4XMYA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 235
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xmyA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xmyA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xmyA02
4OJOA 1OGOX 3GQ8A 2BSPA 1EE6A 5C1EA 4U4BA 2NTPA 4Z03A 2QXZA 4W8SA 2PYGA 4XKVA 1O8JA 2X6YA 4XLCA 2VBEA 4I84A 3ZSCA 3T9GA 2IQ7A 3VSTA 3EQNA 1O8HA 2NTQA 4XLHA 2X85A 3GQ7A 2NSTA 4W8RA 3ZPPA 4NK6A 2O0WA 2INUA 1QJVA 2VBMA 1RMGA 4YZAA 3VSVA 2O17A 1OFLA 4XL9A 1H80A 1IDJA 1O8EA 3VMWA 4XMYA 1RU4A 2NT9A 4XLAA 2NSPA 4OZZA 1DBOA 3B8YA 1GQ8A 3GRHA 5C1CA 4YZXA 2VJIA 3B4NA 3JURA 4MR0A 1JRGA 4XONA 4XKWA 3UW0A 1O8MA 4XLFA 2UVFA 1X0CA 1KCCA 2VJJA 4HWVA 4PMHA 4YELA 2INVA 2PYHA 3EQOA 4OJLA 2O1DA 1VBLA 2QX3A 4XQFA 3GQ9A 1KCDA 4W8TA 3FY3A 3LMWA 4AVZA 2EWEA 1IDKA 1JTAA 4XN0A 1OGMX 4URRA 1O8GA 1OOCA 4MXNA 2NZMA 5AMVA 1O8IA 2Z8GA 4XM3A 1O8KA 3KRGA 1BHEA 1DBGA 1OFMA 4OJPA 4NK8A 1CZFA 1KTWA 2X3HA 4Z06A 1QCXA 2VBKA 4C2LA 1IB4A 4OJ5A 1BN8A 2X6XA 3WWGA 4OJ6A 2X6WA 2QY1A 3GQAA 4W8QA 1IA5A 4Z05A 1O8DA 2O04A 4XLEA 1PLUA 3B90A 4OZYA 4XNFA 1PXZA 3VSUA 4XR6A 2NTBA 1HG8A 4YZQA 3SUCA 1RWRA 4YZ0A 1NHCA 4XORA 1WMRA 4YEJA 1PE9A 2O0VA 2PECA 4XN3A 3VMVA 2UVEA 1O88A 1O8FA 4XOTA 1O8LA 4EW9A 2ODLA 1K5CA 1XG2A 4U49A 4XOPA 1AIRA 2NT6A
chains in the Genus database with same CATH superfamily
4GQNA 1FTTA 3PM1A 2COBA 4DQLA 1KK0A 3QOPA 3WTZA 1RI7A 1XMXA 3FMQA 4HDUA 1K4SA 1MBEA 1X1PA 4CCNA 2JSPA 2JTVA 2P4WA 3F23A 1Y1WJ 2ICWG 1ZGAA 2AHQA 3GFLA 4PJJA 2XT2A 1R5ID 3S3MA 3H9GA 3AVYA 4P5OA 1EWYA 3RY8A 2ECCA 2STWA 3CC2B 1E3OC 3L00A 3H5RA 3I1FA 3R6SA 3I9V2 5JLXA 4Q48A 5CPRB 1LKXA 1PKVA 1R7JA 2DA1A 4F93B 2F5FA 3AVWA 4XKCA 3ZMTA 2RQQA 3T51B 3F6OA 2FU4A 3DTIA 4UNOA 5FKLA 2WTEA 3L2WA 3TW7A 5FNZA 5FLMJ 1OCPA 3GQBA 1BJAA 2FBIA 2K5CA 2F5EA 3CJRB 3GLLA 3KCCA 3O6BB 3ZXSA 4KITB 2ZTNA 2O17A 1PYVA 2KZVA 3VODA 1IDJA 5E79C 1O8EA 1WU8A 3IRQA 4KIBA 2NAZA 3JRAA 2E7XA 3EUHA 1ZM4A 4OZZA 1S8NA 4M6XA 1BA5A 2HZDA 1TNSA 1ZAOA 3CF5F 1M90D 2PI0A 3KZZA 4UV9A 4QWQA 1YIJB 4YXWA 1JUPA 3OYLA 1P4XA 2L9NA 2A05A 4OAZA 1WWXA 2JSCA 3TP0A 4ANJA 1BLIA 1MRZA 2VZLA 4X7EA 2AS5F 3CB4A 2VE9A 1S72I 2IT0A 1QRYA 2F2EA 4C30A 1UCRA 5HLTA 2QX3A 4B3AA 5KVRA 1EH8A 1KCDA 1NG7A 4X0GA 4BY1J 4DK1A 2H6BA 2V31A 3AVVA 4ZYDA 4L0ZB 2A5WA 2XPVA 4RM3A 3MD2A 4AVZA 4E70A 3BY2A 1D8JA 4P22A 3PQJA 2EWNA 4HX7A 2OK7A 5AIPA 3TL4X 2GXGA 2M9HA 5JLVC 2LVSA 4NC8A 2NZMA 2C6YA 5DUIA 5E8GA 2P81A 3TKYA 2DOGA 3SEJA 3MMYB 4F3QA 1SVMA 4KA4A 1A31A 2I10A 3BR5A 2V26A 3CUQC 1BIAA 4YAFA 3KYDB 2DT6A 2QBYA 1LUJB 4HRIA 2VKHA 1YJNI 1UHMA 2DOEA 3K4LA 4HV6A 4P3YA 3R61A 1MBFA 2QBYB 5J3OA 1IB4A 2NRAC 1NG6A 4RB3C 3T1BA 3P27A 5K7ZA 2W24A 2IGKA 3ZP5A 1Z3YA 2BY0A 1ZR4A 2PMUA 1K7AA 1VQ4I 1QRCA 3WTVC 2GOXB 2LREA 4L9JA 2PJRA 3WY9A 2IXSA 3PFYA 1WKMA 3SLNA 3QYFA 3FK7A 4BBRJ 3WTTC 4Z4VA 3AG3H 3V42A 4XNFA 1TC3C 2W6JA 2PJRB 1ITYA 4X06A 2GK6A 1P7IA 4HLYA 4ZZDA 2XKOA 5E3NA 5LHIA 3R6KA 5FD5A 1W35A 3KYCB 2EIJH 2TRTA 2HVQA 1HDDC 4Y7NJ 3VMVA 4R1HA 5DNSA 1TSPA 1O88A 1O57A 2QZ8A 3WGHA 2O61A 1H89C 4BE1A 1W7PA 4NDLA 4UZEA 1QA1A 1EFTA 4LMYA 2YR2A 4B4DA 2ZBVA 2YX7A 3BH4A 2DFHA 2YU3A 3E6CC 1KYWA 2ZBKA 2BXZA 2CW8A 3GCMA 1TT0A 1XE1A 4NCNA 2NTPA 1KA8A 3ZQGA 2AHOA 4JBAA 2VBEA 3PIOF 3CPWB 5IOZA 3ELKA 2XPUA 2EPFA 2ZSIB 2KT0A 3CF2A 5KK1A 3OWTA 4AVPA 4H0EA 1I1GA 1P4WA 3ZBUA 5FKMA 1ZK8A 5DYMA 1KQ0A 3IAM2 4G1BA 4HE6A 2DFFA 3A8KA 1YFHA 1K6YA 4M6VA 5HXBA 4ZC3A 4NK6A 3OYJA 4FQGA 3U9GA 1YRNA 4BXXJ 2FE3A 1PUFB 1YJ9B 4LBZA 3I64A 3RPUD 4QHYA 4Y15A 3FXUA 1YRNB 1U78A 1IRFA 3FPPA 1N06A 4ZDOA 1I1SA 4WF2A 3BG6A 1HKQA 2L02A 2CG4A 3JRDA 1ZLKA 1ZRFA 5L46A 1FOXA 3B8YA 2BY2A 1USTA 2XTXA 4ZYAA 3PA1A 5HKKA 1FMVA 2LZJA 2ZZQA 2WJYA 4MYTA 4WCGA 1T5EA 5CVUA 4XONA 3ASPA 1WPCA 1UG0A 2DFIA 4LD5A 5IYWA 5L3FA 1GT0C 1X0CA 2HYGD 3ZMVA 1H8EA 2P0WA 4HWVA 2Y2ZA 3NAWA 3COAC 3L2UA 4BY7J 1KGSA 4HBLA 3ES9A 3JRBA 1OB2A 1POGA 3VSKA 1ZKGA 3FXOA 2L7FP 5D6EA 3A0BC 1K8AD 2ZCWA 2CGPA 2G0YA 2LC2A 4FT8A 4LLLA 3JQPA 3V8LA 3WGGA 1V5FA 3VB2A 2E5ZA 4ENKA 5B5EC 2K27A 4RB0A 5CLSA 1JTAA 4BHCA 2K9NA 1Z9CA 1DUXC 2V1XA 4ZTJA 1XGOA 1I27A 3OEHA 4HYEA 5CVIA 4I0AA 1HC8A 2XTYA 4TMZA 2DQRA 2EFNA 2VNIA 1I5ZA 2ZL7A 1O8KA 1VLOA 3V8JA 3JCUC 2R7QA 1VQOI 3ONUA 4WZLA 1L3LA 4NK8A 3TH0A 3KZIC 3LSHA 5J1UA 5EZHA 1VQNB 5EF6A 4U7BA 4FK8A 4HE5A 3ISPA 3H9JA 1E3HA 3WU2C 3VYRB 5DDGA 3PSFA 4WXCA 2P8TA 3A02A 2R92J 2X6WA 1RETA 3T53B 2PMZN 2V7TA 3T5XA 2GJPA 1IN5A 1XDSA 3C2GA 1R22A 2ETHA 3K1PA 4ITVA 1YITB 1B9NA 4UXNA 3WYAA 1NH3A 1R1UA 1ZQ3P 4EV0A 4YHBA 3CCMB 2KHMA 4XLEA 3VYUB 3AKZA 2BY3A 2NTBA 1HG8A 3MMPA 1RWRA 3VO2A 3ZCOA 2K9QA 1PP8F 2XT4A 2PE3A 2HOSA 4G94A 1HSTA 5F27A 4BACA 3FISA 2VBSA 2JA2A 2V1DA 3K4BA 2BGJA 2DJNA 4II2A 3DQVC 3BTLA 1FOKA 4PC6A 2PX9A 4PJMA 3IH4A 1VI0A 2VE8A 2X51A 2G7UA 1A8PA 4WXHA 3ZN1A 4GDFA 1FOYA 5KNLA 3HIFA 5FKKA 3PSSA 2IS4A 1NJID 1OGIA 2VFQA 4I0BA 2L4AA 4PDKA 4G6TB 4E7ZA 2QXZA 2MH9A 4U0YA 2VPRA 4XLCA 3H0GJ 4B8XA 2XIGA 3J80Z 4AF7A 3T9GA 5IYPA 3SDBA 2O8KA 4DW6A 2ZMEA 1HXDA 2Q8KA 4KUMA 2NTQA 3C18A 2BW3A 3FIWA 3RTRA 1V5EA 3T56B 3Q9SA 4U0VA 1F43A 3K70C 2VB6A 4P26A 2BW3B 3ML6A 2VI6A 4Q7JB 1M1KD 1CNEA 4D5CA 2Y0MA 1EV7A 3AVUA 3GSIA 1SFOJ 1VLYA 2VQHA 4IHTA 3OYBA 4TMVA 1OKRA 2X8KA 4LB5A 2LKSA 2L5QA 4GXOA 2CW7A 3MKWB 3DDYA 2W84A 5LRSA 1J9ZA 1B59A 3VMWA 2BE5F 4O5VA 2NT9A 1WOOA 1OPCA 3CW2A 1W4MA 4LJZF 1X4PA 2XHKA 4X6AJ 3FZVA 1BIBA 3BLYA 1ETXA 3HGGA 1G3TA 2ME6A 2PQ8A 4C43A 3QFRA 1QO0D 1FNDA 1JGGA 2OV7A 3P9IA 1GV2A 2QSHX 3FKJA 3A8JA 2DTZA 1D1CA 3A8IA 3R0JA 2PYHA 4L9TA 2ZJQF 3QOEA 1U9NA 2HYJA 5ICCA 2UV1A 2X0LA 3CUQB 3RI4A 3ZMUA 1JT0A 3BQJA 4G7ZF 1DP7P 5M3FJ 4DGWB 3D26A 1PJ7A 1UB9A 1IV6A 4JOMA 1QGYA 2Y75A 3VR6A 5E20A 2EB7A 3ZC3A 1OOCA 3E6MA 2QEXI 5FFZA 2EA4A 2QSFX 1TZLA 5DUKA 1FRNA 1K83J 3CCEI 4EJTA 1ERDA 4Y9UA 3WNDA 3LVBA 2JDIA 3C2BA 3KRGA 4E7SA 1DBGA 3D0SA 4AIKA 1KQSB 3CD6B 1OYWA 2K4BA 1YX2A 1IC8A 4OMYA 2X4HA 1UD5A 1TQPA 4X0CA 2F5VA 1W0JA 4NQWA 4P9FA 2CUZA 3LNNA 4ZCIA 3V7SA 3SQNA 1BN8A 4OJ6A 3P9KA 1U9OA 1XX5A 4C2UA 3IP4B 2WADA 2R7WA 2P5LC 4MHGA 2CUEA 3TDUC 5DTDA 1HQCA 2CU7A 2FNPA 3S3OA 2J7KA 5JFRA 2IA1A 3G4SB 4NBSA 2IS6A 1VQ8B 1T0FC 5J4VA 1ZHFA 2RNGA 1TYVA 3K4JA 4H9GA 2CFOA 3LSIA 1T6XA 3S14J 3S15J 4DQKA 1EF4A 1BR2A 3ZPLA 3B73A 3WNBA 5F04A 2VFNA 4WZTA 2ZXJA 1MGTA 4UVAA 2BGCA 1V0EA 1Y8RB 3KP2A 2V7WA 2R5ZB 1IUYA 1FYMA 2XEXA 4WXDA 5EG0A 2V7QA 2DA5A 1XMKA 4HSTA 1GAWA 1UD6A 5C1EA 1VQ7B 1A6QA 2Y48A 3EQLF 3K0LA 3GTPJ 2CW5A 4G5GA 1XB2A 4UZUA 2JN6A 4OWRB 2NOJB 3HBLA 5IT9K 2O8XA 1Y0NA 3M8JA 4Z4YA 4M1KA 3EQNA 2OU2A 3LYCA 1DPUA 2AQEA 1K28D 1WP6A 2IJLA 3BCAA 1AKHA 5J4YA 1J9IA 3RQ4A 3K70D 4B4CA 2WAQN 4QFMA 2DMQA 1F5TA 3ZQFA 2V9PA 2W48A 4BQOA 5GPAA 2GLOA 4XSZF 1AKHB 5F0CA 3PUBA 1QJVA 2FD5A 3DXJF 3RZOJ 4IHYA 1RMGA 4YZAA 4YCQA 4L18B 4FISA 2QA4I 3ZZTA 4RM2A 1YJWI 2HQRA 2R6HA 2ISZA 3KP5A 3HKZA 1O4XA 3BC9A 3I59A 1VF7A 5J8CA 2YWHA 3CMEB 3SEQA 4A12A 2L0KA 3QPLA 3RPQA 5IYQA 2C4TA 1ZARA 1XS9A 1OLTA 3I59B 4B09A 3WBKA 5C1CA 3GVKA 2DK8A 3JURA 3FBIB 1DGWY 2DA6A 4QPOA 1R49A 1KU9A 2NS0A 3BZKA 2JUCA 1O8MA 1WJAA 1KTVA 1YW7A 2DMUA 5IT3A 2HS5A 4C3JJ 2OTLI 1SD6A 3OYHA 1O7FA 2VNJA 4YIFA 2LK2A 3L2RA 2XAHA 3RSNA 2IGOA 2FOKA 2E1CA 2NXNB 5HVQC 3EPZA 1Q86D 4F91B 4JX5A 5IYNA 1TYWA 1BOBA 4MTEA 2DCUA 4Y52J 3BCFA 2HFHA 1Y39A 3LMMA 3WODF 4IPAA 1X1DA 1OGMX 3CJTB 3SFZA 4RBOA 1KJZA 2C78A 3MN2A 5HS7A 3EUAA 3N05A 1W36C 2K4JA 4DYRA 4YALA 1JJ6C 5LBQA 2J5OA 1BHEA 2MLGA 3ZMDA 4OOVA 5GTHC 3Q9VA 2FA5A 1YX5A 5A8AA 3V7CA 1ZN2A 4ESJA 3VWBA 4E7KA 4IHWA 5EEHA 2HQAA 1QNTA 3JRIA 1FNMA 2C5BA 4Q5SF 3CCRB 2NOGA 2CV1A 5F4JA 3ABTA 5TR9A 1T39A 1ON2A 4Q4ZF 1PUEE 3GTOJ 1WJBA 4NC6A 5IYBJ 5DM7F 3WWGA 1ZRCA 4KT6A 2XF6A 4B1RA 2XB0X 1B23P 3EUHC 3A35A 4UUSB 3F8FA 1ZM9A 3LQ6A 4KKUA 2DETA 3F72A 5FGMA 2EZKA 4OZYA 4RAZA 3LA7A 1BC8C 3ZRGA 2Q2EB 5CJ9A 2EJRA 5HDNA 4M9XA 3CC4I 3PNYA 3JRCA 1N05A 1YQAA 5DS9A 2JVGA 1QFJA 3OAAA 3IAS2 2V1UA 1IN7A 1QGPA 4BAYA 4R8HA 4OM9A 2RQPA 4N3NA 2Q6OA 2FNAA 2ODLA 2EV6A 2GIVA 1BOAA 2KZGA 2ZFWA 3KE2A 2EFPA 3B82A 1ZH5A 1EA0A 1OGOX 1BJKA 4TV7A 1RKTA 3L1PA 5L3CA 4U4BA 4YG2F 2WWYA 2BF4A 2B63J 2NVQJ 3BOQA 1A04A 2OUMA 2PYGA 5J47A 3FDYA 3O3KA 2LTPA 4DBQA 2PFBA 3GX4X 3GMEA 3CC7I 1WJDA 2EH3A 1O7LA 1SVLA 2RN7A 2RNJA 3BR3A 3ZZUA 1G3SA 1FC3A 4QPQA 5KHDA 5LGUA 3H5AA 4N9IA 1VQKB 3DPTA 3VSTA 3SLDA 2K85A 2R7DA 2IP2A 4I02A 3Q6QA 3HG9A 2DA2A 5D5WB 4II3A 2Y31A 3BG9A 1M1EB 1YW8A 3G71I 4IJAA 4HX4A 3OV8A 1K78B 3JRFA 2QGUA 5IK2A 3TGNA 3ASQA 3A3BA 1PVEA 1OFDA 2E7WA 2VBMA 2D45A 5H59A 3IH3A 3GUDA 4RGUA 3T8TA 1BM9A 1C0WA 4RM0A 2L4MA 2WSSA 4XLNF 4CQJA 3KETA 3HEFA 3SHFA 3SZTA 4R71A 4C2TA 2LLKA 1MMAA 3DEEA 3GO5A 5IYDJ 1DBOA 4D7NA 3WE2A 4RD3A 4YZXA 3E7LA 1TQMA 3V8KA 4E7LA 3HRTA 4G6IA 2BN4A 4LB6B 1VQ5I 3LA2A 3OYMA 3LOCA 1BMFA 1XFOA 4G6DA 1FT9A 1YTYA 4Z4UA 1IRZA 4PMHA 2INVA 5AIQA 1YS6A 1IRGA 2YX4A 2A6EF 1WQ2A 4QLCU 1V3FA 1GVJA 3SJZA 2R5YA 4UB6C 4XN0A 3CQZJ 1G2HA 3LSRA 3QPTA 2VKEA 4OPOA 1W36D 4A2UA 4L0YB 1J09A 2R5YB 1U5TA 2VQLA 3BY1A 2IEKA 2L3DA 5ERIA 5JBQA 1DGRM 1ETVA 4Z4ZA 4IL6C 1ONVA 3HRUA 1KTWA 2XNJA 1KC8D 2WA0A 4UHTA 1YLFA 3R6JA 1K9MD 1TW2A 5HOOA 3CC2I 4EM1A 2WB1A 3DKXA 2Y30A 2XKPA 1HW1A 2V7XA 1DQUA 2F5CA 1GDTA 1X2MA 1J2XA 2FF4A 2FQ4A 4HOBA 3LQEA 5B1BH 2QWWA 4Z05A 1SKYB 4AYBN 4EJVA 1H88C 2YUSA 3GTLJ 2KPMA 1V55H 4PABA 1IV8A 4CZZA 2VBYA 1OMIA 3S3NA 2M8GX 1KQ5A 2M0CA 3BNWA 4AF6A 1MMGA 3H35A 2CRVA 1FX7A 2O0YA 1TQIA 2WB1N 1BW5A 3KPHA 2DAOA 3I3LA 3KYLA 1LVKA 3CDIA 3HOTA 1FJLA 1D8TA 3MZHA 1YIJI 4P6VF 1U6GA 3GBGA 1Y6IA 2CNDA 5DCMA 3L2CA 1JB9A 1FMWA 5KAFC 4CCJA 1S6LA 1UD3A 3VYTB 3FKIJ 2HKXA 4BHPA 5H2FC 2WPDA 5DCMB 4M9SA 4I84A 3IV5A 1LVAA 3S32A 3OL3A 4YFNF 1TUIA 2KRCA 4ENNA 1MSEC 3MQ0A 2ZJ2A 4A3JJ 2NV4A 1HKTA 1KU3A 3HUGA 2OBTA 3TW6A 3M1EA 3Q39A 3IWZA 2JJ1A 1D5VA 6PAXA 2BBYA 3H9QA 2GJRA 2XGEA 1ZREA 4Z2YA 1P6RA 5CVVA 4RGXA 2ZNZA 2H09A 3FXQA 2EZIA 2A07F 3CP2A 3NARA 4P55A 4OPSA 3I55B 4BU2A 4A3MJ 3BQYA 1OFLA 1TTYA 3S17J 4UV8A 1BI0A 4IOCF 3CCQB 3ECOA 1E62A 1LNWA 5HS9A 3CCLB 2IS1A 1U2WA 4B48A 2IAIA 3H3UA 3HAGA 2XVCA 4G12A 3LSGA 4PCQA 2HDCA 3GTGJ 1UZCA 4P3IA 1B6AA 3BR6A 2QSGX 1VQ6B 5IOYA 3BCDA 2DJIA 1YIOA 3E0JB 2V6EA 2PLYA 1W7PD 4ACAA 3UKGA 4XRFA 2XOKA 1I18A 1W1WE 3ROUA 3N97A 4KKTA 3EYYA 5FFXA 2VJJA 2FRHA 2DEUA 2HTSA 2OC6A 3S1NJ 4DIQA 1NHAA 1I6XA 3I0TA 1G3WA 4XQFA 3QYEA 2WR8A 4ESBA 3LMWA 3I54A 3OIQA 4HQMA 1SEUA 2DU9A 3QRFF 3K4MA 3BG5A 4D9JA 2NS8A 2ZMEC 4RD6A 3J81Z 4M71A 4CICA 2QN6A 2WV1A 3A4CA 3I4MJ 4G8XA 3U2RA 2KKOA 2GK7A 5JHUA 3ISXA 3OFNA 2Z8GA 4EQQA 2I8DA 1JT6A 2RDPA 3WNCA 2IRFG 4KN7X 2IGNA 1HF2A 2TDXA 4G9YA 1SFUA 3M8FA 4KICA 3K4KA 1DPRA 1DARA 1VZ0A 4I01A 5DM6F 4DNRB 3V7AA 1P4AA 4C2MJ 2D1VA 3B02A 3RKQA 2VODA 4MYUA 2XUBA 4XICA 3WHCA 5L3BA 5FKNA 2BM6A 3ULQB 4LG3A 4ACBA 5IY5H 2M5SA 1IA5A 1Z91A 1KZHA 2OBSA 3VYSB 1RUNA 2GXAA 1STZA 3AL0C 5GP9A 2Z99A 1YJ9I 2G7HA 1N25A 3D1NI 2EZLA 4X8IA 4ZDLA 1O3TA 3UNGC 3CRZA 1R5OA 1NHCA 4HNUA 2F43A 2BGIA 3JU4A 1SAUA 1ZGJA 5E1WA 1O8LA 3DPUA 2LBFA 3OYFA 2FJ1A 4D0PA 1JI8A 5BSXA 4IXAA 4YAOA 4NBQA 3DLAA 4U49A 4BS9A 5HLGA 5EJCA 2C77A 4TMXA 4A69C 5CQEA 1Z6TA 1LDDA 2BSPA 4Y4RA 1X4OA 3HZJA 2JA6J 4WZEA 1HVXA 1YHQB 2WY8Q 3I58A 4ZDPA 4GCVA 1S5LC 3J7AO 3ZSCA 4L9NA 2M4KA 2XZLA 1MZBA 4BBSJ 2HTJA 2GWRA 1FY7A 1Q1VA 1VHEA 3G1OA 2Y0SN 2ZZEA 2JPCA 3TBIA 1PDNC 2MD5A 3ONYA 3K9TA 3SYJA 2O0WA 3OEEA 1J0RA 3BTJA 3M07A 4X1EA 1GO2A 1WJEA 2CF4A 4OP7A 1JA1A 1RKWA 5A88A 2JWTA 2M87A 2OPTA 2V9KA 4UVBA 3FK6A 2VBVA 4AC9A 1W7PB 3DEUA 2HU9A 1H80A 1WSVA 2ZFUA 2ZJRF 2Z2SB 1QZZA 3B6AA 2KDZA 2HVRA 1VQNI 3QFCA 2VFOA 2XGXA 3BDDA 1I3AA 4A3KJ 4HF2A 2HOEA 2A5YB 1FDRA 3DF8A 1RIOH 1WH5A 3W3CA 3QWLA 1Y8QB 3OKXA 3TOAA 2MG4A 3AAFA 1IZ1A 3HB9A 2E1OA 2Q1ZB 1YITI 2LKPA 1F4KA 1T6SA 4HG2A 4XKWA 2EV5A 5JVGF 1KQ8A 1VQMB 1YOVB 3DTEA 3CCMI 1KCCA 4M3DA 3CDHA 2OAZA 3K1NA 5D6FA 5FA6A 2DA4A 4YELA 5EEAA 5K7HA 3JREA 3NWTA 3IRRA 2FOWA 1XB4A 1FWZA 4L5EA 3CO6C 4HQEA 1OJLA 3CUOA 1P7JA 1CNFA 1P4MA 1MNEA 3G05A 2XNDA 2DOAA 3OR2C 1K4TA 2BX6A 3OSGA 5L3GA 1SANA 1YS7A 2IBDA 4AM3A 4ZJZA 4RCYA 4EH1A 2BVMA 1X3UA 1Y0UA 1OCRH 2MBFA 3VSLA 4MXNA 4ZYGA 1QRBA 3OP1A 1EFCA 3PSZA 1QVTA 4XM3A 1T2KA 2CQQA 1F60A 1WI3A 1OFMA 4RAFA 3ZUGA 3W2GA 2KFDA 3W2EA 4MQVA 4HIZA 4IRHA 4BE0A 4DNTB 1H0MA 2B7CA 2XRNA 4DZJA 2MGQA 1PP7U 3M4OJ 1FP1D 2NS7A 3G73A 2O03A 1I39A 2PEXA 3K2ZA 2BM0A 3LQRA 3OPOA 4E4HA 4LK0F 2RREA 4M3GA 2XASA 4U7DA 2QE7A 2QY1A 3GQAA 2RV8A 5GADJ 2Z9OA 3KIOA 3OS0A 2PMZA 2JZYA 4LITA 3QYBA 1Y0YA 3DWLE 4WX9A 2VJ5A 1G6NA 2F4MB 4XKBA 4XBFA 3W6JB 5C44J 4N3GA 5HODA 1XGMA 1OCCH 2XF5A 2E1MC 2YS9A 4V19K 3PA2A 2V7UA 1BJZA 3E5QA 4FTHA 3G6EB 1PE9A 2QLZA 2X6OA 3BJ6A 4CCKA 1IN6A 3CJNA 3K4CA 1CQXA 3R4KA 4XOTA 2ZC2A 1XN7A 4KIGA 5E1XA 5J6XA 3WBJA 5TJJA 3SZGA 1QZEA 3JAMK 3DLLF 2DXIA 3CDLA 1QUEA 3P9CA 2PBIA 1J75A 1O8JA 3LFUA 1FYLA 2F4IA 4M0LA 3JTGA 4BXUA 5GV8A 1AU7A 2O5RA 1S7EA 2WZPP 3MKYB 2DI3A 3W2FA 2P6TA 2HDNB 3T0YA 2F3LA 2AO9A 2HWVA 4OIRF 4CGZA 3H9NA 3WE3A 3ZIAA 1GVDA 3C2HA 5K1YA 1P2FA 1D3YA 5KAIC 1VNDA 5EGOA 1KRHA 1OISA 5BOXA 2EFGA 5JI6A 4HSRA 1N07A 1OB0A 1BL0A 2DPDA 3BZ6A 4IEJA 2CS3A 2IGMA 1T8IA 3CD6I 3IKTA 2VT2A 4MQ9F 3X2QH 1WSUA 4ROXA 2YSRA 3IWFA 1B9MA 1LLZA 4CYDA 1YG2A 1QA6A 2HEOA 1VQ9B 3PUNA 4MTDA 4A3IJ 1XC5A 3HTUA 1KZLA 1TYUA 3J81k 1X1CA 4MR0A 3F8BA 5KW9A 2EIXA 4D7MA 1CQTA 5LHHA 3BC8A 3DEWA 4N4OB 2XROA 5E6TA 3G4SI 2ZMEB 2KIMA 1T6YA 1VQ8I 2VBZA 4PJ0C 4EM2A 1TWGJ 4BDYA 4RDUA 2BM1A 1R00A 5FROA 5TV2A 5LEJA 3KEYA 3BZCA 3VMFA 2CMPA 1JHHA 5E3LA 4RLQA 1SKQA 4ZGNB 3CCUB 3DBLB 3CCJB 3JSPA 4UAJA 2WAFA 2K86A 5FLXK 4JRAC 4G7OF 5H6QA 5BPIA 1KONA 3RYRA 3GIRA 4CDGA 2LY9A 1IGNA 3OIPA 3Q38A 2BY1A 1WORA 3MZYA 3IH2A 1LFUP 1AIPA 2BM5A 3AL0B 2VQGA 1QCXA 1EH6A 1JKQC 1NTCA 3LSKA 1X1AA 4IQ4A 2RC5A 1K73D 2X1EA 1GXPA 2EIKH 3CCYA 4M3EA 4NUBA 4D5FA 1JE8A 2F4NA 5BSYA 1Y1VJ 3F21A 1UFMA 2JA5J 4KKSA 2OZUA 1SAXA 1T98A 3GVAA 4I76A 2C4UA 2WV0A 3BR1A 2VOPA 3OZVA 1R23A 3K69A 3VSUA 2EIMH 2VOOA 1EFUA 1G7SA 1RUOA 3DV8A 2XNCA 1PXZA 2V7VA 1JGSA 4CO8A 1JKPC 4HF1A 4YFOA 4J00A 1FZPB 2W00A 2VQCA 2W25A 3S8PA 3CMEI 2R7OA 3H1CA 3DU5A 1EKEA 1E79A 2X1DA 2WZNA 4P9SA 2PECA 4S05A 4PGGA 2Z1DA 1D1BA 1HZEA 3MKZA 1HSJA 2VC0A 2F6CA 3PENA 3K2AA 1WJ5A 2O6GE 3JW4A 4ZH4F 4TN1A 2FEZA 5ICGA 4ZYHA 1GHCA 2ZBUA 5FIUA 4RA2A 4Z03A 4NQWB 2R0QC 2QM3A 2BHYA 1U5TC 2NVXJ 3PETA 1IRXA 4FX0A 2X0KA 4JP0A 1EZGA 4TMTA 4M3FA 3QFSA 3M8EA 1OFEA 4Q47A 3K4NA 4QIWN 4YC5A 3OIOA 2A3SA 3M7GA 1OYYA 1XGNA 3RYPA 2X85A 3PSIA 1TW3A 3QPHA 1LE8A 1VTNC 5FL7A 3ZPPA 1QPMA 1IXCA 3MKLA 2WAQA 5JR3A 1TBXA 5HNFA 1QGZA 1IDYA 1R9TJ 2M5WA 2Z6BD 2JPBA 4RGRA 1I7PA 2B0LA 4U88A 4LG0A 4XL9A 4A3FJ 3RIQA 2MABA 1MH4A 1UAAA 1JXSA 4BXFA 1Q1HA 1YI2B 2OCEA 5EG0B 3NWSA 5CQGA 3CCRI 1O3QA 3SQVA 2JK3A 2DW4A 2XAUA 5IP9J 3MCZA 3KX2A 4M9ZA 4V02C 1XDUA 4PJLA 2NVUB 4L5IA 3D5RC 1B8IA 2WJVA 2HOTA 4IQJA 2Z5UA 5F64A 2OBRA 2XTWA 2CRGA 4I99C 2NNYA 2OTJB 3PFIA 3KEOA 3TO6A 1B8IB 1WCMJ 2GA1A 4F55A 2TCTA 2X1CA 1XMAA 2L54A 2IW5A 1R5BA 1WVRA 5C4XJ 3B8HA 4W97A 4FE7A 4A5MA 3CXCB 3MEXA 1VQLB 3FY3A 2HZTA 2H1KA 4ZTFA 3GEZA 1TWFJ 2XZOA 1XSVA 2EFOA 5F1RA 4Z1MA 4XRMA 1SM4A 4DYQA 3TP3A 1F9NA 4L9VA 2M3AA 5AMVA 2Q6LA 2UZKA 4MFEA 1MW7A 5LGNA 4K1XA 1ODDA 2JA7J 1ZELA 3K7AJ 2JA8J 1IDZA 3KL9A 3FBNB 1BC7C 2X3HA 3NE5B 2RVCA 3F3XA 2FBHA 2X48A 5EEGA 2N8GA 4FHTA 1VQKI 1HKSA 2O7OA 2E1MB 3B6CA 5F6FA 1G7RA 3OOUA 4OJ5A 3OMYA 4CSWA 4AUXA 3TO7A 5E17F 1TTTA 1E3XA 3GFMA 1WI9A 4CZCA 4M2LA 1EP2B 1EJ9A 1ZM3A 2ZL5A 4TMWA 5CVRA 2BV6A 2MW8A 2E71A 2XSJC 1DU0A 1S4MA 3H3ZA 4PC3A 3B90A 4KNYA 4PK4A 1ZGWA 3DBRB 1DDGA 2K9LA 2ZZFA 3ZR8X 2LKXA 3BP8A 2DDBA 4BNCA 2R93J 4PGOA 3RZDJ 2KISA 5DCFA 2W1OA 3FXRA 1R36A 2EA2A 1N08A 4G6QA 4PFOA 2L9VA 4ENJA 5BNGA 2VNHA 2ADUA 4UB8C 1R1VA 4EMSA 4EW9A 1HA8A 4PSWA 2FQ3A 4P6YA 2QQ8A 4RPBA 4U0WA 1A6IA 4AIDA 1KYZA 4J01A 2YWFA 4X05A 2AXTC 2W85A 4WWCA 1KK2A 1YYVA 2KIFA 2M7BA 1RNLA 4B44A 1K6OA 1H9GA 1WTHD 3J7ZI 3OY9A 2PMHA 3VDXA 4CA0A 5IPAA 4XRSA 1ZUNB 4W8SA 2MH2A 2XAGA 1Y56A 1KK1A 3CLOA 4AU7A 1RQRA 4JK1X 4I6ZA 5B6IA 2ELKA 5IYRA 3AG1H 4CH7A 1LDKB 3ECHA 4OIQF 1FSHA 4UUTA 5E3OA 1ETQA 1IO2A 1FBUA 1RRJA 3SJPA 1IJWC 4QVJA 1S0UA 2BZTA 4XK4A 2JQ7A 3PL8A 1VJSA 1D1AA 3EUKL 2GM4A 2X53S 4W8RA 1MBJA 3J7YJ 4PC2A 5LLQA 2R7XA 5JHFA 4IRGA 5IT9Z 2KJBA 2E2HJ 4HDVA 1QU3A 3LSPA 4H4KC 1S7OA 4PUSA 2KMUA 4ESFA 2IVMA 1BR4A 3F6VA 3W5UA 3VFZA 5GAEJ 2QYUA 1E2XA 2CQ7A 2KLOA 4AIHA 1X3WB 4J0QA 1QFZA 1ZM2A 1DDIA 2CH0A 4P9UA 1L0OC 4IHVA 2HYFA 3HOXJ 2BVLA 4IW3B 3DP7A 3MZ8A 4ZGQB 2K40A 5BMZA 5LEKA 1E3ZA 2COMA 3AG4H 4CYCA 2DPUA 2LD5A 4UUVA 2LMDA 3CCSB 1REPC 3KEQA 2EFWA 3TOBA 2V9VA 1TNTA 2K9MA 2B7BA 4Y13A 1WXRA 3GVLA 1ZTRA 4Z6YA 3SZPA 4IHXA 1VQPB 2GBYA 2EFQA 3F8CA 4Y17A 3O8HA 2GA2A 3LAJA 4A3BJ 4A5NA 2XGJA 4Z4TA 3DU6A 4M73A 3PQKA 1LEBA 1UD8A 2LR8A 2CUFA 2H6CA 3G3ZA 4HF0A 1S7AA 1QGAA 4B43A 1R71A 4E0FA 1X19A 2BHZA 1GR1A 1FEXA 3OYEA 2XZPA 1RQPA 4LFUA 4GYIA 4HEA2 4EJWA 1AA7A 3GXOA 1RR8C 3S2WA 2QDXA 2VNKA 4RD2A 2IPQX 4RD0A 1OYIA 5D5XB 1Z0XA 2R7VA 1W5TA 1RESA 2ISYA 3KLOA 1IG7A 4P1VA 3CCVI 4Z06A 1IHMA 4JQFA 3VPRA 3ZMSA 4DNCA 4LIUA 9ANTA 2Q6IA 4JMQA 2L01A 3HGYA 5K5RA 3H0DA 1OR7A 1ZYRF 2W82A 2MFZA 4MFDA 1UMQA 3HOYJ 4Y9RA 2G0EA 3OL4A 1LLWA 2V5IA 3H09A 4XSXF 3WTXC 5DD4A 5FB2A 4XR6A 4YZQA 4YAWA 5LHGA 3T8RA 5GPCA 3WHBA 3I55I 3NQOA 4AYBA 1QHGA 2DO7A 3UR3C 4R79A 4YZ0A 2I5UA 3FXMA 3LSJA 3CCQI 2E60A 2L7ZA 2XAQA 4NNJA 1U5TB 1XG1A 1MJBA 3CCLI 2CBXA 3BG7A 3H36A 5K5QA 2QKLB 3OR1C 1MABA 3LO8A 2E2IJ 4QUZA 3CMAB 1X58A 1VQ6I 3PIPF 1WJFA 2FSWA 3S16J 2ZL6A 3BROA 2RKHA 3RKWA 3L09A 1W5CC 3ERED 1W87A 3N90A 4YIIA 2EQRA 2ZXWH 2OK8A 1D5YA 4RDKA 2OJED 3KZYA 1WH7A 5E18F 1U8RA 1B72A 1O3RA 3S2HJ 1EP1B 3ABKH 3QODA 5EDNA 3IKVA 1WOPA 1I6HJ 1G8XA 4LC0A 3U2QA 1MBKA 1B72B 2JIZA 1CGPA 5B1AH 3MVPA 2DMTA 1QQIA 2W4SA 3FXJA 2ACJA 2HXIA 3GZ5A 2M30A 2MSYA 2ZB9A 4IVNA 4V2GA 2V4JC 1WFXA 2H1LA 2K02A 4P96A 1Q9SA 3OS1A 3E1YE 4Y7CA 3BH7B 5B3SH 4K2EA 2HDDA 4PC1A 3KP6A 3F22A 2OZ6A 1BPLA 2UXXA 1N0VC 3OYGA 3JRHA 4QSHA 1WPKA 3GTJJ 1AOYA 1FSEA 1H42A 1FNNA 3RKXA 5C4JJ 2QKMB 1JA0A 3BR2A 1RU4A 1WOSA 4BUPA 1NB0A 5KSWB 4HA8A 3WTUC 3K10A 2VASA 3GWZA 4BGDA 5LFAA 2W57A 3ZQ7A 2D1HA 2VL8A 2KIUA 3GTQJ 2JRMA 3BPVA 4RMNA 4BHBA 1RR7A 1KU7A 4XLFA 2Z3YA 2LH9A 4RCZA 2CO5A 2DA3A 2K3FA 2QUFA 1JTYA 3A0HC 4FWTA 3HUGB 3W2VA 1TYXA 5LRRA 3B78A 4M74A 3FM3A 3GQ9A 3Q3AA 4OIOF 2IA2A 2CV2A 1QHHD 5JVTA 1K79A 1IJFA 2M34A 2Z16A 1Z67A 4KJZA 3JR9A 1NK3P 1QPIA 2C2WA 1AHDP 1QBJA 2PLFA 4Z4RA 4E6KG 1G3YA 1D1NA 3KEWA 2O9LA 2HXOA 3ZQIA 1Q82D 3D5LA 3HRSA 1N8RD 3L2QA 3AVXA 3OW2B 5FO5A 2W7NA 1YHQI 3V76A 2VFPA 3W2WA 4IX7A 1UJ8A 4F7DA 4BL0B 1SD5A 4IO9F 2JRTA 2P3MA 2O3FA 2ELJA 1RC9A 3PUFA 4MLOA 2HQ5A 1YX3A 1MMNA 3HDDA 3JX8A 3ASRA 1GJRA 3FKSA 2KL4A 1DU6A 3N6ZA 4LBWA 2JVHA 2V6CA 4C9YA 2WAEA 2QGGA 2KDOA 3OJXA 5D5VB 2DDAA 5M5XJ 3ERMA 4IF4A 1I50J 4B3GA 2ID3A 3A1YA 3CJQB 2DODA 1XQBA 1VHOA 3IHUA 5BQTA 3QP6A 1EXMA 2UXNA 5CVJA 4BJTA 2P7VB 3P7NA 2XDVA 2OF7A 3SEZA 4O3MA 1OFCX 4YEJA 1B1BA 3V7RA 3FHZA 1D0YA 2OBPA 2R9VA 1IAWA 4HW0A 1F20A 3QU6A 1O8FA 1SC7A 3HYIA 3HXLA 2FX3A 2FXAA 3OS2A 3S2DJ 2JMWA 4XOPA 1OCZH 3QP5A 5DEQA 2DYIA 2VONA 1GV5A 3R60A 1L1IA 3GQ8A 3LNQA 1XCBA 1VQMI 4J19A 1ETKA 1R5HA 1A36A 2E1NA 5KCMA 2Q0OA 3Q5FA 1SFKA 1LFBA 2GXBA 2NVTJ 3KLNA 2CQXA 2J5PA 2QQAA 4A0YA 3AG2H 3GLXA 5K5OA 4RB2C 2IQ7A 3DU1X 3AK5A 3JTHA 3U1DA 4EEFG 4FASD 3I56B 4EVIA 3ZN0A 3SKBA 3REOA 3W2HA 1V4RA 1FX0A 2H94A 4WK8F 2P7CB 3FF5A 1MDMA 2FUG2 2Y0SA 4GYGA 1DG1G 1IXRC 4S04A 2BOLA 2JJ7A 2LBFB 2FMLA 3JSOA 1HW2A 2ZJPF 1MDMB 1Z7UA 3RQIA 3GW2A 2D74A 1IW7F 5F4OA 2LNBA 4G7XA 3LSTA 1X1BA 1X2NA 3VNUA 3FX3A 4B3FX 1QH0A 1GQ8A 4ZCLA 3OW7A 1Z77A 3KP7A 3U6KA 1R6RA 1J5YA 1CLWA 4PC7A 1XSXA 3OE7A 1X3ZB 4ZV4A 3UW0A 3S1RJ 3IL2A 2XGCA 3TQNA 3QE2A 2NNNA 2YUHA 1JHFA 3WTSC 2YWGA 5E8IA 2DT7B 3AFHA 1O3SA 2MC3A 5HNHA 2MLKA 1QFYA 4RLZA 2R7FA 3HOUJ 1E1QA 5J8FA 3G6EI 2GAUA 5EZGA 4DQ2A 2XC7A 1E1RA 3WU0A 1A35A 2GQQA 1ULYA 3PNVA 3EETA 2WY7Q 4RAGA 4RDJA 3SZEA 3HOZJ 3ZBTA 2J8IA 2LY2A 3FJOA 5CDFA 4KFCA 4CCLA 4YFKF 2XGDA 1T08B 2UUZA 3LAPA 3W6VA 5A89A 5FKOA 3I5UA 2BYVE 4TSFA 1QX4A 1PJRA 2XC1A 2VBKA 2LDUA 2HPMA 4KISA 4MIMA 3BTIA 2YPRA 3OYNA 5FRMA 1RZ4A 1H8HA 3JQQA 1NK2P 4RJLA 3E3VA 1BX1A 2X3UA 1BBYA 1LJ9A 4KN4X 4NC7A 1QA3A 2IOUG 3LL7A 3RIRA 3ASNH 3WTYC 2M8EA 2HLDA 4O6JA 2JUGA 1Z3XA 2OA4A 2JJ2A 2UWMA 2NVYJ 1S72B 3SUCA 4ON0A 4HV5A 2VXZA 3OOCA 2OQRA 1ACIA 1HLVA 1TLLA 4XORA 2QZAA 4TKOB 3FHNA 2WYRA 1Z21A 1H8AC 2QCOA 5GTIC 1PUFA 5FLVA 1IXSB 1G7CA 4LBVA 4BPRA 2ZITA 1OB5A 2O0VA 5H5JA 3W2IA 3EYIA 2KRHA 2DIEA 3F8NA 1CZFA 3BJOA 4TT3A 4UZFA 2OCCH 3BT9A 3HC7A 5CYVA 3J80K 1FP2A 1TWCJ 4PJNA 1TL8A 1VQ9I 4YAUA 3WXMA 4HLXA 1BI1A 2ZSHB 4B3XA 4GFBA 1BX0A 4HZFA 5ICFA 2W6IA 3FPKA 5HZBA 1SD4A 2Y9ZA 3HSFA 3ZPNA 3HM5A 2CWEA 1T56A 1EE6A 3A2KA 2DYRH 2FX0A 2P6SA 3Q0VA 3E5XA 4MNUA 4OPWA 4DOZA 3GZ6A 3HOVJ 2EZHA 2X6YA 1YJNB 2E19A 3HJEA 2F1LA 1TLHB 2Z33A 4LLNA 1SD7A 2BVNA 4F7ZA 1SMYF 2DMNA 1JNYA 2L7MP 3NAUA 4IZZA 1VQ4B 3CCUI 3ZZ0A 3CCJI 2NSTA 1ETOA 2H27A 1S29A 1OHHA 3QSYA 4YIRX 4KIFA 2VKVA 1I3QJ 3WG7H 1Z6RA 3P4GA 1AMOA 1FLIA 4UY8I 4OAYA 4CCOA 2K3PA 3O8GA 4LIVA 4EJOA 1WZ2A 5L3EA 1B2RA 1QVGB 2LRDA 3IC7A 3I71A 3E5UA 3DFGA 4U9UA 3GFJA 5J1YA 5IYCJ 3OYAA 3HHGA 4XMYA 4FCYA 3I53A 2LG4A 1FBSA 1MNDA 4I98B 1NBMA 2H8RA 2YU9J 5FJ8J 1FIPA 3E6DA 3B4NA 1D0XA 1IJEA 2LY1A 1YE9A 2B5OA 3ASSA 2AXLA 4MEXF 1U2RA 2UVFA 3PO2J 5LD2C 1Z7LA 2A69F 3CO7C 2A6HF 2MA3A 3VO1A 4FETA 3G1LA 1UD4A 3OJWA 5FO0A 5TRDA 2O1DA 5TGTA 3S1MJ 4M6YA 1T95A 2KQRA 5EGOB 1EFRA 4W8TA 2BV3A 3KFWX 5IP6A 2CW0F 4HNVA 2CSOA 2BM4A 5DD8A 4EATA 4GRIA 3L9FA 3MAJA 3C1DA 1O8GA 1MMSA 4AWXB 2ESHA 1KD1D 1UHWA 2L2OA 2M45A 1O8IA 4ENMA 2KVOA 3GYHX 5GAGJ 1T38A 2ESNA 2HR3A 1ZG1A 3M9AA 4FE4A 2DFEA 4HAMA 4I7HA 4S0HB 5FO1A 2ZXIA 1ELOA 1MMDA 3GZNB 2QMUA 2HMAA 2J8KA 4C2LA 3CP8A 2VKDA 3HHHA 2K7LA 1FIAA 5B66C 2JN9A 3Q0WA 3AGPA 1DDNA 3ZQHA 1U0JA 1Y0RA 1BW6A 2E36A 4W8QA 1ETWA 1HBXG 4RD4A 1H85A 1O8DA 3RPUA 1MKMA 3FM5A 4LK1F 5L3DA 3K6GA 1J59A 4BQAA 2BMWA 3OYKA 5EMNA 1W0KA 2GPJA 2DOFA 3JRGA 1BN5A 2E35A 4A6DA 2WC2A 1WMRA 1VQ7I 3WQZA 3GTKJ 1GAQA 1YI2I 2XB5A 1U3EM 4BJ5C 2F48A 2A61A 2G9WA 2MYSA 4ASNA 1NRKA 1XG2A 3DBHB 3R0AA 2F4OB 2VXDA 3MFKA 2NT6A 1YLOA 3QFTA 3BCBA 2MD0A 2VT3A 1MH3A 4V2FA 1R5NA 3O2PE 4YDTA 2MC4A 1VQOB 2LP0A 2OTJI 2CV0A 2EK5A 3NB2A 5C3EJ 3ZQCA 4G1VA 3F9KA 1OGJA 5J3LA 3JAMZ 1R5GA 2NPFA 4OOXA 2VN2A 1VQLI 1O8HA 2DCEA 3VNVA 3H92A 4A3DJ 3S93A 4AC0A 3J7AY 2R7RA 1TVCA 4XLHA 4EGYA 5F08A 5AONA 3FMRA 3GQ7A 4PSXA 3CUQA 1XD7A 2OD5A 5DN6A 1Q7YD 2LF7A 3E1SA 2STTA 2INUA 4P25A 1OR7C 2RC4A 4HPQA 3S1QJ 2FMYA 5FRNA 4WWVA 4JX4A 1LEAA 1N75A 4UVCA 3VEPA 5THXA 4U87A 2OYNA 4IOAF 5JMCB 5AN9A 1MD0A 2NSPA 2LSOA 3RCOA 4P1WA 3BTCA 3A03A 2DLLA 3OOPA 1K4ZA 5F0FA 2L7KA 4OINF 4XRSG 3BWGA 4RB1A 2B0RA 3GFIA 1FTZA 2EILH 4F92B 4OMZA 3ZOBA 3OSFA 2HVSA 1Q81D 1G4DA 1W2BB 1SVOA 5F0HA 3I4NJ 3BY6A 1ETYA 5IP7J 3ONQA 3BPXA 4P2NA 1KK3A 1VBLA 4KDPA 3IUOA 1P9QC 1LE8B 4BEHA 3WGIA 2R7SA 3CZ6A 3LA3A 3CTAA 3C7JA 2DBBA 1QQ1A 4Z4SA 5HDGA 5ILSA 4BEHB 4X7CA 4URRA 2R3SA 2CYYA 3FWEA 3ASTA 2Y9YA 3GVJA 4LG0B 2D2WA 3PVDA 2V7FA 1V0FA 3W5HA 4A3LJ 5ILUA 4QVAA 4N0BA 1V5VA 1QG0A 4OJPA 2R5ZA 1R1TA 2HI3A 2H8WA 4CXFA 3DTKA 5F4MA 3LFKA 2O6WA 5D5UB 5D4RA 2D3NA 3HOSA 2L9RA 1WHUA 1MJAA 1XGSA 4BKXA 5FLXZ 4E7HA 2VBXA 2PN6A 5TY0A 4YEIA 4E7IA 1JJ2B 1FBQA 2LOOA 2CFXA 4N9HA 3TMOA 1ZRDA 4P12A 1ORKA 1PJ6A 3CLQA 3FMSA 4MO7A 3FXLA 1KQ9A 5M5WJ 3ML3A 3HSEA 4LOCA 4RS8A 2DK5A 2O04A 5TISC 2ZTGA 2GQFA 1PLUA 4KH3A 3TO9A 5CKTA 2K9SA 2Q6KA 3ZQLA 1N0UA 1W34A 4HX8A 1MBGA 1HDPA 1WJCA 2DMPA 3MCAA 4C3HJ 4A6EA 5K7FA 5JLWA 3OYDA 4GO1A 2UVEA 4BH9A 4GGGA 3PUMA 2HKOA 2VJ4A 3GTMJ 2D9RA 1HW5A 2M7AA 2ZXHA 2VLAA 1AIRA 1V5GA 2QEXB 1IN4A 4OJOA 2EBIA 3CCSI 3CCEB 1U8BA 1IN8A 3U1KA 4WZKA 1BQEA 2DN0A 4BDZA 2M2EA 2XV4S 1PJ5A 5D8LB 3A1PA 2D5VA 2BSAA 1ON1A 2HOAA 1JKRC 4LBYA 4PFPA 1VQPI 4OOIA 4C3IJ 4IRIA 1E64A 2BXYA 3ESWB 5HDKA 3H5NA 4A3EJ 2DERA 3E6BA 1D2EA 2CC2A 2R7ZJ 3VOEA 1ZLJA 2M1BA 2ME0A 1GLNA 1ENHA 3K1MA 4XLPF 1E0EA 5J35A 3ZGKA 3I4PA 4OIPF 1D0ZA 1JTXA 1A5JA 5DS0A 3MWMA 4JYKA 4BQQA 2LFBA 3HKZN 1F1ZA 4CHUA 1V54H 2GIZA 4AD9A 2IA0A 2QTLA 3SJMA 2RC6A 2GJKA 2CJJA 1D8KA 3LWFA 1UHSA 3PNTA 3BJAA 3CESA 2VYQA 1HA3A 2R4GA 1FNCA 1IF1A 1OCOH 4A0XA 4RLFA 3PO3J 3QPSA 2HPIA 4C0SA 3WTWC 1J7KA 2JT1A 2LYCA 1TWHJ 3BR0A 2VJIA 2E5NA 1JRGA 1SFEA 2DYSH 1R4NB 2VIXA 2BEOA 2KJCA 2L9SA 1LM1A 2IS2A 3QAHA 3HPGA 1IUFA 2EINH 3F0CA 4IKFA 3EQOA 3HRMA 1I8DA 4OJLA 1K8FA 4LGWA 1UELB 4B47A 1BR1A 4RAYA 3FXKA 4UUSA 4L5JA 4DBRA 3OYCA 1XPXA 1WSRA 2C5HA 1KMHA 2W7ZA 3LJYA 3E97A 2LF8A 1E3PA 3HOWJ 3HPHA 3ABMH 3BH6B 1CF7A 1KU2A 2Q2EA 3KP3A 4M4SA 3RKYA 2E1BA 1TP4A 2XF7A 1OCTC 1QUFA 2QQBA 2Y69H 4YFXF 3CMAI 3DKWA 2EV0A 3L2VA 4X7FA 5J40A 3SXYA 4DK0A 1OQYA 4EM0B 1CF7B 3SFIA 1N78A 4L8JA 5DSZA 2V1NA 1LPQA 5HLIA 4A3GJ 1LQ1A 2QA4B 2QENA 1YJWB 2XAFA 4PGHA 4BE2A 3HTSB 2BM7A 4RGSA 1GVHA 2E1RA 3C3WA 5E3MA 2KRFA 2QYOA 1ZG3A 4N4NB 4CYCB 5HZAA 4M72A 3P26A 4BJ6C 2HGCA 5A2QK 3Q6RA 2X6XA 1XCVA 4RDLA 1UMKA 5ILVA 2HDWA 3L7WA 3HL2A 5LMZA 3F8MA 1T6ZA 1E17A 2I1LA 2KIQA 2ZNYA 5M3MJ 3Q0UA 4NB5A 5DV5A 3SDGA 4KT5C 1Z1DA 1S3JA 3D5SC 2YWEA 2OTLB 4MEYF 4E7JA 1JJ8C 2M4GA 4BYYA 1MNMC 2VPLA 2R7TA 4G7WA 4Y3OA 3GF2A 1K78A 1MSFC 4G7HF 4I09A 4ABZA 4KYWA 4D1QA 2QQ9A 4XN3A 1JUSA 1SFXA 2DT5A 2XRLA 1ZG5A 3BG3A 3CMMA 3LQQA 1E63A 1FPQA 2ECBA 3OYIA 3AGQA 4PZJA 4LLGF 3DCFA 1UG2A 3H94A 1B4AA 1HCRA 4OU0A 2PMDA 2CK3A 1W0UA 4CUGA 1VFCA 1AWCA 2D3LA 4XKVA 4JX6A 1EA3A 3ZQQA 1FOWA 2QTZA 3M3YJ 2DA7A 2VBUA 1FRQA 2E34A 1NB9A 4DYCA 5HS8A 4FN5A 5GAHJ 4KMFA 1IB0A 5E1ZB 1WGXA 1TWAJ 4CCMA 2PJPA 4FX4A 5BPDA 2ZZGA 1S9HA 3RJPA 2DQLA 3DPLC 3RDIA 3WU1B 1QVUA 3OZWA 5J1RA 3E20A 3H3VK 1T33A 1W5SA 4OOSA 4ZCMA 4KMUX 2VC1A 1WRJA 2VBWA 1DP3A 2BPOA 1FYKA 5ED4A 4OPVA 4ZZLA 1N77A 3SY2A 3CC4B 2OQGA 4W1UA 2B7EA 2RAEA 4F52A 3VSVA 1SMTA 1BI3A 1EP3B 2B9SA 2AQFA 2DTRA 3EDPA 4M3BA 5HLHA 4QV2A 2ZKZA 3V4GA 1H9TA 3SYTA 4XLAA 5GV7A 1USSA 3G1MA 5EYRA 3GRHA 2FBKA 3TEDA 2PIAA 1F36A 2XPWA 4QTRA 1T0FA 5F1JA 2KP6A 2ELHA 1LB2A 4X7DA 4ASUA 3Q3SA 4MGRA 1YO5C 2CUJA 1APLC 4IHSA 3J81K 1BI2A 3CC7B 4YRVA 1GXQA 3KP4A 5H6RA 3W6KB 3WG9A 4A93J 1TT5B 2F1MA 2HCJB 4RPDA 4M53A 2VUMJ 4RD1A 3AVTA 4ETSA 4NHJA 2R7UA 2V4DA 1G59A 2VFMA 2X9DA 2GREA 2VBTA 1UD2A 3G2BA 2EWEA 1IDKA 2A68F 1JUMA 1EH7A 3ABLH 2CQKA 3NRVA 4AIJA 3W2AA 3G71B 1Z05A 2ID6A 1LDJA 3ABUA 5H20A 5A2QZ 2QVOA 2XAJA 2PG4A 3P5JA 1P92A 5FD6A 3CPXA 1YW9A 3U6BA 1DABA 1R58A 1JKOC 1XTAA 1G7TA 5BS6A 4PAAA 4EGZA 3ZMZA 3HSRA 2FVGA 2P5KA 3NEUA 3U21A 1FNBA 5D8KB 4Z4WA 3OZUA 1QA2A 1QZYA 1MBHA 5D4SA 4EJUA 3MHPA 2CQNA 4A3CJ 4I2OA 4ZYEA 4BQNA 3N4MA 2P5VA 1ZR2A 3TDZC 2GZWA 2GOMA 3QQAA 4XIDA 3I56I 1GUUA 2NYXA 2QF7A 1E43A 1MIJA 4FXUA 1WDTA 4WQMA 1R4MB 4HNTA 5M5YJ 1W0TA 2V79A 3ASOH 5LGTA 1VQ5B 4XD7A 3CCVB 1MJ9A 3LSMA 1HOMA 3JQRA 4Y33A 3BQZA 4A0ZA 1VF9A 2XSDC 1LFPA 3M1CA 3DKYA 5ICEA 3CMYA 2HQNA 1W9XA 2M0MA 1K61A 3A01A 2WBMA 4DJAA 1NDHA 3QU3A 1XSDA 2DY1A 2HNHA 1RPWA 3A3GA 1K5CA 2E2JJ 4DZPA 3A01B 1COWA 2ZO4A 4X07A 3PJRA 1QVFB 3W5VA 2F5DA 1HF0A 2RGVA 2A6TA
chains in the Genus database with same CATH topology
4GQNA 1OGOX 3ZPNA 1EE6A 3A2KA 4U4BA 4Z03A 4NQWB 2OUMA 2PYGA 4CCNA 3FDYA 4DOZA 2JSPA 2X6YA 4DBQA 1IRXA 4PJJA 1WJDA 3S3MA 3H9GA 4P5OA 4QPQA 5KHDA 3VSTA 3H5AA 3H5RA 3DPTA 3I9V2 3K4NA 5CPRB 4IZZA 3HG9A 1LKXA 1PKVA 4F93B 4II3A 2X85A 3PSIA 4XKCA 2NSTA 1OHHA 2RQQA 5FL7A 3T51B 3ZPPA 2NTPA 5IK2A 3DTIA 2WAQA 3A3BA 2VBMA 5HNFA 4OAYA 4CCOA 3L2WA 2Z6BD 2K3PA 4KITB 3ZXSA 2K5CA 3CJRB 4LIVA 2ZTNA 3GQBA 2O17A 2LRDA 4XL9A 1PYVA 2WSSA 2KZVA 1IDJA 2MABA 1O8EA 1UAAA 4BXFA 3OYAA 4XMYA 4C2TA 3NWSA 1MMAA 5CQGA 2LG4A 3DEEA 1DBOA 4OZZA 1MNDA 2HZDA 1NBMA 2XAUA 4YZXA 3KX2A 3B4NA 4G6IA 4E7LA 4TKOB 1D0XA 4PJLA 4YXWA 2LY1A 3OYLA 1YE9A 2L9NA 3D5RC 2WJVA 4OAZA 4ANJA 4IQJA 1BLIA 3OYMA 1BMFA 2UVFA 5LD2C 1Z7LA 4PMHA 4FETA 1UD4A 2INVA 4F55A 2X1CA 4C30A 2O1DA 5HLTA 2QX3A 5TGTA 1T95A 1KCDA 1NG7A 2KQRA 4X0GA 4W8TA 1EFRA 4DK1A 3FY3A 2V31A 4ZTFA 2A5WA 4AVZA 4RM3A 3MD2A 2XZOA 4XN0A 4EATA 4P22A 4GRIA 4Z1MA 1W36D 3TL4X 1J09A 1O8GA 4NC8A 2VQLA 2NZMA 2M3AA 5AMVA 2L2OA 3MMYB 1O8IA 4F3QA 1DGRM 2KVOA 1MW7A 2V26A 1ZELA 2DT6A 1KTWA 4HRIA 3FBNB 2X3HA 2VKHA 3NE5B 2WA0A 2ZXIA 1MMDA 3K4LA 5HOOA 4C2LA 3CP8A 2VKDA 2E1MB 1IB4A 1NG6A 2WB1A 3DKXA 3OOUA 3OMYA 4CSWA 4OJ5A 1E3XA 2IGKA 1Z3YA 1DQUA 1U0JA 4CZCA 2GOXB 2LREA 2PJRA 4W8QA 2IXSA 3PFYA 4Z05A 1O8DA 3QYFA 1SKYB 2XSJC 3V42A 3B90A 3K6GA 4XNFA 2W6JA 2PJRB 3OYKA 4PK4A 1W0KA 2GK6A 2KPMA 2K9LA 2ZZFA 3ZR8X 3S3NA 1WMRA 1MMGA 3H35A 2HVQA 3WQZA 2W1OA 3VMVA 4PFOA 1O88A 4BJ5C 4EW9A 2MYSA 4BE1A 1NRKA 1HA8A 1XG2A 4PSWA 3I3LA 3KYLA 1LVKA 2VXDA 3HOTA 4J01A 2NT6A 3GBGA 1Y6IA 3BH4A 2MD0A 3BCBA 2CW8A 2M7BA 4B44A 1FMWA 1TT0A 2MC4A 4CCJA 3OY9A 4CA0A 3VDXA 3VYTB 1UD3A 1WTHD 4W8SA 1Y56A 2WPDA 2VBEA 4AU7A 2CV0A 4I84A 3S32A 3F9KA 3OL3A 1LDKB 4CH7A 2KRCA 2ZSIB 3CF2A 2DCEA 1O8HA 2UVEA 3OWTA 3S93A 3J7AY 2R7RA 4XLHA 3PL8A 3GQ7A 1VJSA 1D1AA 3EUKL 2X53S 4PSXA 4W8RA 3IAM2 2JJ1A 5DN6A 1K6YA 3E1SA 2R7XA 4NK6A 4ZC3A 5JHFA 3OYJA 3H9QA 1QU3A 2GJRA 2INUA 4H4KC 1OR7C 4PUSA 4HPQA 3CP2A 2KMUA 3RPUD 4BU2A 1OFLA 1BR4A 5FRNA 3FPPA 1N75A 2KLOA 4U87A 4ZDOA 3BG6A 2IS1A 2CH0A 4B48A 3HAGA 2NSPA 3RCOA 4P1WA 2BVLA 3B8YA 3LSGA 1E3ZA 4ZYAA 5HKKA 1FMVA 2L7KA 2LZJA 2ZZQA 3BCDA 2WJYA 2DJIA 3E0JB 2V6EA 1T5EA 4XONA 1WPCA 2XOKA 1UG0A 4F92B 1I18A 4KKTA 2HVSA 2K9MA 1X0CA 1H8EA 2P0WA 2VJJA 3GVLA 4HWVA 3L2UA 3ONQA 2OC6A 3VSKA 4DIQA 1VBLA 4XQFA 3IUOA 3QYEA 1P9QC 2XGJA 4BEHA 2LC2A 3DU6A 3CZ6A 2R7SA 3LMWA 3OIQA 1V5FA 2E5ZA 1UD8A 4B43A 1JTAA 4E0FA 3K4MA 1X19A 4BEHB 4ZTJA 4D9JA 3OYEA 4URRA 3OEHA 2XZPA 3GVJA 3A4CA 2V7FA 4HEA2 1V0FA 1AA7A 3OFNA 2GK7A 2Z8GA 1O8KA 4OJPA 2I8DA 2R7QA 4NK8A 3DTKA 2IGNA 2R7VA 3LSHA 2D3NA 3HOSA 4Z06A 3K4KA 1VZ0A 4JQFA 4U7BA 4LIUA 4E7HA 4DNRB 4JMQA 3H9JA 4E7IA 3VYRB 3PSFA 2LOOA 2X6WA 3H0DA 3T53B 3TMOA 2GJPA 3C2GA 2W82A 4ITVA 4LG3A 2MFZA 2M5SA 1IA5A 2W6IA 2O04A 3OL4A 3VYSB 2KHMA 4XLEA 3AL0C 3VYUB 2ZTGA 1PLUA 3AKZA 4XR6A 5CKTA 1HG8A 2NTBA 4YZQA 1RWRA 3ZCOA 4ZDLA 3UNGC 4AYBA 1QHGA 3UR3C 4R79A 1WJCA 4HNUA 4BACA 4YZ0A 2F43A 3JU4A 1NHCA 2E60A 2JA2A 1SAUA 4NNJA 3K4BA 3OYDA 3BG7A 1MABA 2QKLB 3OR1C 4II2A 1O8LA 3DQVC 2LBFA 3DPUA 3OYFA 1JI8A 2VJ4A 4PJMA 2M7AA 2X51A 2ZXHA 3DLAA 4U49A 4BS9A 2VLAA 1AIRA 1V5GA 5KNLA 1WJFA 4OJOA 5CQEA 2IS4A 2BSPA 4Y4RA 4BDZA 1X4OA 2QXZA 4E7ZA 4G6TB 1HVXA 2WY8Q 4ZDPA 4XLCA 3ZSCA 3T9GA 4PFPA 2M4KA 3SDBA 2XZLA 3H5NA 3QODA 2NTQA 1G8XA 2BW3A 3RTRA 1V5EA 2JIZA 3T56B 1GLNA 2W4SA 2ZZEA 1E0EA 3K70C 3TBIA 2VB6A 3ZGKA 2BW3B 1D0ZA 1WFXA 2V4JC 2O0WA 3OS1A 3OEEA 4BQQA 1WJEA 1VLYA 2VQHA 3OYBA 1BPLA 2GJKA 2X8KA 2V9KA 2L5QA 3OYGA 2CW7A 3MKWB 3DDYA 2HU9A 3PNTA 3CESA 1H80A 2QKMB 2ZFUA 2HVRA 2Z2SB 2R4GA 3VMWA 1RU4A 4RLFA 2NT9A 2HPIA 4BUPA 3W3CA 2LYCA 1X4PA 2VJIA 3K10A 2VASA 4BGDA 5LFAA 3BLYA 2E5NA 1JRGA 2VL8A 2Q1ZB 2VIXA 4RMNA 4HG2A 4XKWA 2L9SA 2OV7A 4XLFA 2IS2A 2LH9A 3DTEA 1KCCA 3FKJA 3HPGA 1D1CA 4IKFA 4YELA 3EQOA 2PYHA 1I8DA 3HUGB 3NWTA 3W2VA 4B47A 1UELB 3QOEA 1BR1A 4OJLA 3OYCA 4DBRA 2UV1A 1KMHA 3GQ9A 2CV2A 1QHHD 1MNEA 2Z16A 3G05A 4KJZA 3HPHA 2XNDA 2DOAA 3OR2C 2E1BA 4DGWB 2XF7A 4E6KG 4ZJZA 4JOMA 3L2VA 3VR6A 4DK0A 2BVMA 1N78A 4L8JA 3VSLA 1OOCA 4MXNA 2V1NA 3KEWA 1TZLA 1ERDA 4XM3A 2JDIA 3D5LA 3KRGA 4E7SA 3L2QA 1DBGA 1OFMA 2W7NA 4BE2A 3W2WA 4HIZA 4IX7A 4BE0A 4DNTB 4N4NB 4BL0B 1UD5A 2F5VA 1W0JA 4BJ6C 2CUZA 3LNNA 2ELJA 2X6XA 4MLOA 1BN8A 1YX3A 1MMNA 3FKSA 2KL4A 4C2UA 3OPOA 4OJ6A 4E4HA 2HDWA 2JVHA 2RREA 4C9YA 3HL2A 2WAEA 3IP4B 2KDOA 2WADA 2R7WA 2QE7A 2QY1A 3GQAA 3S3OA 3OS0A 4B3GA 2PMZA 3A1YA 4LITA 3CJQB 3D5SC 3QYBA 2IS6A 3DWLE 2VJ5A 4XKBA 1T0FC 4E7JA 2M4GA 2RNGA 2VPLA 4BJTA 2XF5A 2E1MC 3K4JA 2XDVA 2R7TA 4G7WA 4Y3OA 3SEZA 2CFOA 3LSIA 4YEJA 1PE9A 4D1QA 1D0YA 1BR2A 4XN3A 2R9VA 4CCKA 3K4CA 1O8FA 4XOTA 3HXLA 1V0EA 3CMMA 3OS2A 3OYIA 3SZGA 2DXIA 4XOPA 3H94A 2CK3A 2V7QA 3GQ8A 4HSTA 1UD6A 5C1EA 5KCMA 4CUGA 2D3LA 1SFKA 4XKVA 1O8JA 3LFUA 1EA3A 2F4IA 3ZQQA 4UZUA 4OWRB 2NOJB 3M8JA 2O5RA 2IQ7A 3EQNA 2WZPP 3MKYB 4FASD 2AQEA 1K28D 1WP6A 4CCMA 3BCAA 2ZZGA 1S9HA 3RQ4A 3K70D 3ZIAA 3C2HA 1FX0A 3DPLC 4BQOA 4HSRA 3PUBA 1QJVA 2FUG2 2Y0SA 1DP3A 1OB0A 1RMGA 4YZAA 2BOLA 1N77A 3VSVA 2CS3A 2IGMA 2LBFB 4F52A 4RM2A 3HKZA 3BC9A 1VF7A 2AQFA 3SEQA 3SYTA 4G7XA 1X1BA 4XLAA 4B3FX 1GQ8A 1OLTA 3GRHA 5C1CA 3OW7A 1KZLA 3GVKA 3JURA 1X1CA 1R6RA 3FBIB 1DGWY 4MR0A 4QPOA 2KP6A 3OE7A 3BC8A 4N4OB 3UW0A 4ASUA 1O8MA 1WJAA 2CUJA 3OYHA 2DT7B 3AFHA 4YRVA 3L2RA 4BDYA 2F1MA 5HNHA 3RSNA 2IGOA 5FROA 3KEYA 1E1QA 2CMPA 5HVQC 2R7UA 3EPZA 2V4DA 4F91B 2XC7A 1G59A 1E1RA 1BOBA 4RLQA 1UD2A 3G2BA 2EWEA 1IDKA 3BCFA 3PNVA 2WY7Q 3LMMA 1OGMX 1X1DA 3W2AA 2WAFA 1KONA 3EUAA 3N05A 2LY2A 1W36C 5CDFA 4CCLA 3OIPA 1BHEA 2UUZA 1CZFA 1YX5A 3U21A 3VWBA 4E7KA 3AL0B 2HQAA 4TSFA 2VQGA 1QCXA 1PJRA 2VBKA 3LSKA 1X1AA 4IQ4A 2HPMA 2X1EA 4BQNA 4KISA 2CV1A 3OYNA 5FRMA 2GOMA 4NUBA 1H8HA 4FXUA 1E43A 3WWGA 4KKSA 1WJBA 4KT6A 4HNTA 2XF6A 4NC7A 3EUHC 3A35A 4KKUA 3LL7A 4XD7A 2HLDA 3LSMA 4OZYA 3VSUA 2JUGA 1Z3XA 4Y33A 2JJ2A 1PXZA 2UWMA 3ZRGA 2Q2EB 3SUCA 2VXZA 3OOCA 1LFPA 3M1CA 3PNYA 3DKYA 1W9XA 4XORA 2JVGA 2M0MA 3FHNA 4J00A 1Z21A 3OAAA 2W00A 2WBMA 2VQCA 3S8PA 3IAS2 2R7OA 4DJAA 3DU5A 1E79A 2O0VA 2X1DA 2PECA 2HNHA 2KRHA 2DIEA 2Z1DA 3A3GA 1D1BA 1HZEA 1K5CA 4TT3A 2ODLA 3HC7A 3MKZA 1COWA 4PJNA 3PJRA 2F6CA 1WJ5A 2ZSHB 4B3XA 2A6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJO A;  1OGO X;  3GQ8 A;  2BSP A;  1EE6 A;  5C1E A;  4U4B A;  2NTP A;  4Z03 A;  2QXZ A;  4W8S A;  2PYG A;  4XKV A;  1O8J A;  2X6Y A;  4XLC A;  2VBE A;  4I84 A;  3ZSC A;  3T9G A;  2IQ7 A;  3VST A;  3EQN A;  1O8H A;  2NTQ A;  4XLH A;  2X85 A;  3GQ7 A;  2NST A;  4W8R A;  3ZPP A;  4NK6 A;  2O0W A;  2INU A;  1QJV A;  2VBM A;  1RMG A;  4YZA A;  3VSV A;  2O17 A;  1OFL A;  4XL9 A;  1H80 A;  1IDJ A;  1O8E A;  3VMW A;  4XMY A;  1RU4 A;  2NT9 A;  4XLA A;  2NSP A;  4OZZ A;  1DBO A;  3B8Y A;  1GQ8 A;  3GRH A;  5C1C A;  4YZX A;  2VJI A;  3B4N A;  3JUR A;  4MR0 A;  1JRG A;  4XON A;  4XKW A;  3UW0 A;  1O8M A;  4XLF A;  2UVF A;  1X0C A;  1KCC A;  2VJJ A;  4HWV A;  4PMH A;  4YEL A;  2INV A;  2PYH A;  3EQO A;  4OJL A;  2O1D A;  1VBL A;  2QX3 A;  4XQF A;  3GQ9 A;  1KCD A;  4W8T A;  3FY3 A;  3LMW A;  4AVZ A;  2EWE A;  1IDK A;  1JTA A;  4XN0 A;  1OGM X;  4URR A;  1O8G A;  1OOC A;  4MXN A;  2NZM A;  5AMV A;  1O8I A;  2Z8G A;  4XM3 A;  1O8K A;  3KRG A;  1BHE A;  1DBG A;  1OFM A;  4OJP A;  4NK8 A;  1CZF A;  1KTW A;  2X3H A;  4Z06 A;  1QCX A;  2VBK A;  4C2L A;  1IB4 A;  4OJ5 A;  1BN8 A;  2X6X A;  3WWG A;  4OJ6 A;  2X6W A;  2QY1 A;  3GQA A;  4W8Q A;  1IA5 A;  4Z05 A;  1O8D A;  2O04 A;  4XLE A;  1PLU A;  3B90 A;  4OZY A;  4XNF A;  1PXZ A;  3VSU A;  4XR6 A;  2NTB A;  1HG8 A;  4YZQ A;  3SUC A;  1RWR A;  4YZ0 A;  1NHC A;  4XOR A;  1WMR A;  4YEJ A;  1PE9 A;  2O0V A;  2PEC A;  4XN3 A;  3VMV A;  2UVE A;  1O88 A;  1O8F A;  4XOT A;  1O8L A;  4EW9 A;  2ODL A;  1K5C A;  1XG2 A;  4U49 A;  4XOP A;  1AIR A;  2NT6 A; 
#chains in the Genus database with same CATH topology
 4GQN A;  1FTT A;  3PM1 A;  2COB A;  4DQL A;  1KK0 A;  3QOP A;  3WTZ A;  1RI7 A;  1XMX A;  3FMQ A;  4HDU A;  1K4S A;  1MBE A;  1X1P A;  4CCN A;  2JSP A;  2JTV A;  2P4W A;  3F23 A;  1Y1W J;  2ICW G;  1ZGA A;  2AHQ A;  3GFL A;  4PJJ A;  2XT2 A;  1R5I D;  3S3M A;  3H9G A;  3AVY A;  4P5O A;  1EWY A;  3RY8 A;  2ECC A;  2STW A;  3CC2 B;  1E3O C;  3L00 A;  3H5R A;  3I1F A;  3R6S A;  3I9V 2;  5JLX A;  4Q48 A;  5CPR B;  1LKX A;  1PKV A;  1R7J A;  2DA1 A;  4F93 B;  2F5F A;  3AVW A;  4XKC A;  3ZMT A;  2RQQ A;  3T51 B;  3F6O A;  2FU4 A;  3DTI A;  4UNO A;  5FKL A;  2WTE A;  3L2W A;  3TW7 A;  5FNZ A;  5FLM J;  1OCP A;  3GQB A;  1BJA A;  2FBI A;  2K5C A;  2F5E A;  3CJR B;  3GLL A;  3KCC A;  3O6B B;  3ZXS A;  4KIT B;  2ZTN A;  2O17 A;  1PYV A;  2KZV A;  3VOD A;  1IDJ A;  5E79 C;  1O8E A;  1WU8 A;  3IRQ A;  4KIB A;  2NAZ A;  3JRA A;  2E7X A;  3EUH A;  1ZM4 A;  4OZZ A;  1S8N A;  4M6X A;  1BA5 A;  2HZD A;  1TNS A;  1ZAO A;  3CF5 F;  1M90 D;  2PI0 A;  3KZZ A;  4UV9 A;  4QWQ A;  1YIJ B;  4YXW A;  1JUP A;  3OYL A;  1P4X A;  2L9N A;  2A05 A;  4OAZ A;  1WWX A;  2JSC A;  3TP0 A;  4ANJ A;  1BLI A;  1MRZ A;  2VZL A;  4X7E A;  2AS5 F;  3CB4 A;  2VE9 A;  1S72 I;  2IT0 A;  1QRY A;  2F2E A;  4C30 A;  1UCR A;  5HLT A;  2QX3 A;  4B3A A;  5KVR A;  1EH8 A;  1KCD A;  1NG7 A;  4X0G A;  4BY1 J;  4DK1 A;  2H6B A;  2V31 A;  3AVV A;  4ZYD A;  4L0Z B;  2A5W A;  2XPV A;  4RM3 A;  3MD2 A;  4AVZ A;  4E70 A;  3BY2 A;  1D8J A;  4P22 A;  3PQJ A;  2EWN A;  4HX7 A;  2OK7 A;  5AIP A;  3TL4 X;  2GXG A;  2M9H A;  5JLV C;  2LVS A;  4NC8 A;  2NZM A;  2C6Y A;  5DUI A;  5E8G A;  2P81 A;  3TKY A;  2DOG A;  3SEJ A;  3MMY B;  4F3Q A;  1SVM A;  4KA4 A;  1A31 A;  2I10 A;  3BR5 A;  2V26 A;  3CUQ C;  1BIA A;  4YAF A;  3KYD B;  2DT6 A;  2QBY A;  1LUJ B;  4HRI A;  2VKH A;  1YJN I;  1UHM A;  2DOE A;  3K4L A;  4HV6 A;  4P3Y A;  3R61 A;  1MBF A;  2QBY B;  5J3O A;  1IB4 A;  2NRA C;  1NG6 A;  4RB3 C;  3T1B A;  3P27 A;  5K7Z A;  2W24 A;  2IGK A;  3ZP5 A;  1Z3Y A;  2BY0 A;  1ZR4 A;  2PMU A;  1K7A A;  1VQ4 I;  1QRC A;  3WTV C;  2GOX B;  2LRE A;  4L9J A;  2PJR A;  3WY9 A;  2IXS A;  3PFY A;  1WKM A;  3SLN A;  3QYF A;  3FK7 A;  4BBR J;  3WTT C;  4Z4V A;  3AG3 H;  3V42 A;  4XNF A;  1TC3 C;  2W6J A;  2PJR B;  1ITY A;  4X06 A;  2GK6 A;  1P7I A;  4HLY A;  4ZZD A;  2XKO A;  5E3N A;  5LHI A;  3R6K A;  5FD5 A;  1W35 A;  3KYC B;  2EIJ H;  2TRT A;  2HVQ A;  1HDD C;  4Y7N J;  3VMV A;  4R1H A;  5DNS A;  1TSP A;  1O88 A;  1O57 A;  2QZ8 A;  3WGH A;  2O61 A;  1H89 C;  4BE1 A;  1W7P A;  4NDL A;  4UZE A;  1QA1 A;  1EFT A;  4LMY A;  2YR2 A;  4B4D A;  2ZBV A;  2YX7 A;  3BH4 A;  2DFH A;  2YU3 A;  3E6C C;  1KYW A;  2ZBK A;  2BXZ A;  2CW8 A;  3GCM A;  1TT0 A;  1XE1 A;  4NCN A;  2NTP A;  1KA8 A;  3ZQG A;  2AHO A;  4JBA A;  2VBE A;  3PIO F;  3CPW B;  5IOZ A;  3ELK A;  2XPU A;  2EPF A;  2ZSI B;  2KT0 A;  3CF2 A;  5KK1 A;  3OWT A;  4AVP A;  4H0E A;  1I1G A;  1P4W A;  3ZBU A;  5FKM A;  1ZK8 A;  5DYM A;  1KQ0 A;  3IAM 2;  4G1B A;  4HE6 A;  2DFF A;  3A8K A;  1YFH A;  1K6Y A;  4M6V A;  5HXB A;  4ZC3 A;  4NK6 A;  3OYJ A;  4FQG A;  3U9G A;  1YRN A;  4BXX J;  2FE3 A;  1PUF B;  1YJ9 B;  4LBZ A;  3I64 A;  3RPU D;  4QHY A;  4Y15 A;  3FXU A;  1YRN B;  1U78 A;  1IRF A;  3FPP A;  1N06 A;  4ZDO A;  1I1S A;  4WF2 A;  3BG6 A;  1HKQ A;  2L02 A;  2CG4 A;  3JRD A;  1ZLK A;  1ZRF A;  5L46 A;  1FOX A;  3B8Y A;  2BY2 A;  1UST A;  2XTX A;  4ZYA A;  3PA1 A;  5HKK A;  1FMV A;  2LZJ A;  2ZZQ A;  2WJY A;  4MYT A;  4WCG A;  1T5E A;  5CVU A;  4XON A;  3ASP A;  1WPC A;  1UG0 A;  2DFI A;  4LD5 A;  5IYW A;  5L3F A;  1GT0 C;  1X0C A;  2HYG D;  3ZMV A;  1H8E A;  2P0W A;  4HWV A;  2Y2Z A;  3NAW A;  3COA C;  3L2U A;  4BY7 J;  1KGS A;  4HBL A;  3ES9 A;  3JRB A;  1OB2 A;  1POG A;  3VSK A;  1ZKG A;  3FXO A;  2L7F P;  5D6E A;  3A0B C;  1K8A D;  2ZCW A;  2CGP A;  2G0Y A;  2LC2 A;  4FT8 A;  4LLL A;  3JQP A;  3V8L A;  3WGG A;  1V5F A;  3VB2 A;  2E5Z A;  4ENK A;  5B5E C;  2K27 A;  4RB0 A;  5CLS A;  1JTA A;  4BHC A;  2K9N A;  1Z9C A;  1DUX C;  2V1X A;  4ZTJ A;  1XGO A;  1I27 A;  3OEH A;  4HYE A;  5CVI A;  4I0A A;  1HC8 A;  2XTY A;  4TMZ A;  2DQR A;  2EFN A;  2VNI A;  1I5Z A;  2ZL7 A;  1O8K A;  1VLO A;  3V8J A;  3JCU C;  2R7Q A;  1VQO I;  3ONU A;  4WZL A;  1L3L A;  4NK8 A;  3TH0 A;  3KZI C;  3LSH A;  5J1U A;  5EZH A;  1VQN B;  5EF6 A;  4U7B A;  4FK8 A;  4HE5 A;  3ISP A;  3H9J A;  1E3H A;  3WU2 C;  3VYR B;  5DDG A;  3PSF A;  4WXC A;  2P8T A;  3A02 A;  2R92 J;  2X6W A;  1RET A;  3T53 B;  2PMZ N;  2V7T A;  3T5X A;  2GJP A;  1IN5 A;  1XDS A;  3C2G A;  1R22 A;  2ETH A;  3K1P A;  4ITV A;  1YIT B;  1B9N A;  4UXN A;  3WYA A;  1NH3 A;  1R1U A;  1ZQ3 P;  4EV0 A;  4YHB A;  3CCM B;  2KHM A;  4XLE A;  3VYU B;  3AKZ A;  2BY3 A;  2NTB A;  1HG8 A;  3MMP A;  1RWR A;  3VO2 A;  3ZCO A;  2K9Q A;  1PP8 F;  2XT4 A;  2PE3 A;  2HOS A;  4G94 A;  1HST A;  5F27 A;  4BAC A;  3FIS A;  2VBS A;  2JA2 A;  2V1D A;  3K4B A;  2BGJ A;  2DJN A;  4II2 A;  3DQV C;  3BTL A;  1FOK A;  4PC6 A;  2PX9 A;  4PJM A;  3IH4 A;  1VI0 A;  2VE8 A;  2X51 A;  2G7U A;  1A8P A;  4WXH A;  3ZN1 A;  4GDF A;  1FOY A;  5KNL A;  3HIF A;  5FKK A;  3PSS A;  2IS4 A;  1NJI D;  1OGI A;  2VFQ A;  4I0B A;  2L4A A;  4PDK A;  4G6T B;  4E7Z A;  2QXZ A;  2MH9 A;  4U0Y A;  2VPR A;  4XLC A;  3H0G J;  4B8X A;  2XIG A;  3J80 Z;  4AF7 A;  3T9G A;  5IYP A;  3SDB A;  2O8K A;  4DW6 A;  2ZME A;  1HXD A;  2Q8K A;  4KUM A;  2NTQ A;  3C18 A;  2BW3 A;  3FIW A;  3RTR A;  1V5E A;  3T56 B;  3Q9S A;  4U0V A;  1F43 A;  3K70 C;  2VB6 A;  4P26 A;  2BW3 B;  3ML6 A;  2VI6 A;  4Q7J B;  1M1K D;  1CNE A;  4D5C A;  2Y0M A;  1EV7 A;  3AVU A;  3GSI A;  1SFO J;  1VLY A;  2VQH A;  4IHT A;  3OYB A;  4TMV A;  1OKR A;  2X8K A;  4LB5 A;  2LKS A;  2L5Q A;  4GXO A;  2CW7 A;  3MKW B;  3DDY A;  2W84 A;  5LRS A;  1J9Z A;  1B59 A;  3VMW A;  2BE5 F;  4O5V A;  2NT9 A;  1WOO A;  1OPC A;  3CW2 A;  1W4M A;  4LJZ F;  1X4P A;  2XHK A;  4X6A J;  3FZV A;  1BIB A;  3BLY A;  1ETX A;  3HGG A;  1G3T A;  2ME6 A;  2PQ8 A;  4C43 A;  3QFR A;  1QO0 D;  1FND A;  1JGG A;  2OV7 A;  3P9I A;  1GV2 A;  2QSH X;  3FKJ A;  3A8J A;  2DTZ A;  1D1C A;  3A8I A;  3R0J A;  2PYH A;  4L9T A;  2ZJQ F;  3QOE A;  1U9N A;  2HYJ A;  5ICC A;  2UV1 A;  2X0L A;  3CUQ B;  3RI4 A;  3ZMU A;  1JT0 A;  3BQJ A;  4G7Z F;  1DP7 P;  5M3F J;  4DGW B;  3D26 A;  1PJ7 A;  1UB9 A;  1IV6 A;  4JOM A;  1QGY A;  2Y75 A;  3VR6 A;  5E20 A;  2EB7 A;  3ZC3 A;  1OOC A;  3E6M A;  2QEX I;  5FFZ A;  2EA4 A;  2QSF X;  1TZL A;  5DUK A;  1FRN A;  1K83 J;  3CCE I;  4EJT A;  1ERD A;  4Y9U A;  3WND A;  3LVB A;  2JDI A;  3C2B A;  3KRG A;  4E7S A;  1DBG A;  3D0S A;  4AIK A;  1KQS B;  3CD6 B;  1OYW A;  2K4B A;  1YX2 A;  1IC8 A;  4OMY A;  2X4H A;  1UD5 A;  1TQP A;  4X0C A;  2F5V A;  1W0J A;  4NQW A;  4P9F A;  2CUZ A;  3LNN A;  4ZCI A;  3V7S A;  3SQN A;  1BN8 A;  4OJ6 A;  3P9K A;  1U9O A;  1XX5 A;  4C2U A;  3IP4 B;  2WAD A;  2R7W A;  2P5L C;  4MHG A;  2CUE A;  3TDU C;  5DTD A;  1HQC A;  2CU7 A;  2FNP A;  3S3O A;  2J7K A;  5JFR A;  2IA1 A;  3G4S B;  4NBS A;  2IS6 A;  1VQ8 B;  1T0F C;  5J4V A;  1ZHF A;  2RNG A;  1TYV A;  3K4J A;  4H9G A;  2CFO A;  3LSI A;  1T6X A;  3S14 J;  3S15 J;  4DQK A;  1EF4 A;  1BR2 A;  3ZPL A;  3B73 A;  3WNB A;  5F04 A;  2VFN A;  4WZT A;  2ZXJ A;  1MGT A;  4UVA A;  2BGC A;  1V0E A;  1Y8R B;  3KP2 A;  2V7W A;  2R5Z B;  1IUY A;  1FYM A;  2XEX A;  4WXD A;  5EG0 A;  2V7Q A;  2DA5 A;  1XMK A;  4HST A;  1GAW A;  1UD6 A;  5C1E A;  1VQ7 B;  1A6Q A;  2Y48 A;  3EQL F;  3K0L A;  3GTP J;  2CW5 A;  4G5G A;  1XB2 A;  4UZU A;  2JN6 A;  4OWR B;  2NOJ B;  3HBL A;  5IT9 K;  2O8X A;  1Y0N A;  3M8J A;  4Z4Y A;  4M1K A;  3EQN A;  2OU2 A;  3LYC A;  1DPU A;  2AQE A;  1K28 D;  1WP6 A;  2IJL A;  3BCA A;  1AKH A;  5J4Y A;  1J9I A;  3RQ4 A;  3K70 D;  4B4C A;  2WAQ N;  4QFM A;  2DMQ A;  1F5T A;  3ZQF A;  2V9P A;  2W48 A;  4BQO A;  5GPA A;  2GLO A;  4XSZ F;  1AKH B;  5F0C A;  3PUB A;  1QJV A;  2FD5 A;  3DXJ F;  3RZO J;  4IHY A;  1RMG A;  4YZA A;  4YCQ A;  4L18 B;  4FIS A;  2QA4 I;  3ZZT A;  4RM2 A;  1YJW I;  2HQR A;  2R6H A;  2ISZ A;  3KP5 A;  3HKZ A;  1O4X A;  3BC9 A;  3I59 A;  1VF7 A;  5J8C A;  2YWH A;  3CME B;  3SEQ A;  4A12 A;  2L0K A;  3QPL A;  3RPQ A;  5IYQ A;  2C4T A;  1ZAR A;  1XS9 A;  1OLT A;  3I59 B;  4B09 A;  3WBK A;  5C1C A;  3GVK A;  2DK8 A;  3JUR A;  3FBI B;  1DGW Y;  2DA6 A;  4QPO A;  1R49 A;  1KU9 A;  2NS0 A;  3BZK A;  2JUC A;  1O8M A;  1WJA A;  1KTV A;  1YW7 A;  2DMU A;  5IT3 A;  2HS5 A;  4C3J J;  2OTL I;  1SD6 A;  3OYH A;  1O7F A;  2VNJ A;  4YIF A;  2LK2 A;  3L2R A;  2XAH A;  3RSN A;  2IGO A;  2FOK A;  2E1C A;  2NXN B;  5HVQ C;  3EPZ A;  1Q86 D;  4F91 B;  4JX5 A;  5IYN A;  1TYW A;  1BOB A;  4MTE A;  2DCU A;  4Y52 J;  3BCF A;  2HFH A;  1Y39 A;  3LMM A;  3WOD F;  4IPA A;  1X1D A;  1OGM X;  3CJT B;  3SFZ A;  4RBO A;  1KJZ A;  2C78 A;  3MN2 A;  5HS7 A;  3EUA A;  3N05 A;  1W36 C;  2K4J A;  4DYR A;  4YAL A;  1JJ6 C;  5LBQ A;  2J5O A;  1BHE A;  2MLG A;  3ZMD A;  4OOV A;  5GTH C;  3Q9V A;  2FA5 A;  1YX5 A;  5A8A A;  3V7C A;  1ZN2 A;  4ESJ A;  3VWB A;  4E7K A;  4IHW A;  5EEH A;  2HQA A;  1QNT A;  3JRI A;  1FNM A;  2C5B A;  4Q5S F;  3CCR B;  2NOG A;  2CV1 A;  5F4J A;  3ABT A;  5TR9 A;  1T39 A;  1ON2 A;  4Q4Z F;  1PUE E;  3GTO J;  1WJB A;  4NC6 A;  5IYB J;  5DM7 F;  3WWG A;  1ZRC A;  4KT6 A;  2XF6 A;  4B1R A;  2XB0 X;  1B23 P;  3EUH C;  3A35 A;  4UUS B;  3F8F A;  1ZM9 A;  3LQ6 A;  4KKU A;  2DET A;  3F72 A;  5FGM A;  2EZK A;  4OZY A;  4RAZ A;  3LA7 A;  1BC8 C;  3ZRG A;  2Q2E B;  5CJ9 A;  2EJR A;  5HDN A;  4M9X A;  3CC4 I;  3PNY A;  3JRC A;  1N05 A;  1YQA A;  5DS9 A;  2JVG A;  1QFJ A;  3OAA A;  3IAS 2;  2V1U A;  1IN7 A;  1QGP A;  4BAY A;  4R8H A;  4OM9 A;  2RQP A;  4N3N A;  2Q6O A;  2FNA A;  2ODL A;  2EV6 A;  2GIV A;  1BOA A;  2KZG A;  2ZFW A;  3KE2 A;  2EFP A;  3B82 A;  1ZH5 A;  1EA0 A;  1OGO X;  1BJK A;  4TV7 A;  1RKT A;  3L1P A;  5L3C A;  4U4B A;  4YG2 F;  2WWY A;  2BF4 A;  2B63 J;  2NVQ J;  3BOQ A;  1A04 A;  2OUM A;  2PYG A;  5J47 A;  3FDY A;  3O3K A;  2LTP A;  4DBQ A;  2PFB A;  3GX4 X;  3GME A;  3CC7 I;  1WJD A;  2EH3 A;  1O7L A;  1SVL A;  2RN7 A;  2RNJ A;  3BR3 A;  3ZZU A;  1G3S A;  1FC3 A;  4QPQ A;  5KHD A;  5LGU A;  3H5A A;  4N9I A;  1VQK B;  3DPT A;  3VST A;  3SLD A;  2K85 A;  2R7D A;  2IP2 A;  4I02 A;  3Q6Q A;  3HG9 A;  2DA2 A;  5D5W B;  4II3 A;  2Y31 A;  3BG9 A;  1M1E B;  1YW8 A;  3G71 I;  4IJA A;  4HX4 A;  3OV8 A;  1K78 B;  3JRF A;  2QGU A;  5IK2 A;  3TGN A;  3ASQ A;  3A3B A;  1PVE A;  1OFD A;  2E7W A;  2VBM A;  2D45 A;  5H59 A;  3IH3 A;  3GUD A;  4RGU A;  3T8T A;  1BM9 A;  1C0W A;  4RM0 A;  2L4M A;  2WSS A;  4XLN F;  4CQJ A;  3KET A;  3HEF A;  3SHF A;  3SZT A;  4R71 A;  4C2T A;  2LLK A;  1MMA A;  3DEE A;  3GO5 A;  5IYD J;  1DBO A;  4D7N A;  3WE2 A;  4RD3 A;  4YZX A;  3E7L A;  1TQM A;  3V8K A;  4E7L A;  3HRT A;  4G6I A;  2BN4 A;  4LB6 B;  1VQ5 I;  3LA2 A;  3OYM A;  3LOC A;  1BMF A;  1XFO A;  4G6D A;  1FT9 A;  1YTY A;  4Z4U A;  1IRZ A;  4PMH A;  2INV A;  5AIQ A;  1YS6 A;  1IRG A;  2YX4 A;  2A6E F;  1WQ2 A;  4QLC U;  1V3F A;  1GVJ A;  3SJZ A;  2R5Y A;  4UB6 C;  4XN0 A;  3CQZ J;  1G2H A;  3LSR A;  3QPT A;  2VKE A;  4OPO A;  1W36 D;  4A2U A;  4L0Y B;  1J09 A;  2R5Y B;  1U5T A;  2VQL A;  3BY1 A;  2IEK A;  2L3D A;  5ERI A;  5JBQ A;  1DGR M;  1ETV A;  4Z4Z A;  4IL6 C;  1ONV A;  3HRU A;  1KTW A;  2XNJ A;  1KC8 D;  2WA0 A;  4UHT A;  1YLF A;  3R6J A;  1K9M D;  1TW2 A;  5HOO A;  3CC2 I;  4EM1 A;  2WB1 A;  3DKX A;  2Y30 A;  2XKP A;  1HW1 A;  2V7X A;  1DQU A;  2F5C A;  1GDT A;  1X2M A;  1J2X A;  2FF4 A;  2FQ4 A;  4HOB A;  3LQE A;  5B1B H;  2QWW A;  4Z05 A;  1SKY B;  4AYB N;  4EJV A;  1H88 C;  2YUS A;  3GTL J;  2KPM A;  1V55 H;  4PAB A;  1IV8 A;  4CZZ A;  2VBY A;  1OMI A;  3S3N A;  2M8G X;  1KQ5 A;  2M0C A;  3BNW A;  4AF6 A;  1MMG A;  3H35 A;  2CRV A;  1FX7 A;  2O0Y A;  1TQI A;  2WB1 N;  1BW5 A;  3KPH A;  2DAO A;  3I3L A;  3KYL A;  1LVK A;  3CDI A;  3HOT A;  1FJL A;  1D8T A;  3MZH A;  1YIJ I;  4P6V F;  1U6G A;  3GBG A;  1Y6I A;  2CND A;  5DCM A;  3L2C A;  1JB9 A;  1FMW A;  5KAF C;  4CCJ A;  1S6L A;  1UD3 A;  3VYT B;  3FKI J;  2HKX A;  4BHP A;  5H2F C;  2WPD A;  5DCM B;  4M9S A;  4I84 A;  3IV5 A;  1LVA A;  3S32 A;  3OL3 A;  4YFN F;  1TUI A;  2KRC A;  4ENN A;  1MSE C;  3MQ0 A;  2ZJ2 A;  4A3J J;  2NV4 A;  1HKT A;  1KU3 A;  3HUG A;  2OBT A;  3TW6 A;  3M1E A;  3Q39 A;  3IWZ A;  2JJ1 A;  1D5V A;  6PAX A;  2BBY A;  3H9Q A;  2GJR A;  2XGE A;  1ZRE A;  4Z2Y A;  1P6R A;  5CVV A;  4RGX A;  2ZNZ A;  2H09 A;  3FXQ A;  2EZI A;  2A07 F;  3CP2 A;  3NAR A;  4P55 A;  4OPS A;  3I55 B;  4BU2 A;  4A3M J;  3BQY A;  1OFL A;  1TTY A;  3S17 J;  4UV8 A;  1BI0 A;  4IOC F;  3CCQ B;  3ECO A;  1E62 A;  1LNW A;  5HS9 A;  3CCL B;  2IS1 A;  1U2W A;  4B48 A;  2IAI A;  3H3U A;  3HAG A;  2XVC A;  4G12 A;  3LSG A;  4PCQ A;  2HDC A;  3GTG J;  1UZC A;  4P3I A;  1B6A A;  3BR6 A;  2QSG X;  1VQ6 B;  5IOY A;  3BCD A;  2DJI A;  1YIO A;  3E0J B;  2V6E A;  2PLY A;  1W7P D;  4ACA A;  3UKG A;  4XRF A;  2XOK A;  1I18 A;  1W1W E;  3ROU A;  3N97 A;  4KKT A;  3EYY A;  5FFX A;  2VJJ A;  2FRH A;  2DEU A;  2HTS A;  2OC6 A;  3S1N J;  4DIQ A;  1NHA A;  1I6X A;  3I0T A;  1G3W A;  4XQF A;  3QYE A;  2WR8 A;  4ESB A;  3LMW A;  3I54 A;  3OIQ A;  4HQM A;  1SEU A;  2DU9 A;  3QRF F;  3K4M A;  3BG5 A;  4D9J A;  2NS8 A;  2ZME C;  4RD6 A;  3J81 Z;  4M71 A;  4CIC A;  2QN6 A;  2WV1 A;  3A4C A;  3I4M J;  4G8X A;  3U2R A;  2KKO A;  2GK7 A;  5JHU A;  3ISX A;  3OFN A;  2Z8G A;  4EQQ A;  2I8D A;  1JT6 A;  2RDP A;  3WNC A;  2IRF G;  4KN7 X;  2IGN A;  1HF2 A;  2TDX A;  4G9Y A;  1SFU A;  3M8F A;  4KIC A;  3K4K A;  1DPR A;  1DAR A;  1VZ0 A;  4I01 A;  5DM6 F;  4DNR B;  3V7A A;  1P4A A;  4C2M J;  2D1V A;  3B02 A;  3RKQ A;  2VOD A;  4MYU A;  2XUB A;  4XIC A;  3WHC A;  5L3B A;  5FKN A;  2BM6 A;  3ULQ B;  4LG3 A;  4ACB A;  5IY5 H;  2M5S A;  1IA5 A;  1Z91 A;  1KZH A;  2OBS A;  3VYS B;  1RUN A;  2GXA A;  1STZ A;  3AL0 C;  5GP9 A;  2Z99 A;  1YJ9 I;  2G7H A;  1N25 A;  3D1N I;  2EZL A;  4X8I A;  4ZDL A;  1O3T A;  3UNG C;  3CRZ A;  1R5O A;  1NHC A;  4HNU A;  2F43 A;  2BGI A;  3JU4 A;  1SAU A;  1ZGJ A;  5E1W A;  1O8L A;  3DPU A;  2LBF A;  3OYF A;  2FJ1 A;  4D0P A;  1JI8 A;  5BSX A;  4IXA A;  4YAO A;  4NBQ A;  3DLA A;  4U49 A;  4BS9 A;  5HLG A;  5EJC A;  2C77 A;  4TMX A;  4A69 C;  5CQE A;  1Z6T A;  1LDD A;  2BSP A;  4Y4R A;  1X4O A;  3HZJ A;  2JA6 J;  4WZE A;  1HVX A;  1YHQ B;  2WY8 Q;  3I58 A;  4ZDP A;  4GCV A;  1S5L C;  3J7A O;  3ZSC A;  4L9N A;  2M4K A;  2XZL A;  1MZB A;  4BBS J;  2HTJ A;  2GWR A;  1FY7 A;  1Q1V A;  1VHE A;  3G1O A;  2Y0S N;  2ZZE A;  2JPC A;  3TBI A;  1PDN C;  2MD5 A;  3ONY A;  3K9T A;  3SYJ A;  2O0W A;  3OEE A;  1J0R A;  3BTJ A;  3M07 A;  4X1E A;  1GO2 A;  1WJE A;  2CF4 A;  4OP7 A;  1JA1 A;  1RKW A;  5A88 A;  2JWT A;  2M87 A;  2OPT A;  2V9K A;  4UVB A;  3FK6 A;  2VBV A;  4AC9 A;  1W7P B;  3DEU A;  2HU9 A;  1H80 A;  1WSV A;  2ZFU A;  2ZJR F;  2Z2S B;  1QZZ A;  3B6A A;  2KDZ A;  2HVR A;  1VQN I;  3QFC A;  2VFO A;  2XGX A;  3BDD A;  1I3A A;  4A3K J;  4HF2 A;  2HOE A;  2A5Y B;  1FDR A;  3DF8 A;  1RIO H;  1WH5 A;  3W3C A;  3QWL A;  1Y8Q B;  3OKX A;  3TOA A;  2MG4 A;  3AAF A;  1IZ1 A;  3HB9 A;  2E1O A;  2Q1Z B;  1YIT I;  2LKP A;  1F4K A;  1T6S A;  4HG2 A;  4XKW A;  2EV5 A;  5JVG F;  1KQ8 A;  1VQM B;  1YOV B;  3DTE A;  3CCM I;  1KCC A;  4M3D A;  3CDH A;  2OAZ A;  3K1N A;  5D6F A;  5FA6 A;  2DA4 A;  4YEL A;  5EEA A;  5K7H A;  3JRE A;  3NWT A;  3IRR A;  2FOW A;  1XB4 A;  1FWZ A;  4L5E A;  3CO6 C;  4HQE A;  1OJL A;  3CUO A;  1P7J A;  1CNF A;  1P4M A;  1MNE A;  3G05 A;  2XND A;  2DOA A;  3OR2 C;  1K4T A;  2BX6 A;  3OSG A;  5L3G A;  1SAN A;  1YS7 A;  2IBD A;  4AM3 A;  4ZJZ A;  4RCY A;  4EH1 A;  2BVM A;  1X3U A;  1Y0U A;  1OCR H;  2MBF A;  3VSL A;  4MXN A;  4ZYG A;  1QRB A;  3OP1 A;  1EFC A;  3PSZ A;  1QVT A;  4XM3 A;  1T2K A;  2CQQ A;  1F60 A;  1WI3 A;  1OFM A;  4RAF A;  3ZUG A;  3W2G A;  2KFD A;  3W2E A;  4MQV A;  4HIZ A;  4IRH A;  4BE0 A;  4DNT B;  1H0M A;  2B7C A;  2XRN A;  4DZJ A;  2MGQ A;  1PP7 U;  3M4O J;  1FP1 D;  2NS7 A;  3G73 A;  2O03 A;  1I39 A;  2PEX A;  3K2Z A;  2BM0 A;  3LQR A;  3OPO A;  4E4H A;  4LK0 F;  2RRE A;  4M3G A;  2XAS A;  4U7D A;  2QE7 A;  2QY1 A;  3GQA A;  2RV8 A;  5GAD J;  2Z9O A;  3KIO A;  3OS0 A;  2PMZ A;  2JZY A;  4LIT A;  3QYB A;  1Y0Y A;  3DWL E;  4WX9 A;  2VJ5 A;  1G6N A;  2F4M B;  4XKB A;  4XBF A;  3W6J B;  5C44 J;  4N3G A;  5HOD A;  1XGM A;  1OCC H;  2XF5 A;  2E1M C;  2YS9 A;  4V19 K;  3PA2 A;  2V7U A;  1BJZ A;  3E5Q A;  4FTH A;  3G6E B;  1PE9 A;  2QLZ A;  2X6O A;  3BJ6 A;  4CCK A;  1IN6 A;  3CJN A;  3K4C A;  1CQX A;  3R4K A;  4XOT A;  2ZC2 A;  1XN7 A;  4KIG A;  5E1X A;  5J6X A;  3WBJ A;  5TJJ A;  3SZG A;  1QZE A;  3JAM K;  3DLL F;  2DXI A;  3CDL A;  1QUE A;  3P9C A;  2PBI A;  1J75 A;  1O8J A;  3LFU A;  1FYL A;  2F4I A;  4M0L A;  3JTG A;  4BXU A;  5GV8 A;  1AU7 A;  2O5R A;  1S7E A;  2WZP P;  3MKY B;  2DI3 A;  3W2F A;  2P6T A;  2HDN B;  3T0Y A;  2F3L A;  2AO9 A;  2HWV A;  4OIR F;  4CGZ A;  3H9N A;  3WE3 A;  3ZIA A;  1GVD A;  3C2H A;  5K1Y A;  1P2F A;  1D3Y A;  5KAI C;  1VND A;  5EGO A;  1KRH A;  1OIS A;  5BOX A;  2EFG A;  5JI6 A;  4HSR A;  1N07 A;  1OB0 A;  1BL0 A;  2DPD A;  3BZ6 A;  4IEJ A;  2CS3 A;  2IGM A;  1T8I A;  3CD6 I;  3IKT A;  2VT2 A;  4MQ9 F;  3X2Q H;  1WSU A;  4ROX A;  2YSR A;  3IWF A;  1B9M A;  1LLZ A;  4CYD A;  1YG2 A;  1QA6 A;  2HEO A;  1VQ9 B;  3PUN A;  4MTD A;  4A3I J;  1XC5 A;  3HTU A;  1KZL A;  1TYU A;  3J81 k;  1X1C A;  4MR0 A;  3F8B A;  5KW9 A;  2EIX A;  4D7M A;  1CQT A;  5LHH A;  3BC8 A;  3DEW A;  4N4O B;  2XRO A;  5E6T A;  3G4S I;  2ZME B;  2KIM A;  1T6Y A;  1VQ8 I;  2VBZ A;  4PJ0 C;  4EM2 A;  1TWG J;  4BDY A;  4RDU A;  2BM1 A;  1R00 A;  5FRO A;  5TV2 A;  5LEJ A;  3KEY A;  3BZC A;  3VMF A;  2CMP A;  1JHH A;  5E3L A;  4RLQ A;  1SKQ A;  4ZGN B;  3CCU B;  3DBL B;  3CCJ B;  3JSP A;  4UAJ A;  2WAF A;  2K86 A;  5FLX K;  4JRA C;  4G7O F;  5H6Q A;  5BPI A;  1KON A;  3RYR A;  3GIR A;  4CDG A;  2LY9 A;  1IGN A;  3OIP A;  3Q38 A;  2BY1 A;  1WOR A;  3MZY A;  3IH2 A;  1LFU P;  1AIP A;  2BM5 A;  3AL0 B;  2VQG A;  1QCX A;  1EH6 A;  1JKQ C;  1NTC A;  3LSK A;  1X1A A;  4IQ4 A;  2RC5 A;  1K73 D;  2X1E A;  1GXP A;  2EIK H;  3CCY A;  4M3E A;  4NUB A;  4D5F A;  1JE8 A;  2F4N A;  5BSY A;  1Y1V J;  3F21 A;  1UFM A;  2JA5 J;  4KKS A;  2OZU A;  1SAX A;  1T98 A;  3GVA A;  4I76 A;  2C4U A;  2WV0 A;  3BR1 A;  2VOP A;  3OZV A;  1R23 A;  3K69 A;  3VSU A;  2EIM H;  2VOO A;  1EFU A;  1G7S A;  1RUO A;  3DV8 A;  2XNC A;  1PXZ A;  2V7V A;  1JGS A;  4CO8 A;  1JKP C;  4HF1 A;  4YFO A;  4J00 A;  1FZP B;  2W00 A;  2VQC A;  2W25 A;  3S8P A;  3CME I;  2R7O A;  3H1C A;  3DU5 A;  1EKE A;  1E79 A;  2X1D A;  2WZN A;  4P9S A;  2PEC A;  4S05 A;  4PGG A;  2Z1D A;  1D1B A;  1HZE A;  3MKZ A;  1HSJ A;  2VC0 A;  2F6C A;  3PEN A;  3K2A A;  1WJ5 A;  2O6G E;  3JW4 A;  4ZH4 F;  4TN1 A;  2FEZ A;  5ICG A;  4ZYH A;  1GHC A;  2ZBU A;  5FIU A;  4RA2 A;  4Z03 A;  4NQW B;  2R0Q C;  2QM3 A;  2BHY A;  1U5T C;  2NVX J;  3PET A;  1IRX A;  4FX0 A;  2X0K A;  4JP0 A;  1EZG A;  4TMT A;  4M3F A;  3QFS A;  3M8E A;  1OFE A;  4Q47 A;  3K4N A;  4QIW N;  4YC5 A;  3OIO A;  2A3S A;  3M7G A;  1OYY A;  1XGN A;  3RYP A;  2X85 A;  3PSI A;  1TW3 A;  3QPH A;  1LE8 A;  1VTN C;  5FL7 A;  3ZPP A;  1QPM A;  1IXC A;  3MKL A;  2WAQ A;  5JR3 A;  1TBX A;  5HNF A;  1QGZ A;  1IDY A;  1R9T J;  2M5W A;  2Z6B D;  2JPB A;  4RGR A;  1I7P A;  2B0L A;  4U88 A;  4LG0 A;  4XL9 A;  4A3F J;  3RIQ A;  2MAB A;  1MH4 A;  1UAA A;  1JXS A;  4BXF A;  1Q1H A;  1YI2 B;  2OCE A;  5EG0 B;  3NWS A;  5CQG A;  3CCR I;  1O3Q A;  3SQV A;  2JK3 A;  2DW4 A;  2XAU A;  5IP9 J;  3MCZ A;  3KX2 A;  4M9Z A;  4V02 C;  1XDU A;  4PJL A;  2NVU B;  4L5I A;  3D5R C;  1B8I A;  2WJV A;  2HOT A;  4IQJ A;  2Z5U A;  5F64 A;  2OBR A;  2XTW A;  2CRG A;  4I99 C;  2NNY A;  2OTJ B;  3PFI A;  3KEO A;  3TO6 A;  1B8I B;  1WCM J;  2GA1 A;  4F55 A;  2TCT A;  2X1C A;  1XMA A;  2L54 A;  2IW5 A;  1R5B A;  1WVR A;  5C4X J;  3B8H A;  4W97 A;  4FE7 A;  4A5M A;  3CXC B;  3MEX A;  1VQL B;  3FY3 A;  2HZT A;  2H1K A;  4ZTF A;  3GEZ A;  1TWF J;  2XZO A;  1XSV A;  2EFO A;  5F1R A;  4Z1M A;  4XRM A;  1SM4 A;  4DYQ A;  3TP3 A;  1F9N A;  4L9V A;  2M3A A;  5AMV A;  2Q6L A;  2UZK A;  4MFE A;  1MW7 A;  5LGN A;  4K1X A;  1ODD A;  2JA7 J;  1ZEL A;  3K7A J;  2JA8 J;  1IDZ A;  3KL9 A;  3FBN B;  1BC7 C;  2X3H A;  3NE5 B;  2RVC A;  3F3X A;  2FBH A;  2X48 A;  5EEG A;  2N8G A;  4FHT A;  1VQK I;  1HKS A;  2O7O A;  2E1M B;  3B6C A;  5F6F A;  1G7R A;  3OOU A;  4OJ5 A;  3OMY A;  4CSW A;  4AUX A;  3TO7 A;  5E17 F;  1TTT A;  1E3X A;  3GFM A;  1WI9 A;  4CZC A;  4M2L A;  1EP2 B;  1EJ9 A;  1ZM3 A;  2ZL5 A;  4TMW A;  5CVR A;  2BV6 A;  2MW8 A;  2E71 A;  2XSJ C;  1DU0 A;  1S4M A;  3H3Z A;  4PC3 A;  3B90 A;  4KNY A;  4PK4 A;  1ZGW A;  3DBR B;  1DDG A;  2K9L A;  2ZZF A;  3ZR8 X;  2LKX A;  3BP8 A;  2DDB A;  4BNC A;  2R93 J;  4PGO A;  3RZD J;  2KIS A;  5DCF A;  2W1O A;  3FXR A;  1R36 A;  2EA2 A;  1N08 A;  4G6Q A;  4PFO A;  2L9V A;  4ENJ A;  5BNG A;  2VNH A;  2ADU A;  4UB8 C;  1R1V A;  4EMS A;  4EW9 A;  1HA8 A;  4PSW A;  2FQ3 A;  4P6Y A;  2QQ8 A;  4RPB A;  4U0W A;  1A6I A;  4AID A;  1KYZ A;  4J01 A;  2YWF A;  4X05 A;  2AXT C;  2W85 A;  4WWC A;  1KK2 A;  1YYV A;  2KIF A;  2M7B A;  1RNL A;  4B44 A;  1K6O A;  1H9G A;  1WTH D;  3J7Z I;  3OY9 A;  2PMH A;  3VDX A;  4CA0 A;  5IPA A;  4XRS A;  1ZUN B;  4W8S A;  2MH2 A;  2XAG A;  1Y56 A;  1KK1 A;  3CLO A;  4AU7 A;  1RQR A;  4JK1 X;  4I6Z A;  5B6I A;  2ELK A;  5IYR A;  3AG1 H;  4CH7 A;  1LDK B;  3ECH A;  4OIQ F;  1FSH A;  4UUT A;  5E3O A;  1ETQ A;  1IO2 A;  1FBU A;  1RRJ A;  3SJP A;  1IJW C;  4QVJ A;  1S0U A;  2BZT A;  4XK4 A;  2JQ7 A;  3PL8 A;  1VJS A;  1D1A A;  3EUK L;  2GM4 A;  2X53 S;  4W8R A;  1MBJ A;  3J7Y J;  4PC2 A;  5LLQ A;  2R7X A;  5JHF A;  4IRG A;  5IT9 Z;  2KJB A;  2E2H J;  4HDV A;  1QU3 A;  3LSP A;  4H4K C;  1S7O A;  4PUS A;  2KMU A;  4ESF A;  2IVM A;  1BR4 A;  3F6V A;  3W5U A;  3VFZ A;  5GAE J;  2QYU A;  1E2X A;  2CQ7 A;  2KLO A;  4AIH A;  1X3W B;  4J0Q A;  1QFZ A;  1ZM2 A;  1DDI A;  2CH0 A;  4P9U A;  1L0O C;  4IHV A;  2HYF A;  3HOX J;  2BVL A;  4IW3 B;  3DP7 A;  3MZ8 A;  4ZGQ B;  2K40 A;  5BMZ A;  5LEK A;  1E3Z A;  2COM A;  3AG4 H;  4CYC A;  2DPU A;  2LD5 A;  4UUV A;  2LMD A;  3CCS B;  1REP C;  3KEQ A;  2EFW A;  3TOB A;  2V9V A;  1TNT A;  2K9M A;  2B7B A;  4Y13 A;  1WXR A;  3GVL A;  1ZTR A;  4Z6Y A;  3SZP A;  4IHX A;  1VQP B;  2GBY A;  2EFQ A;  3F8C A;  4Y17 A;  3O8H A;  2GA2 A;  3LAJ A;  4A3B J;  4A5N A;  2XGJ A;  4Z4T A;  3DU6 A;  4M73 A;  3PQK A;  1LEB A;  1UD8 A;  2LR8 A;  2CUF A;  2H6C A;  3G3Z A;  4HF0 A;  1S7A A;  1QGA A;  4B43 A;  1R71 A;  4E0F A;  1X19 A;  2BHZ A;  1GR1 A;  1FEX A;  3OYE A;  2XZP A;  1RQP A;  4LFU A;  4GYI A;  4HEA 2;  4EJW A;  1AA7 A;  3GXO A;  1RR8 C;  3S2W A;  2QDX A;  2VNK A;  4RD2 A;  2IPQ X;  4RD0 A;  1OYI A;  5D5X B;  1Z0X A;  2R7V A;  1W5T A;  1RES A;  2ISY A;  3KLO A;  1IG7 A;  4P1V A;  3CCV I;  4Z06 A;  1IHM A;  4JQF A;  3VPR A;  3ZMS A;  4DNC A;  4LIU A;  9ANT A;  2Q6I A;  4JMQ A;  2L01 A;  3HGY A;  5K5R A;  3H0D A;  1OR7 A;  1ZYR F;  2W82 A;  2MFZ A;  4MFD A;  1UMQ A;  3HOY J;  4Y9R A;  2G0E A;  3OL4 A;  1LLW A;  2V5I A;  3H09 A;  4XSX F;  3WTX C;  5DD4 A;  5FB2 A;  4XR6 A;  4YZQ A;  4YAW A;  5LHG A;  3T8R A;  5GPC A;  3WHB A;  3I55 I;  3NQO A;  4AYB A;  1QHG A;  2DO7 A;  3UR3 C;  4R79 A;  4YZ0 A;  2I5U A;  3FXM A;  3LSJ A;  3CCQ I;  2E60 A;  2L7Z A;  2XAQ A;  4NNJ A;  1U5T B;  1XG1 A;  1MJB A;  3CCL I;  2CBX A;  3BG7 A;  3H36 A;  5K5Q A;  2QKL B;  3OR1 C;  1MAB A;  3LO8 A;  2E2I J;  4QUZ A;  3CMA B;  1X58 A;  1VQ6 I;  3PIP F;  1WJF A;  2FSW A;  3S16 J;  2ZL6 A;  3BRO A;  2RKH A;  3RKW A;  3L09 A;  1W5C C;  3ERE D;  1W87 A;  3N90 A;  4YII A;  2EQR A;  2ZXW H;  2OK8 A;  1D5Y A;  4RDK A;  2OJE D;  3KZY A;  1WH7 A;  5E18 F;  1U8R A;  1B72 A;  1O3R A;  3S2H J;  1EP1 B;  3ABK H;  3QOD A;  5EDN A;  3IKV A;  1WOP A;  1I6H J;  1G8X A;  4LC0 A;  3U2Q A;  1MBK A;  1B72 B;  2JIZ A;  1CGP A;  5B1A H;  3MVP A;  2DMT A;  1QQI A;  2W4S A;  3FXJ A;  2ACJ A;  2HXI A;  3GZ5 A;  2M30 A;  2MSY A;  2ZB9 A;  4IVN A;  4V2G A;  2V4J C;  1WFX A;  2H1L A;  2K02 A;  4P96 A;  1Q9S A;  3OS1 A;  3E1Y E;  4Y7C A;  3BH7 B;  5B3S H;  4K2E A;  2HDD A;  4PC1 A;  3KP6 A;  3F22 A;  2OZ6 A;  1BPL A;  2UXX A;  1N0V C;  3OYG A;  3JRH A;  4QSH A;  1WPK A;  3GTJ J;  1AOY A;  1FSE A;  1H42 A;  1FNN A;  3RKX A;  5C4J J;  2QKM B;  1JA0 A;  3BR2 A;  1RU4 A;  1WOS A;  4BUP A;  1NB0 A;  5KSW B;  4HA8 A;  3WTU C;  3K10 A;  2VAS A;  3GWZ A;  4BGD A;  5LFA A;  2W57 A;  3ZQ7 A;  2D1H A;  2VL8 A;  2KIU A;  3GTQ J;  2JRM A;  3BPV A;  4RMN A;  4BHB A;  1RR7 A;  1KU7 A;  4XLF A;  2Z3Y A;  2LH9 A;  4RCZ A;  2CO5 A;  2DA3 A;  2K3F A;  2QUF A;  1JTY A;  3A0H C;  4FWT A;  3HUG B;  3W2V A;  1TYX A;  5LRR A;  3B78 A;  4M74 A;  3FM3 A;  3GQ9 A;  3Q3A A;  4OIO F;  2IA2 A;  2CV2 A;  1QHH D;  5JVT A;  1K79 A;  1IJF A;  2M34 A;  2Z16 A;  1Z67 A;  4KJZ A;  3JR9 A;  1NK3 P;  1QPI A;  2C2W A;  1AHD P;  1QBJ A;  2PLF A;  4Z4R A;  4E6K G;  1G3Y A;  1D1N A;  3KEW A;  2O9L A;  2HXO A;  3ZQI A;  1Q82 D;  3D5L A;  3HRS A;  1N8R D;  3L2Q A;  3AVX A;  3OW2 B;  5FO5 A;  2W7N A;  1YHQ I;  3V76 A;  2VFP A;  3W2W A;  4IX7 A;  1UJ8 A;  4F7D A;  4BL0 B;  1SD5 A;  4IO9 F;  2JRT A;  2P3M A;  2O3F A;  2ELJ A;  1RC9 A;  3PUF A;  4MLO A;  2HQ5 A;  1YX3 A;  1MMN A;  3HDD A;  3JX8 A;  3ASR A;  1GJR A;  3FKS A;  2KL4 A;  1DU6 A;  3N6Z A;  4LBW A;  2JVH A;  2V6C A;  4C9Y A;  2WAE A;  2QGG A;  2KDO A;  3OJX A;  5D5V B;  2DDA A;  5M5X J;  3ERM A;  4IF4 A;  1I50 J;  4B3G A;  2ID3 A;  3A1Y A;  3CJQ B;  2DOD A;  1XQB A;  1VHO A;  3IHU A;  5BQT A;  3QP6 A;  1EXM A;  2UXN A;  5CVJ A;  4BJT A;  2P7V B;  3P7N A;  2XDV A;  2OF7 A;  3SEZ A;  4O3M A;  1OFC X;  4YEJ A;  1B1B A;  3V7R A;  3FHZ A;  1D0Y A;  2OBP A;  2R9V A;  1IAW A;  4HW0 A;  1F20 A;  3QU6 A;  1O8F A;  1SC7 A;  3HYI A;  3HXL A;  2FX3 A;  2FXA A;  3OS2 A;  3S2D J;  2JMW A;  4XOP A;  1OCZ H;  3QP5 A;  5DEQ A;  2DYI A;  2VON A;  1GV5 A;  3R60 A;  1L1I A;  3GQ8 A;  3LNQ A;  1XCB A;  1VQM I;  4J19 A;  1ETK A;  1R5H A;  1A36 A;  2E1N A;  5KCM A;  2Q0O A;  3Q5F A;  1SFK A;  1LFB A;  2GXB A;  2NVT J;  3KLN A;  2CQX A;  2J5P A;  2QQA A;  4A0Y A;  3AG2 H;  3GLX A;  5K5O A;  4RB2 C;  2IQ7 A;  3DU1 X;  3AK5 A;  3JTH A;  3U1D A;  4EEF G;  4FAS D;  3I56 B;  4EVI A;  3ZN0 A;  3SKB A;  3REO A;  3W2H A;  1V4R A;  1FX0 A;  2H94 A;  4WK8 F;  2P7C B;  3FF5 A;  1MDM A;  2FUG 2;  2Y0S A;  4GYG A;  1DG1 G;  1IXR C;  4S04 A;  2BOL A;  2JJ7 A;  2LBF B;  2FML A;  3JSO A;  1HW2 A;  2ZJP F;  1MDM B;  1Z7U A;  3RQI A;  3GW2 A;  2D74 A;  1IW7 F;  5F4O A;  2LNB A;  4G7X A;  3LST A;  1X1B A;  1X2N A;  3VNU A;  3FX3 A;  4B3F X;  1QH0 A;  1GQ8 A;  4ZCL A;  3OW7 A;  1Z77 A;  3KP7 A;  3U6K A;  1R6R A;  1J5Y A;  1CLW A;  4PC7 A;  1XSX A;  3OE7 A;  1X3Z B;  4ZV4 A;  3UW0 A;  3S1R J;  3IL2 A;  2XGC A;  3TQN A;  3QE2 A;  2NNN A;  2YUH A;  1JHF A;  3WTS C;  2YWG A;  5E8I A;  2DT7 B;  3AFH A;  1O3S A;  2MC3 A;  5HNH A;  2MLK A;  1QFY A;  4RLZ A;  2R7F A;  3HOU J;  1E1Q A;  5J8F A;  3G6E I;  2GAU A;  5EZG A;  4DQ2 A;  2XC7 A;  1E1R A;  3WU0 A;  1A35 A;  2GQQ A;  1ULY A;  3PNV A;  3EET A;  2WY7 Q;  4RAG A;  4RDJ A;  3SZE A;  3HOZ J;  3ZBT A;  2J8I A;  2LY2 A;  3FJO A;  5CDF A;  4KFC A;  4CCL A;  4YFK F;  2XGD A;  1T08 B;  2UUZ A;  3LAP A;  3W6V A;  5A89 A;  5FKO A;  3I5U A;  2BYV E;  4TSF A;  1QX4 A;  1PJR A;  2XC1 A;  2VBK A;  2LDU A;  2HPM A;  4KIS A;  4MIM A;  3BTI A;  2YPR A;  3OYN A;  5FRM A;  1RZ4 A;  1H8H A;  3JQQ A;  1NK2 P;  4RJL A;  3E3V A;  1BX1 A;  2X3U A;  1BBY A;  1LJ9 A;  4KN4 X;  4NC7 A;  1QA3 A;  2IOU G;  3LL7 A;  3RIR A;  3ASN H;  3WTY C;  2M8E A;  2HLD A;  4O6J A;  2JUG A;  1Z3X A;  2OA4 A;  2JJ2 A;  2UWM A;  2NVY J;  1S72 B;  3SUC A;  4ON0 A;  4HV5 A;  2VXZ A;  3OOC A;  2OQR A;  1ACI A;  1HLV A;  1TLL A;  4XOR A;  2QZA A;  4TKO B;  3FHN A;  2WYR A;  1Z21 A;  1H8A C;  2QCO A;  5GTI C;  1PUF A;  5FLV A;  1IXS B;  1G7C A;  4LBV A;  4BPR A;  2ZIT A;  1OB5 A;  2O0V A;  5H5J A;  3W2I A;  3EYI A;  2KRH A;  2DIE A;  3F8N A;  1CZF A;  3BJO A;  4TT3 A;  4UZF A;  2OCC H;  3BT9 A;  3HC7 A;  5CYV A;  3J80 K;  1FP2 A;  1TWC J;  4PJN A;  1TL8 A;  1VQ9 I;  4YAU A;  3WXM A;  4HLX A;  1BI1 A;  2ZSH B;  4B3X A;  4GFB A;  1BX0 A;  4HZF A;  5ICF A;  2W6I A;  3FPK A;  5HZB A;  1SD4 A;  2Y9Z A;  3HSF A;  3ZPN A;  3HM5 A;  2CWE A;  1T56 A;  1EE6 A;  3A2K A;  2DYR H;  2FX0 A;  2P6S A;  3Q0V A;  3E5X A;  4MNU A;  4OPW A;  4DOZ A;  3GZ6 A;  3HOV J;  2EZH A;  2X6Y A;  1YJN B;  2E19 A;  3HJE A;  2F1L A;  1TLH B;  2Z33 A;  4LLN A;  1SD7 A;  2BVN A;  4F7Z A;  1SMY F;  2DMN A;  1JNY A;  2L7M P;  3NAU A;  4IZZ A;  1VQ4 B;  3CCU I;  3ZZ0 A;  3CCJ I;  2NST A;  1ETO A;  2H27 A;  1S29 A;  1OHH A;  3QSY A;  4YIR X;  4KIF A;  2VKV A;  1I3Q J;  3WG7 H;  1Z6R A;  3P4G A;  1AMO A;  1FLI A;  4UY8 I;  4OAY A;  4CCO A;  2K3P A;  3O8G A;  4LIV A;  4EJO A;  1WZ2 A;  5L3E A;  1B2R A;  1QVG B;  2LRD A;  3IC7 A;  3I71 A;  3E5U A;  3DFG A;  4U9U A;  3GFJ A;  5J1Y A;  5IYC J;  3OYA A;  3HHG A;  4XMY A;  4FCY A;  3I53 A;  2LG4 A;  1FBS A;  1MND A;  4I98 B;  1NBM A;  2H8R A;  2YU9 J;  5FJ8 J;  1FIP A;  3E6D A;  3B4N A;  1D0X A;  1IJE A;  2LY1 A;  1YE9 A;  2B5O A;  3ASS A;  2AXL A;  4MEX F;  1U2R A;  2UVF A;  3PO2 J;  5LD2 C;  1Z7L A;  2A69 F;  3CO7 C;  2A6H F;  2MA3 A;  3VO1 A;  4FET A;  3G1L A;  1UD4 A;  3OJW A;  5FO0 A;  5TRD A;  2O1D A;  5TGT A;  3S1M J;  4M6Y A;  1T95 A;  2KQR A;  5EGO B;  1EFR A;  4W8T A;  2BV3 A;  3KFW X;  5IP6 A;  2CW0 F;  4HNV A;  2CSO A;  2BM4 A;  5DD8 A;  4EAT A;  4GRI A;  3L9F A;  3MAJ A;  3C1D A;  1O8G A;  1MMS A;  4AWX B;  2ESH A;  1KD1 D;  1UHW A;  2L2O A;  2M45 A;  1O8I A;  4ENM A;  2KVO A;  3GYH X;  5GAG J;  1T38 A;  2ESN A;  2HR3 A;  1ZG1 A;  3M9A A;  4FE4 A;  2DFE A;  4HAM A;  4I7H A;  4S0H B;  5FO1 A;  2ZXI A;  1ELO A;  1MMD A;  3GZN B;  2QMU A;  2HMA A;  2J8K A;  4C2L A;  3CP8 A;  2VKD A;  3HHH A;  2K7L A;  1FIA A;  5B66 C;  2JN9 A;  3Q0W A;  3AGP A;  1DDN A;  3ZQH A;  1U0J A;  1Y0R A;  1BW6 A;  2E36 A;  4W8Q A;  1ETW A;  1HBX G;  4RD4 A;  1H85 A;  1O8D A;  3RPU A;  1MKM A;  3FM5 A;  4LK1 F;  5L3D A;  3K6G A;  1J59 A;  4BQA A;  2BMW A;  3OYK A;  5EMN A;  1W0K A;  2GPJ A;  2DOF A;  3JRG A;  1BN5 A;  2E35 A;  4A6D A;  2WC2 A;  1WMR A;  1VQ7 I;  3WQZ A;  3GTK J;  1GAQ A;  1YI2 I;  2XB5 A;  1U3E M;  4BJ5 C;  2F48 A;  2A61 A;  2G9W A;  2MYS A;  4ASN A;  1NRK A;  1XG2 A;  3DBH B;  3R0A A;  2F4O B;  2VXD A;  3MFK A;  2NT6 A;  1YLO A;  3QFT A;  3BCB A;  2MD0 A;  2VT3 A;  1MH3 A;  4V2F A;  1R5N A;  3O2P E;  4YDT A;  2MC4 A;  1VQO B;  2LP0 A;  2OTJ I;  2CV0 A;  2EK5 A;  3NB2 A;  5C3E J;  3ZQC A;  4G1V A;  3F9K A;  1OGJ A;  5J3L A;  3JAM Z;  1R5G A;  2NPF A;  4OOX A;  2VN2 A;  1VQL I;  1O8H A;  2DCE A;  3VNV A;  3H92 A;  4A3D J;  3S93 A;  4AC0 A;  3J7A Y;  2R7R A;  1TVC A;  4XLH A;  4EGY A;  5F08 A;  5AON A;  3FMR A;  3GQ7 A;  4PSX A;  3CUQ A;  1XD7 A;  2OD5 A;  5DN6 A;  1Q7Y D;  2LF7 A;  3E1S A;  2STT A;  2INU A;  4P25 A;  1OR7 C;  2RC4 A;  4HPQ A;  3S1Q J;  2FMY A;  5FRN A;  4WWV A;  4JX4 A;  1LEA A;  1N75 A;  4UVC A;  3VEP A;  5THX A;  4U87 A;  2OYN A;  4IOA F;  5JMC B;  5AN9 A;  1MD0 A;  2NSP A;  2LSO A;  3RCO A;  4P1W A;  3BTC A;  3A03 A;  2DLL A;  3OOP A;  1K4Z A;  5F0F A;  2L7K A;  4OIN F;  4XRS G;  3BWG A;  4RB1 A;  2B0R A;  3GFI A;  1FTZ A;  2EIL H;  4F92 B;  4OMZ A;  3ZOB A;  3OSF A;  2HVS A;  1Q81 D;  1G4D A;  1W2B B;  1SVO A;  5F0H A;  3I4N J;  3BY6 A;  1ETY A;  5IP7 J;  3ONQ A;  3BPX A;  4P2N A;  1KK3 A;  1VBL A;  4KDP A;  3IUO A;  1P9Q C;  1LE8 B;  4BEH A;  3WGI A;  2R7S A;  3CZ6 A;  3LA3 A;  3CTA A;  3C7J A;  2DBB A;  1QQ1 A;  4Z4S A;  5HDG A;  5ILS A;  4BEH B;  4X7C A;  4URR A;  2R3S A;  2CYY A;  3FWE A;  3AST A;  2Y9Y A;  3GVJ A;  4LG0 B;  2D2W A;  3PVD A;  2V7F A;  1V0F A;  3W5H A;  4A3L J;  5ILU A;  4QVA A;  4N0B A;  1V5V A;  1QG0 A;  4OJP A;  2R5Z A;  1R1T A;  2HI3 A;  2H8W A;  4CXF A;  3DTK A;  5F4M A;  3LFK A;  2O6W A;  5D5U B;  5D4R A;  2D3N A;  3HOS A;  2L9R A;  1WHU A;  1MJA A;  1XGS A;  4BKX A;  5FLX Z;  4E7H A;  2VBX A;  2PN6 A;  5TY0 A;  4YEI A;  4E7I A;  1JJ2 B;  1FBQ A;  2LOO A;  2CFX A;  4N9H A;  3TMO A;  1ZRD A;  4P12 A;  1ORK A;  1PJ6 A;  3CLQ A;  3FMS A;  4MO7 A;  3FXL A;  1KQ9 A;  5M5W J;  3ML3 A;  3HSE A;  4LOC A;  4RS8 A;  2DK5 A;  2O04 A;  5TIS C;  2ZTG A;  2GQF A;  1PLU A;  4KH3 A;  3TO9 A;  5CKT A;  2K9S A;  2Q6K A;  3ZQL A;  1N0U A;  1W34 A;  4HX8 A;  1MBG A;  1HDP A;  1WJC A;  2DMP A;  3MCA A;  4C3H J;  4A6E A;  5K7F A;  5JLW A;  3OYD A;  4GO1 A;  2UVE A;  4BH9 A;  4GGG A;  3PUM A;  2HKO A;  2VJ4 A;  3GTM J;  2D9R A;  1HW5 A;  2M7A A;  2ZXH A;  2VLA A;  1AIR A;  1V5G A;  2QEX B;  1IN4 A;  4OJO A;  2EBI A;  3CCS I;  3CCE B;  1U8B A;  1IN8 A;  3U1K A;  4WZK A;  1BQE A;  2DN0 A;  4BDZ A;  2M2E A;  2XV4 S;  1PJ5 A;  5D8L B;  3A1P A;  2D5V A;  2BSA A;  1ON1 A;  2HOA A;  1JKR C;  4LBY A;  4PFP A;  1VQP I;  4OOI A;  4C3I J;  4IRI A;  1E64 A;  2BXY A;  3ESW B;  5HDK A;  3H5N A;  4A3E J;  2DER A;  3E6B A;  1D2E A;  2CC2 A;  2R7Z J;  3VOE A;  1ZLJ A;  2M1B A;  2ME0 A;  1GLN A;  1ENH A;  3K1M A;  4XLP F;  1E0E A;  5J35 A;  3ZGK A;  3I4P A;  4OIP F;  1D0Z A;  1JTX A;  1A5J A;  5DS0 A;  3MWM A;  4JYK A;  4BQQ A;  2LFB A;  3HKZ N;  1F1Z A;  4CHU A;  1V54 H;  2GIZ A;  4AD9 A;  2IA0 A;  2QTL A;  3SJM A;  2RC6 A;  2GJK A;  2CJJ A;  1D8K A;  3LWF A;  1UHS A;  3PNT A;  3BJA A;  3CES A;  2VYQ A;  1HA3 A;  2R4G A;  1FNC A;  1IF1 A;  1OCO H;  4A0X A;  4RLF A;  3PO3 J;  3QPS A;  2HPI A;  4C0S A;  3WTW C;  1J7K A;  2JT1 A;  2LYC A;  1TWH J;  3BR0 A;  2VJI A;  2E5N A;  1JRG A;  1SFE A;  2DYS H;  1R4N B;  2VIX A;  2BEO A;  2KJC A;  2L9S A;  1LM1 A;  2IS2 A;  3QAH A;  3HPG A;  1IUF A;  2EIN H;  3F0C A;  4IKF A;  3EQO A;  3HRM A;  1I8D A;  4OJL A;  1K8F A;  4LGW A;  1UEL B;  4B47 A;  1BR1 A;  4RAY A;  3FXK A;  4UUS A;  4L5J A;  4DBR A;  3OYC A;  1XPX A;  1WSR A;  2C5H A;  1KMH A;  2W7Z A;  3LJY A;  3E97 A;  2LF8 A;  1E3P A;  3HOW J;  3HPH A;  3ABM H;  3BH6 B;  1CF7 A;  1KU2 A;  2Q2E A;  3KP3 A;  4M4S A;  3RKY A;  2E1B A;  1TP4 A;  2XF7 A;  1OCT C;  1QUF A;  2QQB A;  2Y69 H;  4YFX F;  3CMA I;  3DKW A;  2EV0 A;  3L2V A;  4X7F A;  5J40 A;  3SXY A;  4DK0 A;  1OQY A;  4EM0 B;  1CF7 B;  3SFI A;  1N78 A;  4L8J A;  5DSZ A;  2V1N A;  1LPQ A;  5HLI A;  4A3G J;  1LQ1 A;  2QA4 B;  2QEN A;  1YJW B;  2XAF A;  4PGH A;  4BE2 A;  3HTS B;  2BM7 A;  4RGS A;  1GVH A;  2E1R A;  3C3W A;  5E3M A;  2KRF A;  2QYO A;  1ZG3 A;  4N4N B;  4CYC B;  5HZA A;  4M72 A;  3P26 A;  4BJ6 C;  2HGC A;  5A2Q K;  3Q6R A;  2X6X A;  1XCV A;  4RDL A;  1UMK A;  5ILV A;  2HDW A;  3L7W A;  3HL2 A;  5LMZ A;  3F8M A;  1T6Z A;  1E17 A;  2I1L A;  2KIQ A;  2ZNY A;  5M3M J;  3Q0U A;  4NB5 A;  5DV5 A;  3SDG A;  4KT5 C;  1Z1D A;  1S3J A;  3D5S C;  2YWE A;  2OTL B;  4MEY F;  4E7J A;  1JJ8 C;  2M4G A;  4BYY A;  1MNM C;  2VPL A;  2R7T A;  4G7W A;  4Y3O A;  3GF2 A;  1K78 A;  1MSF C;  4G7H F;  4I09 A;  4ABZ A;  4KYW A;  4D1Q A;  2QQ9 A;  4XN3 A;  1JUS A;  1SFX A;  2DT5 A;  2XRL A;  1ZG5 A;  3BG3 A;  3CMM A;  3LQQ A;  1E63 A;  1FPQ A;  2ECB A;  3OYI A;  3AGQ A;  4PZJ A;  4LLG F;  3DCF A;  1UG2 A;  3H94 A;  1B4A A;  1HCR A;  4OU0 A;  2PMD A;  2CK3 A;  1W0U A;  4CUG A;  1VFC A;  1AWC A;  2D3L A;  4XKV A;  4JX6 A;  1EA3 A;  3ZQQ A;  1FOW A;  2QTZ A;  3M3Y J;  2DA7 A;  2VBU A;  1FRQ A;  2E34 A;  1NB9 A;  4DYC A;  5HS8 A;  4FN5 A;  5GAH J;  4KMF A;  1IB0 A;  5E1Z B;  1WGX A;  1TWA J;  4CCM A;  2PJP A;  4FX4 A;  5BPD A;  2ZZG A;  1S9H A;  3RJP A;  2DQL A;  3DPL C;  3RDI A;  3WU1 B;  1QVU A;  3OZW A;  5J1R A;  3E20 A;  3H3V K;  1T33 A;  1W5S A;  4OOS A;  4ZCM A;  4KMU X;  2VC1 A;  1WRJ A;  2VBW A;  1DP3 A;  2BPO A;  1FYK A;  5ED4 A;  4OPV A;  4ZZL A;  1N77 A;  3SY2 A;  3CC4 B;  2OQG A;  4W1U A;  2B7E A;  2RAE A;  4F52 A;  3VSV A;  1SMT A;  1BI3 A;  1EP3 B;  2B9S A;  2AQF A;  2DTR A;  3EDP A;  4M3B A;  5HLH A;  4QV2 A;  2ZKZ A;  3V4G A;  1H9T A;  3SYT A;  4XLA A;  5GV7 A;  1USS A;  3G1M A;  5EYR A;  3GRH A;  2FBK A;  3TED A;  2PIA A;  1F36 A;  2XPW A;  4QTR A;  1T0F A;  5F1J A;  2KP6 A;  2ELH A;  1LB2 A;  4X7D A;  4ASU A;  3Q3S A;  4MGR A;  1YO5 C;  2CUJ A;  1APL C;  4IHS A;  3J81 K;  1BI2 A;  3CC7 B;  4YRV A;  1GXQ A;  3KP4 A;  5H6R A;  3W6K B;  3WG9 A;  4A93 J;  1TT5 B;  2F1M A;  2HCJ B;  4RPD A;  4M53 A;  2VUM J;  4RD1 A;  3AVT A;  4ETS A;  4NHJ A;  2R7U A;  2V4D A;  1G59 A;  2VFM A;  2X9D A;  2GRE A;  2VBT A;  1UD2 A;  3G2B A;  2EWE A;  1IDK A;  2A68 F;  1JUM A;  1EH7 A;  3ABL H;  2CQK A;  3NRV A;  4AIJ A;  3W2A A;  3G71 B;  1Z05 A;  2ID6 A;  1LDJ A;  3ABU A;  5H20 A;  5A2Q Z;  2QVO A;  2XAJ A;  2PG4 A;  3P5J A;  1P92 A;  5FD6 A;  3CPX A;  1YW9 A;  3U6B A;  1DAB A;  1R58 A;  1JKO C;  1XTA A;  1G7T A;  5BS6 A;  4PAA A;  4EGZ A;  3ZMZ A;  3HSR A;  2FVG A;  2P5K A;  3NEU A;  3U21 A;  1FNB A;  5D8K B;  4Z4W A;  3OZU A;  1QA2 A;  1QZY A;  1MBH A;  5D4S A;  4EJU A;  3MHP A;  2CQN A;  4A3C J;  4I2O A;  4ZYE A;  4BQN A;  3N4M A;  2P5V A;  1ZR2 A;  3TDZ C;  2GZW A;  2GOM A;  3QQA A;  4XID A;  3I56 I;  1GUU A;  2NYX A;  2QF7 A;  1E43 A;  1MIJ A;  4FXU A;  1WDT A;  4WQM A;  1R4M B;  4HNT A;  5M5Y J;  1W0T A;  2V79 A;  3ASO H;  5LGT A;  1VQ5 B;  4XD7 A;  3CCV B;  1MJ9 A;  3LSM A;  1HOM A;  3JQR A;  4Y33 A;  3BQZ A;  4A0Z A;  1VF9 A;  2XSD C;  1LFP A;  3M1C A;  3DKY A;  5ICE A;  3CMY A;  2HQN A;  1W9X A;  2M0M A;  1K61 A;  3A01 A;  2WBM A;  4DJA A;  1NDH A;  3QU3 A;  1XSD A;  2DY1 A;  2HNH A;  1RPW A;  3A3G A;  1K5C A;  2E2J J;  4DZP A;  3A01 B;  1COW A;  2ZO4 A;  4X07 A;  3PJR A;  1QVF B;  3W5V A;  2F5D A;  1HF0 A;  2RGV A;  2A6T A; 
#chains in the Genus database with same CATH homology
 4GQN A;  1OGO X;  3ZPN A;  1EE6 A;  3A2K A;  4U4B A;  4Z03 A;  4NQW B;  2OUM A;  2PYG A;  4CCN A;  3FDY A;  4DOZ A;  2JSP A;  2X6Y A;  4DBQ A;  1IRX A;  4PJJ A;  1WJD A;  3S3M A;  3H9G A;  4P5O A;  4QPQ A;  5KHD A;  3VST A;  3H5A A;  3H5R A;  3DPT A;  3I9V 2;  3K4N A;  5CPR B;  4IZZ A;  3HG9 A;  1LKX A;  1PKV A;  4F93 B;  4II3 A;  2X85 A;  3PSI A;  4XKC A;  2NST A;  1OHH A;  2RQQ A;  5FL7 A;  3T51 B;  3ZPP A;  2NTP A;  5IK2 A;  3DTI A;  2WAQ A;  3A3B A;  2VBM A;  5HNF A;  4OAY A;  4CCO A;  3L2W A;  2Z6B D;  2K3P A;  4KIT B;  3ZXS A;  2K5C A;  3CJR B;  4LIV A;  2ZTN A;  3GQB A;  2O17 A;  2LRD A;  4XL9 A;  1PYV A;  2WSS A;  2KZV A;  1IDJ A;  2MAB A;  1O8E A;  1UAA A;  4BXF A;  3OYA A;  4XMY A;  4C2T A;  3NWS A;  1MMA A;  5CQG A;  2LG4 A;  3DEE A;  1DBO A;  4OZZ A;  1MND A;  2HZD A;  1NBM A;  2XAU A;  4YZX A;  3KX2 A;  3B4N A;  4G6I A;  4E7L A;  4TKO B;  1D0X A;  4PJL A;  4YXW A;  2LY1 A;  3OYL A;  1YE9 A;  2L9N A;  3D5R C;  2WJV A;  4OAZ A;  4ANJ A;  4IQJ A;  1BLI A;  3OYM A;  1BMF A;  2UVF A;  5LD2 C;  1Z7L A;  4PMH A;  4FET A;  1UD4 A;  2INV A;  4F55 A;  2X1C A;  4C30 A;  2O1D A;  5HLT A;  2QX3 A;  5TGT A;  1T95 A;  1KCD A;  1NG7 A;  2KQR A;  4X0G A;  4W8T A;  1EFR A;  4DK1 A;  3FY3 A;  2V31 A;  4ZTF A;  2A5W A;  4AVZ A;  4RM3 A;  3MD2 A;  2XZO A;  4XN0 A;  4EAT A;  4P22 A;  4GRI A;  4Z1M A;  1W36 D;  3TL4 X;  1J09 A;  1O8G A;  4NC8 A;  2VQL A;  2NZM A;  2M3A A;  5AMV A;  2L2O A;  3MMY B;  1O8I A;  4F3Q A;  1DGR M;  2KVO A;  1MW7 A;  2V26 A;  1ZEL A;  2DT6 A;  1KTW A;  4HRI A;  3FBN B;  2X3H A;  2VKH A;  3NE5 B;  2WA0 A;  2ZXI A;  1MMD A;  3K4L A;  5HOO A;  4C2L A;  3CP8 A;  2VKD A;  2E1M B;  1IB4 A;  1NG6 A;  2WB1 A;  3DKX A;  3OOU A;  3OMY A;  4CSW A;  4OJ5 A;  1E3X A;  2IGK A;  1Z3Y A;  1DQU A;  1U0J A;  4CZC A;  2GOX B;  2LRE A;  2PJR A;  4W8Q A;  2IXS A;  3PFY A;  4Z05 A;  1O8D A;  3QYF A;  1SKY B;  2XSJ C;  3V42 A;  3B90 A;  3K6G A;  4XNF A;  2W6J A;  2PJR B;  3OYK A;  4PK4 A;  1W0K A;  2GK6 A;  2KPM A;  2K9L A;  2ZZF A;  3ZR8 X;  3S3N A;  1WMR A;  1MMG A;  3H35 A;  2HVQ A;  3WQZ A;  2W1O A;  3VMV A;  4PFO A;  1O88 A;  4BJ5 C;  4EW9 A;  2MYS A;  4BE1 A;  1NRK A;  1HA8 A;  1XG2 A;  4PSW A;  3I3L A;  3KYL A;  1LVK A;  2VXD A;  3HOT A;  4J01 A;  2NT6 A;  3GBG A;  1Y6I A;  3BH4 A;  2MD0 A;  3BCB A;  2CW8 A;  2M7B A;  4B44 A;  1FMW A;  1TT0 A;  2MC4 A;  4CCJ A;  3OY9 A;  4CA0 A;  3VDX A;  3VYT B;  1UD3 A;  1WTH D;  4W8S A;  1Y56 A;  2WPD A;  2VBE A;  4AU7 A;  2CV0 A;  4I84 A;  3S32 A;  3F9K A;  3OL3 A;  1LDK B;  4CH7 A;  2KRC A;  2ZSI B;  3CF2 A;  2DCE A;  1O8H A;  2UVE A;  3OWT A;  3S93 A;  3J7A Y;  2R7R A;  4XLH A;  3PL8 A;  3GQ7 A;  1VJS A;  1D1A A;  3EUK L;  2X53 S;  4PSX A;  4W8R A;  3IAM 2;  2JJ1 A;  5DN6 A;  1K6Y A;  3E1S A;  2R7X A;  4NK6 A;  4ZC3 A;  5JHF A;  3OYJ A;  3H9Q A;  1QU3 A;  2GJR A;  2INU A;  4H4K C;  1OR7 C;  4PUS A;  4HPQ A;  3CP2 A;  2KMU A;  3RPU D;  4BU2 A;  1OFL A;  1BR4 A;  5FRN A;  3FPP A;  1N75 A;  2KLO A;  4U87 A;  4ZDO A;  3BG6 A;  2IS1 A;  2CH0 A;  4B48 A;  3HAG A;  2NSP A;  3RCO A;  4P1W A;  2BVL A;  3B8Y A;  3LSG A;  1E3Z A;  4ZYA A;  5HKK A;  1FMV A;  2L7K A;  2LZJ A;  2ZZQ A;  3BCD A;  2WJY A;  2DJI A;  3E0J B;  2V6E A;  1T5E A;  4XON A;  1WPC A;  2XOK A;  1UG0 A;  4F92 B;  1I18 A;  4KKT A;  2HVS A;  2K9M A;  1X0C A;  1H8E A;  2P0W A;  2VJJ A;  3GVL A;  4HWV A;  3L2U A;  3ONQ A;  2OC6 A;  3VSK A;  4DIQ A;  1VBL A;  4XQF A;  3IUO A;  3QYE A;  1P9Q C;  2XGJ A;  4BEH A;  2LC2 A;  3DU6 A;  3CZ6 A;  2R7S A;  3LMW A;  3OIQ A;  1V5F A;  2E5Z A;  1UD8 A;  4B43 A;  1JTA A;  4E0F A;  3K4M A;  1X19 A;  4BEH B;  4ZTJ A;  4D9J A;  3OYE A;  4URR A;  3OEH A;  2XZP A;  3GVJ A;  3A4C A;  2V7F A;  4HEA 2;  1V0F A;  1AA7 A;  3OFN A;  2GK7 A;  2Z8G A;  1O8K A;  4OJP A;  2I8D A;  2R7Q A;  4NK8 A;  3DTK A;  2IGN A;  2R7V A;  3LSH A;  2D3N A;  3HOS A;  4Z06 A;  3K4K A;  1VZ0 A;  4JQF A;  4U7B A;  4LIU A;  4E7H A;  4DNR B;  4JMQ A;  3H9J A;  4E7I A;  3VYR B;  3PSF A;  2LOO A;  2X6W A;  3H0D A;  3T53 B;  3TMO A;  2GJP A;  3C2G A;  2W82 A;  4ITV A;  4LG3 A;  2MFZ A;  2M5S A;  1IA5 A;  2W6I A;  2O04 A;  3OL4 A;  3VYS B;  2KHM A;  4XLE A;  3AL0 C;  3VYU B;  2ZTG A;  1PLU A;  3AKZ A;  4XR6 A;  5CKT A;  1HG8 A;  2NTB A;  4YZQ A;  1RWR A;  3ZCO A;  4ZDL A;  3UNG C;  4AYB A;  1QHG A;  3UR3 C;  4R79 A;  1WJC A;  4HNU A;  4BAC A;  4YZ0 A;  2F43 A;  3JU4 A;  1NHC A;  2E60 A;  2JA2 A;  1SAU A;  4NNJ A;  3K4B A;  3OYD A;  3BG7 A;  1MAB A;  2QKL B;  3OR1 C;  4II2 A;  1O8L A;  3DQV C;  2LBF A;  3DPU A;  3OYF A;  1JI8 A;  2VJ4 A;  4PJM A;  2M7A A;  2X51 A;  2ZXH A;  3DLA A;  4U49 A;  4BS9 A;  2VLA A;  1AIR A;  1V5G A;  5KNL A;  1WJF A;  4OJO A;  5CQE A;  2IS4 A;  2BSP A;  4Y4R A;  4BDZ A;  1X4O A;  2QXZ A;  4E7Z A;  4G6T B;  1HVX A;  2WY8 Q;  4ZDP A;  4XLC A;  3ZSC A;  3T9G A;  4PFP A;  2M4K A;  3SDB A;  2XZL A;  3H5N A;  3QOD A;  2NTQ A;  1G8X A;  2BW3 A;  3RTR A;  1V5E A;  2JIZ A;  3T56 B;  1GLN A;  2W4S A;  2ZZE A;  1E0E A;  3K70 C;  3TBI A;  2VB6 A;  3ZGK A;  2BW3 B;  1D0Z A;  1WFX A;  2V4J C;  2O0W A;  3OS1 A;  3OEE A;  4BQQ A;  1WJE A;  1VLY A;  2VQH A;  3OYB A;  1BPL A;  2GJK A;  2X8K A;  2V9K A;  2L5Q A;  3OYG A;  2CW7 A;  3MKW B;  3DDY A;  2HU9 A;  3PNT A;  3CES A;  1H80 A;  2QKM B;  2ZFU A;  2HVR A;  2Z2S B;  2R4G A;  3VMW A;  1RU4 A;  4RLF A;  2NT9 A;  2HPI A;  4BUP A;  3W3C A;  2LYC A;  1X4P A;  2VJI A;  3K10 A;  2VAS A;  4BGD A;  5LFA A;  3BLY A;  2E5N A;  1JRG A;  2VL8 A;  2Q1Z B;  2VIX A;  4RMN A;  4HG2 A;  4XKW A;  2L9S A;  2OV7 A;  4XLF A;  2IS2 A;  2LH9 A;  3DTE A;  1KCC A;  3FKJ A;  3HPG A;  1D1C A;  4IKF A;  4YEL A;  3EQO A;  2PYH A;  1I8D A;  3HUG B;  3NWT A;  3W2V A;  4B47 A;  1UEL B;  3QOE A;  1BR1 A;  4OJL A;  3OYC A;  4DBR A;  2UV1 A;  1KMH A;  3GQ9 A;  2CV2 A;  1QHH D;  1MNE A;  2Z16 A;  3G05 A;  4KJZ A;  3HPH A;  2XND A;  2DOA A;  3OR2 C;  2E1B A;  4DGW B;  2XF7 A;  4E6K G;  4ZJZ A;  4JOM A;  3L2V A;  3VR6 A;  4DK0 A;  2BVM A;  1N78 A;  4L8J A;  3VSL A;  1OOC A;  4MXN A;  2V1N A;  3KEW A;  1TZL A;  1ERD A;  4XM3 A;  2JDI A;  3D5L A;  3KRG A;  4E7S A;  3L2Q A;  1DBG A;  1OFM A;  2W7N A;  4BE2 A;  3W2W A;  4HIZ A;  4IX7 A;  4BE0 A;  4DNT B;  4N4N B;  4BL0 B;  1UD5 A;  2F5V A;  1W0J A;  4BJ6 C;  2CUZ A;  3LNN A;  2ELJ A;  2X6X A;  4MLO A;  1BN8 A;  1YX3 A;  1MMN A;  3FKS A;  2KL4 A;  4C2U A;  3OPO A;  4OJ6 A;  4E4H A;  2HDW A;  2JVH A;  2RRE A;  4C9Y A;  3HL2 A;  2WAE A;  3IP4 B;  2KDO A;  2WAD A;  2R7W A;  2QE7 A;  2QY1 A;  3GQA A;  3S3O A;  3OS0 A;  4B3G A;  2PMZ A;  3A1Y A;  4LIT A;  3CJQ B;  3D5S C;  3QYB A;  2IS6 A;  3DWL E;  2VJ5 A;  4XKB A;  1T0F C;  4E7J A;  2M4G A;  2RNG A;  2VPL A;  4BJT A;  2XF5 A;  2E1M C;  3K4J A;  2XDV A;  2R7T A;  4G7W A;  4Y3O A;  3SEZ A;  2CFO A;  3LSI A;  4YEJ A;  1PE9 A;  4D1Q A;  1D0Y A;  1BR2 A;  4XN3 A;  2R9V A;  4CCK A;  3K4C A;  1O8F A;  4XOT A;  3HXL A;  1V0E A;  3CMM A;  3OS2 A;  3OYI A;  3SZG A;  2DXI A;  4XOP A;  3H94 A;  2CK3 A;  2V7Q A;  3GQ8 A;  4HST A;  1UD6 A;  5C1E A;  5KCM A;  4CUG A;  2D3L A;  1SFK A;  4XKV A;  1O8J A;  3LFU A;  1EA3 A;  2F4I A;  3ZQQ A;  4UZU A;  4OWR B;  2NOJ B;  3M8J A;  2O5R A;  2IQ7 A;  3EQN A;  2WZP P;  3MKY B;  4FAS D;  2AQE A;  1K28 D;  1WP6 A;  4CCM A;  3BCA A;  2ZZG A;  1S9H A;  3RQ4 A;  3K70 D;  3ZIA A;  3C2H A;  1FX0 A;  3DPL C;  4BQO A;  4HSR A;  3PUB A;  1QJV A;  2FUG 2;  2Y0S A;  1DP3 A;  1OB0 A;  1RMG A;  4YZA A;  2BOL A;  1N77 A;  3VSV A;  2CS3 A;  2IGM A;  2LBF B;  4F52 A;  4RM2 A;  3HKZ A;  3BC9 A;  1VF7 A;  2AQF A;  3SEQ A;  3SYT A;  4G7X A;  1X1B A;  4XLA A;  4B3F X;  1GQ8 A;  1OLT A;  3GRH A;  5C1C A;  3OW7 A;  1KZL A;  3GVK A;  3JUR A;  1X1C A;  1R6R A;  3FBI B;  1DGW Y;  4MR0 A;  4QPO A;  2KP6 A;  3OE7 A;  3BC8 A;  4N4O B;  3UW0 A;  4ASU A;  1O8M A;  1WJA A;  2CUJ A;  3OYH A;  2DT7 B;  3AFH A;  4YRV A;  3L2R A;  4BDY A;  2F1M A;  5HNH A;  3RSN A;  2IGO A;  5FRO A;  3KEY A;  1E1Q A;  2CMP A;  5HVQ C;  2R7U A;  3EPZ A;  2V4D A;  4F91 B;  2XC7 A;  1G59 A;  1E1R A;  1BOB A;  4RLQ A;  1UD2 A;  3G2B A;  2EWE A;  1IDK A;  3BCF A;  3PNV A;  2WY7 Q;  3LMM A;  1OGM X;  1X1D A;  3W2A A;  2WAF A;  1KON A;  3EUA A;  3N05 A;  2LY2 A;  1W36 C;  5CDF A;  4CCL A;  3OIP A;  1BHE A;  2UUZ A;  1CZF A;  1YX5 A;  3U21 A;  3VWB A;  4E7K A;  3AL0 B;  2HQA A;  4TSF A;  2VQG A;  1QCX A;  1PJR A;  2VBK A;  3LSK A;  1X1A A;  4IQ4 A;  2HPM A;  2X1E A;  4BQN A;  4KIS A;  2CV1 A;  3OYN A;  5FRM A;  2GOM A;  4NUB A;  1H8H A;  4FXU A;  1E43 A;  3WWG A;  4KKS A;  1WJB A;  4KT6 A;  4HNT A;  2XF6 A;  4NC7 A;  3EUH C;  3A35 A;  4KKU A;  3LL7 A;  4XD7 A;  2HLD A;  3LSM A;  4OZY A;  3VSU A;  2JUG A;  1Z3X A;  4Y33 A;  2JJ2 A;  1PXZ A;  2UWM A;  3ZRG A;  2Q2E B;  3SUC A;  2VXZ A;  3OOC A;  1LFP A;  3M1C A;  3PNY A;  3DKY A;  1W9X A;  4XOR A;  2JVG A;  2M0M A;  3FHN A;  4J00 A;  1Z21 A;  3OAA A;  2W00 A;  2WBM A;  2VQC A;  3S8P A;  3IAS 2;  2R7O A;  4DJA A;  3DU5 A;  1E79 A;  2O0V A;  2X1D A;  2PEC A;  2HNH A;  2KRH A;  2DIE A;  2Z1D A;  3A3G A;  1D1B A;  1HZE A;  1K5C A;  4TT3 A;  2ODL A;  3HC7 A;  3MKZ A;  1COW A;  4PJN A;  3PJR A;  2F6C A;  1WJ5 A;  2ZSH B;  4B3X A;  2A6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...