4XMYA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 235
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xmyA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xmyA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xmyA02
4AVZA 3B4NA 4YEJA 1OOCA 3SUCA 4XLCA 4OJOA 2VBEA 4Z06A 4U4BA 4XNFA 1XG2A 4XN0A 4XOPA 1KCDA 3GQ8A 5AMVA 1K5CA 3ZPPA 3GQ7A 2UVFA 4NK8A 4PMHA 4Z03A 2PYGA 4XORA 1IA5A 1O8GA 2NSTA 1O8DA 2X6YA 4OJPA 2X3HA 3VMVA 4OJ5A 4XKWA 2BSPA 1O8EA 2NSPA 2QY1A 2UVEA 3KRGA 4W8SA 2VBMA 4XLFA 4XMYA 4U49A 1RWRA 4W8QA 1IDKA 2O0VA 4NK6A 1IB4A 4XQFA 4I84A 4URRA 2O17A 4MXNA 3FY3A 2NT9A 4C2LA 3WWGA 1VBLA 1NHCA 4OZYA 1KTWA 3JURA 1EE6A 2QXZA 4YELA 4XOTA 4XLEA 1BHEA 1RMGA 3VSUA 2NTBA 3EQOA 1O8LA 2O1DA 3ZSCA 4OJLA 2ODLA 1O8IA 1JRGA 2INUA 4YZ0A 2VJJA 1DBOA 1O8KA 2NTQA 4YZXA 1H80A 1PE9A 1O8JA 3T9GA 2O04A 2PECA 1CZFA 1OFMA 4Z05A 2QX3A 1QCXA 1O8MA 1PXZA 4HWVA 4OJ6A 5C1EA 4XR6A 1RU4A 4MR0A 2NT6A 3VMWA 4EW9A 2NZMA 4W8RA 2INVA 4W8TA 2EWEA 1AIRA 2NTPA 3GQAA 4XLHA 3GQ9A 1X0CA 3EQNA 3VSTA 2O0WA 3B8YA 2IQ7A 1HG8A 1O8HA 5C1CA 3LMWA 1GQ8A 3GRHA 4XKVA 4YZAA 3VSVA 4XLAA 2X85A 1JTAA 3B90A 1KCCA 4XM3A 2X6XA 1OGMX 2VBKA 3UW0A 1OGOX 2VJIA 1O88A 1DBGA 4XONA 1IDJA 4YZQA 4XL9A 1PLUA 1OFLA 1QJVA 4OZZA 1BN8A 2X6WA 2Z8GA 2PYHA 4XN3A 1WMRA 1O8FA
chains in the Genus database with same CATH superfamily
2DOAA 3HOWJ 2EIMH 4A12A 3A03A 2F5FA 3VWBA 3ZQ7A 3H1CA 4U4BA 1OFDA 3JRHA 3W2HA 1VLYA 4DBRA 4G7ZF 4OOXA 3MCZA 3CO6C 4ZGQB 3S32A 5AMVA 2JT1A 1IF1A 1I6XA 5LFAA 5C4JJ 3WTWC 2B63J 2F5EA 2CU7A 1GAQA 2XOKA 1TNSA 4M0LA 4S04A 3GQ7A 3PIOF 3O8HA 3NAUA 4X7FA 4QIWN 2V1UA 2VODA 1PUFB 4IZZA 2DFFA 1DARA 1GUUA 4HW0A 1MH3A 4KKSA 3VYTB 3I71A 4WX9A 1BOAA 4M3DA 1R22A 2ISZA 1TLLA 2QGGA 3QWLA 1IG7A 3SEJA 2MLGA 5FROA 4W8SA 1R4MB 2HGCA 3Q0VA 1VQ8B 3HPGA 3DEEA 5CKTA 3HG9A 4RLZA 3KP3A 4B3AA 1AOYA 1WJ5A 2VB6A 3ELKA 4OAYA 1R5NA 4LC0A 1ETQA 2MC3A 5FJ8J 1D1NA 5HLGA 3WE3A 4UY8I 2MABA 5L3GA 1XE1A 3PO3J 4HX8A 5A88A 3RY8A 2QQ8A 3JURA 2CFXA 1X1DA 1RQPA 1DG1G 3CCVB 2R7QA 4KFCA 3DBHB 3K1MA 3P5JA 1O57A 2F4NA 1U5TA 5E18F 3IRRA 1RMGA 4WXDA 4MTDA 2ZXHA 4L18B 3GVJA 4YHBA 3BG3A 3TQNA 3FJOA 2CMPA 1X1CA 2Y9ZA 3HOXJ 2GJKA 1G2HA 4MNUA 4WZTA 1X1PA 2WY8Q 1Z7UA 1FP1D 4Y4RA 3H0DA 4LG0B 1DUXC 3H3ZA 5HXBA 1BA5A 1O8JA 2E7XA 4WCGA 2UWMA 3WU1B 3ZCOA 3K4JA 2BY3A 3PNVA 2FA5A 3GTGJ 5H59A 2HOSA 3H94A 1D1CA 2FBKA 1BI2A 4C30A 1H85A 3CCUB 4MQVA 3A2KA 1HDDC 4EW9A 4LJZF 5HOOA 4X0GA 2EWNA 5H6RA 3K2ZA 3MKLA 2WPDA 1Y0RA 1S7AA 3ONQA 3L2VA 4RD3A 3CMYA 1JGSA 2DXIA 2UZKA 1X2NA 1QA2A 2GM4A 3MZYA 1BIAA 3H9JA 1DU0A 2EA2A 1BX1A 4I98B 2M1BA 3H5NA 4ON0A 1IN8A 4NUBA 1U2RA 2O0WA 4HDUA 4ZCIA 1MJAA 4EJOA 1UHMA 3VNUA 3O2PE 2DO7A 3JRBA 2K9LA 3KIOA 4D7NA 2K4JA 2JA5J 3IWZA 3W6JB 1OFCX 4YZ0A 2C5HA 4UZUA 3ZZTA 3WHCA 5C4XJ 4AU7A 1YHQI 5A2QK 1BQEA 4EGYA 2CQXA 1R58A 2HKXA 2WB1N 4RB3C 1KZHA 1B2RA 3L9FA 1XFOA 4M1KA 2FD5A 2Q6KA 1MIJA 1FOXA 4OZZA 4E6KG 4P9UA 5DV5A 2BM0A 2OBPA 1XSDA 1WMRA 1R5HA 4V19K 1IXCA 5TGTA 2ZL5A 2XF6A 3CLOA 5JVGF 2VN2A 3V4GA 2C4TA 1QPMA 3VYUB 1RESA 1S9HA 1G6NA 2DOEA 3BWGA 2PMDA 3TDUC 4RDLA 1YS6A 3QPTA 2XKPA 4XN0A 5KAFC 1TP4A 5IP6A 1UD4A 3KFWX 3R60A 3CW2A 3MCAA 2PMZA 2R4GA 2X48A 2KIUA 2DERA 2VOOA 2EQRA 2ZXWH 2Y0MA 2XB5A 3K4LA 3PSSA 2YUSA 3WTZA 4A3FJ 3AG1H 2MA3A 2MD0A 3RDIA 2LY1A 3TW7A 3BY6A 1H8EA 2W6IA 4RDUA 1WH7A 1ZG1A 2IA0A 2G7HA 3WYAA 4NK6A 3EETA 4URRA 3LSTA 1KU3A 3ABMH 1QHHD 3K4CA 2JRMA 2K9SA 3G71I 2DQLA 3N05A 4HBLA 1E62A 3U6BA 2MD5A 3OP1A 1YJNB 1MMNA 1V3FA 1W4MA 2OTJB 5HNHA 1ACIA 2B7EA 4M3FA 3LO8A 2L54A 1WJAA 3V7CA 3VO2A 5F1RA 3D0SA 2BXZA 4IO9F 4RCYA 3KEOA 3AVUA 2Q6OA 4M3GA 1QFZA 1KONA 3LMMA 3Q6RA 5JLXA 5LRRA 2VBUA 4V02C 2VASA 5E1WA 1Q9SA 2EA4A 2OBRA 1IV6A 1ZM9A 1P7IA 3IUOA 1XCVA 2AS5F 2L2OA 3PNYA 3PSZA 3T8TA 1E3PA 3TEDA 2E71A 2XRLA 1W36C 3HM5A 3B78A 4KT6A 1ZM2A 4FE4A 3GTQJ 3F21A 3I5UA 4HRIA 2XROA 1TQMA 1H9GA 2HPIA 1BJZA 5HS7A 3H92A 3CCLB 2BM5A 1T0FC 3O6BB 2FNAA 1T39A 5IYPA 5FO1A 4BHPA 1N75A 3BDDA 3HYIA 3PFIA 3SQNA 3S14J 1YW8A 5F0HA 2PI0A 1UD5A 1X2MA 1WI9A 3CC7B 1EKEA 3D5SC 3WTSC 4CCOA 1R6RA 1FOWA 2VKDA 2LVSA 3BPVA 1ON2A 4ABZA 3I4MJ 4TN1A 3LA7A 1KC8D 3U2RA 2B0LA 1EFUA 4Z4VA 1HVXA 3R61A 4I2OA 1F36A 4PK4A 2ZL7A 2K3FA 5LHHA 2V9KA 3OYAA 2GK6A 2UXXA 1QNTA 1G7TA 4QWQA 2FMLA 1XSXA 5EZGA 3BR2A 4CZCA 3JRCA 3ASOH 1DP7P 4RAFA 4Y52J 1N0UA 1PJ7A 3FKIJ 2QYOA 4LLLA 5K5RA 4EM2A 4UV9A 3S2DJ 2HOAA 4ZCLA 2Z2SB 3ZQFA 2P81A 2CW7A 5A8AA 3BC9A 3CZ6A 2K85A 3KEQA 3OR1C 2NVUB 2ZL6A 4Y17A 1SVLA 2KL4A 4MFEA 3GFMA 4BAYA 5FRNA 2GXBA 2Z1DA 4RGUA 4ESBA 2ZTNA 2IAIA 2YU3A 1QZZA 2ZBKA 5FLXZ 2FBHA 1LQ1A 2V5IA 4CCLA 3OYJA 4IHYA 2Y30A 1J09A 5KNLA 3AG3H 3ECOA 5IK2A 1IUYA 3WBJA 1AU7A 1IA5A 4XD7A 1S5LC 1XG1A 3SLDA 2VFOA 1T8IA 2VNJA 1LEBA 4UUSA 2WY7Q 1YHQB 1R1UA 3KZYA 5JLWA 2X3HA 4I7HA 2XGJA 3LYCA 2HXIA 2ELJA 2K86A 1VNDA 1WHUA 2IGMA 1IC8A 1AWCA 2NSPA 4HQEA 1IUFA 1D8KA 2ICWG 3BTLA 2EBIA 4KH3A 4RM3A 2YX7A 1X3ZB 4OPSA 5B66C 2IP2A 2E5NA 5IYCJ 4P12A 1WCMJ 2ZJPF 5ED4A 2XNCA 3PQKA 5GAHJ 1HKTA 4X07A 3MKWB 2XAUA 2BW3A 4Y13A 3L2CA 2OUMA 3GFLA 3HTUA 2XAQA 3BZ6A 4RBOA 1LNWA 2O9LA 5E3OA 2NTBA 1FT9A 1VQNB 3GTJJ 2XPWA 4DJAA 5FD5A 1N25A 2QBYB 3ZSCA 3W6KB 2X51A 3DQVC 5IP7J 1E3OC 3PM1A 1XGMA 3QODA 1TNTA 2O8XA 1Q81D 2WAEA 3P7NA 4ZJZA 3B8HA 2M8EA 3OZVA 3W2EA 3WG9A 2ELKA 5LHGA 3G05A 2PLFA 4BHBA 3GZ5A 2HNHA 3A0HC 4DQKA 3Q38A 4Z05A 2K02A 2ME6A 4P22A 3OPOA 1Z3YA 3BG9A 1L3LA 3I54A 2CW0F 2BYVE 3BG7A 5H5JA 2QENA 3O8GA 2RREA 1BI3A 2P5LC 1BJAA 2H8WA 3CJTB 2YWHA 2BEOA 4LIUA 5E17F 3HB9A 2V7QA 1EZGA 2K3PA 2OQRA 1GV5A 2E35A 3BROA 3FBNB 1X3UA 2ZJ2A 4XKCA 3DKXA 2VOPA 2VZLA 3A01B 5L3EA 3KLOA 3FISA 4Z4YA 3B8YA 4J00A 1R71A 5C1CA 6PAXA 2BPOA 4BGDA 5HZAA 3J7AY 1JUSA 2EB7A 1EP2B 4XRSG 2D9RA 1KK2A 5KSWB 5CDFA 1BR2A 5IT3A 2H09A 1YE9A 4CYCA 5IT9Z 2ISYA 4F3QA 4NQWA 3TW6A 2BY2A 2WZPP 1QVTA 4PAAA 3ZMTA 2C6YA 3ASSA 4XONA 5EGOA 4BQNA 4O3MA 1IDJA 2L9RA 4IVNA 5M3MJ 2KMUA 3GZNB 3SZTA 1WPKA 3HL2A 2VNHA 3CF2A 4F7ZA 3LJYA 2A6HF 2YX4A 2ID6A 1OYWA 3AKZA 2GPJA 5M5WJ 3FXOA 4UXNA 1SKQA 1RKWA 1RNLA 2DLLA 3ESWB 2G7UA 2JA6J 3S1NJ 5H6QA 3QFCA 1LLWA 4Y3OA 4K2EA 3CUQB 2TDXA 3V76A 4PC7A 2VBEA 2DMPA 2UV1A 2YS9A 2LC2A 3H0GJ 2R5ZA 1XG2A 2WADA 3G1LA 1QA1A 1W35A 3DDYA 1QGZA 4ZYHA 1LFPA 3AL0C 1YJWB 4G6TB 4HE5A 2RDPA 1QU3A 4I99C 5D8LB 2Z16A 2WR8A 3BCDA 3H9GA 3M9AA 3OIPA 4RPDA 1K8FA 1JJ8C 4OJ5A 2BMWA 3CP2A 1W34A 1PUEE 2HOEA 2RN7A 2VBYA 4U0YA 1E43A 4L5IA 4A5NA 3J7AO 1A8PA 1RI7A 3CB4A 3F8MA 3K4KA 1BPLA 4MIMA 1YG2A 2LP0A 2V7WA 2K9MA 2DY1A 2OD5A 4HX7A 4MXNA 2BVMA 2FE3A 2QN6A 4RDKA 3OW2B 1RR8C 1ZHFA 2JA2A 2KRHA 2GOXB 1QGYA 1WU8A 1FX0A 3SHFA 3ZQGA 3V42A 3BQJA 2RQPA 3IH3A 1I27A 4KN7X 4XOTA 4XICA 1BL0A 4NBSA 3DPUA 2XTXA 3FBIB 3FHZA 1OISA 2NPFA 5FKLA 3HOSA 4BKXA 1WSRA 1IXRC 1MW7A 3D26A 2VQHA 4BE0A 2E2IJ 1O8IA 3WHBA 3QPSA 3JRDA 2F3LA 2BVNA 3CTAA 1ON1A 2LOOA 3DEWA 3NRVA 4S0HB 4EQQA 4IL6C 2E5ZA 4WXHA 4Z4SA 3BC8A 1G7SA 4DK1A 3CC4I 2P7CB 4HIZA 3F6VA 4EM0B 1KZLA 2DODA 1O8MA 2V1NA 3J7YJ 1MDMA 1ZG5A 2GREA 2XAGA 3OYHA 4IQJA 2OJED 3CMAB 3G1OA 3OIQA 1K9MD 1V0EA 2GZWA 4B48A 2W7ZA 2EINH 3GVAA 4LG3A 5HS8A 4RS8A 1MNDA 2A3SA 2CC2A 3SJZA 1MH4A 2D1HA 4W1UA 5LRSA 1R1TA 4RD4A 4IHVA 1GVJA 3QOEA 3W2FA 4UB8C 3H09A 2QDXA 4JBAA 3LSMA 3MVPA 3PVDA 3H5AA 2GJPA 1VQ9I 3VSLA 4K1XA 5HVQC 4AYBN 1ZGWA 2LZJA 2EV5A 2GAUA 3AGPA 4FETA 2ZNYA 1QUFA 2BGJA 1U5TB 2IPQX 3D1NI 4P2NA 3FK7A 1OGOX 1DP3A 3C18A 3JQQA 1KTVA 4I02A 4D1QA 2XSJC 3F72A 3E7LA 1LDJA 3FDYA 3LL7A 5BPDA 2W25A 3C7JA 1IRZA 1ZREA 1HW1A 1MBEA 2A5YB 3IP4B 1K83J 5M3FJ 2X6WA 2DPDA 1BI1A 1UD3A 4PSXA 2MH9A 1HW2A 4AF6A 3KETA 1K8AD 4L0YB 1D1BA 3EUAA 2PYHA 2XTWA 3GXOA 3PNTA 1UFMA 3T8RA 1JJ2B 2AXLA 1GAWA 1BM9A 3QQAA 1QRCA 4JYKA 4BACA 3H3UA 5B1BH 4C9YA 4XLCA 1EXMA 2JRTA 2LY9A 1Y8QB 1XB2A 1OB5A 2CBXA 2GQFA 2R7DA 2EIKH 3C3WA 4L9NA 1TWFJ 1FWZA 2VI6A 1KCDA 1TW3A 3T1BA 5DUKA 1JKPC 3A02A 4WWVA 3ERMA 3SQVA 2HU9A 3OL4A 3TBIA 2E2HJ 3QRFF 1VQ7I 1N06A 1OR7C 4KIFA 3WTTC 4OJPA 2OBSA 3KEYA 4GCVA 2A69F 2QQBA 3K0LA 1X4PA 2Q2EA 3OS2A 1VQ8I 1T6ZA 1TSPA 4LITA 2HTJA 2D3LA 4ENKA 2DAOA 3R6JA 2QY1A 3KRGA 2YWEA 2IRFG 1ETOA 2KRCA 3UNGC 1U3EM 1PP7U 3M8JA 3FMSA 4ENMA 3T56B 1I1GA 2DA4A 3JREA 4E4HA 2EFPA 3CCVI 1F20A 4DYRA 2LF7A 1WXRA 3U6KA 2A07F 5E3NA 2TCTA 2R7ZJ 4GFBA 4FK8A 5GAGJ 1NDHA 2CK3A 2HKOA 2HQNA 2INUA 3F23A 3WNDA 5DM7F 4BQOA 4JK1X 1X58A 2JDIA 3BG6A 4Z4RA 3VNVA 3CCQB 4YZXA 4P5OA 3GFJA 4FASD 2VFPA 4ZTFA 1ULYA 1FIAA 1V5FA 2ZZFA 3AVXA 3B6AA 3FMQA 5J6XA 2W84A 3C1DA 3L00A 1OYIA 4G6QA 3KL9A 1XN7A 1KQ5A 1L1IA 3GVLA 4XR6A 1E3ZA 4ZH4F 4AF7A 2E1CA 1UMQA 1BBYA 2DCEA 3IAS2 5B5EC 1IO2A 2CNDA 5JLVC 3BTCA 4PC6A 1QHGA 1T0FA 2HPMA 5DSZA 3MZ8A 3ZQLA 1TC3C 3M4OJ 1XX5A 2ZKZA 5FKKA 3TMOA 4Y15A 3AAFA 3WNBA 1JJ6C 3SZEA 2VKEA 3KP2A 4MLOA 5FA6A 3TH0A 3OR2C 1Z9CA 1KCCA 2LREA 3TKYA 3BT9A 2E19A 4G7HF 2Z3YA 3HUGA 3CC4B 1R5OA 1TL8A 2Y9YA 1A35A 4IRIA 4Z4WA 5GV7A 3W2WA 1WI3A 4OIOF 2PMHA 1WJFA 2NAZA 4ASUA 4M72A 3FM5A 3ML3A 2W24A 1MSFC 4CCJA 1A6QA 1IAWA 4KISA 1G7CA 4HE6A 3ZUGA 1TVCA 1KU9A 3M3YJ 4OWRB 3TO6A 2W48A 5KVRA 2HCJB 2KIQA 4AVZA 4XLPF 2KJCA 3K1NA 1HBXG 1FNMA 3OKXA 2Q8KA 3GBGA 4HQMA 3BP8A 4ITVA 4U0WA 3HRTA 4HSRA 4XBFA 4G1VA 1IN6A 2LKPA 2BM6A 1CQTA 5IP9J 2PN6A 2O61A 1W0UA 1G59A 1WOOA 4E7SA 2FX3A 4HEA2 2CUZA 1WZ2A 2FMYA 3MZHA 2HR3A 4EH1A 1XCBA 3ZR8X 2JVGA 3ZMVA 2RC6A 3RSNA 3OSFA 3J81Z 1TQPA 3UKGA 1M1KD 5J1UA 2L3DA 4EV0A 4NC8A 4CYDA 3OYGA 4LBWA 5DS9A 3OJXA 2BSPA 1O8EA 2VIXA 1DDIA 5DN6A 3I0TA 2L9VA 2ESNA 3BR5A 5IYBJ 3WGIA 5FB2A 1GXQA 1YJNI 3FMRA 1JKOC 4UVCA 2OTJI 2IEKA 4GYGA 3PA1A 2XNDA 4ZYDA 3CCJB 4UUTA 5J4YA 2WWYA 5BPIA 2M0CA 2XGXA 1YRNA 4RPBA 4LBVA 4KMUX 2WSSA 4PZJA 5L3FA 1IRFA 1EFCA 1OQYA 3K10A 4HOBA 4DIQA 4IX7A 1YLFA 3GIRA 3DU5A 3OYMA 1U8RA 1XDSA 3Q3AA 2UUZA 1I50J 3OYNA 2LG4A 4HNUA 1WJDA 4M74A 4IW3B 3ZBTA 3E6DA 3W2IA 2AQEA 1VQ7B 3MKZA 2R7FA 4IF4A 5FFXA 1LM1A 4XSZF 1WOSA 3QYEA 4ETSA 4B44A 1USTA 1JUMA 3BOQA 1SFOJ 2WZNA 4UNOA 4BDYA 2EZLA 4G6IA 4TSFA 3V7AA 2C4UA 4ACAA 5F0CA 3CCLI 1WRJA 2VBWA 4Y33A 2PBIA 3QYFA 3RCOA 4UUSB 2XAJA 1PXZA 5C1EA 4OIRF 2JTVA 1EH7A 4MTEA 3CC7I 4J19A 1W7PA 3DP7A 2F6CA 1Y6IA 2VXZA 1TWGJ 2NZMA 2INVA 1BIBA 2EFNA 2IS1A 3M07A 3ONUA 1TZLA 2LH9A 3ECHA 2Y0SA 4GO1A 4UHTA 3K70D 2H6CA 1FBUA 3PUBA 2R93J 1EF4A 2ESHA 2HMAA 2VBVA 4LBZA 5E79C 1XDUA 4YAFA 1BLIA 2V4DA 3ZP5A 4PJJA 4UV8A 5F04A 2G0YA 2VC1A 2HXOA 2BW3B 2IBDA 1FSHA 2ZFUA 3A4CA 5CJ9A 1M90D 4OAZA 1ZARA 3HBLA 2DMTA 4EJWA 4KNYA 1POGA 3X2QH 2JWTA 3I4NJ 3P26A 1OGMX 2K9NA 3TOBA 4DGWB 5DM6F 4F52A 4OP7A 4A3JJ 1V5EA 2GOMA 1W2BB 1FNCA 2WBMA 2KFDA 1A36A 3TL4X 3PSFA 1BN8A 1GO2A 2A6TA 4MFDA 3ZC3A 1SFXA 3ASTA 1YQAA 1ZN2A 3MMYB 1O7LA 2KKOA 3HAGA 1TYVA 1Z05A 1OCPA 2M4KA 4M6XA 3S8PA 1FMVA 2VXDA 2WJVA 1COWA 4EJUA 2EFGA 2WAQA 3S15J 1VQ6I 4RGRA 5HS9A 2H1LA 1DDGA 4Z06A 3R4KA 1UMKA 2L7FP 1E1QA 3ASQA 1CF7A 4XRMA 3GQ8A 2F1LA 1CLWA 1PP8F 4BQAA 1MJ9A 1QZEA 4G94A 2HVSA 3VO1A 2J7KA 2EFOA 2FOKA 3F6OA 4HV5A 4IEJA 3WODF 2E1BA 4PJNA 1N77A 3ROUA 2X4HA 5TR9A 4CCMA 2HYJA 5CLSA 3RYRA 3G4SB 1O8DA 4D9JA 3S1QJ 2FVGA 5ICGA 4CYCB 2EJRA 1IB0A 4NQWB 3LSIA 1XSVA 2BV3A 4BE1A 2J5OA 1ZRDA 3GCMA 3T5XA 4U49A 2G9WA 1T6XA 3ZZ0A 4P3YA 2DA5A 1QVUA 5IPAA 3U1KA 2DYSH 3FY3A 2M9HA 5CVIA 3M8EA 3NARA 2HQAA 3KE2A 1KTWA 4JQFA 5D5UB 3OYEA 3WBKA 2QXZA 4GQNA 1VQNI 4RAYA 1W0KA 1HQCA 4LFUA 5LGTA 1K28D 2DQRA 3Q5FA 4A2UA 3BCBA 4KA4A 1E17A 2BZTA 1BHEA 4X7DA 2RKHA 2BY1A 4A0ZA 1NBMA 2R5ZB 2HZDA 2LY2A 3H5RA 2IXSA 5FKMA 5LLQA 2M34A 2PQ8A 2CV1A 2EIXA 1LJ9A 1MJBA 5DD4A 4B4CA 1E3XA 2D45A 4OOSA 4YAWA 4UVAA 1YO5C 2VNKA 2GLOA 4BNCA 3VPRA 2J5PA 2M87A 2D74A 1H8AC 5FLXK 3W5UA 5L46A 3T9GA 5FRMA 2FQ3A 1WWXA 3NE5B 3DPTA 1KJZA 3G3ZA 2VLAA 4N3GA 3PENA 3J80K 5EEAA 1B6AA 2CJJA 5CVUA 3CCRB 4G6DA 2L02A 4ENNA 5KK1A 4QV2A 2DJIA 1DQUA 1J5YA 2F4MB 4OPOA 3GQAA 4P6VF 4LBYA 4EJVA 2JK3A 3R0JA 1YIJI 4KIGA 2DYIA 1OKRA 3C2GA 2CUFA 1RC9A 5H20A 1ITYA 4P26A 2COBA 3Q3SA 3HSRA 4CZZA 2STWA 4NBQA 4E7JA 1UHSA 1NB0A 2PE3A 4XKVA 5BSXA 2R7TA 5HLIA 4TMVA 1JTAA 4MEYF 2R0QC 3OIOA 4DK0A 2JVHA 3OYIA 3HTSB 2X6XA 2X9DA 4PSWA 3TOAA 2HTSA 2GXAA 2FU4A 4Q48A 4Z6YA 3SY2A 1K73D 2VJIA 5DUIA 4IHXA 2MC4A 4A3MJ 3I56B 2HDCA 3E97A 1FYMA 3GVKA 5AONA 4RDJA 3QYBA 3BR6A 5JFRA 2VUMJ 1UZCA 4M9XA 1BJKA 2ZSIB 2DN0A 2MLKA 4HPQA 1YW9A 5BQTA 3AK5A 3VYSB 2CRGA 3QU3A 1P4AA 2LBFB 1O3TA 1WKMA 3CRZA 1T6SA 2XC1A 3HOYJ 4G9YA 3I9V2 3P9KA 1MDMB 3I55I 1O8FA 3BR0A 1NB9A 2B7CA 1SFUA 2ZCWA 5J1YA 3FWEA 2NV4A 1BR4A 3L2RA 1U9NA 4P3IA 2ZJQF 2VKVA 4BHCA 1LUJB 2JSPA 4LLNA 3LQEA 4YCQA 4A3LJ 4RD0A 4U7BA 5F64A 3LFKA 1YJWI 3KZZA 2X3UA 1JKRC 2E1MB 4J01A 1WSUA 1WP6A 2F1MA 4RD2A 4YC5A 3EYYA 4O5VA 1P6RA 4IOCF 2Y69H 1RZ4A 3HC7A 3BCAA 3V8JA 1LE8A 3SEQA 1ZRCA 2VBXA 3L09A 1FLIA 2V9VA 4I76A 3LAJA 1Z1DA 3FK6A 2F48A 3OYKA 4WZLA 4FN5A 1V0FA 2VE8A 4RMNA 2UVEA 4R71A 4YIRX 1E63A 1YS7A 1PJ6A 4G1BA 1OR7A 1X19A 2P6TA 3FXRA 1CGPA 4B09A 2O0VA 1FYKA 1PKVA 4XQFA 4I84A 5AN9A 2RVCA 5HLHA 1YJ9I 1HA8A 5IT9K 1ZK8A 4I0BA 5LEKA 1Z0XA 2Y75A 1VQ6B 1KGSA 1BMFA 2M4GA 4YEIA 3J80Z 4BYYA 3ZZUA 5HLTA 1FRNA 3OS0A 3BH4A 2PLYA 1G3SA 1Y8RB 4KKUA 4XLEA 2G0EA 2XZOA 1SMYF 3SFZA 4M71A 3OYDA 5GADJ 5F4MA 2BM4A 1BR1A 1Q1HA 1SFKA 1WGXA 3M1CA 3N97A 1FMWA 2DA7A 3OYBA 1V5GA 4GDFA 1R36A 3DEUA 3QAHA 4RLFA 5GP9A 2WYRA 3BLYA 2H8RA 2OZUA 1NJID 2O04A 1OFMA 3RPUD 2DDAA 2VONA 2CUEA 3CMAI 1Y0NA 4DBQA 4U9UA 5K5QA 1GR1A 3JW4A 4EATA 1YITB 2Q2EB 3N4MA 5FLVA 1E1RA 1U0JA 4W8RA 4DYQA 1XGNA 3QSYA 4EEFG 3KYCB 1TW2A 2JIZA 1P7JA 1ZRFA 3ISXA 3GUDA 2M7BA 4ZC3A 4KDPA 4LOCA 3GQBA 1JXSA 3AVVA 4X06A 1EA0A 2KPMA 4QVAA 4B3GA 5CYVA 1OB0A 1OCCH 3GRHA 3ES9A 2WV1A 1EFRA 3R6KA 1A6IA 1FEXA 1XB4A 4N9HA 4Q47A 3WGHA 4IKFA 5JR3A 4H0EA 2CF4A 1TWAJ 4DOZA 2Z33A 4A3GJ 1SC7A 2VPLA 2XT4A 3QFTA 4NDLA 4RLQA 3HHHA 5HKKA 1C0WA 2EIJH 5J47A 1S8NA 5GTHC 3RZOJ 1ZELA 4BJ5C 2CSOA 2FXAA 2XIGA 1VHOA 1PLUA 1OGIA 5E1XA 5JVTA 3HPHA 3FXLA 4A3KJ 3QU6A 4X6AJ 3PJRA 2WA0A 1YLOA 4HAMA 1EH8A 3ZOBA 1SD7A 5L3BA 4PC3A 1TYWA 1HF0A 2PMUA 4AIDA 1YIJB 3E5UA 2R7OA 3K9TA 2F43A 3BCFA 2GWRA 1QPIA 4IJAA 3M1EA 4YXWA 1AKHA 3KP6A 1K78A 4OJOA 3L7WA 5AIQA 1ETXA 3LA2A 1B59A 3CQZJ 3EPZA 3VOEA 4A3BJ 1J7KA 3BQZA 1D0YA 4G7OF 1SAXA 5F1JA 3SYJA 3IHUA 2X0LA 3COAC 3GTKJ 4BL0B 2DK5A 2FUG2 1MKMA 2LKSA 1S7OA 2QM3A 2VBZA 3BZKA 1R1VA 4YFOA 2A61A 2P5VA 4RAZA 4ZV4A 2W85A 4B1RA 3WTUC 1O3QA 5L3DA 4CXFA 1QFJA 1TYXA 4YG2F 3CD6I 1G8XA 4M73A 1R5GA 3HUGB 3HGYA 4HSTA 1WTHD 3HDDA 4E7LA 4AVPA 1O8KA 1ETKA 5J40A 1HLVA 1REPC 3DFGA 1BOBA 2DA6A 1HSTA 3BJ6A 3I55B 3DPLC 3D5LA 4M6YA 4XSXF 3CCEB 1XQBA 4PFPA 4N4OB 2BBYA 2XZLA 2L4MA 3WWGA 3REOA 1KU7A 3OSGA 2DBBA 2R9VA 3ASRA 4OZYA 3P27A 1OYYA 4FCYA 2JSCA 5FIUA 5EF6A 4FISA 5LHIA 4UUVA 2X1DA 2P8TA 2Y2ZA 1ZGAA 4O6JA 5EZHA 1Y56A 2LKXA 2O3FA 1Y0UA 4C2MJ 3K69A 4IQ4A 5E20A 1ZGJA 2R7RA 1ZUNB 5J8CA 2R7WA 5EG0A 4OMYA 5JI6A 4XKBA 5E3MA 3S3MA 4RD6A 1JRGA 3K4MA 3CCQI 3W6VA 2P4WA 3SEZA 5F4JA 2VJJA 4D5CA 3OEEA 2IW5A 3BQYA 1D0ZA 2FX0A 1OCRH 1Q82D 3I64A 5D5WB 3DU6A 1YFHA 1MNEA 3VFZA 2KLOA 2DT7B 3WNCA 3KP7A 1S3JA 4C3HJ 1MMDA 3P9CA 5H2FC 1H88C 3B02A 1G3WA 1YJ9B 1YW7A 1VQLB 2NT6A 4MR0A 2W7NA 1PYVA 1WORA 4W8TA 2BHYA 9ANTA 1QGAA 3U2QA 2XEXA 3G6EB 1GVHA 5HZBA 2HI3A 5F08A 1VQKB 1X0CA 2ZBVA 4M2LA 5ICCA 1TUIA 3HEFA 1YRNB 1F5TA 2O0YA 1HDPA 2YUHA 5BMZA 4RM0A 2ZBUA 2K27A 4AD9A 1OHHA 4JRAC 1OCTC 1CNFA 2NVXJ 1RETA 3EQLF 2OPTA 3OYCA 1K4SA 2JJ2A 1Z21A 3VSKA 2OK7A 3IKVA 1I1SA 2DK8A 3D5RC 4A3IJ 2DTRA 2E60A 4XL9A 2DEUA 1B8IA 2OYNA 3MD2A 3BH7B 3CLQA 3CPXA 1VF9A 3GTOJ 5ILVA 1QJVA 1XMKA 2CW8A 3Q0UA 4D0PA 2Q6LA 1B9MA 5TV2A 3GMEA 4KICA 5HDKA 1E64A 3LSHA 2XTYA 4ACBA 4YDTA 2ZO4A 4G7XA 3DKWA 4PJMA 4R8HA 1YI2I 1AMOA 3WTYC 1IJWC 1LKXA 4RGXA 4YIIA 4LB5A 1W7PB 2QKLB 1HKSA 2NVQJ 3K2AA 3HKZA 4E7IA 3W2AA 2L9NA 4DNTB 3FZVA 4IPAA 2LR8A 4FT8A 3SXYA 3SKBA 3S3OA 2DW4A 3HOTA 1FTTA 3LSPA 1HA3A 3LNNA 1D2EA 4P1VA 3HZJA 4A69C 5AIPA 3S3NA 2O7OA 4HLYA 5ERIA 1RRJA 4WXCA 1E3HA 2ID3A 3ZN0A 4QUZA 2IQ7A 4NK8A 3K7AJ 2RNGA 2GA1A 4P1WA 2VQLA 4BUPA 2ZMEC 2KISA 3U1DA 4A3CJ 1EP3B 1QO0D 2O5RA 2X6YA 3IH4A 2A05A 4LGWA 2MSYA 4ASNA 1Q7YD 2L7KA 3RIQA 3AGQA 2Z5UA 3ZPNA 2OZ6A 3ABLH 1V5VA 1RPWA 1U6GA 5D6EA 4XLNF 5KHDA 1ZH5A 5D4SA 3IRQA 1KYWA 1P4XA 3CCJI 2BN4A 5TJJA 1ZQ3P 4RB0A 5E6TA 3F8NA 5F27A 1W1WE 2DDBA 4Q4ZF 3N6ZA 1OB2A 3E1SA 3RQIA 3E6MA 3WGGA 1N05A 2EZIA 1GV2A 4WQMA 2PFBA 3LQQA 2VBSA 3JSOA 2IOUG 4C2TA 2BGCA 1JHHA 1AA7A 5IYQA 1IZ1A 2LFBA 2OBTA 4MO7A 1QZYA 2ZZEA 4OJLA 1CF7B 3TP0A 4B43A 2HWVA 1O3RA 3GYHX 5LMZA 2Y31A 3FPPA 3IC7A 2D3NA 2L7ZA 2TRTA 3CD6B 1KQ0A 5TISC 5HNFA 4YFKF 4L9JA 3W3CA 3VDXA 3PIPF 1Y39A 2IGNA 5IYNA 1EFTA 2IS4A 2GIZA 2LTPA 2W57A 4BDZA 1HC8A 1KQ8A 3L2QA 3AL0B 1O7FA 2V9PA 1MRZA 2QUFA 3PETA 1S7EA 2M45A 4UAJA 1I18A 2VFMA 2DA2A 3F3XA 2R7XA 4DW6A 3J81K 1OGJA 2RQQA 1J0RA 3CP8A 2KJBA 3RIRA 1D8TA 5D5VB 2WTEA 2M8GX 3ZIAA 4FWTA 2M30A 1WJEA 1QQIA 3WU2C 3LMWA 1U2WA 2RC4A 1MD0A 3FM3A 2HDNB 4Y9UA 2VL8A 1D5VA 2X6OA 5DEQA 3BJAA 5CQEA 3RQ4A 1N78A 3BZCA 5HDGA 1P9QC 1AHDP 1FZPB 3HXLA 1ZG3A 4PC1A 1D1AA 2LSOA 1QVFB 1GVDA 1I39A 4TMZA 2CQQA 3RJPA 4RCZA 2P3MA 1ELOA 2JJ7A 3I53A 4PGHA 4B3XA 3BTIA 3JQRA 3OEHA 5J3OA 2Z99A 1V55H 3DLLF 2EFQA 1R5ID 1JE8A 2CYYA 3FKSA 1LLZA 1VF7A 2BX6A 1O3SA 2DETA 3TO9A 4BU2A 3PFYA 3BH6B 3EYIA 1WVRA 3C2HA 2XC7A 2W00A 3B6CA 3U21A 4CHUA 3A01A 3ZQIA 2FRHA 3CC2I 3E1YE 1VI0A 1K7AA 1MSEC 2HQRA 4M4SA 2XT2A 3ZPPA 3H3VK 1HF2A 3F8FA 2A5WA 3G4SI 4XORA 2A6EF 3CCYA 5FD6A 1ENHA 1Q86D 2ECCA 4U7DA 3GTMJ 4M3BA 1YX2A 4P9SA 2D2WA 2FF4A 2KHMA 2PJRA 5HDNA 5J35A 2DA1A 1ODDA 4ZCMA 4XKWA 3HOUJ 1PJRA 1IN5A 3FXJA 1ZTRA 2EZHA 4M9ZA 3MHPA 4KT5C 4TKOB 2IJLA 3BTJA 4HF0A 2VBMA 1OJLA 3ABUA 2L9SA 4W8QA 5GPCA 2EK5A 2V7XA 1IDKA 3MN2A 4YIFA 1UAAA 2OTLB 1B4AA 3NQOA 3W2VA 4D5FA 4WWCA 3P9IA 1F4KA 4PABA 1YI2B 2LNBA 1UHWA 5J3LA 3TGNA 3QP5A 1BC8C 4BH9A 1IHMA 1TTTA 1MMSA 1UD6A 3J81k 2KIFA 1L0OC 2VNIA 3VYRB 3KYDB 1MBFA 5LD2C 1SVMA 4A3EJ 3DTKA 4UZEA 1VFCA 1EE6A 2E1OA 1FNNA 3ZPLA 2C5BA 2XNJA 3BY2A 3JRAA 2AQFA 2QEXI 1X1BA 4NB5A 2ZB9A 2DOGA 1DGRM 1MBHA 4IXAA 4NHJA 2I8DA 3VSUA 5ILSA 4Y9RA 1N8RD 4WZEA 4NC6A 4EVIA 1V4RA 4FXUA 2BHZA 1ONVA 4AIKA 4OM9A 3RI4A 2KZVA 1UB9A 2L01A 2QZ8A 4A0YA 2QWWA 3ZBUA 4LIVA 3N90A 2B5OA 1J2XA 4G7WA 1K6OA 1LE8B 1PE9A 3RPUA 3NAWA 4IRGA 3CCRI 4FX0A 2L4AA 5EEHA 2X53S 4XRFA 1S4MA 2E1RA 3A1PA 5IYDJ 4X05A 3EUKL 2KQRA 2XRNA 3L2UA 1SD4A 4MGRA 1IN4A 2IS2A 4XK4A 4QFMA 1QA6A 1RKTA 2V7FA 3PUFA 4XRSA 2NTPA 2ACJA 1JA0A 2XPUA 4NC7A 5K7ZA 3GQ9A 3F9KA 1KK0A 2IA1A 5IYRA 2VC0A 1P4WA 1NRKA 2DT6A 4BPRA 4W97A 1Z67A 3IV5A 3JU4A 2Y0SN 4N9IA 1J59A 4IOAF 5M5XJ 2IVMA 4ZDOA 5EMNA 4XLAA 2J8IA 2XB0X 2QQAA 3A8KA 2R5YA 2DCUA 4AC0A 3I56I 2K5CA 1VZ0A 1IJFA 2M5WA 2VJ4A 3FXMA 1HOMA 1FYLA 3VEPA 3K70C 1T08B 2ZZGA 3FPKA 1Z3XA 3BNWA 3OY9A 3QFSA 5ICEA 2V31A 1YX5A 2CO5A 5JMCB 5DCMA 1KRHA 2M3AA 4N0BA 1NK3P 1VQOB 1T5EA 4X0CA 4BEHA 4TMWA 4AWXB 2HYGD 2B9SA 1RUNA 1VJSA 1OFLA 4LMYA 1A04A 3OJWA 1PVEA 4Q5SF 2Z8GA 4BXUA 2E36A 3MWMA 3DTEA 1VHEA 4ZDLA 4I09A 3ZMZA 5E8IA 1WFXA 3WE2A 1T38A 5J8FA 4E0FA 2QQ9A 1IW7F 4OPWA 3SUCA 3QE2A 4ESJA 2MBFA 4QPQA 4CQJA 4G12A 5FFZA 2B7BA 1LFBA 1J75A 2E2JJ 1T6YA 1D5YA 1P4MA 5J1RA 3MMPA 3V8LA 2WAQN 2QTZA 4NNJA 1WQ2A 3B73A 1JI8A 4B8XA 1VQMI 3WY9A 4JX6A 4PGOA 2PYGA 3CCMI 4P25A 2LDUA 2VBTA 4HYEA 4DZJA 3OMYA 5HODA 2H27A 3CJNA 1AIPA 2WAFA 4BBSJ 2JJ1A 3LQ6A 2CRVA 4YFXF 4HX4A 4KITB 4TV7A 4EJTA 3CDLA 4P55A 1MBKA 4WK8F 4ZYGA 1I6HJ 4BY1J 2QA4I 4AC9A 1Z7LA 3DLAA 1LVAA 1ORKA 1GHCA 5DDGA 4BY7J 2FJ1A 2XAFA 3HOZJ 2BE5F 1JUPA 1GXPA 1VBLA 3V8KA 2EV0A 2E1MC 4C3IJ 1ZR2A 2HYFA 3KX2A 3P4GA 3GX4X 1G7RA 3LOCA 1XGOA 3EUHC 3O3KA 2C78A 3W5VA 3SFIA 1VQ4B 4OIQF 4OU0A 3CC2B 1FTZA 1ZM4A 1I3QJ 2CG4A 3ZQCA 2QLZA 1AKHB 3F22A 1K78B 1GDTA 4RA2A 2PMZN 2BM1A 4Z4TA 1B1BA 4U0VA 5JHFA 4E7HA 2VYQA 4DNCA 5C3EJ 3OOUA 3CJQB 5DD8A 2HVQA 1K61A 3AVWA 3VODA 2DPUA 4PDKA 1H80A 5EGOB 1QUEA 5IOZA 1JKQC 3OYLA 1IXSB 2PECA 4QPOA 4PJLA 1YITI 2QX3A 5GV8A 4QLCU 5K7HA 2MGQA 1R9TJ 1S72I 3KP4A 1JA1A 1RU4A 3JTHA 4OPVA 4QSHA 1QX4A 3FXKA 2XKOA 1H42A 1AIRA 4RD1A 1FOYA 2HFHA 2Y48A 4X8IA 4AUXA 5EJCA 4Y7CA 2E7WA 3HHGA 4FQGA 3K4NA 3JRFA 2QEXB 4ZGNB 1S29A 5THXA 1TLHB 4A5MA 5M5YJ 2ECBA 1ZM3A 3CCSB 1W5TA 4LB6B 2AO9A 2DI3A 3CDIA 5CVRA 1H9TA 1BX0A 2XZPA 3JQPA 1GQ8A 5BOXA 5IY5H 4B47A 2R6HA 5DS0A 5LBQA 3I58A 4YZAA 3ASPA 1KA8A 1W87A 1XD7A 4GRIA 2WB1A 4AM3A 3A1YA 1NHAA 5D4RA 2BSAA 5ICFA 1DPRA 2JZYA 2C2WA 1WJCA 2QZAA 5EG0B 3OZWA 2DJNA 4ZDPA 1ERDA 2V4JC 1FNDA 1IGNA 3LAPA 2V7UA 2BV6A 4HF1A 3GLLA 1M1EB 2P7VB 1A31A 1KD1D 1A5JA 2EH3A 4EGZA 2ME0A 1Y1VJ 2X1CA 4II3A 1SANA 5BNGA 5ILUA 1MBGA 2EZKA 1H8HA 1T2KA 4X1EA 4A0XA 3CMEI 1JHFA 2NVYJ 2F5CA 3LSRA 5FKOA 3OYFA 3JRGA 1Z77A 2WC2A 2STTA 2C77A 3I59A 4YEJA 1VQ5B 3H9QA 1B72A 2CWEA 3HJEA 4BXFA 1YX3A 4PCQA 2F5DA 4RB2C 4PFOA 2DU9A 4XOPA 1OFEA 5FNZA 4A6EA 2FBIA 4J0QA 1S0UA 4RM2A 3GF2A 1UJ8A 3R0AA 4X7EA 1IRXA 4L5EA 5J4VA 3ZMSA 4JX4A 2UVFA 3H9NA 3L2WA 2QE7A 2HS5A 2LF8A 3FXQA 1Z91A 2QSHX 1XMXA 3LSKA 2MFZA 1TQIA 2ELHA 3GLXA 3JRIA 2OQGA 1KYZA 1MABA 3OW7A 4Z4UA 3ZQQA 1QQ1A 4M6VA 2ZMEA 4XLFA 4XMYA 1NTCA 1IDYA 2JUCA 3CCEI 5TRDA 3RKWA 2COMA 2GIVA 2ETHA 1B8IB 1PJ5A 3Q39A 2ZFWA 4A93J 4FX4A 2O17A 1U9OA 4LK0F 5C44J 2NNNA 2NOJB 5B1AH 4C2LA 2X1EA 3RKXA 3OFNA 1J9IA 4CDGA 2YSRA 1VQPI 3C2BA 1QH0A 1TWHJ 2H94A 1W36D 3DU1X 2BOLA 3OWTA 4DYCA 1EJ9A 2B0RA 3QPHA 1N08A 4TMXA 1T33A 2JA7J 4RB1A 2Z6BD 5A2QZ 3CESA 1IV8A 2K7LA 1FSEA 2V6EA 2V1DA 4B4DA 2I5UA 2BF4A 1S6LA 1X4OA 3IKTA 5LGNA 3GTLJ 1VQMB 4XIDA 1SD5A 1JTYA 2FEZA 4F91B 4JX5A 2ZJRF 1BW5A 3SJPA 2E34A 2ZXJA 5BS6A 1BI0A 2R92J 2HLDA 3CCMB 4PUSA 4HDVA 4ESFA 2DMNA 1MZBA 3TO7A 5EYRA 5FO5A 2CUJA 4LK1F 2QTLA 3VR6A 2PEXA 3A3GA 3CUQC 3SZGA 4C43A 2OF7A 1WSVA 5FO0A 2F4IA 3PL8A 1VQLI 3SDGA 2QA4B 1QCXA 3OV8A 4L9TA 1U78A 3DF8A 5DYMA 1QRYA 1IRGA 3S2WA 1SM4A 2WJYA 3HSEA 4N3NA 1N0VC 2HDWA 3OS1A 2DA3A 3G6EI 3DBRB 5GAEJ 1EP1B 1VQKI 2RGVA 2V79A 1H89C 4NCNA 2R7UA 1KQ9A 3E5QA 3J7ZI 2P6SA 2XGEA 4BXXJ 3QP6A 2ZNZA 4HLXA 3CMMA 4KIBA 5KCMA 3SYTA 1SEUA 3WTXC 4I0AA 3CJRB 3S1MJ 3VSTA 4E70A 2YWGA 2FQ4A 2BXYA 5A89A 5DNSA 4JP0A 2VPRA 4U88A 2OU2A 2V7VA 1PUFA 2Z9OA 1W9XA 1I8DA 3B90A 3WQZA 2KDOA 1OLTA 1QG0A 4RGSA 3G1MA 2AXTC 3MKYB 3GWZA 1O88A 3HGGA 1KMHA 2BM7A 1DBGA 1FNBA 3KEWA 1NG7A 2VQCA 5D5XB 1TTYA 4YZQA 3DV8A 4U87A 5CPRB 2XAHA 2HOTA 1S72B 1WDTA 3KP5A 1HKQA 4CICA 4M53A 1IN7A 1R00A 2E1NA 1RIOH 2NRAC 3LQRA 2XGDA 3R6SA 1KK1A 3AG2H 1EA3A 4XN3A 3JR9A 4G5GA 5K5OA 5B3SH 4YALA 3GFIA 3FX3A 3B4NA 1FPQA 2YU9J 2XSDC 1UD2A 1MGTA 1JB9A 2H6BA 1OCOH 3S17J 5JBQA 2OC6A 2LMDA 1DPUA 1W5SA 4UZFA 1QVGB 2IT0A 1LPQA 1TT0A 2VKHA 1WOPA 1T98A 3ZMUA 1NH3A 1R4NB 1BW6A 4LG0A 3OZUA 5F6FA 3FF5A 3K6GA 1G3TA 2NNYA 4A6DA 1UG2A 4HF2A 3E3VA 2ZXIA 4MEXF 4JOMA 4BS9A 3HOVJ 2V7TA 3LSGA 1F9NA 1GLNA 2QMUA 1BN5A 3ZXSA 1RWRA 2NTQA 3L1PA 3F0CA 5L3CA 3CMEB 2EV6A 3A3BA 3JX8A 3LNQA 2A68F 1HSJA 2HZTA 4HG2A 1VLOA 4X7CA 4M3EA 3SLNA 2NT9A 1WPCA 1NHCA 1MNMC 1U5TC 3K1PA 4I6ZA 2XF7A 2R3SA 5E8GA 1U8BA 2M0MA 4QTRA 4KMFA 5BSYA 3KLNA 5F0FA 3ABKH 3G71B 1WH5A 2MYSA 4HA8A 1W7PD 5GTIC 2NS0A 1Y1WJ 2IGOA 3HRUA 2CV2A 4L0ZB 4CSWA 3I4PA 2M7AA 1KK3A 2CQ7A 4ZYAA 1FP2A 2X8KA 3EQOA 3PA2A 1QA3A 2UXNA 3AFHA 3KYLA 2LYCA 4WF2A 1BC7C 3IWFA 4CO8A 2JMWA 2JQ7A 1D8JA 4Z4ZA 1W0TA 1LEAA 4ROXA 1Z6TA 3ZRGA 2NS8A 3OL3A 2L7MP 3MEXA 1R49A 1MMAA 1D0XA 2YR2A 1YOVB 2HDDA 3Q6QA 1XTAA 2OCEA 5FLMJ 2XHKA 3OE7A 3M8FA 3E6BA 3S93A 1LVKA 1R23A 4II2A 2PJRB 3JTGA 1RQRA 4N4NB 2KP6A 2V26A 3VMWA 2DIEA 1SFEA 2DMQA 1F43A 4ENJA 1VQPB 2CGPA 1X3WB 3I1FA 1ZYRF 4I01A 2DTZA 4MYTA 4XLHA 5E3LA 4AIJA 2GQQA 1ZLKA 2QF7A 1USSA 2Q0OA 2XUBA 3DBLB 4OMZA 4ZYEA 1OPCA 4AIHA 2IS6A 3H36A 2QKMB 1T56A 4TT3A 4FTHA 3ABTA 1LDDA 2IA2A 3CO7C 2DMUA 1DGWY 3DWLE 1E79A 1P2FA 2OA4A 2GXGA 4D7MA 4YFNF 4H4KC 4FE7A 3JCUC 2Q6IA 1FJLA 4KJZA 5E1ZB 4G8XA 3FKJA 1JTXA 1F60A 1JT6A 3PO2J 4HV6A 2OK8A 4KN4X 2NYXA 3FIWA 2YPRA 3GW2A 2NVTJ 3OOCA 3NEUA 3KCCA 3LFUA 4ZZDA 1TWCJ 4DQ2A 2DFEA 3HSFA 3MQ0A 5K7FA 4CH7A 3GSIA 4HNTA 3A8JA 3IH2A 2PG4A 2K40A 3ERED 1XGSA 1ZKGA 4C2UA 3BPXA 4RAGA 2CS3A 2KT0A 3DKYA 1RUOA 4IRHA 3PSIA 1N07A 1XC5A 4P9FA 4ZTJA 1K5CA 4CUGA 4P96A 2O6WA 2BY0A 3HKZN 2ZSHB 4PGGA 1YIOA 1PDNC 4Z03A 3HIFA 3NWTA 1OMIA 5D8KB 2NSTA 1STZA 3ASNH 2AHOA 4E7KA 1XPXA 3QFRA 2R5YB 1LDKB 3CDHA 2L0KA 5B6IA 1FC3A 2CFOA 2RV8A 3E6CC 2K4BA 1MBJA 1FX7A 2OTLI 3IL2A 2M5SA 4KYWA 4BE2A 5DCMB 1MMGA 4Y7NJ 2LBFA 2DFHA 5CQGA 1VTNC 2HEOA 4BEHB 3CPWB 3NB2A 2QYUA 3A0BC 2V6CA 3F8BA 2ADUA 4E7ZA 2V1XA 4FHTA 4MHGA 3PUNA 1HW5A 1WJBA 4A3DJ 4WZKA 4IHSA 1E2XA 3A35A 2CQNA 2QSGX 1Z6RA 3DTIA 1QRBA 2PIAA 3AG4H 3LWFA 2VFQA 2BGIA 3CF5F 3A8IA 2QGUA 4L5JA 4LLGF 2O1DA 3EUHA 5LEJA 3T51B 3JAMK 1LB2A 4EMSA 2QCOA 1HZEA 2NXNB 3V7RA 5IOYA 4H9GA 2F4OB 1NG6A 2XGCA 1DU6A 3IAM2 1X1AA 1JGGA 2JN6A 3E0JB 3KPHA 2MG4A 3CUOA 3RYPA 3TDZC 3ZQHA 3LSJA 1W5CC 2FOWA 4YRVA 3G73A 3ONYA 4QHYA 2XVCA 4GGGA 1J9ZA 2KVOA 1CQXA 1I3AA 3LVBA 1R5BA 3Q9SA 2X0KA 4CCNA 3FXUA 2F2EA 3RPQA 1P92A 2XPVA 1EV7A 4S05A 1FDRA 2YWFA 4F93B 1W0JA 4V2FA 2HVRA 3ML6A 2EWEA 1ETVA 4AYBA 3BJOA 2O6GE 3OOPA 4OOIA 2D1VA 3ZN1A 2KDZA 4KKTA 4F7DA 4ANJA 3EQNA 1ZAOA 1G4DA 3WTVC 5EEGA 2N8GA 2EFWA 2NS7A 1HG8A 2VT2A 1O8HA 2RC5A 4Z2YA 3PQJA 1B23P 3LA3A 3VSVA 2ZZQA 1D3YA 1FIPA 3MAJA 2VBKA 1VQOI 4OOVA 1F1ZA 3AVYA 1ZLJA 2GA2A 3ISPA 1FOKA 2RAEA 3F8CA 4GYIA 4CGZA 2AHQA 3EDPA 4DZPA 3GEZA 4BJTA 3RZDJ 2CV0A 1K6YA 2KZGA 3S1RJ 1H0MA 4BJ6C 4Z1MA 5CVJA 2LK2A 5KW9A 3ZMDA 3S2HJ 4CA0A 4OIPF 1CNEA 4EM1A 3PUMA 4JMQA 5FL7A 2JA8J 1LFUP 4P6YA 1UD8A 2QVOA 2FSWA 1SD6A 3DXJF 1GT0C 3JSPA 3RKYA 2W6JA 3SZPA 4DNRB 1UELB 4TMTA 2JUGA 2BVLA 2CH0A 2CQKA 1YTYA 1OOCA 3B82A 1SVOA 3VB2A 2LRDA 1O4XA 5LGUA 4XNFA 4C0SA 2KIMA 4M9SA 4UVBA 2H1KA 3OAAA 2WV0A 3Q0WA 3G2BA 2QBYA 1IDZA 3VMFA 1ETYA 3ZGKA 2LD5A 5TY0A 5FKNA 1Y0YA 1DABA 3BY1A 4HNVA 2DFIA 3RTRA 3BR3A 5K1YA 3SJMA 1K4TA 2JPCA 3NWSA 3Q9VA 4PMHA 1ETWA 3BG5A 5GPAA 1QBJA 5IYWA 1O8GA 1T95A 1HCRA 2K9QA 2I1LA 4HZFA 4F55A 2W4SA 1V54H 2XASA 1JNYA 3VMVA 2W1OA 3QOPA 1G3YA 2KRFA 3WXMA 4IHWA 2D5VA 3JAMZ 5FGMA 1Q1VA 2OAZA 4V2GA 1YYVA 3FHNA 1ZR4A 2M2EA 3WG7H 1IB4A 2DYRH 3CCUI 1RR7A 4CCKA 4F92B 4YAUA 1SMTA 2IGKA 2NOGA 1GJRA 3BR1A 3S16J 2VFNA 1K79A 1QGPA 3M7GA 1NK2P 1VQ4I 1EWYA 1FBQA 2EILH 2R7SA 4YELA 2JPBA 3GTPJ 2XDVA 1FRQA 3E5XA 3GO5A 3I59B 3MFKA 2JN9A 2OCCH 3E20A 1B72B 3TP3A 1HXDA 1JT0A 4LD5A 1K4ZA 2I10A 3UR3C 1EH6A 2W82A 4KUMA 1O8LA 3T53B 2LLKA 2ODLA 2PX9A 2VJ5A 3K4BA 2R7VA 3KZIC 4B3FX 2FNPA 1DBOA 1TBXA 4L9VA 5CVVA 1B9NA 2RNJA 3QPLA 1UG0A 1APLC 2QSFX 3GZ6A 4C3JJ 5D6FA 1CZFA 3W2GA 2VT3A 2GJRA 2VQGA 4HWVA 2OV7A 2P5KA 4OJ6A 4L8JA 1SKYB 3HRSA 5KAIC 4QVJA 1UCRA 2MH2A 3DCFA 5DCFA 2CW5A 2EPFA 3CUQA 2ZTGA 2ZITA 2MW8A 2XV4S 2ZMEB 2F5VA 4UB6C 3U9GA 1QFYA 4RJLA 2GK7A 2J8KA 3T0YA 4OINF 3RKQA 3H35A 4MYUA 1FBSA 3SDBA 3CCSI 4YAOA 2VE9A 2GBYA 5JHUA 1KU2A 3CXCB 1DDNA 2XF5A 2O03A 3I3LA 1E0EA 2ZC2A 2PJPA 4ZZLA 3AVTA 2X85A 4DQLA 1VQ9B 2L5QA 1OCZH 4XM3A 3ULQB 1XS9A 3HRMA 5EDNA 3UW0A 4PC2A 2HQ5A 3WU0A 2O8KA 4BBRJ 1I5ZA 1TT5B 1SAUA 1XMAA 4MQ9F 4BQQA 4IHTA 4Q7JB 4PJ0C 2DT5A 4GXOA 4R79A 1R7JA 5F4OA 1FY7A 3V7SA 1I7PA 3W5HA 5DTDA 2P0WA 2DOFA 1VQ5I 4R1HA 1IJEA 2Q1ZB 1TYUA 1KQSB
chains in the Genus database with same CATH topology
2DOAA 4YEJA 4BACA 3H9QA 2F43A 2R7OA 4BXFA 3BCFA 1YX3A 4XLCA 4C9YA 3VWBA 4OJOA 4PFOA 4YXWA 4U4BA 1VLYA 3EPZA 4DBRA 4XOPA 1D0YA 3S32A 4RM2A 5AMVA 5LFAA 1KCDA 2XOKA 1IRXA 3GQ7A 4BL0B 2UVFA 2FUG2 3L2WA 2QE7A 2HU9A 3OL4A 3TBIA 4IZZA 1OR7C 3LSKA 4KKSA 2MFZA 3VYTB 4OJPA 3KEYA 1X4PA 3OS2A 1MABA 3OW7A 1G8XA 4LITA 1WTHD 3HUGB 4HSTA 2D3LA 2QY1A 3KRGA 5FROA 3ZQQA 4E7LA 4XLFA 4W8SA 4XMYA 3HPGA 3DEEA 1BOBA 2KRCA 3HG9A 5CKTA 3UNGC 3DPLC 3D5LA 3M8JA 3T56B 1WJ5A 2VB6A 2O17A 4OAYA 2NOJB 4PFPA 4N4OB 2XZLA 4C2LA 4E4HA 3WWGA 2X1EA 3OFNA 2MABA 2R9VA 4OZYA 1W36D 3JURA 2BOLA 3OWTA 1X1DA 2R7QA 2X1DA 2Z6BD 3CESA 1Y56A 2V6EA 1RMGA 4IQ4A 2CK3A 1X4OA 2R7RA 2ZXHA 4F91B 3GVJA 2R7WA 2CMPA 4XKBA 1X1CA 3S3MA 2HLDA 2GJKA 3K4MA 4PUSA 1JRGA 2INUA 3SEZA 2VJJA 3OEEA 4BQOA 1D0ZA 2WY8Q 2JDIA 3BG6A 4Y4RA 3H0DA 4YZXA 2CUJA 3VR6A 4P5OA 3DU6A 4FASD 3A3GA 3SZGA 4ZTFA 1O8JA 1MNEA 1V5FA 2ZZFA 2KLOA 2DT7B 2F4IA 3PL8A 2UWMA 3ZCOA 3K4JA 1QCXA 3PNVA 1MMDA 3GVLA 3H94A 4XR6A 1E3ZA 1D1CA 4MR0A 4C30A 2WJYA 2NT6A 3A2KA 2W7NA 4EW9A 2HDWA 3OS1A 5HOOA 4X0GA 1PYVA 2WPDA 2DCEA 3IAS2 3ONQA 3L2VA 4W8TA 1QHGA 2HPMA 2R7UA 2DXIA 1X0CA 3CMMA 5KCMA 3SYTA 3TMOA 3H9JA 3CJRB 3VSTA 3H5NA 2O0WA 4NUBA 4MLOA 1OHHA 1W9XA 3OR2C 1I8DA 3B90A 3WQZA 2KDOA 2K9LA 1KCCA 2LREA 1OLTA 3OYCA 2JJ2A 3MKYB 1Z21A 3VSKA 1O88A 1KMHA 1DBGA 4UZUA 3KEWA 1NG7A 2VQCA 3D5RC 4AU7A 2E60A 3W2WA 4XL9A 4U87A 4YZQA 5CPRB 3MD2A 1WJFA 4ASUA 1QJVA 4OZZA 2CW8A 4E6KG 4CCJA 4KISA 3LSHA 4OWRB 1EA3A 4XN3A 4G7XA 1WMRA 4PJMA 5TGTA 4AVZA 2XF6A 3B4NA 1LKXA 2QKLB 3GBGA 4ITVA 3HKZA 3VYUB 4E7IA 2L9NA 3W2AA 1UD2A 1S9HA 4DNTB 4HSRA 3S3OA 2OC6A 4XN0A 3HOTA 1TT0A 2VKHA 1UD4A 3LNNA 2PMZA 1G59A 2R4GA 4E7SA 4HEA2 2CUZA 3S3NA 3ZR8X 2JVGA 4NK8A 2RNGA 3K4LA 4P1WA 2VQLA 3K6GA 4BUPA 3RSNA 2MD0A 2O5RA 2X6YA 2ZXIA 3OYGA 4NC8A 4JOMA 2L7KA 4BS9A 2BSPA 2LY1A 3LSGA 1O8EA 3ZPNA 2VIXA 1GLNA 5KHDA 5DN6A 1H8EA 2W6IA 3ZXSA 1RWRA 3A3BA 4NK6A 4URRA 2XNDA 3K4CA 1QHHD 4HG2A 2NT9A 1WPCA 3E1SA 3N05A 1NHCA 1MMNA 2XF7A 2M0MA 5HNHA 2WSSA 1WJAA 2MYSA 4IX7A 3K10A 4DIQA 2IGOA 2CV2A 4C2TA 3DU5A 3OYMA 1KONA 2UUZA 1AA7A 3LMMA 4CSWA 3OYNA 2M7AA 2LG4A 4ZYAA 4HNUA 1WJDA 2X8KA 2VASA 3EQOA 3IUOA 2ZZEA 3AFHA 2L2OA 3PNYA 4OJLA 4B43A 2AQEA 3KYLA 2LYCA 3MKZA 4YZ0A 3QYEA 1W36C 4B44A 3ZRGA 3FPPA 4G6IA 1O8KA 4KT6A 2D3NA 3OL3A 4BDYA 4TSFA 2NTQA 4HRIA 1MMAA 1D0XA 5HNFA 2HPIA 3VDXA 3W3CA 4Y33A 2IGNA 3QYFA 3RCOA 2IS4A 3OE7A 1PXZA 3S93A 1T0FC 4BDZA 1LVKA 4II2A 3L2QA 2PJRB 3AL0B 5C1EA 4N4NB 1N75A 2KP6A 2V26A 3VMWA 2DIEA 2F6CA 1Y6IA 2VXZA 1I18A 2NZMA 2INVA 1UD5A 2IS1A 2R7XA 1TZLA 2LH9A 3D5SC 2RQQA 2Y0SA 3CP8A 4CCOA 3K70D 1R6RA 3PUBA 4XLHA 2VKDA 1BLIA 2V4DA 4PJJA 2IS6A 3ZIAA 2QKMB 4TT3A 1WJEA 3LMWA 2BW3B 1HVXA 2ZFUA 3A4CA 1DGWY 3DWLE 4PK4A 2VL8A 1E79A 4OAZA 4H4KC 2V9KA 1OGMX 3OYAA 5CQEA 3RQ4A 2GK6A 4KJZA 1N78A 3FKJA 1P9QC 4DGWB 3HXLA 4F52A 4CZCA 1V5EA 1D1AA 2GOMA 2WBMA 3TL4X 3PSFA 3OOCA 1BN8A 2A6TA 3LFUA 2Z2SB 4B3XA 3OEHA 2CW7A 3MMYB 3BC9A 3HAGA 3CZ6A 4CH7A 2M4KA 4HNTA 3OR1C 4C2UA 3FKSA 3S8PA 1FMVA 2VXDA 2CS3A 3DKYA 1COWA 2WJVA 2KL4A 4BU2A 2WAQA 3PFYA 5FRNA 2Z1DA 2ZTNA 3C2HA 2XC7A 4Z06A 2W00A 3U21A 3PSIA 1E1QA 4CCLA 3OYJA 4ZTJA 1J09A 3GQ8A 1K5CA 4CUGA 5KNLA 2HVSA 3ZPPA 5IK2A 2ZSHB 2A5WA 4PJNA 2E1BA 4Z03A 1IA5A 4XORA 4XD7A 3NWTA 1N77A 2NSTA 4CCMA 4E7KA 2WY7Q 1O8DA 4D9JA 1LDKB 2KHMA 2X3HA 2PJRA 2CFOA 4XKWA 2XGJA 1PJRA 2ELJA 2IGMA 2NSPA 4NQWB 4TKOB 3LSIA 2M5SA 4BE2A 4BE1A 2VBMA 1MMGA 2LBFA 2L9SA 5CQGA 4RM3A 1IDKA 4U49A 4W8QA 4BEHB 1UAAA 3W2VA 2E5NA 3FY3A 4E7ZA 1UD6A 1WJBA 2HQAA 3VYRB 1KTWA 4JQFA 5LD2C 3DTKA 3OYEA 1EE6A 2QXZA 3MKWB 2XAUA 2BW3A 3A35A 4GQNA 2AQFA 2OUMA 1W0KA 1X1BA 3DTIA 1K28D 1DGRM 3BCBA 2I8DA 1BHEA 3VSUA 2NTBA 1NBMA 2HZDA 2LY2A 3H5RA 2IXSA 4DJAA 2O1DA 3ZSCA 4FXUA 2CV1A 3T51B 2X51A 3DQVC 2KZVA 1E3XA 1HZEA 3QODA 1NG6A 3IAM2 1X1AA 2WAEA 3E0JB 4LIVA 4ZJZA 1VF7A 1O8IA 4G7WA 4YRVA 1PE9A 3G05A 3T9GA 5FRMA 2HNHA 3DPTA 2KVOA 3NE5B 4Z05A 2VLAA 2X53S 4P22A 3OPOA 1Z3YA 4CCNA 3BG7A 2RREA 3EUKL 2KQRA 3L2UA 4F93B 1W0JA 2IS2A 4LIUA 2DJIA 2HVRA 1DQUA 2K3PA 2V7QA 2V7FA 2EWEA 3FBNB 4AYBA 2NTPA 3GQAA 4NC7A 4XKCA 3DKXA 3F9KA 4KKTA 3GQ9A 4ANJA 3EQNA 3C2GA 1NRKA 2DT6A 3B8YA 4E7JA 4J00A 3JU4A 1HG8A 1O8HA 5C1CA 4XKVA 3VSVA 4BGDA 4ZDOA 4XLAA 2R7TA 1JTAA 2ZZQA 3J7AY 4DK0A 2JVHA 3OYIA 2K5CA 1VZ0A 5CDFA 2VJ4A 1BR2A 2X6XA 2ZZGA 1YE9A 4PSWA 3K70C 2VBKA 1Z3XA 4F3QA 2WZPP 2VJIA 3OY9A 3OYFA 2MC4A 2V31A 1YX5A 4XONA 2M3AA 3GVKA 3QYBA 4BQNA 1T5EA 4BJTA 4BEHA 2CV0A 1IDJA 1K6YA 2ZSIB 4BJ6C 4Z1MA 4HPQA 2KMUA 3VYSB 1VJSA 4CA0A 2LBFB 1OFLA 3HL2A 3CF2A 4JMQA 5FL7A 2Z8GA 1UD8A 3AKZA 3DTEA 3I9V2 4ZDLA 1O8FA 2W6JA 4DNRB 1UELB 1WFXA 2JUGA 4E0FA 2BVLA 2CH0A 1OOCA 4Y3OA 1BR4A 3L2RA 3SUCA 2LRDA 4QPQA 2VBEA 2UV1A 2JSPA 4XNFA 2LC2A 1D1BA 3OAAA 1XG2A 4U7BA 3G2BA 2WADA 3ZGKA 2E1MB 4J01A 3DDYA 1WP6A 2F1MA 1LFPA 3AL0C 4NNJA 3RTRA 4G6TB 1JI8A 3NWSA 3HC7A 3BCAA 4PMHA 3SEQA 2PYGA 1QU3A 2Z16A 1O8GA 3BCDA 1T95A 3H9GA 4F55A 3OIPA 2W4SA 3OMYA 3VMVA 2W1OA 3OYKA 2WAFA 2JJ1A 4OJ5A 3CP2A 1V0FA 4RMNA 4KITB 2UVEA 1E43A 1X19A 1Z7LA 3DLAA 3FHNA 3K4KA 1BPLA 2O0VA 1PKVA 1IB4A 2K9MA 4XQFA 4I84A 4MXNA 2BVMA 4CCKA 4F92B 1HA8A 2IGKA 2JA2A 2KRHA 1VBLA 2GOXB 2E1MC 3KX2A 1BMFA 2M4GA 1FX0A 3EUHC 3V42A 2R7SA 4YELA 4XOTA 5HLTA 2XDVA 3OS0A 3BH4A 3DPUA 3FBIB 4KKUA 4XLEA 2XZOA 3HOSA 3UR3C 3OYDA 2W82A 1O8LA 1BR1A 1MW7A 1SFKA 3M1CA 3T53B 2VQHA 4BE0A 2ODLA 5JHFA 4E7HA 2VJ5A 1FMWA 3K4BA 3OYBA 1V5GA 3OOUA 3CJQB 2R7VA 4B3FX 1DBOA 2HVQA 2LOOA 2E5ZA 1H80A 3BC8A 4RLFA 4DK1A 1UG0A 3OYLA 3BLYA 4HIZA 2O04A 2PECA 4QPOA 4PJLA 1CZFA 1OFMA 3RPUD 1KZLA 2QX3A 2GJRA 2VQGA 1O8MA 4HWVA 2OV7A 2V1NA 4OJ6A 4DBQA 3OYHA 4L8JA 1SKYB 4IQJA 4EATA 1RU4A 2Q2EB 3OIQA 1E1RA 2ZTGA 1U0JA 1V0EA 4B48A 4W8RA 2F5VA 4LG3A 1MNDA 2GK7A 1AIRA 3H35A 3SDBA 2JIZA 3K4NA 3QOEA 2M7BA 4ZC3A 3LSMA 3GQBA 3H5AA 2GJPA 2KPMA 3VSLA 2IQ7A 2XF5A 2XZPA 3I3LA 1E0EA 5HVQC 1OB0A 4B3GA 1GQ8A 2LZJA 3GRHA 4B47A 4YZAA 2X85A 1EFRA 4FETA 2L5QA 4GRIA 4XM3A 4IKFA 2WB1A 4DOZA 3A1YA 3UW0A 1OGOX 1DP3A 1WJCA 2VPLA 4ZDPA 1ERDA 4RLQA 4D1QA 1SAUA 2XSJC 5HKKA 2V4JC 3FDYA 4BQQA 3LL7A 1ZELA 4BJ5C 1PLUA 4R79A 3IP4B 2X1CA 4II3A 3HPHA 2X6WA 1H8HA 1UD3A 4PSXA 2P0WA 2PYHA 3PJRA 2Q1ZB 2WA0A 3EUAA 3PNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVZ A;  3B4N A;  4YEJ A;  1OOC A;  3SUC A;  4XLC A;  4OJO A;  2VBE A;  4Z06 A;  4U4B A;  4XNF A;  1XG2 A;  4XN0 A;  4XOP A;  1KCD A;  3GQ8 A;  5AMV A;  1K5C A;  3ZPP A;  3GQ7 A;  2UVF A;  4NK8 A;  4PMH A;  4Z03 A;  2PYG A;  4XOR A;  1IA5 A;  1O8G A;  2NST A;  1O8D A;  2X6Y A;  4OJP A;  2X3H A;  3VMV A;  4OJ5 A;  4XKW A;  2BSP A;  1O8E A;  2NSP A;  2QY1 A;  2UVE A;  3KRG A;  4W8S A;  2VBM A;  4XLF A;  4XMY A;  4U49 A;  1RWR A;  4W8Q A;  1IDK A;  2O0V A;  4NK6 A;  1IB4 A;  4XQF A;  4I84 A;  4URR A;  2O17 A;  4MXN A;  3FY3 A;  2NT9 A;  4C2L A;  3WWG A;  1VBL A;  1NHC A;  4OZY A;  1KTW A;  3JUR A;  1EE6 A;  2QXZ A;  4YEL A;  4XOT A;  4XLE A;  1BHE A;  1RMG A;  3VSU A;  2NTB A;  3EQO A;  1O8L A;  2O1D A;  3ZSC A;  4OJL A;  2ODL A;  1O8I A;  1JRG A;  2INU A;  4YZ0 A;  2VJJ A;  1DBO A;  1O8K A;  2NTQ A;  4YZX A;  1H80 A;  1PE9 A;  1O8J A;  3T9G A;  2O04 A;  2PEC A;  1CZF A;  1OFM A;  4Z05 A;  2QX3 A;  1QCX A;  1O8M A;  1PXZ A;  4HWV A;  4OJ6 A;  5C1E A;  4XR6 A;  1RU4 A;  4MR0 A;  2NT6 A;  3VMW A;  4EW9 A;  2NZM A;  4W8R A;  2INV A;  4W8T A;  2EWE A;  1AIR A;  2NTP A;  3GQA A;  4XLH A;  3GQ9 A;  1X0C A;  3EQN A;  3VST A;  2O0W A;  3B8Y A;  2IQ7 A;  1HG8 A;  1O8H A;  5C1C A;  3LMW A;  1GQ8 A;  3GRH A;  4XKV A;  4YZA A;  3VSV A;  4XLA A;  2X85 A;  1JTA A;  3B90 A;  1KCC A;  4XM3 A;  2X6X A;  1OGM X;  2VBK A;  3UW0 A;  1OGO X;  2VJI A;  1O88 A;  1DBG A;  4XON A;  1IDJ A;  4YZQ A;  4XL9 A;  1PLU A;  1OFL A;  1QJV A;  4OZZ A;  1BN8 A;  2X6W A;  2Z8G A;  2PYH A;  4XN3 A;  1WMR A;  1O8F A; 
#chains in the Genus database with same CATH topology
 2DOA A;  3HOW J;  2EIM H;  4A12 A;  3A03 A;  2F5F A;  3VWB A;  3ZQ7 A;  3H1C A;  4U4B A;  1OFD A;  3JRH A;  3W2H A;  1VLY A;  4DBR A;  4G7Z F;  4OOX A;  3MCZ A;  3CO6 C;  4ZGQ B;  3S32 A;  5AMV A;  2JT1 A;  1IF1 A;  1I6X A;  5LFA A;  5C4J J;  3WTW C;  2B63 J;  2F5E A;  2CU7 A;  1GAQ A;  2XOK A;  1TNS A;  4M0L A;  4S04 A;  3GQ7 A;  3PIO F;  3O8H A;  3NAU A;  4X7F A;  4QIW N;  2V1U A;  2VOD A;  1PUF B;  4IZZ A;  2DFF A;  1DAR A;  1GUU A;  4HW0 A;  1MH3 A;  4KKS A;  3VYT B;  3I71 A;  4WX9 A;  1BOA A;  4M3D A;  1R22 A;  2ISZ A;  1TLL A;  2QGG A;  3QWL A;  1IG7 A;  3SEJ A;  2MLG A;  5FRO A;  4W8S A;  1R4M B;  2HGC A;  3Q0V A;  1VQ8 B;  3HPG A;  3DEE A;  5CKT A;  3HG9 A;  4RLZ A;  3KP3 A;  4B3A A;  1AOY A;  1WJ5 A;  2VB6 A;  3ELK A;  4OAY A;  1R5N A;  4LC0 A;  1ETQ A;  2MC3 A;  5FJ8 J;  1D1N A;  5HLG A;  3WE3 A;  4UY8 I;  2MAB A;  5L3G A;  1XE1 A;  3PO3 J;  4HX8 A;  5A88 A;  3RY8 A;  2QQ8 A;  3JUR A;  2CFX A;  1X1D A;  1RQP A;  1DG1 G;  3CCV B;  2R7Q A;  4KFC A;  3DBH B;  3K1M A;  3P5J A;  1O57 A;  2F4N A;  1U5T A;  5E18 F;  3IRR A;  1RMG A;  4WXD A;  4MTD A;  2ZXH A;  4L18 B;  3GVJ A;  4YHB A;  3BG3 A;  3TQN A;  3FJO A;  2CMP A;  1X1C A;  2Y9Z A;  3HOX J;  2GJK A;  1G2H A;  4MNU A;  4WZT A;  1X1P A;  2WY8 Q;  1Z7U A;  1FP1 D;  4Y4R A;  3H0D A;  4LG0 B;  1DUX C;  3H3Z A;  5HXB A;  1BA5 A;  1O8J A;  2E7X A;  4WCG A;  2UWM A;  3WU1 B;  3ZCO A;  3K4J A;  2BY3 A;  3PNV A;  2FA5 A;  3GTG J;  5H59 A;  2HOS A;  3H94 A;  1D1C A;  2FBK A;  1BI2 A;  4C30 A;  1H85 A;  3CCU B;  4MQV A;  3A2K A;  1HDD C;  4EW9 A;  4LJZ F;  5HOO A;  4X0G A;  2EWN A;  5H6R A;  3K2Z A;  3MKL A;  2WPD A;  1Y0R A;  1S7A A;  3ONQ A;  3L2V A;  4RD3 A;  3CMY A;  1JGS A;  2DXI A;  2UZK A;  1X2N A;  1QA2 A;  2GM4 A;  3MZY A;  1BIA A;  3H9J A;  1DU0 A;  2EA2 A;  1BX1 A;  4I98 B;  2M1B A;  3H5N A;  4ON0 A;  1IN8 A;  4NUB A;  1U2R A;  2O0W A;  4HDU A;  4ZCI A;  1MJA A;  4EJO A;  1UHM A;  3VNU A;  3O2P E;  2DO7 A;  3JRB A;  2K9L A;  3KIO A;  4D7N A;  2K4J A;  2JA5 J;  3IWZ A;  3W6J B;  1OFC X;  4YZ0 A;  2C5H A;  4UZU A;  3ZZT A;  3WHC A;  5C4X J;  4AU7 A;  1YHQ I;  5A2Q K;  1BQE A;  4EGY A;  2CQX A;  1R58 A;  2HKX A;  2WB1 N;  4RB3 C;  1KZH A;  1B2R A;  3L9F A;  1XFO A;  4M1K A;  2FD5 A;  2Q6K A;  1MIJ A;  1FOX A;  4OZZ A;  4E6K G;  4P9U A;  5DV5 A;  2BM0 A;  2OBP A;  1XSD A;  1WMR A;  1R5H A;  4V19 K;  1IXC A;  5TGT A;  2ZL5 A;  2XF6 A;  3CLO A;  5JVG F;  2VN2 A;  3V4G A;  2C4T A;  1QPM A;  3VYU B;  1RES A;  1S9H A;  1G6N A;  2DOE A;  3BWG A;  2PMD A;  3TDU C;  4RDL A;  1YS6 A;  3QPT A;  2XKP A;  4XN0 A;  5KAF C;  1TP4 A;  5IP6 A;  1UD4 A;  3KFW X;  3R60 A;  3CW2 A;  3MCA A;  2PMZ A;  2R4G A;  2X48 A;  2KIU A;  2DER A;  2VOO A;  2EQR A;  2ZXW H;  2Y0M A;  2XB5 A;  3K4L A;  3PSS A;  2YUS A;  3WTZ A;  4A3F J;  3AG1 H;  2MA3 A;  2MD0 A;  3RDI A;  2LY1 A;  3TW7 A;  3BY6 A;  1H8E A;  2W6I A;  4RDU A;  1WH7 A;  1ZG1 A;  2IA0 A;  2G7H A;  3WYA A;  4NK6 A;  3EET A;  4URR A;  3LST A;  1KU3 A;  3ABM H;  1QHH D;  3K4C A;  2JRM A;  2K9S A;  3G71 I;  2DQL A;  3N05 A;  4HBL A;  1E62 A;  3U6B A;  2MD5 A;  3OP1 A;  1YJN B;  1MMN A;  1V3F A;  1W4M A;  2OTJ B;  5HNH A;  1ACI A;  2B7E A;  4M3F A;  3LO8 A;  2L54 A;  1WJA A;  3V7C A;  3VO2 A;  5F1R A;  3D0S A;  2BXZ A;  4IO9 F;  4RCY A;  3KEO A;  3AVU A;  2Q6O A;  4M3G A;  1QFZ A;  1KON A;  3LMM A;  3Q6R A;  5JLX A;  5LRR A;  2VBU A;  4V02 C;  2VAS A;  5E1W A;  1Q9S A;  2EA4 A;  2OBR A;  1IV6 A;  1ZM9 A;  1P7I A;  3IUO A;  1XCV A;  2AS5 F;  2L2O A;  3PNY A;  3PSZ A;  3T8T A;  1E3P A;  3TED A;  2E71 A;  2XRL A;  1W36 C;  3HM5 A;  3B78 A;  4KT6 A;  1ZM2 A;  4FE4 A;  3GTQ J;  3F21 A;  3I5U A;  4HRI A;  2XRO A;  1TQM A;  1H9G A;  2HPI A;  1BJZ A;  5HS7 A;  3H92 A;  3CCL B;  2BM5 A;  1T0F C;  3O6B B;  2FNA A;  1T39 A;  5IYP A;  5FO1 A;  4BHP A;  1N75 A;  3BDD A;  3HYI A;  3PFI A;  3SQN A;  3S14 J;  1YW8 A;  5F0H A;  2PI0 A;  1UD5 A;  1X2M A;  1WI9 A;  3CC7 B;  1EKE A;  3D5S C;  3WTS C;  4CCO A;  1R6R A;  1FOW A;  2VKD A;  2LVS A;  3BPV A;  1ON2 A;  4ABZ A;  3I4M J;  4TN1 A;  3LA7 A;  1KC8 D;  3U2R A;  2B0L A;  1EFU A;  4Z4V A;  1HVX A;  3R61 A;  4I2O A;  1F36 A;  4PK4 A;  2ZL7 A;  2K3F A;  5LHH A;  2V9K A;  3OYA A;  2GK6 A;  2UXX A;  1QNT A;  1G7T A;  4QWQ A;  2FML A;  1XSX A;  5EZG A;  3BR2 A;  4CZC A;  3JRC A;  3ASO H;  1DP7 P;  4RAF A;  4Y52 J;  1N0U A;  1PJ7 A;  3FKI J;  2QYO A;  4LLL A;  5K5R A;  4EM2 A;  4UV9 A;  3S2D J;  2HOA A;  4ZCL A;  2Z2S B;  3ZQF A;  2P81 A;  2CW7 A;  5A8A A;  3BC9 A;  3CZ6 A;  2K85 A;  3KEQ A;  3OR1 C;  2NVU B;  2ZL6 A;  4Y17 A;  1SVL A;  2KL4 A;  4MFE A;  3GFM A;  4BAY A;  5FRN A;  2GXB A;  2Z1D A;  4RGU A;  4ESB A;  2ZTN A;  2IAI A;  2YU3 A;  1QZZ A;  2ZBK A;  5FLX Z;  2FBH A;  1LQ1 A;  2V5I A;  4CCL A;  3OYJ A;  4IHY A;  2Y30 A;  1J09 A;  5KNL A;  3AG3 H;  3ECO A;  5IK2 A;  1IUY A;  3WBJ A;  1AU7 A;  1IA5 A;  4XD7 A;  1S5L C;  1XG1 A;  3SLD A;  2VFO A;  1T8I A;  2VNJ A;  1LEB A;  4UUS A;  2WY7 Q;  1YHQ B;  1R1U A;  3KZY A;  5JLW A;  2X3H A;  4I7H A;  2XGJ A;  3LYC A;  2HXI A;  2ELJ A;  2K86 A;  1VND A;  1WHU A;  2IGM A;  1IC8 A;  1AWC A;  2NSP A;  4HQE A;  1IUF A;  1D8K A;  2ICW G;  3BTL A;  2EBI A;  4KH3 A;  4RM3 A;  2YX7 A;  1X3Z B;  4OPS A;  5B66 C;  2IP2 A;  2E5N A;  5IYC J;  4P12 A;  1WCM J;  2ZJP F;  5ED4 A;  2XNC A;  3PQK A;  5GAH J;  1HKT A;  4X07 A;  3MKW B;  2XAU A;  2BW3 A;  4Y13 A;  3L2C A;  2OUM A;  3GFL A;  3HTU A;  2XAQ A;  3BZ6 A;  4RBO A;  1LNW A;  2O9L A;  5E3O A;  2NTB A;  1FT9 A;  1VQN B;  3GTJ J;  2XPW A;  4DJA A;  5FD5 A;  1N25 A;  2QBY B;  3ZSC A;  3W6K B;  2X51 A;  3DQV C;  5IP7 J;  1E3O C;  3PM1 A;  1XGM A;  3QOD A;  1TNT A;  2O8X A;  1Q81 D;  2WAE A;  3P7N A;  4ZJZ A;  3B8H A;  2M8E A;  3OZV A;  3W2E A;  3WG9 A;  2ELK A;  5LHG A;  3G05 A;  2PLF A;  4BHB A;  3GZ5 A;  2HNH A;  3A0H C;  4DQK A;  3Q38 A;  4Z05 A;  2K02 A;  2ME6 A;  4P22 A;  3OPO A;  1Z3Y A;  3BG9 A;  1L3L A;  3I54 A;  2CW0 F;  2BYV E;  3BG7 A;  5H5J A;  2QEN A;  3O8G A;  2RRE A;  1BI3 A;  2P5L C;  1BJA A;  2H8W A;  3CJT B;  2YWH A;  2BEO A;  4LIU A;  5E17 F;  3HB9 A;  2V7Q A;  1EZG A;  2K3P A;  2OQR A;  1GV5 A;  2E35 A;  3BRO A;  3FBN B;  1X3U A;  2ZJ2 A;  4XKC A;  3DKX A;  2VOP A;  2VZL A;  3A01 B;  5L3E A;  3KLO A;  3FIS A;  4Z4Y A;  3B8Y A;  4J00 A;  1R71 A;  5C1C A;  6PAX A;  2BPO A;  4BGD A;  5HZA A;  3J7A Y;  1JUS A;  2EB7 A;  1EP2 B;  4XRS G;  2D9R A;  1KK2 A;  5KSW B;  5CDF A;  1BR2 A;  5IT3 A;  2H09 A;  1YE9 A;  4CYC A;  5IT9 Z;  2ISY A;  4F3Q A;  4NQW A;  3TW6 A;  2BY2 A;  2WZP P;  1QVT A;  4PAA A;  3ZMT A;  2C6Y A;  3ASS A;  4XON A;  5EGO A;  4BQN A;  4O3M A;  1IDJ A;  2L9R A;  4IVN A;  5M3M J;  2KMU A;  3GZN B;  3SZT A;  1WPK A;  3HL2 A;  2VNH A;  3CF2 A;  4F7Z A;  3LJY A;  2A6H F;  2YX4 A;  2ID6 A;  1OYW A;  3AKZ A;  2GPJ A;  5M5W J;  3FXO A;  4UXN A;  1SKQ A;  1RKW A;  1RNL A;  2DLL A;  3ESW B;  2G7U A;  2JA6 J;  3S1N J;  5H6Q A;  3QFC A;  1LLW A;  4Y3O A;  4K2E A;  3CUQ B;  2TDX A;  3V76 A;  4PC7 A;  2VBE A;  2DMP A;  2UV1 A;  2YS9 A;  2LC2 A;  3H0G J;  2R5Z A;  1XG2 A;  2WAD A;  3G1L A;  1QA1 A;  1W35 A;  3DDY A;  1QGZ A;  4ZYH A;  1LFP A;  3AL0 C;  1YJW B;  4G6T B;  4HE5 A;  2RDP A;  1QU3 A;  4I99 C;  5D8L B;  2Z16 A;  2WR8 A;  3BCD A;  3H9G A;  3M9A A;  3OIP A;  4RPD A;  1K8F A;  1JJ8 C;  4OJ5 A;  2BMW A;  3CP2 A;  1W34 A;  1PUE E;  2HOE A;  2RN7 A;  2VBY A;  4U0Y A;  1E43 A;  4L5I A;  4A5N A;  3J7A O;  1A8P A;  1RI7 A;  3CB4 A;  3F8M A;  3K4K A;  1BPL A;  4MIM A;  1YG2 A;  2LP0 A;  2V7W A;  2K9M A;  2DY1 A;  2OD5 A;  4HX7 A;  4MXN A;  2BVM A;  2FE3 A;  2QN6 A;  4RDK A;  3OW2 B;  1RR8 C;  1ZHF A;  2JA2 A;  2KRH A;  2GOX B;  1QGY A;  1WU8 A;  1FX0 A;  3SHF A;  3ZQG A;  3V42 A;  3BQJ A;  2RQP A;  3IH3 A;  1I27 A;  4KN7 X;  4XOT A;  4XIC A;  1BL0 A;  4NBS A;  3DPU A;  2XTX A;  3FBI B;  3FHZ A;  1OIS A;  2NPF A;  5FKL A;  3HOS A;  4BKX A;  1WSR A;  1IXR C;  1MW7 A;  3D26 A;  2VQH A;  4BE0 A;  2E2I J;  1O8I A;  3WHB A;  3QPS A;  3JRD A;  2F3L A;  2BVN A;  3CTA A;  1ON1 A;  2LOO A;  3DEW A;  3NRV A;  4S0H B;  4EQQ A;  4IL6 C;  2E5Z A;  4WXH A;  4Z4S A;  3BC8 A;  1G7S A;  4DK1 A;  3CC4 I;  2P7C B;  4HIZ A;  3F6V A;  4EM0 B;  1KZL A;  2DOD A;  1O8M A;  2V1N A;  3J7Y J;  1MDM A;  1ZG5 A;  2GRE A;  2XAG A;  3OYH A;  4IQJ A;  2OJE D;  3CMA B;  3G1O A;  3OIQ A;  1K9M D;  1V0E A;  2GZW A;  4B48 A;  2W7Z A;  2EIN H;  3GVA A;  4LG3 A;  5HS8 A;  4RS8 A;  1MND A;  2A3S A;  2CC2 A;  3SJZ A;  1MH4 A;  2D1H A;  4W1U A;  5LRS A;  1R1T A;  4RD4 A;  4IHV A;  1GVJ A;  3QOE A;  3W2F A;  4UB8 C;  3H09 A;  2QDX A;  4JBA A;  3LSM A;  3MVP A;  3PVD A;  3H5A A;  2GJP A;  1VQ9 I;  3VSL A;  4K1X A;  5HVQ C;  4AYB N;  1ZGW A;  2LZJ A;  2EV5 A;  2GAU A;  3AGP A;  4FET A;  2ZNY A;  1QUF A;  2BGJ A;  1U5T B;  2IPQ X;  3D1N I;  4P2N A;  3FK7 A;  1OGO X;  1DP3 A;  3C18 A;  3JQQ A;  1KTV A;  4I02 A;  4D1Q A;  2XSJ C;  3F72 A;  3E7L A;  1LDJ A;  3FDY A;  3LL7 A;  5BPD A;  2W25 A;  3C7J A;  1IRZ A;  1ZRE A;  1HW1 A;  1MBE A;  2A5Y B;  3IP4 B;  1K83 J;  5M3F J;  2X6W A;  2DPD A;  1BI1 A;  1UD3 A;  4PSX A;  2MH9 A;  1HW2 A;  4AF6 A;  3KET A;  1K8A D;  4L0Y B;  1D1B A;  3EUA A;  2PYH A;  2XTW A;  3GXO A;  3PNT A;  1UFM A;  3T8R A;  1JJ2 B;  2AXL A;  1GAW A;  1BM9 A;  3QQA A;  1QRC A;  4JYK A;  4BAC A;  3H3U A;  5B1B H;  4C9Y A;  4XLC A;  1EXM A;  2JRT A;  2LY9 A;  1Y8Q B;  1XB2 A;  1OB5 A;  2CBX A;  2GQF A;  2R7D A;  2EIK H;  3C3W A;  4L9N A;  1TWF J;  1FWZ A;  2VI6 A;  1KCD A;  1TW3 A;  3T1B A;  5DUK A;  1JKP C;  3A02 A;  4WWV A;  3ERM A;  3SQV A;  2HU9 A;  3OL4 A;  3TBI A;  2E2H J;  3QRF F;  1VQ7 I;  1N06 A;  1OR7 C;  4KIF A;  3WTT C;  4OJP A;  2OBS A;  3KEY A;  4GCV A;  2A69 F;  2QQB A;  3K0L A;  1X4P A;  2Q2E A;  3OS2 A;  1VQ8 I;  1T6Z A;  1TSP A;  4LIT A;  2HTJ A;  2D3L A;  4ENK A;  2DAO A;  3R6J A;  2QY1 A;  3KRG A;  2YWE A;  2IRF G;  1ETO A;  2KRC A;  3UNG C;  1U3E M;  1PP7 U;  3M8J A;  3FMS A;  4ENM A;  3T56 B;  1I1G A;  2DA4 A;  3JRE A;  4E4H A;  2EFP A;  3CCV I;  1F20 A;  4DYR A;  2LF7 A;  1WXR A;  3U6K A;  2A07 F;  5E3N A;  2TCT A;  2R7Z J;  4GFB A;  4FK8 A;  5GAG J;  1NDH A;  2CK3 A;  2HKO A;  2HQN A;  2INU A;  3F23 A;  3WND A;  5DM7 F;  4BQO A;  4JK1 X;  1X58 A;  2JDI A;  3BG6 A;  4Z4R A;  3VNV A;  3CCQ B;  4YZX A;  4P5O A;  3GFJ A;  4FAS D;  2VFP A;  4ZTF A;  1ULY A;  1FIA A;  1V5F A;  2ZZF A;  3AVX A;  3B6A A;  3FMQ A;  5J6X A;  2W84 A;  3C1D A;  3L00 A;  1OYI A;  4G6Q A;  3KL9 A;  1XN7 A;  1KQ5 A;  1L1I A;  3GVL A;  4XR6 A;  1E3Z A;  4ZH4 F;  4AF7 A;  2E1C A;  1UMQ A;  1BBY A;  2DCE A;  3IAS 2;  5B5E C;  1IO2 A;  2CND A;  5JLV C;  3BTC A;  4PC6 A;  1QHG A;  1T0F A;  2HPM A;  5DSZ A;  3MZ8 A;  3ZQL A;  1TC3 C;  3M4O J;  1XX5 A;  2ZKZ A;  5FKK A;  3TMO A;  4Y15 A;  3AAF A;  3WNB A;  1JJ6 C;  3SZE A;  2VKE A;  3KP2 A;  4MLO A;  5FA6 A;  3TH0 A;  3OR2 C;  1Z9C A;  1KCC A;  2LRE A;  3TKY A;  3BT9 A;  2E19 A;  4G7H F;  2Z3Y A;  3HUG A;  3CC4 B;  1R5O A;  1TL8 A;  2Y9Y A;  1A35 A;  4IRI A;  4Z4W A;  5GV7 A;  3W2W A;  1WI3 A;  4OIO F;  2PMH A;  1WJF A;  2NAZ A;  4ASU A;  4M72 A;  3FM5 A;  3ML3 A;  2W24 A;  1MSF C;  4CCJ A;  1A6Q A;  1IAW A;  4KIS A;  1G7C A;  4HE6 A;  3ZUG A;  1TVC A;  1KU9 A;  3M3Y J;  4OWR B;  3TO6 A;  2W48 A;  5KVR A;  2HCJ B;  2KIQ A;  4AVZ A;  4XLP F;  2KJC A;  3K1N A;  1HBX G;  1FNM A;  3OKX A;  2Q8K A;  3GBG A;  4HQM A;  3BP8 A;  4ITV A;  4U0W A;  3HRT A;  4HSR A;  4XBF A;  4G1V A;  1IN6 A;  2LKP A;  2BM6 A;  1CQT A;  5IP9 J;  2PN6 A;  2O61 A;  1W0U A;  1G59 A;  1WOO A;  4E7S A;  2FX3 A;  4HEA 2;  2CUZ A;  1WZ2 A;  2FMY A;  3MZH A;  2HR3 A;  4EH1 A;  1XCB A;  3ZR8 X;  2JVG A;  3ZMV A;  2RC6 A;  3RSN A;  3OSF A;  3J81 Z;  1TQP A;  3UKG A;  1M1K D;  5J1U A;  2L3D A;  4EV0 A;  4NC8 A;  4CYD A;  3OYG A;  4LBW A;  5DS9 A;  3OJX A;  2BSP A;  1O8E A;  2VIX A;  1DDI A;  5DN6 A;  3I0T A;  2L9V A;  2ESN A;  3BR5 A;  5IYB J;  3WGI A;  5FB2 A;  1GXQ A;  1YJN I;  3FMR A;  1JKO C;  4UVC A;  2OTJ I;  2IEK A;  4GYG A;  3PA1 A;  2XND A;  4ZYD A;  3CCJ B;  4UUT A;  5J4Y A;  2WWY A;  5BPI A;  2M0C A;  2XGX A;  1YRN A;  4RPB A;  4LBV A;  4KMU X;  2WSS A;  4PZJ A;  5L3F A;  1IRF A;  1EFC A;  1OQY A;  3K10 A;  4HOB A;  4DIQ A;  4IX7 A;  1YLF A;  3GIR A;  3DU5 A;  3OYM A;  1U8R A;  1XDS A;  3Q3A A;  2UUZ A;  1I50 J;  3OYN A;  2LG4 A;  4HNU A;  1WJD A;  4M74 A;  4IW3 B;  3ZBT A;  3E6D A;  3W2I A;  2AQE A;  1VQ7 B;  3MKZ A;  2R7F A;  4IF4 A;  5FFX A;  1LM1 A;  4XSZ F;  1WOS A;  3QYE A;  4ETS A;  4B44 A;  1UST A;  1JUM A;  3BOQ A;  1SFO J;  2WZN A;  4UNO A;  4BDY A;  2EZL A;  4G6I A;  4TSF A;  3V7A A;  2C4U A;  4ACA A;  5F0C A;  3CCL I;  1WRJ A;  2VBW A;  4Y33 A;  2PBI A;  3QYF A;  3RCO A;  4UUS B;  2XAJ A;  1PXZ A;  5C1E A;  4OIR F;  2JTV A;  1EH7 A;  4MTE A;  3CC7 I;  4J19 A;  1W7P A;  3DP7 A;  2F6C A;  1Y6I A;  2VXZ A;  1TWG J;  2NZM A;  2INV A;  1BIB A;  2EFN A;  2IS1 A;  3M07 A;  3ONU A;  1TZL A;  2LH9 A;  3ECH A;  2Y0S A;  4GO1 A;  4UHT A;  3K70 D;  2H6C A;  1FBU A;  3PUB A;  2R93 J;  1EF4 A;  2ESH A;  2HMA A;  2VBV A;  4LBZ A;  5E79 C;  1XDU A;  4YAF A;  1BLI A;  2V4D A;  3ZP5 A;  4PJJ A;  4UV8 A;  5F04 A;  2G0Y A;  2VC1 A;  2HXO A;  2BW3 B;  2IBD A;  1FSH A;  2ZFU A;  3A4C A;  5CJ9 A;  1M90 D;  4OAZ A;  1ZAR A;  3HBL A;  2DMT A;  4EJW A;  4KNY A;  1POG A;  3X2Q H;  2JWT A;  3I4N J;  3P26 A;  1OGM X;  2K9N A;  3TOB A;  4DGW B;  5DM6 F;  4F52 A;  4OP7 A;  4A3J J;  1V5E A;  2GOM A;  1W2B B;  1FNC A;  2WBM A;  2KFD A;  1A36 A;  3TL4 X;  3PSF A;  1BN8 A;  1GO2 A;  2A6T A;  4MFD A;  3ZC3 A;  1SFX A;  3AST A;  1YQA A;  1ZN2 A;  3MMY B;  1O7L A;  2KKO A;  3HAG A;  1TYV A;  1Z05 A;  1OCP A;  2M4K A;  4M6X A;  3S8P A;  1FMV A;  2VXD A;  2WJV A;  1COW A;  4EJU A;  2EFG A;  2WAQ A;  3S15 J;  1VQ6 I;  4RGR A;  5HS9 A;  2H1L A;  1DDG A;  4Z06 A;  3R4K A;  1UMK A;  2L7F P;  1E1Q A;  3ASQ A;  1CF7 A;  4XRM A;  3GQ8 A;  2F1L A;  1CLW A;  1PP8 F;  4BQA A;  1MJ9 A;  1QZE A;  4G94 A;  2HVS A;  3VO1 A;  2J7K A;  2EFO A;  2FOK A;  3F6O A;  4HV5 A;  4IEJ A;  3WOD F;  2E1B A;  4PJN A;  1N77 A;  3ROU A;  2X4H A;  5TR9 A;  4CCM A;  2HYJ A;  5CLS A;  3RYR A;  3G4S B;  1O8D A;  4D9J A;  3S1Q J;  2FVG A;  5ICG A;  4CYC B;  2EJR A;  1IB0 A;  4NQW B;  3LSI A;  1XSV A;  2BV3 A;  4BE1 A;  2J5O A;  1ZRD A;  3GCM A;  3T5X A;  4U49 A;  2G9W A;  1T6X A;  3ZZ0 A;  4P3Y A;  2DA5 A;  1QVU A;  5IPA A;  3U1K A;  2DYS H;  3FY3 A;  2M9H A;  5CVI A;  3M8E A;  3NAR A;  2HQA A;  3KE2 A;  1KTW A;  4JQF A;  5D5U B;  3OYE A;  3WBK A;  2QXZ A;  4GQN A;  1VQN I;  4RAY A;  1W0K A;  1HQC A;  4LFU A;  5LGT A;  1K28 D;  2DQR A;  3Q5F A;  4A2U A;  3BCB A;  4KA4 A;  1E17 A;  2BZT A;  1BHE A;  4X7D A;  2RKH A;  2BY1 A;  4A0Z A;  1NBM A;  2R5Z B;  2HZD A;  2LY2 A;  3H5R A;  2IXS A;  5FKM A;  5LLQ A;  2M34 A;  2PQ8 A;  2CV1 A;  2EIX A;  1LJ9 A;  1MJB A;  5DD4 A;  4B4C A;  1E3X A;  2D45 A;  4OOS A;  4YAW A;  4UVA A;  1YO5 C;  2VNK A;  2GLO A;  4BNC A;  3VPR A;  2J5P A;  2M87 A;  2D74 A;  1H8A C;  5FLX K;  3W5U A;  5L46 A;  3T9G A;  5FRM A;  2FQ3 A;  1WWX A;  3NE5 B;  3DPT A;  1KJZ A;  3G3Z A;  2VLA A;  4N3G A;  3PEN A;  3J80 K;  5EEA A;  1B6A A;  2CJJ A;  5CVU A;  3CCR B;  4G6D A;  2L02 A;  4ENN A;  5KK1 A;  4QV2 A;  2DJI A;  1DQU A;  1J5Y A;  2F4M B;  4OPO A;  3GQA A;  4P6V F;  4LBY A;  4EJV A;  2JK3 A;  3R0J A;  1YIJ I;  4KIG A;  2DYI A;  1OKR A;  3C2G A;  2CUF A;  1RC9 A;  5H20 A;  1ITY A;  4P26 A;  2COB A;  3Q3S A;  3HSR A;  4CZZ A;  2STW A;  4NBQ A;  4E7J A;  1UHS A;  1NB0 A;  2PE3 A;  4XKV A;  5BSX A;  2R7T A;  5HLI A;  4TMV A;  1JTA A;  4MEY F;  2R0Q C;  3OIO A;  4DK0 A;  2JVH A;  3OYI A;  3HTS B;  2X6X A;  2X9D A;  4PSW A;  3TOA A;  2HTS A;  2GXA A;  2FU4 A;  4Q48 A;  4Z6Y A;  3SY2 A;  1K73 D;  2VJI A;  5DUI A;  4IHX A;  2MC4 A;  4A3M J;  3I56 B;  2HDC A;  3E97 A;  1FYM A;  3GVK A;  5AON A;  4RDJ A;  3QYB A;  3BR6 A;  5JFR A;  2VUM J;  1UZC A;  4M9X A;  1BJK A;  2ZSI B;  2DN0 A;  2MLK A;  4HPQ A;  1YW9 A;  5BQT A;  3AK5 A;  3VYS B;  2CRG A;  3QU3 A;  1P4A A;  2LBF B;  1O3T A;  1WKM A;  3CRZ A;  1T6S A;  2XC1 A;  3HOY J;  4G9Y A;  3I9V 2;  3P9K A;  1MDM B;  3I55 I;  1O8F A;  3BR0 A;  1NB9 A;  2B7C A;  1SFU A;  2ZCW A;  5J1Y A;  3FWE A;  2NV4 A;  1BR4 A;  3L2R A;  1U9N A;  4P3I A;  2ZJQ F;  2VKV A;  4BHC A;  1LUJ B;  2JSP A;  4LLN A;  3LQE A;  4YCQ A;  4A3L J;  4RD0 A;  4U7B A;  5F64 A;  3LFK A;  1YJW I;  3KZZ A;  2X3U A;  1JKR C;  2E1M B;  4J01 A;  1WSU A;  1WP6 A;  2F1M A;  4RD2 A;  4YC5 A;  3EYY A;  4O5V A;  1P6R A;  4IOC F;  2Y69 H;  1RZ4 A;  3HC7 A;  3BCA A;  3V8J A;  1LE8 A;  3SEQ A;  1ZRC A;  2VBX A;  3L09 A;  1FLI A;  2V9V A;  4I76 A;  3LAJ A;  1Z1D A;  3FK6 A;  2F48 A;  3OYK A;  4WZL A;  4FN5 A;  1V0F A;  2VE8 A;  4RMN A;  2UVE A;  4R71 A;  4YIR X;  1E63 A;  1YS7 A;  1PJ6 A;  4G1B A;  1OR7 A;  1X19 A;  2P6T A;  3FXR A;  1CGP A;  4B09 A;  2O0V A;  1FYK A;  1PKV A;  4XQF A;  4I84 A;  5AN9 A;  2RVC A;  5HLH A;  1YJ9 I;  1HA8 A;  5IT9 K;  1ZK8 A;  4I0B A;  5LEK A;  1Z0X A;  2Y75 A;  1VQ6 B;  1KGS A;  1BMF A;  2M4G A;  4YEI A;  3J80 Z;  4BYY A;  3ZZU A;  5HLT A;  1FRN A;  3OS0 A;  3BH4 A;  2PLY A;  1G3S A;  1Y8R B;  4KKU A;  4XLE A;  2G0E A;  2XZO A;  1SMY F;  3SFZ A;  4M71 A;  3OYD A;  5GAD J;  5F4M A;  2BM4 A;  1BR1 A;  1Q1H A;  1SFK A;  1WGX A;  3M1C A;  3N97 A;  1FMW A;  2DA7 A;  3OYB A;  1V5G A;  4GDF A;  1R36 A;  3DEU A;  3QAH A;  4RLF A;  5GP9 A;  2WYR A;  3BLY A;  2H8R A;  2OZU A;  1NJI D;  2O04 A;  1OFM A;  3RPU D;  2DDA A;  2VON A;  2CUE A;  3CMA I;  1Y0N A;  4DBQ A;  4U9U A;  5K5Q A;  1GR1 A;  3JW4 A;  4EAT A;  1YIT B;  2Q2E B;  3N4M A;  5FLV A;  1E1R A;  1U0J A;  4W8R A;  4DYQ A;  1XGN A;  3QSY A;  4EEF G;  3KYC B;  1TW2 A;  2JIZ A;  1P7J A;  1ZRF A;  3ISX A;  3GUD A;  2M7B A;  4ZC3 A;  4KDP A;  4LOC A;  3GQB A;  1JXS A;  3AVV A;  4X06 A;  1EA0 A;  2KPM A;  4QVA A;  4B3G A;  5CYV A;  1OB0 A;  1OCC H;  3GRH A;  3ES9 A;  2WV1 A;  1EFR A;  3R6K A;  1A6I A;  1FEX A;  1XB4 A;  4N9H A;  4Q47 A;  3WGH A;  4IKF A;  5JR3 A;  4H0E A;  2CF4 A;  1TWA J;  4DOZ A;  2Z33 A;  4A3G J;  1SC7 A;  2VPL A;  2XT4 A;  3QFT A;  4NDL A;  4RLQ A;  3HHH A;  5HKK A;  1C0W A;  2EIJ H;  5J47 A;  1S8N A;  5GTH C;  3RZO J;  1ZEL A;  4BJ5 C;  2CSO A;  2FXA A;  2XIG A;  1VHO A;  1PLU A;  1OGI A;  5E1X A;  5JVT A;  3HPH A;  3FXL A;  4A3K J;  3QU6 A;  4X6A J;  3PJR A;  2WA0 A;  1YLO A;  4HAM A;  1EH8 A;  3ZOB A;  1SD7 A;  5L3B A;  4PC3 A;  1TYW A;  1HF0 A;  2PMU A;  4AID A;  1YIJ B;  3E5U A;  2R7O A;  3K9T A;  2F43 A;  3BCF A;  2GWR A;  1QPI A;  4IJA A;  3M1E A;  4YXW A;  1AKH A;  3KP6 A;  1K78 A;  4OJO A;  3L7W A;  5AIQ A;  1ETX A;  3LA2 A;  1B59 A;  3CQZ J;  3EPZ A;  3VOE A;  4A3B J;  1J7K A;  3BQZ A;  1D0Y A;  4G7O F;  1SAX A;  5F1J A;  3SYJ A;  3IHU A;  2X0L A;  3COA C;  3GTK J;  4BL0 B;  2DK5 A;  2FUG 2;  1MKM A;  2LKS A;  1S7O A;  2QM3 A;  2VBZ A;  3BZK A;  1R1V A;  4YFO A;  2A61 A;  2P5V A;  4RAZ A;  4ZV4 A;  2W85 A;  4B1R A;  3WTU C;  1O3Q A;  5L3D A;  4CXF A;  1QFJ A;  1TYX A;  4YG2 F;  3CD6 I;  1G8X A;  4M73 A;  1R5G A;  3HUG B;  3HGY A;  4HST A;  1WTH D;  3HDD A;  4E7L A;  4AVP A;  1O8K A;  1ETK A;  5J40 A;  1HLV A;  1REP C;  3DFG A;  1BOB A;  2DA6 A;  1HST A;  3BJ6 A;  3I55 B;  3DPL C;  3D5L A;  4M6Y A;  4XSX F;  3CCE B;  1XQB A;  4PFP A;  4N4O B;  2BBY A;  2XZL A;  2L4M A;  3WWG A;  3REO A;  1KU7 A;  3OSG A;  2DBB A;  2R9V A;  3ASR A;  4OZY A;  3P27 A;  1OYY A;  4FCY A;  2JSC A;  5FIU A;  5EF6 A;  4FIS A;  5LHI A;  4UUV A;  2X1D A;  2P8T A;  2Y2Z A;  1ZGA A;  4O6J A;  5EZH A;  1Y56 A;  2LKX A;  2O3F A;  1Y0U A;  4C2M J;  3K69 A;  4IQ4 A;  5E20 A;  1ZGJ A;  2R7R A;  1ZUN B;  5J8C A;  2R7W A;  5EG0 A;  4OMY A;  5JI6 A;  4XKB A;  5E3M A;  3S3M A;  4RD6 A;  1JRG A;  3K4M A;  3CCQ I;  3W6V A;  2P4W A;  3SEZ A;  5F4J A;  2VJJ A;  4D5C A;  3OEE A;  2IW5 A;  3BQY A;  1D0Z A;  2FX0 A;  1OCR H;  1Q82 D;  3I64 A;  5D5W B;  3DU6 A;  1YFH A;  1MNE A;  3VFZ A;  2KLO A;  2DT7 B;  3WNC A;  3KP7 A;  1S3J A;  4C3H J;  1MMD A;  3P9C A;  5H2F C;  1H88 C;  3B02 A;  1G3W A;  1YJ9 B;  1YW7 A;  1VQL B;  2NT6 A;  4MR0 A;  2W7N A;  1PYV A;  1WOR A;  4W8T A;  2BHY A;  9ANT A;  1QGA A;  3U2Q A;  2XEX A;  3G6E B;  1GVH A;  5HZB A;  2HI3 A;  5F08 A;  1VQK B;  1X0C A;  2ZBV A;  4M2L A;  5ICC A;  1TUI A;  3HEF A;  1YRN B;  1F5T A;  2O0Y A;  1HDP A;  2YUH A;  5BMZ A;  4RM0 A;  2ZBU A;  2K27 A;  4AD9 A;  1OHH A;  4JRA C;  1OCT C;  1CNF A;  2NVX J;  1RET A;  3EQL F;  2OPT A;  3OYC A;  1K4S A;  2JJ2 A;  1Z21 A;  3VSK A;  2OK7 A;  3IKV A;  1I1S A;  2DK8 A;  3D5R C;  4A3I J;  2DTR A;  2E60 A;  4XL9 A;  2DEU A;  1B8I A;  2OYN A;  3MD2 A;  3BH7 B;  3CLQ A;  3CPX A;  1VF9 A;  3GTO J;  5ILV A;  1QJV A;  1XMK A;  2CW8 A;  3Q0U A;  4D0P A;  2Q6L A;  1B9M A;  5TV2 A;  3GME A;  4KIC A;  5HDK A;  1E64 A;  3LSH A;  2XTY A;  4ACB A;  4YDT A;  2ZO4 A;  4G7X A;  3DKW A;  4PJM A;  4R8H A;  1YI2 I;  1AMO A;  3WTY C;  1IJW C;  1LKX A;  4RGX A;  4YII A;  4LB5 A;  1W7P B;  2QKL B;  1HKS A;  2NVQ J;  3K2A A;  3HKZ A;  4E7I A;  3W2A A;  2L9N A;  4DNT B;  3FZV A;  4IPA A;  2LR8 A;  4FT8 A;  3SXY A;  3SKB A;  3S3O A;  2DW4 A;  3HOT A;  1FTT A;  3LSP A;  1HA3 A;  3LNN A;  1D2E A;  4P1V A;  3HZJ A;  4A69 C;  5AIP A;  3S3N A;  2O7O A;  4HLY A;  5ERI A;  1RRJ A;  4WXC A;  1E3H A;  2ID3 A;  3ZN0 A;  4QUZ A;  2IQ7 A;  4NK8 A;  3K7A J;  2RNG A;  2GA1 A;  4P1W A;  2VQL A;  4BUP A;  2ZME C;  2KIS A;  3U1D A;  4A3C J;  1EP3 B;  1QO0 D;  2O5R A;  2X6Y A;  3IH4 A;  2A05 A;  4LGW A;  2MSY A;  4ASN A;  1Q7Y D;  2L7K A;  3RIQ A;  3AGQ A;  2Z5U A;  3ZPN A;  2OZ6 A;  3ABL H;  1V5V A;  1RPW A;  1U6G A;  5D6E A;  4XLN F;  5KHD A;  1ZH5 A;  5D4S A;  3IRQ A;  1KYW A;  1P4X A;  3CCJ I;  2BN4 A;  5TJJ A;  1ZQ3 P;  4RB0 A;  5E6T A;  3F8N A;  5F27 A;  1W1W E;  2DDB A;  4Q4Z F;  3N6Z A;  1OB2 A;  3E1S A;  3RQI A;  3E6M A;  3WGG A;  1N05 A;  2EZI A;  1GV2 A;  4WQM A;  2PFB A;  3LQQ A;  2VBS A;  3JSO A;  2IOU G;  4C2T A;  2BGC A;  1JHH A;  1AA7 A;  5IYQ A;  1IZ1 A;  2LFB A;  2OBT A;  4MO7 A;  1QZY A;  2ZZE A;  4OJL A;  1CF7 B;  3TP0 A;  4B43 A;  2HWV A;  1O3R A;  3GYH X;  5LMZ A;  2Y31 A;  3FPP A;  3IC7 A;  2D3N A;  2L7Z A;  2TRT A;  3CD6 B;  1KQ0 A;  5TIS C;  5HNF A;  4YFK F;  4L9J A;  3W3C A;  3VDX A;  3PIP F;  1Y39 A;  2IGN A;  5IYN A;  1EFT A;  2IS4 A;  2GIZ A;  2LTP A;  2W57 A;  4BDZ A;  1HC8 A;  1KQ8 A;  3L2Q A;  3AL0 B;  1O7F A;  2V9P A;  1MRZ A;  2QUF A;  3PET A;  1S7E A;  2M45 A;  4UAJ A;  1I18 A;  2VFM A;  2DA2 A;  3F3X A;  2R7X A;  4DW6 A;  3J81 K;  1OGJ A;  2RQQ A;  1J0R A;  3CP8 A;  2KJB A;  3RIR A;  1D8T A;  5D5V B;  2WTE A;  2M8G X;  3ZIA A;  4FWT A;  2M30 A;  1WJE A;  1QQI A;  3WU2 C;  3LMW A;  1U2W A;  2RC4 A;  1MD0 A;  3FM3 A;  2HDN B;  4Y9U A;  2VL8 A;  1D5V A;  2X6O A;  5DEQ A;  3BJA A;  5CQE A;  3RQ4 A;  1N78 A;  3BZC A;  5HDG A;  1P9Q C;  1AHD P;  1FZP B;  3HXL A;  1ZG3 A;  4PC1 A;  1D1A A;  2LSO A;  1QVF B;  1GVD A;  1I39 A;  4TMZ A;  2CQQ A;  3RJP A;  4RCZ A;  2P3M A;  1ELO A;  2JJ7 A;  3I53 A;  4PGH A;  4B3X A;  3BTI A;  3JQR A;  3OEH A;  5J3O A;  2Z99 A;  1V55 H;  3DLL F;  2EFQ A;  1R5I D;  1JE8 A;  2CYY A;  3FKS A;  1LLZ A;  1VF7 A;  2BX6 A;  1O3S A;  2DET A;  3TO9 A;  4BU2 A;  3PFY A;  3BH6 B;  3EYI A;  1WVR A;  3C2H A;  2XC7 A;  2W00 A;  3B6C A;  3U21 A;  4CHU A;  3A01 A;  3ZQI A;  2FRH A;  3CC2 I;  3E1Y E;  1VI0 A;  1K7A A;  1MSE C;  2HQR A;  4M4S A;  2XT2 A;  3ZPP A;  3H3V K;  1HF2 A;  3F8F A;  2A5W A;  3G4S I;  4XOR A;  2A6E F;  3CCY A;  5FD6 A;  1ENH A;  1Q86 D;  2ECC A;  4U7D A;  3GTM J;  4M3B A;  1YX2 A;  4P9S A;  2D2W A;  2FF4 A;  2KHM A;  2PJR A;  5HDN A;  5J35 A;  2DA1 A;  1ODD A;  4ZCM A;  4XKW A;  3HOU J;  1PJR A;  1IN5 A;  3FXJ A;  1ZTR A;  2EZH A;  4M9Z A;  3MHP A;  4KT5 C;  4TKO B;  2IJL A;  3BTJ A;  4HF0 A;  2VBM A;  1OJL A;  3ABU A;  2L9S A;  4W8Q A;  5GPC A;  2EK5 A;  2V7X A;  1IDK A;  3MN2 A;  4YIF A;  1UAA A;  2OTL B;  1B4A A;  3NQO A;  3W2V A;  4D5F A;  4WWC A;  3P9I A;  1F4K A;  4PAB A;  1YI2 B;  2LNB A;  1UHW A;  5J3L A;  3TGN A;  3QP5 A;  1BC8 C;  4BH9 A;  1IHM A;  1TTT A;  1MMS A;  1UD6 A;  3J81 k;  2KIF A;  1L0O C;  2VNI A;  3VYR B;  3KYD B;  1MBF A;  5LD2 C;  1SVM A;  4A3E J;  3DTK A;  4UZE A;  1VFC A;  1EE6 A;  2E1O A;  1FNN A;  3ZPL A;  2C5B A;  2XNJ A;  3BY2 A;  3JRA A;  2AQF A;  2QEX I;  1X1B A;  4NB5 A;  2ZB9 A;  2DOG A;  1DGR M;  1MBH A;  4IXA A;  4NHJ A;  2I8D A;  3VSU A;  5ILS A;  4Y9R A;  1N8R D;  4WZE A;  4NC6 A;  4EVI A;  1V4R A;  4FXU A;  2BHZ A;  1ONV A;  4AIK A;  4OM9 A;  3RI4 A;  2KZV A;  1UB9 A;  2L01 A;  2QZ8 A;  4A0Y A;  2QWW A;  3ZBU A;  4LIV A;  3N90 A;  2B5O A;  1J2X A;  4G7W A;  1K6O A;  1LE8 B;  1PE9 A;  3RPU A;  3NAW A;  4IRG A;  3CCR I;  4FX0 A;  2L4A A;  5EEH A;  2X53 S;  4XRF A;  1S4M A;  2E1R A;  3A1P A;  5IYD J;  4X05 A;  3EUK L;  2KQR A;  2XRN A;  3L2U A;  1SD4 A;  4MGR A;  1IN4 A;  2IS2 A;  4XK4 A;  4QFM A;  1QA6 A;  1RKT A;  2V7F A;  3PUF A;  4XRS A;  2NTP A;  2ACJ A;  1JA0 A;  2XPU A;  4NC7 A;  5K7Z A;  3GQ9 A;  3F9K A;  1KK0 A;  2IA1 A;  5IYR A;  2VC0 A;  1P4W A;  1NRK A;  2DT6 A;  4BPR A;  4W97 A;  1Z67 A;  3IV5 A;  3JU4 A;  2Y0S N;  4N9I A;  1J59 A;  4IOA F;  5M5X J;  2IVM A;  4ZDO A;  5EMN A;  4XLA A;  2J8I A;  2XB0 X;  2QQA A;  3A8K A;  2R5Y A;  2DCU A;  4AC0 A;  3I56 I;  2K5C A;  1VZ0 A;  1IJF A;  2M5W A;  2VJ4 A;  3FXM A;  1HOM A;  1FYL A;  3VEP A;  3K70 C;  1T08 B;  2ZZG A;  3FPK A;  1Z3X A;  3BNW A;  3OY9 A;  3QFS A;  5ICE A;  2V31 A;  1YX5 A;  2CO5 A;  5JMC B;  5DCM A;  1KRH A;  2M3A A;  4N0B A;  1NK3 P;  1VQO B;  1T5E A;  4X0C A;  4BEH A;  4TMW A;  4AWX B;  2HYG D;  2B9S A;  1RUN A;  1VJS A;  1OFL A;  4LMY A;  1A04 A;  3OJW A;  1PVE A;  4Q5S F;  2Z8G A;  4BXU A;  2E36 A;  3MWM A;  3DTE A;  1VHE A;  4ZDL A;  4I09 A;  3ZMZ A;  5E8I A;  1WFX A;  3WE2 A;  1T38 A;  5J8F A;  4E0F A;  2QQ9 A;  1IW7 F;  4OPW A;  3SUC A;  3QE2 A;  4ESJ A;  2MBF A;  4QPQ A;  4CQJ A;  4G12 A;  5FFZ A;  2B7B A;  1LFB A;  1J75 A;  2E2J J;  1T6Y A;  1D5Y A;  1P4M A;  5J1R A;  3MMP A;  3V8L A;  2WAQ N;  2QTZ A;  4NNJ A;  1WQ2 A;  3B73 A;  1JI8 A;  4B8X A;  1VQM I;  3WY9 A;  4JX6 A;  4PGO A;  2PYG A;  3CCM I;  4P25 A;  2LDU A;  2VBT A;  4HYE A;  4DZJ A;  3OMY A;  5HOD A;  2H27 A;  3CJN A;  1AIP A;  2WAF A;  4BBS J;  2JJ1 A;  3LQ6 A;  2CRV A;  4YFX F;  4HX4 A;  4KIT B;  4TV7 A;  4EJT A;  3CDL A;  4P55 A;  1MBK A;  4WK8 F;  4ZYG A;  1I6H J;  4BY1 J;  2QA4 I;  4AC9 A;  1Z7L A;  3DLA A;  1LVA A;  1ORK A;  1GHC A;  5DDG A;  4BY7 J;  2FJ1 A;  2XAF A;  3HOZ J;  2BE5 F;  1JUP A;  1GXP A;  1VBL A;  3V8K A;  2EV0 A;  2E1M C;  4C3I J;  1ZR2 A;  2HYF A;  3KX2 A;  3P4G A;  3GX4 X;  1G7R A;  3LOC A;  1XGO A;  3EUH C;  3O3K A;  2C78 A;  3W5V A;  3SFI A;  1VQ4 B;  4OIQ F;  4OU0 A;  3CC2 B;  1FTZ A;  1ZM4 A;  1I3Q J;  2CG4 A;  3ZQC A;  2QLZ A;  1AKH B;  3F22 A;  1K78 B;  1GDT A;  4RA2 A;  2PMZ N;  2BM1 A;  4Z4T A;  1B1B A;  4U0V A;  5JHF A;  4E7H A;  2VYQ A;  4DNC A;  5C3E J;  3OOU A;  3CJQ B;  5DD8 A;  2HVQ A;  1K61 A;  3AVW A;  3VOD A;  2DPU A;  4PDK A;  1H80 A;  5EGO B;  1QUE A;  5IOZ A;  1JKQ C;  3OYL A;  1IXS B;  2PEC A;  4QPO A;  4PJL A;  1YIT I;  2QX3 A;  5GV8 A;  4QLC U;  5K7H A;  2MGQ A;  1R9T J;  1S72 I;  3KP4 A;  1JA1 A;  1RU4 A;  3JTH A;  4OPV A;  4QSH A;  1QX4 A;  3FXK A;  2XKO A;  1H42 A;  1AIR A;  4RD1 A;  1FOY A;  2HFH A;  2Y48 A;  4X8I A;  4AUX A;  5EJC A;  4Y7C A;  2E7W A;  3HHG A;  4FQG A;  3K4N A;  3JRF A;  2QEX B;  4ZGN B;  1S29 A;  5THX A;  1TLH B;  4A5M A;  5M5Y J;  2ECB A;  1ZM3 A;  3CCS B;  1W5T A;  4LB6 B;  2AO9 A;  2DI3 A;  3CDI A;  5CVR A;  1H9T A;  1BX0 A;  2XZP A;  3JQP A;  1GQ8 A;  5BOX A;  5IY5 H;  4B47 A;  2R6H A;  5DS0 A;  5LBQ A;  3I58 A;  4YZA A;  3ASP A;  1KA8 A;  1W87 A;  1XD7 A;  4GRI A;  2WB1 A;  4AM3 A;  3A1Y A;  1NHA A;  5D4R A;  2BSA A;  5ICF A;  1DPR A;  2JZY A;  2C2W A;  1WJC A;  2QZA A;  5EG0 B;  3OZW A;  2DJN A;  4ZDP A;  1ERD A;  2V4J C;  1FND A;  1IGN A;  3LAP A;  2V7U A;  2BV6 A;  4HF1 A;  3GLL A;  1M1E B;  2P7V B;  1A31 A;  1KD1 D;  1A5J A;  2EH3 A;  4EGZ A;  2ME0 A;  1Y1V J;  2X1C A;  4II3 A;  1SAN A;  5BNG A;  5ILU A;  1MBG A;  2EZK A;  1H8H A;  1T2K A;  4X1E A;  4A0X A;  3CME I;  1JHF A;  2NVY J;  2F5C A;  3LSR A;  5FKO A;  3OYF A;  3JRG A;  1Z77 A;  2WC2 A;  2STT A;  2C77 A;  3I59 A;  4YEJ A;  1VQ5 B;  3H9Q A;  1B72 A;  2CWE A;  3HJE A;  4BXF A;  1YX3 A;  4PCQ A;  2F5D A;  4RB2 C;  4PFO A;  2DU9 A;  4XOP A;  1OFE A;  5FNZ A;  4A6E A;  2FBI A;  4J0Q A;  1S0U A;  4RM2 A;  3GF2 A;  1UJ8 A;  3R0A A;  4X7E A;  1IRX A;  4L5E A;  5J4V A;  3ZMS A;  4JX4 A;  2UVF A;  3H9N A;  3L2W A;  2QE7 A;  2HS5 A;  2LF8 A;  3FXQ A;  1Z91 A;  2QSH X;  1XMX A;  3LSK A;  2MFZ A;  1TQI A;  2ELH A;  3GLX A;  3JRI A;  2OQG A;  1KYZ A;  1MAB A;  3OW7 A;  4Z4U A;  3ZQQ A;  1QQ1 A;  4M6V A;  2ZME A;  4XLF A;  4XMY A;  1NTC A;  1IDY A;  2JUC A;  3CCE I;  5TRD A;  3RKW A;  2COM A;  2GIV A;  2ETH A;  1B8I B;  1PJ5 A;  3Q39 A;  2ZFW A;  4A93 J;  4FX4 A;  2O17 A;  1U9O A;  4LK0 F;  5C44 J;  2NNN A;  2NOJ B;  5B1A H;  4C2L A;  2X1E A;  3RKX A;  3OFN A;  1J9I A;  4CDG A;  2YSR A;  1VQP I;  3C2B A;  1QH0 A;  1TWH J;  2H94 A;  1W36 D;  3DU1 X;  2BOL A;  3OWT A;  4DYC A;  1EJ9 A;  2B0R A;  3QPH A;  1N08 A;  4TMX A;  1T33 A;  2JA7 J;  4RB1 A;  2Z6B D;  5A2Q Z;  3CES A;  1IV8 A;  2K7L A;  1FSE A;  2V6E A;  2V1D A;  4B4D A;  2I5U A;  2BF4 A;  1S6L A;  1X4O A;  3IKT A;  5LGN A;  3GTL J;  1VQM B;  4XID A;  1SD5 A;  1JTY A;  2FEZ A;  4F91 B;  4JX5 A;  2ZJR F;  1BW5 A;  3SJP A;  2E34 A;  2ZXJ A;  5BS6 A;  1BI0 A;  2R92 J;  2HLD A;  3CCM B;  4PUS A;  4HDV A;  4ESF A;  2DMN A;  1MZB A;  3TO7 A;  5EYR A;  5FO5 A;  2CUJ A;  4LK1 F;  2QTL A;  3VR6 A;  2PEX A;  3A3G A;  3CUQ C;  3SZG A;  4C43 A;  2OF7 A;  1WSV A;  5FO0 A;  2F4I A;  3PL8 A;  1VQL I;  3SDG A;  2QA4 B;  1QCX A;  3OV8 A;  4L9T A;  1U78 A;  3DF8 A;  5DYM A;  1QRY A;  1IRG A;  3S2W A;  1SM4 A;  2WJY A;  3HSE A;  4N3N A;  1N0V C;  2HDW A;  3OS1 A;  2DA3 A;  3G6E I;  3DBR B;  5GAE J;  1EP1 B;  1VQK I;  2RGV A;  2V79 A;  1H89 C;  4NCN A;  2R7U A;  1KQ9 A;  3E5Q A;  3J7Z I;  2P6S A;  2XGE A;  4BXX J;  3QP6 A;  2ZNZ A;  4HLX A;  3CMM A;  4KIB A;  5KCM A;  3SYT A;  1SEU A;  3WTX C;  4I0A A;  3CJR B;  3S1M J;  3VST A;  4E70 A;  2YWG A;  2FQ4 A;  2BXY A;  5A89 A;  5DNS A;  4JP0 A;  2VPR A;  4U88 A;  2OU2 A;  2V7V A;  1PUF A;  2Z9O A;  1W9X A;  1I8D A;  3B90 A;  3WQZ A;  2KDO A;  1OLT A;  1QG0 A;  4RGS A;  3G1M A;  2AXT C;  3MKY B;  3GWZ A;  1O88 A;  3HGG A;  1KMH A;  2BM7 A;  1DBG A;  1FNB A;  3KEW A;  1NG7 A;  2VQC A;  5D5X B;  1TTY A;  4YZQ A;  3DV8 A;  4U87 A;  5CPR B;  2XAH A;  2HOT A;  1S72 B;  1WDT A;  3KP5 A;  1HKQ A;  4CIC A;  4M53 A;  1IN7 A;  1R00 A;  2E1N A;  1RIO H;  2NRA C;  3LQR A;  2XGD A;  3R6S A;  1KK1 A;  3AG2 H;  1EA3 A;  4XN3 A;  3JR9 A;  4G5G A;  5K5O A;  5B3S H;  4YAL A;  3GFI A;  3FX3 A;  3B4N A;  1FPQ A;  2YU9 J;  2XSD C;  1UD2 A;  1MGT A;  1JB9 A;  2H6B A;  1OCO H;  3S17 J;  5JBQ A;  2OC6 A;  2LMD A;  1DPU A;  1W5S A;  4UZF A;  1QVG B;  2IT0 A;  1LPQ A;  1TT0 A;  2VKH A;  1WOP A;  1T98 A;  3ZMU A;  1NH3 A;  1R4N B;  1BW6 A;  4LG0 A;  3OZU A;  5F6F A;  3FF5 A;  3K6G A;  1G3T A;  2NNY A;  4A6D A;  1UG2 A;  4HF2 A;  3E3V A;  2ZXI A;  4MEX F;  4JOM A;  4BS9 A;  3HOV J;  2V7T A;  3LSG A;  1F9N A;  1GLN A;  2QMU A;  1BN5 A;  3ZXS A;  1RWR A;  2NTQ A;  3L1P A;  3F0C A;  5L3C A;  3CME B;  2EV6 A;  3A3B A;  3JX8 A;  3LNQ A;  2A68 F;  1HSJ A;  2HZT A;  4HG2 A;  1VLO A;  4X7C A;  4M3E A;  3SLN A;  2NT9 A;  1WPC A;  1NHC A;  1MNM C;  1U5T C;  3K1P A;  4I6Z A;  2XF7 A;  2R3S A;  5E8G A;  1U8B A;  2M0M A;  4QTR A;  4KMF A;  5BSY A;  3KLN A;  5F0F A;  3ABK H;  3G71 B;  1WH5 A;  2MYS A;  4HA8 A;  1W7P D;  5GTI C;  2NS0 A;  1Y1W J;  2IGO A;  3HRU A;  2CV2 A;  4L0Z B;  4CSW A;  3I4P A;  2M7A A;  1KK3 A;  2CQ7 A;  4ZYA A;  1FP2 A;  2X8K A;  3EQO A;  3PA2 A;  1QA3 A;  2UXN A;  3AFH A;  3KYL A;  2LYC A;  4WF2 A;  1BC7 C;  3IWF A;  4CO8 A;  2JMW A;  2JQ7 A;  1D8J A;  4Z4Z A;  1W0T A;  1LEA A;  4ROX A;  1Z6T A;  3ZRG A;  2NS8 A;  3OL3 A;  2L7M P;  3MEX A;  1R49 A;  1MMA A;  1D0X A;  2YR2 A;  1YOV B;  2HDD A;  3Q6Q A;  1XTA A;  2OCE A;  5FLM J;  2XHK A;  3OE7 A;  3M8F A;  3E6B A;  3S93 A;  1LVK A;  1R23 A;  4II2 A;  2PJR B;  3JTG A;  1RQR A;  4N4N B;  2KP6 A;  2V26 A;  3VMW A;  2DIE A;  1SFE A;  2DMQ A;  1F43 A;  4ENJ A;  1VQP B;  2CGP A;  1X3W B;  3I1F A;  1ZYR F;  4I01 A;  2DTZ A;  4MYT A;  4XLH A;  5E3L A;  4AIJ A;  2GQQ A;  1ZLK A;  2QF7 A;  1USS A;  2Q0O A;  2XUB A;  3DBL B;  4OMZ A;  4ZYE A;  1OPC A;  4AIH A;  2IS6 A;  3H36 A;  2QKM B;  1T56 A;  4TT3 A;  4FTH A;  3ABT A;  1LDD A;  2IA2 A;  3CO7 C;  2DMU A;  1DGW Y;  3DWL E;  1E79 A;  1P2F A;  2OA4 A;  2GXG A;  4D7M A;  4YFN F;  4H4K C;  4FE7 A;  3JCU C;  2Q6I A;  1FJL A;  4KJZ A;  5E1Z B;  4G8X A;  3FKJ A;  1JTX A;  1F60 A;  1JT6 A;  3PO2 J;  4HV6 A;  2OK8 A;  4KN4 X;  2NYX A;  3FIW A;  2YPR A;  3GW2 A;  2NVT J;  3OOC A;  3NEU A;  3KCC A;  3LFU A;  4ZZD A;  1TWC J;  4DQ2 A;  2DFE A;  3HSF A;  3MQ0 A;  5K7F A;  4CH7 A;  3GSI A;  4HNT A;  3A8J A;  3IH2 A;  2PG4 A;  2K40 A;  3ERE D;  1XGS A;  1ZKG A;  4C2U A;  3BPX A;  4RAG A;  2CS3 A;  2KT0 A;  3DKY A;  1RUO A;  4IRH A;  3PSI A;  1N07 A;  1XC5 A;  4P9F A;  4ZTJ A;  1K5C A;  4CUG A;  4P96 A;  2O6W A;  2BY0 A;  3HKZ N;  2ZSH B;  4PGG A;  1YIO A;  1PDN C;  4Z03 A;  3HIF A;  3NWT A;  1OMI A;  5D8K B;  2NST A;  1STZ A;  3ASN H;  2AHO A;  4E7K A;  1XPX A;  3QFR A;  2R5Y B;  1LDK B;  3CDH A;  2L0K A;  5B6I A;  1FC3 A;  2CFO A;  2RV8 A;  3E6C C;  2K4B A;  1MBJ A;  1FX7 A;  2OTL I;  3IL2 A;  2M5S A;  4KYW A;  4BE2 A;  5DCM B;  1MMG A;  4Y7N J;  2LBF A;  2DFH A;  5CQG A;  1VTN C;  2HEO A;  4BEH B;  3CPW B;  3NB2 A;  2QYU A;  3A0B C;  2V6C A;  3F8B A;  2ADU A;  4E7Z A;  2V1X A;  4FHT A;  4MHG A;  3PUN A;  1HW5 A;  1WJB A;  4A3D J;  4WZK A;  4IHS A;  1E2X A;  3A35 A;  2CQN A;  2QSG X;  1Z6R A;  3DTI A;  1QRB A;  2PIA A;  3AG4 H;  3LWF A;  2VFQ A;  2BGI A;  3CF5 F;  3A8I A;  2QGU A;  4L5J A;  4LLG F;  2O1D A;  3EUH A;  5LEJ A;  3T51 B;  3JAM K;  1LB2 A;  4EMS A;  2QCO A;  1HZE A;  2NXN B;  3V7R A;  5IOY A;  4H9G A;  2F4O B;  1NG6 A;  2XGC A;  1DU6 A;  3IAM 2;  1X1A A;  1JGG A;  2JN6 A;  3E0J B;  3KPH A;  2MG4 A;  3CUO A;  3RYP A;  3TDZ C;  3ZQH A;  3LSJ A;  1W5C C;  2FOW A;  4YRV A;  3G73 A;  3ONY A;  4QHY A;  2XVC A;  4GGG A;  1J9Z A;  2KVO A;  1CQX A;  1I3A A;  3LVB A;  1R5B A;  3Q9S A;  2X0K A;  4CCN A;  3FXU A;  2F2E A;  3RPQ A;  1P92 A;  2XPV A;  1EV7 A;  4S05 A;  1FDR A;  2YWF A;  4F93 B;  1W0J A;  4V2F A;  2HVR A;  3ML6 A;  2EWE A;  1ETV A;  4AYB A;  3BJO A;  2O6G E;  3OOP A;  4OOI A;  2D1V A;  3ZN1 A;  2KDZ A;  4KKT A;  4F7D A;  4ANJ A;  3EQN A;  1ZAO A;  1G4D A;  3WTV C;  5EEG A;  2N8G A;  2EFW A;  2NS7 A;  1HG8 A;  2VT2 A;  1O8H A;  2RC5 A;  4Z2Y A;  3PQJ A;  1B23 P;  3LA3 A;  3VSV A;  2ZZQ A;  1D3Y A;  1FIP A;  3MAJ A;  2VBK A;  1VQO I;  4OOV A;  1F1Z A;  3AVY A;  1ZLJ A;  2GA2 A;  3ISP A;  1FOK A;  2RAE A;  3F8C A;  4GYI A;  4CGZ A;  2AHQ A;  3EDP A;  4DZP A;  3GEZ A;  4BJT A;  3RZD J;  2CV0 A;  1K6Y A;  2KZG A;  3S1R J;  1H0M A;  4BJ6 C;  4Z1M A;  5CVJ A;  2LK2 A;  5KW9 A;  3ZMD A;  3S2H J;  4CA0 A;  4OIP F;  1CNE A;  4EM1 A;  3PUM A;  4JMQ A;  5FL7 A;  2JA8 J;  1LFU P;  4P6Y A;  1UD8 A;  2QVO A;  2FSW A;  1SD6 A;  3DXJ F;  1GT0 C;  3JSP A;  3RKY A;  2W6J A;  3SZP A;  4DNR B;  1UEL B;  4TMT A;  2JUG A;  2BVL A;  2CH0 A;  2CQK A;  1YTY A;  1OOC A;  3B82 A;  1SVO A;  3VB2 A;  2LRD A;  1O4X A;  5LGU A;  4XNF A;  4C0S A;  2KIM A;  4M9S A;  4UVB A;  2H1K A;  3OAA A;  2WV0 A;  3Q0W A;  3G2B A;  2QBY A;  1IDZ A;  3VMF A;  1ETY A;  3ZGK A;  2LD5 A;  5TY0 A;  5FKN A;  1Y0Y A;  1DAB A;  3BY1 A;  4HNV A;  2DFI A;  3RTR A;  3BR3 A;  5K1Y A;  3SJM A;  1K4T A;  2JPC A;  3NWS A;  3Q9V A;  4PMH A;  1ETW A;  3BG5 A;  5GPA A;  1QBJ A;  5IYW A;  1O8G A;  1T95 A;  1HCR A;  2K9Q A;  2I1L A;  4HZF A;  4F55 A;  2W4S A;  1V54 H;  2XAS A;  1JNY A;  3VMV A;  2W1O A;  3QOP A;  1G3Y A;  2KRF A;  3WXM A;  4IHW A;  2D5V A;  3JAM Z;  5FGM A;  1Q1V A;  2OAZ A;  4V2G A;  1YYV A;  3FHN A;  1ZR4 A;  2M2E A;  3WG7 H;  1IB4 A;  2DYR H;  3CCU I;  1RR7 A;  4CCK A;  4F92 B;  4YAU A;  1SMT A;  2IGK A;  2NOG A;  1GJR A;  3BR1 A;  3S16 J;  2VFN A;  1K79 A;  1QGP A;  3M7G A;  1NK2 P;  1VQ4 I;  1EWY A;  1FBQ A;  2EIL H;  2R7S A;  4YEL A;  2JPB A;  3GTP J;  2XDV A;  1FRQ A;  3E5X A;  3GO5 A;  3I59 B;  3MFK A;  2JN9 A;  2OCC H;  3E20 A;  1B72 B;  3TP3 A;  1HXD A;  1JT0 A;  4LD5 A;  1K4Z A;  2I10 A;  3UR3 C;  1EH6 A;  2W82 A;  4KUM A;  1O8L A;  3T53 B;  2LLK A;  2ODL A;  2PX9 A;  2VJ5 A;  3K4B A;  2R7V A;  3KZI C;  4B3F X;  2FNP A;  1DBO A;  1TBX A;  4L9V A;  5CVV A;  1B9N A;  2RNJ A;  3QPL A;  1UG0 A;  1APL C;  2QSF X;  3GZ6 A;  4C3J J;  5D6F A;  1CZF A;  3W2G A;  2VT3 A;  2GJR A;  2VQG A;  4HWV A;  2OV7 A;  2P5K A;  4OJ6 A;  4L8J A;  1SKY B;  3HRS A;  5KAI C;  4QVJ A;  1UCR A;  2MH2 A;  3DCF A;  5DCF A;  2CW5 A;  2EPF A;  3CUQ A;  2ZTG A;  2ZIT A;  2MW8 A;  2XV4 S;  2ZME B;  2F5V A;  4UB6 C;  3U9G A;  1QFY A;  4RJL A;  2GK7 A;  2J8K A;  3T0Y A;  4OIN F;  3RKQ A;  3H35 A;  4MYU A;  1FBS A;  3SDB A;  3CCS I;  4YAO A;  2VE9 A;  2GBY A;  5JHU A;  1KU2 A;  3CXC B;  1DDN A;  2XF5 A;  2O03 A;  3I3L A;  1E0E A;  2ZC2 A;  2PJP A;  4ZZL A;  3AVT A;  2X85 A;  4DQL A;  1VQ9 B;  2L5Q A;  1OCZ H;  4XM3 A;  3ULQ B;  1XS9 A;  3HRM A;  5EDN A;  3UW0 A;  4PC2 A;  2HQ5 A;  3WU0 A;  2O8K A;  4BBR J;  1I5Z A;  1TT5 B;  1SAU A;  1XMA A;  4MQ9 F;  4BQQ A;  4IHT A;  4Q7J B;  4PJ0 C;  2DT5 A;  4GXO A;  4R79 A;  1R7J A;  5F4O A;  1FY7 A;  3V7S A;  1I7P A;  3W5H A;  5DTD A;  2P0W A;  2DOF A;  1VQ5 I;  4R1H A;  1IJE A;  2Q1Z B;  1TYU A;  1KQS B; 
#chains in the Genus database with same CATH homology
 2DOA A;  4YEJ A;  4BAC A;  3H9Q A;  2F43 A;  2R7O A;  4BXF A;  3BCF A;  1YX3 A;  4XLC A;  4C9Y A;  3VWB A;  4OJO A;  4PFO A;  4YXW A;  4U4B A;  1VLY A;  3EPZ A;  4DBR A;  4XOP A;  1D0Y A;  3S32 A;  4RM2 A;  5AMV A;  5LFA A;  1KCD A;  2XOK A;  1IRX A;  3GQ7 A;  4BL0 B;  2UVF A;  2FUG 2;  3L2W A;  2QE7 A;  2HU9 A;  3OL4 A;  3TBI A;  4IZZ A;  1OR7 C;  3LSK A;  4KKS A;  2MFZ A;  3VYT B;  4OJP A;  3KEY A;  1X4P A;  3OS2 A;  1MAB A;  3OW7 A;  1G8X A;  4LIT A;  1WTH D;  3HUG B;  4HST A;  2D3L A;  2QY1 A;  3KRG A;  5FRO A;  3ZQQ A;  4E7L A;  4XLF A;  4W8S A;  4XMY A;  3HPG A;  3DEE A;  1BOB A;  2KRC A;  3HG9 A;  5CKT A;  3UNG C;  3DPL C;  3D5L A;  3M8J A;  3T56 B;  1WJ5 A;  2VB6 A;  2O17 A;  4OAY A;  2NOJ B;  4PFP A;  4N4O B;  2XZL A;  4C2L A;  4E4H A;  3WWG A;  2X1E A;  3OFN A;  2MAB A;  2R9V A;  4OZY A;  1W36 D;  3JUR A;  2BOL A;  3OWT A;  1X1D A;  2R7Q A;  2X1D A;  2Z6B D;  3CES A;  1Y56 A;  2V6E A;  1RMG A;  4IQ4 A;  2CK3 A;  1X4O A;  2R7R A;  2ZXH A;  4F91 B;  3GVJ A;  2R7W A;  2CMP A;  4XKB A;  1X1C A;  3S3M A;  2HLD A;  2GJK A;  3K4M A;  4PUS A;  1JRG A;  2INU A;  3SEZ A;  2VJJ A;  3OEE A;  4BQO A;  1D0Z A;  2WY8 Q;  2JDI A;  3BG6 A;  4Y4R A;  3H0D A;  4YZX A;  2CUJ A;  3VR6 A;  4P5O A;  3DU6 A;  4FAS D;  3A3G A;  3SZG A;  4ZTF A;  1O8J A;  1MNE A;  1V5F A;  2ZZF A;  2KLO A;  2DT7 B;  2F4I A;  3PL8 A;  2UWM A;  3ZCO A;  3K4J A;  1QCX A;  3PNV A;  1MMD A;  3GVL A;  3H94 A;  4XR6 A;  1E3Z A;  1D1C A;  4MR0 A;  4C30 A;  2WJY A;  2NT6 A;  3A2K A;  2W7N A;  4EW9 A;  2HDW A;  3OS1 A;  5HOO A;  4X0G A;  1PYV A;  2WPD A;  2DCE A;  3IAS 2;  3ONQ A;  3L2V A;  4W8T A;  1QHG A;  2HPM A;  2R7U A;  2DXI A;  1X0C A;  3CMM A;  5KCM A;  3SYT A;  3TMO A;  3H9J A;  3CJR B;  3VST A;  3H5N A;  2O0W A;  4NUB A;  4MLO A;  1OHH A;  1W9X A;  3OR2 C;  1I8D A;  3B90 A;  3WQZ A;  2KDO A;  2K9L A;  1KCC A;  2LRE A;  1OLT A;  3OYC A;  2JJ2 A;  3MKY B;  1Z21 A;  3VSK A;  1O88 A;  1KMH A;  1DBG A;  4UZU A;  3KEW A;  1NG7 A;  2VQC A;  3D5R C;  4AU7 A;  2E60 A;  3W2W A;  4XL9 A;  4U87 A;  4YZQ A;  5CPR B;  3MD2 A;  1WJF A;  4ASU A;  1QJV A;  4OZZ A;  2CW8 A;  4E6K G;  4CCJ A;  4KIS A;  3LSH A;  4OWR B;  1EA3 A;  4XN3 A;  4G7X A;  1WMR A;  4PJM A;  5TGT A;  4AVZ A;  2XF6 A;  3B4N A;  1LKX A;  2QKL B;  3GBG A;  4ITV A;  3HKZ A;  3VYU B;  4E7I A;  2L9N A;  3W2A A;  1UD2 A;  1S9H A;  4DNT B;  4HSR A;  3S3O A;  2OC6 A;  4XN0 A;  3HOT A;  1TT0 A;  2VKH A;  1UD4 A;  3LNN A;  2PMZ A;  1G59 A;  2R4G A;  4E7S A;  4HEA 2;  2CUZ A;  3S3N A;  3ZR8 X;  2JVG A;  4NK8 A;  2RNG A;  3K4L A;  4P1W A;  2VQL A;  3K6G A;  4BUP A;  3RSN A;  2MD0 A;  2O5R A;  2X6Y A;  2ZXI A;  3OYG A;  4NC8 A;  4JOM A;  2L7K A;  4BS9 A;  2BSP A;  2LY1 A;  3LSG A;  1O8E A;  3ZPN A;  2VIX A;  1GLN A;  5KHD A;  5DN6 A;  1H8E A;  2W6I A;  3ZXS A;  1RWR A;  3A3B A;  4NK6 A;  4URR A;  2XND A;  3K4C A;  1QHH D;  4HG2 A;  2NT9 A;  1WPC A;  3E1S A;  3N05 A;  1NHC A;  1MMN A;  2XF7 A;  2M0M A;  5HNH A;  2WSS A;  1WJA A;  2MYS A;  4IX7 A;  3K10 A;  4DIQ A;  2IGO A;  2CV2 A;  4C2T A;  3DU5 A;  3OYM A;  1KON A;  2UUZ A;  1AA7 A;  3LMM A;  4CSW A;  3OYN A;  2M7A A;  2LG4 A;  4ZYA A;  4HNU A;  1WJD A;  2X8K A;  2VAS A;  3EQO A;  3IUO A;  2ZZE A;  3AFH A;  2L2O A;  3PNY A;  4OJL A;  4B43 A;  2AQE A;  3KYL A;  2LYC A;  3MKZ A;  4YZ0 A;  3QYE A;  1W36 C;  4B44 A;  3ZRG A;  3FPP A;  4G6I A;  1O8K A;  4KT6 A;  2D3N A;  3OL3 A;  4BDY A;  4TSF A;  2NTQ A;  4HRI A;  1MMA A;  1D0X A;  5HNF A;  2HPI A;  3VDX A;  3W3C A;  4Y33 A;  2IGN A;  3QYF A;  3RCO A;  2IS4 A;  3OE7 A;  1PXZ A;  3S93 A;  1T0F C;  4BDZ A;  1LVK A;  4II2 A;  3L2Q A;  2PJR B;  3AL0 B;  5C1E A;  4N4N B;  1N75 A;  2KP6 A;  2V26 A;  3VMW A;  2DIE A;  2F6C A;  1Y6I A;  2VXZ A;  1I18 A;  2NZM A;  2INV A;  1UD5 A;  2IS1 A;  2R7X A;  1TZL A;  2LH9 A;  3D5S C;  2RQQ A;  2Y0S A;  3CP8 A;  4CCO A;  3K70 D;  1R6R A;  3PUB A;  4XLH A;  2VKD A;  1BLI A;  2V4D A;  4PJJ A;  2IS6 A;  3ZIA A;  2QKM B;  4TT3 A;  1WJE A;  3LMW A;  2BW3 B;  1HVX A;  2ZFU A;  3A4C A;  1DGW Y;  3DWL E;  4PK4 A;  2VL8 A;  1E79 A;  4OAZ A;  4H4K C;  2V9K A;  1OGM X;  3OYA A;  5CQE A;  3RQ4 A;  2GK6 A;  4KJZ A;  1N78 A;  3FKJ A;  1P9Q C;  4DGW B;  3HXL A;  4F52 A;  4CZC A;  1V5E A;  1D1A A;  2GOM A;  2WBM A;  3TL4 X;  3PSF A;  3OOC A;  1BN8 A;  2A6T A;  3LFU A;  2Z2S B;  4B3X A;  3OEH A;  2CW7 A;  3MMY B;  3BC9 A;  3HAG A;  3CZ6 A;  4CH7 A;  2M4K A;  4HNT A;  3OR1 C;  4C2U A;  3FKS A;  3S8P A;  1FMV A;  2VXD A;  2CS3 A;  3DKY A;  1COW A;  2WJV A;  2KL4 A;  4BU2 A;  2WAQ A;  3PFY A;  5FRN A;  2Z1D A;  2ZTN A;  3C2H A;  2XC7 A;  4Z06 A;  2W00 A;  3U21 A;  3PSI A;  1E1Q A;  4CCL A;  3OYJ A;  4ZTJ A;  1J09 A;  3GQ8 A;  1K5C A;  4CUG A;  5KNL A;  2HVS A;  3ZPP A;  5IK2 A;  2ZSH B;  2A5W A;  4PJN A;  2E1B A;  4Z03 A;  1IA5 A;  4XOR A;  4XD7 A;  3NWT A;  1N77 A;  2NST A;  4CCM A;  4E7K A;  2WY7 Q;  1O8D A;  4D9J A;  1LDK B;  2KHM A;  2X3H A;  2PJR A;  2CFO A;  4XKW A;  2XGJ A;  1PJR A;  2ELJ A;  2IGM A;  2NSP A;  4NQW B;  4TKO B;  3LSI A;  2M5S A;  4BE2 A;  4BE1 A;  2VBM A;  1MMG A;  2LBF A;  2L9S A;  5CQG A;  4RM3 A;  1IDK A;  4U49 A;  4W8Q A;  4BEH B;  1UAA A;  3W2V A;  2E5N A;  3FY3 A;  4E7Z A;  1UD6 A;  1WJB A;  2HQA A;  3VYR B;  1KTW A;  4JQF A;  5LD2 C;  3DTK A;  3OYE A;  1EE6 A;  2QXZ A;  3MKW B;  2XAU A;  2BW3 A;  3A35 A;  4GQN A;  2AQF A;  2OUM A;  1W0K A;  1X1B A;  3DTI A;  1K28 D;  1DGR M;  3BCB A;  2I8D A;  1BHE A;  3VSU A;  2NTB A;  1NBM A;  2HZD A;  2LY2 A;  3H5R A;  2IXS A;  4DJA A;  2O1D A;  3ZSC A;  4FXU A;  2CV1 A;  3T51 B;  2X51 A;  3DQV C;  2KZV A;  1E3X A;  1HZE A;  3QOD A;  1NG6 A;  3IAM 2;  1X1A A;  2WAE A;  3E0J B;  4LIV A;  4ZJZ A;  1VF7 A;  1O8I A;  4G7W A;  4YRV A;  1PE9 A;  3G05 A;  3T9G A;  5FRM A;  2HNH A;  3DPT A;  2KVO A;  3NE5 B;  4Z05 A;  2VLA A;  2X53 S;  4P22 A;  3OPO A;  1Z3Y A;  4CCN A;  3BG7 A;  2RRE A;  3EUK L;  2KQR A;  3L2U A;  4F93 B;  1W0J A;  2IS2 A;  4LIU A;  2DJI A;  2HVR A;  1DQU A;  2K3P A;  2V7Q A;  2V7F A;  2EWE A;  3FBN B;  4AYB A;  2NTP A;  3GQA A;  4NC7 A;  4XKC A;  3DKX A;  3F9K A;  4KKT A;  3GQ9 A;  4ANJ A;  3EQN A;  3C2G A;  1NRK A;  2DT6 A;  3B8Y A;  4E7J A;  4J00 A;  3JU4 A;  1HG8 A;  1O8H A;  5C1C A;  4XKV A;  3VSV A;  4BGD A;  4ZDO A;  4XLA A;  2R7T A;  1JTA A;  2ZZQ A;  3J7A Y;  4DK0 A;  2JVH A;  3OYI A;  2K5C A;  1VZ0 A;  5CDF A;  2VJ4 A;  1BR2 A;  2X6X A;  2ZZG A;  1YE9 A;  4PSW A;  3K70 C;  2VBK A;  1Z3X A;  4F3Q A;  2WZP P;  2VJI A;  3OY9 A;  3OYF A;  2MC4 A;  2V31 A;  1YX5 A;  4XON A;  2M3A A;  3GVK A;  3QYB A;  4BQN A;  1T5E A;  4BJT A;  4BEH A;  2CV0 A;  1IDJ A;  1K6Y A;  2ZSI B;  4BJ6 C;  4Z1M A;  4HPQ A;  2KMU A;  3VYS B;  1VJS A;  4CA0 A;  2LBF B;  1OFL A;  3HL2 A;  3CF2 A;  4JMQ A;  5FL7 A;  2Z8G A;  1UD8 A;  3AKZ A;  3DTE A;  3I9V 2;  4ZDL A;  1O8F A;  2W6J A;  4DNR B;  1UEL B;  1WFX A;  2JUG A;  4E0F A;  2BVL A;  2CH0 A;  1OOC A;  4Y3O A;  1BR4 A;  3L2R A;  3SUC A;  2LRD A;  4QPQ A;  2VBE A;  2UV1 A;  2JSP A;  4XNF A;  2LC2 A;  1D1B A;  3OAA A;  1XG2 A;  4U7B A;  3G2B A;  2WAD A;  3ZGK A;  2E1M B;  4J01 A;  3DDY A;  1WP6 A;  2F1M A;  1LFP A;  3AL0 C;  4NNJ A;  3RTR A;  4G6T B;  1JI8 A;  3NWS A;  3HC7 A;  3BCA A;  4PMH A;  3SEQ A;  2PYG A;  1QU3 A;  2Z16 A;  1O8G A;  3BCD A;  1T95 A;  3H9G A;  4F55 A;  3OIP A;  2W4S A;  3OMY A;  3VMV A;  2W1O A;  3OYK A;  2WAF A;  2JJ1 A;  4OJ5 A;  3CP2 A;  1V0F A;  4RMN A;  4KIT B;  2UVE A;  1E43 A;  1X19 A;  1Z7L A;  3DLA A;  3FHN A;  3K4K A;  1BPL A;  2O0V A;  1PKV A;  1IB4 A;  2K9M A;  4XQF A;  4I84 A;  4MXN A;  2BVM A;  4CCK A;  4F92 B;  1HA8 A;  2IGK A;  2JA2 A;  2KRH A;  1VBL A;  2GOX B;  2E1M C;  3KX2 A;  1BMF A;  2M4G A;  1FX0 A;  3EUH C;  3V42 A;  2R7S A;  4YEL A;  4XOT A;  5HLT A;  2XDV A;  3OS0 A;  3BH4 A;  3DPU A;  3FBI B;  4KKU A;  4XLE A;  2XZO A;  3HOS A;  3UR3 C;  3OYD A;  2W82 A;  1O8L A;  1BR1 A;  1MW7 A;  1SFK A;  3M1C A;  3T53 B;  2VQH A;  4BE0 A;  2ODL A;  5JHF A;  4E7H A;  2VJ5 A;  1FMW A;  3K4B A;  3OYB A;  1V5G A;  3OOU A;  3CJQ B;  2R7V A;  4B3F X;  1DBO A;  2HVQ A;  2LOO A;  2E5Z A;  1H80 A;  3BC8 A;  4RLF A;  4DK1 A;  1UG0 A;  3OYL A;  3BLY A;  4HIZ A;  2O04 A;  2PEC A;  4QPO A;  4PJL A;  1CZF A;  1OFM A;  3RPU D;  1KZL A;  2QX3 A;  2GJR A;  2VQG A;  1O8M A;  4HWV A;  2OV7 A;  2V1N A;  4OJ6 A;  4DBQ A;  3OYH A;  4L8J A;  1SKY B;  4IQJ A;  4EAT A;  1RU4 A;  2Q2E B;  3OIQ A;  1E1R A;  2ZTG A;  1U0J A;  1V0E A;  4B48 A;  4W8R A;  2F5V A;  4LG3 A;  1MND A;  2GK7 A;  1AIR A;  3H35 A;  3SDB A;  2JIZ A;  3K4N A;  3QOE A;  2M7B A;  4ZC3 A;  3LSM A;  3GQB A;  3H5A A;  2GJP A;  2KPM A;  3VSL A;  2IQ7 A;  2XF5 A;  2XZP A;  3I3L A;  1E0E A;  5HVQ C;  1OB0 A;  4B3G A;  1GQ8 A;  2LZJ A;  3GRH A;  4B47 A;  4YZA A;  2X85 A;  1EFR A;  4FET A;  2L5Q A;  4GRI A;  4XM3 A;  4IKF A;  2WB1 A;  4DOZ A;  3A1Y A;  3UW0 A;  1OGO X;  1DP3 A;  1WJC A;  2VPL A;  4ZDP A;  1ERD A;  4RLQ A;  4D1Q A;  1SAU A;  2XSJ C;  5HKK A;  2V4J C;  3FDY A;  4BQQ A;  3LL7 A;  1ZEL A;  4BJ5 C;  1PLU A;  4R79 A;  3IP4 B;  2X1C A;  4II3 A;  3HPH A;  2X6W A;  1H8H A;  1UD3 A;  4PSX A;  2P0W A;  2PYH A;  3PJR A;  2Q1Z B;  2WA0 A;  3EUA A;  3PNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...