4XKWA

Tailspike protein mutant d339n of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 233
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkwA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkwA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkwA02
4YZQA 4C2LA 1VBLA 1BN8A 1EE6A 3GQ8A 4XQFA 1WMRA 4XLAA 1XG2A 4MR0A 1O8IA 2PYGA 3B4NA 4U49A 2QX3A 1PXZA 2O17A 1OFMA 2O0WA 4YZXA 2UVFA 4EW9A 5C1CA 3EQOA 4OZZA 4XONA 4XORA 1AIRA 2NT9A 4NK6A 2UVEA 4MXNA 1O8LA 1OGOX 1O8MA 2X6WA 2QXZA 1IDJA 1O8JA 1NHCA 4XNFA 4NK8A 3T9GA 4XLEA 4XLCA 4XOTA 1BHEA 2VBMA 4URRA 1O8GA 4AVZA 1RWRA 1JRGA 1DBOA 4HWVA 2NSTA 1OOCA 4W8SA 3JURA 2IQ7A 4XN3A 1QJVA 2INUA 2Z8GA 4XL9A 3B8YA 2NTPA 4W8TA 2NT6A 4YZ0A 3WWGA 4XM3A 2O1DA 3GQ9A 1O88A 1IDKA 4Z03A 1IA5A 2BSPA 2NTQA 4YEJA 3VMWA 1RU4A 2QY1A 1JTAA 3VSVA 2NTBA 1QCXA 2VBEA 3ZPPA 2EWEA 2X6XA 2X3HA 3GQ7A 4W8QA 3FY3A 4W8RA 4U4BA 3B90A 1HG8A 1OFLA 1O8HA 2VBKA 3SUCA 1KCCA 2ODLA 4XKWA 1IB4A 3ZSCA 2X85A 2X6YA 4Z05A 4YELA 1CZFA 4Z06A 3UW0A 1KCDA 3LMWA 2O0VA 2INVA 4OJOA 3VSTA 1O8KA 1H80A 4XOPA 4OJLA 4OJ6A 1OGMX 4OJ5A 4XR6A 2O04A 2NSPA 3VSUA 1X0CA 2NZMA 3KRGA 2PYHA 1O8DA 2PECA 4XLFA 4XLHA 2VJIA 4XMYA 3EQNA 5AMVA 3GRHA 4PMHA 1K5CA 3GQAA 4OJPA 3VMVA 1PE9A 1KTWA 4I84A 4XN0A 1RMGA 2VJJA 1O8EA 5C1EA 4YZAA 1PLUA 1GQ8A 4OZYA 1DBGA 1O8FA 4XKVA
chains in the Genus database with same CATH superfamily
2AXLA 1OPCA 4AIJA 1W0UA 4KMUX 5CKTA 4WX9A 4HF0A 3T8TA 2XDVA 2P5VA 4P22A 3PNTA 3IWZA 4DJAA 3I55B 5CJ9A 3NRVA 2XGXA 3CRZA 1X3WB 2BXYA 2CFOA 2UUZA 3VYTB 2P8TA 2I1LA 4BGDA 2WAQN 3FHNA 3X2QH 4ETSA 4PAAA 1DQUA 5TY0A 3HJEA 4P96A 1WGXA 3OYEA 2PJRB 3TBIA 3KYCB 3H5NA 1U8RA 2XNJA 3O2PE 1SC7A 3HIFA 2B0RA 3FXLA 3W6JB 2WR8A 4ZCLA 5HOOA 2NT9A 4HF1A 4HSRA 2VFQA 1RKWA 5M5XJ 1G8XA 2JUCA 2FBHA 2CW0F 1WTHD 2K5CA 4M74A 4FX4A 2LY1A 4G7HF 1VF7A 2HLDA 5HNHA 4C9YA 4KICA 3G4SI 4HIZA 2JK3A 3K4LA 1RWRA 1JRGA 3GXOA 2EQRA 2A5YB 2KL4A 1W35A 2FVGA 1OJLA 2WY7Q 2FOWA 4ANJA 4OMYA 1RQPA 2XTYA 3CQZJ 1XCVA 4A12A 3EETA 2LY9A 1RKTA 2GXAA 4BQAA 4CYCB 2Q6IA 2QQAA 3LQQA 2D3LA 2HVSA 4IW3B 4A3DJ 3VDXA 3I64A 4CYCA 1OCPA 3JRDA 1ZTRA 2WAFA 1JGSA 1KRHA 1HF0A 1MGTA 1WCMJ 2DLLA 2CBXA 2DFFA 3I58A 5LFAA 4OOSA 2E34A 4PJ0C 5E3OA 4XKCA 2CO5A 3VSKA 4RB0A 4LB6B 4P1WA 2VBVA 3CJRB 2WTEA 1ZG5A 3S1QJ 2W1OA 2FEZA 4MIMA 1QQ1A 1MKMA 4OIRF 1FNCA 1DARA 2JSPA 1FEXA 1E43A 3BZKA 3C2BA 2HKXA 4YELA 2DYIA 4NB5A 2V7UA 3CF5F 2EZKA 3FBIB 2VBUA 1UFMA 3CZ6A 2M5SA 1TBXA 2Y31A 3OYJA 1KYZA 5DCFA 2LBFB 2GQFA 4RD6A 3KP3A 4ABZA 2IRFG 1QGYA 1YJ9B 3GWZA 2CS3A 2DW4A 4TT3A 5D8LB 2L0KA 2PG4A 4XRSG 2R5YB 1B59A 2R4GA 2HEOA 3GRHA 2D3NA 3JRFA 3JRBA 1HVXA 4C30A 2NNYA 3JREA 4DK0A 1ZKGA 5DM7F 2H09A 3LSKA 5J8CA 3BQYA 2KIFA 2R5YA 4PSXA 2H8WA 2M87A 4M3DA 1UAAA 1O8EA 2FJ1A 3DBLB 4GYGA 4FWTA 4JRAC 4Z4ZA 3CC7B 2CC2A 5C1EA 1SFEA 5C4XJ 1R5ID 3PUMA 2KRCA 1S8NA 4PABA 3U2RA 3ZN1A 2IAIA 2F4OB 3CLOA 1N0VC 3WHCA 1DABA 3B6CA 4E6KG 1WHUA 4Z4VA 4XQFA 3OS1A 3WU1B 2BSAA 3WTXC 2KISA 5DS9A 4BUPA 3BCFA 3B4NA 2FQ3A 5LRRA 4KITB 1HW5A 2TCTA 3SFIA 1K4ZA 3DQVC 4L5EA 1R9TJ 1JHFA 1QX4A 3PO3J 4M73A 4WZKA 4IXAA 3F3XA 3W2AA 4IZZA 4ZGNB 1RZ4A 1IN8A 2B5OA 4YIIA 3MMYB 4RAYA 5LEJA 4S05A 3L2VA 3CW2A 3CD6B 1IW7F 1SFKA 1W2BB 2JA7J 4LOCA 1GHCA 5A8AA 4R79A 2X1DA 2Z3YA 2WB1N 3B02A 1WI9A 2V7TA 1XGOA 3PFIA 1KONA 3JRGA 5ILSA 4L0ZB 2A05A 4N4OB 2C78A 2OUMA 4OP7A 3LMMA 1TUIA 4BE2A 4ZZDA 1L3LA 1SAUA 3WY9A 4M9XA 2EWNA 3HPGA 1NTCA 3ECOA 5ICGA 1MJ9A 1YX2A 1VQ9I 1P4XA 1ZREA 4RAGA 5IOZA 1BOBA 1OCTC 2CV2A 3LL7A 3QU3A 3QU6A 4HX8A 1VQLI 2GAUA 5B66C 1ZQ3P 3CCSB 4E7ZA 3B8YA 2L7KA 1R6RA 3I4PA 3DLAA 1FX7A 5FKMA 3I0TA 1ZR4A 2FRHA 3RQ4A 5IY5H 5IYBJ 4I02A 2IGOA 3RJPA 2DU9A 3U21A 2DOFA 4L8JA 1MMDA 4V19K 3OJWA 3P7NA 4DYRA 4EJWA 2RC5A 1N77A 5FLVA 4DZPA 3FKJA 3CCEI 2EPFA 4BXUA 2GA2A 2JIZA 5FROA 2MD0A 5KCMA 2DDAA 4P5OA 3CDIA 4ZYEA 2VT2A 2FNPA 3BT9A 4HLXA 2ZZEA 4GGGA 2DMQA 2L2OA 2R5ZB 3U6BA 2V6CA 2ZJQF 1KCCA 1Z3YA 1FOKA 4PC6A 2M9HA 2Q1ZB 4IQ4A 1F4KA 1I1GA 1I5ZA 5EYRA 5AIQA 4JYKA 4OJOA 1NB9A 1D8KA 2R5ZA 2Q0OA 4XOPA 1VQ7B 3IV5A 2CW5A 3GLXA 4OJ5A 4X0GA 4AIDA 2HYJA 2LRDA 3K70D 3SEQA 3GEZA 2VNKA 3R4KA 1BI0A 2HZTA 2KPMA 5GADJ 4PFPA 1YITI 3H94A 2XIGA 3E97A 5AMVA 1G3TA 2UV1A 3H3UA 3HHHA 3RPQA 3TQNA 3W6KB 2AQFA 3Q0WA 3S1MJ 4RD0A 1T6ZA 3FXQA 3OZUA 5M5WJ 4E70A 2V7FA 3V76A 3OEEA 2PI0A 1KC8D 4EM0B 2BV6A 2D5VA 4L9NA 2PMZA 1OB5A 4J0QA 1WFXA 4MGRA 2GREA 1E1RA 1CQTA 3C7JA 1BC7C 2XF6A 2YS9A 2GXBA 3R60A 2XKOA 2V4JC 3ISPA 3VNVA 2KDZA 1OCZH 2KRHA 1T98A 4UXNA 4QVAA 1YHQB 2N8GA 4MQVA 3QRFF 1SFOJ 4M53A 4RDKA 4RGUA 4G9YA 3J7YJ 2DDBA 4LD5A 1ZRFA 2PJPA 5A89A 1VQOI 2XZOA 2CK3A 2W57A 2DT5A 2A3SA 3BR2A 3VNUA 5D8KB 3OYMA 3EYIA 5K5OA 2ESHA 3P9CA 4FE4A 4WWVA 2DT7B 3QE2A 1R1TA 3ABLH 4Q4ZF 3GTOJ 2XPVA 1QFZA 2R9VA 2O17A 1VQ6B 3S3MA 1Q86D 1ENHA 1X1PA 3HHGA 4BJTA 4P12A 1W9XA 3IKVA 2RV8A 2X0KA 4Z4WA 2L9VA 3MKYB 2FBKA 3TOBA 1DDIA 1N0UA 2M4GA 4DNRB 1YTYA 3AG1H 2C2WA 3OFNA 2YUHA 1VQ4I 1WH5A 3SJPA 1NHCA 1UELB 5CYVA 2W00A 4G6TB 3S8PA 1GR1A 3OAAA 4URRA 1Y0UA 4BE0A 2E36A 1JNYA 1YLOA 1BI2A 1ZHFA 2ZB9A 3F8MA 3PUFA 1P4AA 5H2FC 4R1HA 3F23A 4A93J 2KIQA 3KE2A 1OOCA 2NNNA 2AHOA 3CCJB 4DBRA 2FD5A 2K3FA 2DCEA 5H6RA 4KFCA 2WY8Q 1QHGA 2ZC2A 3L1PA 4OPOA 1A6IA 2L01A 3ASPA 1H42A 3GZNB 1QZZA 3ABUA 4F55A 1HXDA 1Q1HA 1KD1D 5ED4A 1A04A 1COWA 1O88A 4Y9UA 3I4NJ 2XSJC 3LA2A 3HSRA 2YUSA 1GDTA 3GTLJ 1FC3A 5EDNA 3OSGA 2NV4A 2DO7A 3BH7B 2HYFA 2IJLA 5K1YA 4EM1A 2GIZA 1S4MA 2X53S 1LM1A 1QCXA 5M3FJ 5THXA 3I3LA 2VBEA 2X3HA 1QVUA 3FY3A 1WPKA 1U2WA 3BZ6A 2BBYA 3RPUD 3W2WA 2WWYA 3E3VA 4KNYA 3PL8A 1BJZA 2XC7A 1IUYA 2Q6KA 3B8HA 2WA0A 3VR6A 2K9MA 1OFLA 1VHOA 5IYRA 1WJEA 3DPTA 1IXRC 3TMOA 1U78A 1APLC 2MGQA 4CA0A 1J9ZA 1XG1A 1ZG1A 1E3XA 1QGZA 2CFXA 4PC7A 2RQQA 4L0YB 1QPMA 1KGSA 2HCJB 2DEUA 2DA1A 3L00A 3BQJA 2HU9A 4KMFA 2A68F 2VQGA 2NOGA 4DYQA 2C77A 5TRDA 1CGPA 1BBYA 1EH7A 2HI3A 2QEXI 2QSFX 2R7ZJ 1S6LA 2WADA 1A36A 3DEWA 2Y48A 1W0JA 2EBIA 3DPLC 1V4RA 4FK8A 2Y9ZA 1RRJA 4HYEA 4TMVA 1D8JA 3K4KA 2H1KA 1Z91A 1XGNA 1Z9CA 1UCRA 4FCYA 2PLYA 3K4CA 3GUDA 2QF7A 2HFHA 1NRKA 1LE8B 4PZJA 2X6OA 4Z4RA 1J09A 2VASA 2GWRA 1IB0A 3ES9A 1LLWA 3TO6A 2VXZA 4M0LA 1IJFA 2LMDA 4IX7A 2BHZA 1DBGA 2DFHA 2PQ8A 5GAGJ 2V31A 1BI1A 1VBLA 2B7CA 4UB6C 5GPAA 1LE8A 2HTJA 1Q9SA 4WXHA 2BM5A 3DU1X 1PYVA 1N05A 3C2GA 2XAUA 2XV4S 3CESA 2F43A 1NK3P 1LPQA 1GVHA 2QX3A 1QBJA 1PXZA 3B6AA 1G4DA 2ZXWH 5DTDA 1P6RA 1Z6RA 2VIXA 1BL0A 3SY2A 4MYUA 5M3MJ 2RQPA 3V8JA 3BP8A 4RDLA 1E0EA 5C1CA 2GA1A 3S15J 1QA6A 2EFNA 2MW8A 2K9NA 5BOXA 1F43A 1OQYA 5B6IA 1KU3A 4V02C 1QVTA 3OOCA 1O8JA 1ITYA 3UNGC 2ISZA 4CYDA 1N25A 2ESNA 3F9KA 1YJNB 1ZRCA 2VBMA 2D1HA 2HPIA 4TV7A 5C3EJ 4AIKA 3JCUC 3CCMB 2W7ZA 4Z4SA 4O6JA 3CMEI 2R7DA 2LSOA 2GM4A 1F9NA 3MD2A 4HWVA 2E19A 1UD4A 1KQ9A 3KLNA 2CYYA 4P3IA 2VBXA 4XN3A 3N05A 3OPOA 3EUHA 2IA2A 4NQWB 4XL9A 4Q48A 3NE5B 3MKWB 3AFHA 3WXMA 4E7KA 4HSTA 4MEXF 2ID3A 3QFSA 4LBZA 2B7BA 3WTYC 2QM3A 1D3YA 1MNDA 2A69F 2NYXA 2CU7A 3CDHA 4A6EA 1FYLA 1N08A 2XZLA 3ZQFA 2BM4A 4NQWA 1W0TA 4IHXA 2F4MB 4PJNA 3MKZA 1VTNC 1K83J 3RKYA 1SKYB 1OB2A 5JHUA 3FK7A 3KEQA 3DKXA 3GMEA 2HOSA 4EH1A 3T8RA 2ZBVA 1QQIA 3OWTA 2Y75A 3KP7A 3MFKA 4X8IA 2OBRA 4DK1A 4OOXA 5E6TA 2EIKH 4I99C 5C44J 1ZUNB 1K9MD 1YO5C 3W5VA 4MQ9F 1IB4A 3FKSA 5B5EC 1TT5B 3OMYA 2IS4A 1OGJA 1AWCA 3ONUA 3G4SB 4EATA 1XPXA 1EFUA 2W48A 5DM6F 3LNQA 2R7SA 4JX5A 2GPJA 2KMUA 1TWAJ 2HYGD 4P9SA 2DYSH 1A35A 1B9NA 2YU3A 4BAYA 1POGA 3S17J 2NS7A 4U4BA 5DNSA 2HR3A 2HWVA 3HM5A 3ZQLA 5DSZA 1SEUA 3S16J 3MZ8A 2C5BA 1TQPA 2OQGA 4A3MJ 1IG7A 2PYHA 4IOAF 4MEYF 2KJBA 1WSUA 2IPQX 3M1CA 4JK1X 3BH4A 4X7DA 5FO0A 3CPWB 3VYRB 3BDDA 1VQNI 5CDFA 1K5CA 3SYTA 5EMNA 2PMUA 5JVTA 4L9VA 3ZQHA 4FT8A 1AOYA 2DQLA 2V1NA 2DOEA 4KN4X 3LAPA 1KQSB 4ZC3A 4BDYA 2NRAC 1Y0YA 1WSVA 2HXOA 3E1SA 1VHEA 2JDIA 3DV8A 3MHPA 3WYAA 3ZPPA 4N4NB 1D1AA 2BY3A 2V7XA 1M1KD 2IOUG 2D2WA 2L7ZA 5F0CA 1BN8A 4BDZA 1M90D 2O1DA 3BWGA 3H1CA 1GVDA 4ZYDA 1QA2A 2WV0A 3HEFA 2NVUB 3S32A 3KIOA 2E7WA 3FPPA 1NG7A 4RD3A 3K1MA 4J19A 3HRSA 2ZKZA 2CV1A 4U49A 1JHHA 5IT9K 2DERA 2QLZA 3H0DA 2DOGA 3DBHB 3Q0UA 3RPUA 2V7WA 3L2CA 5H5JA 3A0HC 1OFMA 2VFMA 5L3DA 3LSMA 4MTEA 2NVTJ 1IHMA 1BOAA 4HA8A 5L3FA 1IJWC 5J4YA 5C4JJ 3P9KA 1BC8C 1I8DA 2L7FP 5HZAA 1HW1A 2GK7A 2KZVA 1K78A 3M9AA 3U6KA 1N75A 4NK6A 3PO2J 2QENA 3GF2A 5EG0A 2E60A 2OJED 5ICFA 3LSTA 2HTSA 5LHGA 2BGJA 3CCJI 3CUQB 2NXNB 1FNNA 4RS8A 1RI7A 3WTZA 1ZM4A 2C4TA 5IPAA 2QQ9A 2QYOA 3KZIC 4E7JA 1H0MA 4YAWA 5FO1A 3ERMA 1E63A 1Z77A 2DTRA 3W6VA 4I0AA 3H35A 5CVRA 1WZ2A 1WJFA 3CUQA 1K79A 4CGZA 2LKSA 6PAXA 3CCMI 4C43A 2IEKA 3K6GA 2VN2A 3UKGA 5BSYA 4A3BJ 3Q9VA 2WAEA 1VQ5I 2EZHA 3CC4B 2K9SA 2GIVA 2ZXIA 4IHTA 2NS0A 3AVXA 3PIPF 3NAWA 2X1EA 4RM0A 2BHYA 2IXSA 2LVSA 3CJTB 1XDUA 2K27A 3L9FA 5HS9A 5KAIC 2OZUA 4F92B 3KP2A 2ZL5A 5IP9J 3FF5A 1CQXA 2DETA 4HG2A 1R4MB 2F48A 2DK5A 2JJ7A 5IP7J 3JRAA 2XT4A 1D0YA 2JN6A 3HOWJ 1T0FC 1OB0A 4IPAA 2EWEA 3GQ7A 1RESA 3WG9A 3LA7A 2ME6A 2FXAA 2JPBA 3OYFA 3S3OA 4IHWA 3AVVA 3HGGA 1E62A 3KX2A 1MH3A 4YG2F 2R7OA 2O8XA 4TSFA 2EB7A 4KUMA 4U7DA 3CMAI 1FLIA 3LMWA 3HUGB 1YS7A 1IO2A 1K28D 1VQPI 2M8GX 3KYDB 3S2HJ 1IRXA 2XGEA 2Z6BD 1VQLB 3C2HA 4OMZA 3V7SA 3ZQIA 2VNJA 3L09A 3HUGA 5ICEA 2XNDA 2RNGA 4A3EJ 1HF2A 1TQIA 4AUXA 4HQEA 1K4TA 4ROXA 1ZGAA 2ECBA 5BSXA 1TQMA 2VC0A 1XB2A 2EA2A 2PBIA 2KLOA 3K2AA 3G6EB 2B63J 1PE9A 2M0MA 2HQRA 3KZZA 1AKHB 5DCMA 1W34A 2X3UA 2VT3A 3TW7A 3DEEA 1W7PD 1X4OA 2XROA 4I2OA 3CCEB 4GCVA 2D45A 5M5YJ 1TSPA 4KT5C 5HLHA 1OR7A 1RUNA 3JRIA 3ASQA 3K69A 5L3CA 2VBZA 2EFQA 1Y0NA 3G1LA 2B0LA 3J80K 3IWFA 1ZH5A 2X1CA 3VO2A 3MVPA 3KPHA 5CVIA 1TT0A 5FFZA 5JR3A 1YG2A 2R7WA 1IRZA 2ZL7A 1GUUA 1U9NA 1BA5A 1A6QA 1U2RA 4F91B 4N9IA 1I39A 4HX7A 2XKPA 3KP4A 2PMHA 1ON2A 1TWGJ 3KCCA 2CUFA 1MRZA 5FL7A 1B23P 1Z21A 1JE8A 2GK6A 1MH4A 3ELKA 3SLNA 1DGRM 4CICA 4X05A 2HKOA 1TYXA 3RDIA 2R7UA 4P6VF 4LLNA 1JUSA 1LFBA 1BJAA 2XGCA 3TL4X 2BW3A 1JB9A 4H0EA 1R71A 3QOEA 2DYRH 2K85A 4B47A 1HC8A 1R00A 1Y8QB 3K1PA 3AVUA 1ODDA 4P2NA 3BG9A 1N78A 1YJNI 3GZ5A 3A8IA 2CV0A 2L54A 1STZA 2KDOA 3M8FA 5D6FA 1KQ8A 2STTA 4JMQA 4OAZA 3O8HA 4RA2A 4A0YA 4NCNA 2DJNA 1KK0A 3GO5A 3H92A 2VFNA 4NK8A 2NAZA 3MEXA 4XLEA 4QLCU 4PUSA 1PVEA 3P26A 2ZMEA 3BR0A 2G7UA 2BOLA 2Q2EB 3ZN0A 3U2QA 3F0CA 3Q9SA 2CQQA 3J7ZI 3W2EA 5TGTA 1B4AA 2UXXA 3HXLA 3E6DA 3GIRA 1VQOB 2NVXJ 4BBSJ 2ZNYA 3FJOA 5LHHA 4FETA 1HA3A 2Z8GA 5F27A 1XS9A 2Q2EA 3J7AY 2DAOA 3MZHA 5GP9A 2WSSA 3Q38A 4A5NA 2O6WA 4B43A 3FDYA 1HDDC 3FXMA 3E6CC 4H9GA 3QYFA 4Z6YA 3I4MJ 2DMUA 2PJRA 4NUBA 3LO8A 1VF9A 4OOIA 4EEFG 3F6OA 1XTAA 2LF8A 1IXSB 3ZMSA 2R0QC 2ZXHA 4IHSA 1J0RA 3DU5A 3OZVA 3B73A 4BHPA 1OYIA 3EYYA 3V7AA 1VQ4B 2CQNA 4A69C 1O8HA 1Z3XA 2BEOA 2UWMA 2BMWA 2X6YA 1O3QA 1JJ6C 4N3GA 4BYYA 3BH6B 4NBSA 2FSWA 2RDPA 2INVA 4YFKF 3CCVB 1KU9A 4OJLA 3CC2I 1E3ZA 2HDNB 2DODA 1GO2A 4ENKA 1WXRA 3QAHA 2LF7A 3GFJA 2NZMA 3SFZA 4E4HA 4BACA 3RSNA 2VBSA 5F0FA 4LGWA 1MBHA 3ZMUA 1PJ6A 5HS7A 2DBBA 2PECA 4HF2A 3EQNA 3JU4A 2XSDC 3BJOA 2G9WA 3A02A 2F5DA 3D5LA 1ZLKA 3NB2A 2X0LA 3TP3A 2CQKA 1O7FA 2GLOA 3V8KA 5EGOB 4CZCA 3WG7H 2H6CA 2QCOA 1XD7A 4P3YA 5GAHJ 1UB9A 3F21A 2G0YA 2XAFA 3BJAA 5LGUA 3S1RJ 1IDZA 2E1BA 1S7EA 5L3EA 1IZ1A 2XRNA 5EGOA 1QG0A 3KEOA 2W85A 3FXKA 1YFHA 3T56B 1R5HA 1ERDA 3MMPA 4UB8C 4LG0B 2EH3A 2JT1A 3FMRA 4YAOA 4D7MA 5HLGA 2NVQJ 5F08A 4HV6A 2QE7A 1L1IA 1P9QC 5AONA 2O6GE 3ZUGA 5FKKA 1PJ5A 3ZRGA 1Z7UA 4Q47A 5FA6A 1QVFB 3OS2A 2CW8A 5E8GA 2MBFA 1X1BA 3A4CA 2LBFA 3JSOA 1W5TA 4OPWA 3OIPA 4ZH4F 2OU2A 5KSWB 3W2VA 3SXYA 2Y9YA 5JFRA 2QEXB 2F3LA 3LYCA 3HKZA 3HG9A 2PN6A 4EW9A 4OIOF 3ZQ7A 4CDGA 2DTZA 2MFZA 3BR3A 4I01A 4CXFA 4JX4A 5GTHC 2BM0A 4WZLA 5L3BA 5F1RA 2X6WA 2IS6A 5FIUA 4BKXA 3A8KA 3RTRA 2X48A 2YR2A 4XLCA 1ON1A 1I7PA 1BX1A 3AG4H 3SQVA 1WH7A 5A2QZ 4AVZA 1W7PB 3DKWA 3CC4I 3ZMDA 4PJMA 1IGNA 2XOKA 4JBAA 4A3FJ 2HNHA 1BPLA 5HS8A 2OTLI 3I1FA 4DYCA 1F20A 5ERIA 2MH9A 1K4SA 4TN1A 1WDTA 2EV6A 2XTWA 3TO9A 2E2IJ 4G1BA 4AF7A 1FMVA 1R5OA 4Z03A 1IN6A 3JTGA 2GJPA 2M45A 3CCUI 1USTA 3HZJA 2ZTNA 1OCOH 3QSYA 2OBPA 2OQRA 3BG5A 3OIQA 2QGGA 1O7LA 3P4GA 1CNFA 3DTKA 1D0ZA 2HDCA 5DUIA 2XAJA 1JJ2B 2K40A 3BPXA 2JA2A 1X3UA 1Q7YD 1JUPA 1K7AA 4Y7CA 2I5UA 4XKBA 4JOMA 4HE5A 3SDBA 3OV8A 1M1EB 3ZSCA 2JVHA 2EFGA 4TMWA 3CMEB 2V6EA 1BI3A 1YOVB 2E1CA 1GAQA 4QFMA 1IV8A 1KYWA 4LIVA 9ANTA 3Q6RA 2BM7A 3FBNB 3TGNA 3ESWB 2EFWA 4F52A 3QPLA 3TOAA 2WPDA 2FQ4A 3WTSC 4M9SA 1ETWA 1F5TA 1BMFA 1HKTA 3GVLA 4P25A 4HQMA 2CRVA 1LFPA 4A3GJ 1I18A 3G6EI 4XLHA 1PP7U 3OSFA 4L9JA 5B1BH 1EP2B 1X1AA 2DA4A 2CH0A 3PNVA 5KVRA 3DTIA 4C2TA 3GQAA 1WJ5A 2MC4A 3ZP5A 1U8BA 1WJBA 3HSEA 3IAM2 4HV5A 3QQAA 2WJVA 4X06A 5DN6A 2MABA 1B2RA 1FWZA 1BIAA 1K8FA 4YZAA 5HDGA 1XB4A 2EFOA 3ZC3A 2IGNA 2K7LA 4B4DA 1T08B 3H3ZA 2CF4A 2GJKA 3RYRA 4B09A 3A03A 3G1MA 4A3IJ 2I8DA 3D5SC 1ZRDA 3FXUA 2BY1A 3RKXA 4BXXJ 1P4WA 2KP6A 4DNCA 4WWCA 4F7DA 5E3LA 5B1AH 2W7NA 2ISYA 3HB9A 3SZGA 4N3NA 4EV0A 2Y0SN 3DEUA 1T38A 2VBYA 4Y9RA 4M3FA 3LSPA 2GOMA 3FIWA 3KL9A 3M8JA 2V26A 2EIMH 2KQRA 4P6YA 1QO0D 3KETA 4I09A 5CQGA 2V9VA 2ZBUA 3GVJA 4ZCMA 4ZDOA 2J8IA 2VNHA 5LGNA 1VQNB 2QYUA 2P0WA 2ZSHB 4S0HB 1XSDA 2D74A 4KH3A 3BR6A 5GTIC 4TMZA 3DP7A 3CCQI 3E0JB 1KMHA 2WBMA 1FNMA 4I6ZA 4G6QA 1HKQA 1MW7A 4II3A 2UVEA 4BBRJ 3HOSA 3E20A 3BQZA 4X7CA 1O8MA 5BMZA 1I1SA 3BTIA 3O3KA 1U0JA 1IDJA 4C0SA 1I50J 1XCBA 4XOTA 2F5EA 4HNUA 4IRIA 5KK1A 1IV6A 1LB2A 1E17A 2L4MA 5FD6A 3TKYA 1UMQA 2W84A 4HDVA 4X7FA 4Y15A 2XAQA 2RVCA 3IL2A 2VB6A 3IH2A 2MLKA 2M7AA 4ZYHA 4W8TA 1R1VA 2XB0X 1Z67A 4NC6A 3BCDA 4AM3A 2XHKA 4FQGA 1SMTA 2MH2A 4WXDA 2Z9OA 3G71I 3GQ9A 4NHJA 4LC0A 1J7KA 5AN9A 1Z05A 5D6EA 2Y2ZA 1IA5A 3BC9A 2DMPA 4PC2A 3A01B 2CRGA 2EV0A 4ENJA 1FY7A 3FISA 1YW8A 2M30A 1LQ1A 3VMWA 3COAC 5B3SH 1W0KA 3OL3A 2M0CA 2JA6J 2RC6A 2H94A 3HOTA 3A01A 4EJVA 1QU3A 4W8RA 3WTVC 2DA7A 1EFCA 3CCVI 4CQJA 2DA5A 3R61A 2ODLA 3BJ6A 3Q3AA 3O8GA 1YLFA 4L18B 2PE3A 1CZFA 4G7ZF 3UW0A 2R92J 5TV2A 2O0VA 1TWHJ 3AK5A 4RLQA 4RPDA 3FMQA 3PJRA 2CG4A 2LDUA 3V4GA 3M3YJ 3QFCA 3OE7A 3OIOA 1G3WA 4M71A 5GPCA 3C1DA 5IT9Z 1VQ5B 3KRGA 4QTRA 1WPCA 4IF4A 5HKKA 1ETOA 2O0YA 4GO1A 1V5VA 2PMDA 3W5UA 4PMHA 1BR2A 2EZLA 3MKLA 5L3GA 1ZM3A 2FU4A 2GJRA 1TWFJ 4WCGA 1EP3B 4OJPA 1R5BA 4M2LA 5HDNA 4UZEA 2Y30A 3T1BA 3G3ZA 1KK3A 5GV7A 2JRMA 5A2QK 1QFYA 3GVKA 1AA7A 1WJCA 2PIAA 4DW6A 3BTJA 1I6HJ 4S04A 4L5JA 1UJ8A 4M9ZA 2MG4A 2DOAA 3FZVA 4C2LA 3HKZN 2HXIA 4B3GA 2O61A 3H0GJ 1UHWA 4HBLA 4UUVA 1VQKB 3CMAB 2KFDA 5EEAA 4MR0A 2M5WA 1H9TA 3HC7A 4K1XA 2WZPP 2W4SA 2BN4A 1O3SA 3FM5A 1VQPB 4FN5A 2Z16A 3K2ZA 2L02A 1W36C 4LITA 2MSYA 4RB3C 4HZFA 3PQJA 2VJ5A 5E79C 1OFDA 2LY2A 4GXOA 4YZXA 2QQBA 4XIDA 1E3PA 2CW7A 4EMSA 2D9RA 2ZZFA 3K4BA 4BEHB 2XRLA 3BROA 2JTVA 3R0JA 2MC3A 5J3OA 1V54H 1XGMA 2FF4A 3S3NA 3HOUJ 4CUGA 4X6AJ 3NAUA 3GLLA 2EINH 2FMLA 5EF6A 5KHDA 1EH6A 1ZM2A 1HDPA 1VNDA 4MNUA 3GW2A 3HTUA 2P6TA 4LBYA 2EJRA 2DFIA 4G12A 4G6DA 2JUGA 4QSHA 1TLLA 4A3JJ 3ISXA 5A88A 2IQ7A 1R49A 2R93J 1BLIA 2VC1A 2K86A 2RGVA 4AIHA 2L4AA 1D1BA 1Y8RB 4P9FA 2ZFWA 3E6MA 3FWEA 1WP6A 4X7EA 2JWTA 1QRCA 4HPQA 4YFNF 2XAGA 1QUEA 3ZBUA 3VYSB 2DPUA 3CB4A 2NTQA 3ZQCA 2KHMA 5JLWA 2HPMA 4V2GA 4FTHA 5FRMA 3LSRA 4CCLA 1NG6A 4FE7A 3HDDA 5L46A 2PFBA 2HDWA 1XMKA 2V7VA 1WQ2A 2MLGA 1LVAA 2XNCA 4YIRX 1ETVA 3CDLA 1HG8A 4MFDA 3B90A 1HSTA 3J80Z 3GFIA 2FX3A 3OL4A 1WSRA 4N0BA 4Z05A 4Z06A 1JKOC 2F2EA 2XPWA 3B82A 3H5RA 1QVGB 4XRFA 3ASTA 5BPIA 1FSHA 1R36A 4BJ5C 3VEPA 2O8KA 2LG4A 1EH8A 1VJSA 3G05A 4R71A 2VBTA 4I76A 2VQHA 2W24A 3N6ZA 3DFGA 3F8NA 1B72B 1YS6A 1WI3A 1ZELA 4MHGA 1D5YA 4ESJA 4WQMA 4ZDLA 3FHZA 2LC2A 3ONQA 1GJRA 1FOWA 1I3AA 4UVAA 3RYPA 2BVNA 4I98B 1H89C 1S7OA 1FT9A 1B72A 4P1VA 1LNWA 4ESFA 1JT6A 4C3IJ 3ASRA 2W6JA 3JQPA 1GQ8A 1Y1WJ 1IN5A 2PMZN 4RM3A 2M1BA 4B8XA 4ASNA 2K3PA 5DD4A 2B7EA 3FXOA 2MA3A 2QZ8A 4A5MA 4RPBA 3L7WA 1PUFB 2OZ6A 2ADUA 2AS5F 1FRNA 4IL6C 3GSIA 1MBFA 3QYBA 4L9TA 3CC2B 3CMYA 2BZTA 2M7BA 3F8BA 2QBYB 3OEHA 4Q5SF 1YIOA 3OR2C 2M8EA 2IS2A 1PUFA 1X19A 1E1QA 1MMGA 4RD2A 5E1ZB 2H27A 2A5WA 5HODA 2OAZA 4KKUA 3CCYA 3FXJA 2HDDA 2LTPA 4RB2C 1O3TA 5TR9A 3TW6A 4OAYA 4X0CA 1LDKB 4ZDPA 1TYWA 1ZK8A 2DIEA 3LFKA 3KFWX 2WV1A 2YWGA 2QXZA 2CWEA 4KDPA 1LJ9A 3S14J 2ZZQA 4B3XA 3IKTA 3ASSA 3LSGA 1OCCH 4JP0A 2RN7A 4HDUA 1DBOA 2FX0A 4DQ2A 1GV5A 1V5EA 5E1XA 4UUSB 1O3RA 4IRGA 2A07F 4O3MA 1FDRA 2V4DA 3PETA 1OYYA 3T0YA 4ENNA 3SHFA 1EA3A 4TMXA 2Q8KA 3KZYA 1ONVA 3SZEA 1ETQA 2P7VB 3WWGA 4UUSA 4KN7X 1SFUA 4D1QA 3K9TA 1R5GA 5D5XB 3PVDA 2QTLA 2ICWG 1X2MA 2VXDA 1BR1A 3HSFA 1YJWI 1V5FA 4MYTA 4RDUA 1WJAA 1O57A 2XASA 4B44A 4HW0A 2QA4I 3I54A 1SD6A 3T5XA 4C3JJ 1Y39A 5AIPA 4RD1A 5KW9A 5CVVA 2NTBA 3N90A 4C3HJ 3FKIJ 4RAFA 2X6XA 1ACIA 3W2IA 5D4RA 5D5VB 3DF8A 3NWTA 2OPTA 1FIAA 5TJJA 1P92A 3Q3SA 3NARA 4ITVA 4IJAA 1EXMA 1KQ5A 2CMPA 5GV8A 3QWLA 3UR3C 2VQLA 3W2HA 2OC6A 2HZDA 4ZZLA 2BXZA 3WBJA 1T56A 1MSFC 1GAWA 2LLKA 4DQLA 3MWMA 1EWYA 2VL8A 3RCOA 3BTLA 2F1LA 2R6HA 2OTLB 1O8KA 1U9OA 1FP1D 3LSJA 5JBQA 4XR6A 2GXGA 3I9V2 2IVMA 4B1RA 3VSUA 1SD7A 5LBQA 2STWA 1TW2A 4LBVA 2CSOA 5KAFC 2EK5A 1TTYA 2R3SA 3ZMTA 1SMYF 1T95A 4LMYA 2V1UA 4BH9A 1OYWA 5LGTA 3S93A 3CCUB 5FNZA 2HVQA 1R7JA 3VMVA 1Y56A 2LK2A 3KP5A 4XLPF 2F1MA 3TP0A 1IJEA 4XN0A 4RD4A 1S72B 1FP2A 1J2XA 4EJOA 1VQKI 2BGCA 3VMFA 2QTZA 1PLUA 2KT0A 4M1KA 1OHHA 2VFOA 1TZLA 4MTDA 2XVCA 4MLOA 1J75A 5IYWA 2LKPA 3ZMVA 5J8FA 3A35A 3FM3A 3QYEA 3GQ8A 1N8RD 3SEZA 4E7IA 4XLAA 5J47A 3KEWA 4XRMA 1H88C 1FSEA 1IN7A 4U9UA 2RKHA 5E3MA 1OFEA 3WE2A 3E5UA 1EA0A 2L9SA 1T0FA 1P4MA 3WGIA 4XBFA 2K02A 4RBOA 3E5QA 1RNLA 5LRSA 1TL8A 1KZLA 4A6DA 2M34A 2RAEA 4OINF 4EVIA 1W5SA 1WKMA 2ELKA 2NS8A 3SJMA 1ZARA 4HAMA 3BR5A 1OR7C 2DA3A 3Q0VA 2DI3A 4PFOA 2WYRA 1AIRA 2FOKA 3IHUA 1XGSA 2J7KA 3VODA 1BQEA 2Y69H 4NC7A 1AKHA 4WZTA 4MXNA 1O8LA 4M6XA 4FHTA 4Y13A 1MJAA 3D0SA 3CO7C 4Y52J 3U1KA 3WGHA 1VQ8I 5E20A 4CCKA 5H6QA 4D7NA 2KKOA 2OTJI 1REPC 2CNDA 2JA5J 1VLYA 1YW9A 3OYNA 3S1NJ 4EGZA 3CUOA 2QVOA 3MN2A 4PGHA 1W5CC 2L7MP 3V7CA 2NSTA 4F93B 4IQJA 4Z1MA 1FTZA 1H85A 2LNBA 1NJID 1U5TC 1O4XA 3BY2A 2INUA 4PJLA 5ICCA 3DDYA 1B9MA 2UXNA 5CQEA 1R1UA 4YEIA 3OYLA 4UAJA 3AVTA 4CH7A 1RC9A 2HQ5A 1UMKA 2BX6A 2P3MA 1SD5A 3GTJJ 2BY0A 3VYUB 2F5CA 2K4JA 2W25A 2FE3A 2VBWA 2C4UA 3WTWC 1XN7A 1MABA 4O5VA 1RU4A 3CCQB 1QRYA 4DBQA 2ZJRF 2D1VA 2VODA 2KJCA 3H3VK 3BLYA 4X07A 1IN4A 2KIMA 3A2KA 3OJXA 3P5JA 3F22A 1J59A 2LKXA 1DDNA 1NK2P 3SUCA 4ON0A 1HOMA 1JA1A 2Y0MA 5LLQA 4PSWA 3OYIA 1BN5A 3OZWA 1IXCA 5HLIA 1ULYA 3GTMJ 3W2FA 1ZR2A 5DDGA 1ZAOA 1WJDA 4I0BA 4UVCA 4OJ6A 3KYLA 1QZYA 2YPRA 4ENMA 5CVUA 5J1UA 2DFEA 2KVOA 5DD8A 2ELJA 2LR8A 3ZPLA 4GQNA 1B6AA 3ZQQA 2JPCA 2IW5A 3ZZTA 4UV9A 2JVGA 3GBGA 1MBEA 4XLFA 1K8AD 4ZV4A 1IAWA 3LQRA 3G71B 3JQRA 1SVOA 2BY2A 3D5RC 1I27A 1RQRA 2HGCA 4Q7JB 2XGJA 1Q82D 2RNJA 1D0XA 1ETXA 1K61A 1HBXG 2LOOA 5E18F 1LEBA 4LLGF 5BPDA 1AIPA 5FKNA 1RMGA 3AVYA 2XPUA 4D5CA 4WXCA 3RQIA 2PEXA 2XEXA 5FLMJ 3Q39A 4B3FX 2PX9A 1LKXA 2YSRA 3LSIA 1UHMA 3RZDJ 3HTSB 5HVQC 4QPOA 3I56I 2R7VA 1EE6A 5F64A 2XTXA 3GTKJ 1QA3A 1XMXA 4RDJA 2J8KA 2K4BA 1XG2A 1ZM9A 5CPRB 3CP2A 4WF2A 1O8IA 2J5PA 2W6IA 1R58A 3Q5FA 4YDTA 1L0OC 1B1BA 1MMNA 4XSZF 2R7XA 2KZGA 2COMA 4XD7A 1W4MA 1MJBA 1E3OC 2O0WA 3PSFA 5FKLA 2CQ7A 2H6BA 5BQTA 5TISC 3LA3A 1FBSA 4BY7J 2WZNA 3K0LA 1X3ZB 1D1NA 3DPUA 3JX8A 2H8RA 2CJJA 3EQLF 3PENA 1OISA 2V9KA 1XFOA 4N9HA 1EFRA 1NB0A 1USSA 1LDJA 4HOBA 4KJZA 3AAFA 3GZ6A 4YIFA 1XDSA 1YE9A 5IYNA 3A8JA 2GZWA 4F7ZA 2COBA 3CXCB 2BM6A 4KKTA 2A61A 5F6FA 3ZOBA 4ESBA 1JTYA 1PJRA 1TNSA 2EIJH 4LG0A 4LB5A 1UG2A 3REOA 4W8SA 1DP3A 3OW2B 5FB2A 4RGXA 2AQEA 1PDNC 2HOEA 1NH3A 3CJQB 4B3AA 2P5KA 3IAS2 2A6HF 3K4MA 3N97A 1V0FA 1XE1A 5JI6A 4ZGQB 3PUBA 3G2BA 2OBSA 4P9UA 4BS9A 5F4JA 1DGWY 2JN9A 4UHTA 3D1NI 2GQQA 2QKMB 2M2EA 2IS1A 1F60A 3B78A 1U6GA 3LJYA 1SVLA 3DBRB 4HNTA 1G7RA 4AD9A 3PA1A 2FNAA 1FYMA 3HRUA 1QRBA 3R0AA 4M6YA 1MBKA 1RR7A 1EZGA 1S7AA 3E6BA 5FGMA 5EZGA 4CCOA 3WU0A 4CO8A 3GFLA 3CCLB 2X51A 2YWFA 2ZTGA 4QWQA 3L2QA 3TEDA 2VONA 3O6BB 4Z4TA 4CZZA 2OCCH 3IC7A 1EJ9A 4YRVA 5FRNA 5F1JA 2R7FA 4Z2YA 3RI4A 1W7PA 4UZUA 1KCDA 1UD2A 1IDYA 1T6YA 1S9HA 1DU0A 2O04A 4QV2A 2ZJ2A 2NSPA 1MD0A 1WRJA 2LH9A 3JTHA 5FLXZ 3SDGA 3PSIA 1O8DA 4BHCA 1JUMA 5JLXA 3HOYJ 3AGPA 5E1WA 2VJIA 3QP6A 3H9NA 2PLFA 3A3BA 3ABMH 4XICA 4QUZA 4IHYA 1OCRH 1S72I 1AU7A 1BX0A 1QUFA 3RKWA 4OPVA 1V55H 4UVBA 3TO7A 4RAZA 4IOCF 1JKRC 4GFBA 3WNCA 3DXJF 3JW4A 3EDPA 4IO9F 2VE8A 3BZCA 1G6NA 1VQMB 2DY1A 2ZFUA 3CTAA 1G7SA 2DA2A 4A3CJ 5K5RA 4X1EA 3I71A 3NQOA 5J40A 2L9RA 2QWWA 4IHVA 1O8FA 2OF7A 3IP4B 2LREA 4XKVA 3GTQJ 2XC1A 2NOJB 4E7SA 2OBTA 2XZPA 3QOPA 4OOVA 3CMMA 1D1CA 2CUZA 1R22A 3M1EA 4OWRB 2OV7A 4OIPF 3HRTA 1VI0A 4LIUA 2GBYA 3ABTA 2VJ4A 4GDFA 1DG1G 1SFXA 5E3NA 4EJTA 3WQZA 1W36D 1IC8A 2JJ2A 3BY1A 3VB2A 3I5UA 3ERED 1Z0XA 2G7HA 3OOPA 3WGGA 1A31A 1I6XA 2HOTA 4PDKA 5J1YA 1K6YA 3R6JA 1XQBA 1EF4A 4EGYA 3RKQA 3AL0C 2YWHA 4XONA 1BR4A 2JRTA 4XRSA 2LZJA 1XSXA 1MMSA 4EQQA 4XLNF 3ROUA 5DUKA 2MYSA 2VPLA 1OGOX 3M7GA 3GCMA 5JMCB 2DT6A 3ZXSA 1QGAA 3T9GA 5F0HA 2IA1A 1BHEA 3QPSA 3ULQB 3V7RA 5GAEJ 4M3GA 1MZBA 3AL0B 1W1WE 2XF7A 3LFUA 1YIJI 2ZL6A 4RCYA 1AMOA 4LK0F 4OM9A 3LQ6A 4E7LA 2IGMA 4XSXF 1T2KA 2E2JJ 3W3CA 2ELHA 5J3LA 4K2EA 5LMZA 1FOYA 3J81k 2DQRA 3GX4X 2LP0A 1SKQA 3MAJA 2VZLA 4BQQA 3ZMZA 3W5HA 4RB1A 1Z6TA 3MQ0A 1TW3A 3GTGJ 1IDKA 1G59A 5IK2A 1TLHB 1EP1B 1N07A 3A3GA 4L5IA 4KKSA 1GV2A 3F8FA 1ZLJA 1ORKA 4U7BA 4U0WA 3HOZJ 1TP4A 3G1OA 4YEJA 2P81A 4KA4A 1RUOA 4ASUA 3FMSA 1T6SA 3OKXA 1YYVA 2V1DA 4XK4A 2XGDA 3F8CA 5LD2C 3SJZA 4W8QA 2F4NA 4AF6A 2OK8A 3H9JA 1K73D 2WC2A 4G8XA 4ZTJA 2VKEA 2VPRA 3VOEA 1JA0A 2VBKA 1G7TA 4HNVA 3HYIA 3RIQA 2E1OA 3L2WA 2X85A 2CUEA 3A1PA 1T33A 2JZYA 3MCAA 3I53A 2EA4A 4A0XA 1HZEA 3ZBTA 4E0FA 4LK1F 5DV5A 3VSTA 1UZCA 2G0EA 3I55I 3NEUA 3L2UA 4FISA 2UZKA 3ASNH 3GTPJ 2DCUA 2YU9J 1OGMX 2VQCA 4U0YA 1PJ7A 4AYBA 3SZPA 3WU2C 4IEJA 1LUJB 2ACJA 4W97A 4CHUA 4P26A 1S0UA 2VKDA 2O5RA 4UUTA 4XMYA 1YRNB 2QSGX 3K7AJ 2VYQA 2IGKA 2ZSIB 1JT0A 1YJWB 1GLNA 3WHBA 3EPZA 5EEHA 3KP6A 4Z4UA 1LLZA 4BNCA 4G5GA 1KK1A 2QA4B 4U0VA 2BPOA 4IRHA 4BQNA 1YRNA 4D9JA 1KTWA 4YFXF 1BM9A 1UD8A 1HW2A 1WOSA 1F1ZA 3BR1A 2VJJA 3C3WA 1JXSA 2OYNA 4M4SA 3WNDA 1DDGA 1LDDA 4U88A 1SM4A 2P5LC 4JX6A 3HBLA 2EIXA 2V7QA 1S3JA 1FNBA 2CQXA 5HXBA 3PSZA 3PM1A 5BS6A 3OP1A 2K9QA 1Q1VA 1X1CA 3FXRA 3HPHA 1PP8F 5LHIA 2BE5F 2ETHA 1FBUA 3HOXJ 5FJ8J 3ZCOA 4M72A 1IRGA 1QGPA 4A0ZA 4PC3A 2ZITA 3DCFA 1KQ0A 1ZGJA 3GYHX 4CCJA 5E8IA 4ZTFA 3PFYA 1T5EA 2XUBA 3OW7A 2E1MC 4IKFA 4KYWA 2XT2A 2DJIA 4HX4A 4EJUA 1FOXA 1ZN2A 3ECHA 3IRQA 1WU8A 2J5OA 1PKVA 5LEKA 4PC1A 2HQAA 1UG0A 5BNGA 2UVFA 5H20A 2MD5A 1QPIA 3BC8A 2EV5A 4BPRA 4OZZA 1C0WA 3K4JA 1TYVA 3MCZA 3LWFA 2E1MB 2ME0A 4G7XA 4Y3OA 3BOQA 1J9IA 1T8IA 1KJZA 3K10A 1SVMA 1X58A 4G94A 2X8KA 4YFOA 3SKBA 5ILUA 3BG7A 3U1DA 1TVCA 4Y4RA 1Y6IA 1IF1A 2FUG2 3RZOJ 3F72A 2AXTC 2O9LA 2F5VA 5E17F 4Y33A 4RM2A 1AHDP 3CO6C 5FLXK 2Q6OA 2AHQA 3BNWA 4YXWA 3JURA 4A3KJ 4YC5A 2A6EF 2EFPA 3AG3H 1YJ9I 3OYDA 1KK2A 1QJVA 2VKHA 1TYUA 1OLTA 3CCRB 2R7QA 1ETKA 1OFCX 1RPWA 3JAMZ 3E1YE 4KISA 2DK8A 4TMTA 1V5GA 2NTPA 3PSSA 1YX3A 4J00A 4XM3A 3JR9A 3HRMA 1TC3C 2GOXB 3PUNA 4D5FA 2I10A 4UV8A 2HOAA 4HRIA 3IUOA 4OU0A 4UY8I 1R5NA 2BF4A 3FPKA 1BJKA 2KRFA 3WTUC 4RMNA 1H9GA 4CCNA 4BQOA 3CCLI 4BEHA 5JVGF 1T6XA 3WBKA 2QGUA 4RLZA 3KEYA 5J1RA 2Z2SB 1HCRA 1JTAA 3RY8A 4KIBA 1WOOA 3CC7I 1GVJA 2QKLB 2QQ8A 3BTCA 2O03A 3A0BC 1A5JA 5DS0A 1YQAA 4F3QA 3QODA 3T51B 2E71A 2F6CA 1KU7A 5J35A 5IYCJ 3BCAA 2NPFA 1VQ8B 3H09A 3RIRA 2OTJB 1XMAA 2LD5A 3P27A 3LNNA 5IYQA 2JMWA 3D26A 2IT0A 3M8EA 3JQQA 2ZO4A 4MFEA 1IRFA 1Y0RA 3K70C 1WORA 3G73A 3IH3A 3W2GA 2E7XA 1FMWA 1MIJA 1VQMI 4UZFA 2DMTA 1H8HA 3TDUC 3OOUA 3DTEA 2K9LA 1JJ8C 1MNMC 4FASD 1G3SA 2ID6A 3Q6QA 4HE6A 5CVJA 3TDZC 3CD6I 4AVPA 2Z5UA 4PK4A 1P7JA 2FA5A 1FYKA 4I84A 3ZZ0A 1F36A 3EUHC 4M6VA 3OS0A 4AU7A 4PGOA 1KZHA 5D4SA 1HA8A 2C5HA 4FXUA 1CF7B 4OZYA 1JI8A 1MBJA 1YI2B 4V2FA 3ZR8X 2BM1A 3ZGKA 3PA2A 4YZQA 1KU2A 1FRQA 4MO7A 2O7OA 3BCBA 2R7TA 1GXQA 1HSJA 3OYGA 2JQ7A 3CJNA 4HLYA 3OY9A 3LQEA 1EV7A 1CF7A 3DKYA 4CCMA 3J7AO 2QZAA 5IOYA 3CCSI 1DPRA 4G7OF 2PYGA 3HGYA 3ML6A 4LG3A 1A8PA 1E2XA 1BW6A 4Y7NJ 3AGQA 2A6TA 1U3EM 1X1DA 1JKPC 4ZYGA 4ZYAA 4W1UA 5K7HA 5EJCA 4ACBA 1XSVA 2RC4A 1T39A 3EQOA 4OPSA 4AC0A 1GT0C 2QN6A 5F4MA 4AC9A 5K5QA 1JGGA 5JLVC 1E3HA 3R6SA 4RGSA 1XC5A 3OYAA 1NDHA 1V3FA 4WK8F 3SEJA 1CLWA 2XF5A 2WAQA 2ZJPF 2VKVA 5F4OA 2ZCWA 1G7CA 3QPHA 1QHHD 4KIFA 3F6VA 1MDMB 3ZPNA 5FD5A 4ZJZA 2VFPA 1O8GA 2V1XA 2M4KA 3AKZA 1OKRA 2EZIA 3WE3A 5J6XA 3I56B 3M07A 1ZGWA 3H9QA 3DU6A 1H8AC 3OYKA 3FX3A 1VQ7I 1MDMA 4NBQA 2VLAA 3J81Z 2CGPA 3BG6A 2HMAA 1TWCJ 2DMNA 3FK6A 1WOPA 1PUEE 3QFRA 4CSWA 2NT6A 5FO5A 4YZ0A 1YX5A 3EUKL 4LLLA 2QBYA 3BY6A 5IYDJ 3P9IA 2L9NA 2OD5A 5EZHA 1Z1DA 5DYMA 1UD5A 3BPVA 2TDXA 2E35A 2RREA 1MSEC 1MNEA 4M3BA 3OYHA 2V79A 1VFCA 2QY1A 3VSVA 4QHYA 4AYBN 3A1YA 4ZCIA 4JQFA 3HOVJ 2ECCA 2P6SA 3VPRA 3OYBA 1S5LC 3H5AA 2DN0A 1YHQI 3V42A 4BJ6C 4A2UA 4E7HA 3WTTC 4EM2A 4RCZA 4Z4YA 3H9GA 1Y1VJ 4ACAA 1YW7A 1DP7P 1D5VA 4TKOB 2Z1DA 3K4NA 1WVRA 5HLTA 3S2DJ 1EFTA 3PQKA 2FBIA 4LJZF 5KNLA 1OGIA 5H59A 2P4WA 2X4HA 4R8HA 2QDXA 2YWEA 2E1NA 3VO1A 2ZZGA 1X0CA 3VSLA 2HVRA 3ZQGA 3LVBA 3WNBA 3PIOF 1BIBA 1EKEA 3CPXA 1VQ6I 4C2UA 3BG3A 3JSPA 2ZXJA 2V9PA 4UNOA 1UD3A 2OK7A 4G1VA 1E64A 2W82A 4H4KC 1K78B 1CNEA 2VOOA 3GQBA 1D8TA 5IYPA 3CUQC 3DLLF 1LVKA 3HAGA 2L3DA 2VI6A 5EG0B 2QMUA 2C6YA 4DGWB 2XAHA 5FFXA 1FPQA 4B4CA 3N4MA 2JJ1A 5HZBA 1LFUP 3C18A 1RETA 1KTVA 4PCQA 5JHFA 3M4OJ 1FTTA 4LFUA 4DQKA 2Z33A 4YAFA 2IA0A 3JAMK 2OA4A 2CUJA 2ZBKA 2H1LA 2HS5A 2P7CB 1DU6A 1WMRA 2IBDA 1H8EA 4BXFA 1JKQC 1B8IB 4DNTB 2VE9A 1ELOA 4G7WA 4GRIA 2R7RA 3SQNA 4OIQF 1I3QJ 2BVMA 1DUXC 1QFJA 2QSHX 2F5FA 1N06A 5FKOA 3LAJA 2BVLA 3ZIAA 4RJLA 1B8IA 1RR8C 2BGIA 2BV3A 3U9GA 1OMIA 2E5NA 3OR1C 3GVAA 4U87A 3E5XA 3HL2A 4YCQA 4XORA 3ASOH 3QFTA 3ONYA 1MBGA 4QVJA 4BU2A 3DWLE 1IUFA 3H36A 2VUMJ 1KA8A 3K1NA 3ABKH 2YX4A 2E1RA 1X4PA 4P55A 4XNFA 1G2HA 2LYCA 1HQCA 1RIOH 2V5IA 3CCRI 5HDKA 1ZYRF 1V0EA 2JSCA 1G3YA 3I59B 3LSHA 4PJJA 3QP5A 1ETYA 4II2A 4G6IA 3IRRA 1P7IA 1NBMA 3ZZUA 4HEA2 2B9SA 3VFZA 2VNIA 1WWXA 2EILH 2X9DA 3TH0A 1BW5A 1SAXA 1FBQA 1QNTA 1QZEA 2BYVE 4I7HA 2OCEA 4AWXB 3JRCA 5EEGA 3QPTA 3I59A 4IVNA 1SANA 2DA6A 2WB1A 4FX0A 5F04A 2DPDA 1MMAA 3PNYA 3S2WA 3VWBA 4A3LJ 4PGGA 4NDLA 4LBWA 1VQ9B 3T53B 5HNFA 2DXIA 3AG2H 4DIQA 4GYIA 5DEQA 2BSPA 2AO9A 3CP8A 1DPUA 1Q81D 2IP2A 2M3AA 4D0PA 2NVYJ 1J5YA 4KT6A 1SD4A 5DCMB 1JTXA 1E79A 1UD6A 2YX7A 5IP6A 2E2HJ 1UHSA 4RGRA 1FZPB 1VLOA 3L2RA 1TNTA 1VZ0A 4QIWN 3SLDA 2TRTA 4C2MJ 3R6KA 3E7LA 1S29A 5CLSA 3SZTA 5IT3A 5D5WB 1R23A 3OYCA 5K7ZA 1XX5A 3ML3A 4WZEA 1FJLA 4XKWA 1HKSA 2HQNA 2Z99A 4NC8A 1YIJB 1LEAA 3IH4A 2ZNZA 2WJYA 2E5ZA 4NNJA 2XB5A 4M3EA 3V8LA 1FX0A 1H80A 3KLOA 4YALA 5K7FA 1NHAA 3NWSA 4B48A 3EUAA 3LOCA 1FNDA 1R4NB 2QUFA 4BHBA 4BL0B 4YAUA 2O3FA 3JRHA 4J01A 1Z7LA 3CLQA 2JA8J 1U5TB 2BW3B 2F4IA 4YHBA 4Y17A 4BE1A 2Q6LA 2FMYA 4RLFA 2ZMEC 1HLVA 1K6OA 1P2FA 1QA1A 2LFBA 4DZJA 5J4VA 3SYJA 4BY1J 1U5TA 1YI2I 1YITB 2KIUA 1GXPA 2L5QA 1D2EA 1W87A 3AVWA 3CF2A 4KIGA 4QPQA 1TTTA 1ZG3A 1QH0A 5ILVA 1FIPA 1X2NA 2VOPA 5D5UB 3WODF 2Y0SA 3GFMA 2ZMEB 4DOZA 3J81K 3MZYA
chains in the Genus database with same CATH topology
2NOJB 1D1AA 4C2LA 4E7SA 1BN8A 2XZPA 4BDZA 4B3GA 5CKTA 3CMMA 1D1CA 2CUZA 4OWRB 2OV7A 2XDVA 4LIUA 4P22A 2VJ4A 3PNTA 3S32A 4MR0A 3FPPA 3WQZA 1NG7A 3HC7A 4DJAA 2WZPP 2W4SA 1W36D 2JJ2A 2CFOA 2UUZA 3VYTB 2CV1A 2Z16A 4U49A 4BGDA 1W36C 4LITA 3FHNA 3H0DA 2VJ5A 1DQUA 2LY2A 4YZXA 1K6YA 1OFMA 3LSMA 3AL0C 2CW7A 3OYEA 2ZZFA 1I8DA 4XONA 3K4BA 4BEHB 2PJRB 3TBIA 1BR4A 3H5NA 2GK7A 2KZVA 2LZJA 2NT9A 5HOOA 1N75A 2MYSA 4HSRA 4NK6A 3S3NA 1G8XA 2E60A 2VPLA 1OGOX 4CUGA 1WTHD 2K5CA 2DT6A 5KHDA 3ZXSA 2LY1A 3T9GA 1BHEA 1VF7A 2HLDA 5HNHA 3AL0B 4E7JA 4XKVA 4C9YA 2XF7A 4HIZA 3LFUA 3K4LA 1RWRA 1JRGA 4E7LA 2IGMA 2KL4A 3H35A 2JUGA 2WY7Q 1WJFA 3W3CA 4ANJA 2IQ7A 1BLIA 3K6GA 2WAEA 4BQQA 1D1BA 2ZXIA 2HVSA 2D3LA 2X1EA 1WP6A 1IDKA 3VDXA 1G59A 5IK2A 2IXSA 4HPQA 3A3GA 3VYSB 4KKSA 2NTQA 2KHMA 2WAFA 4F92B 4U7BA 2HPMA 4YEJA 5FRMA 4HG2A 4ASUA 4CCLA 1NG6A 5LFAA 1D0YA 2EWEA 2HDWA 1T0FC 1OB0A 3GQ7A 4XKCA 5LD2C 3VSKA 4W8QA 1XG2A 4P1WA 3CJRB 3H9JA 3OYFA 2W1OA 3S3OA 1HG8A 3B90A 4ZTJA 2VBKA 3KX2A 2JSPA 3L2WA 1E43A 2X85A 3OL4A 4TSFA 2R7OA 4Z05A 4YELA 4Z06A 4E0FA 1HZEA 3FBIB 3H5RA 3CZ6A 3HUGB 2M5SA 3LMWA 3VSTA 3OYJA 3L2UA 1K28D 4BJ5C 1OGMX 2LBFB 2VQCA 1IRXA 2Z6BD 2LG4A 4AYBA 3C2HA 2CS3A 1VJSA 3G05A 2VQHA 4TT3A 2VKDA 2O5RA 4XMYA 2RNGA 2XNDA 2R4GA 3GRHA 1ZELA 2D3NA 2IGKA 2ZSIB 1HVXA 4C30A 4ZDLA 1GLNA 2LC2A 3ONQA 3EPZA 4DK0A 2KLOA 1PE9A 3LSKA 2M0MA 4BQNA 1KTWA 4D9JA 4PSXA 1UD8A 3DEEA 1X4OA 1UAAA 2VJJA 1O8EA 5C1EA 2W6JA 2V7QA 1GQ8A 2KRCA 4RM3A 1X1CA 2K3PA 2X1CA 3HPHA 1TT0A 2R7WA 4E6KG 3ZCOA 4XQFA 3OS1A 4F91B 4BUPA 4CCJA 4ZTFA 1T5EA 3PFYA 5FL7A 3BCFA 1Z21A 2GK6A 3B4NA 3QYBA 3OW7A 2E1MC 4IKFA 1DGRM 2DJIA 2M7BA 3OEHA 4KITB 2R7UA 3OR2C 2IS2A 1PKVA 3DQVC 1X19A 1E1QA 1MMGA 2BW3A 3TL4X 2HQAA 2A5WA 4KKUA 1UG0A 3QOEA 2UVFA 4B47A 3BC8A 4OZZA 3W2AA 4IZZA 3K4JA 3MMYB 4OAYA 1N78A 1LDKB 4ZDPA 3L2VA 2E1MB 2KDOA 2CV0A 1SFKA 4G7XA 4Y3OA 4JMQA 4OAZA 4R79A 2X1DA 3K10A 2DIEA 2QXZA 1KONA 2X8KA 4NK8A 4XLEA 2ZZQA 4B3XA 3BG7A 4N4OB 4PUSA 2OUMA 4Y4RA 1Y6IA 3LSGA 3LMMA 4BE2A 2FUG2 1SAUA 2BOLA 2Q2EB 1DBOA 2F5VA 4Y33A 4RM2A 4YXWA 1V5EA 3HPGA 3JURA 5TGTA 2V4DA 3HXLA 2CV2A 1BOBA 3OYDA 3LL7A 1EA3A 2VKHA 4FETA 1QJVA 1OLTA 2Z8GA 2R7QA 4E7ZA 4KISA 2NTPA 2L7KA 1V5GA 3J7AY 1R6RA 3B8YA 1YX3A 3DLAA 4J00A 3WWGA 3RQ4A 2WSSA 4XM3A 4D1QA 2GOXB 4B43A 2IGOA 3FDYA 3U21A 4L8JA 2VXDA 4HRIA 1BR1A 1MMDA 3IUOA 1V5FA 1WJAA 4B44A 4RMNA 4CCNA 1N77A 3QYFA 4BQOA 4BEHA 3FKJA 2PJRA 4NUBA 3KEYA 2JIZA 2Z2SB 1JTAA 2NTBA 5FROA 2MD0A 2X6XA 5KCMA 2ZXHA 2QKLB 4P5OA 3NWTA 3DU5A 2ZZEA 2L2OA 4F3QA 3T51B 3QODA 4ITVA 1O8HA 1Z3XA 2CMPA 2F6CA 2UWMA 3BCAA 3UR3C 2VQLA 1Z3YA 2OC6A 1KCCA 2HZDA 2Q1ZB 4IQ4A 2X6YA 3LNNA 4OJOA 2INVA 2VL8A 3RCOA 1O8KA 4XOPA 4OJLA 1E3ZA 4OJ5A 4XR6A 3I9V2 4X0GA 3VSUA 2NZMA 2LRDA 3K70D 3SEQA 4E4HA 4BACA 3RSNA 3K70C 2PECA 2KPMA 4PFPA 3H94A 3EQNA 3JU4A 5AMVA 2UV1A 1FMWA 1T95A 2AQFA 3D5LA 1H8HA 3OOUA 3S93A 3DTEA 2K9LA 2V7FA 4FASD 3OEEA 2HVQA 4CZCA 3VMVA 1Y56A 2PMZA 4PK4A 2F1MA 1WFXA 4I84A 4XN0A 3EUHC 1E1RA 3OS0A 2XF6A 4AU7A 1HA8A 2E1BA 4FXUA 2V4JC 1PLUA 4OZYA 1JI8A 3ZR8X 1OHHA 2KRHA 1TZLA 3ZGKA 3T56B 4YZQA 1ERDA 4MLOA 3BCBA 2R7TA 3A35A 3OYGA 3QYEA 3GQ8A 3OY9A 3SEZA 1P9QC 4XLAA 4E7IA 3DKYA 4CCMA 2QE7A 2CK3A 3KEWA 2XZOA 3ZRGA 2PYGA 3OYMA 2L9SA 3OS2A 2CW8A 4LG3A 1X1BA 3A4CA 2LBFA 2A6TA 3OIPA 2DT7B 1KZLA 1X1DA 3W2VA 4ZYAA 2R9VA 2O17A 3S3MA 3HKZA 3HG9A 4EW9A 4BJTA 1W9XA 3EQOA 2MFZA 1OR7C 4PFOA 3MKYB 1AIRA 2M4GA 4DNRB 4NC7A 3OYAA 3OFNA 4MXNA 1O8LA 2X6WA 2IS6A 2XF5A 1NHCA 2WAQA 1UELB 3ZPNA 3RTRA 1QHHD 2W00A 4G6TB 4XLCA 3S8PA 3OAAA 4URRA 4CCKA 4BE0A 4ZJZA 1O8GA 1VLYA 2M4KA 4AVZA 3AKZA 3OYNA 4PJMA 2XOKA 2NSTA 2HNHA 3H9QA 1BPLA 3DU6A 4F93B 4IQJA 4Z1MA 1OOCA 3OYKA 2VLAA 4DBRA 2INUA 2DCEA 3BG6A 4PJLA 2WY8Q 1QHGA 3DDYA 5CQEA 4CSWA 2NT6A 4YZ0A 1YX5A 4F55A 3EUKL 3OYLA 4CH7A 1FMVA 2L9NA 1COWA 1UD5A 4Z03A 1O88A 3VYUB 2GJPA 2RREA 2XSJC 2ZTNA 1MNEA 3OIQA 1MABA 3OYHA 2X53S 1RU4A 3DTKA 2QY1A 1D0ZA 3VSVA 1QCXA 2VBEA 3I3LA 2X3HA 4DBQA 3A1YA 4N4NB 4JQFA 3BLYA 3OYBA 3FY3A 2JA2A 3RPUD 3W2WA 3A2KA 4U4BA 3PL8A 2XC7A 1OFLA 3H5AA 3VR6A 2WA0A 2K9MA 4XKBA 4JOMA 3V42A 1WJEA 3DPTA 3SDBA 3TMOA 4BJ6C 4E7HA 2JVHA 4CA0A 1E3XA 3ZSCA 4PSWA 3H9GA 2RQQA 3OYIA 2V6EA 4TKOB 4LIVA 2Z1DA 3K4NA 1WJDA 3FBNB 2HU9A 5HLTA 4OJ6A 4F52A 3KYLA 2WPDA 5KNLA 1BMFA 3GVLA 2VQGA 1X0CA 2KVOA 2ZZGA 2ELJA 3VSLA 2HVRA 4GQNA 3ZQQA 1LFPA 1I18A 2JVGA 3GBGA 4XLFA 4XLHA 4C2UA 2WADA 1UD3A 1W0JA 3DPLC 1X1AA 2W82A 3D5RC 2CH0A 3PNVA 3DTIA 2XGJA 3K4KA 4H4KC 4C2TA 3GQAA 1D0XA 1WJ5A 2MC4A 3GQBA 2LOOA 1LVKA 1WJBA 3HAGA 3IAM2 2WJVA 3K4CA 4DGWB 5DN6A 2MABA 1NRKA 1RMGA 1J09A 2VASA 2JJ1A 4YZAA 4DOZA 2VXZA 2IGNA 4IX7A 4B3FX 1LKXA 3LSIA 1DBGA 5JHFA 2GJKA 2V31A 5HVQC 4QPOA 2R7VA 2I8DA 3D5SC 1VBLA 1EE6A 2CUJA 2KP6A 1WMRA 2W7NA 1H8EA 1PYVA 3SZGA 3C2GA 2XAUA 5CPRB 4BXFA 3CP2A 4DNTB 3CESA 4G7WA 1O8IA 4GRIA 2R7RA 2F43A 2W6IA 2BVMA 1MMNA 2GOMA 2QX3A 2R7XA 3M8JA 2V26A 1PXZA 2KQRA 4XD7A 2BVLA 5CQGA 3ZIAA 2VIXA 3GVJA 2O0WA 4ZDOA 3PSFA 2E5NA 1E0EA 5C1CA 3OR1C 2P0WA 2ZSHB 4U87A 3DPUA 3HL2A 4XORA 1KMHA 3E0JB 2WBMA 2V9KA 2UVEA 1MW7A 4II3A 4BU2A 3HOSA 1EFRA 3DWLE 3OOCA 1O8MA 4KJZA 1U0JA 1IDJA 1O8JA 1YE9A 1X4PA 4XNFA 3UNGC 2LYCA 3F9KA 4XOTA 2VBMA 4KKTA 2HPIA 4HNUA 1V0EA 1PJRA 3LSHA 4PJJA 4G6IA 4II2A 1NBMA 4HWVA 4HEA2 3MD2A 4W8SA 1UD4A 1DP3A 2VB6A 4XN3A 3N05A 2AQEA 3OPOA 2M7AA 4NQWB 4XL9A 3NE5B 3CJQB 3AFHA 3MKWB 4W8TA 4E7KA 2WB1A 4HSTA 3BCDA 3IAS2 1MMAA 3PNYA 3K4MA 3VWBA 1V0FA 3PUBA 3G2BA 4BS9A 2O1DA 1MNDA 3GQ9A 1DGWY 3T53B 2XZLA 2QKMB 5HNFA 2DXIA 2IS1A 1IA5A 4DIQA 3BC9A 4PJNA 2BSPA 3CP8A 4HNTA 3MKZA 2M3AA 4KT6A 1SKYB 1UD6A 1E79A 3VMWA 3ZPPA 1W0KA 3L2RA 3DKXA 1VZ0A 3OL3A 4CCOA 3HOTA 3OWTA 1QU3A 4W8RA 4DK1A 2X51A 2ZTGA 3OYCA 3L2QA 3SUCA 2ODLA 4XKWA 1IB4A 3FKSA 3OMYA 4YRVA 5FRNA 2IS4A 4NC8A 1CZFA 4EATA 4UZUA 2WJYA 3UW0A 2E5ZA 4NNJA 2R7SA 2O0VA 1KCDA 1UD2A 2KMUA 1FX0A 1H80A 1S9HA 4RLQA 3NWSA 4B48A 3EUAA 3PJRA 2O04A 2NSPA 2LH9A 4BL0B 3OE7A 4J01A 1Z7LA 3PSIA 2PYHA 1O8DA 2BW3B 3KRGA 2F4IA 1WPCA 5HKKA 2VJIA 3M1CA 3BH4A 3VYRB 3A3BA 5CDFA 4BE1A 4RLFA 4PMHA 1K5CA 1BR2A 3SYTA 2GJRA 4OJPA 2L5QA 2V1NA 3CF2A 4ZC3A 4QPQA 3GVKA 2ZFUA 4BDYA 1AA7A 1WJCA 3E1SA 2Y0SA 2JDIA 1O8FA 3IP4B 2LREA 2DOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZQ A;  4C2L A;  1VBL A;  1BN8 A;  1EE6 A;  3GQ8 A;  4XQF A;  1WMR A;  4XLA A;  1XG2 A;  4MR0 A;  1O8I A;  2PYG A;  3B4N A;  4U49 A;  2QX3 A;  1PXZ A;  2O17 A;  1OFM A;  2O0W A;  4YZX A;  2UVF A;  4EW9 A;  5C1C A;  3EQO A;  4OZZ A;  4XON A;  4XOR A;  1AIR A;  2NT9 A;  4NK6 A;  2UVE A;  4MXN A;  1O8L A;  1OGO X;  1O8M A;  2X6W A;  2QXZ A;  1IDJ A;  1O8J A;  1NHC A;  4XNF A;  4NK8 A;  3T9G A;  4XLE A;  4XLC A;  4XOT A;  1BHE A;  2VBM A;  4URR A;  1O8G A;  4AVZ A;  1RWR A;  1JRG A;  1DBO A;  4HWV A;  2NST A;  1OOC A;  4W8S A;  3JUR A;  2IQ7 A;  4XN3 A;  1QJV A;  2INU A;  2Z8G A;  4XL9 A;  3B8Y A;  2NTP A;  4W8T A;  2NT6 A;  4YZ0 A;  3WWG A;  4XM3 A;  2O1D A;  3GQ9 A;  1O88 A;  1IDK A;  4Z03 A;  1IA5 A;  2BSP A;  2NTQ A;  4YEJ A;  3VMW A;  1RU4 A;  2QY1 A;  1JTA A;  3VSV A;  2NTB A;  1QCX A;  2VBE A;  3ZPP A;  2EWE A;  2X6X A;  2X3H A;  3GQ7 A;  4W8Q A;  3FY3 A;  4W8R A;  4U4B A;  3B90 A;  1HG8 A;  1OFL A;  1O8H A;  2VBK A;  3SUC A;  1KCC A;  2ODL A;  4XKW A;  1IB4 A;  3ZSC A;  2X85 A;  2X6Y A;  4Z05 A;  4YEL A;  1CZF A;  4Z06 A;  3UW0 A;  1KCD A;  3LMW A;  2O0V A;  2INV A;  4OJO A;  3VST A;  1O8K A;  1H80 A;  4XOP A;  4OJL A;  4OJ6 A;  1OGM X;  4OJ5 A;  4XR6 A;  2O04 A;  2NSP A;  3VSU A;  1X0C A;  2NZM A;  3KRG A;  2PYH A;  1O8D A;  2PEC A;  4XLF A;  4XLH A;  2VJI A;  4XMY A;  3EQN A;  5AMV A;  3GRH A;  4PMH A;  1K5C A;  3GQA A;  4OJP A;  3VMV A;  1PE9 A;  1KTW A;  4I84 A;  4XN0 A;  1RMG A;  2VJJ A;  1O8E A;  5C1E A;  4YZA A;  1PLU A;  1GQ8 A;  4OZY A;  1DBG A;  1O8F A;  4XKV A; 
#chains in the Genus database with same CATH topology
 2AXL A;  1OPC A;  4AIJ A;  1W0U A;  4KMU X;  5CKT A;  4WX9 A;  4HF0 A;  3T8T A;  2XDV A;  2P5V A;  4P22 A;  3PNT A;  3IWZ A;  4DJA A;  3I55 B;  5CJ9 A;  3NRV A;  2XGX A;  3CRZ A;  1X3W B;  2BXY A;  2CFO A;  2UUZ A;  3VYT B;  2P8T A;  2I1L A;  4BGD A;  2WAQ N;  3FHN A;  3X2Q H;  4ETS A;  4PAA A;  1DQU A;  5TY0 A;  3HJE A;  4P96 A;  1WGX A;  3OYE A;  2PJR B;  3TBI A;  3KYC B;  3H5N A;  1U8R A;  2XNJ A;  3O2P E;  1SC7 A;  3HIF A;  2B0R A;  3FXL A;  3W6J B;  2WR8 A;  4ZCL A;  5HOO A;  2NT9 A;  4HF1 A;  4HSR A;  2VFQ A;  1RKW A;  5M5X J;  1G8X A;  2JUC A;  2FBH A;  2CW0 F;  1WTH D;  2K5C A;  4M74 A;  4FX4 A;  2LY1 A;  4G7H F;  1VF7 A;  2HLD A;  5HNH A;  4C9Y A;  4KIC A;  3G4S I;  4HIZ A;  2JK3 A;  3K4L A;  1RWR A;  1JRG A;  3GXO A;  2EQR A;  2A5Y B;  2KL4 A;  1W35 A;  2FVG A;  1OJL A;  2WY7 Q;  2FOW A;  4ANJ A;  4OMY A;  1RQP A;  2XTY A;  3CQZ J;  1XCV A;  4A12 A;  3EET A;  2LY9 A;  1RKT A;  2GXA A;  4BQA A;  4CYC B;  2Q6I A;  2QQA A;  3LQQ A;  2D3L A;  2HVS A;  4IW3 B;  4A3D J;  3VDX A;  3I64 A;  4CYC A;  1OCP A;  3JRD A;  1ZTR A;  2WAF A;  1JGS A;  1KRH A;  1HF0 A;  1MGT A;  1WCM J;  2DLL A;  2CBX A;  2DFF A;  3I58 A;  5LFA A;  4OOS A;  2E34 A;  4PJ0 C;  5E3O A;  4XKC A;  2CO5 A;  3VSK A;  4RB0 A;  4LB6 B;  4P1W A;  2VBV A;  3CJR B;  2WTE A;  1ZG5 A;  3S1Q J;  2W1O A;  2FEZ A;  4MIM A;  1QQ1 A;  1MKM A;  4OIR F;  1FNC A;  1DAR A;  2JSP A;  1FEX A;  1E43 A;  3BZK A;  3C2B A;  2HKX A;  4YEL A;  2DYI A;  4NB5 A;  2V7U A;  3CF5 F;  2EZK A;  3FBI B;  2VBU A;  1UFM A;  3CZ6 A;  2M5S A;  1TBX A;  2Y31 A;  3OYJ A;  1KYZ A;  5DCF A;  2LBF B;  2GQF A;  4RD6 A;  3KP3 A;  4ABZ A;  2IRF G;  1QGY A;  1YJ9 B;  3GWZ A;  2CS3 A;  2DW4 A;  4TT3 A;  5D8L B;  2L0K A;  2PG4 A;  4XRS G;  2R5Y B;  1B59 A;  2R4G A;  2HEO A;  3GRH A;  2D3N A;  3JRF A;  3JRB A;  1HVX A;  4C30 A;  2NNY A;  3JRE A;  4DK0 A;  1ZKG A;  5DM7 F;  2H09 A;  3LSK A;  5J8C A;  3BQY A;  2KIF A;  2R5Y A;  4PSX A;  2H8W A;  2M87 A;  4M3D A;  1UAA A;  1O8E A;  2FJ1 A;  3DBL B;  4GYG A;  4FWT A;  4JRA C;  4Z4Z A;  3CC7 B;  2CC2 A;  5C1E A;  1SFE A;  5C4X J;  1R5I D;  3PUM A;  2KRC A;  1S8N A;  4PAB A;  3U2R A;  3ZN1 A;  2IAI A;  2F4O B;  3CLO A;  1N0V C;  3WHC A;  1DAB A;  3B6C A;  4E6K G;  1WHU A;  4Z4V A;  4XQF A;  3OS1 A;  3WU1 B;  2BSA A;  3WTX C;  2KIS A;  5DS9 A;  4BUP A;  3BCF A;  3B4N A;  2FQ3 A;  5LRR A;  4KIT B;  1HW5 A;  2TCT A;  3SFI A;  1K4Z A;  3DQV C;  4L5E A;  1R9T J;  1JHF A;  1QX4 A;  3PO3 J;  4M73 A;  4WZK A;  4IXA A;  3F3X A;  3W2A A;  4IZZ A;  4ZGN B;  1RZ4 A;  1IN8 A;  2B5O A;  4YII A;  3MMY B;  4RAY A;  5LEJ A;  4S05 A;  3L2V A;  3CW2 A;  3CD6 B;  1IW7 F;  1SFK A;  1W2B B;  2JA7 J;  4LOC A;  1GHC A;  5A8A A;  4R79 A;  2X1D A;  2Z3Y A;  2WB1 N;  3B02 A;  1WI9 A;  2V7T A;  1XGO A;  3PFI A;  1KON A;  3JRG A;  5ILS A;  4L0Z B;  2A05 A;  4N4O B;  2C78 A;  2OUM A;  4OP7 A;  3LMM A;  1TUI A;  4BE2 A;  4ZZD A;  1L3L A;  1SAU A;  3WY9 A;  4M9X A;  2EWN A;  3HPG A;  1NTC A;  3ECO A;  5ICG A;  1MJ9 A;  1YX2 A;  1VQ9 I;  1P4X A;  1ZRE A;  4RAG A;  5IOZ A;  1BOB A;  1OCT C;  2CV2 A;  3LL7 A;  3QU3 A;  3QU6 A;  4HX8 A;  1VQL I;  2GAU A;  5B66 C;  1ZQ3 P;  3CCS B;  4E7Z A;  3B8Y A;  2L7K A;  1R6R A;  3I4P A;  3DLA A;  1FX7 A;  5FKM A;  3I0T A;  1ZR4 A;  2FRH A;  3RQ4 A;  5IY5 H;  5IYB J;  4I02 A;  2IGO A;  3RJP A;  2DU9 A;  3U21 A;  2DOF A;  4L8J A;  1MMD A;  4V19 K;  3OJW A;  3P7N A;  4DYR A;  4EJW A;  2RC5 A;  1N77 A;  5FLV A;  4DZP A;  3FKJ A;  3CCE I;  2EPF A;  4BXU A;  2GA2 A;  2JIZ A;  5FRO A;  2MD0 A;  5KCM A;  2DDA A;  4P5O A;  3CDI A;  4ZYE A;  2VT2 A;  2FNP A;  3BT9 A;  4HLX A;  2ZZE A;  4GGG A;  2DMQ A;  2L2O A;  2R5Z B;  3U6B A;  2V6C A;  2ZJQ F;  1KCC A;  1Z3Y A;  1FOK A;  4PC6 A;  2M9H A;  2Q1Z B;  4IQ4 A;  1F4K A;  1I1G A;  1I5Z A;  5EYR A;  5AIQ A;  4JYK A;  4OJO A;  1NB9 A;  1D8K A;  2R5Z A;  2Q0O A;  4XOP A;  1VQ7 B;  3IV5 A;  2CW5 A;  3GLX A;  4OJ5 A;  4X0G A;  4AID A;  2HYJ A;  2LRD A;  3K70 D;  3SEQ A;  3GEZ A;  2VNK A;  3R4K A;  1BI0 A;  2HZT A;  2KPM A;  5GAD J;  4PFP A;  1YIT I;  3H94 A;  2XIG A;  3E97 A;  5AMV A;  1G3T A;  2UV1 A;  3H3U A;  3HHH A;  3RPQ A;  3TQN A;  3W6K B;  2AQF A;  3Q0W A;  3S1M J;  4RD0 A;  1T6Z A;  3FXQ A;  3OZU A;  5M5W J;  4E70 A;  2V7F A;  3V76 A;  3OEE A;  2PI0 A;  1KC8 D;  4EM0 B;  2BV6 A;  2D5V A;  4L9N A;  2PMZ A;  1OB5 A;  4J0Q A;  1WFX A;  4MGR A;  2GRE A;  1E1R A;  1CQT A;  3C7J A;  1BC7 C;  2XF6 A;  2YS9 A;  2GXB A;  3R60 A;  2XKO A;  2V4J C;  3ISP A;  3VNV A;  2KDZ A;  1OCZ H;  2KRH A;  1T98 A;  4UXN A;  4QVA A;  1YHQ B;  2N8G A;  4MQV A;  3QRF F;  1SFO J;  4M53 A;  4RDK A;  4RGU A;  4G9Y A;  3J7Y J;  2DDB A;  4LD5 A;  1ZRF A;  2PJP A;  5A89 A;  1VQO I;  2XZO A;  2CK3 A;  2W57 A;  2DT5 A;  2A3S A;  3BR2 A;  3VNU A;  5D8K B;  3OYM A;  3EYI A;  5K5O A;  2ESH A;  3P9C A;  4FE4 A;  4WWV A;  2DT7 B;  3QE2 A;  1R1T A;  3ABL H;  4Q4Z F;  3GTO J;  2XPV A;  1QFZ A;  2R9V A;  2O17 A;  1VQ6 B;  3S3M A;  1Q86 D;  1ENH A;  1X1P A;  3HHG A;  4BJT A;  4P12 A;  1W9X A;  3IKV A;  2RV8 A;  2X0K A;  4Z4W A;  2L9V A;  3MKY B;  2FBK A;  3TOB A;  1DDI A;  1N0U A;  2M4G A;  4DNR B;  1YTY A;  3AG1 H;  2C2W A;  3OFN A;  2YUH A;  1VQ4 I;  1WH5 A;  3SJP A;  1NHC A;  1UEL B;  5CYV A;  2W00 A;  4G6T B;  3S8P A;  1GR1 A;  3OAA A;  4URR A;  1Y0U A;  4BE0 A;  2E36 A;  1JNY A;  1YLO A;  1BI2 A;  1ZHF A;  2ZB9 A;  3F8M A;  3PUF A;  1P4A A;  5H2F C;  4R1H A;  3F23 A;  4A93 J;  2KIQ A;  3KE2 A;  1OOC A;  2NNN A;  2AHO A;  3CCJ B;  4DBR A;  2FD5 A;  2K3F A;  2DCE A;  5H6R A;  4KFC A;  2WY8 Q;  1QHG A;  2ZC2 A;  3L1P A;  4OPO A;  1A6I A;  2L01 A;  3ASP A;  1H42 A;  3GZN B;  1QZZ A;  3ABU A;  4F55 A;  1HXD A;  1Q1H A;  1KD1 D;  5ED4 A;  1A04 A;  1COW A;  1O88 A;  4Y9U A;  3I4N J;  2XSJ C;  3LA2 A;  3HSR A;  2YUS A;  1GDT A;  3GTL J;  1FC3 A;  5EDN A;  3OSG A;  2NV4 A;  2DO7 A;  3BH7 B;  2HYF A;  2IJL A;  5K1Y A;  4EM1 A;  2GIZ A;  1S4M A;  2X53 S;  1LM1 A;  1QCX A;  5M3F J;  5THX A;  3I3L A;  2VBE A;  2X3H A;  1QVU A;  3FY3 A;  1WPK A;  1U2W A;  3BZ6 A;  2BBY A;  3RPU D;  3W2W A;  2WWY A;  3E3V A;  4KNY A;  3PL8 A;  1BJZ A;  2XC7 A;  1IUY A;  2Q6K A;  3B8H A;  2WA0 A;  3VR6 A;  2K9M A;  1OFL A;  1VHO A;  5IYR A;  1WJE A;  3DPT A;  1IXR C;  3TMO A;  1U78 A;  1APL C;  2MGQ A;  4CA0 A;  1J9Z A;  1XG1 A;  1ZG1 A;  1E3X A;  1QGZ A;  2CFX A;  4PC7 A;  2RQQ A;  4L0Y B;  1QPM A;  1KGS A;  2HCJ B;  2DEU A;  2DA1 A;  3L00 A;  3BQJ A;  2HU9 A;  4KMF A;  2A68 F;  2VQG A;  2NOG A;  4DYQ A;  2C77 A;  5TRD A;  1CGP A;  1BBY A;  1EH7 A;  2HI3 A;  2QEX I;  2QSF X;  2R7Z J;  1S6L A;  2WAD A;  1A36 A;  3DEW A;  2Y48 A;  1W0J A;  2EBI A;  3DPL C;  1V4R A;  4FK8 A;  2Y9Z A;  1RRJ A;  4HYE A;  4TMV A;  1D8J A;  3K4K A;  2H1K A;  1Z91 A;  1XGN A;  1Z9C A;  1UCR A;  4FCY A;  2PLY A;  3K4C A;  3GUD A;  2QF7 A;  2HFH A;  1NRK A;  1LE8 B;  4PZJ A;  2X6O A;  4Z4R A;  1J09 A;  2VAS A;  2GWR A;  1IB0 A;  3ES9 A;  1LLW A;  3TO6 A;  2VXZ A;  4M0L A;  1IJF A;  2LMD A;  4IX7 A;  2BHZ A;  1DBG A;  2DFH A;  2PQ8 A;  5GAG J;  2V31 A;  1BI1 A;  1VBL A;  2B7C A;  4UB6 C;  5GPA A;  1LE8 A;  2HTJ A;  1Q9S A;  4WXH A;  2BM5 A;  3DU1 X;  1PYV A;  1N05 A;  3C2G A;  2XAU A;  2XV4 S;  3CES A;  2F43 A;  1NK3 P;  1LPQ A;  1GVH A;  2QX3 A;  1QBJ A;  1PXZ A;  3B6A A;  1G4D A;  2ZXW H;  5DTD A;  1P6R A;  1Z6R A;  2VIX A;  1BL0 A;  3SY2 A;  4MYU A;  5M3M J;  2RQP A;  3V8J A;  3BP8 A;  4RDL A;  1E0E A;  5C1C A;  2GA1 A;  3S15 J;  1QA6 A;  2EFN A;  2MW8 A;  2K9N A;  5BOX A;  1F43 A;  1OQY A;  5B6I A;  1KU3 A;  4V02 C;  1QVT A;  3OOC A;  1O8J A;  1ITY A;  3UNG C;  2ISZ A;  4CYD A;  1N25 A;  2ESN A;  3F9K A;  1YJN B;  1ZRC A;  2VBM A;  2D1H A;  2HPI A;  4TV7 A;  5C3E J;  4AIK A;  3JCU C;  3CCM B;  2W7Z A;  4Z4S A;  4O6J A;  3CME I;  2R7D A;  2LSO A;  2GM4 A;  1F9N A;  3MD2 A;  4HWV A;  2E19 A;  1UD4 A;  1KQ9 A;  3KLN A;  2CYY A;  4P3I A;  2VBX A;  4XN3 A;  3N05 A;  3OPO A;  3EUH A;  2IA2 A;  4NQW B;  4XL9 A;  4Q48 A;  3NE5 B;  3MKW B;  3AFH A;  3WXM A;  4E7K A;  4HST A;  4MEX F;  2ID3 A;  3QFS A;  4LBZ A;  2B7B A;  3WTY C;  2QM3 A;  1D3Y A;  1MND A;  2A69 F;  2NYX A;  2CU7 A;  3CDH A;  4A6E A;  1FYL A;  1N08 A;  2XZL A;  3ZQF A;  2BM4 A;  4NQW A;  1W0T A;  4IHX A;  2F4M B;  4PJN A;  3MKZ A;  1VTN C;  1K83 J;  3RKY A;  1SKY B;  1OB2 A;  5JHU A;  3FK7 A;  3KEQ A;  3DKX A;  3GME A;  2HOS A;  4EH1 A;  3T8R A;  2ZBV A;  1QQI A;  3OWT A;  2Y75 A;  3KP7 A;  3MFK A;  4X8I A;  2OBR A;  4DK1 A;  4OOX A;  5E6T A;  2EIK H;  4I99 C;  5C44 J;  1ZUN B;  1K9M D;  1YO5 C;  3W5V A;  4MQ9 F;  1IB4 A;  3FKS A;  5B5E C;  1TT5 B;  3OMY A;  2IS4 A;  1OGJ A;  1AWC A;  3ONU A;  3G4S B;  4EAT A;  1XPX A;  1EFU A;  2W48 A;  5DM6 F;  3LNQ A;  2R7S A;  4JX5 A;  2GPJ A;  2KMU A;  1TWA J;  2HYG D;  4P9S A;  2DYS H;  1A35 A;  1B9N A;  2YU3 A;  4BAY A;  1POG A;  3S17 J;  2NS7 A;  4U4B A;  5DNS A;  2HR3 A;  2HWV A;  3HM5 A;  3ZQL A;  5DSZ A;  1SEU A;  3S16 J;  3MZ8 A;  2C5B A;  1TQP A;  2OQG A;  4A3M J;  1IG7 A;  2PYH A;  4IOA F;  4MEY F;  2KJB A;  1WSU A;  2IPQ X;  3M1C A;  4JK1 X;  3BH4 A;  4X7D A;  5FO0 A;  3CPW B;  3VYR B;  3BDD A;  1VQN I;  5CDF A;  1K5C A;  3SYT A;  5EMN A;  2PMU A;  5JVT A;  4L9V A;  3ZQH A;  4FT8 A;  1AOY A;  2DQL A;  2V1N A;  2DOE A;  4KN4 X;  3LAP A;  1KQS B;  4ZC3 A;  4BDY A;  2NRA C;  1Y0Y A;  1WSV A;  2HXO A;  3E1S A;  1VHE A;  2JDI A;  3DV8 A;  3MHP A;  3WYA A;  3ZPP A;  4N4N B;  1D1A A;  2BY3 A;  2V7X A;  1M1K D;  2IOU G;  2D2W A;  2L7Z A;  5F0C A;  1BN8 A;  4BDZ A;  1M90 D;  2O1D A;  3BWG A;  3H1C A;  1GVD A;  4ZYD A;  1QA2 A;  2WV0 A;  3HEF A;  2NVU B;  3S32 A;  3KIO A;  2E7W A;  3FPP A;  1NG7 A;  4RD3 A;  3K1M A;  4J19 A;  3HRS A;  2ZKZ A;  2CV1 A;  4U49 A;  1JHH A;  5IT9 K;  2DER A;  2QLZ A;  3H0D A;  2DOG A;  3DBH B;  3Q0U A;  3RPU A;  2V7W A;  3L2C A;  5H5J A;  3A0H C;  1OFM A;  2VFM A;  5L3D A;  3LSM A;  4MTE A;  2NVT J;  1IHM A;  1BOA A;  4HA8 A;  5L3F A;  1IJW C;  5J4Y A;  5C4J J;  3P9K A;  1BC8 C;  1I8D A;  2L7F P;  5HZA A;  1HW1 A;  2GK7 A;  2KZV A;  1K78 A;  3M9A A;  3U6K A;  1N75 A;  4NK6 A;  3PO2 J;  2QEN A;  3GF2 A;  5EG0 A;  2E60 A;  2OJE D;  5ICF A;  3LST A;  2HTS A;  5LHG A;  2BGJ A;  3CCJ I;  3CUQ B;  2NXN B;  1FNN A;  4RS8 A;  1RI7 A;  3WTZ A;  1ZM4 A;  2C4T A;  5IPA A;  2QQ9 A;  2QYO A;  3KZI C;  4E7J A;  1H0M A;  4YAW A;  5FO1 A;  3ERM A;  1E63 A;  1Z77 A;  2DTR A;  3W6V A;  4I0A A;  3H35 A;  5CVR A;  1WZ2 A;  1WJF A;  3CUQ A;  1K79 A;  4CGZ A;  2LKS A;  6PAX A;  3CCM I;  4C43 A;  2IEK A;  3K6G A;  2VN2 A;  3UKG A;  5BSY A;  4A3B J;  3Q9V A;  2WAE A;  1VQ5 I;  2EZH A;  3CC4 B;  2K9S A;  2GIV A;  2ZXI A;  4IHT A;  2NS0 A;  3AVX A;  3PIP F;  3NAW A;  2X1E A;  4RM0 A;  2BHY A;  2IXS A;  2LVS A;  3CJT B;  1XDU A;  2K27 A;  3L9F A;  5HS9 A;  5KAI C;  2OZU A;  4F92 B;  3KP2 A;  2ZL5 A;  5IP9 J;  3FF5 A;  1CQX A;  2DET A;  4HG2 A;  1R4M B;  2F48 A;  2DK5 A;  2JJ7 A;  5IP7 J;  3JRA A;  2XT4 A;  1D0Y A;  2JN6 A;  3HOW J;  1T0F C;  1OB0 A;  4IPA A;  2EWE A;  3GQ7 A;  1RES A;  3WG9 A;  3LA7 A;  2ME6 A;  2FXA A;  2JPB A;  3OYF A;  3S3O A;  4IHW A;  3AVV A;  3HGG A;  1E62 A;  3KX2 A;  1MH3 A;  4YG2 F;  2R7O A;  2O8X A;  4TSF A;  2EB7 A;  4KUM A;  4U7D A;  3CMA I;  1FLI A;  3LMW A;  3HUG B;  1YS7 A;  1IO2 A;  1K28 D;  1VQP I;  2M8G X;  3KYD B;  3S2H J;  1IRX A;  2XGE A;  2Z6B D;  1VQL B;  3C2H A;  4OMZ A;  3V7S A;  3ZQI A;  2VNJ A;  3L09 A;  3HUG A;  5ICE A;  2XND A;  2RNG A;  4A3E J;  1HF2 A;  1TQI A;  4AUX A;  4HQE A;  1K4T A;  4ROX A;  1ZGA A;  2ECB A;  5BSX A;  1TQM A;  2VC0 A;  1XB2 A;  2EA2 A;  2PBI A;  2KLO A;  3K2A A;  3G6E B;  2B63 J;  1PE9 A;  2M0M A;  2HQR A;  3KZZ A;  1AKH B;  5DCM A;  1W34 A;  2X3U A;  2VT3 A;  3TW7 A;  3DEE A;  1W7P D;  1X4O A;  2XRO A;  4I2O A;  3CCE B;  4GCV A;  2D45 A;  5M5Y J;  1TSP A;  4KT5 C;  5HLH A;  1OR7 A;  1RUN A;  3JRI A;  3ASQ A;  3K69 A;  5L3C A;  2VBZ A;  2EFQ A;  1Y0N A;  3G1L A;  2B0L A;  3J80 K;  3IWF A;  1ZH5 A;  2X1C A;  3VO2 A;  3MVP A;  3KPH A;  5CVI A;  1TT0 A;  5FFZ A;  5JR3 A;  1YG2 A;  2R7W A;  1IRZ A;  2ZL7 A;  1GUU A;  1U9N A;  1BA5 A;  1A6Q A;  1U2R A;  4F91 B;  4N9I A;  1I39 A;  4HX7 A;  2XKP A;  3KP4 A;  2PMH A;  1ON2 A;  1TWG J;  3KCC A;  2CUF A;  1MRZ A;  5FL7 A;  1B23 P;  1Z21 A;  1JE8 A;  2GK6 A;  1MH4 A;  3ELK A;  3SLN A;  1DGR M;  4CIC A;  4X05 A;  2HKO A;  1TYX A;  3RDI A;  2R7U A;  4P6V F;  4LLN A;  1JUS A;  1LFB A;  1BJA A;  2XGC A;  3TL4 X;  2BW3 A;  1JB9 A;  4H0E A;  1R71 A;  3QOE A;  2DYR H;  2K85 A;  4B47 A;  1HC8 A;  1R00 A;  1Y8Q B;  3K1P A;  3AVU A;  1ODD A;  4P2N A;  3BG9 A;  1N78 A;  1YJN I;  3GZ5 A;  3A8I A;  2CV0 A;  2L54 A;  1STZ A;  2KDO A;  3M8F A;  5D6F A;  1KQ8 A;  2STT A;  4JMQ A;  4OAZ A;  3O8H A;  4RA2 A;  4A0Y A;  4NCN A;  2DJN A;  1KK0 A;  3GO5 A;  3H92 A;  2VFN A;  4NK8 A;  2NAZ A;  3MEX A;  4XLE A;  4QLC U;  4PUS A;  1PVE A;  3P26 A;  2ZME A;  3BR0 A;  2G7U A;  2BOL A;  2Q2E B;  3ZN0 A;  3U2Q A;  3F0C A;  3Q9S A;  2CQQ A;  3J7Z I;  3W2E A;  5TGT A;  1B4A A;  2UXX A;  3HXL A;  3E6D A;  3GIR A;  1VQO B;  2NVX J;  4BBS J;  2ZNY A;  3FJO A;  5LHH A;  4FET A;  1HA3 A;  2Z8G A;  5F27 A;  1XS9 A;  2Q2E A;  3J7A Y;  2DAO A;  3MZH A;  5GP9 A;  2WSS A;  3Q38 A;  4A5N A;  2O6W A;  4B43 A;  3FDY A;  1HDD C;  3FXM A;  3E6C C;  4H9G A;  3QYF A;  4Z6Y A;  3I4M J;  2DMU A;  2PJR A;  4NUB A;  3LO8 A;  1VF9 A;  4OOI A;  4EEF G;  3F6O A;  1XTA A;  2LF8 A;  1IXS B;  3ZMS A;  2R0Q C;  2ZXH A;  4IHS A;  1J0R A;  3DU5 A;  3OZV A;  3B73 A;  4BHP A;  1OYI A;  3EYY A;  3V7A A;  1VQ4 B;  2CQN A;  4A69 C;  1O8H A;  1Z3X A;  2BEO A;  2UWM A;  2BMW A;  2X6Y A;  1O3Q A;  1JJ6 C;  4N3G A;  4BYY A;  3BH6 B;  4NBS A;  2FSW A;  2RDP A;  2INV A;  4YFK F;  3CCV B;  1KU9 A;  4OJL A;  3CC2 I;  1E3Z A;  2HDN B;  2DOD A;  1GO2 A;  4ENK A;  1WXR A;  3QAH A;  2LF7 A;  3GFJ A;  2NZM A;  3SFZ A;  4E4H A;  4BAC A;  3RSN A;  2VBS A;  5F0F A;  4LGW A;  1MBH A;  3ZMU A;  1PJ6 A;  5HS7 A;  2DBB A;  2PEC A;  4HF2 A;  3EQN A;  3JU4 A;  2XSD C;  3BJO A;  2G9W A;  3A02 A;  2F5D A;  3D5L A;  1ZLK A;  3NB2 A;  2X0L A;  3TP3 A;  2CQK A;  1O7F A;  2GLO A;  3V8K A;  5EGO B;  4CZC A;  3WG7 H;  2H6C A;  2QCO A;  1XD7 A;  4P3Y A;  5GAH J;  1UB9 A;  3F21 A;  2G0Y A;  2XAF A;  3BJA A;  5LGU A;  3S1R J;  1IDZ A;  2E1B A;  1S7E A;  5L3E A;  1IZ1 A;  2XRN A;  5EGO A;  1QG0 A;  3KEO A;  2W85 A;  3FXK A;  1YFH A;  3T56 B;  1R5H A;  1ERD A;  3MMP A;  4UB8 C;  4LG0 B;  2EH3 A;  2JT1 A;  3FMR A;  4YAO A;  4D7M A;  5HLG A;  2NVQ J;  5F08 A;  4HV6 A;  2QE7 A;  1L1I A;  1P9Q C;  5AON A;  2O6G E;  3ZUG A;  5FKK A;  1PJ5 A;  3ZRG A;  1Z7U A;  4Q47 A;  5FA6 A;  1QVF B;  3OS2 A;  2CW8 A;  5E8G A;  2MBF A;  1X1B A;  3A4C A;  2LBF A;  3JSO A;  1W5T A;  4OPW A;  3OIP A;  4ZH4 F;  2OU2 A;  5KSW B;  3W2V A;  3SXY A;  2Y9Y A;  5JFR A;  2QEX B;  2F3L A;  3LYC A;  3HKZ A;  3HG9 A;  2PN6 A;  4EW9 A;  4OIO F;  3ZQ7 A;  4CDG A;  2DTZ A;  2MFZ A;  3BR3 A;  4I01 A;  4CXF A;  4JX4 A;  5GTH C;  2BM0 A;  4WZL A;  5L3B A;  5F1R A;  2X6W A;  2IS6 A;  5FIU A;  4BKX A;  3A8K A;  3RTR A;  2X48 A;  2YR2 A;  4XLC A;  1ON1 A;  1I7P A;  1BX1 A;  3AG4 H;  3SQV A;  1WH7 A;  5A2Q Z;  4AVZ A;  1W7P B;  3DKW A;  3CC4 I;  3ZMD A;  4PJM A;  1IGN A;  2XOK A;  4JBA A;  4A3F J;  2HNH A;  1BPL A;  5HS8 A;  2OTL I;  3I1F A;  4DYC A;  1F20 A;  5ERI A;  2MH9 A;  1K4S A;  4TN1 A;  1WDT A;  2EV6 A;  2XTW A;  3TO9 A;  2E2I J;  4G1B A;  4AF7 A;  1FMV A;  1R5O A;  4Z03 A;  1IN6 A;  3JTG A;  2GJP A;  2M45 A;  3CCU I;  1UST A;  3HZJ A;  2ZTN A;  1OCO H;  3QSY A;  2OBP A;  2OQR A;  3BG5 A;  3OIQ A;  2QGG A;  1O7L A;  3P4G A;  1CNF A;  3DTK A;  1D0Z A;  2HDC A;  5DUI A;  2XAJ A;  1JJ2 B;  2K40 A;  3BPX A;  2JA2 A;  1X3U A;  1Q7Y D;  1JUP A;  1K7A A;  4Y7C A;  2I5U A;  4XKB A;  4JOM A;  4HE5 A;  3SDB A;  3OV8 A;  1M1E B;  3ZSC A;  2JVH A;  2EFG A;  4TMW A;  3CME B;  2V6E A;  1BI3 A;  1YOV B;  2E1C A;  1GAQ A;  4QFM A;  1IV8 A;  1KYW A;  4LIV A;  9ANT A;  3Q6R A;  2BM7 A;  3FBN B;  3TGN A;  3ESW B;  2EFW A;  4F52 A;  3QPL A;  3TOA A;  2WPD A;  2FQ4 A;  3WTS C;  4M9S A;  1ETW A;  1F5T A;  1BMF A;  1HKT A;  3GVL A;  4P25 A;  4HQM A;  2CRV A;  1LFP A;  4A3G J;  1I18 A;  3G6E I;  4XLH A;  1PP7 U;  3OSF A;  4L9J A;  5B1B H;  1EP2 B;  1X1A A;  2DA4 A;  2CH0 A;  3PNV A;  5KVR A;  3DTI A;  4C2T A;  3GQA A;  1WJ5 A;  2MC4 A;  3ZP5 A;  1U8B A;  1WJB A;  3HSE A;  3IAM 2;  4HV5 A;  3QQA A;  2WJV A;  4X06 A;  5DN6 A;  2MAB A;  1B2R A;  1FWZ A;  1BIA A;  1K8F A;  4YZA A;  5HDG A;  1XB4 A;  2EFO A;  3ZC3 A;  2IGN A;  2K7L A;  4B4D A;  1T08 B;  3H3Z A;  2CF4 A;  2GJK A;  3RYR A;  4B09 A;  3A03 A;  3G1M A;  4A3I J;  2I8D A;  3D5S C;  1ZRD A;  3FXU A;  2BY1 A;  3RKX A;  4BXX J;  1P4W A;  2KP6 A;  4DNC A;  4WWC A;  4F7D A;  5E3L A;  5B1A H;  2W7N A;  2ISY A;  3HB9 A;  3SZG A;  4N3N A;  4EV0 A;  2Y0S N;  3DEU A;  1T38 A;  2VBY A;  4Y9R A;  4M3F A;  3LSP A;  2GOM A;  3FIW A;  3KL9 A;  3M8J A;  2V26 A;  2EIM H;  2KQR A;  4P6Y A;  1QO0 D;  3KET A;  4I09 A;  5CQG A;  2V9V A;  2ZBU A;  3GVJ A;  4ZCM A;  4ZDO A;  2J8I A;  2VNH A;  5LGN A;  1VQN B;  2QYU A;  2P0W A;  2ZSH B;  4S0H B;  1XSD A;  2D74 A;  4KH3 A;  3BR6 A;  5GTI C;  4TMZ A;  3DP7 A;  3CCQ I;  3E0J B;  1KMH A;  2WBM A;  1FNM A;  4I6Z A;  4G6Q A;  1HKQ A;  1MW7 A;  4II3 A;  2UVE A;  4BBR J;  3HOS A;  3E20 A;  3BQZ A;  4X7C A;  1O8M A;  5BMZ A;  1I1S A;  3BTI A;  3O3K A;  1U0J A;  1IDJ A;  4C0S A;  1I50 J;  1XCB A;  4XOT A;  2F5E A;  4HNU A;  4IRI A;  5KK1 A;  1IV6 A;  1LB2 A;  1E17 A;  2L4M A;  5FD6 A;  3TKY A;  1UMQ A;  2W84 A;  4HDV A;  4X7F A;  4Y15 A;  2XAQ A;  2RVC A;  3IL2 A;  2VB6 A;  3IH2 A;  2MLK A;  2M7A A;  4ZYH A;  4W8T A;  1R1V A;  2XB0 X;  1Z67 A;  4NC6 A;  3BCD A;  4AM3 A;  2XHK A;  4FQG A;  1SMT A;  2MH2 A;  4WXD A;  2Z9O A;  3G71 I;  3GQ9 A;  4NHJ A;  4LC0 A;  1J7K A;  5AN9 A;  1Z05 A;  5D6E A;  2Y2Z A;  1IA5 A;  3BC9 A;  2DMP A;  4PC2 A;  3A01 B;  2CRG A;  2EV0 A;  4ENJ A;  1FY7 A;  3FIS A;  1YW8 A;  2M30 A;  1LQ1 A;  3VMW A;  3COA C;  5B3S H;  1W0K A;  3OL3 A;  2M0C A;  2JA6 J;  2RC6 A;  2H94 A;  3HOT A;  3A01 A;  4EJV A;  1QU3 A;  4W8R A;  3WTV C;  2DA7 A;  1EFC A;  3CCV I;  4CQJ A;  2DA5 A;  3R61 A;  2ODL A;  3BJ6 A;  3Q3A A;  3O8G A;  1YLF A;  4L18 B;  2PE3 A;  1CZF A;  4G7Z F;  3UW0 A;  2R92 J;  5TV2 A;  2O0V A;  1TWH J;  3AK5 A;  4RLQ A;  4RPD A;  3FMQ A;  3PJR A;  2CG4 A;  2LDU A;  3V4G A;  3M3Y J;  3QFC A;  3OE7 A;  3OIO A;  1G3W A;  4M71 A;  5GPC A;  3C1D A;  5IT9 Z;  1VQ5 B;  3KRG A;  4QTR A;  1WPC A;  4IF4 A;  5HKK A;  1ETO A;  2O0Y A;  4GO1 A;  1V5V A;  2PMD A;  3W5U A;  4PMH A;  1BR2 A;  2EZL A;  3MKL A;  5L3G A;  1ZM3 A;  2FU4 A;  2GJR A;  1TWF J;  4WCG A;  1EP3 B;  4OJP A;  1R5B A;  4M2L A;  5HDN A;  4UZE A;  2Y30 A;  3T1B A;  3G3Z A;  1KK3 A;  5GV7 A;  2JRM A;  5A2Q K;  1QFY A;  3GVK A;  1AA7 A;  1WJC A;  2PIA A;  4DW6 A;  3BTJ A;  1I6H J;  4S04 A;  4L5J A;  1UJ8 A;  4M9Z A;  2MG4 A;  2DOA A;  3FZV A;  4C2L A;  3HKZ N;  2HXI A;  4B3G A;  2O61 A;  3H0G J;  1UHW A;  4HBL A;  4UUV A;  1VQK B;  3CMA B;  2KFD A;  5EEA A;  4MR0 A;  2M5W A;  1H9T A;  3HC7 A;  4K1X A;  2WZP P;  2W4S A;  2BN4 A;  1O3S A;  3FM5 A;  1VQP B;  4FN5 A;  2Z16 A;  3K2Z A;  2L02 A;  1W36 C;  4LIT A;  2MSY A;  4RB3 C;  4HZF A;  3PQJ A;  2VJ5 A;  5E79 C;  1OFD A;  2LY2 A;  4GXO A;  4YZX A;  2QQB A;  4XID A;  1E3P A;  2CW7 A;  4EMS A;  2D9R A;  2ZZF A;  3K4B A;  4BEH B;  2XRL A;  3BRO A;  2JTV A;  3R0J A;  2MC3 A;  5J3O A;  1V54 H;  1XGM A;  2FF4 A;  3S3N A;  3HOU J;  4CUG A;  4X6A J;  3NAU A;  3GLL A;  2EIN H;  2FML A;  5EF6 A;  5KHD A;  1EH6 A;  1ZM2 A;  1HDP A;  1VND A;  4MNU A;  3GW2 A;  3HTU A;  2P6T A;  4LBY A;  2EJR A;  2DFI A;  4G12 A;  4G6D A;  2JUG A;  4QSH A;  1TLL A;  4A3J J;  3ISX A;  5A88 A;  2IQ7 A;  1R49 A;  2R93 J;  1BLI A;  2VC1 A;  2K86 A;  2RGV A;  4AIH A;  2L4A A;  1D1B A;  1Y8R B;  4P9F A;  2ZFW A;  3E6M A;  3FWE A;  1WP6 A;  4X7E A;  2JWT A;  1QRC A;  4HPQ A;  4YFN F;  2XAG A;  1QUE A;  3ZBU A;  3VYS B;  2DPU A;  3CB4 A;  2NTQ A;  3ZQC A;  2KHM A;  5JLW A;  2HPM A;  4V2G A;  4FTH A;  5FRM A;  3LSR A;  4CCL A;  1NG6 A;  4FE7 A;  3HDD A;  5L46 A;  2PFB A;  2HDW A;  1XMK A;  2V7V A;  1WQ2 A;  2MLG A;  1LVA A;  2XNC A;  4YIR X;  1ETV A;  3CDL A;  1HG8 A;  4MFD A;  3B90 A;  1HST A;  3J80 Z;  3GFI A;  2FX3 A;  3OL4 A;  1WSR A;  4N0B A;  4Z05 A;  4Z06 A;  1JKO C;  2F2E A;  2XPW A;  3B82 A;  3H5R A;  1QVG B;  4XRF A;  3AST A;  5BPI A;  1FSH A;  1R36 A;  4BJ5 C;  3VEP A;  2O8K A;  2LG4 A;  1EH8 A;  1VJS A;  3G05 A;  4R71 A;  2VBT A;  4I76 A;  2VQH A;  2W24 A;  3N6Z A;  3DFG A;  3F8N A;  1B72 B;  1YS6 A;  1WI3 A;  1ZEL A;  4MHG A;  1D5Y A;  4ESJ A;  4WQM A;  4ZDL A;  3FHZ A;  2LC2 A;  3ONQ A;  1GJR A;  1FOW A;  1I3A A;  4UVA A;  3RYP A;  2BVN A;  4I98 B;  1H89 C;  1S7O A;  1FT9 A;  1B72 A;  4P1V A;  1LNW A;  4ESF A;  1JT6 A;  4C3I J;  3ASR A;  2W6J A;  3JQP A;  1GQ8 A;  1Y1W J;  1IN5 A;  2PMZ N;  4RM3 A;  2M1B A;  4B8X A;  4ASN A;  2K3P A;  5DD4 A;  2B7E A;  3FXO A;  2MA3 A;  2QZ8 A;  4A5M A;  4RPB A;  3L7W A;  1PUF B;  2OZ6 A;  2ADU A;  2AS5 F;  1FRN A;  4IL6 C;  3GSI A;  1MBF A;  3QYB A;  4L9T A;  3CC2 B;  3CMY A;  2BZT A;  2M7B A;  3F8B A;  2QBY B;  3OEH A;  4Q5S F;  1YIO A;  3OR2 C;  2M8E A;  2IS2 A;  1PUF A;  1X19 A;  1E1Q A;  1MMG A;  4RD2 A;  5E1Z B;  2H27 A;  2A5W A;  5HOD A;  2OAZ A;  4KKU A;  3CCY A;  3FXJ A;  2HDD A;  2LTP A;  4RB2 C;  1O3T A;  5TR9 A;  3TW6 A;  4OAY A;  4X0C A;  1LDK B;  4ZDP A;  1TYW A;  1ZK8 A;  2DIE A;  3LFK A;  3KFW X;  2WV1 A;  2YWG A;  2QXZ A;  2CWE A;  4KDP A;  1LJ9 A;  3S14 J;  2ZZQ A;  4B3X A;  3IKT A;  3ASS A;  3LSG A;  1OCC H;  4JP0 A;  2RN7 A;  4HDU A;  1DBO A;  2FX0 A;  4DQ2 A;  1GV5 A;  1V5E A;  5E1X A;  4UUS B;  1O3R A;  4IRG A;  2A07 F;  4O3M A;  1FDR A;  2V4D A;  3PET A;  1OYY A;  3T0Y A;  4ENN A;  3SHF A;  1EA3 A;  4TMX A;  2Q8K A;  3KZY A;  1ONV A;  3SZE A;  1ETQ A;  2P7V B;  3WWG A;  4UUS A;  4KN7 X;  1SFU A;  4D1Q A;  3K9T A;  1R5G A;  5D5X B;  3PVD A;  2QTL A;  2ICW G;  1X2M A;  2VXD A;  1BR1 A;  3HSF A;  1YJW I;  1V5F A;  4MYT A;  4RDU A;  1WJA A;  1O57 A;  2XAS A;  4B44 A;  4HW0 A;  2QA4 I;  3I54 A;  1SD6 A;  3T5X A;  4C3J J;  1Y39 A;  5AIP A;  4RD1 A;  5KW9 A;  5CVV A;  2NTB A;  3N90 A;  4C3H J;  3FKI J;  4RAF A;  2X6X A;  1ACI A;  3W2I A;  5D4R A;  5D5V B;  3DF8 A;  3NWT A;  2OPT A;  1FIA A;  5TJJ A;  1P92 A;  3Q3S A;  3NAR A;  4ITV A;  4IJA A;  1EXM A;  1KQ5 A;  2CMP A;  5GV8 A;  3QWL A;  3UR3 C;  2VQL A;  3W2H A;  2OC6 A;  2HZD A;  4ZZL A;  2BXZ A;  3WBJ A;  1T56 A;  1MSF C;  1GAW A;  2LLK A;  4DQL A;  3MWM A;  1EWY A;  2VL8 A;  3RCO A;  3BTL A;  2F1L A;  2R6H A;  2OTL B;  1O8K A;  1U9O A;  1FP1 D;  3LSJ A;  5JBQ A;  4XR6 A;  2GXG A;  3I9V 2;  2IVM A;  4B1R A;  3VSU A;  1SD7 A;  5LBQ A;  2STW A;  1TW2 A;  4LBV A;  2CSO A;  5KAF C;  2EK5 A;  1TTY A;  2R3S A;  3ZMT A;  1SMY F;  1T95 A;  4LMY A;  2V1U A;  4BH9 A;  1OYW A;  5LGT A;  3S93 A;  3CCU B;  5FNZ A;  2HVQ A;  1R7J A;  3VMV A;  1Y56 A;  2LK2 A;  3KP5 A;  4XLP F;  2F1M A;  3TP0 A;  1IJE A;  4XN0 A;  4RD4 A;  1S72 B;  1FP2 A;  1J2X A;  4EJO A;  1VQK I;  2BGC A;  3VMF A;  2QTZ A;  1PLU A;  2KT0 A;  4M1K A;  1OHH A;  2VFO A;  1TZL A;  4MTD A;  2XVC A;  4MLO A;  1J75 A;  5IYW A;  2LKP A;  3ZMV A;  5J8F A;  3A35 A;  3FM3 A;  3QYE A;  3GQ8 A;  1N8R D;  3SEZ A;  4E7I A;  4XLA A;  5J47 A;  3KEW A;  4XRM A;  1H88 C;  1FSE A;  1IN7 A;  4U9U A;  2RKH A;  5E3M A;  1OFE A;  3WE2 A;  3E5U A;  1EA0 A;  2L9S A;  1T0F A;  1P4M A;  3WGI A;  4XBF A;  2K02 A;  4RBO A;  3E5Q A;  1RNL A;  5LRS A;  1TL8 A;  1KZL A;  4A6D A;  2M34 A;  2RAE A;  4OIN F;  4EVI A;  1W5S A;  1WKM A;  2ELK A;  2NS8 A;  3SJM A;  1ZAR A;  4HAM A;  3BR5 A;  1OR7 C;  2DA3 A;  3Q0V A;  2DI3 A;  4PFO A;  2WYR A;  1AIR A;  2FOK A;  3IHU A;  1XGS A;  2J7K A;  3VOD A;  1BQE A;  2Y69 H;  4NC7 A;  1AKH A;  4WZT A;  4MXN A;  1O8L A;  4M6X A;  4FHT A;  4Y13 A;  1MJA A;  3D0S A;  3CO7 C;  4Y52 J;  3U1K A;  3WGH A;  1VQ8 I;  5E20 A;  4CCK A;  5H6Q A;  4D7N A;  2KKO A;  2OTJ I;  1REP C;  2CND A;  2JA5 J;  1VLY A;  1YW9 A;  3OYN A;  3S1N J;  4EGZ A;  3CUO A;  2QVO A;  3MN2 A;  4PGH A;  1W5C C;  2L7M P;  3V7C A;  2NST A;  4F93 B;  4IQJ A;  4Z1M A;  1FTZ A;  1H85 A;  2LNB A;  1NJI D;  1U5T C;  1O4X A;  3BY2 A;  2INU A;  4PJL A;  5ICC A;  3DDY A;  1B9M A;  2UXN A;  5CQE A;  1R1U A;  4YEI A;  3OYL A;  4UAJ A;  3AVT A;  4CH7 A;  1RC9 A;  2HQ5 A;  1UMK A;  2BX6 A;  2P3M A;  1SD5 A;  3GTJ J;  2BY0 A;  3VYU B;  2F5C A;  2K4J A;  2W25 A;  2FE3 A;  2VBW A;  2C4U A;  3WTW C;  1XN7 A;  1MAB A;  4O5V A;  1RU4 A;  3CCQ B;  1QRY A;  4DBQ A;  2ZJR F;  2D1V A;  2VOD A;  2KJC A;  3H3V K;  3BLY A;  4X07 A;  1IN4 A;  2KIM A;  3A2K A;  3OJX A;  3P5J A;  3F22 A;  1J59 A;  2LKX A;  1DDN A;  1NK2 P;  3SUC A;  4ON0 A;  1HOM A;  1JA1 A;  2Y0M A;  5LLQ A;  4PSW A;  3OYI A;  1BN5 A;  3OZW A;  1IXC A;  5HLI A;  1ULY A;  3GTM J;  3W2F A;  1ZR2 A;  5DDG A;  1ZAO A;  1WJD A;  4I0B A;  4UVC A;  4OJ6 A;  3KYL A;  1QZY A;  2YPR A;  4ENM A;  5CVU A;  5J1U A;  2DFE A;  2KVO A;  5DD8 A;  2ELJ A;  2LR8 A;  3ZPL A;  4GQN A;  1B6A A;  3ZQQ A;  2JPC A;  2IW5 A;  3ZZT A;  4UV9 A;  2JVG A;  3GBG A;  1MBE A;  4XLF A;  1K8A D;  4ZV4 A;  1IAW A;  3LQR A;  3G71 B;  3JQR A;  1SVO A;  2BY2 A;  3D5R C;  1I27 A;  1RQR A;  2HGC A;  4Q7J B;  2XGJ A;  1Q82 D;  2RNJ A;  1D0X A;  1ETX A;  1K61 A;  1HBX G;  2LOO A;  5E18 F;  1LEB A;  4LLG F;  5BPD A;  1AIP A;  5FKN A;  1RMG A;  3AVY A;  2XPU A;  4D5C A;  4WXC A;  3RQI A;  2PEX A;  2XEX A;  5FLM J;  3Q39 A;  4B3F X;  2PX9 A;  1LKX A;  2YSR A;  3LSI A;  1UHM A;  3RZD J;  3HTS B;  5HVQ C;  4QPO A;  3I56 I;  2R7V A;  1EE6 A;  5F64 A;  2XTX A;  3GTK J;  1QA3 A;  1XMX A;  4RDJ A;  2J8K A;  2K4B A;  1XG2 A;  1ZM9 A;  5CPR B;  3CP2 A;  4WF2 A;  1O8I A;  2J5P A;  2W6I A;  1R58 A;  3Q5F A;  4YDT A;  1L0O C;  1B1B A;  1MMN A;  4XSZ F;  2R7X A;  2KZG A;  2COM A;  4XD7 A;  1W4M A;  1MJB A;  1E3O C;  2O0W A;  3PSF A;  5FKL A;  2CQ7 A;  2H6B A;  5BQT A;  5TIS C;  3LA3 A;  1FBS A;  4BY7 J;  2WZN A;  3K0L A;  1X3Z B;  1D1N A;  3DPU A;  3JX8 A;  2H8R A;  2CJJ A;  3EQL F;  3PEN A;  1OIS A;  2V9K A;  1XFO A;  4N9H A;  1EFR A;  1NB0 A;  1USS A;  1LDJ A;  4HOB A;  4KJZ A;  3AAF A;  3GZ6 A;  4YIF A;  1XDS A;  1YE9 A;  5IYN A;  3A8J A;  2GZW A;  4F7Z A;  2COB A;  3CXC B;  2BM6 A;  4KKT A;  2A61 A;  5F6F A;  3ZOB A;  4ESB A;  1JTY A;  1PJR A;  1TNS A;  2EIJ H;  4LG0 A;  4LB5 A;  1UG2 A;  3REO A;  4W8S A;  1DP3 A;  3OW2 B;  5FB2 A;  4RGX A;  2AQE A;  1PDN C;  2HOE A;  1NH3 A;  3CJQ B;  4B3A A;  2P5K A;  3IAS 2;  2A6H F;  3K4M A;  3N97 A;  1V0F A;  1XE1 A;  5JI6 A;  4ZGQ B;  3PUB A;  3G2B A;  2OBS A;  4P9U A;  4BS9 A;  5F4J A;  1DGW Y;  2JN9 A;  4UHT A;  3D1N I;  2GQQ A;  2QKM B;  2M2E A;  2IS1 A;  1F60 A;  3B78 A;  1U6G A;  3LJY A;  1SVL A;  3DBR B;  4HNT A;  1G7R A;  4AD9 A;  3PA1 A;  2FNA A;  1FYM A;  3HRU A;  1QRB A;  3R0A A;  4M6Y A;  1MBK A;  1RR7 A;  1EZG A;  1S7A A;  3E6B A;  5FGM A;  5EZG A;  4CCO A;  3WU0 A;  4CO8 A;  3GFL A;  3CCL B;  2X51 A;  2YWF A;  2ZTG A;  4QWQ A;  3L2Q A;  3TED A;  2VON A;  3O6B B;  4Z4T A;  4CZZ A;  2OCC H;  3IC7 A;  1EJ9 A;  4YRV A;  5FRN A;  5F1J A;  2R7F A;  4Z2Y A;  3RI4 A;  1W7P A;  4UZU A;  1KCD A;  1UD2 A;  1IDY A;  1T6Y A;  1S9H A;  1DU0 A;  2O04 A;  4QV2 A;  2ZJ2 A;  2NSP A;  1MD0 A;  1WRJ A;  2LH9 A;  3JTH A;  5FLX Z;  3SDG A;  3PSI A;  1O8D A;  4BHC A;  1JUM A;  5JLX A;  3HOY J;  3AGP A;  5E1W A;  2VJI A;  3QP6 A;  3H9N A;  2PLF A;  3A3B A;  3ABM H;  4XIC A;  4QUZ A;  4IHY A;  1OCR H;  1S72 I;  1AU7 A;  1BX0 A;  1QUF A;  3RKW A;  4OPV A;  1V55 H;  4UVB A;  3TO7 A;  4RAZ A;  4IOC F;  1JKR C;  4GFB A;  3WNC A;  3DXJ F;  3JW4 A;  3EDP A;  4IO9 F;  2VE8 A;  3BZC A;  1G6N A;  1VQM B;  2DY1 A;  2ZFU A;  3CTA A;  1G7S A;  2DA2 A;  4A3C J;  5K5R A;  4X1E A;  3I71 A;  3NQO A;  5J40 A;  2L9R A;  2QWW A;  4IHV A;  1O8F A;  2OF7 A;  3IP4 B;  2LRE A;  4XKV A;  3GTQ J;  2XC1 A;  2NOJ B;  4E7S A;  2OBT A;  2XZP A;  3QOP A;  4OOV A;  3CMM A;  1D1C A;  2CUZ A;  1R22 A;  3M1E A;  4OWR B;  2OV7 A;  4OIP F;  3HRT A;  1VI0 A;  4LIU A;  2GBY A;  3ABT A;  2VJ4 A;  4GDF A;  1DG1 G;  1SFX A;  5E3N A;  4EJT A;  3WQZ A;  1W36 D;  1IC8 A;  2JJ2 A;  3BY1 A;  3VB2 A;  3I5U A;  3ERE D;  1Z0X A;  2G7H A;  3OOP A;  3WGG A;  1A31 A;  1I6X A;  2HOT A;  4PDK A;  5J1Y A;  1K6Y A;  3R6J A;  1XQB A;  1EF4 A;  4EGY A;  3RKQ A;  3AL0 C;  2YWH A;  4XON A;  1BR4 A;  2JRT A;  4XRS A;  2LZJ A;  1XSX A;  1MMS A;  4EQQ A;  4XLN F;  3ROU A;  5DUK A;  2MYS A;  2VPL A;  1OGO X;  3M7G A;  3GCM A;  5JMC B;  2DT6 A;  3ZXS A;  1QGA A;  3T9G A;  5F0H A;  2IA1 A;  1BHE A;  3QPS A;  3ULQ B;  3V7R A;  5GAE J;  4M3G A;  1MZB A;  3AL0 B;  1W1W E;  2XF7 A;  3LFU A;  1YIJ I;  2ZL6 A;  4RCY A;  1AMO A;  4LK0 F;  4OM9 A;  3LQ6 A;  4E7L A;  2IGM A;  4XSX F;  1T2K A;  2E2J J;  3W3C A;  2ELH A;  5J3L A;  4K2E A;  5LMZ A;  1FOY A;  3J81 k;  2DQR A;  3GX4 X;  2LP0 A;  1SKQ A;  3MAJ A;  2VZL A;  4BQQ A;  3ZMZ A;  3W5H A;  4RB1 A;  1Z6T A;  3MQ0 A;  1TW3 A;  3GTG J;  1IDK A;  1G59 A;  5IK2 A;  1TLH B;  1EP1 B;  1N07 A;  3A3G A;  4L5I A;  4KKS A;  1GV2 A;  3F8F A;  1ZLJ A;  1ORK A;  4U7B A;  4U0W A;  3HOZ J;  1TP4 A;  3G1O A;  4YEJ A;  2P81 A;  4KA4 A;  1RUO A;  4ASU A;  3FMS A;  1T6S A;  3OKX A;  1YYV A;  2V1D A;  4XK4 A;  2XGD A;  3F8C A;  5LD2 C;  3SJZ A;  4W8Q A;  2F4N A;  4AF6 A;  2OK8 A;  3H9J A;  1K73 D;  2WC2 A;  4G8X A;  4ZTJ A;  2VKE A;  2VPR A;  3VOE A;  1JA0 A;  2VBK A;  1G7T A;  4HNV A;  3HYI A;  3RIQ A;  2E1O A;  3L2W A;  2X85 A;  2CUE A;  3A1P A;  1T33 A;  2JZY A;  3MCA A;  3I53 A;  2EA4 A;  4A0X A;  1HZE A;  3ZBT A;  4E0F A;  4LK1 F;  5DV5 A;  3VST A;  1UZC A;  2G0E A;  3I55 I;  3NEU A;  3L2U A;  4FIS A;  2UZK A;  3ASN H;  3GTP J;  2DCU A;  2YU9 J;  1OGM X;  2VQC A;  4U0Y A;  1PJ7 A;  4AYB A;  3SZP A;  3WU2 C;  4IEJ A;  1LUJ B;  2ACJ A;  4W97 A;  4CHU A;  4P26 A;  1S0U A;  2VKD A;  2O5R A;  4UUT A;  4XMY A;  1YRN B;  2QSG X;  3K7A J;  2VYQ A;  2IGK A;  2ZSI B;  1JT0 A;  1YJW B;  1GLN A;  3WHB A;  3EPZ A;  5EEH A;  3KP6 A;  4Z4U A;  1LLZ A;  4BNC A;  4G5G A;  1KK1 A;  2QA4 B;  4U0V A;  2BPO A;  4IRH A;  4BQN A;  1YRN A;  4D9J A;  1KTW A;  4YFX F;  1BM9 A;  1UD8 A;  1HW2 A;  1WOS A;  1F1Z A;  3BR1 A;  2VJJ A;  3C3W A;  1JXS A;  2OYN A;  4M4S A;  3WND A;  1DDG A;  1LDD A;  4U88 A;  1SM4 A;  2P5L C;  4JX6 A;  3HBL A;  2EIX A;  2V7Q A;  1S3J A;  1FNB A;  2CQX A;  5HXB A;  3PSZ A;  3PM1 A;  5BS6 A;  3OP1 A;  2K9Q A;  1Q1V A;  1X1C A;  3FXR A;  3HPH A;  1PP8 F;  5LHI A;  2BE5 F;  2ETH A;  1FBU A;  3HOX J;  5FJ8 J;  3ZCO A;  4M72 A;  1IRG A;  1QGP A;  4A0Z A;  4PC3 A;  2ZIT A;  3DCF A;  1KQ0 A;  1ZGJ A;  3GYH X;  4CCJ A;  5E8I A;  4ZTF A;  3PFY A;  1T5E A;  2XUB A;  3OW7 A;  2E1M C;  4IKF A;  4KYW A;  2XT2 A;  2DJI A;  4HX4 A;  4EJU A;  1FOX A;  1ZN2 A;  3ECH A;  3IRQ A;  1WU8 A;  2J5O A;  1PKV A;  5LEK A;  4PC1 A;  2HQA A;  1UG0 A;  5BNG A;  2UVF A;  5H20 A;  2MD5 A;  1QPI A;  3BC8 A;  2EV5 A;  4BPR A;  4OZZ A;  1C0W A;  3K4J A;  1TYV A;  3MCZ A;  3LWF A;  2E1M B;  2ME0 A;  4G7X A;  4Y3O A;  3BOQ A;  1J9I A;  1T8I A;  1KJZ A;  3K10 A;  1SVM A;  1X58 A;  4G94 A;  2X8K A;  4YFO A;  3SKB A;  5ILU A;  3BG7 A;  3U1D A;  1TVC A;  4Y4R A;  1Y6I A;  1IF1 A;  2FUG 2;  3RZO J;  3F72 A;  2AXT C;  2O9L A;  2F5V A;  5E17 F;  4Y33 A;  4RM2 A;  1AHD P;  3CO6 C;  5FLX K;  2Q6O A;  2AHQ A;  3BNW A;  4YXW A;  3JUR A;  4A3K J;  4YC5 A;  2A6E F;  2EFP A;  3AG3 H;  1YJ9 I;  3OYD A;  1KK2 A;  1QJV A;  2VKH A;  1TYU A;  1OLT A;  3CCR B;  2R7Q A;  1ETK A;  1OFC X;  1RPW A;  3JAM Z;  3E1Y E;  4KIS A;  2DK8 A;  4TMT A;  1V5G A;  2NTP A;  3PSS A;  1YX3 A;  4J00 A;  4XM3 A;  3JR9 A;  3HRM A;  1TC3 C;  2GOX B;  3PUN A;  4D5F A;  2I10 A;  4UV8 A;  2HOA A;  4HRI A;  3IUO A;  4OU0 A;  4UY8 I;  1R5N A;  2BF4 A;  3FPK A;  1BJK A;  2KRF A;  3WTU C;  4RMN A;  1H9G A;  4CCN A;  4BQO A;  3CCL I;  4BEH A;  5JVG F;  1T6X A;  3WBK A;  2QGU A;  4RLZ A;  3KEY A;  5J1R A;  2Z2S B;  1HCR A;  1JTA A;  3RY8 A;  4KIB A;  1WOO A;  3CC7 I;  1GVJ A;  2QKL B;  2QQ8 A;  3BTC A;  2O03 A;  3A0B C;  1A5J A;  5DS0 A;  1YQA A;  4F3Q A;  3QOD A;  3T51 B;  2E71 A;  2F6C A;  1KU7 A;  5J35 A;  5IYC J;  3BCA A;  2NPF A;  1VQ8 B;  3H09 A;  3RIR A;  2OTJ B;  1XMA A;  2LD5 A;  3P27 A;  3LNN A;  5IYQ A;  2JMW A;  3D26 A;  2IT0 A;  3M8E A;  3JQQ A;  2ZO4 A;  4MFE A;  1IRF A;  1Y0R A;  3K70 C;  1WOR A;  3G73 A;  3IH3 A;  3W2G A;  2E7X A;  1FMW A;  1MIJ A;  1VQM I;  4UZF A;  2DMT A;  1H8H A;  3TDU C;  3OOU A;  3DTE A;  2K9L A;  1JJ8 C;  1MNM C;  4FAS D;  1G3S A;  2ID6 A;  3Q6Q A;  4HE6 A;  5CVJ A;  3TDZ C;  3CD6 I;  4AVP A;  2Z5U A;  4PK4 A;  1P7J A;  2FA5 A;  1FYK A;  4I84 A;  3ZZ0 A;  1F36 A;  3EUH C;  4M6V A;  3OS0 A;  4AU7 A;  4PGO A;  1KZH A;  5D4S A;  1HA8 A;  2C5H A;  4FXU A;  1CF7 B;  4OZY A;  1JI8 A;  1MBJ A;  1YI2 B;  4V2F A;  3ZR8 X;  2BM1 A;  3ZGK A;  3PA2 A;  4YZQ A;  1KU2 A;  1FRQ A;  4MO7 A;  2O7O A;  3BCB A;  2R7T A;  1GXQ A;  1HSJ A;  3OYG A;  2JQ7 A;  3CJN A;  4HLY A;  3OY9 A;  3LQE A;  1EV7 A;  1CF7 A;  3DKY A;  4CCM A;  3J7A O;  2QZA A;  5IOY A;  3CCS I;  1DPR A;  4G7O F;  2PYG A;  3HGY A;  3ML6 A;  4LG3 A;  1A8P A;  1E2X A;  1BW6 A;  4Y7N J;  3AGQ A;  2A6T A;  1U3E M;  1X1D A;  1JKP C;  4ZYG A;  4ZYA A;  4W1U A;  5K7H A;  5EJC A;  4ACB A;  1XSV A;  2RC4 A;  1T39 A;  3EQO A;  4OPS A;  4AC0 A;  1GT0 C;  2QN6 A;  5F4M A;  4AC9 A;  5K5Q A;  1JGG A;  5JLV C;  1E3H A;  3R6S A;  4RGS A;  1XC5 A;  3OYA A;  1NDH A;  1V3F A;  4WK8 F;  3SEJ A;  1CLW A;  2XF5 A;  2WAQ A;  2ZJP F;  2VKV A;  5F4O A;  2ZCW A;  1G7C A;  3QPH A;  1QHH D;  4KIF A;  3F6V A;  1MDM B;  3ZPN A;  5FD5 A;  4ZJZ A;  2VFP A;  1O8G A;  2V1X A;  2M4K A;  3AKZ A;  1OKR A;  2EZI A;  3WE3 A;  5J6X A;  3I56 B;  3M07 A;  1ZGW A;  3H9Q A;  3DU6 A;  1H8A C;  3OYK A;  3FX3 A;  1VQ7 I;  1MDM A;  4NBQ A;  2VLA A;  3J81 Z;  2CGP A;  3BG6 A;  2HMA A;  1TWC J;  2DMN A;  3FK6 A;  1WOP A;  1PUE E;  3QFR A;  4CSW A;  2NT6 A;  5FO5 A;  4YZ0 A;  1YX5 A;  3EUK L;  4LLL A;  2QBY A;  3BY6 A;  5IYD J;  3P9I A;  2L9N A;  2OD5 A;  5EZH A;  1Z1D A;  5DYM A;  1UD5 A;  3BPV A;  2TDX A;  2E35 A;  2RRE A;  1MSE C;  1MNE A;  4M3B A;  3OYH A;  2V79 A;  1VFC A;  2QY1 A;  3VSV A;  4QHY A;  4AYB N;  3A1Y A;  4ZCI A;  4JQF A;  3HOV J;  2ECC A;  2P6S A;  3VPR A;  3OYB A;  1S5L C;  3H5A A;  2DN0 A;  1YHQ I;  3V42 A;  4BJ6 C;  4A2U A;  4E7H A;  3WTT C;  4EM2 A;  4RCZ A;  4Z4Y A;  3H9G A;  1Y1V J;  4ACA A;  1YW7 A;  1DP7 P;  1D5V A;  4TKO B;  2Z1D A;  3K4N A;  1WVR A;  5HLT A;  3S2D J;  1EFT A;  3PQK A;  2FBI A;  4LJZ F;  5KNL A;  1OGI A;  5H59 A;  2P4W A;  2X4H A;  4R8H A;  2QDX A;  2YWE A;  2E1N A;  3VO1 A;  2ZZG A;  1X0C A;  3VSL A;  2HVR A;  3ZQG A;  3LVB A;  3WNB A;  3PIO F;  1BIB A;  1EKE A;  3CPX A;  1VQ6 I;  4C2U A;  3BG3 A;  3JSP A;  2ZXJ A;  2V9P A;  4UNO A;  1UD3 A;  2OK7 A;  4G1V A;  1E64 A;  2W82 A;  4H4K C;  1K78 B;  1CNE A;  2VOO A;  3GQB A;  1D8T A;  5IYP A;  3CUQ C;  3DLL F;  1LVK A;  3HAG A;  2L3D A;  2VI6 A;  5EG0 B;  2QMU A;  2C6Y A;  4DGW B;  2XAH A;  5FFX A;  1FPQ A;  4B4C A;  3N4M A;  2JJ1 A;  5HZB A;  1LFU P;  3C18 A;  1RET A;  1KTV A;  4PCQ A;  5JHF A;  3M4O J;  1FTT A;  4LFU A;  4DQK A;  2Z33 A;  4YAF A;  2IA0 A;  3JAM K;  2OA4 A;  2CUJ A;  2ZBK A;  2H1L A;  2HS5 A;  2P7C B;  1DU6 A;  1WMR A;  2IBD A;  1H8E A;  4BXF A;  1JKQ C;  1B8I B;  4DNT B;  2VE9 A;  1ELO A;  4G7W A;  4GRI A;  2R7R A;  3SQN A;  4OIQ F;  1I3Q J;  2BVM A;  1DUX C;  1QFJ A;  2QSH X;  2F5F A;  1N06 A;  5FKO A;  3LAJ A;  2BVL A;  3ZIA A;  4RJL A;  1B8I A;  1RR8 C;  2BGI A;  2BV3 A;  3U9G A;  1OMI A;  2E5N A;  3OR1 C;  3GVA A;  4U87 A;  3E5X A;  3HL2 A;  4YCQ A;  4XOR A;  3ASO H;  3QFT A;  3ONY A;  1MBG A;  4QVJ A;  4BU2 A;  3DWL E;  1IUF A;  3H36 A;  2VUM J;  1KA8 A;  3K1N A;  3ABK H;  2YX4 A;  2E1R A;  1X4P A;  4P55 A;  4XNF A;  1G2H A;  2LYC A;  1HQC A;  1RIO H;  2V5I A;  3CCR I;  5HDK A;  1ZYR F;  1V0E A;  2JSC A;  1G3Y A;  3I59 B;  3LSH A;  4PJJ A;  3QP5 A;  1ETY A;  4II2 A;  4G6I A;  3IRR A;  1P7I A;  1NBM A;  3ZZU A;  4HEA 2;  2B9S A;  3VFZ A;  2VNI A;  1WWX A;  2EIL H;  2X9D A;  3TH0 A;  1BW5 A;  1SAX A;  1FBQ A;  1QNT A;  1QZE A;  2BYV E;  4I7H A;  2OCE A;  4AWX B;  3JRC A;  5EEG A;  3QPT A;  3I59 A;  4IVN A;  1SAN A;  2DA6 A;  2WB1 A;  4FX0 A;  5F04 A;  2DPD A;  1MMA A;  3PNY A;  3S2W A;  3VWB A;  4A3L J;  4PGG A;  4NDL A;  4LBW A;  1VQ9 B;  3T53 B;  5HNF A;  2DXI A;  3AG2 H;  4DIQ A;  4GYI A;  5DEQ A;  2BSP A;  2AO9 A;  3CP8 A;  1DPU A;  1Q81 D;  2IP2 A;  2M3A A;  4D0P A;  2NVY J;  1J5Y A;  4KT6 A;  1SD4 A;  5DCM B;  1JTX A;  1E79 A;  1UD6 A;  2YX7 A;  5IP6 A;  2E2H J;  1UHS A;  4RGR A;  1FZP B;  1VLO A;  3L2R A;  1TNT A;  1VZ0 A;  4QIW N;  3SLD A;  2TRT A;  4C2M J;  3R6K A;  3E7L A;  1S29 A;  5CLS A;  3SZT A;  5IT3 A;  5D5W B;  1R23 A;  3OYC A;  5K7Z A;  1XX5 A;  3ML3 A;  4WZE A;  1FJL A;  4XKW A;  1HKS A;  2HQN A;  2Z99 A;  4NC8 A;  1YIJ B;  1LEA A;  3IH4 A;  2ZNZ A;  2WJY A;  2E5Z A;  4NNJ A;  2XB5 A;  4M3E A;  3V8L A;  1FX0 A;  1H80 A;  3KLO A;  4YAL A;  5K7F A;  1NHA A;  3NWS A;  4B48 A;  3EUA A;  3LOC A;  1FND A;  1R4N B;  2QUF A;  4BHB A;  4BL0 B;  4YAU A;  2O3F A;  3JRH A;  4J01 A;  1Z7L A;  3CLQ A;  2JA8 J;  1U5T B;  2BW3 B;  2F4I A;  4YHB A;  4Y17 A;  4BE1 A;  2Q6L A;  2FMY A;  4RLF A;  2ZME C;  1HLV A;  1K6O A;  1P2F A;  1QA1 A;  2LFB A;  4DZJ A;  5J4V A;  3SYJ A;  4BY1 J;  1U5T A;  1YI2 I;  1YIT B;  2KIU A;  1GXP A;  2L5Q A;  1D2E A;  1W87 A;  3AVW A;  3CF2 A;  4KIG A;  4QPQ A;  1TTT A;  1ZG3 A;  1QH0 A;  5ILV A;  1FIP A;  1X2N A;  2VOP A;  5D5U B;  3WOD F;  2Y0S A;  3GFM A;  2ZME B;  4DOZ A;  3J81 K;  3MZY A; 
#chains in the Genus database with same CATH homology
 2NOJ B;  1D1A A;  4C2L A;  4E7S A;  1BN8 A;  2XZP A;  4BDZ A;  4B3G A;  5CKT A;  3CMM A;  1D1C A;  2CUZ A;  4OWR B;  2OV7 A;  2XDV A;  4LIU A;  4P22 A;  2VJ4 A;  3PNT A;  3S32 A;  4MR0 A;  3FPP A;  3WQZ A;  1NG7 A;  3HC7 A;  4DJA A;  2WZP P;  2W4S A;  1W36 D;  2JJ2 A;  2CFO A;  2UUZ A;  3VYT B;  2CV1 A;  2Z16 A;  4U49 A;  4BGD A;  1W36 C;  4LIT A;  3FHN A;  3H0D A;  2VJ5 A;  1DQU A;  2LY2 A;  4YZX A;  1K6Y A;  1OFM A;  3LSM A;  3AL0 C;  2CW7 A;  3OYE A;  2ZZF A;  1I8D A;  4XON A;  3K4B A;  4BEH B;  2PJR B;  3TBI A;  1BR4 A;  3H5N A;  2GK7 A;  2KZV A;  2LZJ A;  2NT9 A;  5HOO A;  1N75 A;  2MYS A;  4HSR A;  4NK6 A;  3S3N A;  1G8X A;  2E60 A;  2VPL A;  1OGO X;  4CUG A;  1WTH D;  2K5C A;  2DT6 A;  5KHD A;  3ZXS A;  2LY1 A;  3T9G A;  1BHE A;  1VF7 A;  2HLD A;  5HNH A;  3AL0 B;  4E7J A;  4XKV A;  4C9Y A;  2XF7 A;  4HIZ A;  3LFU A;  3K4L A;  1RWR A;  1JRG A;  4E7L A;  2IGM A;  2KL4 A;  3H35 A;  2JUG A;  2WY7 Q;  1WJF A;  3W3C A;  4ANJ A;  2IQ7 A;  1BLI A;  3K6G A;  2WAE A;  4BQQ A;  1D1B A;  2ZXI A;  2HVS A;  2D3L A;  2X1E A;  1WP6 A;  1IDK A;  3VDX A;  1G59 A;  5IK2 A;  2IXS A;  4HPQ A;  3A3G A;  3VYS B;  4KKS A;  2NTQ A;  2KHM A;  2WAF A;  4F92 B;  4U7B A;  2HPM A;  4YEJ A;  5FRM A;  4HG2 A;  4ASU A;  4CCL A;  1NG6 A;  5LFA A;  1D0Y A;  2EWE A;  2HDW A;  1T0F C;  1OB0 A;  3GQ7 A;  4XKC A;  5LD2 C;  3VSK A;  4W8Q A;  1XG2 A;  4P1W A;  3CJR B;  3H9J A;  3OYF A;  2W1O A;  3S3O A;  1HG8 A;  3B90 A;  4ZTJ A;  2VBK A;  3KX2 A;  2JSP A;  3L2W A;  1E43 A;  2X85 A;  3OL4 A;  4TSF A;  2R7O A;  4Z05 A;  4YEL A;  4Z06 A;  4E0F A;  1HZE A;  3FBI B;  3H5R A;  3CZ6 A;  3HUG B;  2M5S A;  3LMW A;  3VST A;  3OYJ A;  3L2U A;  1K28 D;  4BJ5 C;  1OGM X;  2LBF B;  2VQC A;  1IRX A;  2Z6B D;  2LG4 A;  4AYB A;  3C2H A;  2CS3 A;  1VJS A;  3G05 A;  2VQH A;  4TT3 A;  2VKD A;  2O5R A;  4XMY A;  2RNG A;  2XND A;  2R4G A;  3GRH A;  1ZEL A;  2D3N A;  2IGK A;  2ZSI B;  1HVX A;  4C30 A;  4ZDL A;  1GLN A;  2LC2 A;  3ONQ A;  3EPZ A;  4DK0 A;  2KLO A;  1PE9 A;  3LSK A;  2M0M A;  4BQN A;  1KTW A;  4D9J A;  4PSX A;  1UD8 A;  3DEE A;  1X4O A;  1UAA A;  2VJJ A;  1O8E A;  5C1E A;  2W6J A;  2V7Q A;  1GQ8 A;  2KRC A;  4RM3 A;  1X1C A;  2K3P A;  2X1C A;  3HPH A;  1TT0 A;  2R7W A;  4E6K G;  3ZCO A;  4XQF A;  3OS1 A;  4F91 B;  4BUP A;  4CCJ A;  4ZTF A;  1T5E A;  3PFY A;  5FL7 A;  3BCF A;  1Z21 A;  2GK6 A;  3B4N A;  3QYB A;  3OW7 A;  2E1M C;  4IKF A;  1DGR M;  2DJI A;  2M7B A;  3OEH A;  4KIT B;  2R7U A;  3OR2 C;  2IS2 A;  1PKV A;  3DQV C;  1X19 A;  1E1Q A;  1MMG A;  2BW3 A;  3TL4 X;  2HQA A;  2A5W A;  4KKU A;  1UG0 A;  3QOE A;  2UVF A;  4B47 A;  3BC8 A;  4OZZ A;  3W2A A;  4IZZ A;  3K4J A;  3MMY B;  4OAY A;  1N78 A;  1LDK B;  4ZDP A;  3L2V A;  2E1M B;  2KDO A;  2CV0 A;  1SFK A;  4G7X A;  4Y3O A;  4JMQ A;  4OAZ A;  4R79 A;  2X1D A;  3K10 A;  2DIE A;  2QXZ A;  1KON A;  2X8K A;  4NK8 A;  4XLE A;  2ZZQ A;  4B3X A;  3BG7 A;  4N4O B;  4PUS A;  2OUM A;  4Y4R A;  1Y6I A;  3LSG A;  3LMM A;  4BE2 A;  2FUG 2;  1SAU A;  2BOL A;  2Q2E B;  1DBO A;  2F5V A;  4Y33 A;  4RM2 A;  4YXW A;  1V5E A;  3HPG A;  3JUR A;  5TGT A;  2V4D A;  3HXL A;  2CV2 A;  1BOB A;  3OYD A;  3LL7 A;  1EA3 A;  2VKH A;  4FET A;  1QJV A;  1OLT A;  2Z8G A;  2R7Q A;  4E7Z A;  4KIS A;  2NTP A;  2L7K A;  1V5G A;  3J7A Y;  1R6R A;  3B8Y A;  1YX3 A;  3DLA A;  4J00 A;  3WWG A;  3RQ4 A;  2WSS A;  4XM3 A;  4D1Q A;  2GOX B;  4B43 A;  2IGO A;  3FDY A;  3U21 A;  4L8J A;  2VXD A;  4HRI A;  1BR1 A;  1MMD A;  3IUO A;  1V5F A;  1WJA A;  4B44 A;  4RMN A;  4CCN A;  1N77 A;  3QYF A;  4BQO A;  4BEH A;  3FKJ A;  2PJR A;  4NUB A;  3KEY A;  2JIZ A;  2Z2S B;  1JTA A;  2NTB A;  5FRO A;  2MD0 A;  2X6X A;  5KCM A;  2ZXH A;  2QKL B;  4P5O A;  3NWT A;  3DU5 A;  2ZZE A;  2L2O A;  4F3Q A;  3T51 B;  3QOD A;  4ITV A;  1O8H A;  1Z3X A;  2CMP A;  2F6C A;  2UWM A;  3BCA A;  3UR3 C;  2VQL A;  1Z3Y A;  2OC6 A;  1KCC A;  2HZD A;  2Q1Z B;  4IQ4 A;  2X6Y A;  3LNN A;  4OJO A;  2INV A;  2VL8 A;  3RCO A;  1O8K A;  4XOP A;  4OJL A;  1E3Z A;  4OJ5 A;  4XR6 A;  3I9V 2;  4X0G A;  3VSU A;  2NZM A;  2LRD A;  3K70 D;  3SEQ A;  4E4H A;  4BAC A;  3RSN A;  3K70 C;  2PEC A;  2KPM A;  4PFP A;  3H94 A;  3EQN A;  3JU4 A;  5AMV A;  2UV1 A;  1FMW A;  1T95 A;  2AQF A;  3D5L A;  1H8H A;  3OOU A;  3S93 A;  3DTE A;  2K9L A;  2V7F A;  4FAS D;  3OEE A;  2HVQ A;  4CZC A;  3VMV A;  1Y56 A;  2PMZ A;  4PK4 A;  2F1M A;  1WFX A;  4I84 A;  4XN0 A;  3EUH C;  1E1R A;  3OS0 A;  2XF6 A;  4AU7 A;  1HA8 A;  2E1B A;  4FXU A;  2V4J C;  1PLU A;  4OZY A;  1JI8 A;  3ZR8 X;  1OHH A;  2KRH A;  1TZL A;  3ZGK A;  3T56 B;  4YZQ A;  1ERD A;  4MLO A;  3BCB A;  2R7T A;  3A35 A;  3OYG A;  3QYE A;  3GQ8 A;  3OY9 A;  3SEZ A;  1P9Q C;  4XLA A;  4E7I A;  3DKY A;  4CCM A;  2QE7 A;  2CK3 A;  3KEW A;  2XZO A;  3ZRG A;  2PYG A;  3OYM A;  2L9S A;  3OS2 A;  2CW8 A;  4LG3 A;  1X1B A;  3A4C A;  2LBF A;  2A6T A;  3OIP A;  2DT7 B;  1KZL A;  1X1D A;  3W2V A;  4ZYA A;  2R9V A;  2O17 A;  3S3M A;  3HKZ A;  3HG9 A;  4EW9 A;  4BJT A;  1W9X A;  3EQO A;  2MFZ A;  1OR7 C;  4PFO A;  3MKY B;  1AIR A;  2M4G A;  4DNR B;  4NC7 A;  3OYA A;  3OFN A;  4MXN A;  1O8L A;  2X6W A;  2IS6 A;  2XF5 A;  1NHC A;  2WAQ A;  1UEL B;  3ZPN A;  3RTR A;  1QHH D;  2W00 A;  4G6T B;  4XLC A;  3S8P A;  3OAA A;  4URR A;  4CCK A;  4BE0 A;  4ZJZ A;  1O8G A;  1VLY A;  2M4K A;  4AVZ A;  3AKZ A;  3OYN A;  4PJM A;  2XOK A;  2NST A;  2HNH A;  3H9Q A;  1BPL A;  3DU6 A;  4F93 B;  4IQJ A;  4Z1M A;  1OOC A;  3OYK A;  2VLA A;  4DBR A;  2INU A;  2DCE A;  3BG6 A;  4PJL A;  2WY8 Q;  1QHG A;  3DDY A;  5CQE A;  4CSW A;  2NT6 A;  4YZ0 A;  1YX5 A;  4F55 A;  3EUK L;  3OYL A;  4CH7 A;  1FMV A;  2L9N A;  1COW A;  1UD5 A;  4Z03 A;  1O88 A;  3VYU B;  2GJP A;  2RRE A;  2XSJ C;  2ZTN A;  1MNE A;  3OIQ A;  1MAB A;  3OYH A;  2X53 S;  1RU4 A;  3DTK A;  2QY1 A;  1D0Z A;  3VSV A;  1QCX A;  2VBE A;  3I3L A;  2X3H A;  4DBQ A;  3A1Y A;  4N4N B;  4JQF A;  3BLY A;  3OYB A;  3FY3 A;  2JA2 A;  3RPU D;  3W2W A;  3A2K A;  4U4B A;  3PL8 A;  2XC7 A;  1OFL A;  3H5A A;  3VR6 A;  2WA0 A;  2K9M A;  4XKB A;  4JOM A;  3V42 A;  1WJE A;  3DPT A;  3SDB A;  3TMO A;  4BJ6 C;  4E7H A;  2JVH A;  4CA0 A;  1E3X A;  3ZSC A;  4PSW A;  3H9G A;  2RQQ A;  3OYI A;  2V6E A;  4TKO B;  4LIV A;  2Z1D A;  3K4N A;  1WJD A;  3FBN B;  2HU9 A;  5HLT A;  4OJ6 A;  4F52 A;  3KYL A;  2WPD A;  5KNL A;  1BMF A;  3GVL A;  2VQG A;  1X0C A;  2KVO A;  2ZZG A;  2ELJ A;  3VSL A;  2HVR A;  4GQN A;  3ZQQ A;  1LFP A;  1I18 A;  2JVG A;  3GBG A;  4XLF A;  4XLH A;  4C2U A;  2WAD A;  1UD3 A;  1W0J A;  3DPL C;  1X1A A;  2W82 A;  3D5R C;  2CH0 A;  3PNV A;  3DTI A;  2XGJ A;  3K4K A;  4H4K C;  4C2T A;  3GQA A;  1D0X A;  1WJ5 A;  2MC4 A;  3GQB A;  2LOO A;  1LVK A;  1WJB A;  3HAG A;  3IAM 2;  2WJV A;  3K4C A;  4DGW B;  5DN6 A;  2MAB A;  1NRK A;  1RMG A;  1J09 A;  2VAS A;  2JJ1 A;  4YZA A;  4DOZ A;  2VXZ A;  2IGN A;  4IX7 A;  4B3F X;  1LKX A;  3LSI A;  1DBG A;  5JHF A;  2GJK A;  2V31 A;  5HVQ C;  4QPO A;  2R7V A;  2I8D A;  3D5S C;  1VBL A;  1EE6 A;  2CUJ A;  2KP6 A;  1WMR A;  2W7N A;  1H8E A;  1PYV A;  3SZG A;  3C2G A;  2XAU A;  5CPR B;  4BXF A;  3CP2 A;  4DNT B;  3CES A;  4G7W A;  1O8I A;  4GRI A;  2R7R A;  2F43 A;  2W6I A;  2BVM A;  1MMN A;  2GOM A;  2QX3 A;  2R7X A;  3M8J A;  2V26 A;  1PXZ A;  2KQR A;  4XD7 A;  2BVL A;  5CQG A;  3ZIA A;  2VIX A;  3GVJ A;  2O0W A;  4ZDO A;  3PSF A;  2E5N A;  1E0E A;  5C1C A;  3OR1 C;  2P0W A;  2ZSH B;  4U87 A;  3DPU A;  3HL2 A;  4XOR A;  1KMH A;  3E0J B;  2WBM A;  2V9K A;  2UVE A;  1MW7 A;  4II3 A;  4BU2 A;  3HOS A;  1EFR A;  3DWL E;  3OOC A;  1O8M A;  4KJZ A;  1U0J A;  1IDJ A;  1O8J A;  1YE9 A;  1X4P A;  4XNF A;  3UNG C;  2LYC A;  3F9K A;  4XOT A;  2VBM A;  4KKT A;  2HPI A;  4HNU A;  1V0E A;  1PJR A;  3LSH A;  4PJJ A;  4G6I A;  4II2 A;  1NBM A;  4HWV A;  4HEA 2;  3MD2 A;  4W8S A;  1UD4 A;  1DP3 A;  2VB6 A;  4XN3 A;  3N05 A;  2AQE A;  3OPO A;  2M7A A;  4NQW B;  4XL9 A;  3NE5 B;  3CJQ B;  3AFH A;  3MKW B;  4W8T A;  4E7K A;  2WB1 A;  4HST A;  3BCD A;  3IAS 2;  1MMA A;  3PNY A;  3K4M A;  3VWB A;  1V0F A;  3PUB A;  3G2B A;  4BS9 A;  2O1D A;  1MND A;  3GQ9 A;  1DGW Y;  3T53 B;  2XZL A;  2QKM B;  5HNF A;  2DXI A;  2IS1 A;  1IA5 A;  4DIQ A;  3BC9 A;  4PJN A;  2BSP A;  3CP8 A;  4HNT A;  3MKZ A;  2M3A A;  4KT6 A;  1SKY B;  1UD6 A;  1E79 A;  3VMW A;  3ZPP A;  1W0K A;  3L2R A;  3DKX A;  1VZ0 A;  3OL3 A;  4CCO A;  3HOT A;  3OWT A;  1QU3 A;  4W8R A;  4DK1 A;  2X51 A;  2ZTG A;  3OYC A;  3L2Q A;  3SUC A;  2ODL A;  4XKW A;  1IB4 A;  3FKS A;  3OMY A;  4YRV A;  5FRN A;  2IS4 A;  4NC8 A;  1CZF A;  4EAT A;  4UZU A;  2WJY A;  3UW0 A;  2E5Z A;  4NNJ A;  2R7S A;  2O0V A;  1KCD A;  1UD2 A;  2KMU A;  1FX0 A;  1H80 A;  1S9H A;  4RLQ A;  3NWS A;  4B48 A;  3EUA A;  3PJR A;  2O04 A;  2NSP A;  2LH9 A;  4BL0 B;  3OE7 A;  4J01 A;  1Z7L A;  3PSI A;  2PYH A;  1O8D A;  2BW3 B;  3KRG A;  2F4I A;  1WPC A;  5HKK A;  2VJI A;  3M1C A;  3BH4 A;  3VYR B;  3A3B A;  5CDF A;  4BE1 A;  4RLF A;  4PMH A;  1K5C A;  1BR2 A;  3SYT A;  2GJR A;  4OJP A;  2L5Q A;  2V1N A;  3CF2 A;  4ZC3 A;  4QPQ A;  3GVK A;  2ZFU A;  4BDY A;  1AA7 A;  1WJC A;  3E1S A;  2Y0S A;  2JDI A;  1O8F A;  3IP4 B;  2LRE A;  2DOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...