4XKWA

Tailspike protein mutant d339n of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 233
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkwA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkwA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkwA02
1NHCA 3UW0A 1O8EA 1QJVA 4XOTA 4XMYA 1BN8A 4Z06A 2NTQA 1OOCA 1X0CA 4C2LA 1OFLA 3GQ9A 1O8GA 4OJPA 4EW9A 4U4BA 3WWGA 4YELA 3VSTA 4OZZA 2O17A 5C1CA 3KRGA 1KCCA 1IB4A 2NTPA 4XNFA 4XKVA 4XLCA 4PMHA 1HG8A 2O0WA 3LMWA 2NSTA 1CZFA 5C1EA 3EQNA 4NK6A 2X6WA 4OJ5A 3GQAA 4YZAA 3SUCA 1H80A 2VJJA 1IDKA 4W8RA 1O8MA 1OGOX 2VBKA 3VMVA 2INVA 2IQ7A 4XL9A 2NZMA 4OJ6A 1IDJA 4XM3A 1AIRA 4XLAA 1O8HA 4YZXA 4W8TA 2O1DA 3JURA 4U49A 1DBOA 1K5CA 1GQ8A 3ZSCA 3EQOA 1O8FA 2UVEA 3VSUA 2NT9A 4OJOA 4Z05A 1IA5A 2X85A 1O8JA 4MR0A 2O0VA 3GRHA 2Z8GA 4YZ0A 1RWRA 1WMRA 2QX3A 4XR6A 4XLHA 4YZQA 1O8LA 1DBGA 2X6YA 2ODLA 3B90A 4OJLA 3ZPPA 1JRGA 1RU4A 4XKWA 1O8KA 2EWEA 2QXZA 4XN3A 1O88A 1OFMA 2INUA 2PECA 1O8IA 4XQFA 2PYHA 4YEJA 3GQ8A 3FY3A 4NK8A 3GQ7A 2NT6A 2BSPA 2VJIA 1PLUA 4XORA 4XN0A 2O04A 2NSPA 3VMWA 3B8YA 2VBEA 4HWVA 1KTWA 2UVFA 4W8QA 1BHEA 4W8SA 1QCXA 2NTBA 4Z03A 1O8DA 1VBLA 4XLEA 4XOPA 1PXZA 2PYGA 4XLFA 2VBMA 1XG2A 4AVZA 1OGMX 4I84A 2X3HA 5AMVA 3T9GA 1EE6A 1PE9A 1JTAA 3B4NA 4URRA 1KCDA 4MXNA 4XONA 3VSVA 4OZYA 1RMGA 2X6XA 2QY1A
chains in the Genus database with same CATH superfamily
4Y3OA 1JT0A 2Y0SN 2B63J 4S05A 1BJKA 3DBRB 2XC1A 5LGUA 3BDDA 3CDIA 2WADA 4N9HA 1R6RA 3CCLB 1BN8A 1WOSA 1OFLA 2WPDA 3LJYA 2HVRA 3BQYA 4RCYA 3IRRA 2XAQA 2HOSA 5GTIC 1GLNA 1G7RA 4Y13A 1QFJA 1W0JA 4YALA 1TYVA 1FSHA 3A3GA 3E1SA 1Z21A 5D6FA 2ZNZA 3ZIAA 1V5FA 3U2RA 3S3MA 1OMIA 3LSKA 2K3FA 2K40A 4HAMA 3CCVB 2CF4A 1MBEA 4TT3A 1VQKB 4BY1J 2VNKA 1ON2A 1NJID 2LMDA 2GK7A 3S16J 2KKOA 1R00A 2X6WA 1JKOC 1QO0D 3HOUJ 2O61A 1VQMI 3M1CA 3PO2J 2L02A 1T56A 3BR1A 1FX0A 3PUBA 2A68F 2DTZA 2A6TA 2I1LA 2NZMA 3SJMA 3T5XA 1EWYA 5LHHA 2HKXA 3ONYA 1TNSA 1FMWA 3OZVA 1IN8A 1QVGB 1G2HA 2E1BA 4HV6A 4RLZA 1J0RA 2CBXA 1MJBA 3Q0UA 3MFKA 1N25A 2W00A 2B7BA 1EKEA 1YJNI 2YWGA 1S5LC 2VB6A 2NT9A 1W1WE 2VOPA 5DM7F 3CTAA 3FXUA 1APLC 3GTJJ 1NB9A 1VQ7B 5D5VB 3FMQA 1TSPA 4UAJA 2K27A 3H0GJ 1FWZA 1IGNA 4ROXA 5DD4A 4EEFG 1O8LA 2KISA 2DT7B 1WWXA 1H8AC 4OIPF 4E7IA 1JB9A 4C2UA 2Y75A 2HQRA 3L2QA 1K83J 3F3XA 2DMQA 3ZMDA 1Z05A 3WYAA 2CQKA 2VBTA 3JU4A 1T6SA 1YS7A 4I0AA 2LD5A 1EJ9A 2Z9OA 2IS1A 2PYHA 2HS5A 3PJRA 2A6EF 1SMTA 4KKTA 2L01A 2H09A 4NQWB 5GADJ 1Y1WJ 2XAJA 1BOAA 3OYAA 3GSIA 3B8YA 2DOFA 1IO2A 2WB1N 4K2EA 5TISC 5D4RA 3L2UA 2VBEA 3K4NA 3SYTA 5JLWA 2L7MP 2JPBA 4TMZA 3PQJA 5BQTA 1P2FA 3KZYA 4P96A 3TGNA 2HEOA 1X1CA 2L9NA 2LTPA 3TO9A 1MKMA 1V54H 2QENA 4XLPF 3BH4A 3A8IA 4WZTA 4TMTA 2ACJA 3K2ZA 1VF9A 3MZHA 2ELJA 1Z7LA 4DIQA 4MEXF 3AVXA 1OYIA 2H6CA 2MYSA 4I98B 4H0EA 4UV8A 4QVJA 3ROUA 2QA4I 5F0FA 3OZWA 5H5JA 2C77A 3CCMB 5FNZA 4IHWA 5C3EJ 5GP9A 1E3PA 4G6QA 1D8KA 2QZAA 2WAFA 3L7WA 2G7HA 3HZJA 1NHCA 3S93A 4MYTA 3RSNA 2OBPA 4Q48A 2QBYA 1YJWB 4BY7J 1RR7A 3FXQA 2CW7A 2P3MA 4FK8A 3IH2A 3WTTC 3BG9A 4Q5SF 4WXCA 1YQAA 4YAUA 4M1KA 5TV2A 4GGGA 2YPRA 4HF2A 2VBXA 2CU7A 1PDNC 5J3LA 2IW5A 2ZFUA 1VQ5I 5TGTA 4DK1A 3W2FA 5DEQA 2BGIA 3GYHX 3RJPA 2MLGA 3EQLF 3OYEA 3AG1H 3RTRA 4XLCA 4CDGA 5LRSA 4ZGNB 1EP3B 3ZCOA 2VFOA 1FOWA 2HZTA 4ZCMA 4B4CA 4UB8C 1R23A 3G3ZA 1WFXA 2F4OB 4QFMA 1QRBA 2LRDA 1ACIA 3GQAA 4BDYA 1YI2I 2R7SA 3Q0WA 4UZUA 2JWTA 4G8XA 2F5VA 2PMUA 3Q9SA 4JX6A 4LITA 4G5GA 3A35A 4P1VA 1R5OA 1O7FA 4KMUX 4JBAA 2W4SA 3CW2A 1KK1A 3IAS2 1D3YA 4A3JJ 1MBGA 4L5EA 4AIDA 2VE9A 1VTNC 4I09A 2XIGA 3I54A 3QU6A 4LG0A 1X19A 2Y2ZA 2GXGA 3I64A 3L9FA 4F7ZA 4KITB 5HVQC 4HNTA 2GREA 3OKXA 2V1UA 4U49A 3HDDA 1E63A 3BR5A 4RM2A 1DGRM 4RM0A 4A0XA 1FBQA 4Z05A 3B82A 4OPSA 2H1LA 3FXOA 2V7UA 2E19A 4MO7A 3OP1A 3TH0A 2OQGA 3CF5F 2OC6A 2ZITA 2A69F 2F5EA 2MC4A 3RQ4A 2RQQA 3ISPA 3LFKA 3V8JA 1TP4A 1FRNA 3T0YA 2BYVE 4I01A 3N4MA 1ENHA 4X6AJ 3AAFA 1MABA 1H88C 3L2WA 2DFIA 2CK3A 3C7JA 2J5OA 2PQ8A 4IHYA 4LIVA 2F6CA 1E64A 3LSPA 2KIUA 1VLYA 2IGOA 1JHHA 4MQ9F 3PO3J 2QWWA 3DKWA 1WRJA 2DQLA 1ZR2A 3GW2A 5FD6A 3BY2A 2DDBA 1MMNA 5AN9A 3SZGA 1IN4A 5AIQA 4KN4X 2XT4A 3QPTA 4RB1A 3K4JA 1YX5A 2HYFA 2QM3A 2Y9ZA 4ACBA 2HNHA 3HPGA 3CCJI 1WXRA 5E3OA 3M4OJ 5IT9Z 3W5HA 2WSSA 2WJYA 1FOXA 4XLEA 2YX4A 4EJVA 4AM3A 2ZL6A 2VASA 2D74A 4DBRA 4YFNF 1Z77A 4ZGQB 2B0RA 1B9NA 3CMYA 5DUIA 2IA2A 2RV8A 2EV5A 3FBNB 2LFBA 4X0CA 1O57A 5ILVA 2KIMA 3FBIB 2PLYA 5HS7A 3OS0A 1TW2A 2BPOA 1B59A 5L3CA 3J7YJ 3KLOA 3I59A 4NDLA 3WHBA 2KDZA 2HQAA 4RD1A 2DA3A 4RGUA 2D2WA 1IXSB 2L54A 3BR0A 1KTVA 2R9VA 4XOTA 1HW1A 3LVBA 3ZMUA 4XMYA 2KJCA 1X4OA 2ZCWA 1MRZA 1TYUA 2UXNA 3ABMH 3PNYA 2H8WA 4MHGA 3VYUB 3EUHC 2KMUA 3WHCA 1ZGJA 4ZYHA 5LEKA 5M5YJ 1L3LA 3S32A 2QQ8A 1K4SA 3VNUA 1DPRA 4HEA2 1UMKA 3K69A 5CVIA 1TW3A 2M4GA 1D5YA 2P6SA 4H9GA 5FFZA 3BTLA 4S04A 4Q47A 2D45A 1HKTA 4JP0A 1XB4A 2NTPA 2BGJA 1U0JA 1Z0XA 4X1EA 2UWMA 3PNVA 4IOAF 3BQJA 2GJKA 2KRCA 1Q86D 5HLGA 4NK6A 3BZ6A 3KP5A 4XKBA 4G9YA 4BKXA 3S2HJ 1WTHD 5E6TA 1I39A 3RKXA 1AIPA 1D2EA 3UKGA 4X7EA 4YG2F 2K5CA 4Y7CA 5JVTA 1IC8A 4MLOA 2B7CA 3H5RA 5IYDJ 3GO5A 3H35A 2ESHA 3GCMA 1GXQA 3R6SA 5JMCB 2O8XA 5HZBA 4IHXA 2Y31A 3WBJA 4HX7A 3G1MA 1KU9A 2MLKA 3F8NA 3IUOA 1O8HA 1DUXC 4NUBA 3FWEA 3JQQA 2O1DA 4G7OF 3M8EA 3T1BA 5ICEA 2CSOA 2DCEA 4ENJA 4RD0A 4YEIA 1AU7A 1XD7A 3I55I 1H8HA 4BGDA 2ZZQA 1JGSA 4L0ZB 5TRDA 1ZLJA 2PEXA 2K85A 2LYCA 3WG7H 2XTXA 3I1FA 4Q7JB 4LBVA 3V7SA 1KQ5A 2MSYA 1ZRFA 3B6CA 2ZZEA 4FT8A 3FXRA 2KLOA 1JXSA 2X6YA 1TWFJ 2QSFX 2Z1DA 2CUJA 2DU9A 2EZIA 3H3ZA 2O6WA 1O8KA 5J40A 4HDVA 3H36A 2D3NA 3LSIA 2LNBA 5M5WJ 3HBLA 3HUGA 1U3EM 1SFOJ 3CZ6A 3PVDA 4BQQA 2G7UA 4HX8A 2X8KA 5IK2A 3GQ8A 3JRBA 1T0FA 2RC4A 4MIMA 3U6BA 3BR6A 2DJNA 2P6TA 2R7XA 2CQQA 2ZZGA 2ZL7A 3ZZ0A 2JIZA 3ZC3A 3LMMA 4Y52J 4JRAC 1O3RA 2WAQA 1UG0A 5L3GA 1L1IA 2EFQA 2E2HJ 3VMWA 4LB5A 2E36A 3HXLA 5HS8A 1ZAOA 3PSZA 1PVEA 2E7WA 4HWVA 5E8IA 3G71B 1B4AA 3OYHA 3CO6C 3ML6A 2CQ7A 2ICWG 3F8MA 4CCMA 1FZPB 1FNMA 2B5OA 3MD2A 2MG4A 1FPQA 2M2EA 1K6YA 4G6TB 2CYYA 3EUHA 4R8HA 1QGPA 4AVZA 3F72A 1WOOA 2DA2A 2FUG2 4RS8A 1PE9A 1KK0A 1VNDA 2HXIA 2O8KA 4ESFA 2DOAA 2NS0A 2J7KA 2QQ9A 3B4NA 1QA3A 3ML3A 1SFKA 5FKOA 1OCZH 2Q1ZB 3KE2A 4OZYA 2QY1A 2L9SA 5FJ8J 2D5VA 1E3OC 1S7AA 2IA1A 3NAWA 3QOPA 1Z6RA 5E8GA 2K9LA 2LREA 2VFQA 1NK3P 2AQFA 3ZOBA 4I99C 2A3SA 5D8KB 2W57A 2DK5A 3Q38A 2XZLA 1SANA 5EDNA 3O8HA 4EJWA 2BOLA 1BW6A 4CZCA 1TZLA 5EF6A 3C2HA 4J00A 4KT6A 2M0CA 4MNUA 2XPVA 1OYWA 2O17A 4A6EA 3CCJB 3SDGA 4M71A 1HQCA 2VC1A 1BC8C 4QWQA 2NRAC 4CCOA 3T51B 3CCQB 3GFLA 1P7IA 2ZNYA 2XSDC 1GO2A 1T98A 3D5RC 3PSIA 1NB0A 1OGIA 2MH2A 5LFAA 2NSTA 2RREA 2VT2A 2TRTA 3JSOA 3GTLJ 1JA0A 1QGYA 2CW5A 3HSFA 3GFIA 2W1OA 4MTDA 1HW5A 1U5TB 3EUKL 1OGJA 4N9IA 5H20A 3OYGA 2W7NA 3CC2I 2GK6A 3WXMA 3GBGA 1TLLA 4YAWA 1LPQA 3C18A 2BN4A 4Z4ZA 3FDYA 4A5MA 3PA1A 4Z4VA 3O2PE 1GV5A 2VNJA 4AIKA 3BR2A 3JRIA 3BPVA 4PJMA 1X1PA 1JJ2B 2WC2A 2ZSIB 3OYLA 2HDWA 3ABUA 1YTYA 5HLHA 2VKEA 2VBYA 4P6YA 3PIOF 2GOMA 5CDFA 2XGJA 2WJVA 3F21A 4HBLA 3WTZA 2M1BA 2X0KA 4UV9A 3ECHA 3RYRA 2BSAA 3A0BC 1OCPA 4IVNA 1UCRA 2CQXA 2FOWA 3DPLC 1YLOA 3H94A 2CRVA 1VQOB 4ZZLA 4V19K 1OFDA 2QZ8A 4YZ0A 4CYDA 3DP7A 1X4PA 4IOCF 3L2VA 4LLNA 2ZXHA 4GYGA 3PNTA 4FE7A 3F8CA 5D8LB 3QYBA 4BXXJ 3DEUA 3HL2A 1FBSA 3KZZA 4CSWA 2JVGA 3LSTA 2VBUA 1WJ5A 4WXHA 4P6VF 3CD6B 1XS9A 4LMYA 1H85A 2LY9A 3A3BA 3B8HA 1EA0A 5BPIA 4KH3A 1PP8F 2HXOA 4XRFA 1FYMA 3LSGA 2BSPA 4Z6YA 4HE5A 2DI3A 1KQSB 4FISA 2C2WA 1U5TC 2NSPA 3CUQB 5IP9J 1LE8A 3QODA 2YU9J 2FSWA 1U2RA 3ISXA 5A88A 1R71A 5GV8A 1HSJA 3CJQB 1WDTA 4PABA 5HODA 5DD8A 1VQ5B 4W8QA 4E7SA 4NCNA 1GV2A 5IP6A 2QUFA 3D1NI 2QGUA 4A0ZA 1SC7A 4XSXF 1NHAA 4E70A 1IRXA 1R58A 4XLFA 4GCVA 4P3IA 1AKHB 2VBMA 1MBFA 5IOZA 1VQLB 2ETHA 3IRQA 2DCUA 1VQPI 2QDXA 3G1OA 3FX3A 2RNJA 4V2FA 4RD4A 3HSEA 2V4DA 2QBYB 3PSFA 4RAGA 3MMPA 3M1EA 5LHIA 2IJLA 4N3GA 5BPDA 5GAEJ 1OR7C 2M4KA 2L9VA 1BA5A 3L2RA 1QJVA 1GAWA 3LNQA 1VQPB 1GUUA 2BY0A 1OOCA 4RD2A 2DBBA 4BQNA 4FXUA 4BDZA 1OB5A 2VN2A 3UR3C 1RQPA 3K4LA 3O3KA 3WWGA 3IL2A 3GEZA 2UZKA 1WI9A 3BG7A 1A04A 3OYFA 3PFIA 3P9KA 2EA4A 2NS8A 4UHTA 4AC9A 3C2GA 4XNFA 1IRFA 4XKVA 3ASRA 3W2AA 4B4DA 1TL8A 2RVCA 3ZQFA 2YX7A 3OYBA 2R92J 4KA4A 2DDAA 1Y1VJ 2GQQA 2EK5A 1V5GA 2VLAA 1DG1G 1M1KD 2IAIA 3PETA 4WWCA 3N90A 3FKIJ 1V0EA 3BC9A 2VJJA 3QFTA 1IDKA 2Q6IA 4W8RA 2ZJPF 4HLYA 1YFHA 1HLVA 1XDUA 3CMEI 2R7ZJ 4XICA 1BJAA 2WAQN 4HF0A 5DNSA 1QRYA 1Q1VA 3V7RA 4EM1A 2EFNA 3VSLA 5KSWB 4AF7A 5FLXZ 2ELHA 3HJEA 4P1WA 4IJAA 3BJAA 1QNTA 2KPMA 1SVLA 2E1MB 2NOJB 4QLCU 3MKZA 4XLAA 1OCRH 1UD5A 4MFDA 2H8RA 2FD5A 3WGHA 3OR1C 2D3LA 1S29A 3NWSA 2ISZA 5B6IA 2BEOA 3DEEA 1D5VA 1O8FA 1IA5A 2F1LA 4CA0A 2QSGX 3GLLA 2ZXIA 3WNBA 1MMAA 2GZWA 4C3JJ 4BHBA 2E5NA 3LSJA 2VBVA 3OE7A 2OAZA 2JK3A 5L3DA 4X05A 2Z8GA 1QA2A 3K6GA 3CCQI 4ZV4A 3HRSA 1LUJB 2WA0A 4M9ZA 3NWTA 1O3SA 1HKSA 2XF5A 1TWGJ 4HF1A 1IXCA 1WOPA 1YITB 4Y17A 2DOEA 9ANTA 1WCMJ 5C44J 3FHZA 5E1XA 1X3ZB 2CFXA 1F36A 3GVAA 3OJXA 5EZGA 2DYIA 2HTSA 1GT0C 1IAWA 3IWZA 2DAOA 2KDOA 2VI6A 4QHYA 4BXUA 2NNNA 1Y39A 1GHCA 3U6KA 4B47A 1F20A 2ZBUA 2CV0A 1MZBA 5FFXA 1VQ8B 4A93J 4NNJA 1J2XA 3F8BA 2STWA 4A3GJ 4G12A 3ZRGA 3LQ6A 2L3DA 4YIRX 4M3DA 3ZBUA 1HF0A 1W0TA 4AD9A 4ZYEA 2HOEA 3COAC 1M1EB 4BJ5C 4YAOA 2RQPA 2HKOA 1D8TA 2EFGA 1TT0A 3HB9A 2JA6J 5HDKA 1T38A 2PYGA 4M73A 1KQ9A 2X1CA 5M5XJ 3E5XA 1X2MA 1OB2A 5H6QA 1VJSA 4LB6B 1OISA 3N6ZA 2JJ2A 2EH3A 2EFPA 2JPCA 2VQGA 4U88A 1R49A 3CCUB 1FOKA 2H94A 1ZQ3P 3U1KA 4CGZA 4X7DA 1COWA 4DNRB 3K9TA 1LEAA 4PAAA 2IPQX 2XZPA 4FWTA 1W7PD 1GAQA 1RRJA 1W36C 1KCDA 3ULQB 3BJOA 4MXNA 5J1UA 2VQHA 3PUFA 3EETA 3ASTA 4IX7A 1EFRA 1QH0A 2HOTA 3HYIA 3UW0A 3CMMA 5DCMA 1XE1A 4ENMA 1S72I 1PYVA 4P55A 3LA7A 4KFCA 1E2XA 3GQ9A 3HRTA 1P7JA 3CC7I 2HDDA 1VF7A 2QCOA 4YELA 1LVAA 1FTZA 2PMZA 3ZN1A 3F22A 4D5CA 1JNYA 1LFPA 1Z6TA 2XV4S 1W0KA 1GVDA 1A6IA 5F4MA 2BW3A 4B8XA 3R6JA 4PC1A 2F5CA 2M7AA 5DCFA 5LRRA 3RIRA 2OCCH 3CC4B 1GDTA 4CYCB 2E7XA 5TR9A 3CP2A 3JRFA 3HOTA 2KZVA 1BR1A 1WGXA 2DFHA 3J80K 4OJ5A 2EFOA 1LFBA 3PUMA 3RZOJ 4EJOA 3CB4A 3OZUA 5ERIA 1UHSA 2COBA 3MZ8A 3JRDA 1OCCH 2R7VA 4P5OA 1D1BA 2HI3A 5K1YA 3VMVA 1EP1B 2XROA 2V7QA 1ZGWA 4NC6A 4MFEA 1LJ9A 1AIRA 2HOAA 4OIQF 2Z2SB 1QFYA 1QRCA 2K3PA 2H27A 1S8NA 1VI0A 2P8TA 3DF8A 1VZ0A 2VT3A 1OFEA 2XF7A 1PJ7A 2Y48A 1AKHA 1HXDA 2O9LA 1SM4A 3P9IA 3WQZA 2K9SA 1SAXA 4UUVA 3E0JB 5IYBJ 1N78A 2V1XA 2NS7A 3EDPA 1D0ZA 2HU9A 3MKLA 2NXNB 5JR3A 5LBQA 3HTSB 3RKWA 4IRIA 1DBGA 2XPUA 1EV7A 3DXJF 4W1UA 1BLIA 1O3TA 4HE6A 3HOSA 2VC0A 2IXSA 5CKTA 2D1HA 1QUFA 2V79A 5F64A 1YW8A 4RAFA 5FKMA 3BCDA 2STTA 2QQAA 4ESJA 3L2CA 3B78A 3CMAI 2OTJI 3FMSA 1XCBA 2B0LA 2HFHA 3DU6A 3KEQA 1UD2A 1VHOA 1J7KA 3GF2A 4XN0A 3JCUC 2M30A 3E97A 3P5JA 1D1AA 3TDUC 4A3LJ 4OWRB 2F5DA 1ZUNB 4JQFA 3OW2B 2QVOA 3DBHB 1G3TA 1ZK8A 5TY0A 2KRFA 3A1PA 4D9JA 4X7CA 4V2GA 4G6DA 2EIJH 5TJJA 2GJPA 4C43A 2DYSH 3P9CA 4B3AA 3JAMZ 2RC6A 2OJED 1TWCJ 3FK6A 3SEQA 1E43A 2KIQA 3M3YJ 5K5RA 2LR8A 4EQQA 1QG0A 3R61A 4IO9F 2VQCA 3E7LA 1YIJB 4OOVA 4GQNA 2HVSA 2BV6A 4Z4SA 1OHHA 1MBKA 4L8JA 1FIPA 1XSXA 2DMPA 3IHUA 2FQ3A 2KP6A 5EMNA 2IBDA 4IPAA 2CJJA 4BL0B 4DW6A 4XKCA 5FB2A 2IRFG 4BEHA 3GTKJ 3JQRA 4X06A 3ZQQA 2XGDA 4XONA 1D0YA 4DK0A 2X6XA 3IH3A 2M45A 3K0LA 5FLVA 5F1JA 3OIQA 4WWVA 1WH7A 4DYQA 4DOZA 4BAYA 5GTHC 1MNDA 3JX8A 4XIDA 3BPXA 4Z4UA 3BZKA 4ZCLA 2BXYA 4EGZA 2K4JA 5J6XA 4CHUA 1WJCA 1G3WA 2V9KA 2UUZA 1XDSA 1E1RA 3OOCA 1USSA 2TCTA 4UVCA 4C3HJ 1I50J 1KCCA 2BE5F 1XGNA 1W5CC 3K2AA 2GM4A 1ETKA 2XHKA 1O7LA 2FBKA 3V4GA 1HG8A 1W7PA 3LL7A 2R7DA 3LMWA 5A89A 2XRLA 1G6NA 3PL8A 5J8CA 1ERDA 1K28D 1HW2A 2Q2EB 2DPUA 2D1VA 1N08A 3NB2A 1FJLA 2JMWA 4YAFA 4P22A 3RPUD 1GVJA 1WJFA 1ONVA 3V42A 4AU7A 1ULYA 2PLFA 4PUSA 1KD1D 1YJNB 1IRGA 3BP8A 3KL9A 1V55H 3ELKA 4Z4WA 4XK4A 5IP7J 3Q6QA 4KISA 1XGSA 2LF8A 1BN5A 5C4XJ 1W34A 3OWTA 3I59B 1B2RA 3RDIA 3FXJA 1S4MA 2VFMA 2XGXA 5HNHA 4WX9A 3S3OA 2IGKA 1J09A 3RIQA 1QZYA 3CCRI 4QSHA 1OKRA 3CJNA 3RYPA 4CO8A 2QN6A 3K10A 3GTMJ 1U9NA 1FP2A 1LNWA 3KP7A 1MJAA 1RWRA 2FU4A 3DKXA 4M3FA 1MBHA 2ZJQF 3HOWJ 4MYUA 1BPLA 2XZOA 1I3QJ 5EGOB 3JR9A 4UUSB 3ZQ7A 1MJ9A 2FQ4A 3BJ6A 1TTYA 1PJRA 1YW9A 4WF2A 2MW8A 4F7DA 3I56B 1SD4A 3I0TA 4KUMA 5KCMA 1UB9A 2R7UA 3GMEA 3QP5A 5ICGA 4UUSA 4JX5A 4OIRF 3E1YE 1Q7YD 4YRVA 3GVKA 1QQIA 2VBWA 4XRMA 3CLQA 4F52A 3P26A 1I27A 1JGGA 2OYNA 3I56I 2GOXB 1QHGA 2Q0OA 4M9SA 1SD5A 3RPQA 4G1BA 4AYBA 2PFBA 2VKVA 3KEYA 4ZC3A 2CWEA 3LO8A 3CQZJ 5CLSA 5LGNA 5LMZA 2XAHA 1FX7A 2MFZA 2PBIA 1KTWA 2WV1A 4QTRA 3LQEA 1UMQA 5J4VA 3J7AY 1RUOA 2ZZFA 3GVLA 3D26A 1ZG1A 1N75A 1UHWA 1WJBA 1IHMA 4BNCA 1PXZA 1ETWA 2CNDA 3OSFA 1KMHA 2A5WA 1XG2A 3U2QA 2W48A 3FISA 4A3MJ 1DP7P 4ZTJA 5LGTA 2JSPA 1CF7B 2ESNA 2X3HA 3KETA 2ZXJA 2RAEA 2V7WA 1YJWI 1I7PA 3CDLA 1JUSA 3ZQIA 3ZN0A 2DA1A 2R6HA 4FHTA 4KMFA 2WZPP 1JTXA 2XVCA 3TW7A 4FE4A 3CDHA 4IHSA 4ZJZA 3IKTA 5EG0B 2WWYA 4Z1MA 3VPRA 1Q1HA 2V9PA 3JRAA 2VUMJ 1BMFA 2ZTNA 3AK5A 4LK1F 4ZDLA 3RI4A 1K4ZA 2OTJB 4NBQA 1PUFB 4N4OB 3MMYB 2NV4A 2HYJA 2ZJ2A 2EIKH 3HEFA 4LD5A 5B1AH 3K1NA 1O8GA 5B66C 4LK0F 3W6VA 3I55B 3OL4A 5HDGA 3OY9A 1QA1A 1E17A 1BOBA 2OUMA 4HOBA 1BX0A 2V7XA 5EYRA 1YX2A 2NYXA 3KRGA 3WY9A 2VFNA 1B1BA 1IB0A 4II2A 3VFZA 1P4XA 4G7WA 4PMHA 3MZYA 2CW8A 4B43A 5D5WB 1FTTA 4UVBA 1LQ1A 4RD3A 3A02A 4Y9RA 3QRFF 1SEUA 2JJ7A 1WSRA 3HOZJ 1F4KA 4YZAA 4KN7X 5FO5A 4A3FJ 3KLNA 5GPAA 1BC7C 2BW3B 4Z4TA 1O8MA 3AVUA 2AQEA 1A5JA 2Y0MA 3ES9A 1S7EA 2HWVA 4HX4A 1VQ8I 3OPOA 2O7OA 2EIXA 3RKYA 3K4KA 4I7HA 1JT6A 4Y9UA 3VO1A 1XGMA 2X3UA 4M4SA 2KL4A 3L00A 5BSYA 5HXBA 4EVIA 3TL4X 3BQZA 3NEUA 1ZG5A 5IYPA 1TNTA 1AOYA 1TQMA 4M9XA 2BY1A 2X9DA 1DBOA 1YJ9B 4DZJA 3KYCB 1H89C 4LG0B 1EFUA 3GTOJ 5CVUA 4OJOA 1SKYB 2H1KA 1BIBA 3KP2A 4IRGA 4GYIA 2HMAA 1USTA 4BEHB 2JA5J 1KYZA 1J9IA 4LLGF 5J4YA 2QF7A 1DU6A 3S1NJ 3CCVI 3LQRA 4YIFA 3B90A 2DA7A 4OPVA 1VQKI 2BVNA 4M6YA 4B48A 3A01A 2RKHA 1RPWA 4UZFA 3ASSA 1XX5A 2JA8J 1ORKA 2G9WA 3DTEA 3CESA 5EGOA 1B6AA 4LJZF 4J0QA 1RQRA 3DLLF 1S72B 1X3UA 3CCMI 4P2NA 3ASOH 1IF1A 2ID3A 2GXBA 5HZAA 2XDVA 2VIXA 4LOCA 1BI2A 1UG2A 4RA2A 3ZMTA 1YS6A 4L5JA 3SXYA 3A01B 2OBTA 3ASPA 1D1CA 3LQQA 2CH0A 5CPRB 3BZCA 1YHQI 2CFOA 5JFRA 5J1YA 4YFXF 1A36A 1W7PB 2PE3A 3FKSA 3I3LA 4IEJA 4PGGA 5J35A 3GUDA 4PJ0C 3VSKA 5C4JJ 3EUAA 3AKZA 2MC3A 2WR8A 5H59A 1U78A 1BIAA 3SZEA 3HPHA 1RESA 2LY2A 1FDRA 1G7CA 3FHNA 3CUQC 4X07A 4Z4RA 2PJRA 4KYWA 4I84A 1NBMA 3GLXA 3T9GA 4Y15A 1MH4A 1CQTA 2R7RA 1ZR4A 2PI0A 5D6EA 2IGNA 4R79A 2E35A 2KJBA 4LGWA 1F5TA 1S7OA 2HZDA 2M3AA 2L4MA 4ITVA 5J47A 1DDNA 3ZPLA 1I1SA 1NDHA 2OD5A 1Q82D 1TWHJ 3VSVA 2XAFA 2W85A 4J19A 1W5TA 1ITYA 3LFUA 3QQAA 1RUNA 3ERMA 3CCEB 2IOUG 3AL0C 2IS6A 4W8SA 4U87A 2Z99A 3ZXSA 3WTUC 3N97A 2VODA 3GTGJ 3HAGA 3A4CA 4PFPA 5JVGF 4N0BA 3JQPA 4CXFA 2NVUB 4IZZA 1YIOA 3A0HC 2F2EA 3Q3SA 2JDIA 4C2LA 3K7AJ 4EV0A 3W2IA 1FNDA 4LG3A 4M3EA 2WV0A 3L09A 1NK2P 1MDMB 1N0VC 4AIHA 3OW7A 5FLXK 1R1TA 2DT6A 2VKDA 4PSWA 1X2NA 1FNCA 1D0XA 1FSEA 2LY1A 3Q3AA 2R5ZB 2OCEA 2ZMEA 2HDCA 4G1VA 3PSSA 3TBIA 3S2WA 2QTZA 5HDNA 1FYLA 2HGCA 2P5KA 4HSTA 4M74A 1TYXA 1OJLA 1SKQA 2DMNA 4HG2A 3HGGA 3G05A 2BVLA 3QYEA 2FOKA 3W5UA 1QBJA 2X48A 5F04A 2VZLA 3D5LA 3A8KA 5E3MA 2O3FA 1T6ZA 1OGOX 3ABKH 3ERED 2L7FP 3HSRA 2VBKA 4D7MA 3FPPA 4DJAA 2XF6A 3OYCA 1OYYA 1WI3A 1SFXA 2RN7A 2QGGA 5FKKA 2Z16A 2P0WA 3NQOA 3QFCA 2BMWA 4RAZA 5JLVC 4UNOA 3HTUA 4UUTA 2BF4A 1ODDA 2K7LA 4AYBN 1Z67A 5CVRA 3WU0A 2EZHA 1K61A 3S17J 2W84A 2COMA 2J5PA 1STZA 3RQIA 1MH3A 2DW4A 2PMHA 1VQLI 5H6RA 1H9GA 5A2QZ 1YW7A 4CQJA 1OR7A 2QKLB 5DV5A 1OFMA 1DU0A 3OMYA 2Q6OA 3HKZA 3AGQA 2BX6A 2DQRA 3HM5A 4EJTA 5EEHA 4FTHA 3MQ0A 1WP6A 5M3FJ 2VFPA 5F4OA 3OL3A 2ZTGA 2PECA 2A07F 1S0UA 3BTIA 1DDIA 1VQNB 5GPCA 4R71A 1KONA 2CUEA 2E60A 3NRVA 2RDPA 2AS5F 3OOUA 1LEBA 4L9VA 5E1ZB 4HPQA 2ECBA 4PGHA 2OTLI 2Y30A 4K1XA 3E3VA 4M2LA 1K73D 3VWBA 4BXFA 2FJ1A 2VNHA 3IAM2 3ONQA 1QGZA 3WODF 4F3QA 1YO5C 1I8DA 1L0OC 3HKZN 3BCBA 4RB3C 1JA1A 1JI8A 1OFCX 2MD5A 4L18B 1KU3A 2K02A 1DPUA 4BBRJ 2V1DA 2XNDA 1O8DA 4KT5C 1UD4A 1D1NA 2R5YA 2BM5A 4WZEA 1JUMA 3W2EA 2H6BA 1ETYA 4LC0A 3E6MA 3DQVC 1OGMX 1EA3A 4GO1A 5K7HA 5K7FA 1IDZA 3NAUA 2VNIA 4PCQA 4OAZA 4A12A 1TWAJ 2JN9A 3SZTA 3SQVA 3KIOA 5D5XB 3TOAA 1HA8A 2OBSA 2XB0X 3R0JA 1E0EA 4P3YA 4BE0A 1P6RA 4IRHA 4O3MA 1IV6A 2DK8A 1HKQA 2VQLA 4TV7A 4B44A 1C0WA 3S15J 4C0SA 3ZZTA 1N8RD 1O8EA 3BH6B 3GXOA 1K6OA 4YC5A 5FO0A 3BG6A 2V1NA 1QZEA 3F8FA 1MGTA 2QKMB 5L46A 3QSYA 2KVOA 4IF4A 5LHGA 4FASD 1ELOA 4MTEA 2GIVA 1Y8QB 1TUIA 3SY2A 3CXCB 2M34A 2BVMA 1FRQA 2JA7J 2WYRA 5D5UB 2VBSA 1YOVB 1KQ8A 4UZEA 3TP0A 3PQKA 2R7WA 4OOXA 3DKYA 2IEKA 1DQUA 3E6CC 1CZFA 4WZLA 5FO1A 1KA8A 4GDFA 1QVUA 3QAHA 1WHUA 5GAHJ 5ED4A 4OMYA 2GJRA 1TBXA 4QPOA 2CS3A 2FRHA 3CUQA 2CW0F 1O4XA 2V7TA 4RLFA 1ZYRF 4U0VA 4D5FA 4OIOF 2IP2A 3JTHA 3VEPA 4OU0A 3CC4I 1J5YA 4TKOB 4UB6C 3DFGA 1QQ1A 2X51A 2GA1A 2HPIA 1QFZA 3DEWA 1R22A 5EG0A 3JRGA 3AG2H 3CC2B 2CO5A 1T95A 3CF2A 3PUNA 2M87A 1IN5A 1CGPA 2IVMA 2XKPA 5IT9K 2EBIA 4BHPA 3LSMA 4RB0A 2YSRA 5FD5A 6PAXA 4RDLA 3VB2A 5AONA 2PJRB 4E7KA 4QVAA 1S9HA 2V26A 3GRHA 2VKHA 1EFTA 2EZLA 3ZP5A 5F0HA 1KYWA 2GQFA 2QA4B 4HW0A 4H4KC 2FVGA 2PMDA 5EEGA 4HLXA 5FGMA 2QMUA 2KT0A 2DEUA 3QP6A 3ZR8X 2ODLA 1JRGA 2YUHA 3SLNA 2ZO4A 2LKXA 1HCRA 3FKJA 4XN3A 4E7ZA 4HQEA 5HNFA 5IPAA 2KFDA 2I5UA 3ONUA 3T53B 1QVFB 3OSGA 1WPCA 2XTYA 4NK8A 4XLNF 5JLXA 4OOIA 1IZ1A 1JUPA 4LIUA 4NC7A 4DBQA 3VMFA 3PFYA 2QEXI 4XD7A 4L9NA 2Z33A 2X1DA 4JMQA 1MDMA 4ESBA 3BY6A 2M0MA 2K4BA 3CRZA 4D1QA 4A3EJ 4PGOA 3GQBA 3CMAB 1QUEA 3AVTA 3OS1A 2A5YB 4XSZF 1AHDP 1LLWA 5KW9A 2HYGD 3SYJA 3RZDJ 2HPMA 2W24A 2E71A 4IL6C 1YE9A 2CUFA 4X0GA 2W25A 4I76A 1ZN2A 1U8RA 4YFKF 3P4GA 1T2KA 2F4NA 1JHFA 2JRTA 1BR2A 2C5BA 3TMOA 4O5VA 3DBLB 1J75A 1R5GA 1VQ9I 5A8AA 2E1MC 5FKLA 1A35A 2GIZA 5BNGA 4QIWN 1CF7A 1FC3A 2BM7A 1RMGA 5E79C 1MSEC 2K9NA 2A61A 2LDUA 2ZC2A 2ME0A 2BM4A 4B09A 1XMAA 5E18F 2E2JJ 3ABLH 5K7ZA 2P81A 3WU2C 2RNGA 3H92A 2CMPA 1X0CA 1VQ9B 2WTEA 1YJ9I 4WCGA 2BXZA 2LK2A 3FMRA 3TDZC 5HS9A 5KHDA 2AXTC 5L3BA 1R5HA 1IN7A 2JVHA 5FL7A 3OJWA 4IQ4A 3HRMA 1XC5A 3WTVC 1IJWC 4Y4RA 1YRNB 2Z6BD 5C1CA 5FLMJ 1BX1A 3TKYA 4ABZA 4MGRA 4L0YB 2QQBA 2NVTJ 3CMEB 4A5NA 2EILH 3W2HA 2O0WA 2EJRA 3PM1A 4M3GA 2FBHA 4XBFA 3EQNA 2V6CA 3MAJA 4OOSA 3E6DA 1I18A 1G3SA 4OP7A 3JRHA 1QZZA 3K1PA 4BACA 4E7JA 3T8RA 4G7ZF 1XFOA 2R7QA 3A8JA 2FNAA 1Y6IA 2LOOA 1HZEA 2R93J 4RGSA 2GWRA 1BJZA 2L2OA 2R3SA 3J81Z 1E3XA 2M5SA 1NG7A 1ON1A 1QPMA 1KGSA 2R4GA 4S0HB 4DGWB 4U7BA 1PKVA 3FJOA 1SAUA 3F6OA 4LFUA 3ZUGA 5THXA 2Y69H 3CLOA 5KNLA 4JYKA 2BM0A 4M6XA 1CLWA 1BBYA 3G6EI 2CV2A 2VBZA 2UVEA 1TT5B 1YITI 2X85A 2Z5UA 1E3HA 1ZKGA 1ZG3A 3DTKA 3V8LA 1U6GA 2CV1A 1HA3A 2W6IA 3FXMA 3BY1A 2V7FA 1KK2A 2LG4A 4RLQA 4XLHA 1R36A 4MQVA 3VYTB 3VYSB 1RETA 4YZQA 4OJLA 4OINF 1E3ZA 2D9RA 3VNVA 1RU4A 2ZMEC 3IC7A 1B8IA 1IXRC 3WU1B 1ZREA 1O88A 3OYMA 3BROA 3I5UA 1VQ7I 2VJ5A 3BC8A 4BBSJ 3SEJA 4X7FA 2JZYA 3H9QA 2XRNA 1KU7A 1LDKB 4BE2A 3SJPA 1AMOA 4EM0B 2P7VB 1Y8RB 4CCLA 3IH4A 3QE2A 4XORA 5CQEA 4C9YA 2EB7A 3VR6A 3LOCA 4E0FA 2O04A 3K70D 4CCKA 3S1MJ 1FBUA 3CCSB 2PIAA 3F0CA 1UFMA 1Y0NA 2JTVA 1R4MB 3BOQA 3AVWA 1POGA 2DFEA 2RGVA 1F1ZA 3GIRA 5BSXA 3G4SI 4ZYGA 1BHEA 3QPHA 3S1RJ 1LLZA 4DZPA 2GXAA 1ZGAA 2DODA 3KYLA 4G6IA 2OPTA 3DCFA 4ZTFA 3BLYA 3QU3A 4HZFA 3JSPA 4ZDPA 1REPC 1P4AA 3RKQA 3H5NA 2V9VA 1JTAA 3W2GA 3U9GA 2BV3A 2V6EA 3U1DA 3W2WA 3NARA 2Q8KA 5E3NA 4PFOA 2ZKZA 3REOA 1KRHA 1Q9SA 5F6FA 4DQKA 5DYMA 2G0EA 3ZQHA 5GV7A 3FIWA 3FPKA 1P4WA 4IHTA 2FX3A 1R1UA 1DGWY 2EWNA 2EV6A 5FA6A 1LFUP 4G7HF 2C6YA 2MGQA 3W3CA 4U4BA 1GXPA 1K9MD 3RY8A 5EJCA 4ASNA 4KICA 4CICA 1UD6A 3MN2A 2BM1A 4P25A 5IYNA 5KK1A 1IB4A 4KDPA 2CG4A 2ZB9A 3IP4B 4L5IA 2M8GX 1YLFA 4TSFA 4A69C 2LLKA 3HRUA 2F48A 4IXAA 2EFWA 1N77A 2LZJA 1VQ6B 4QPQA 3BH7B 3ZMSA 1M90D 1Y0UA 3PA2A 2FMLA 3S14J 3T56B 4BH9A 2VXDA 4GXOA 1G7SA 2MA3A 3WBKA 3OYIA 2FBIA 4AF6A 4EH1A 5DM6F 3FXLA 1H8EA 2OTLB 2OZ6A 4OJ6A 2JT1A 1WJDA 1UELB 1D8JA 5AIPA 1WJAA 1UAAA 2QSHX 2IS4A 2R7TA 3V7AA 5A2QK 2XTWA 2X1EA 1Q81D 2F4IA 3HGYA 3LA3A 2PN6A 3Q6RA 1T6YA 5FIUA 4FX0A 4W8TA 4IKFA 3WE3A 1H9TA 4CCJA 4U7DA 1OB0A 3EQOA 1HDDC 2TDXA 3VSUA 4N3NA 2XNCA 3H1CA 5KVRA 1O8JA 4MR0A 1X1DA 5KAIC 1HF2A 1F9NA 1ZARA 4ENKA 1FT9A 1YRNA 1ZRCA 1WMRA 3OAAA 1FY7A 1SFUA 4NB5A 3HUGB 2EQRA 3CUOA 1IJFA 4P9SA 2JSCA 3WGIA 1V0FA 4YDTA 1JKQC 2EZKA 2CGPA 1WZ2A 4RB2C 3C2BA 3W6JB 4DQ2A 1W87A 2QXZA 1QX4A 1T08B 3DPUA 2V31A 1W9XA 3KCCA 1FNNA 1XSVA 3AVYA 1W35A 2BZTA 4ZDOA 1TTTA 3OS2A 4XQFA 4B3GA 4YEJA 3I9V2 3FY3A 2NT6A 3OFNA 3D5SC 2DA5A 4HA8A 5IT3A 1JTYA 1RZ4A 2BHZA 1IN6A 1T33A 5DTDA 2FX0A 1EP2B 2FXAA 1K8AD 3JRCA 1U9OA 2YU3A 4BJ6C 2OV7A 2CC2A 3QOEA 2NPFA 3O6BB 4Z4YA 2E5ZA 5FROA 2JA2A 2E1NA 3CJTB 3F6VA 3HC7A 2ZBKA 3GVJA 4DQLA 3DV8A 4ACAA 2CRGA 4EM2A 2VONA 3WGGA 3I58A 2MH9A 4I2OA 3MCAA 3R60A 3CCLI 3BR3A 4WK8F 2LF7A 3LAJA 4YCQA 4E7HA 2OQRA 2OZUA 4O6JA 1J9ZA 2F5FA 1F60A 5IYRA 3H09A 1FP1D 4PJLA 2E2IJ 2V5IA 1QPIA 2LBFB 4ETSA 1HBXG 3ASQA 2G0YA 5LD2C 2EV0A 4WZKA 2R5ZA 4A3DJ 1T8IA 4YHBA 4CYCA 3VOEA 2JRMA 3LSHA 3CCSI 1B9MA 2XASA 3JREA 1IUFA 3VSTA 3MKWB 1RIOH 1BM9A 2KQRA 4N4NB 4KKSA 1VQMB 4F93B 4M3BA 1XQBA 3AL0B 4QUZA 2DLLA 1E79A 2AO9A 2K86A 3KEWA 1MNMC 2X0LA 4DNCA 2OK7A 1X1AA 2XT2A 4FCYA 2OA4A 2E1CA 1MBJA 1KJZA 2K9MA 1XTAA 2VJ4A 3GTQJ 5C1EA 3O8GA 4L9TA 1S6LA 4CH7A 3OR2C 2DY1A 4TMWA 2MBFA 3SUCA 4BS9A 2ELKA 1K79A 1SD6A 5J8FA 2X4HA 3OEHA 4A3KJ 1Z3YA 1W5SA 2OU2A 1K7AA 1G4DA 2EINH 2JN6A 4HQMA 4BQAA 4HRIA 3DTIA 3JW4A 1RR8C 3GFMA 3CO7C 1HDPA 3TO6A 4HNUA 2QE7A 3CCRB 2LKSA 3ZZUA 2DYRH 3MVPA 3TO7A 1PUEE 1U5TA 1UD3A 2HDNB 2CQNA 1YHQB 1Z7UA 1TC3C 2P4WA 1QA6A 2VL8A 1FLIA 3H9GA 1EH8A 2FE3A 3M8FA 3GZ6A 1EXMA 1OCTC 5DN6A 3WTWC 2M7BA 3HOXJ 2L4AA 4F55A 3ZMZA 4E4HA 3EYIA 3CC7B 1FIAA 4DYCA 4E7LA 1CNFA 3FM3A 3LYCA 3B73A 2C5HA 4DYRA 1PJ6A 4LBZA 3OOPA 1YX3A 5LLQA 2JJ1A 1OCOH 1N07A 3QPSA 5J3OA 2EPFA 2HVQA 3FK7A 1DDGA 5IYCJ 2F1MA 3GZNB 1JJ6C 2DFFA 3ZPPA 5GAGJ 1VQ6I 4E6KG 4ZCIA 2EWEA 1T39A 2IA0A 2LBFA 3OYDA 3TOBA 4I0BA 5JI6A 3TEDA 2FF4A 2O6GE 1ZH5A 3DDYA 1QGAA 1CNEA 3IKVA 4HIZA 4PSXA 2UXXA 3EYYA 4UXNA 1MSFC 1WU8A 3F9KA 2XSJC 4EJUA 3R6KA 1IRZA 2FNPA 2XGEA 3KFWX 1B8IB 5DDGA 4B3FX 3HG9A 2ZMEB 3SFZA 4HSRA 1N0UA 4RCZA 1U8BA 1XGOA 2R7FA 4RPBA 2GA2A 3CCYA 5BOXA 3ZGKA 2NTBA 4Z03A 2P5LC 3P27A 2LH9A 3VDXA 1KC8D 4XOPA 2L7ZA 4A2UA 5E3LA 4BUPA 1RKWA 4BE1A 3M9AA 1QHHD 5CYVA 3QFRA 1KZLA 4A3IJ 1EE6A 3L1PA 2JUGA 3C1DA 4EMSA 1NTCA 2DA6A 2K9QA 1MIJA 1A8PA 2VOOA 4KKUA 3E5UA 1JKPC 3D0SA 1SD7A 2EA2A 1SMYF 3H5AA 2C4TA 3ZPNA 1T0FC 5BS6A 3E6BA 2WB1A 1K4TA 2PMZN 3ABTA 5IY5H 4P26A 3FZVA 2BY3A 2W82A 4XRSG 3S2DJ 3ECOA 2LC2A 1X1BA 3LSRA 1G3YA 4Z06A 2NTQA 1RC9A 1X58A 4MEYF 2VYQA 5F27A 3E5QA 2VXZA 4KIFA 4BJTA 1P4MA 3OEEA 1VFCA 4Q4ZF 1B72B 3P7NA 2XGCA 1T5EA 1IDYA 3K4CA 1KU2A 2DMUA 4W97A 2B7EA 3NE5B 1YYVA 1ETQA 1K78B 1ZM9A 3BCFA 2BHYA 1XG1A 1E62A 2ECCA 3GWZA 1VQ4I 5E1WA 4RDJA 5IOYA 3KP3A 1XSDA 3DLAA 5E20A 1V3FA 4KIBA 4XRSA 3VO2A 1P92A 2X6OA 5FRMA 2CUZA 4EGYA 1RNLA 1R9TJ 4FN5A 4LBWA 3V76A 1XMXA 5F0CA 4RAYA 4IQJA 2INVA 4AC0A 1DARA 1TVCA 2ID6A 4PDKA 1WQ2A 2GAUA 2LKPA 3EPZA 2ZJRF 4G7XA 1GJRA 2YWFA 4BYYA 1FYKA 2RC5A 1VQOI 1T6XA 3LNNA 2JUCA 4RGXA 2R5YB 4C2TA 1SVMA 4P9FA 5ILSA 2HQNA 2FEZA 1LDJA 3H9NA 2OK8A 1BW5A 4WQMA 3JURA 1GQ8A 2J8IA 3ZSCA 1X3WB 2DA4A 4J01A 3V8KA 4JOMA 4ASUA 4Y7NJ 4PJJA 3B02A 2IS2A 1TYWA 3FF5A 3DU1X 3F23A 3OYNA 1XMKA 3QWLA 3GTPJ 2YR2A 2O0VA 1BI0A 2DPDA 4NHJA 2ZFWA 2BY2A 2XOKA 4YIIA 4PJNA 4BQOA 2QX3A 2PG4A 3Q9VA 2F4MB 3IV5A 1PJ5A 3DU5A 4L9JA 1LE8B 4XKWA 1Z9CA 3CP8A 1QVTA 3SHFA 1FNBA 2FMYA 4HDUA 3ZBTA 1RKTA 1MW7A 4RGRA 1TLHB 3GZ5A 3N05A 1CQXA 2W6JA 3S8PA 5HKKA 4F91B 3G2BA 2M8EA 2IGMA 3CJRB 1PLUA 1JKRC 1I5ZA 1IUYA 3A03A 2A6HF 2HR3A 3KPHA 5F1RA 1BI1A 1YG2A 4ZZDA 1W4MA 4X8IA 3TW6A 1PP7U 3S3NA 2BM6A 5HOOA 1IW7F 1SFEA 2ME6A 2GLOA 4AVPA 4KNYA 2DXIA 2ISYA 1I6XA 4CZZA 4U0WA 1F43A 1GR1A 4RJLA 3I71A 1HVXA 2XEXA 4C3IJ 2N8GA 4HV5A 3HHHA 4M72A 2DJIA 1O3QA 5JBQA 1HC8A 2DETA 3BG3A 2Z3YA 2I8DA 5EZHA 2XC7A 1W2BB 1UD8A 2YUSA 3V7CA 1WKMA 2A05A 1KZHA 3WG9A 1H42A 2V7VA 1W36D 1H0MA 3MHPA 3KP4A 2NVYJ 1WPKA 4IW3B 5F4JA 1ETOA 2O0YA 4F92B 3ESWB 1I3AA 2NNYA 1IJEA 2AHOA 3SLDA 2J8KA 3TQNA 2BGCA 2W7ZA 4QV2A 4CUGA 3JAMK 4TMXA 4TMVA 4OPOA 3M07A 1VLOA 2E1OA 4U0YA 1K8FA 3OYKA 5L3EA 1Y0RA 3KZIC 3CCEI 1BL0A 3FXKA 4DNTB 5JHFA 2M9HA 3ZMVA 3SFIA 5CQGA 3G71I 4ENNA 2KIFA 3H9JA 4ZH4F 4A3BJ 3Q39A 3LA2A 1V5VA 1Y56A 1AA7A 3OV8A 2R0QC 1V4RA 1E1QA 3LWFA 4R1HA 4ZYAA 4AUXA 2P7CB 4PC2A 3UNGC 1EH6A 1R7JA 1S3JA 4LBYA 2YWEA 2OF7A 1ZRDA 4RMNA 3ZQGA 4RDKA 1VHEA 4NBSA 3OIOA 2IQ7A 1MNEA 2R7OA 1UZCA 2KZGA 1EF4A 3MCZA 4Y33A 4AIJA 1R5NA 3R4KA 2Y0SA 2DOGA 3AGPA 3W5VA 1DABA 3WTSC 2AHQA 5CJ9A 3BG5A 3G73A 4C2MJ 3A2KA 4M0LA 4YZXA 3SQNA 1NH3A 3SZPA 4FX4A 2LSOA 4A6DA 5IYQA 3E20A 1LM1A 2MABA 4BPRA 1MD0A 3TP3A 2LP0A 4WXDA 3SKBA 3AFHA 4HNVA 3BWGA 1VQNI 3HHGA 4PZJA 5D4SA 2IT0A 4UY8I 4P12A 1EH7A 2NAZA 2AXLA 4RPDA 1R5ID 2WAEA 1B72A 5IYWA 3G6EB 1BR4A 5ILUA 4M6VA 3DWLE 4EATA 4A3CJ 1EFCA 3J80Z 2INUA 3I53A 3I4PA 1PUFA 1ZHFA 1ZM3A 1O8IA 1AWCA 4NC8A 5ICCA 3KEOA 3J7ZI 1JE8A 2Q2EA 2VJIA 1UHMA 3M8JA 1LVKA 2PX9A 2YS9A 1XB2A 4B1RA 1A6QA 5K5QA 4ZYDA 1XCVA 3W2VA 3QFSA 2GPJA 4RDUA 2PJPA 1ZM4A 2VE8A 3U21A 1V5EA 1G7TA 4I02A 3SEZA 5DSZA 1WJEA 3KX2A 4ON0A 1K78A 3H3VK 1BQEA 2WZNA 2V4JC 1QU3A 3VODA 3H3UA 3K1MA 1P9QC 2O03A 1G8XA 3G1LA 2B9SA 1OLTA 4UVAA 5M3MJ 1N05A 2ZSHB 1B23P 1I1GA 4II3A 2C78A 1LB2A 5K5OA 4D0PA 2DO7A 2L0KA 4G94A 4RM3A 1IV8A 4TN1A 3IWFA 5BMZA 3HOVJ 2X53S 3K70C 2DTRA 4PC3A 1UJ8A 4BHCA 1N06A 3CCUI 2NOGA 5FKNA 3GFJA 1FEXA 3VYRB 4ANJA 3LAPA 1ZELA 1OPCA 4PC6A 2LVSA 2L9RA 1OQYA 3X2QH 1HOMA 4LLLA 3AG3H 2HQ5A 2DT5A 3SJZA 4I6ZA 3ZQCA 1GVHA 2HLDA 1ZTRA 3QPLA 1MMDA 3PIPF 1ETXA 4M53A 4OJPA 4EW9A 1FOYA 4D7NA 3MEXA 2HTJA 4JK1X 1Y0YA 2DIEA 2ZBVA 4OZZA 4KJZA 1ZM2A 1KK3A 3H0DA 4AWXB 1WVRA 1EZGA 2DERA 1G59A 3C3WA 3ZQLA 2F3LA 2P5VA 1ETVA 3QYFA 5DS9A 3DPTA 2WY8Q 1W0UA 4Z2YA 1A31A 4U9UA 3AG4H 3A1YA 3B6AA 1HSTA 2ADUA 3OYJA 4V02C 3BNWA 1ZLKA 5E17F 1H80A 5B5EC 2L7KA 4IHVA 2EIMH 2VPRA 5B3SH 1I6HJ 3K4BA 2YWHA 2UV1A 2E1RA 1TQPA 2KHMA 3K4MA 4YFOA 2ZXWH 3W6KB 4OPWA 4XL9A 2JQ7A 1XN7A 1R5BA 4KIGA 4RBOA 1XPXA 1IDJA 5F08A 5DUKA 4XM3A 5CVVA 1KQ0A 4C30A 3I4MJ 3G4SB 1MMGA 3J7AO 1J59A 1R1VA 4CCNA 3Q5FA 3S1QJ 5HLIA 2NVXJ 1WSUA 3WTYC 2XB5A 1NRKA 2Q6LA 5DCMB 2Q6KA 1K5CA 1RI7A 4BU2A 5H2FC 4P9UA 2NVQJ 5ICFA 5B1BH 2XKOA 1QCXA 2XPWA 1U2WA 4PC7A 3WE2A 3SDBA 1TQIA 3CD6I 1LDDA 1LKXA 4GFBA 4JX4A 3ASNH 4XR6A 1Z91A 4FETA 3RCOA 2XNJA 2WBMA 5CVJA 2C4UA 4OM9A 5KAFC 2QEXB 2QTLA 2BBYA 2Y9YA 4FQGA 1DP3A 2XAGA 3M7GA 5LEJA 3GX4X 1IG7A 3HOYJ 3T8TA 2HCJB 5EEAA 2OBRA 3GQ7A 3R0AA 4HYEA 3HIFA 3FM5A 2WY7Q 2QYOA 3Q0VA 3BCAA 1WSVA 2XAUA 3AVVA 3CPXA 4YXWA 3WNDA 3J81K 1JJ8C 5FRNA 2L5QA 1MMSA 4OAYA 4A0YA 1SVOA 3MKYB 3CPWB 2QYUA 5DS0A 3BTJA 2MD0A 2UVFA 2KRHA 5J1RA 2O5RA 1NG6A 1VBLA 2FA5A 2I10A 4PK4A 5JHUA 3I4NJ 4NQWA 3MWMA 3J81k 1VQ4B 3BT9A 2QLZA 3PENA 5L3FA 1R4NB 2ZL5A 4OMZA 4RD6A 3BTCA 3WNCA 3WTXC 1WORA 3RPUA 5AMVA 1FMVA 3KP6A 5HLTA 1YI2B 3KYDB 3OIPA 2XUBA 3JTGA 1Z3XA 2DMTA 1BI3A 4URRA 2GBYA 2M5WA 2VPLA 4GRIA 2E34A 4B3XA 2DN0A 1Z1DA 2F43A 1YIJI 1WH5A
chains in the Genus database with same CATH topology
4Y3OA 2LBFB 1OR7C 3LFUA 2M4KA 3AL0C 5LD2C 2IS6A 4U87A 3HAGA 3ZXSA 3L2RA 1QJVA 3A4CA 4PFPA 2WADA 1BN8A 1R6RA 4IZZA 1OOCA 4C2LA 2JDIA 1OFLA 4BQNA 2WPDA 4BDZA 4FXUA 4LG3A 3UR3C 3K4LA 2HVRA 3LSHA 3WWGA 3VSTA 3BG7A 1GLNA 3MKWB 1W0JA 3OW7A 4N4NB 2KQRA 3OYFA 4KKSA 3A3GA 2DT6A 2VKDA 3E1SA 1Z21A 4PSWA 4F93B 3AL0B 1D0XA 1V5FA 1E79A 3S3MA 2LY1A 3ZIAA 3C2GA 3LSKA 4XNFA 4XKVA 3KEWA 3W2AA 3TBIA 1X1AA 4HSTA 4TT3A 2K9MA 2VJ4A 3OYBA 2GK7A 5C1EA 4HG2A 4CH7A 3G05A 3OR2C 2BVLA 2X6WA 1V5GA 3QYEA 2VLAA 3SUCA 4BS9A 1V0EA 3BC9A 2VJJA 3D5LA 3M1CA 1IDKA 4W8RA 3OEHA 1Z3YA 1FX0A 3PUBA 1OGOX 4HRIA 2A6TA 3DTIA 2VBKA 3FPPA 4DJAA 2XF6A 4HNUA 3OYCA 2QE7A 2NZMA 2Z16A 1FMWA 3VSLA 1UD3A 2P0WA 2E1BA 4P1WA 3MKZA 2KPMA 2E1MB 2VL8A 2NOJB 3H9GA 4XLAA 1UD5A 2W00A 5DN6A 2D3LA 3OR1C 3NWSA 2M7BA 3DEEA 1O8FA 4F55A 2VB6A 4E4HA 2NT9A 1IA5A 4CA0A 2ZXIA 1MMAA 4E7LA 2E5NA 3OE7A 2Z8GA 2QKLB 1YX3A 2JJ1A 3K6GA 3OMYA 2WA0A 3HKZA 3NWTA 2HVQA 2F1MA 1O8LA 2XF5A 2DT7B 1WP6A 3ZPPA 4E7IA 4E6KG 4C2UA 3OL3A 2EWEA 2LBFA 2ZTGA 3OYDA 3L2QA 2PECA 3JU4A 3DDYA 2PYHA 1KONA 2IS1A 2E60A 4HIZA 2KDOA 4PSXA 3PJRA 3OOUA 4B47A 4HPQA 3F9KA 2XSJC 2CV0A 4KKTA 3VWBA 4NQWB 4BXFA 4B3FX 4NNJA 3IAM2 3OYAA 3ONQA 3HG9A 3ZRGA 4F3QA 3B8YA 1I8DA 3BCBA 4HSRA 2VBEA 3L2UA 3K4NA 3SYTA 1JI8A 3ZGKA 4W8SA 2XNDA 4BJ5C 2NTBA 4Z03A 1X1CA 2L9NA 2LH9A 1O8DA 1UD4A 3VDXA 1TT0A 4XOPA 2PYGA 3BH4A 2X1CA 1VJSA 4BUPA 4BE1A 2VQGA 2JJ2A 3DQVC 2ELJA 1Z7LA 1EA3A 4DIQA 1OGMX 1QHHD 2MYSA 4OAZA 1COWA 1KZLA 4DNRB 1EE6A 2JUGA 2XZPA 1HA8A 1W36C 1KCDA 4MXNA 2VQHA 4KKUA 1E0EA 2WAFA 4IX7A 4BE0A 1EFRA 3H5AA 3ZPNA 1NHCA 1T0FC 2VQLA 3S93A 3RSNA 4B44A 3UW0A 3CMMA 2WB1A 1O8EA 3BG6A 2V1NA 2W82A 2CW7A 1PYVA 1X1BA 2LC2A 2QKMB 4Z06A 2KVOA 2NTQA 4FASD 3GQ9A 2VXZA 4BJTA 1VF7A 4YELA 3OEEA 2ZFUA 2BVMA 2PMZA 4DK1A 5TGTA 1T5EA 1LFPA 1W0KA 3K4CA 2BW3A 3OYEA 3NE5B 3RTRA 2M7AA 4XLCA 2R7WA 3DKYA 1DQUA 3BCFA 3ZCOA 1CZFA 3CP2A 3HOTA 2KZVA 2GJRA 1WFXA 1BR1A 2LRDA 3DLAA 4QPOA 3GQAA 4BDYA 4OJ5A 2CS3A 2R7SA 5FRMA 2CUZA 4UZUA 4RLFA 2F5VA 4LITA 2R7VA 3A35A 4P5OA 1D1BA 3VMVA 4IQJA 2INVA 4TKOB 2W4SA 2X51A 4G7XA 3EPZA 2HPIA 3IAS2 2V7QA 3LNNA 1AIRA 1X19A 4C2TA 1T95A 2Z2SB 3CF2A 4KITB 2K3PA 5HVQC 4HNTA 1VZ0A 3JURA 4U49A 1GQ8A 3ZSCA 4J01A 2XF7A 4RM2A 1DGRM 3LSMA 4JOMA 4PJJA 3WQZA 4Z05A 2IS2A 2PJRB 4E7KA 3E0JB 1S9HA 3OYNA 1N78A 2V26A 2O0VA 3GRHA 2VKHA 2OC6A 1D0ZA 2MC4A 2XOKA 2HU9A 4PJNA 3RQ4A 4BQOA 2QX3A 2RQQA 4H4KC 1DBGA 1BLIA 2ODLA 3DU5A 3ZR8X 1JRGA 3HOSA 1MABA 4XKWA 2IXSA 3CP8A 5CKTA 3L2WA 2CK3A 3FKJA 4XN3A 4E7ZA 3BCDA 4LIVA 2F6CA 5HNFA 3T53B 1MW7A 1VLYA 1WPCA 2IGOA 3N05A 4NK8A 2W6JA 3S8PA 5HKKA 4F91B 3DU6A 3CJRB 3G2BA 2IGMA 4LIUA 4NC7A 1UD2A 1PLUA 4DBQA 1MMNA 4XN0A 3SZGA 3PFYA 4XD7A 1D1AA 4JMQA 2X1DA 3K4JA 1YX5A 4OWRB 4JQFA 2M0MA 2HNHA 3S3NA 3HPGA 4D1QA 5HOOA 4D9JA 2GJPA 3GQBA 2WSSA 3OS1A 2DXIA 2WJYA 3SEQA 1E43A 4XLEA 1HVXA 2VASA 4DBRA 2VQCA 2HPMA 2DJIA 4GQNA 2HVSA 1YE9A 1OHHA 4X0GA 3FBNB 4L8JA 2I8DA 2XC7A 2KP6A 3FBIB 1UD8A 4BL0B 3OS0A 1BR2A 4XKCA 3TMOA 4BEHA 1W36D 2E1MC 3ZQQA 4XONA 1D0YA 4DK0A 1RMGA 2X6XA 2HQAA 4F92B 3OIQA 2R9VA 4XOTA 4DOZA 1MNDA 4XMYA 1X4OA 2RNGA 4CUGA 2CMPA 3PNYA 1X0CA 3VYUB 3EUHC 2KMUA 5KHDA 1WJCA 3S32A 2JVHA 3OYKA 4HEA2 5FL7A 2V9KA 2UUZA 4IQ4A 1E1RA 3OOCA 2M4GA 4DNTB 5JHFA 4Y4RA 2Z6BD 5CQGA 5C1CA 1KCCA 3H9JA 2NTPA 1Y56A 1AA7A 3LL7A 1HG8A 2O0WA 3LMWA 1E1QA 1U0JA 2UWMA 3PL8A 3PNVA 2GJKA 4ZYAA 1ERDA 2KRCA 1K28D 3EQNA 4NK6A 2Q2EB 4XKBA 3UNGC 1WTHD 1I18A 4P22A 4RMNA 1WJFA 2K5CA 3RPUD 3V42A 4AU7A 4BACA 4E7JA 4PUSA 2R7QA 4MLOA 2IQ7A 1Y6IA 2LOOA 3H5RA 1MNEA 2R7OA 1HZEA 3H35A 2L2OA 4Y33A 1E3XA 2M5SA 1NG7A 4KISA 2Y0SA 4DGWB 4U7BA 2R4GA 1PKVA 3OWTA 1SAUA 3IUOA 1O8HA 4YZXA 4NUBA 3A2KA 2O1DA 5HNHA 5KNLA 3S3OA 2IGKA 1J09A 2CV2A 2DCEA 2UVEA 2MABA 2X85A 3K10A 1H8HA 4BGDA 2ZZQA 3DTKA 2CV1A 2W6IA 3AFHA 2V7FA 2LYCA 2LG4A 1RWRA 3DKXA 4RLQA 4XLHA 2ZZEA 3VYTB 1BPLA 2WAEA 3VYSB 2XZOA 2KLOA 4YZQA 4OJLA 2X6YA 1BR4A 2Z1DA 2CUJA 1E3ZA 1PJRA 1RU4A 3DWLE 4EATA 1O8KA 2D3NA 1O88A 3LSIA 5KCMA 3OYMA 2R7UA 2INUA 2VJ5A 3BC8A 1O8IA 3CZ6A 3H9QA 4NC8A 4BQQA 2X8KA 5IK2A 3GQ8A 4YRVA 1LDKB 4BE2A 3GVKA 2VJIA 4CCLA 3M8JA 4F52A 1LVKA 2R7XA 4XORA 5CQEA 4C9YA 2ZZGA 2JIZA 3VR6A 4E0FA 2O04A 2GOXB 1QHGA 3LMMA 4CCKA 2WAQA 3K70D 1UG0A 4AYBA 3KEYA 3VMWA 4ZC3A 3W2VA 3HXLA 2MFZA 1KTWA 4HWVA 3U21A 3OYHA 3J7AY 3GVLA 1V5EA 2ZZFA 3SEZA 4ASUA 1N75A 1WJEA 3KX2A 1WJBA 1BHEA 4CCMA 1QCXA 3KYLA 2V4JC 1PXZA 3MD2A 4G6IA 1QU3A 1K6YA 2A5WA 3BLYA 4G6TB 4ZTFA 1P9QC 1KMHA 1G8XA 1XG2A 4AVZA 1OLTA 4ZTJA 2ZSHB 2JSPA 2FUG2 2X3HA 4II3A 4ZDPA 1PE9A 3H5NA 1JTAA 2DOAA 3B4NA 4RM3A 2V6EA 2WZPP 1SFKA 2X53S 3W2WA 3K70C 2Q1ZB 4PFOA 4OZYA 4ZJZA 2L9SA 3VYRB 4ANJA 4Z1MA 1ZELA 2K9LA 2LREA 1BMFA 2ZTNA 2AQFA 4ZDLA 2XZLA 4N4OB 3MMYB 2BOLA 4CZCA 1DGWY 1TZLA 2HLDA 3C2HA 1MMDA 4KT6A 4J00A 1O8GA 4OJPA 3OL4A 3W3CA 3OY9A 4U4BA 4EW9A 1BOBA 2OUMA 2DIEA 4OZZA 2O17A 4KJZA 1UD6A 3H0DA 3KRGA 1IB4A 4CCOA 1G59A 3T51B 4TSFA 3IP4B 4II2A 3QYFA 4G7WA 4PMHA 3D5RC 3DPTA 2WY8Q 3PSIA 5LFAA 1N77A 2NSTA 2CW8A 2RREA 4B43A 4QPQA 2LZJA 3A1YA 3OYJA 2W1OA 3EUKL 2GK6A 4YZAA 3OYGA 2W7NA 3T56B 1H80A 2L7KA 3GBGA 2BW3B 1O8MA 2VXDA 3K4BA 2AQEA 3FDYA 3OYIA 2UV1A 2KHMA 3K4MA 1H8EA 3OPOA 4XL9A 4OJ6A 1WJDA 3K4KA 1UELB 1IDJA 1WJAA 4XM3A 1UAAA 4PJMA 2IS4A 2R7TA 2KL4A 2X1EA 2ZSIB 4C30A 3OYLA 2F4IA 2HDWA 1MMGA 3TL4X 4W8TA 4IKFA 2GOMA 4CCNA 1NRKA 5CDFA 4CCJA 1OB0A 2WJVA 2XGJA 1DBOA 1K5CA 3EQOA 4BU2A 3VSUA 4OJOA 1SKYB 3H94A 3DPLC 1O8JA 1X1DA 3SDBA 4MR0A 4BEHB 1LKXA 4YZ0A 1WMRA 3OAAA 1X4PA 4XR6A 3L2VA 2ZXHA 4FETA 3RCOA 3PNTA 2WBMA 3HUGB 3QYBA 3B90A 1V0FA 3HL2A 1DP3A 4B48A 2QXZA 4CSWA 2JVGA 1OFMA 2V31A 1WJ5A 3DPUA 3DTEA 1W9XA 3CESA 4ZDOA 3A3BA 3OS2A 4XQFA 4B3GA 4YEJA 3I9V2 3FY3A 3GQ7A 2NT6A 3OFNA 3LSGA 3D5SC 2BSPA 2WY7Q 2XDVA 2VIXA 2XAUA 3BCAA 4YXWA 2NSPA 3QODA 5FRNA 2L5QA 4OAYA 1D1CA 3MKYB 2CH0A 5CPRB 2CFOA 3CJQB 3FKSA 2UVFA 2MD0A 4BJ6C 4E7SA 4W8QA 2KRHA 2OV7A 3I3LA 3QOEA 2E5ZA 3VSKA 2O5RA 3EUAA 3AKZA 1NG6A 1VBLA 1IRXA 5FROA 4PK4A 4XLFA 2JA2A 3HPHA 2VBMA 2LY2A 3FHNA 3HC7A 3GVJA 2PJRA 4I84A 1NBMA 5AMVA 3T9GA 1FMVA 5HLTA 3OIPA 2R7RA 1Z3XA 2IGNA 4R79A 4URRA 4E7HA 2HZDA 4ITVA 2M3AA 2V4DA 2VPLA 3PSFA 4GRIA 4B3XA 3VSVA 4PJLA 2F43A 2QY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHC A;  3UW0 A;  1O8E A;  1QJV A;  4XOT A;  4XMY A;  1BN8 A;  4Z06 A;  2NTQ A;  1OOC A;  1X0C A;  4C2L A;  1OFL A;  3GQ9 A;  1O8G A;  4OJP A;  4EW9 A;  4U4B A;  3WWG A;  4YEL A;  3VST A;  4OZZ A;  2O17 A;  5C1C A;  3KRG A;  1KCC A;  1IB4 A;  2NTP A;  4XNF A;  4XKV A;  4XLC A;  4PMH A;  1HG8 A;  2O0W A;  3LMW A;  2NST A;  1CZF A;  5C1E A;  3EQN A;  4NK6 A;  2X6W A;  4OJ5 A;  3GQA A;  4YZA A;  3SUC A;  1H80 A;  2VJJ A;  1IDK A;  4W8R A;  1O8M A;  1OGO X;  2VBK A;  3VMV A;  2INV A;  2IQ7 A;  4XL9 A;  2NZM A;  4OJ6 A;  1IDJ A;  4XM3 A;  1AIR A;  4XLA A;  1O8H A;  4YZX A;  4W8T A;  2O1D A;  3JUR A;  4U49 A;  1DBO A;  1K5C A;  1GQ8 A;  3ZSC A;  3EQO A;  1O8F A;  2UVE A;  3VSU A;  2NT9 A;  4OJO A;  4Z05 A;  1IA5 A;  2X85 A;  1O8J A;  4MR0 A;  2O0V A;  3GRH A;  2Z8G A;  4YZ0 A;  1RWR A;  1WMR A;  2QX3 A;  4XR6 A;  4XLH A;  4YZQ A;  1O8L A;  1DBG A;  2X6Y A;  2ODL A;  3B90 A;  4OJL A;  3ZPP A;  1JRG A;  1RU4 A;  4XKW A;  1O8K A;  2EWE A;  2QXZ A;  4XN3 A;  1O88 A;  1OFM A;  2INU A;  2PEC A;  1O8I A;  4XQF A;  2PYH A;  4YEJ A;  3GQ8 A;  3FY3 A;  4NK8 A;  3GQ7 A;  2NT6 A;  2BSP A;  2VJI A;  1PLU A;  4XOR A;  4XN0 A;  2O04 A;  2NSP A;  3VMW A;  3B8Y A;  2VBE A;  4HWV A;  1KTW A;  2UVF A;  4W8Q A;  1BHE A;  4W8S A;  1QCX A;  2NTB A;  4Z03 A;  1O8D A;  1VBL A;  4XLE A;  4XOP A;  1PXZ A;  2PYG A;  4XLF A;  2VBM A;  1XG2 A;  4AVZ A;  1OGM X;  4I84 A;  2X3H A;  5AMV A;  3T9G A;  1EE6 A;  1PE9 A;  1JTA A;  3B4N A;  4URR A;  1KCD A;  4MXN A;  4XON A;  3VSV A;  4OZY A;  1RMG A;  2X6X A;  2QY1 A; 
#chains in the Genus database with same CATH topology
 4Y3O A;  1JT0 A;  2Y0S N;  2B63 J;  4S05 A;  1BJK A;  3DBR B;  2XC1 A;  5LGU A;  3BDD A;  3CDI A;  2WAD A;  4N9H A;  1R6R A;  3CCL B;  1BN8 A;  1WOS A;  1OFL A;  2WPD A;  3LJY A;  2HVR A;  3BQY A;  4RCY A;  3IRR A;  2XAQ A;  2HOS A;  5GTI C;  1GLN A;  1G7R A;  4Y13 A;  1QFJ A;  1W0J A;  4YAL A;  1TYV A;  1FSH A;  3A3G A;  3E1S A;  1Z21 A;  5D6F A;  2ZNZ A;  3ZIA A;  1V5F A;  3U2R A;  3S3M A;  1OMI A;  3LSK A;  2K3F A;  2K40 A;  4HAM A;  3CCV B;  2CF4 A;  1MBE A;  4TT3 A;  1VQK B;  4BY1 J;  2VNK A;  1ON2 A;  1NJI D;  2LMD A;  2GK7 A;  3S16 J;  2KKO A;  1R00 A;  2X6W A;  1JKO C;  1QO0 D;  3HOU J;  2O61 A;  1VQM I;  3M1C A;  3PO2 J;  2L02 A;  1T56 A;  3BR1 A;  1FX0 A;  3PUB A;  2A68 F;  2DTZ A;  2A6T A;  2I1L A;  2NZM A;  3SJM A;  3T5X A;  1EWY A;  5LHH A;  2HKX A;  3ONY A;  1TNS A;  1FMW A;  3OZV A;  1IN8 A;  1QVG B;  1G2H A;  2E1B A;  4HV6 A;  4RLZ A;  1J0R A;  2CBX A;  1MJB A;  3Q0U A;  3MFK A;  1N25 A;  2W00 A;  2B7B A;  1EKE A;  1YJN I;  2YWG A;  1S5L C;  2VB6 A;  2NT9 A;  1W1W E;  2VOP A;  5DM7 F;  3CTA A;  3FXU A;  1APL C;  3GTJ J;  1NB9 A;  1VQ7 B;  5D5V B;  3FMQ A;  1TSP A;  4UAJ A;  2K27 A;  3H0G J;  1FWZ A;  1IGN A;  4ROX A;  5DD4 A;  4EEF G;  1O8L A;  2KIS A;  2DT7 B;  1WWX A;  1H8A C;  4OIP F;  4E7I A;  1JB9 A;  4C2U A;  2Y75 A;  2HQR A;  3L2Q A;  1K83 J;  3F3X A;  2DMQ A;  3ZMD A;  1Z05 A;  3WYA A;  2CQK A;  2VBT A;  3JU4 A;  1T6S A;  1YS7 A;  4I0A A;  2LD5 A;  1EJ9 A;  2Z9O A;  2IS1 A;  2PYH A;  2HS5 A;  3PJR A;  2A6E F;  1SMT A;  4KKT A;  2L01 A;  2H09 A;  4NQW B;  5GAD J;  1Y1W J;  2XAJ A;  1BOA A;  3OYA A;  3GSI A;  3B8Y A;  2DOF A;  1IO2 A;  2WB1 N;  4K2E A;  5TIS C;  5D4R A;  3L2U A;  2VBE A;  3K4N A;  3SYT A;  5JLW A;  2L7M P;  2JPB A;  4TMZ A;  3PQJ A;  5BQT A;  1P2F A;  3KZY A;  4P96 A;  3TGN A;  2HEO A;  1X1C A;  2L9N A;  2LTP A;  3TO9 A;  1MKM A;  1V54 H;  2QEN A;  4XLP F;  3BH4 A;  3A8I A;  4WZT A;  4TMT A;  2ACJ A;  3K2Z A;  1VF9 A;  3MZH A;  2ELJ A;  1Z7L A;  4DIQ A;  4MEX F;  3AVX A;  1OYI A;  2H6C A;  2MYS A;  4I98 B;  4H0E A;  4UV8 A;  4QVJ A;  3ROU A;  2QA4 I;  5F0F A;  3OZW A;  5H5J A;  2C77 A;  3CCM B;  5FNZ A;  4IHW A;  5C3E J;  5GP9 A;  1E3P A;  4G6Q A;  1D8K A;  2QZA A;  2WAF A;  3L7W A;  2G7H A;  3HZJ A;  1NHC A;  3S93 A;  4MYT A;  3RSN A;  2OBP A;  4Q48 A;  2QBY A;  1YJW B;  4BY7 J;  1RR7 A;  3FXQ A;  2CW7 A;  2P3M A;  4FK8 A;  3IH2 A;  3WTT C;  3BG9 A;  4Q5S F;  4WXC A;  1YQA A;  4YAU A;  4M1K A;  5TV2 A;  4GGG A;  2YPR A;  4HF2 A;  2VBX A;  2CU7 A;  1PDN C;  5J3L A;  2IW5 A;  2ZFU A;  1VQ5 I;  5TGT A;  4DK1 A;  3W2F A;  5DEQ A;  2BGI A;  3GYH X;  3RJP A;  2MLG A;  3EQL F;  3OYE A;  3AG1 H;  3RTR A;  4XLC A;  4CDG A;  5LRS A;  4ZGN B;  1EP3 B;  3ZCO A;  2VFO A;  1FOW A;  2HZT A;  4ZCM A;  4B4C A;  4UB8 C;  1R23 A;  3G3Z A;  1WFX A;  2F4O B;  4QFM A;  1QRB A;  2LRD A;  1ACI A;  3GQA A;  4BDY A;  1YI2 I;  2R7S A;  3Q0W A;  4UZU A;  2JWT A;  4G8X A;  2F5V A;  2PMU A;  3Q9S A;  4JX6 A;  4LIT A;  4G5G A;  3A35 A;  4P1V A;  1R5O A;  1O7F A;  4KMU X;  4JBA A;  2W4S A;  3CW2 A;  1KK1 A;  3IAS 2;  1D3Y A;  4A3J J;  1MBG A;  4L5E A;  4AID A;  2VE9 A;  1VTN C;  4I09 A;  2XIG A;  3I54 A;  3QU6 A;  4LG0 A;  1X19 A;  2Y2Z A;  2GXG A;  3I64 A;  3L9F A;  4F7Z A;  4KIT B;  5HVQ C;  4HNT A;  2GRE A;  3OKX A;  2V1U A;  4U49 A;  3HDD A;  1E63 A;  3BR5 A;  4RM2 A;  1DGR M;  4RM0 A;  4A0X A;  1FBQ A;  4Z05 A;  3B82 A;  4OPS A;  2H1L A;  3FXO A;  2V7U A;  2E19 A;  4MO7 A;  3OP1 A;  3TH0 A;  2OQG A;  3CF5 F;  2OC6 A;  2ZIT A;  2A69 F;  2F5E A;  2MC4 A;  3RQ4 A;  2RQQ A;  3ISP A;  3LFK A;  3V8J A;  1TP4 A;  1FRN A;  3T0Y A;  2BYV E;  4I01 A;  3N4M A;  1ENH A;  4X6A J;  3AAF A;  1MAB A;  1H88 C;  3L2W A;  2DFI A;  2CK3 A;  3C7J A;  2J5O A;  2PQ8 A;  4IHY A;  4LIV A;  2F6C A;  1E64 A;  3LSP A;  2KIU A;  1VLY A;  2IGO A;  1JHH A;  4MQ9 F;  3PO3 J;  2QWW A;  3DKW A;  1WRJ A;  2DQL A;  1ZR2 A;  3GW2 A;  5FD6 A;  3BY2 A;  2DDB A;  1MMN A;  5AN9 A;  3SZG A;  1IN4 A;  5AIQ A;  4KN4 X;  2XT4 A;  3QPT A;  4RB1 A;  3K4J A;  1YX5 A;  2HYF A;  2QM3 A;  2Y9Z A;  4ACB A;  2HNH A;  3HPG A;  3CCJ I;  1WXR A;  5E3O A;  3M4O J;  5IT9 Z;  3W5H A;  2WSS A;  2WJY A;  1FOX A;  4XLE A;  2YX4 A;  4EJV A;  4AM3 A;  2ZL6 A;  2VAS A;  2D74 A;  4DBR A;  4YFN F;  1Z77 A;  4ZGQ B;  2B0R A;  1B9N A;  3CMY A;  5DUI A;  2IA2 A;  2RV8 A;  2EV5 A;  3FBN B;  2LFB A;  4X0C A;  1O57 A;  5ILV A;  2KIM A;  3FBI B;  2PLY A;  5HS7 A;  3OS0 A;  1TW2 A;  2BPO A;  1B59 A;  5L3C A;  3J7Y J;  3KLO A;  3I59 A;  4NDL A;  3WHB A;  2KDZ A;  2HQA A;  4RD1 A;  2DA3 A;  4RGU A;  2D2W A;  1IXS B;  2L54 A;  3BR0 A;  1KTV A;  2R9V A;  4XOT A;  1HW1 A;  3LVB A;  3ZMU A;  4XMY A;  2KJC A;  1X4O A;  2ZCW A;  1MRZ A;  1TYU A;  2UXN A;  3ABM H;  3PNY A;  2H8W A;  4MHG A;  3VYU B;  3EUH C;  2KMU A;  3WHC A;  1ZGJ A;  4ZYH A;  5LEK A;  5M5Y J;  1L3L A;  3S32 A;  2QQ8 A;  1K4S A;  3VNU A;  1DPR A;  4HEA 2;  1UMK A;  3K69 A;  5CVI A;  1TW3 A;  2M4G A;  1D5Y A;  2P6S A;  4H9G A;  5FFZ A;  3BTL A;  4S04 A;  4Q47 A;  2D45 A;  1HKT A;  4JP0 A;  1XB4 A;  2NTP A;  2BGJ A;  1U0J A;  1Z0X A;  4X1E A;  2UWM A;  3PNV A;  4IOA F;  3BQJ A;  2GJK A;  2KRC A;  1Q86 D;  5HLG A;  4NK6 A;  3BZ6 A;  3KP5 A;  4XKB A;  4G9Y A;  4BKX A;  3S2H J;  1WTH D;  5E6T A;  1I39 A;  3RKX A;  1AIP A;  1D2E A;  3UKG A;  4X7E A;  4YG2 F;  2K5C A;  4Y7C A;  5JVT A;  1IC8 A;  4MLO A;  2B7C A;  3H5R A;  5IYD J;  3GO5 A;  3H35 A;  2ESH A;  3GCM A;  1GXQ A;  3R6S A;  5JMC B;  2O8X A;  5HZB A;  4IHX A;  2Y31 A;  3WBJ A;  4HX7 A;  3G1M A;  1KU9 A;  2MLK A;  3F8N A;  3IUO A;  1O8H A;  1DUX C;  4NUB A;  3FWE A;  3JQQ A;  2O1D A;  4G7O F;  3M8E A;  3T1B A;  5ICE A;  2CSO A;  2DCE A;  4ENJ A;  4RD0 A;  4YEI A;  1AU7 A;  1XD7 A;  3I55 I;  1H8H A;  4BGD A;  2ZZQ A;  1JGS A;  4L0Z B;  5TRD A;  1ZLJ A;  2PEX A;  2K85 A;  2LYC A;  3WG7 H;  2XTX A;  3I1F A;  4Q7J B;  4LBV A;  3V7S A;  1KQ5 A;  2MSY A;  1ZRF A;  3B6C A;  2ZZE A;  4FT8 A;  3FXR A;  2KLO A;  1JXS A;  2X6Y A;  1TWF J;  2QSF X;  2Z1D A;  2CUJ A;  2DU9 A;  2EZI A;  3H3Z A;  2O6W A;  1O8K A;  5J40 A;  4HDV A;  3H36 A;  2D3N A;  3LSI A;  2LNB A;  5M5W J;  3HBL A;  3HUG A;  1U3E M;  1SFO J;  3CZ6 A;  3PVD A;  4BQQ A;  2G7U A;  4HX8 A;  2X8K A;  5IK2 A;  3GQ8 A;  3JRB A;  1T0F A;  2RC4 A;  4MIM A;  3U6B A;  3BR6 A;  2DJN A;  2P6T A;  2R7X A;  2CQQ A;  2ZZG A;  2ZL7 A;  3ZZ0 A;  2JIZ A;  3ZC3 A;  3LMM A;  4Y52 J;  4JRA C;  1O3R A;  2WAQ A;  1UG0 A;  5L3G A;  1L1I A;  2EFQ A;  2E2H J;  3VMW A;  4LB5 A;  2E36 A;  3HXL A;  5HS8 A;  1ZAO A;  3PSZ A;  1PVE A;  2E7W A;  4HWV A;  5E8I A;  3G71 B;  1B4A A;  3OYH A;  3CO6 C;  3ML6 A;  2CQ7 A;  2ICW G;  3F8M A;  4CCM A;  1FZP B;  1FNM A;  2B5O A;  3MD2 A;  2MG4 A;  1FPQ A;  2M2E A;  1K6Y A;  4G6T B;  2CYY A;  3EUH A;  4R8H A;  1QGP A;  4AVZ A;  3F72 A;  1WOO A;  2DA2 A;  2FUG 2;  4RS8 A;  1PE9 A;  1KK0 A;  1VND A;  2HXI A;  2O8K A;  4ESF A;  2DOA A;  2NS0 A;  2J7K A;  2QQ9 A;  3B4N A;  1QA3 A;  3ML3 A;  1SFK A;  5FKO A;  1OCZ H;  2Q1Z B;  3KE2 A;  4OZY A;  2QY1 A;  2L9S A;  5FJ8 J;  2D5V A;  1E3O C;  1S7A A;  2IA1 A;  3NAW A;  3QOP A;  1Z6R A;  5E8G A;  2K9L A;  2LRE A;  2VFQ A;  1NK3 P;  2AQF A;  3ZOB A;  4I99 C;  2A3S A;  5D8K B;  2W57 A;  2DK5 A;  3Q38 A;  2XZL A;  1SAN A;  5EDN A;  3O8H A;  4EJW A;  2BOL A;  1BW6 A;  4CZC A;  1TZL A;  5EF6 A;  3C2H A;  4J00 A;  4KT6 A;  2M0C A;  4MNU A;  2XPV A;  1OYW A;  2O17 A;  4A6E A;  3CCJ B;  3SDG A;  4M71 A;  1HQC A;  2VC1 A;  1BC8 C;  4QWQ A;  2NRA C;  4CCO A;  3T51 B;  3CCQ B;  3GFL A;  1P7I A;  2ZNY A;  2XSD C;  1GO2 A;  1T98 A;  3D5R C;  3PSI A;  1NB0 A;  1OGI A;  2MH2 A;  5LFA A;  2NST A;  2RRE A;  2VT2 A;  2TRT A;  3JSO A;  3GTL J;  1JA0 A;  1QGY A;  2CW5 A;  3HSF A;  3GFI A;  2W1O A;  4MTD A;  1HW5 A;  1U5T B;  3EUK L;  1OGJ A;  4N9I A;  5H20 A;  3OYG A;  2W7N A;  3CC2 I;  2GK6 A;  3WXM A;  3GBG A;  1TLL A;  4YAW A;  1LPQ A;  3C18 A;  2BN4 A;  4Z4Z A;  3FDY A;  4A5M A;  3PA1 A;  4Z4V A;  3O2P E;  1GV5 A;  2VNJ A;  4AIK A;  3BR2 A;  3JRI A;  3BPV A;  4PJM A;  1X1P A;  1JJ2 B;  2WC2 A;  2ZSI B;  3OYL A;  2HDW A;  3ABU A;  1YTY A;  5HLH A;  2VKE A;  2VBY A;  4P6Y A;  3PIO F;  2GOM A;  5CDF A;  2XGJ A;  2WJV A;  3F21 A;  4HBL A;  3WTZ A;  2M1B A;  2X0K A;  4UV9 A;  3ECH A;  3RYR A;  2BSA A;  3A0B C;  1OCP A;  4IVN A;  1UCR A;  2CQX A;  2FOW A;  3DPL C;  1YLO A;  3H94 A;  2CRV A;  1VQO B;  4ZZL A;  4V19 K;  1OFD A;  2QZ8 A;  4YZ0 A;  4CYD A;  3DP7 A;  1X4P A;  4IOC F;  3L2V A;  4LLN A;  2ZXH A;  4GYG A;  3PNT A;  4FE7 A;  3F8C A;  5D8L B;  3QYB A;  4BXX J;  3DEU A;  3HL2 A;  1FBS A;  3KZZ A;  4CSW A;  2JVG A;  3LST A;  2VBU A;  1WJ5 A;  4WXH A;  4P6V F;  3CD6 B;  1XS9 A;  4LMY A;  1H85 A;  2LY9 A;  3A3B A;  3B8H A;  1EA0 A;  5BPI A;  4KH3 A;  1PP8 F;  2HXO A;  4XRF A;  1FYM A;  3LSG A;  2BSP A;  4Z6Y A;  4HE5 A;  2DI3 A;  1KQS B;  4FIS A;  2C2W A;  1U5T C;  2NSP A;  3CUQ B;  5IP9 J;  1LE8 A;  3QOD A;  2YU9 J;  2FSW A;  1U2R A;  3ISX A;  5A88 A;  1R71 A;  5GV8 A;  1HSJ A;  3CJQ B;  1WDT A;  4PAB A;  5HOD A;  5DD8 A;  1VQ5 B;  4W8Q A;  4E7S A;  4NCN A;  1GV2 A;  5IP6 A;  2QUF A;  3D1N I;  2QGU A;  4A0Z A;  1SC7 A;  4XSX F;  1NHA A;  4E70 A;  1IRX A;  1R58 A;  4XLF A;  4GCV A;  4P3I A;  1AKH B;  2VBM A;  1MBF A;  5IOZ A;  1VQL B;  2ETH A;  3IRQ A;  2DCU A;  1VQP I;  2QDX A;  3G1O A;  3FX3 A;  2RNJ A;  4V2F A;  4RD4 A;  3HSE A;  2V4D A;  2QBY B;  3PSF A;  4RAG A;  3MMP A;  3M1E A;  5LHI A;  2IJL A;  4N3G A;  5BPD A;  5GAE J;  1OR7 C;  2M4K A;  2L9V A;  1BA5 A;  3L2R A;  1QJV A;  1GAW A;  3LNQ A;  1VQP B;  1GUU A;  2BY0 A;  1OOC A;  4RD2 A;  2DBB A;  4BQN A;  4FXU A;  4BDZ A;  1OB5 A;  2VN2 A;  3UR3 C;  1RQP A;  3K4L A;  3O3K A;  3WWG A;  3IL2 A;  3GEZ A;  2UZK A;  1WI9 A;  3BG7 A;  1A04 A;  3OYF A;  3PFI A;  3P9K A;  2EA4 A;  2NS8 A;  4UHT A;  4AC9 A;  3C2G A;  4XNF A;  1IRF A;  4XKV A;  3ASR A;  3W2A A;  4B4D A;  1TL8 A;  2RVC A;  3ZQF A;  2YX7 A;  3OYB A;  2R92 J;  4KA4 A;  2DDA A;  1Y1V J;  2GQQ A;  2EK5 A;  1V5G A;  2VLA A;  1DG1 G;  1M1K D;  2IAI A;  3PET A;  4WWC A;  3N90 A;  3FKI J;  1V0E A;  3BC9 A;  2VJJ A;  3QFT A;  1IDK A;  2Q6I A;  4W8R A;  2ZJP F;  4HLY A;  1YFH A;  1HLV A;  1XDU A;  3CME I;  2R7Z J;  4XIC A;  1BJA A;  2WAQ N;  4HF0 A;  5DNS A;  1QRY A;  1Q1V A;  3V7R A;  4EM1 A;  2EFN A;  3VSL A;  5KSW B;  4AF7 A;  5FLX Z;  2ELH A;  3HJE A;  4P1W A;  4IJA A;  3BJA A;  1QNT A;  2KPM A;  1SVL A;  2E1M B;  2NOJ B;  4QLC U;  3MKZ A;  4XLA A;  1OCR H;  1UD5 A;  4MFD A;  2H8R A;  2FD5 A;  3WGH A;  3OR1 C;  2D3L A;  1S29 A;  3NWS A;  2ISZ A;  5B6I A;  2BEO A;  3DEE A;  1D5V A;  1O8F A;  1IA5 A;  2F1L A;  4CA0 A;  2QSG X;  3GLL A;  2ZXI A;  3WNB A;  1MMA A;  2GZW A;  4C3J J;  4BHB A;  2E5N A;  3LSJ A;  2VBV A;  3OE7 A;  2OAZ A;  2JK3 A;  5L3D A;  4X05 A;  2Z8G A;  1QA2 A;  3K6G A;  3CCQ I;  4ZV4 A;  3HRS A;  1LUJ B;  2WA0 A;  4M9Z A;  3NWT A;  1O3S A;  1HKS A;  2XF5 A;  1TWG J;  4HF1 A;  1IXC A;  1WOP A;  1YIT B;  4Y17 A;  2DOE A;  9ANT A;  1WCM J;  5C44 J;  3FHZ A;  5E1X A;  1X3Z B;  2CFX A;  1F36 A;  3GVA A;  3OJX A;  5EZG A;  2DYI A;  2HTS A;  1GT0 C;  1IAW A;  3IWZ A;  2DAO A;  2KDO A;  2VI6 A;  4QHY A;  4BXU A;  2NNN A;  1Y39 A;  1GHC A;  3U6K A;  4B47 A;  1F20 A;  2ZBU A;  2CV0 A;  1MZB A;  5FFX A;  1VQ8 B;  4A93 J;  4NNJ A;  1J2X A;  3F8B A;  2STW A;  4A3G J;  4G12 A;  3ZRG A;  3LQ6 A;  2L3D A;  4YIR X;  4M3D A;  3ZBU A;  1HF0 A;  1W0T A;  4AD9 A;  4ZYE A;  2HOE A;  3COA C;  1M1E B;  4BJ5 C;  4YAO A;  2RQP A;  2HKO A;  1D8T A;  2EFG A;  1TT0 A;  3HB9 A;  2JA6 J;  5HDK A;  1T38 A;  2PYG A;  4M73 A;  1KQ9 A;  2X1C A;  5M5X J;  3E5X A;  1X2M A;  1OB2 A;  5H6Q A;  1VJS A;  4LB6 B;  1OIS A;  3N6Z A;  2JJ2 A;  2EH3 A;  2EFP A;  2JPC A;  2VQG A;  4U88 A;  1R49 A;  3CCU B;  1FOK A;  2H94 A;  1ZQ3 P;  3U1K A;  4CGZ A;  4X7D A;  1COW A;  4DNR B;  3K9T A;  1LEA A;  4PAA A;  2IPQ X;  2XZP A;  4FWT A;  1W7P D;  1GAQ A;  1RRJ A;  1W36 C;  1KCD A;  3ULQ B;  3BJO A;  4MXN A;  5J1U A;  2VQH A;  3PUF A;  3EET A;  3AST A;  4IX7 A;  1EFR A;  1QH0 A;  2HOT A;  3HYI A;  3UW0 A;  3CMM A;  5DCM A;  1XE1 A;  4ENM A;  1S72 I;  1PYV A;  4P55 A;  3LA7 A;  4KFC A;  1E2X A;  3GQ9 A;  3HRT A;  1P7J A;  3CC7 I;  2HDD A;  1VF7 A;  2QCO A;  4YEL A;  1LVA A;  1FTZ A;  2PMZ A;  3ZN1 A;  3F22 A;  4D5C A;  1JNY A;  1LFP A;  1Z6T A;  2XV4 S;  1W0K A;  1GVD A;  1A6I A;  5F4M A;  2BW3 A;  4B8X A;  3R6J A;  4PC1 A;  2F5C A;  2M7A A;  5DCF A;  5LRR A;  3RIR A;  2OCC H;  3CC4 B;  1GDT A;  4CYC B;  2E7X A;  5TR9 A;  3CP2 A;  3JRF A;  3HOT A;  2KZV A;  1BR1 A;  1WGX A;  2DFH A;  3J80 K;  4OJ5 A;  2EFO A;  1LFB A;  3PUM A;  3RZO J;  4EJO A;  3CB4 A;  3OZU A;  5ERI A;  1UHS A;  2COB A;  3MZ8 A;  3JRD A;  1OCC H;  2R7V A;  4P5O A;  1D1B A;  2HI3 A;  5K1Y A;  3VMV A;  1EP1 B;  2XRO A;  2V7Q A;  1ZGW A;  4NC6 A;  4MFE A;  1LJ9 A;  1AIR A;  2HOA A;  4OIQ F;  2Z2S B;  1QFY A;  1QRC A;  2K3P A;  2H27 A;  1S8N A;  1VI0 A;  2P8T A;  3DF8 A;  1VZ0 A;  2VT3 A;  1OFE A;  2XF7 A;  1PJ7 A;  2Y48 A;  1AKH A;  1HXD A;  2O9L A;  1SM4 A;  3P9I A;  3WQZ A;  2K9S A;  1SAX A;  4UUV A;  3E0J B;  5IYB J;  1N78 A;  2V1X A;  2NS7 A;  3EDP A;  1D0Z A;  2HU9 A;  3MKL A;  2NXN B;  5JR3 A;  5LBQ A;  3HTS B;  3RKW A;  4IRI A;  1DBG A;  2XPU A;  1EV7 A;  3DXJ F;  4W1U A;  1BLI A;  1O3T A;  4HE6 A;  3HOS A;  2VC0 A;  2IXS A;  5CKT A;  2D1H A;  1QUF A;  2V79 A;  5F64 A;  1YW8 A;  4RAF A;  5FKM A;  3BCD A;  2STT A;  2QQA A;  4ESJ A;  3L2C A;  3B78 A;  3CMA I;  2OTJ I;  3FMS A;  1XCB A;  2B0L A;  2HFH A;  3DU6 A;  3KEQ A;  1UD2 A;  1VHO A;  1J7K A;  3GF2 A;  4XN0 A;  3JCU C;  2M30 A;  3E97 A;  3P5J A;  1D1A A;  3TDU C;  4A3L J;  4OWR B;  2F5D A;  1ZUN B;  4JQF A;  3OW2 B;  2QVO A;  3DBH B;  1G3T A;  1ZK8 A;  5TY0 A;  2KRF A;  3A1P A;  4D9J A;  4X7C A;  4V2G A;  4G6D A;  2EIJ H;  5TJJ A;  2GJP A;  4C43 A;  2DYS H;  3P9C A;  4B3A A;  3JAM Z;  2RC6 A;  2OJE D;  1TWC J;  3FK6 A;  3SEQ A;  1E43 A;  2KIQ A;  3M3Y J;  5K5R A;  2LR8 A;  4EQQ A;  1QG0 A;  3R61 A;  4IO9 F;  2VQC A;  3E7L A;  1YIJ B;  4OOV A;  4GQN A;  2HVS A;  2BV6 A;  4Z4S A;  1OHH A;  1MBK A;  4L8J A;  1FIP A;  1XSX A;  2DMP A;  3IHU A;  2FQ3 A;  2KP6 A;  5EMN A;  2IBD A;  4IPA A;  2CJJ A;  4BL0 B;  4DW6 A;  4XKC A;  5FB2 A;  2IRF G;  4BEH A;  3GTK J;  3JQR A;  4X06 A;  3ZQQ A;  2XGD A;  4XON A;  1D0Y A;  4DK0 A;  2X6X A;  3IH3 A;  2M45 A;  3K0L A;  5FLV A;  5F1J A;  3OIQ A;  4WWV A;  1WH7 A;  4DYQ A;  4DOZ A;  4BAY A;  5GTH C;  1MND A;  3JX8 A;  4XID A;  3BPX A;  4Z4U A;  3BZK A;  4ZCL A;  2BXY A;  4EGZ A;  2K4J A;  5J6X A;  4CHU A;  1WJC A;  1G3W A;  2V9K A;  2UUZ A;  1XDS A;  1E1R A;  3OOC A;  1USS A;  2TCT A;  4UVC A;  4C3H J;  1I50 J;  1KCC A;  2BE5 F;  1XGN A;  1W5C C;  3K2A A;  2GM4 A;  1ETK A;  2XHK A;  1O7L A;  2FBK A;  3V4G A;  1HG8 A;  1W7P A;  3LL7 A;  2R7D A;  3LMW A;  5A89 A;  2XRL A;  1G6N A;  3PL8 A;  5J8C A;  1ERD A;  1K28 D;  1HW2 A;  2Q2E B;  2DPU A;  2D1V A;  1N08 A;  3NB2 A;  1FJL A;  2JMW A;  4YAF A;  4P22 A;  3RPU D;  1GVJ A;  1WJF A;  1ONV A;  3V42 A;  4AU7 A;  1ULY A;  2PLF A;  4PUS A;  1KD1 D;  1YJN B;  1IRG A;  3BP8 A;  3KL9 A;  1V55 H;  3ELK A;  4Z4W A;  4XK4 A;  5IP7 J;  3Q6Q A;  4KIS A;  1XGS A;  2LF8 A;  1BN5 A;  5C4X J;  1W34 A;  3OWT A;  3I59 B;  1B2R A;  3RDI A;  3FXJ A;  1S4M A;  2VFM A;  2XGX A;  5HNH A;  4WX9 A;  3S3O A;  2IGK A;  1J09 A;  3RIQ A;  1QZY A;  3CCR I;  4QSH A;  1OKR A;  3CJN A;  3RYP A;  4CO8 A;  2QN6 A;  3K10 A;  3GTM J;  1U9N A;  1FP2 A;  1LNW A;  3KP7 A;  1MJA A;  1RWR A;  2FU4 A;  3DKX A;  4M3F A;  1MBH A;  2ZJQ F;  3HOW J;  4MYU A;  1BPL A;  2XZO A;  1I3Q J;  5EGO B;  3JR9 A;  4UUS B;  3ZQ7 A;  1MJ9 A;  2FQ4 A;  3BJ6 A;  1TTY A;  1PJR A;  1YW9 A;  4WF2 A;  2MW8 A;  4F7D A;  3I56 B;  1SD4 A;  3I0T A;  4KUM A;  5KCM A;  1UB9 A;  2R7U A;  3GME A;  3QP5 A;  5ICG A;  4UUS A;  4JX5 A;  4OIR F;  3E1Y E;  1Q7Y D;  4YRV A;  3GVK A;  1QQI A;  2VBW A;  4XRM A;  3CLQ A;  4F52 A;  3P26 A;  1I27 A;  1JGG A;  2OYN A;  3I56 I;  2GOX B;  1QHG A;  2Q0O A;  4M9S A;  1SD5 A;  3RPQ A;  4G1B A;  4AYB A;  2PFB A;  2VKV A;  3KEY A;  4ZC3 A;  2CWE A;  3LO8 A;  3CQZ J;  5CLS A;  5LGN A;  5LMZ A;  2XAH A;  1FX7 A;  2MFZ A;  2PBI A;  1KTW A;  2WV1 A;  4QTR A;  3LQE A;  1UMQ A;  5J4V A;  3J7A Y;  1RUO A;  2ZZF A;  3GVL A;  3D26 A;  1ZG1 A;  1N75 A;  1UHW A;  1WJB A;  1IHM A;  4BNC A;  1PXZ A;  1ETW A;  2CND A;  3OSF A;  1KMH A;  2A5W A;  1XG2 A;  3U2Q A;  2W48 A;  3FIS A;  4A3M J;  1DP7 P;  4ZTJ A;  5LGT A;  2JSP A;  1CF7 B;  2ESN A;  2X3H A;  3KET A;  2ZXJ A;  2RAE A;  2V7W A;  1YJW I;  1I7P A;  3CDL A;  1JUS A;  3ZQI A;  3ZN0 A;  2DA1 A;  2R6H A;  4FHT A;  4KMF A;  2WZP P;  1JTX A;  2XVC A;  3TW7 A;  4FE4 A;  3CDH A;  4IHS A;  4ZJZ A;  3IKT A;  5EG0 B;  2WWY A;  4Z1M A;  3VPR A;  1Q1H A;  2V9P A;  3JRA A;  2VUM J;  1BMF A;  2ZTN A;  3AK5 A;  4LK1 F;  4ZDL A;  3RI4 A;  1K4Z A;  2OTJ B;  4NBQ A;  1PUF B;  4N4O B;  3MMY B;  2NV4 A;  2HYJ A;  2ZJ2 A;  2EIK H;  3HEF A;  4LD5 A;  5B1A H;  3K1N A;  1O8G A;  5B66 C;  4LK0 F;  3W6V A;  3I55 B;  3OL4 A;  5HDG A;  3OY9 A;  1QA1 A;  1E17 A;  1BOB A;  2OUM A;  4HOB A;  1BX0 A;  2V7X A;  5EYR A;  1YX2 A;  2NYX A;  3KRG A;  3WY9 A;  2VFN A;  1B1B A;  1IB0 A;  4II2 A;  3VFZ A;  1P4X A;  4G7W A;  4PMH A;  3MZY A;  2CW8 A;  4B43 A;  5D5W B;  1FTT A;  4UVB A;  1LQ1 A;  4RD3 A;  3A02 A;  4Y9R A;  3QRF F;  1SEU A;  2JJ7 A;  1WSR A;  3HOZ J;  1F4K A;  4YZA A;  4KN7 X;  5FO5 A;  4A3F J;  3KLN A;  5GPA A;  1BC7 C;  2BW3 B;  4Z4T A;  1O8M A;  3AVU A;  2AQE A;  1A5J A;  2Y0M A;  3ES9 A;  1S7E A;  2HWV A;  4HX4 A;  1VQ8 I;  3OPO A;  2O7O A;  2EIX A;  3RKY A;  3K4K A;  4I7H A;  1JT6 A;  4Y9U A;  3VO1 A;  1XGM A;  2X3U A;  4M4S A;  2KL4 A;  3L00 A;  5BSY A;  5HXB A;  4EVI A;  3TL4 X;  3BQZ A;  3NEU A;  1ZG5 A;  5IYP A;  1TNT A;  1AOY A;  1TQM A;  4M9X A;  2BY1 A;  2X9D A;  1DBO A;  1YJ9 B;  4DZJ A;  3KYC B;  1H89 C;  4LG0 B;  1EFU A;  3GTO J;  5CVU A;  4OJO A;  1SKY B;  2H1K A;  1BIB A;  3KP2 A;  4IRG A;  4GYI A;  2HMA A;  1UST A;  4BEH B;  2JA5 J;  1KYZ A;  1J9I A;  4LLG F;  5J4Y A;  2QF7 A;  1DU6 A;  3S1N J;  3CCV I;  3LQR A;  4YIF A;  3B90 A;  2DA7 A;  4OPV A;  1VQK I;  2BVN A;  4M6Y A;  4B48 A;  3A01 A;  2RKH A;  1RPW A;  4UZF A;  3ASS A;  1XX5 A;  2JA8 J;  1ORK A;  2G9W A;  3DTE A;  3CES A;  5EGO A;  1B6A A;  4LJZ F;  4J0Q A;  1RQR A;  3DLL F;  1S72 B;  1X3U A;  3CCM I;  4P2N A;  3ASO H;  1IF1 A;  2ID3 A;  2GXB A;  5HZA A;  2XDV A;  2VIX A;  4LOC A;  1BI2 A;  1UG2 A;  4RA2 A;  3ZMT A;  1YS6 A;  4L5J A;  3SXY A;  3A01 B;  2OBT A;  3ASP A;  1D1C A;  3LQQ A;  2CH0 A;  5CPR B;  3BZC A;  1YHQ I;  2CFO A;  5JFR A;  5J1Y A;  4YFX F;  1A36 A;  1W7P B;  2PE3 A;  3FKS A;  3I3L A;  4IEJ A;  4PGG A;  5J35 A;  3GUD A;  4PJ0 C;  3VSK A;  5C4J J;  3EUA A;  3AKZ A;  2MC3 A;  2WR8 A;  5H59 A;  1U78 A;  1BIA A;  3SZE A;  3HPH A;  1RES A;  2LY2 A;  1FDR A;  1G7C A;  3FHN A;  3CUQ C;  4X07 A;  4Z4R A;  2PJR A;  4KYW A;  4I84 A;  1NBM A;  3GLX A;  3T9G A;  4Y15 A;  1MH4 A;  1CQT A;  2R7R A;  1ZR4 A;  2PI0 A;  5D6E A;  2IGN A;  4R79 A;  2E35 A;  2KJB A;  4LGW A;  1F5T A;  1S7O A;  2HZD A;  2M3A A;  2L4M A;  4ITV A;  5J47 A;  1DDN A;  3ZPL A;  1I1S A;  1NDH A;  2OD5 A;  1Q82 D;  1TWH J;  3VSV A;  2XAF A;  2W85 A;  4J19 A;  1W5T A;  1ITY A;  3LFU A;  3QQA A;  1RUN A;  3ERM A;  3CCE B;  2IOU G;  3AL0 C;  2IS6 A;  4W8S A;  4U87 A;  2Z99 A;  3ZXS A;  3WTU C;  3N97 A;  2VOD A;  3GTG J;  3HAG A;  3A4C A;  4PFP A;  5JVG F;  4N0B A;  3JQP A;  4CXF A;  2NVU B;  4IZZ A;  1YIO A;  3A0H C;  2F2E A;  3Q3S A;  2JDI A;  4C2L A;  3K7A J;  4EV0 A;  3W2I A;  1FND A;  4LG3 A;  4M3E A;  2WV0 A;  3L09 A;  1NK2 P;  1MDM B;  1N0V C;  4AIH A;  3OW7 A;  5FLX K;  1R1T A;  2DT6 A;  2VKD A;  4PSW A;  1X2N A;  1FNC A;  1D0X A;  1FSE A;  2LY1 A;  3Q3A A;  2R5Z B;  2OCE A;  2ZME A;  2HDC A;  4G1V A;  3PSS A;  3TBI A;  3S2W A;  2QTZ A;  5HDN A;  1FYL A;  2HGC A;  2P5K A;  4HST A;  4M74 A;  1TYX A;  1OJL A;  1SKQ A;  2DMN A;  4HG2 A;  3HGG A;  3G05 A;  2BVL A;  3QYE A;  2FOK A;  3W5U A;  1QBJ A;  2X48 A;  5F04 A;  2VZL A;  3D5L A;  3A8K A;  5E3M A;  2O3F A;  1T6Z A;  1OGO X;  3ABK H;  3ERE D;  2L7F P;  3HSR A;  2VBK A;  4D7M A;  3FPP A;  4DJA A;  2XF6 A;  3OYC A;  1OYY A;  1WI3 A;  1SFX A;  2RN7 A;  2QGG A;  5FKK A;  2Z16 A;  2P0W A;  3NQO A;  3QFC A;  2BMW A;  4RAZ A;  5JLV C;  4UNO A;  3HTU A;  4UUT A;  2BF4 A;  1ODD A;  2K7L A;  4AYB N;  1Z67 A;  5CVR A;  3WU0 A;  2EZH A;  1K61 A;  3S17 J;  2W84 A;  2COM A;  2J5P A;  1STZ A;  3RQI A;  1MH3 A;  2DW4 A;  2PMH A;  1VQL I;  5H6R A;  1H9G A;  5A2Q Z;  1YW7 A;  4CQJ A;  1OR7 A;  2QKL B;  5DV5 A;  1OFM A;  1DU0 A;  3OMY A;  2Q6O A;  3HKZ A;  3AGQ A;  2BX6 A;  2DQR A;  3HM5 A;  4EJT A;  5EEH A;  4FTH A;  3MQ0 A;  1WP6 A;  5M3F J;  2VFP A;  5F4O A;  3OL3 A;  2ZTG A;  2PEC A;  2A07 F;  1S0U A;  3BTI A;  1DDI A;  1VQN B;  5GPC A;  4R71 A;  1KON A;  2CUE A;  2E60 A;  3NRV A;  2RDP A;  2AS5 F;  3OOU A;  1LEB A;  4L9V A;  5E1Z B;  4HPQ A;  2ECB A;  4PGH A;  2OTL I;  2Y30 A;  4K1X A;  3E3V A;  4M2L A;  1K73 D;  3VWB A;  4BXF A;  2FJ1 A;  2VNH A;  3IAM 2;  3ONQ A;  1QGZ A;  3WOD F;  4F3Q A;  1YO5 C;  1I8D A;  1L0O C;  3HKZ N;  3BCB A;  4RB3 C;  1JA1 A;  1JI8 A;  1OFC X;  2MD5 A;  4L18 B;  1KU3 A;  2K02 A;  1DPU A;  4BBR J;  2V1D A;  2XND A;  1O8D A;  4KT5 C;  1UD4 A;  1D1N A;  2R5Y A;  2BM5 A;  4WZE A;  1JUM A;  3W2E A;  2H6B A;  1ETY A;  4LC0 A;  3E6M A;  3DQV C;  1OGM X;  1EA3 A;  4GO1 A;  5K7H A;  5K7F A;  1IDZ A;  3NAU A;  2VNI A;  4PCQ A;  4OAZ A;  4A12 A;  1TWA J;  2JN9 A;  3SZT A;  3SQV A;  3KIO A;  5D5X B;  3TOA A;  1HA8 A;  2OBS A;  2XB0 X;  3R0J A;  1E0E A;  4P3Y A;  4BE0 A;  1P6R A;  4IRH A;  4O3M A;  1IV6 A;  2DK8 A;  1HKQ A;  2VQL A;  4TV7 A;  4B44 A;  1C0W A;  3S15 J;  4C0S A;  3ZZT A;  1N8R D;  1O8E A;  3BH6 B;  3GXO A;  1K6O A;  4YC5 A;  5FO0 A;  3BG6 A;  2V1N A;  1QZE A;  3F8F A;  1MGT A;  2QKM B;  5L46 A;  3QSY A;  2KVO A;  4IF4 A;  5LHG A;  4FAS D;  1ELO A;  4MTE A;  2GIV A;  1Y8Q B;  1TUI A;  3SY2 A;  3CXC B;  2M34 A;  2BVM A;  1FRQ A;  2JA7 J;  2WYR A;  5D5U B;  2VBS A;  1YOV B;  1KQ8 A;  4UZE A;  3TP0 A;  3PQK A;  2R7W A;  4OOX A;  3DKY A;  2IEK A;  1DQU A;  3E6C C;  1CZF A;  4WZL A;  5FO1 A;  1KA8 A;  4GDF A;  1QVU A;  3QAH A;  1WHU A;  5GAH J;  5ED4 A;  4OMY A;  2GJR A;  1TBX A;  4QPO A;  2CS3 A;  2FRH A;  3CUQ A;  2CW0 F;  1O4X A;  2V7T A;  4RLF A;  1ZYR F;  4U0V A;  4D5F A;  4OIO F;  2IP2 A;  3JTH A;  3VEP A;  4OU0 A;  3CC4 I;  1J5Y A;  4TKO B;  4UB6 C;  3DFG A;  1QQ1 A;  2X51 A;  2GA1 A;  2HPI A;  1QFZ A;  3DEW A;  1R22 A;  5EG0 A;  3JRG A;  3AG2 H;  3CC2 B;  2CO5 A;  1T95 A;  3CF2 A;  3PUN A;  2M87 A;  1IN5 A;  1CGP A;  2IVM A;  2XKP A;  5IT9 K;  2EBI A;  4BHP A;  3LSM A;  4RB0 A;  2YSR A;  5FD5 A;  6PAX A;  4RDL A;  3VB2 A;  5AON A;  2PJR B;  4E7K A;  4QVA A;  1S9H A;  2V26 A;  3GRH A;  2VKH A;  1EFT A;  2EZL A;  3ZP5 A;  5F0H A;  1KYW A;  2GQF A;  2QA4 B;  4HW0 A;  4H4K C;  2FVG A;  2PMD A;  5EEG A;  4HLX A;  5FGM A;  2QMU A;  2KT0 A;  2DEU A;  3QP6 A;  3ZR8 X;  2ODL A;  1JRG A;  2YUH A;  3SLN A;  2ZO4 A;  2LKX A;  1HCR A;  3FKJ A;  4XN3 A;  4E7Z A;  4HQE A;  5HNF A;  5IPA A;  2KFD A;  2I5U A;  3ONU A;  3T53 B;  1QVF B;  3OSG A;  1WPC A;  2XTY A;  4NK8 A;  4XLN F;  5JLX A;  4OOI A;  1IZ1 A;  1JUP A;  4LIU A;  4NC7 A;  4DBQ A;  3VMF A;  3PFY A;  2QEX I;  4XD7 A;  4L9N A;  2Z33 A;  2X1D A;  4JMQ A;  1MDM A;  4ESB A;  3BY6 A;  2M0M A;  2K4B A;  3CRZ A;  4D1Q A;  4A3E J;  4PGO A;  3GQB A;  3CMA B;  1QUE A;  3AVT A;  3OS1 A;  2A5Y B;  4XSZ F;  1AHD P;  1LLW A;  5KW9 A;  2HYG D;  3SYJ A;  3RZD J;  2HPM A;  2W24 A;  2E71 A;  4IL6 C;  1YE9 A;  2CUF A;  4X0G A;  2W25 A;  4I76 A;  1ZN2 A;  1U8R A;  4YFK F;  3P4G A;  1T2K A;  2F4N A;  1JHF A;  2JRT A;  1BR2 A;  2C5B A;  3TMO A;  4O5V A;  3DBL B;  1J75 A;  1R5G A;  1VQ9 I;  5A8A A;  2E1M C;  5FKL A;  1A35 A;  2GIZ A;  5BNG A;  4QIW N;  1CF7 A;  1FC3 A;  2BM7 A;  1RMG A;  5E79 C;  1MSE C;  2K9N A;  2A61 A;  2LDU A;  2ZC2 A;  2ME0 A;  2BM4 A;  4B09 A;  1XMA A;  5E18 F;  2E2J J;  3ABL H;  5K7Z A;  2P81 A;  3WU2 C;  2RNG A;  3H92 A;  2CMP A;  1X0C A;  1VQ9 B;  2WTE A;  1YJ9 I;  4WCG A;  2BXZ A;  2LK2 A;  3FMR A;  3TDZ C;  5HS9 A;  5KHD A;  2AXT C;  5L3B A;  1R5H A;  1IN7 A;  2JVH A;  5FL7 A;  3OJW A;  4IQ4 A;  3HRM A;  1XC5 A;  3WTV C;  1IJW C;  4Y4R A;  1YRN B;  2Z6B D;  5C1C A;  5FLM J;  1BX1 A;  3TKY A;  4ABZ A;  4MGR A;  4L0Y B;  2QQB A;  2NVT J;  3CME B;  4A5N A;  2EIL H;  3W2H A;  2O0W A;  2EJR A;  3PM1 A;  4M3G A;  2FBH A;  4XBF A;  3EQN A;  2V6C A;  3MAJ A;  4OOS A;  3E6D A;  1I18 A;  1G3S A;  4OP7 A;  3JRH A;  1QZZ A;  3K1P A;  4BAC A;  4E7J A;  3T8R A;  4G7Z F;  1XFO A;  2R7Q A;  3A8J A;  2FNA A;  1Y6I A;  2LOO A;  1HZE A;  2R93 J;  4RGS A;  2GWR A;  1BJZ A;  2L2O A;  2R3S A;  3J81 Z;  1E3X A;  2M5S A;  1NG7 A;  1ON1 A;  1QPM A;  1KGS A;  2R4G A;  4S0H B;  4DGW B;  4U7B A;  1PKV A;  3FJO A;  1SAU A;  3F6O A;  4LFU A;  3ZUG A;  5THX A;  2Y69 H;  3CLO A;  5KNL A;  4JYK A;  2BM0 A;  4M6X A;  1CLW A;  1BBY A;  3G6E I;  2CV2 A;  2VBZ A;  2UVE A;  1TT5 B;  1YIT I;  2X85 A;  2Z5U A;  1E3H A;  1ZKG A;  1ZG3 A;  3DTK A;  3V8L A;  1U6G A;  2CV1 A;  1HA3 A;  2W6I A;  3FXM A;  3BY1 A;  2V7F A;  1KK2 A;  2LG4 A;  4RLQ A;  4XLH A;  1R36 A;  4MQV A;  3VYT B;  3VYS B;  1RET A;  4YZQ A;  4OJL A;  4OIN F;  1E3Z A;  2D9R A;  3VNV A;  1RU4 A;  2ZME C;  3IC7 A;  1B8I A;  1IXR C;  3WU1 B;  1ZRE A;  1O88 A;  3OYM A;  3BRO A;  3I5U A;  1VQ7 I;  2VJ5 A;  3BC8 A;  4BBS J;  3SEJ A;  4X7F A;  2JZY A;  3H9Q A;  2XRN A;  1KU7 A;  1LDK B;  4BE2 A;  3SJP A;  1AMO A;  4EM0 B;  2P7V B;  1Y8R B;  4CCL A;  3IH4 A;  3QE2 A;  4XOR A;  5CQE A;  4C9Y A;  2EB7 A;  3VR6 A;  3LOC A;  4E0F A;  2O04 A;  3K70 D;  4CCK A;  3S1M J;  1FBU A;  3CCS B;  2PIA A;  3F0C A;  1UFM A;  1Y0N A;  2JTV A;  1R4M B;  3BOQ A;  3AVW A;  1POG A;  2DFE A;  2RGV A;  1F1Z A;  3GIR A;  5BSX A;  3G4S I;  4ZYG A;  1BHE A;  3QPH A;  3S1R J;  1LLZ A;  4DZP A;  2GXA A;  1ZGA A;  2DOD A;  3KYL A;  4G6I A;  2OPT A;  3DCF A;  4ZTF A;  3BLY A;  3QU3 A;  4HZF A;  3JSP A;  4ZDP A;  1REP C;  1P4A A;  3RKQ A;  3H5N A;  2V9V A;  1JTA A;  3W2G A;  3U9G A;  2BV3 A;  2V6E A;  3U1D A;  3W2W A;  3NAR A;  2Q8K A;  5E3N A;  4PFO A;  2ZKZ A;  3REO A;  1KRH A;  1Q9S A;  5F6F A;  4DQK A;  5DYM A;  2G0E A;  3ZQH A;  5GV7 A;  3FIW A;  3FPK A;  1P4W A;  4IHT A;  2FX3 A;  1R1U A;  1DGW Y;  2EWN A;  2EV6 A;  5FA6 A;  1LFU P;  4G7H F;  2C6Y A;  2MGQ A;  3W3C A;  4U4B A;  1GXP A;  1K9M D;  3RY8 A;  5EJC A;  4ASN A;  4KIC A;  4CIC A;  1UD6 A;  3MN2 A;  2BM1 A;  4P25 A;  5IYN A;  5KK1 A;  1IB4 A;  4KDP A;  2CG4 A;  2ZB9 A;  3IP4 B;  4L5I A;  2M8G X;  1YLF A;  4TSF A;  4A69 C;  2LLK A;  3HRU A;  2F48 A;  4IXA A;  2EFW A;  1N77 A;  2LZJ A;  1VQ6 B;  4QPQ A;  3BH7 B;  3ZMS A;  1M90 D;  1Y0U A;  3PA2 A;  2FML A;  3S14 J;  3T56 B;  4BH9 A;  2VXD A;  4GXO A;  1G7S A;  2MA3 A;  3WBK A;  3OYI A;  2FBI A;  4AF6 A;  4EH1 A;  5DM6 F;  3FXL A;  1H8E A;  2OTL B;  2OZ6 A;  4OJ6 A;  2JT1 A;  1WJD A;  1UEL B;  1D8J A;  5AIP A;  1WJA A;  1UAA A;  2QSH X;  2IS4 A;  2R7T A;  3V7A A;  5A2Q K;  2XTW A;  2X1E A;  1Q81 D;  2F4I A;  3HGY A;  3LA3 A;  2PN6 A;  3Q6R A;  1T6Y A;  5FIU A;  4FX0 A;  4W8T A;  4IKF A;  3WE3 A;  1H9T A;  4CCJ A;  4U7D A;  1OB0 A;  3EQO A;  1HDD C;  2TDX A;  3VSU A;  4N3N A;  2XNC A;  3H1C A;  5KVR A;  1O8J A;  4MR0 A;  1X1D A;  5KAI C;  1HF2 A;  1F9N A;  1ZAR A;  4ENK A;  1FT9 A;  1YRN A;  1ZRC A;  1WMR A;  3OAA A;  1FY7 A;  1SFU A;  4NB5 A;  3HUG B;  2EQR A;  3CUO A;  1IJF A;  4P9S A;  2JSC A;  3WGI A;  1V0F A;  4YDT A;  1JKQ C;  2EZK A;  2CGP A;  1WZ2 A;  4RB2 C;  3C2B A;  3W6J B;  4DQ2 A;  1W87 A;  2QXZ A;  1QX4 A;  1T08 B;  3DPU A;  2V31 A;  1W9X A;  3KCC A;  1FNN A;  1XSV A;  3AVY A;  1W35 A;  2BZT A;  4ZDO A;  1TTT A;  3OS2 A;  4XQF A;  4B3G A;  4YEJ A;  3I9V 2;  3FY3 A;  2NT6 A;  3OFN A;  3D5S C;  2DA5 A;  4HA8 A;  5IT3 A;  1JTY A;  1RZ4 A;  2BHZ A;  1IN6 A;  1T33 A;  5DTD A;  2FX0 A;  1EP2 B;  2FXA A;  1K8A D;  3JRC A;  1U9O A;  2YU3 A;  4BJ6 C;  2OV7 A;  2CC2 A;  3QOE A;  2NPF A;  3O6B B;  4Z4Y A;  2E5Z A;  5FRO A;  2JA2 A;  2E1N A;  3CJT B;  3F6V A;  3HC7 A;  2ZBK A;  3GVJ A;  4DQL A;  3DV8 A;  4ACA A;  2CRG A;  4EM2 A;  2VON A;  3WGG A;  3I58 A;  2MH9 A;  4I2O A;  3MCA A;  3R60 A;  3CCL I;  3BR3 A;  4WK8 F;  2LF7 A;  3LAJ A;  4YCQ A;  4E7H A;  2OQR A;  2OZU A;  4O6J A;  1J9Z A;  2F5F A;  1F60 A;  5IYR A;  3H09 A;  1FP1 D;  4PJL A;  2E2I J;  2V5I A;  1QPI A;  2LBF B;  4ETS A;  1HBX G;  3ASQ A;  2G0Y A;  5LD2 C;  2EV0 A;  4WZK A;  2R5Z A;  4A3D J;  1T8I A;  4YHB A;  4CYC A;  3VOE A;  2JRM A;  3LSH A;  3CCS I;  1B9M A;  2XAS A;  3JRE A;  1IUF A;  3VST A;  3MKW B;  1RIO H;  1BM9 A;  2KQR A;  4N4N B;  4KKS A;  1VQM B;  4F93 B;  4M3B A;  1XQB A;  3AL0 B;  4QUZ A;  2DLL A;  1E79 A;  2AO9 A;  2K86 A;  3KEW A;  1MNM C;  2X0L A;  4DNC A;  2OK7 A;  1X1A A;  2XT2 A;  4FCY A;  2OA4 A;  2E1C A;  1MBJ A;  1KJZ A;  2K9M A;  1XTA A;  2VJ4 A;  3GTQ J;  5C1E A;  3O8G A;  4L9T A;  1S6L A;  4CH7 A;  3OR2 C;  2DY1 A;  4TMW A;  2MBF A;  3SUC A;  4BS9 A;  2ELK A;  1K79 A;  1SD6 A;  5J8F A;  2X4H A;  3OEH A;  4A3K J;  1Z3Y A;  1W5S A;  2OU2 A;  1K7A A;  1G4D A;  2EIN H;  2JN6 A;  4HQM A;  4BQA A;  4HRI A;  3DTI A;  3JW4 A;  1RR8 C;  3GFM A;  3CO7 C;  1HDP A;  3TO6 A;  4HNU A;  2QE7 A;  3CCR B;  2LKS A;  3ZZU A;  2DYR H;  3MVP A;  3TO7 A;  1PUE E;  1U5T A;  1UD3 A;  2HDN B;  2CQN A;  1YHQ B;  1Z7U A;  1TC3 C;  2P4W A;  1QA6 A;  2VL8 A;  1FLI A;  3H9G A;  1EH8 A;  2FE3 A;  3M8F A;  3GZ6 A;  1EXM A;  1OCT C;  5DN6 A;  3WTW C;  2M7B A;  3HOX J;  2L4A A;  4F55 A;  3ZMZ A;  4E4H A;  3EYI A;  3CC7 B;  1FIA A;  4DYC A;  4E7L A;  1CNF A;  3FM3 A;  3LYC A;  3B73 A;  2C5H A;  4DYR A;  1PJ6 A;  4LBZ A;  3OOP A;  1YX3 A;  5LLQ A;  2JJ1 A;  1OCO H;  1N07 A;  3QPS A;  5J3O A;  2EPF A;  2HVQ A;  3FK7 A;  1DDG A;  5IYC J;  2F1M A;  3GZN B;  1JJ6 C;  2DFF A;  3ZPP A;  5GAG J;  1VQ6 I;  4E6K G;  4ZCI A;  2EWE A;  1T39 A;  2IA0 A;  2LBF A;  3OYD A;  3TOB A;  4I0B A;  5JI6 A;  3TED A;  2FF4 A;  2O6G E;  1ZH5 A;  3DDY A;  1QGA A;  1CNE A;  3IKV A;  4HIZ A;  4PSX A;  2UXX A;  3EYY A;  4UXN A;  1MSF C;  1WU8 A;  3F9K A;  2XSJ C;  4EJU A;  3R6K A;  1IRZ A;  2FNP A;  2XGE A;  3KFW X;  1B8I B;  5DDG A;  4B3F X;  3HG9 A;  2ZME B;  3SFZ A;  4HSR A;  1N0U A;  4RCZ A;  1U8B A;  1XGO A;  2R7F A;  4RPB A;  2GA2 A;  3CCY A;  5BOX A;  3ZGK A;  2NTB A;  4Z03 A;  2P5L C;  3P27 A;  2LH9 A;  3VDX A;  1KC8 D;  4XOP A;  2L7Z A;  4A2U A;  5E3L A;  4BUP A;  1RKW A;  4BE1 A;  3M9A A;  1QHH D;  5CYV A;  3QFR A;  1KZL A;  4A3I J;  1EE6 A;  3L1P A;  2JUG A;  3C1D A;  4EMS A;  1NTC A;  2DA6 A;  2K9Q A;  1MIJ A;  1A8P A;  2VOO A;  4KKU A;  3E5U A;  1JKP C;  3D0S A;  1SD7 A;  2EA2 A;  1SMY F;  3H5A A;  2C4T A;  3ZPN A;  1T0F C;  5BS6 A;  3E6B A;  2WB1 A;  1K4T A;  2PMZ N;  3ABT A;  5IY5 H;  4P26 A;  3FZV A;  2BY3 A;  2W82 A;  4XRS G;  3S2D J;  3ECO A;  2LC2 A;  1X1B A;  3LSR A;  1G3Y A;  4Z06 A;  2NTQ A;  1RC9 A;  1X58 A;  4MEY F;  2VYQ A;  5F27 A;  3E5Q A;  2VXZ A;  4KIF A;  4BJT A;  1P4M A;  3OEE A;  1VFC A;  4Q4Z F;  1B72 B;  3P7N A;  2XGC A;  1T5E A;  1IDY A;  3K4C A;  1KU2 A;  2DMU A;  4W97 A;  2B7E A;  3NE5 B;  1YYV A;  1ETQ A;  1K78 B;  1ZM9 A;  3BCF A;  2BHY A;  1XG1 A;  1E62 A;  2ECC A;  3GWZ A;  1VQ4 I;  5E1W A;  4RDJ A;  5IOY A;  3KP3 A;  1XSD A;  3DLA A;  5E20 A;  1V3F A;  4KIB A;  4XRS A;  3VO2 A;  1P92 A;  2X6O A;  5FRM A;  2CUZ A;  4EGY A;  1RNL A;  1R9T J;  4FN5 A;  4LBW A;  3V76 A;  1XMX A;  5F0C A;  4RAY A;  4IQJ A;  2INV A;  4AC0 A;  1DAR A;  1TVC A;  2ID6 A;  4PDK A;  1WQ2 A;  2GAU A;  2LKP A;  3EPZ A;  2ZJR F;  4G7X A;  1GJR A;  2YWF A;  4BYY A;  1FYK A;  2RC5 A;  1VQO I;  1T6X A;  3LNN A;  2JUC A;  4RGX A;  2R5Y B;  4C2T A;  1SVM A;  4P9F A;  5ILS A;  2HQN A;  2FEZ A;  1LDJ A;  3H9N A;  2OK8 A;  1BW5 A;  4WQM A;  3JUR A;  1GQ8 A;  2J8I A;  3ZSC A;  1X3W B;  2DA4 A;  4J01 A;  3V8K A;  4JOM A;  4ASU A;  4Y7N J;  4PJJ A;  3B02 A;  2IS2 A;  1TYW A;  3FF5 A;  3DU1 X;  3F23 A;  3OYN A;  1XMK A;  3QWL A;  3GTP J;  2YR2 A;  2O0V A;  1BI0 A;  2DPD A;  4NHJ A;  2ZFW A;  2BY2 A;  2XOK A;  4YII A;  4PJN A;  4BQO A;  2QX3 A;  2PG4 A;  3Q9V A;  2F4M B;  3IV5 A;  1PJ5 A;  3DU5 A;  4L9J A;  1LE8 B;  4XKW A;  1Z9C A;  3CP8 A;  1QVT A;  3SHF A;  1FNB A;  2FMY A;  4HDU A;  3ZBT A;  1RKT A;  1MW7 A;  4RGR A;  1TLH B;  3GZ5 A;  3N05 A;  1CQX A;  2W6J A;  3S8P A;  5HKK A;  4F91 B;  3G2B A;  2M8E A;  2IGM A;  3CJR B;  1PLU A;  1JKR C;  1I5Z A;  1IUY A;  3A03 A;  2A6H F;  2HR3 A;  3KPH A;  5F1R A;  1BI1 A;  1YG2 A;  4ZZD A;  1W4M A;  4X8I A;  3TW6 A;  1PP7 U;  3S3N A;  2BM6 A;  5HOO A;  1IW7 F;  1SFE A;  2ME6 A;  2GLO A;  4AVP A;  4KNY A;  2DXI A;  2ISY A;  1I6X A;  4CZZ A;  4U0W A;  1F43 A;  1GR1 A;  4RJL A;  3I71 A;  1HVX A;  2XEX A;  4C3I J;  2N8G A;  4HV5 A;  3HHH A;  4M72 A;  2DJI A;  1O3Q A;  5JBQ A;  1HC8 A;  2DET A;  3BG3 A;  2Z3Y A;  2I8D A;  5EZH A;  2XC7 A;  1W2B B;  1UD8 A;  2YUS A;  3V7C A;  1WKM A;  2A05 A;  1KZH A;  3WG9 A;  1H42 A;  2V7V A;  1W36 D;  1H0M A;  3MHP A;  3KP4 A;  2NVY J;  1WPK A;  4IW3 B;  5F4J A;  1ETO A;  2O0Y A;  4F92 B;  3ESW B;  1I3A A;  2NNY A;  1IJE A;  2AHO A;  3SLD A;  2J8K A;  3TQN A;  2BGC A;  2W7Z A;  4QV2 A;  4CUG A;  3JAM K;  4TMX A;  4TMV A;  4OPO A;  3M07 A;  1VLO A;  2E1O A;  4U0Y A;  1K8F A;  3OYK A;  5L3E A;  1Y0R A;  3KZI C;  3CCE I;  1BL0 A;  3FXK A;  4DNT B;  5JHF A;  2M9H A;  3ZMV A;  3SFI A;  5CQG A;  3G71 I;  4ENN A;  2KIF A;  3H9J A;  4ZH4 F;  4A3B J;  3Q39 A;  3LA2 A;  1V5V A;  1Y56 A;  1AA7 A;  3OV8 A;  2R0Q C;  1V4R A;  1E1Q A;  3LWF A;  4R1H A;  4ZYA A;  4AUX A;  2P7C B;  4PC2 A;  3UNG C;  1EH6 A;  1R7J A;  1S3J A;  4LBY A;  2YWE A;  2OF7 A;  1ZRD A;  4RMN A;  3ZQG A;  4RDK A;  1VHE A;  4NBS A;  3OIO A;  2IQ7 A;  1MNE A;  2R7O A;  1UZC A;  2KZG A;  1EF4 A;  3MCZ A;  4Y33 A;  4AIJ A;  1R5N A;  3R4K A;  2Y0S A;  2DOG A;  3AGP A;  3W5V A;  1DAB A;  3WTS C;  2AHQ A;  5CJ9 A;  3BG5 A;  3G73 A;  4C2M J;  3A2K A;  4M0L A;  4YZX A;  3SQN A;  1NH3 A;  3SZP A;  4FX4 A;  2LSO A;  4A6D A;  5IYQ A;  3E20 A;  1LM1 A;  2MAB A;  4BPR A;  1MD0 A;  3TP3 A;  2LP0 A;  4WXD A;  3SKB A;  3AFH A;  4HNV A;  3BWG A;  1VQN I;  3HHG A;  4PZJ A;  5D4S A;  2IT0 A;  4UY8 I;  4P12 A;  1EH7 A;  2NAZ A;  2AXL A;  4RPD A;  1R5I D;  2WAE A;  1B72 A;  5IYW A;  3G6E B;  1BR4 A;  5ILU A;  4M6V A;  3DWL E;  4EAT A;  4A3C J;  1EFC A;  3J80 Z;  2INU A;  3I53 A;  3I4P A;  1PUF A;  1ZHF A;  1ZM3 A;  1O8I A;  1AWC A;  4NC8 A;  5ICC A;  3KEO A;  3J7Z I;  1JE8 A;  2Q2E A;  2VJI A;  1UHM A;  3M8J A;  1LVK A;  2PX9 A;  2YS9 A;  1XB2 A;  4B1R A;  1A6Q A;  5K5Q A;  4ZYD A;  1XCV A;  3W2V A;  3QFS A;  2GPJ A;  4RDU A;  2PJP A;  1ZM4 A;  2VE8 A;  3U21 A;  1V5E A;  1G7T A;  4I02 A;  3SEZ A;  5DSZ A;  1WJE A;  3KX2 A;  4ON0 A;  1K78 A;  3H3V K;  1BQE A;  2WZN A;  2V4J C;  1QU3 A;  3VOD A;  3H3U A;  3K1M A;  1P9Q C;  2O03 A;  1G8X A;  3G1L A;  2B9S A;  1OLT A;  4UVA A;  5M3M J;  1N05 A;  2ZSH B;  1B23 P;  1I1G A;  4II3 A;  2C78 A;  1LB2 A;  5K5O A;  4D0P A;  2DO7 A;  2L0K A;  4G94 A;  4RM3 A;  1IV8 A;  4TN1 A;  3IWF A;  5BMZ A;  3HOV J;  2X53 S;  3K70 C;  2DTR A;  4PC3 A;  1UJ8 A;  4BHC A;  1N06 A;  3CCU I;  2NOG A;  5FKN A;  3GFJ A;  1FEX A;  3VYR B;  4ANJ A;  3LAP A;  1ZEL A;  1OPC A;  4PC6 A;  2LVS A;  2L9R A;  1OQY A;  3X2Q H;  1HOM A;  4LLL A;  3AG3 H;  2HQ5 A;  2DT5 A;  3SJZ A;  4I6Z A;  3ZQC A;  1GVH A;  2HLD A;  1ZTR A;  3QPL A;  1MMD A;  3PIP F;  1ETX A;  4M53 A;  4OJP A;  4EW9 A;  1FOY A;  4D7N A;  3MEX A;  2HTJ A;  4JK1 X;  1Y0Y A;  2DIE A;  2ZBV A;  4OZZ A;  4KJZ A;  1ZM2 A;  1KK3 A;  3H0D A;  4AWX B;  1WVR A;  1EZG A;  2DER A;  1G59 A;  3C3W A;  3ZQL A;  2F3L A;  2P5V A;  1ETV A;  3QYF A;  5DS9 A;  3DPT A;  2WY8 Q;  1W0U A;  4Z2Y A;  1A31 A;  4U9U A;  3AG4 H;  3A1Y A;  3B6A A;  1HST A;  2ADU A;  3OYJ A;  4V02 C;  3BNW A;  1ZLK A;  5E17 F;  1H80 A;  5B5E C;  2L7K A;  4IHV A;  2EIM H;  2VPR A;  5B3S H;  1I6H J;  3K4B A;  2YWH A;  2UV1 A;  2E1R A;  1TQP A;  2KHM A;  3K4M A;  4YFO A;  2ZXW H;  3W6K B;  4OPW A;  4XL9 A;  2JQ7 A;  1XN7 A;  1R5B A;  4KIG A;  4RBO A;  1XPX A;  1IDJ A;  5F08 A;  5DUK A;  4XM3 A;  5CVV A;  1KQ0 A;  4C30 A;  3I4M J;  3G4S B;  1MMG A;  3J7A O;  1J59 A;  1R1V A;  4CCN A;  3Q5F A;  3S1Q J;  5HLI A;  2NVX J;  1WSU A;  3WTY C;  2XB5 A;  1NRK A;  2Q6L A;  5DCM B;  2Q6K A;  1K5C A;  1RI7 A;  4BU2 A;  5H2F C;  4P9U A;  2NVQ J;  5ICF A;  5B1B H;  2XKO A;  1QCX A;  2XPW A;  1U2W A;  4PC7 A;  3WE2 A;  3SDB A;  1TQI A;  3CD6 I;  1LDD A;  1LKX A;  4GFB A;  4JX4 A;  3ASN H;  4XR6 A;  1Z91 A;  4FET A;  3RCO A;  2XNJ A;  2WBM A;  5CVJ A;  2C4U A;  4OM9 A;  5KAF C;  2QEX B;  2QTL A;  2BBY A;  2Y9Y A;  4FQG A;  1DP3 A;  2XAG A;  3M7G A;  5LEJ A;  3GX4 X;  1IG7 A;  3HOY J;  3T8T A;  2HCJ B;  5EEA A;  2OBR A;  3GQ7 A;  3R0A A;  4HYE A;  3HIF A;  3FM5 A;  2WY7 Q;  2QYO A;  3Q0V A;  3BCA A;  1WSV A;  2XAU A;  3AVV A;  3CPX A;  4YXW A;  3WND A;  3J81 K;  1JJ8 C;  5FRN A;  2L5Q A;  1MMS A;  4OAY A;  4A0Y A;  1SVO A;  3MKY B;  3CPW B;  2QYU A;  5DS0 A;  3BTJ A;  2MD0 A;  2UVF A;  2KRH A;  5J1R A;  2O5R A;  1NG6 A;  1VBL A;  2FA5 A;  2I10 A;  4PK4 A;  5JHU A;  3I4N J;  4NQW A;  3MWM A;  3J81 k;  1VQ4 B;  3BT9 A;  2QLZ A;  3PEN A;  5L3F A;  1R4N B;  2ZL5 A;  4OMZ A;  4RD6 A;  3BTC A;  3WNC A;  3WTX C;  1WOR A;  3RPU A;  5AMV A;  1FMV A;  3KP6 A;  5HLT A;  1YI2 B;  3KYD B;  3OIP A;  2XUB A;  3JTG A;  1Z3X A;  2DMT A;  1BI3 A;  4URR A;  2GBY A;  2M5W A;  2VPL A;  4GRI A;  2E34 A;  4B3X A;  2DN0 A;  1Z1D A;  2F43 A;  1YIJ I;  1WH5 A; 
#chains in the Genus database with same CATH homology
 4Y3O A;  2LBF B;  1OR7 C;  3LFU A;  2M4K A;  3AL0 C;  5LD2 C;  2IS6 A;  4U87 A;  3HAG A;  3ZXS A;  3L2R A;  1QJV A;  3A4C A;  4PFP A;  2WAD A;  1BN8 A;  1R6R A;  4IZZ A;  1OOC A;  4C2L A;  2JDI A;  1OFL A;  4BQN A;  2WPD A;  4BDZ A;  4FXU A;  4LG3 A;  3UR3 C;  3K4L A;  2HVR A;  3LSH A;  3WWG A;  3VST A;  3BG7 A;  1GLN A;  3MKW B;  1W0J A;  3OW7 A;  4N4N B;  2KQR A;  3OYF A;  4KKS A;  3A3G A;  2DT6 A;  2VKD A;  3E1S A;  1Z21 A;  4PSW A;  4F93 B;  3AL0 B;  1D0X A;  1V5F A;  1E79 A;  3S3M A;  2LY1 A;  3ZIA A;  3C2G A;  3LSK A;  4XNF A;  4XKV A;  3KEW A;  3W2A A;  3TBI A;  1X1A A;  4HST A;  4TT3 A;  2K9M A;  2VJ4 A;  3OYB A;  2GK7 A;  5C1E A;  4HG2 A;  4CH7 A;  3G05 A;  3OR2 C;  2BVL A;  2X6W A;  1V5G A;  3QYE A;  2VLA A;  3SUC A;  4BS9 A;  1V0E A;  3BC9 A;  2VJJ A;  3D5L A;  3M1C A;  1IDK A;  4W8R A;  3OEH A;  1Z3Y A;  1FX0 A;  3PUB A;  1OGO X;  4HRI A;  2A6T A;  3DTI A;  2VBK A;  3FPP A;  4DJA A;  2XF6 A;  4HNU A;  3OYC A;  2QE7 A;  2NZM A;  2Z16 A;  1FMW A;  3VSL A;  1UD3 A;  2P0W A;  2E1B A;  4P1W A;  3MKZ A;  2KPM A;  2E1M B;  2VL8 A;  2NOJ B;  3H9G A;  4XLA A;  1UD5 A;  2W00 A;  5DN6 A;  2D3L A;  3OR1 C;  3NWS A;  2M7B A;  3DEE A;  1O8F A;  4F55 A;  2VB6 A;  4E4H A;  2NT9 A;  1IA5 A;  4CA0 A;  2ZXI A;  1MMA A;  4E7L A;  2E5N A;  3OE7 A;  2Z8G A;  2QKL B;  1YX3 A;  2JJ1 A;  3K6G A;  3OMY A;  2WA0 A;  3HKZ A;  3NWT A;  2HVQ A;  2F1M A;  1O8L A;  2XF5 A;  2DT7 B;  1WP6 A;  3ZPP A;  4E7I A;  4E6K G;  4C2U A;  3OL3 A;  2EWE A;  2LBF A;  2ZTG A;  3OYD A;  3L2Q A;  2PEC A;  3JU4 A;  3DDY A;  2PYH A;  1KON A;  2IS1 A;  2E60 A;  4HIZ A;  2KDO A;  4PSX A;  3PJR A;  3OOU A;  4B47 A;  4HPQ A;  3F9K A;  2XSJ C;  2CV0 A;  4KKT A;  3VWB A;  4NQW B;  4BXF A;  4B3F X;  4NNJ A;  3IAM 2;  3OYA A;  3ONQ A;  3HG9 A;  3ZRG A;  4F3Q A;  3B8Y A;  1I8D A;  3BCB A;  4HSR A;  2VBE A;  3L2U A;  3K4N A;  3SYT A;  1JI8 A;  3ZGK A;  4W8S A;  2XND A;  4BJ5 C;  2NTB A;  4Z03 A;  1X1C A;  2L9N A;  2LH9 A;  1O8D A;  1UD4 A;  3VDX A;  1TT0 A;  4XOP A;  2PYG A;  3BH4 A;  2X1C A;  1VJS A;  4BUP A;  4BE1 A;  2VQG A;  2JJ2 A;  3DQV C;  2ELJ A;  1Z7L A;  1EA3 A;  4DIQ A;  1OGM X;  1QHH D;  2MYS A;  4OAZ A;  1COW A;  1KZL A;  4DNR B;  1EE6 A;  2JUG A;  2XZP A;  1HA8 A;  1W36 C;  1KCD A;  4MXN A;  2VQH A;  4KKU A;  1E0E A;  2WAF A;  4IX7 A;  4BE0 A;  1EFR A;  3H5A A;  3ZPN A;  1NHC A;  1T0F C;  2VQL A;  3S93 A;  3RSN A;  4B44 A;  3UW0 A;  3CMM A;  2WB1 A;  1O8E A;  3BG6 A;  2V1N A;  2W82 A;  2CW7 A;  1PYV A;  1X1B A;  2LC2 A;  2QKM B;  4Z06 A;  2KVO A;  2NTQ A;  4FAS D;  3GQ9 A;  2VXZ A;  4BJT A;  1VF7 A;  4YEL A;  3OEE A;  2ZFU A;  2BVM A;  2PMZ A;  4DK1 A;  5TGT A;  1T5E A;  1LFP A;  1W0K A;  3K4C A;  2BW3 A;  3OYE A;  3NE5 B;  3RTR A;  2M7A A;  4XLC A;  2R7W A;  3DKY A;  1DQU A;  3BCF A;  3ZCO A;  1CZF A;  3CP2 A;  3HOT A;  2KZV A;  2GJR A;  1WFX A;  1BR1 A;  2LRD A;  3DLA A;  4QPO A;  3GQA A;  4BDY A;  4OJ5 A;  2CS3 A;  2R7S A;  5FRM A;  2CUZ A;  4UZU A;  4RLF A;  2F5V A;  4LIT A;  2R7V A;  3A35 A;  4P5O A;  1D1B A;  3VMV A;  4IQJ A;  2INV A;  4TKO B;  2W4S A;  2X51 A;  4G7X A;  3EPZ A;  2HPI A;  3IAS 2;  2V7Q A;  3LNN A;  1AIR A;  1X19 A;  4C2T A;  1T95 A;  2Z2S B;  3CF2 A;  4KIT B;  2K3P A;  5HVQ C;  4HNT A;  1VZ0 A;  3JUR A;  4U49 A;  1GQ8 A;  3ZSC A;  4J01 A;  2XF7 A;  4RM2 A;  1DGR M;  3LSM A;  4JOM A;  4PJJ A;  3WQZ A;  4Z05 A;  2IS2 A;  2PJR B;  4E7K A;  3E0J B;  1S9H A;  3OYN A;  1N78 A;  2V26 A;  2O0V A;  3GRH A;  2VKH A;  2OC6 A;  1D0Z A;  2MC4 A;  2XOK A;  2HU9 A;  4PJN A;  3RQ4 A;  4BQO A;  2QX3 A;  2RQQ A;  4H4K C;  1DBG A;  1BLI A;  2ODL A;  3DU5 A;  3ZR8 X;  1JRG A;  3HOS A;  1MAB A;  4XKW A;  2IXS A;  3CP8 A;  5CKT A;  3L2W A;  2CK3 A;  3FKJ A;  4XN3 A;  4E7Z A;  3BCD A;  4LIV A;  2F6C A;  5HNF A;  3T53 B;  1MW7 A;  1VLY A;  1WPC A;  2IGO A;  3N05 A;  4NK8 A;  2W6J A;  3S8P A;  5HKK A;  4F91 B;  3DU6 A;  3CJR B;  3G2B A;  2IGM A;  4LIU A;  4NC7 A;  1UD2 A;  1PLU A;  4DBQ A;  1MMN A;  4XN0 A;  3SZG A;  3PFY A;  4XD7 A;  1D1A A;  4JMQ A;  2X1D A;  3K4J A;  1YX5 A;  4OWR B;  4JQF A;  2M0M A;  2HNH A;  3S3N A;  3HPG A;  4D1Q A;  5HOO A;  4D9J A;  2GJP A;  3GQB A;  2WSS A;  3OS1 A;  2DXI A;  2WJY A;  3SEQ A;  1E43 A;  4XLE A;  1HVX A;  2VAS A;  4DBR A;  2VQC A;  2HPM A;  2DJI A;  4GQN A;  2HVS A;  1YE9 A;  1OHH A;  4X0G A;  3FBN B;  4L8J A;  2I8D A;  2XC7 A;  2KP6 A;  3FBI B;  1UD8 A;  4BL0 B;  3OS0 A;  1BR2 A;  4XKC A;  3TMO A;  4BEH A;  1W36 D;  2E1M C;  3ZQQ A;  4XON A;  1D0Y A;  4DK0 A;  1RMG A;  2X6X A;  2HQA A;  4F92 B;  3OIQ A;  2R9V A;  4XOT A;  4DOZ A;  1MND A;  4XMY A;  1X4O A;  2RNG A;  4CUG A;  2CMP A;  3PNY A;  1X0C A;  3VYU B;  3EUH C;  2KMU A;  5KHD A;  1WJC A;  3S32 A;  2JVH A;  3OYK A;  4HEA 2;  5FL7 A;  2V9K A;  2UUZ A;  4IQ4 A;  1E1R A;  3OOC A;  2M4G A;  4DNT B;  5JHF A;  4Y4R A;  2Z6B D;  5CQG A;  5C1C A;  1KCC A;  3H9J A;  2NTP A;  1Y56 A;  1AA7 A;  3LL7 A;  1HG8 A;  2O0W A;  3LMW A;  1E1Q A;  1U0J A;  2UWM A;  3PL8 A;  3PNV A;  2GJK A;  4ZYA A;  1ERD A;  2KRC A;  1K28 D;  3EQN A;  4NK6 A;  2Q2E B;  4XKB A;  3UNG C;  1WTH D;  1I18 A;  4P22 A;  4RMN A;  1WJF A;  2K5C A;  3RPU D;  3V42 A;  4AU7 A;  4BAC A;  4E7J A;  4PUS A;  2R7Q A;  4MLO A;  2IQ7 A;  1Y6I A;  2LOO A;  3H5R A;  1MNE A;  2R7O A;  1HZE A;  3H35 A;  2L2O A;  4Y33 A;  1E3X A;  2M5S A;  1NG7 A;  4KIS A;  2Y0S A;  4DGW B;  4U7B A;  2R4G A;  1PKV A;  3OWT A;  1SAU A;  3IUO A;  1O8H A;  4YZX A;  4NUB A;  3A2K A;  2O1D A;  5HNH A;  5KNL A;  3S3O A;  2IGK A;  1J09 A;  2CV2 A;  2DCE A;  2UVE A;  2MAB A;  2X85 A;  3K10 A;  1H8H A;  4BGD A;  2ZZQ A;  3DTK A;  2CV1 A;  2W6I A;  3AFH A;  2V7F A;  2LYC A;  2LG4 A;  1RWR A;  3DKX A;  4RLQ A;  4XLH A;  2ZZE A;  3VYT B;  1BPL A;  2WAE A;  3VYS B;  2XZO A;  2KLO A;  4YZQ A;  4OJL A;  2X6Y A;  1BR4 A;  2Z1D A;  2CUJ A;  1E3Z A;  1PJR A;  1RU4 A;  3DWL E;  4EAT A;  1O8K A;  2D3N A;  1O88 A;  3LSI A;  5KCM A;  3OYM A;  2R7U A;  2INU A;  2VJ5 A;  3BC8 A;  1O8I A;  3CZ6 A;  3H9Q A;  4NC8 A;  4BQQ A;  2X8K A;  5IK2 A;  3GQ8 A;  4YRV A;  1LDK B;  4BE2 A;  3GVK A;  2VJI A;  4CCL A;  3M8J A;  4F52 A;  1LVK A;  2R7X A;  4XOR A;  5CQE A;  4C9Y A;  2ZZG A;  2JIZ A;  3VR6 A;  4E0F A;  2O04 A;  2GOX B;  1QHG A;  3LMM A;  4CCK A;  2WAQ A;  3K70 D;  1UG0 A;  4AYB A;  3KEY A;  3VMW A;  4ZC3 A;  3W2V A;  3HXL A;  2MFZ A;  1KTW A;  4HWV A;  3U21 A;  3OYH A;  3J7A Y;  3GVL A;  1V5E A;  2ZZF A;  3SEZ A;  4ASU A;  1N75 A;  1WJE A;  3KX2 A;  1WJB A;  1BHE A;  4CCM A;  1QCX A;  3KYL A;  2V4J C;  1PXZ A;  3MD2 A;  4G6I A;  1QU3 A;  1K6Y A;  2A5W A;  3BLY A;  4G6T B;  4ZTF A;  1P9Q C;  1KMH A;  1G8X A;  1XG2 A;  4AVZ A;  1OLT A;  4ZTJ A;  2ZSH B;  2JSP A;  2FUG 2;  2X3H A;  4II3 A;  4ZDP A;  1PE9 A;  3H5N A;  1JTA A;  2DOA A;  3B4N A;  4RM3 A;  2V6E A;  2WZP P;  1SFK A;  2X53 S;  3W2W A;  3K70 C;  2Q1Z B;  4PFO A;  4OZY A;  4ZJZ A;  2L9S A;  3VYR B;  4ANJ A;  4Z1M A;  1ZEL A;  2K9L A;  2LRE A;  1BMF A;  2ZTN A;  2AQF A;  4ZDL A;  2XZL A;  4N4O B;  3MMY B;  2BOL A;  4CZC A;  1DGW Y;  1TZL A;  2HLD A;  3C2H A;  1MMD A;  4KT6 A;  4J00 A;  1O8G A;  4OJP A;  3OL4 A;  3W3C A;  3OY9 A;  4U4B A;  4EW9 A;  1BOB A;  2OUM A;  2DIE A;  4OZZ A;  2O17 A;  4KJZ A;  1UD6 A;  3H0D A;  3KRG A;  1IB4 A;  4CCO A;  1G59 A;  3T51 B;  4TSF A;  3IP4 B;  4II2 A;  3QYF A;  4G7W A;  4PMH A;  3D5R C;  3DPT A;  2WY8 Q;  3PSI A;  5LFA A;  1N77 A;  2NST A;  2CW8 A;  2RRE A;  4B43 A;  4QPQ A;  2LZJ A;  3A1Y A;  3OYJ A;  2W1O A;  3EUK L;  2GK6 A;  4YZA A;  3OYG A;  2W7N A;  3T56 B;  1H80 A;  2L7K A;  3GBG A;  2BW3 B;  1O8M A;  2VXD A;  3K4B A;  2AQE A;  3FDY A;  3OYI A;  2UV1 A;  2KHM A;  3K4M A;  1H8E A;  3OPO A;  4XL9 A;  4OJ6 A;  1WJD A;  3K4K A;  1UEL B;  1IDJ A;  1WJA A;  4XM3 A;  1UAA A;  4PJM A;  2IS4 A;  2R7T A;  2KL4 A;  2X1E A;  2ZSI B;  4C30 A;  3OYL A;  2F4I A;  2HDW A;  1MMG A;  3TL4 X;  4W8T A;  4IKF A;  2GOM A;  4CCN A;  1NRK A;  5CDF A;  4CCJ A;  1OB0 A;  2WJV A;  2XGJ A;  1DBO A;  1K5C A;  3EQO A;  4BU2 A;  3VSU A;  4OJO A;  1SKY B;  3H94 A;  3DPL C;  1O8J A;  1X1D A;  3SDB A;  4MR0 A;  4BEH B;  1LKX A;  4YZ0 A;  1WMR A;  3OAA A;  1X4P A;  4XR6 A;  3L2V A;  2ZXH A;  4FET A;  3RCO A;  3PNT A;  2WBM A;  3HUG B;  3QYB A;  3B90 A;  1V0F A;  3HL2 A;  1DP3 A;  4B48 A;  2QXZ A;  4CSW A;  2JVG A;  1OFM A;  2V31 A;  1WJ5 A;  3DPU A;  3DTE A;  1W9X A;  3CES A;  4ZDO A;  3A3B A;  3OS2 A;  4XQF A;  4B3G A;  4YEJ A;  3I9V 2;  3FY3 A;  3GQ7 A;  2NT6 A;  3OFN A;  3LSG A;  3D5S C;  2BSP A;  2WY7 Q;  2XDV A;  2VIX A;  2XAU A;  3BCA A;  4YXW A;  2NSP A;  3QOD A;  5FRN A;  2L5Q A;  4OAY A;  1D1C A;  3MKY B;  2CH0 A;  5CPR B;  2CFO A;  3CJQ B;  3FKS A;  2UVF A;  2MD0 A;  4BJ6 C;  4E7S A;  4W8Q A;  2KRH A;  2OV7 A;  3I3L A;  3QOE A;  2E5Z A;  3VSK A;  2O5R A;  3EUA A;  3AKZ A;  1NG6 A;  1VBL A;  1IRX A;  5FRO A;  4PK4 A;  4XLF A;  2JA2 A;  3HPH A;  2VBM A;  2LY2 A;  3FHN A;  3HC7 A;  3GVJ A;  2PJR A;  4I84 A;  1NBM A;  5AMV A;  3T9G A;  1FMV A;  5HLT A;  3OIP A;  2R7R A;  1Z3X A;  2IGN A;  4R79 A;  4URR A;  4E7H A;  2HZD A;  4ITV A;  2M3A A;  2V4D A;  2VPL A;  3PSF A;  4GRI A;  4B3X A;  3VSV A;  4PJL A;  2F43 A;  2QY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...