Q6K A;  1ZEL A;  3BY1 A;  1R5O A;  2LKP A;  4XM3 A;  4BH9 A;  2C5B A;  5CQG A;  1TTY A;  2DLL A;  2IA0 A;  3ESW B;  5F08 A;  1K83 J;  3HHH A;  4DGW B;  3D5S C;  3QFT A;  2XNJ A;  3G6E B;  2JA5 J;  2QF7 A;  5AN9 A;  1BHE A;  5CVJ A;  1VQL B;  5D6F A;  3Q0U A;  1LLZ A;  2K9L A;  1STZ A;  3BG7 A;  4WX9 A;  3L2V A;  3LSP A;  1W2B B;  3H9G A;  3E20 A;  2DI3 A;  3A4C A;  3LO8 A;  1IGN A;  1XN7 A;  1IUF A;  1J7K A;  1Y56 A;  2JSC A;  2XHK A;  1VQ7 I;  2ZZQ A;  2VIX A;  3CCU B;  2INU A;  2ADU A;  1P9Q C;  2BGJ A;  4HV6 A;  2D1V A;  4E7Z A;  2PG4 A;  2Y9Y A;  3DU1 X;  4EMS A;  3EUH A;  3KCC A;  3P5J A;  3ASN H;  5D5U B;  2RC6 A;  1UMQ A;  3DXJ F;  2HOS A;  3DCF A;  2QMU A;  1IDZ A;  3LL7 A;  4WCG A;  1YIO A;  2UZK A;  2YWF A;  2PBI A;  4HF2 A;  3Q6R A;  3AG1 H;  1R71 A;  4EEF G;  1EH6 A;  2L9R A;  4X6A J;  4DYR A;  4MGR A;  2GJK A;  1ONV A;  1O8E A;  4QTR A;  3T9G A;  5TR9 A;  4L0Y B;  1IN4 A;  1ZRE A;  1KU9 A;  1KYW A;  2CW8 A;  3ABL H;  4FT8 A;  1LKX A;  3I53 A;  4ESF A;  3TQN A;  4YG2 F;  1QGY A;  1B59 A;  1D1N A;  3VMV A;  3HOT A;  2X4H A;  5ILS A;  3FJO A;  1QGP A;  1PVE A;  2OBP A;  4P3Y A;  1UEL B;  3RZO J;  4AUX A;  3JSO A;  2NPF A;  4AF7 A;  4WF2 A;  3HGY A;  2HLD A;  1LJ9 A;  3PNT A;  3AG2 H;  3OJX A;  2QSF X;  3ZRG A;  3D5R C;  2F5E A;  1MBK A;  2R7W A;  4BXX J;  4Z1M A;  1BM9 A;  3RPU A;  2F6C A;  4A3J J;  1VQL I;  1KON A;  4HAM A;  1YW8 A;  2CV2 A;  2C77 A;  2DER A;  4RAY A;  2NXN B;  2BM5 A;  3WTY C;  2YX7 A;  5B1A H;  3V7C A;  1EFR A;  4XKB A;  4P9F A;  5DUI A;  1O3Q A;  2NTP A;  3GTQ J;  1Z9C A;  3BG9 A;  1WJA A;  2ODL A;  1LB2 A;  2RQQ A;  2IPQ X;  3FKJ A;  3ZQG A;  1QRY A;  1E62 A;  3P9K A;  3K4M A;  2I1L A;  2WTE A;  3BH6 B;  4Z4Z A;  1Z6T A;  1X4P A;  2BV6 A;  4S0H B;  1P92 A;  1WI9 A;  2VBS A;  4RDL A;  1ACI A;  3KP5 A;  4WZT A;  1H0M A;  1T56 A;  1AU7 A;  4XN3 A;  3COA C;  2JDI A;  1FIP A;  3ERE D;  3VWB A;  1ZR4 A;  4M0L A;  1U5T A;  2J8K A;  1OFM A;  4DZP A;  4Y3O A;  1BPL A;  1YHQ I;  5DM7 F;  2KRH A;  4F3Q A;  4P6V F;  2M8E A;  5DCM B;  1QH0 A;  3KE2 A;  2LY1 A;  4NC8 A;  2V5I A;  1VQO I;  3DU5 A;  1GUU A;  2LSO A;  4ANJ A;  3P4G A;  4BE1 A;  1A31 A;  1O8H A;  3EQN A;  3SYJ A;  1WDT A;  3V76 A;  3B82 A;  1SFX A;  1O57 A;  2KFD A;  1IW7 F;  3OR1 C;  4RD0 A;  1F1Z A;  3CC4 I;  5K5R A;  3DP7 A;  3A0B C;  4FTH A;  1N77 A;  4G1V A;  3I56 I;  3OZW A;  4HQM A;  4JRA C;  2IT0 A;  3RKW A;  1VQ9 I;  4PC1 A;  1S8N A;  4ZTF A;  1X58 A;  2GAU A;  3WYA A;  4W8Q A;  1KU7 A;  3E5Q A;  3HDD A;  1XCB A;  1SD6 A;  5E20 A;  1LUJ B;  2E19 A;  3IH4 A;  2V4J C;  1LE8 B;  2FUG 2;  2QYO A;  2XAG A;  2EFG A;  2ID6 A;  3QRF F;  4IHS A;  2KPM A;  2Z1D A;  3CC7 B;  3BQJ A;  3MHP A;  1K9M D;  4UUT A;  1X1D A;  2GLO A;  4PAB A;  2X1D A;  2K85 A;  4KJZ A;  3RY8 A;  4JK1 X;  1W0K A;  2JUC A;  1NRK A;  3OWT A;  5EZH A;  4HST A;  2VE8 A;  4E7I A;  2EA2 A;  1GDT A;  5J8C A;  3S17 J;  3ZQH A;  3IH2 A;  1T39 A;  3CC2 I;  2B7C A;  1PLU A;  3OYI A;  3ZP5 A;  3KRG A;  1OB5 A;  5IP9 J;  3LSJ A;  3CDI A;  4QPQ A;  4J0Q A;  4CYC B;  1PUE E;  1OIS A;  2CUF A;  3KP2 A;  2ZXW H;  1JHF A;  3WTV C;  1ZRF A;  3BZC A;  1DPR A;  3WTT C;  1GT0 C;  3H5R A;  4C2U A;  4IZZ A;  1WPC A;  2GWR A;  2ZC2 A;  4XRF A;  1TTT A;  2OZ6 A;  2BEO A;  4Q7J B;  1XDU A;  1E2X A;  4MYT A;  1WQ2 A;  3LQR A;  2Y48 A;  3LSR A;  2X53 S;  3I55 B;  2CWE A;  3EUK L;  3VSV A;  3FKI J;  1Y39 A;  2ZME B;  2QE7 A;  2VBY A;  2V7V A;  5F6F A;  5HLH A;  2QEX I;  2Q6O A;  1IA5 A;  1U2W A;  1JXS A;  3WTW C;  4YEJ A;  2KDZ A;  4XOP A;  2LVS A;  2PLF A;  2NOJ B;  4X7E A;  4A0Z A;  3S3N A;  1WCM J;  3W6J B;  2ZTN A;  5E3L A;  1XG1 A;  3QFC A;  4NC6 A;  1UHS A;  3OL4 A;  1FND A;  1ON1 A;  1XE1 A;  4KDP A;  4P9U A;  3ABM H;  2Z33 A;  4MEY F;  2DT6 A;  5A2Q K;  3GTP J;  2XOK A;  1HKT A;  3CJR B;  1D0Y A;  3ELK A;  2MC4 A;  3IWF A;  4A3F J;  2ECC A;  4HX8 A;  1B23 P;  3ZPL A;  1O8M A;  2ELH A;  2X6Y A;  2VN2 A;  2W6J A;  4W8R A;  1VQ5 B;  2FU4 A;  5DUK A;  2P5L C;  5M5W J;  4X0C A;  1SMY F;  3F8F A;  1EP1 B;  3KYD B;  2HYJ A;  1R58 A;  5THX A;  1ZN2 A;  2ZFU A;  4IEJ A;  4A3K J;  3RPQ A;  1G7S A;  1JTX A;  5H20 A;  1UHW A;  1QFZ A;  4ENJ A;  2WZP P;  2LH9 A;  4XOT A;  2TDX A;  1YJN B;  1KU3 A;  1Q9S A;  1PJR A;  2JPB A;  2LK2 A;  1B9N A;  1W4M A;  3DWL E;  3ROU A;  1H8A C;  1ORK A;  3OZV A;  1IB0 A;  2VBU A;  4D5C A;  2CQX A;  2PE3 A;  3DTE A;  1KQS B;  2ISY A;  2KL4 A;  5J6X A;  2GRE A;  3OSG A;  3TP0 A;  4V2F A;  1XGO A;  5F4M A;  2OU2 A;  3GX4 X;  4YZQ A;  4HG2 A;  4QUZ A;  4N4O B;  4XLN F;  2D5V A;  3SLN A;  2FF4 A;  2X3H A;  5TRD A;  3OYA A;  2K4B A;  2BPO A;  1RKW A;  2LDU A;  3HOS A;  3BQZ A;  2E2I J;  2XB5 A;  4YXW A;  1GV5 A;  1FEX A;  3WNC A;  1RKT A;  2QQB A;  1UHM A;  4F7Z A;  3BCD A;  3HPG A;  4R79 A;  4YCQ A;  2NT6 A;  3DKY A;  4ESJ A;  4Y52 J;  1S29 A;  2Z16 A;  2YR2 A;  2ZL7 A;  4ZDL A;  5IT3 A;  2OV7 A;  5FKL A;  2Y2Z A;  4M74 A;  4D7M A;  3CME B;  2ZL5 A;  5FLM J;  3O8H A;  1YRN A;  3RKQ A;  1KRH A;  3OW2 B;  1OCR H;  2DK8 A;  4FE7 A;  3LWF A;  4XN0 A;  5DV5 A;  4WK8 F;  4PAA A;  3V8L A;  2XRN A;  4RM0 A;  3G4S B;  2B7B A;  3A02 A;  2OJE D;  1BN5 A;  1TWH J;  3PL8 A;  4MQV A;  4FIS A;  1G8X A;  2NVQ J;  1F20 A;  2BW3 A;  2V1D A;  1LM1 A;  1BMF A;  2VBZ A;  3FHN A;  3GVA A;  3H35 A;  2ESN A;  5HDG A;  2WY7 Q;  5DD8 A;  1G59 A;  4OJP A;  4NC7 A;  1B72 B;  1K8A D;  3VR6 A;  2HNH A;  4C0S A;  3N6Z A;  5JLV C;  3TO9 A;  2QXZ A;  1NK3 P;  4EJT A;  3E5U A;  4F7D A;  5FKK A;  1KJZ A;  1IUY A;  3KP3 A;  1RQP A;  4M6X A;  1MD0 A;  1OMI A;  2RV8 A;  2CQQ A;  3RSN A;  4RB0 A;  1EH7 A;  4CCJ A;  1H88 C;  4CSW A;  2O6W A;  1GHC A;  4V2G A;  1D3Y A;  4NBQ A;  3U6B A;  2OBR A;  4U88 A;  4RCZ A;  1X19 A;  4O5V A;  3VNV A;  1TL8 A;  4DYQ A;  4ASU A;  3U2Q A;  3LMW A;  3S2W A;  5B3S H;  4M3D A;  4HLY A;  5L3F A;  1OGI A;  2QVO A;  5LMZ A;  3RIQ A;  1XSX A;  4CZZ A;  1G3Y A;  3ZN1 A;  4Z4R A;  5CYV A;  1K73 D;  5M5Y J;  1V0E A;  3I54 A;  2BN4 A;  5J47 A;  3CLO A;  2XZL A;  2K27 A;  4EV0 A;  1QVT A;  3OYF A;  3VO2 A;  2VON A;  2IEK A;  4CO8 A;  1V54 H;  2JRT A;  2PIA A;  3PM1 A;  2WZN A;  3WU1 B;  4MO7 A;  4GYG A;  1ETY A;  4CCK A;  3S3M A;  2F3L A;  5ILU A;  3RYR A;  1WJ5 A;  5K7Z A;  3JRH A;  1AA7 A;  1REP C;  2MC3 A;  4XBF A;  2F1L A;  3CC4 B;  1HF2 A;  2EQR A;  1FX0 A;  3SKB A;  2RVC A;  4RAG A;  1JI8 A;  3J81 k;  3LMM A;  1XS9 A;  2LF7 A;  2MH9 A;  3KPH A;  4BL0 B;  2JIZ A;  2DDB A;  3GQB A;  1SFE A;  2V79 A;  1U3E M;  1CQT A;  1X3W B;  1MJA A;  1NTC A;  3RDI A;  4CQJ A;  1VQO B;  2V9P A;  2W82 A;  2DTZ A;  2KJB A;  4ON0 A;  2PMZ A;  1DUX C;  2XZO A;  3GYH X;  3SYT A;  1J0R A;  3LAJ A;  3V4G A;  4I2O A;  2VNJ A;  2VBE A;  4G7H F;  2VKH A;  2XKO A;  5FD5 A;  1ELO A;  1E79 A;  5FKO A;  4B3A A;  3ZPP A;  2BVM A;  2BHZ A;  3GVL A;  4YFK F;  1BN8 A;  1FDR A;  2NT9 A;  4R1H A;  2E36 A;  2DA1 A;  2EZL A;  3SXY A;  1D8T A;  2FNP A;  4DQK A;  3ZMT A;  4RDU A;  2HVS A;  1JNY A;  4B4C A;  5D8L B;  4Z03 A;  4A3M J;  3QFR A;  1J59 A;  3DPT A;  3JQP A;  4XIC A;  3S2D J;  1SAU A;  2IBD A;  1FPQ A;  1Y1V J;  4BS9 A;  1FBQ A;  3PJR A;  3FBN B;  3BR2 A;  4TKO B;  1FSH A;  3T53 B;  1UAA A;  4EGZ A;  3U9G A;  2QSG X;  1TUI A;  2DY1 A;  3NWS A;  2XZP A;  1BI2 A;  2VBK A;  1V5G A;  5K1Y A;  2DIE A;  2A5W A;  1U6G A;  2VFO A;  3QSY A;  4KUM A;  4ITV A;  2R7R A;  1D5V A;  4U49 A;  1HDP A;  2CF4 A;  1UD5 A;  2H6C A;  4J01 A;  1S7A A;  3ZC3 A;  4XR6 A;  5LLQ A;  2VKE A;  2FQ3 A;  3P9I A;  3PUF A;  3BY2 A;  3DLL F;  2I10 A;  2AQF A;  2K7L A;  2JWT A;  5KAI C;  5F27 A;  4MTE A;  1D1A A;  4OIP F;  3LJY A;  1IN7 A;  2CRV A;  1J9I A;  1WRJ A;  2DA5 A;  3L9F A;  2HDN B;  3PQJ A;  2VPR A;  2OYN A;  4RGX A;  4XRS G;  2ZJQ F;  3K4C A;  1UFM A;  3QOE A;  2XPW A;  3I64 A;  1YYV A;  1KGS A;  3JRG A;  2UVF A;  5TGT A;  2FBI A;  2I8D A;  2Y69 H;  4UVB A;  1VND A;  2PMU A;  4CH7 A;  1DAB A;  4YDT A;  4FWT A;  2GBY A;  3KEO A;  1IN8 A;  2I5U A;  2IAI A;  3FK7 A;  5BNG A;  5KHD A;  4L5J A;  1WSU A;  1PUF B;  2STW A;  4X07 A;  4Z4U A;  4C2T A;  3Q9S A;  3H5A A;  1JGG A;  3GBG A;  4NB5 A;  3ZQC A;  4ZYA A;  2XGJ A;  2V1U A;  4R71 A;  2P6S A;  2PJP A;  1EA3 A;  3MMY B;  2V7Q A;  4JMQ A;  1ZKG A;  2NAZ A;  2IA2 A;  4XQF A;  4E6K G;  2KIF A;  1YIT I;  3ZR8 X;  2Z5U A;  1D2E A;  3SFZ A;  4DJA A;  3EET A;  3HAG A;  3P26 A;  4ZYE A;  5FO0 A;  4G6D A;  1GVJ A;  5LHG A;  5IT9 K;  2F48 A;  1GVH A;  1CLW A;  4GYI A;  3JRD A;  5E1W A;  2NS0 A;  4ZGQ B;  1TT5 B;  4CHU A;  3OKX A;  3OYE A;  1T5E A;  1VQ4 B;  3ZQ7 A;  1RRJ A;  2KQR A;  2MH2 A;  3U2R A;  3PET A;  1J75 A;  1I7P A;  2XPU A;  2BY1 A;  3OMY A;  4UUV A;  1RUN A;  5BPD A;  2WAE A;  2XUB A;  3MEX A;  3QPS A;  2NNY A;  4IKF A;  2CND A;  1SKQ A;  3QE2 A;  1JKR C;  2Z9O A;  4M6V A;  3N4M A;  3FPP A;  3HZJ A;  2H94 A;  1LDJ A;  1EF4 A;  3I4P A;  2KRC A;  3PFY A;  3CCQ I;  1VQ8 I;  2EWE A;  1GR1 A;  4OM9 A;  1IO2 A;  3ONU A;  1LFB A;  4XLF A;  5DNS A;  4RGS A;  1U78 A;  3OYG A;  1KMH A;  2W6I A;  4G5G A;  2XND A;  4AF6 A;  2VJ5 A;  1FRN A;  4AC0 A;  3S2H J;  4YAU A;  3I3L A;  4EQQ A;  3H09 A;  2OCC H;  2DW4 A;  5F0C A;  3TMO A;  3QOD A;  4G6I A;  1GJR A;  1OYY A;  2XAH A;  2MBF A;  2X85 A;  2DA6 A;  4M72 A;  4NDL A;  5IYC J;  4Y15 A;  1FRQ A;  3JX8 A;  2JJ1 A;  2CUJ A;  2W7Z A;  1FNB A;  2B5O A;  5EG0 B;  2P4W A;  2EV0 A;  1O4X A;  1XB4 A;  2DTR A;  2D3N A;  5FLV A;  4Y33 A;  4XMY A;  3MKY B;  4QPO A;  1E1Q A;  2WJV A;  1FP2 A;  1YFH A;  4B4D A;  1HW2 A;  5LEJ A;  1YQA A;  2C78 A;  2QGG A;  1FP1 D;  2DU9 A;  5BS6 A;  2XGD A;  4UVA A;  2QBY A;  1QGZ A;  2JK3 A;  1PJ6 A;  3AVX A;  2VE9 A;  2BM1 A;  4RMN A;  3KEY A;  2BM7 A;  5KAF C;  1M90 D;  2XT4 A;  1Z77 A;  1T98 A;  4K2E A;  4FK8 A;  4M71 A;  2YUS A;  4EM1 A;  1PP8 F;  5H59 A;  1LVA A;  4ASN A;  2WJY A;  2A05 A;  4BQA A;  2VT3 A;  1Z1D A;  2R7Q A;  3CF2 A;  5GAH J;  3PSF A;  3E1Y E;  2DQL A;  2GIV A;  5IP7 J;  4I09 A;  2DA4 A;  2W00 A;  2PMH A;  2DA3 A;  1W7P D;  3QP5 A;  2DMU A;  2YWH A;  3CCU I;  1HCR A;  2BX6 A;  4HNV A;  1TQM A;  2CGP A;  4FXU A;  1R4N B;  1Z7L A;  3MD2 A;  3CTA A;  3EQL F;  5EG0 A;  3CCM B;  1PP7 U;  3NAR A;  2P8T A;  4HYE A;  2JRM A;  4Q4Z F;  2NVY J;  4PDK A;  3CMY A;  3PEN A;  4OPO A;  4A2U A;  2HS5 A;  4YIF A;  2EWN A;  4E7H A;  1N0V C;  1W0J A;  2F4N A;  2QWW A;  3VB2 A;  4ZZL A;  3ASQ A;  1MMN A;  1QO0 D;  2ZO4 A;  3T51 B;  2ZZG A;  1K4S A;  1IRZ A;  2MAB A;  4G6Q A;  1LEA A;  2DFH A;  3CES A;  3O6B B;  2KIM A;  2NYX A;  2VQG A;  3PSI A;  5HVQ C;  2WSS A;  1VHE A;  2O8X A;  1K79 A;  2MG4 A;  1U8B A;  4UUS A;  2OUM A;  2KLO A;  2QTZ A;  2ZBU A;  2ZL6 A;  3G2B A;  5E79 C;  1AOY A;  5IK2 A;  2DOE A;  2CQK A;  3IAS 2;  4GO1 A;  1WOO A;  1FX7 A;  2PJR B;  2GOX B;  2KJC A;  2M4K A;  3CCS B;  1LE8 A;  2DT7 B;  1RET A;  2GA2 A;  5E8I A;  5J1Y A;  1KYZ A;  4FX0 A;  3WU0 A;  1CGP A;  1EKE A;  4M3G A;  3TL4 X;  2NVT J;  3OYL A;  1NG7 A;  3KFW X;  4XON A;  2QX3 A;  2VPL A;  2QGU A;  3WE3 A;  2CG4 A;  1MH3 A;  4CUG A;  1ZG3 A;  2HOA A;  3H36 A;  3BZK A;  1MSE C;  2R7T A;  3DV8 A;  3ZMS A;  3PA1 A;  1I39 A;  2YPR A;  1FBS A;  1ZM2 A;  2DK5 A;  3Q39 A;  5DSZ A;  4QIW N;  4LOC A;  3V8J A;  1O88 A;  5D5X B;  2WV0 A;  4D9J A;  4BY7 J;  2LP0 A;  4LLL A;  1Q81 D;  2Z2S B;  3F6O A;  5IYW A;  3CW2 A;  2GJP A;  3REO A;  2KIU A;  1MMG A;  4MNU A;  3V7S A;  3BCA A;  3N90 A;  4AWX B;  4LK0 F;  1YI2 I;  1S0U A;  3A1P A;  4I0A A;  1BJZ A;  4OOI A;  2D45 A;  2ETH A;  2QA4 I;  4IVN A;  1MZB A;  1F43 A;  5J8F A;  3CRZ A;  3W5U A;  3A01 A;  3BY6 A;  1OFD A;  2EIM H;  4IRH A;  4LBW A;  4RAZ A;  4XID A;  3W2W A;  5L3C A;  4NBS A;  2KP6 A;  3CCS I;  2X51 A;  2XGE A;  3ZZT A;  3GVJ A;  3R6K A;  2QQA A;  3WE2 A;  2IRF G;  4TT3 A;  1UD6 A;  3K2A A;  2LR8 A;  1R1V A;  1YRN B;  4AC9 A;  1ETX A;  1XGN A;  1AIR A;  4AIJ A;  4O3M A;  2KMU A;  3DEE A;  3E0J B;  3HSF A;  4ZDO A;  3ZSC A;  1I18 A;  3TED A;  2E1M B;  2OC6 A;  3QU3 A;  4LG0 B;  4XLC A;  4XRM A;  2IS6 A;  1V3F A;  1F4K A;  1B2R A;  3ZIA A;  1TZL A;  1WGX A;  2EV6 A;  1S5L C;  2Y31 A;  3PNV A;  3VEP A;  4BDY A;  3S1N J;  2QLZ A;  4M9X A;  1M1K D;  1T2K A;  5EDN A;  3M9A A;  3VYS B;  1O7L A;  5KW9 A;  4EJO A;  1ZAR A;  3WHB A;  2VI6 A;  3WNB A;  1H80 A;  1PJ5 A;  2XT2 A;  1POG A;  1U9N A;  3W2H A;  1TP4 A;  1G7C A;  4FE4 A;  1QGA A;  3BTJ A;  4TV7 A;  2CV0 A;  3J7A Y;  2M34 A;  2RQP A;  2L4M A;  5LFA A;  1QUE A;  2NVU B;  2P81 A;  2PMZ N;  3BJ6 A;  3GTK J;  5E6T A;  5D6E A;  3G1M A;  1OYW A;  4TMT A;  2E34 A;  2ZJ2 A;  1WFX A;  3K4J A;  2A6E F;  1T6S A;  5JFR A;  1WPK A;  1VQ9 B;  3GEZ A;  4LLN A;  1VQM I;  3FM5 A;  3TO6 A;  1V0F A;  2E5N A;  4XLE A;  1Q82 D;  3SJZ A;  3GQ9 A;  4OJL A;  3HJE A;  3LA2 A;  3CCJ I;  1TQP A;  1AKH A;  2FOK A;  4RD3 A;  2A6T A;  4RM2 A;  2MFZ A;  3OIO A;  3OYK A;  1VFC A;  2WAD A;  5CPR B;  2OTL I;  1V5F A;  1WHU A;  3ZBU A;  4XSX F;  3CD6 I;  3HRU A;  4B44 A;  4F92 B;  4OU0 A;  1MSF C;  3R4K A;  1WOR A;  4DBQ A;  3HRM A;  4QVA A;  5GPC A;  2DQR A;  1ZM9 A;  1ZK8 A;  2L01 A;  4XKC A;  3HL2 A;  2VKV A;  4XK4 A;  2DXI A;  1YHQ B;  4OJO A;  1S72 I;  4B43 A;  3I55 I;  4A3L J;  5A8A A;  2C4T A;  3R6S A;  1JA0 A;  2HQR A;  5FA6 A;  5F4J A;  3HOU J;  4UV9 A;  1VQ8 B;  1EFT A;  3ML6 A;  3CCR B;  1OCO H;  2OAZ A;  1Y0R A;  4HE6 A;  4YZ0 A;  4Y17 A;  1IN6 A;  1B1B A;  2LOO A;  2NVX J;  2JA8 J;  3SJM A;  2RC5 A;  3ASR A;  4P22 A;  3PUN A;  2VNK A;  4HDU A;  2LG4 A;  3E7L A;  5BOX A;  3CUQ C;  3R6J A;  2JA2 A;  1F9N A;  2Q2E A;  4C2L A;  1FC3 A;  3UW0 A;  1P7I A;  4ZCM A;  2BGI A;  2OTJ B;  2NSP A;  3PSS A;  1XCV A;  3I4N J;  1AIP A;  2K86 A;  1QPI A;  2D1H A;  3RPU D;  1NHA A;  1C0W A;  5K5O A;  4QV2 A;  3B90 A;  4DK1 A;  5L46 A;  2G0Y A;  3JCU C;  2CH0 A;  3S93 A;  1D0Z A;  4BXU A;  4OMZ A;  2BMW A;  4H9G A;  5HZA A;  1E63 A;  1U5T B;  1G2H A;  1TNS A;  5C4X J;  3PO2 J;  3SDB A;  4JBA A;  1YW9 A;  1X2M A;  3HC7 A;  1R49 A;  3CCV I;  1Z05 A;  3ASP A;  2GK6 A;  1X0C A;  1ZLJ A;  3ZMD A;  4DQ2 A;  3H9J A;  5H2F C;  4OIR F;  4UHT A;  4L18 B;  3VPR A;  4UY8 I;  4UXN A;  3AGQ A;  4YC5 A;  3H9Q A;  3HOX J;  3KIO A;  4YZX A;  3SZE A;  5HLI A;  1RU4 A;  1QFJ A;  3LSM A;  4JX4 A;  1QA6 A;  1ETO A;  1WJC A;  4DNR B;  3JRF A;  1OCP A;  5KNL A;  2EIK H;  2R7V A;  4RLF A;  3IKV A;  3GQ8 A;  3KZZ A;  3CPW B;  2MLK A;  2RRE A;  1YJW I;  3HRS A;  3HKZ N;  2DCE A;  4HPQ A;  3GME A;  3S32 A;  1ENH A;  2QQ8 A;  4DIQ A;  1ZAO A;  5EZG A;  3AK5 A;  4E0F A;  2EIN H;  4CA0 A;  3QPH A;  4FHT A;  1F36 A;  3L1P A;  4A69 C;  4B09 A;  2EZK A;  2Q0O A;  1WVR A;  3JRI A;  1BLI A;  3WBK A;  4Z06 A;  3G1O A;  5CKT A;  4A3C J;  4I84 A;  2E60 A;  2ZJP F;  2HDW A;  2K9S A;  3Q0W A;  4KIT B;  4ZGN B;  1GQ8 A;  2DAO A;  3KZI C;  2P3M A;  1HSJ A;  2M9H A;  1TLL A;  4P3I A;  4A0Y A;  4M3F A;  5KK1 A;  3OS2 A;  4U0V A;  3LYC A;  2BE5 F;  2DOF A;  1G7R A;  3MWM A;  4IHY A;  5B5E C;  2NS7 A;  3WG7 H;  1S4M A;  3HM5 A;  4A12 A;  3C2B A;  1ZLK A;  4QSH A;  4B3G A;  3NRV A;  3HIF A;  4LG0 A;  3FHZ A;  3ABU A;  2K3P A;  4CCM A;  2CO5 A;  4YAO A;  2R7O A;  3A1Y A;  2V7T A;  4HIZ A;  4BE2 A;  1KK3 A;  3ML3 A;  2DMQ A;  1WU8 A;  1I3Q J;  2FBH A;  1KC8 D;  2XVC A;  4P2N A;  1ETQ A;  1N75 A;  2L5Q A;  2ZXI A;  4HNT A;  4MYU A;  1BX0 A;  4URR A;  3IV5 A;  4GFB A;  1E3H A;  4G1B A;  3CUQ A;  2FNA A;  3HG9 A;  5JBQ A;  3ZQF A;  1ZQ3 P;  3Q3A A;  4FQG A;  3ZQI A;  2VLA A;  2R7D A;  3T8T A;  3JAM Z;  3EQO A;  3FXU A;  4OJ6 A;  2O17 A;  3FM3 A;  5FRN A;  2Y0S A;  2ZB9 A;  2FX0 A;  4I76 A;  4KIC A;  2VOO A;  2EZI A;  4QLC U;  1I1S A;  1VQN B;  2JN6 A;  4P9S A;  5FD6 A;  2HWV A;  4HF1 A;  2BY3 A;  5A88 A;  2M8G X;  2WWY A;  1APL C;  3VO1 A;  3IRR A;  4IHW A;  4LD5 A;  3BTL A;  4BHC A;  4XRS A;  3I58 A;  2Y0S N;  3OPO A;  1IDK A;  2ZTG A;  2W1O A;  5TIS C;  2PN6 A;  3MMP A;  3WBJ A;  2HQ5 A;  3R60 A;  2HEO A;  3TW7 A;  5EGO B;  4CYC A;  2NV4 A;  2HDD A;  1W34 A;  1T95 A;  4IJA A;  3A3B A;  3CUQ B;  1ZM3 A;  2XF5 A;  5JLW A;  5IY5 H;  3CCL B;  1K5C A;  2BZT A;  3R0A A;  1D5Y A;  1IJE A;  3DPU A;  1N05 A;  2KDO A;  5GAE J;  1FYK A;  1XFO A;  3E1S A;  2XTY A;  3T0Y A;  1Y6I A;  2J8I A;  2YU9 J;  4BHB A;  3JSP A;  3WTX C;  1YTY A;  2J5O A;  3W6K B;  1NB0 A;  1A04 A;  1R36 A;  2LFB A;  4BBR J;  2QKL B;  3NAW A;  2LY9 A;  4BQO A;  2OTJ I;  4BGD A;  5JHF A;  2V31 A;  1DBO A;  4W8S A;  1B8I B;  3BPX A;  2HI3 A;  1S7E A;  3ECH A;  5BSY A;  5HNF A;  2P5K A;  3F21 A;  1I6H J;  2Q6L A;  3LA3 A;  1ZH5 A;  3WGI A;  1IRX A;  2LTP A;  2UXX A;  3RZD J;  2VT2 A;  3BQY A;  5H6R A;  4II2 A;  1KK2 A;  4M53 A;  3WU2 C;  1TYV A;  3SQN A;  3LSH A;  3W2V A;  2ZBK A;  2Z3Y A;  2VUM J;  3B73 A;  1OB0 A;  1Z6R A;  3BRO A;  2ZFW A;  2F2E A;  3JQR A;  3X2Q H;  1Y0U A;  4JX5 A;  2O7O A;  3JRA A;  1DU0 A;  2CRG A;  2PEC A;  3TO7 A;  5E3O A;  5GP9 A;  2CV1 A;  1KQ8 A;  1JJ2 B;  3KP4 A;  1RR7 A;  2M1B A;  5DCM A;  1XTA A;  1MBE A;  4X0G A;  5C1E A;  1DQU A;  2YU3 A;  1O8J A;  3PUM A;  1KA8 A;  4Z2Y A;  2R5Z B;  3AGP A;  4PJ0 C;  1BQE A;  4CYD A;  3CXC B;  2VXZ A;  4PK4 A;  1O3S A;  1GXQ A;  4DYC A;  1RR8 C;  3FIW A;  5LEK A;  2FSW A;  1Z21 A;  2NNN A;  5JVT A;  5C44 J;  3B78 A;  2HOT A;  4NQW A;  3WND A;  4G7W A;  1OGJ A;  4UZU A;  3WTU C;  3OS0 A;  5DTD A;  4Z4S A;  2B0L A;  1R22 A;  4FET A;  1TYW A;  4DBR A;  3CPX A;  5LGN A;  3L2C A;  1ZR2 A;  2XB0 X;  3Q9V A;  4OPV A;  4BUP A;  2KVO A;  2P7V B;  2XIG A;  1OCT C;  3C18 A;  2RN7 A;  5BQT A;  1E64 A;  3B8Y A;  2QDX A;  5CVR A;  5E17 F;  1BBY A;  3SDG A;  2BVN A;  5LD2 C;  5KSW B;  3HOV J;  2QZA A;  4ZH4 F;  4CCN A;  3FXK A;  4JOM A;  3K0L A;  4MFD A;  1E3P A;  4I6Z A;  1HBX G;  5FO1 A;  4IF4 A;  1EZG A;  2DFE A;  3K2Z A;  3K4N A;  1G3S A;  3LQ6 A;  2G7U A;  4I99 C;  2QTL A;  1RES A;  2E35 A;  4GGG A;  1J5Y A;  1KCC A;  1ETV A;  3MZY A;  1A8P A;  3OEH A;  4GXO A;  4NQW B;  1BW5 A;  3Q0V A;  1VF9 A;  4EJV A;  3OL3 A;  2COB A;  5J3L A;  1VQ5 I;  1SM4 A;  2PMD A;  3ES9 A;  1YS7 A;  1WH5 A;  3AFH A;  1EJ9 A;  1E17 A;  3C3W A;  1WXR A;  1N06 A;  2XPV A;  2DOG A;  3BP8 A;  3P7N A;  2E2H J;  3SQV A;  1SVL A;  3BLY A;  1DGR M;  3FK6 A;  3FX3 A;  4GDF A;  3A2K A;  4A3B J;  4B3F X;  1QCX A;  1NJI D;  4HQE A;  4I0B A;  2VJI A;  3G4S I;  1BC7 C;  1NHC A;  5J1R A;  3N97 A;  3KET A;  1JKQ C;  1HVX A;  5EJC A;  3WY9 A;  2XEX A;  2IQ7 A;  4LFU A;  1QUF A;  3WQZ A;  4D7N A;  3WHC A;  1NB9 A;  1BR4 A;  1R5H A;  4I98 B;  4LIU A;  4L9J A;  1FNM A;  3Q6Q A;  4BJ6 C;  3J7Z I;  5TV2 A;  2FJ1 A;  1BOA A;  3DQV C;  1W0T A;  2M30 A;  4O6J A;  5CJ9 A;  1X2N A;  3MKL A;  1K78 B;  3M3Y J;  4P96 A;  4A5M A;  4PUS A;  1LPQ A;  4L5E A;  1ZRD A;  1YOV B;  2WAF A;  2LLK A;  5ICC A;  3HEF A;  2BV3 A;  1SD5 A;  4ZCI A;  2A68 F;  3H3U A;  3L2Q A;  4QVJ A;  2CU7 A;  2TCT A;  2XRL A;  3L2R A;  2FML A;  2YS9 A;  2JA6 J;  2R7X A;  4YII A;  4OPS A;  5AMV A;  4XD7 A;  4HZF A;  3CJT B;  2F5C A;  3ZQQ A;  2K5C A;  4U9U A;  4G7Z F;  3DLA A;  5CLS A;  5KVR A;  3SJP A;  3K70 D;  3M1C A;  2BY2 A;  4M3E A;  1FYL A;  3ISP A;  5E1X A;  1QU3 A;  1UG2 A;  2DEU A;  2R6H A;  3WTZ A;  4XKW A;  2IJL A;  4RDK A;  2C4U A;  4M4S A;  3OR2 C;  5J40 A;  3BH7 B;  1FJL A;  2BY0 A;  1YLO A;  1QVG B;  2OD5 A;  3FIS A;  3GFI A;  5IT9 Z;  3ECO A;  1YIJ B;  3E6M A;  1GVD A;  3TBI A;  4BJT A;  1ERD A;  4WZE A;  1LLW A;  2R3S A;  3O8G A;  4PJJ A;  4F93 B;  1ZM4 A;  3NWT A;  2E1B A;  3VFZ A;  1N08 A;  4YFN F;  2J7K A;  4LBV A;  2HMA A;  1BR1 A;  4Y7C A;  1XD7 A;  1QX4 A;  5FIU A;  3SEQ A;  1R23 A;  4I01 A;  4NCN A;  3GRH A;  2V1N A;  3VDX A;  5CQE A;  5E8G A;  1MMS A;  1H42 A;  4XLH A;  1GLN A;  3GFJ A;  1MH4 A;  3WGG A;  4NNJ A;  5HDN A;  1GO2 A;  5K7F A;  4FX4 A;  3K4L A;  3ZBT A;  2OBS A;  2HPI A;  2BBY A;  3RI4 A;  1OFE A;  1TWF J;  3QOP A;  2XTX A;  1OCZ H;  5D5W B;  2VZL A;  2X0L A;  3GW2 A;  1YJW B;  4L5I A;  1EH8 A;  4AYB A;  2K3F A;  2CYY A;  5FB2 A;  2R93 J;  4G6T B;  1FLI A;  3OIP A;  3OOC A;  2IOU G;  3LVB A;  1HQC A;  4N9H A;  1L3L A;  3GZ6 A;  4BDZ A;  2FX3 A;  1O8L A;  1A35 A;  5CDF A;  3K10 A;  4W97 A;  1JGS A;  5C4J J;  4BNC A;  3HGG A;  3GTO J;  2K9N A;  4ZCL A;  1H8H A;  5HLT A;  2LC2 A;  1J9Z A;  1QHG A;  4PGH A;  1RUO A;  2LRE A;  3ZZU A;  4KYW A;  2A5Y B;  5TY0 A;  2HU9 A;  3OOP A;  1YX2 A;  1ZUN B;  5FFZ A;  3CCV B;  2MD5 A;  2OK8 A;  1FIA A;  3W2G A;  3J81 K;  2YX4 A;  2V7W A;  1BX1 A;  1Y8Q B;  1V5V A;  2ZBV A;  4C43 A;  1OQY A;  4WQM A;  3AVY A;  3SUC A;  2WR8 A;  4LB6 B;  2FXA A;  1VLY A;  1SAN A;  2EIX A;  1QA3 A;  3GCM A;  3OE7 A;  5JLX A;  2FQ4 A;  1MBG A;  1TW2 A;  1EXM A;  1IHM A;  1VZ0 A;  4Z6Y A;  4HNU A;  4A3E J;  4NUB A;  1RC9 A;  3M7G A;  2WY8 Q;  3KYL A;  3BR3 A;  2NRA C;  2H09 A;  2FEZ A;  4PSX A;  4RLZ A;  1N25 A;  3AG4 H;  2WB1 A;  3MZH A;  5TJJ A;  1TWG J;  1VQP B;  1SD7 A;  1QNT A;  2F5V A;  1WH7 A;  3E5X A;  3HXL A;  2XAF A;  4IO9 F;  3IH3 A;  4KN4 X;  1FOY A;  4B8X A;  2CC2 A;  3F6V A;  1I1G A;  4LB5 A;  1NK2 P;  3GTG J;  1WJE A;  1WOP A;  3I4M J;  1T8I A;  1AWC A;  1FT9 A;  1WOS A;  3A8I A;  3CP8 A;  3CMM A;  3QFS A;  3BH4 A;  1U9O A;  3KLO A;  1Y1W J;  1OB2 A;  3P9C A;  3HHG A;  2ZME A;  1I6X A;  5IOY A;  2XC7 A;  3BZ6 A;  1FMV A;  1P4W A;  1AKH B;  3H94 A;  4LMY A;  3CDH A;  3DBH B;  3SZG A;  2X0K A;  3G71 B;  3BTI A;  2NZM A;  2XGX A;  3FXQ A;  1PE9 A;  4PFO A;  3F8M A;  4J00 A;  2A6H F;  4RB2 C;  3S1M J;  2EBI A;  4Z4T A;  2HKX A;  2A3S A;  3JRB A;  2R5Y A;  2EZH A;  3S15 J;  3GTM J;  2H8W A;  4IOA F;  1D1C A;  1R5G A;  2DJI A;  2R7F A;  2X9D A;  2ICW G;  1VQ7 B;  2VAS A;  4TSF A;  1FNN A;  3OYD A;  1CZF A;  2W4S A;  2BOL A;  2HVQ A;  3K4K A;  3SZP A;  2HCJ B;  4L9T A;  2OF7 A;  1LFP A;  1H85 A;  2B7E A;  3MCA A;  2YWG A;  3R0J A;  2HQN A;  5JVG F;  1USS A;  3QQA A;  3E6C C;  1ITY A;  4ZV4 A;  2Q2E B;  3GTJ J;  3JR9 A;  4IHV A;  3SEJ A;  2F5D A;  5C3E J;  3AVU A;  4YFX F;  1TW3 A;  2CW7 A;  3NQO A;  2ZKZ A;  3BPV A;  4RPB A;  2RC4 A;  4P25 A;  4M73 A;  2EIJ H;  1OR7 C;  3C1D A;  3LSG A;  4F91 B;  2HPM A;  2MGQ A;  3BJO A;  4OJ5 A;  3MCZ A;  3H1C A;  3VOE A;  2F5F A;  1WI3 A;  3C7J A;  1VLO A;  2DCU A;  2WPD A;  4OOS A;  1COW A;  3HTS B;  3CCY A;  1KU2 A;  2K02 A;  2ZCW A;  3JW4 A;  1IV8 A;  4RB1 A;  1R5I D;  1YJ9 I;  2GXB A;  2VB6 A;  4OAZ A;  4HRI A;  1K4T A;  2ZZE A;  2ZXJ A;  1X1A A;  3BTC A;  3U21 A;  3AL0 B;  1PDN C;  4GCV A;  1G3T A;  3PVD A;  2HFH A;  3WGH A;  4AVP A;  2HR3 A;  2X3U A;  1Q7Y D;  1X4O A;  3DDY A;  2BVL A;  1JUP A;  1FY7 A;  1U5T C;  1B9M A;  2XV4 S;  4Z05 A;  1WKM A;  2OA4 A;  3GLL A;  2XF6 A;  1KD1 D;  1KTW A;  4B47 A;  1KQ0 A;  1BC8 C;  1PUF A;  3GLX A;  2V9V A;  4M9Z A;  5FRO A;  1TLH B;  5HZB A;  2P6T A;  4YEL A;  3HYI A;  3VSL A;  4CZC A;  3BJA A;  4OMY A;  3GTL J;  5IYN A;  2ISZ A;  1VTN C;  1MDM A;  1BI0 A;  2XDV A;  1R00 A;  4EVI A;  4XNF A;  2WAQ A;  4U0Y A;  4HX7 A;  6PAX A;  2DA2 A;  2DJN A;  2Z99 A;  4RPD A;  4A6D A;  3FZV A;  4J19 A;  3AVV A;  3AVT A;  1QRC A;  2VNH A;  1A5J A;  5L3G A;  2DDA A;  1JE8 A;  2O0W A;  2FRH A;  5L3D A;  1PKV A;  2CS3 A;  1T08 B;  4BU2 A;  1YG2 A;  4MIM A;  5E18 F;  5IYR A;  3ASO H;  1JJ6 C;  1LFU P;  1Z91 A;  3RKX A;  3RQ4 A;  3V42 A;  4AID A;  5FLX Z;  3BG6 A;  3LA7 A;  5DDG A;  4P12 A;  3W5H A;  1J09 A;  3PIO F;  1CNE A;  4HW0 A;  3TGN A;  2HDC A;  2LZJ A;  2JUG A;  4B48 A;  1W5C C;  3SEZ A;  4RB3 C;  4EJW A;  2L9N A;  2V6C A;  2KIS A;  3IAM 2;  5EF6 A;  1YIJ I;  1X3U A;  3LAP A;  4CGZ A;  5EEG A;  1G7T A;  2VC0 A;  4FN5 A;  2R4G A;  1W7P A;  2XF7 A;  2L3D A;  4OOV A;  1MGT A;  1O3R A;  1E3X A;  3GIR A;  1HC8 A;  1MMD A;  3U1K A;  2KT0 A;  3W2E A;  2GXG A;  2MYS A;  3LSK A;  4YFO A;  4K1X A;  1BIA A;  2EFN A;  2XNC A;  2OZU A;  4YAL A;  2HXO A;  2LY2 A;  2ZSI B;  5LRR A;  4BEH B;  2NTB A;  1FTT A;  4ZYD A;  1T6Y A;  2FOW A;  2DMP A;  4PGO A;  2UV1 A;  3GFL A;  3GQA A;  1GAW A;  5IP6 A;  5JHU A;  3T56 B;  1DDN A;  5HXB A;  3K1P A;  4JYK A;  4BE0 A;  1EP2 B;  2JA7 J;  3S3O A;  1TYX A;  1FSE A;  2JVH A;  3QP6 A;  1P4X A;  2QBY B;  1Q86 D;  4XSZ F;  4PFP A;  3ZZ0 A;  1IXR C;  4M1K A;  2O5R A;  3CCE B;  2BM0 A;  1W7P B;  2ZSH B;  1X1B A;  2LKX A;  3HB9 A;  3OW7 A;  2QCO A;  3HOY J;  4E7J A;  1ULY A;  3KEW A;  3CCE I;  1LQ1 A;  2PYH A;  2LNB A;  1RQR A;  4V02 C;  2DMN A;  2CUE A;  2E71 A;  3VNU A;  2X8K A;  2BF4 A;  4MTD A;  4RCY A;  2A07 F;  2R7U A;  1MJB A;  3W2A A;  2VKD A;  3H5N A;  2IGM A;  3ONQ A;  1P4A A;  4HX4 A;  2M4G A;  3CMA I;  4L8J A;  4HF0 A;  2L7M P;  3S8P A;  3T8R A;  4PJL A;  4OIN F;  2UVE A;  1IRF A;  5HLG A;  3IKT A;  1DP7 P;  3SLD A;  1QRB A;  1IJW C;  2YUH A;  4IW3 B;  4U7D A;  1FNC A;  1T6Z A;  4IPA A;  1QVF B;  4IQ4 A;  3IC7 A;  3IP4 B;  4YRV A;  4NK6 A;  3AKZ A;  1AMO A;  4E7L A;  3VOD A;  1R1U A;  2K9M A;  3U6K A;  4BAC A;  3VMF A;  1NG6 A;  4OAY A;  1Y8R B;  1BOB A;  1OLT A;  2DN0 A;  2LMD A;  1BIB A;  3FXJ A;  5ICE A;  3J80 Z;  2DOD A;  1G3W A;  4L9N A;  1A36 A;  2W84 A;  4ENK A;  4CDG A;  2BW3 B;  2GM4 A;  3NE5 B;  5GAG J;  2B9S A;  2GQF A;  1VQ6 I;  3OJW A;  1JTA A;  4HOB A;  2M7A A;  4V19 K;  3CJQ B;  2QSH X;  1XQB A;  2UUZ A;  3TDZ C;  3GVK A;  2BXY A;  2WV1 A;  3GSI A;  2DFF A;  3F72 A;  4QFM A;  1RMG A;  3PO3 J;  2HTJ A;  3B6C A;  1OKR A;  3DKW A;  5K5Q A;  3A03 A;  1YO5 C;  3EDP A;  4ACA A; 
#chains in the Genus database with same CATH homology
 1AA7 A;  2LYC A;  3DPU A;  2KDO A;  1D0X A;  1OHH A;  2D3L A;  3E1S A;  3VYU B;  1FX0 A;  1Y6I A;  1JI8 A;  3LMM A;  4KKU A;  1WMR A;  4BL0 B;  2O1D A;  2VQL A;  1MND A;  5DN6 A;  2QKL B;  2JIZ A;  3GQB A;  4BQO A;  2Z6B D;  2W82 A;  3F9K A;  4BGD A;  2M3A A;  2PMZ A;  2XZO A;  5JHF A;  4IQJ A;  3SYT A;  2V31 A;  1DBO A;  2VBE A;  4W8S A;  2VKH A;  1E79 A;  5HNF A;  1E3Z A;  3ZPP A;  2BVM A;  3GVL A;  1BN8 A;  3OYN A;  1MW7 A;  1IRX A;  2NT9 A;  2V7F A;  4BXF A;  4II2 A;  2V6E A;  2NST A;  3T9G A;  2KZV A;  2W7N A;  4KT6 A;  3EUH C;  3OOU A;  4BQN A;  2HVS A;  3BCF A;  1HG8 A;  3LSH A;  4MR0 A;  3W2V A;  5HOO A;  1OB0 A;  4Z03 A;  4E7K A;  1HA8 A;  1W9X A;  2IGK A;  3DPT A;  2PEC A;  1SAU A;  4KIS A;  2VXD A;  5KCM A;  2NTQ A;  4BS9 A;  2CV1 A;  3PJR A;  1S9H A;  3DU6 A;  3FBN B;  4TKO B;  3T53 B;  1UAA A;  4Y4R A;  3QYF A;  4IX7 A;  4ZTJ A;  3OYJ A;  1SKY B;  3G05 A;  4X0G A;  5C1E A;  1DQU A;  1O8J A;  3NWS A;  1UD4 A;  2XZP A;  4PMH A;  2VBK A;  1V5G A;  2P0W A;  2VXZ A;  4AVZ A;  4PK4 A;  2A5W A;  4ZDP A;  2PJR A;  2DIE A;  1EE6 A;  3OFN A;  4ITV A;  2R7R A;  1YX3 A;  1VF7 A;  3ZPN A;  4U49 A;  1Z21 A;  2XAU A;  4GRI A;  4N4N B;  1UD5 A;  3N05 A;  2F43 A;  4E4H A;  4J01 A;  4XR6 A;  1DBG A;  4G7W A;  2AQF A;  1WP6 A;  4UZU A;  1OOC A;  2X6X A;  3OS0 A;  1D1A A;  4FET A;  2AQE A;  1BR2 A;  4DBR A;  1IDJ A;  3M8J A;  2LRD A;  3DTI A;  4LIT A;  4BUP A;  3K4C A;  2IS1 A;  2UWM A;  2KVO A;  3QOE A;  1MAB A;  5FL7 A;  3ZGK A;  1LVK A;  3HUG B;  2UVF A;  2INV A;  3B8Y A;  5TGT A;  4JQF A;  4PJM A;  2I8D A;  4CH7 A;  4YZA A;  5LD2 C;  4FAS D;  4ZC3 A;  4DNT B;  5KHD A;  4CCN A;  4EW9 A;  4C30 A;  4JOM A;  1FMW A;  3ZCO A;  4C2T A;  2F4I A;  3H5A A;  2ELJ A;  3K6G A;  3GBG A;  2R7S A;  3FY3 A;  3K4N A;  4ZYA A;  3PNY A;  2XGJ A;  1KCC A;  1EA3 A;  3MMY B;  2V7Q A;  3OEH A;  4JMQ A;  4XL9 A;  2DOA A;  4NQW B;  4NK8 A;  4XOR A;  3OL3 A;  1K5C A;  1T0F C;  3FBI B;  4XQF A;  2IGO A;  4E6K G;  4OJP A;  3ZR8 X;  3QYE A;  4DJA A;  3HAG A;  2VQH A;  3OAA A;  4B3X A;  3AFH A;  1O8K A;  3JUR A;  3VYT B;  2IS4 A;  1OGO X;  3BLY A;  1DGR M;  3A2K A;  1QCX A;  4B3F X;  4MXN A;  2Z8G A;  3I9V 2;  3OYE A;  3MKW B;  1T5E A;  2L7K A;  3HKZ A;  2IGN A;  1W36 C;  2KQR A;  2VJI A;  1NHC A;  2L2O A;  1QHH D;  4XKV A;  3UR3 C;  3OMY A;  1JRG A;  1YE9 A;  2WAE A;  4E7S A;  1HVX A;  4U87 A;  4IKF A;  2IQ7 A;  1O8F A;  4BQQ A;  2VJ4 A;  3WQZ A;  1V5E A;  2L9S A;  2RNG A;  3L2U A;  3FPP A;  1BR4 A;  2VJJ A;  2X1E A;  4LG3 A;  2KHM A;  4LIU A;  3PFY A;  2KRC A;  2EWE A;  2O0V A;  4BJ6 C;  3IUO A;  1YX5 A;  2WBM A;  2PYG A;  3DQV C;  1VJS A;  4XLF A;  4OZY A;  1N78 A;  4G7X A;  2E1M C;  3OYG A;  1KMH A;  2W6I A;  4PUS A;  1X1C A;  2VJ5 A;  2XND A;  2WAF A;  4HIZ A;  2XSJ C;  3I3L A;  1O8D A;  3VST A;  1H8E A;  3L2Q A;  3TMO A;  2R7X A;  3QOD A;  3L2R A;  5AMV A;  4G6I A;  1WJD A;  3OYM A;  4XD7 A;  4CCL A;  2X85 A;  2BSP A;  2X6W A;  3ZQQ A;  2K5C A;  3DLA A;  2JJ1 A;  3D5L A;  2CUJ A;  3K70 D;  3M1C A;  3BC9 A;  1QU3 A;  2D3N A;  1UG0 A;  4XKW A;  4Y33 A;  2Q1Z B;  4XMY A;  4QPO A;  3MKY B;  1Z3Y A;  1E1Q A;  2WJV A;  3OR2 C;  4II3 A;  2CUZ A;  1ZEL A;  4GQN A;  2CFO A;  2QKM B;  4XM3 A;  3TBI A;  4BJT A;  1ERD A;  5CQG A;  2VBM A;  4RMN A;  3KEY A;  4PJJ A;  4F93 B;  2E1B A;  3NWT A;  4DGW B;  3D5S C;  1VBL A;  1E0E A;  2CMP A;  2HZD A;  2V4D A;  1BHE A;  4D1Q A;  1BR1 A;  2WJY A;  3SEQ A;  2K9L A;  2V1N A;  3VDX A;  2R7Q A;  2E5Z A;  3CF2 A;  5CQE A;  3BG7 A;  3PSF A;  3GRH A;  4XLH A;  1GLN A;  3L2V A;  3H9G A;  2W00 A;  4NNJ A;  3A4C A;  2V26 A;  3K4L A;  2HPI A;  1Y56 A;  4FXU A;  2INU A;  1Z7L A;  2LBF B;  2ZZQ A;  2VIX A;  3MD2 A;  3B4N A;  1P9Q C;  2IS2 A;  4E7Z A;  1W0J A;  4E7H A;  4AYB A;  2ZZF A;  1O8I A;  1PXZ A;  4G6T B;  3OOC A;  1MMN A;  3OIP A;  1U0J A;  3T51 B;  2ZZG A;  3OYC A;  3LL7 A;  4BDZ A;  2MAB A;  1O8L A;  1XG2 A;  2WSS A;  3CES A;  5CDF A;  2VQG A;  3K10 A;  3PSI A;  5HVQ C;  4HWV A;  3OYB A;  1R6R A;  2OUM A;  2KLO A;  4BJ5 C;  5HLT A;  3OS1 A;  2LC2 A;  3G2B A;  1H8H A;  3VYR B;  2GJK A;  1QHG A;  5IK2 A;  3IAS 2;  2LRE A;  4ZJZ A;  2PJR B;  2CW8 A;  2GOX B;  2M4K A;  1LKX A;  2HU9 A;  3DTK A;  5HKK A;  3VMV A;  3HOT A;  2DT7 B;  1UEL B;  3SUC A;  3VSK A;  3TL4 X;  2QX3 A;  3OYL A;  1NG7 A;  2HLD A;  4XON A;  3EPZ A;  3PNT A;  2VPL A;  1W36 D;  4CUG A;  1VLY A;  3ZRG A;  3D5R C;  2R7W A;  4Z1M A;  2R7T A;  1UD8 A;  2F6C A;  1DGW Y;  1KON A;  3OE7 A;  2CV2 A;  2M0M A;  1VZ0 A;  1WJF A;  4HNU A;  1O88 A;  4NUB A;  3K4B A;  1EFR A;  4D9J A;  4XKB A;  2WY8 Q;  3KX2 A;  3KYL A;  2Z2S B;  2NTP A;  4PSX A;  2ODL A;  1WJA A;  2X1C A;  2GJP A;  2RQQ A;  1MMG A;  2WB1 A;  3FKJ A;  3BCA A;  3K4M A;  2F5V A;  4W8T A;  3HXL A;  1X4P A;  1RWR A;  3BC8 A;  3W2W A;  1WJE A;  2ZXH A;  4XN3 A;  2KP6 A;  2JDI A;  2X51 A;  3VWB A;  3CP8 A;  3CMM A;  1KZL A;  3A35 A;  3HPH A;  1OFM A;  4Y3O A;  1BPL A;  3GVJ A;  3BH4 A;  2KRH A;  4F3Q A;  4TT3 A;  1UD6 A;  1MNE A;  1AIR A;  2JJ2 A;  2LY1 A;  4NC8 A;  2KMU A;  3DEE A;  3DU5 A;  2XC7 A;  1FMV A;  4RLQ A;  3E0J B;  4ANJ A;  3PUB A;  4BE1 A;  4ZDO A;  1WTH D;  3H94 A;  3SZG A;  1O8H A;  1I18 A;  3EQN A;  2E1M B;  2OC6 A;  3ZSC A;  4XLC A;  4C9Y A;  2IS6 A;  1PYV A;  3QYB A;  2WA0 A;  3AL0 C;  2NZM A;  3ZIA A;  1PE9 A;  1TZL A;  4PFO A;  4CCO A;  1O8E A;  4J00 A;  3OR1 C;  3PNV A;  4BDY A;  3CZ6 A;  1D1C A;  2DJI A;  1N77 A;  2M7B A;  2R9V A;  2VAS A;  4TSF A;  4W8Q A;  4ZTF A;  3OYD A;  3VYS B;  4EAT A;  3VSU A;  1E1R A;  1CZF A;  1H80 A;  2W4S A;  2BOL A;  4PSW A;  2HVQ A;  3K4K A;  1TT0 A;  2V4J C;  2FUG 2;  3W3C A;  2QY1 A;  1K6Y A;  1LFP A;  2VL8 A;  2KPM A;  3OYH A;  2CV0 A;  2Z1D A;  3J7A Y;  5LFA A;  4KKT A;  2IXS A;  1X1D A;  5HNH A;  2X1D A;  2O04 A;  4KJZ A;  2Q2E B;  1W0K A;  1NRK A;  3OWT A;  4HST A;  3K4J A;  1WFX A;  4E7I A;  1OFL A;  2CW7 A;  1V0F A;  2E5N A;  4XLE A;  1PLU A;  3GQ9 A;  4OJL A;  4H4K C;  1KCD A;  3OYI A;  3KRG A;  3OIQ A;  1OR7 C;  2A6T A;  3LSG A;  2MFZ A;  4RM2 A;  4QPQ A;  4F91 B;  2WAD A;  5CPR B;  3OYK A;  1V5F A;  2HPM A;  4DK0 A;  4OJ5 A;  4B44 A;  4F92 B;  4F52 A;  1NBM A;  4C2U A;  3FDY A;  4DBQ A;  3H5R A;  1COW A;  4IZZ A;  1WPC A;  2WPD A;  2ZZE A;  2VB6 A;  4OAZ A;  4XKC A;  3HL2 A;  4HRI A;  2DXI A;  4OJO A;  1X1A A;  3AL0 B;  3U21 A;  4B43 A;  1MMA A;  2X53 S;  1D1B A;  3K70 C;  3EUK L;  3VSV A;  3EUA A;  3C2H A;  2QE7 A;  4DOZ A;  1IA5 A;  3H0D A;  3WWG A;  4YZ0 A;  1X4O A;  2LOO A;  3DDY A;  2BVL A;  4YEJ A;  4XOP A;  4P22 A;  2NOJ B;  3S3N A;  2LG4 A;  2ZTN A;  4Z05 A;  3RCO A;  3DKX A;  4KKS A;  4C2L A;  2JA2 A;  2XF6 A;  3OL4 A;  1KTW A;  5C1C A;  4B47 A;  3UW0 A;  3C2G A;  1E43 A;  5FRO A;  2NSP A;  4OWR B;  4F55 A;  2DT6 A;  2XOK A;  3RPU D;  3CJR B;  1D0Y A;  4YEL A;  3VSL A;  4CZC A;  2MC4 A;  1IB4 A;  3B90 A;  4DK1 A;  2XDV A;  4XNF A;  2WAQ A;  2CH0 A;  1O8M A;  3S93 A;  1D0Z A;  2X6Y A;  2W6J A;  4W8R A;  4AU7 A;  4BEH A;  1OGM X;  3CP2 A;  3ZXS A;  2HVR A;  2O0W A;  3SDB A;  1PKV A;  2CS3 A;  3HC7 A;  4XLA A;  4BU2 A;  2F1M A;  1O8G A;  2ZFU A;  2HQA A;  2GK6 A;  1X0C A;  3RQ4 A;  4RM3 A;  3V42 A;  3H9J A;  2WZP P;  3BG6 A;  3JU4 A;  1J09 A;  3UNG C;  2LZJ A;  2LH9 A;  4XOT A;  2JUG A;  1PJR A;  3DWL E;  3H9Q A;  4B48 A;  3SEZ A;  2MD0 A;  4PJN A;  2M5S A;  4YZX A;  2L9N A;  2GOM A;  3IAM 2;  3DTE A;  3RTR A;  2GJR A;  2KL4 A;  1RU4 A;  3LSM A;  1WJC A;  4DNR B;  2R4G A;  2XF7 A;  5KNL A;  2R7V A;  1E3X A;  4RLF A;  4YZQ A;  3MKZ A;  1SFK A;  3GQ8 A;  4HEA 2;  4HG2 A;  1MMD A;  2RRE A;  4N4O B;  2DCE A;  3BCB A;  2MYS A;  3LSK A;  4HPQ A;  3S32 A;  4DIQ A;  3OYA A;  5FRM A;  1K28 D;  2X3H A;  3VMW A;  3HOS A;  4YXW A;  2LY2 A;  2ZSI B;  4BEH B;  3OY9 A;  1UD3 A;  4E0F A;  2NTB A;  4CA0 A;  2VQC A;  4P5O A;  1WJB A;  1BLI A;  4Z06 A;  2UV1 A;  3BCD A;  3HPG A;  5CKT A;  4R79 A;  4I84 A;  2E60 A;  3DKY A;  2NT6 A;  3GQA A;  2Z16 A;  2HDW A;  4KIT B;  1GQ8 A;  3T56 B;  2CK3 A;  4ZDL A;  3DPL C;  2OV7 A;  4BE0 A;  4HSR A;  3S3O A;  3LFU A;  2JVH A;  3GQ7 A;  3OS2 A;  4U4B A;  4PFP A;  1QJV A;  2O5R A;  4XN0 A;  2ZSH B;  1X1B A;  3OW7 A;  4LIV A;  4B3G A;  3LSI A;  4E7J A;  2K3P A;  3PL8 A;  4CCM A;  1Z3X A;  3KEW A;  2PYH A;  1G8X A;  2R7O A;  3A1Y A;  2BW3 A;  4BE2 A;  1BMF A;  3FHN A;  1LDK B;  2X8K A;  3H35 A;  2R7U A;  2WY7 Q;  3W2A A;  3OEE A;  2VKD A;  1G59 A;  3H5N A;  2IGM A;  3ONQ A;  1N75 A;  2JVG A;  2M4G A;  2L5Q A;  2ZXI A;  4NC7 A;  3S8P A;  2HNH A;  4HNT A;  1HZE A;  4L8J A;  4PJL A;  3VR6 A;  2JSP A;  2LBF A;  2UVE A;  4URR A;  1I8D A;  2QXZ A;  4MLO A;  3HG9 A;  3FKS A;  2VLA A;  4IQ4 A;  3IP4 B;  3EQO A;  1DP3 A;  4YRV A;  4NK6 A;  2O17 A;  5FRN A;  4OJ6 A;  2Y0S A;  3RSN A;  3AKZ A;  4CCJ A;  4CSW A;  4E7L A;  2K9M A;  4BAC A;  1NG6 A;  4OAY A;  1X19 A;  1BOB A;  1OLT A;  3A3G A;  4ASU A;  3LMW A;  4U7B A;  3NE5 B;  2BW3 B;  3L2W A;  3LNN A;  3OPO A;  1V0E A;  1IDK A;  2ZTG A;  2W1O A;  1UD2 A;  1JTA A;  2M7A A;  2XZL A;  3OYF A;  3CJQ B;  2UUZ A;  3GVK A;  1T95 A;  3A3B A;  4OZZ A;  1RMG A;  2V9K A;  2GK7 A;  2XF5 A;  4CCK A;  3S3M A;  4P1W A;  1WJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...