4XKWA

Tailspike protein mutant d339n of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
599
structure length
599
Chain Sequence
b'PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 233
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkwA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkwA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkwA02
4W8SA 2O0WA 4XLAA 4XOTA 1O8GA 3VSVA 3VMVA 5AMVA 2PYGA 2NT6A 3JURA 1OGMX 4XONA 1HG8A 4XLEA 1XG2A 1JTAA 1O88A 3WWGA 4XM3A 2NSTA 4XLCA 3VSUA 3GQ8A 4EW9A 4OJPA 4Z03A 4NK8A 1O8MA 4YELA 4URRA 4YZQA 3UW0A 4OJOA 2O0VA 4NK6A 1KTWA 1QCXA 2NTPA 4W8TA 4XN0A 2NTBA 4AVZA 4XQFA 1O8KA 3B90A 1PLUA 2O17A 4XNFA 1BHEA 1QJVA 3GQAA 1BN8A 1O8HA 3SUCA 1OFMA 1O8FA 4YZAA 1PXZA 4XMYA 1X0CA 1H80A 1IA5A 1O8LA 4I84A 1WMRA 4Z05A 2O04A 3B4NA 1CZFA 2INUA 4OJ6A 4XR6A 1K5CA 1NHCA 1RU4A 5C1EA 2PYHA 2INVA 4U49A 4W8QA 2QXZA 2PECA 2VBMA 2NT9A 2Z8GA 4OJLA 4MXNA 4U4BA 2O1DA 3KRGA 1DBOA 1EE6A 2QY1A 3GQ9A 2X6WA 1AIRA 4MR0A 2X6YA 4OZYA 3T9GA 2X3HA 1IB4A 1KCDA 2X85A 3B8YA 4Z06A 4XORA 1IDJA 4XL9A 1O8JA 4XN3A 3LMWA 3VSTA 2BSPA 2EWEA 3VMWA 1O8IA 4YZ0A 1RMGA 4XOPA 4XKVA 4HWVA 1OGOX 4W8RA 2QX3A 2ODLA 4YZXA 1O8DA 2IQ7A 2UVEA 4XLHA 2NSPA 4PMHA 1KCCA 3GRHA 1PE9A 3EQNA 1VBLA 4YEJA 3ZPPA 4XKWA 1OOCA 3EQOA 2VJIA 1DBGA 5C1CA 2X6XA 2UVFA 2VBEA 2VBKA 2VJJA 1IDKA 4C2LA 4XLFA 1JRGA 3FY3A 3GQ7A 3ZSCA 1OFLA 1RWRA 4OJ5A 1O8EA 1GQ8A 2NTQA 2NZMA 4OZZA
chains in the Genus database with same CATH superfamily
1EA0A 2C4TA 4KNYA 1FNCA 1QGPA 1S72I 1WJCA 3V76A 4OAZA 1VQPI 2XOKA 1MNDA 2CRVA 3BH4A 4LGWA 1FIPA 3EQLF 4OWRB 4CSWA 3BR1A 4XLCA 3ES9A 3I55I 1QGZA 3FXJA 2R5ZB 4HE5A 3CCRB 1WTHD 2JJ7A 2GZWA 1USTA 4Q4ZF 5L3DA 3IRRA 3SLNA 4OJOA 1EP3B 2Z5UA 4YEIA 1VFCA 2HYFA 2RREA 3FXOA 4IJAA 1PP7U 2FF4A 3CCSI 3QWLA 4ZTJA 4ZZLA 3J80K 1WH7A 1MDMA 3DU6A 5EEGA 4L18B 3HIFA 2UV1A 3S2WA 4LJZF 2LKXA 1MBEA 4G6TB 1GAQA 3Q3AA 3P9KA 2J8IA 3NWSA 1E62A 3SDBA 1BOBA 1F4KA 1WMRA 2L9RA 2BX6A 3S17J 3B4NA 4OPSA 2QA4B 3ZPLA 3RPUD 2CJJA 4B3GA 5KAIC 3TDUC 4A3LJ 1KU2A 1TWAJ 3C2GA 3JW4A 2ZJRF 3JQRA 1K5CA 2OV7A 1SFOJ 3A1PA 4N9HA 3JAMZ 2D3NA 1RIOH 4BKXA 4IO9F 3BOQA 4X0GA 4A3GJ 2CFXA 3E6DA 4Z4UA 4RLZA 1Z67A 1WSVA 1GVDA 3ZQHA 1WPKA 1OLTA 1Z91A 5A2QZ 2BVNA 4RMNA 2CWEA 1ONVA 2KKOA 2RNGA 3AVYA 2YSRA 2ZXHA 5EJCA 3CCUB 1TW2A 2PBIA 5J40A 4A3IJ 3BJAA 5FLVA 3FBNB 5FD6A 2DT6A 1FDRA 5KW9A 2ZBUA 3V7RA 4CXFA 2YUHA 2K9SA 3DPTA 2LH9A 1R5ID 2O61A 4FASD 1KU3A 5F1JA 1R49A 3HUGB 3V8LA 1E63A 3G6EB 1IF1A 2A61A 2R4GA 2L7ZA 4G7HF 1PJ5A 1XD7A 1YTYA 2LRDA 4LC0A 2W82A 2V6EA 3GTLJ 2DPDA 2W25A 3MQ0A 2WADA 5D4RA 5C4XJ 4QWQA 3DQVC 4RCYA 2L02A 4CYDA 4Y17A 2STWA 1VBLA 2VBTA 4YEJA 2EZHA 1RI7A 1VQKI 3O6BB 4IZZA 3HL2A 4A3BJ 1LE8A 1TQMA 1UG2A 3A3GA 2VJJA 3CCLB 3B82A 3FHNA 3KP3A 3V42A 1QGAA 1SKYB 1BR4A 2IGKA 4BPRA 2XAFA 2ESNA 1KQ0A 4PFPA 4XLFA 1E3XA 1MH3A 2N8GA 3EUKL 1TC3C 2V5IA 3LSMA 5FLMJ 1IGNA 3WNCA 1QQ1A 1TWCJ 2L4MA 1G3YA 1TP4A 2YR2A 3KL9A 2E2IJ 1ZK8A 3HKZN 1QO0D 5KVRA 1E43A 2VB6A 1N06A 1MKMA 1D0YA 5FKMA 2VNJA 4B4CA 4G12A 4DBQA 4TSFA 1PDNC 1XGNA 1TSPA 4E7LA 1XG2A 2VFQA 3PUFA 1IXRC 3FXMA 3LSTA 1MMGA 4C2MJ 1I1SA 3H3VK 4P25A 1TTTA 2VYQA 4HV5A 3H3ZA 3FXKA 2PJPA 3CD6B 3SEQA 1WPCA 3EUHA 3LQ6A 2M4GA 3SJMA 2BY1A 1ZRCA 5D5WB 4ZCIA 4RD6A 1D8JA 4G6IA 5DCMB 1T0FC 2VL8A 3DLLF 2Q2EA 3F22A 1N0UA 3AK5A 2M3AA 4KYWA 3GLXA 3CQZJ 2ZBVA 1DUXC 4KT5C 3QFTA 4QVJA 1HW5A 1YITB 2CBXA 3CO6C 2DLLA 2BY2A 1M1EB 4HDVA 1K78B 1ELOA 2WTEA 3SUCA 3ELKA 2VODA 2Y31A 5TJJA 4PUSA 2VBZA 5E8GA 5FFXA 2XPUA 3MWMA 2BGJA 2Q8KA 4S04A 1P6RA 3EYYA 2V7TA 4QPQA 3OZWA 1A6QA 2XTWA 1F1ZA 1TWHJ 4R79A 2V1DA 1VQ6B 2G7HA 3OIPA 1NK2P 1SFEA 1MNEA 1KTVA 2BY3A 2E1NA 2E5NA 5J4VA 3ABLH 1F20A 3J81Z 3WNBA 2WYRA 4B43A 4E4HA 2O1DA 2WWYA 4Z4RA 1D0XA 3LA7A 2HFHA 2LY1A 3T5XA 2GWRA 3CCMB 4LB5A 2VNKA 2PMZA 3D5SC 5E20A 5IYBJ 5M3MJ 4L0ZB 3ABUA 1F60A 4WZEA 1E0EA 4OZYA 1KCDA 1B59A 2PMZN 1U0JA 2EH3A 4S0HB 4RD3A 1WH5A 3DU5A 5IYCJ 2DJNA 3ZMZA 3F8BA 4N9IA 3GVJA 4IRGA 3R6SA 2OUMA 2VKDA 2VZLA 2WY7Q 3C2BA 1EFTA 1Z6TA 4HSRA 3CC2B 2RDPA 2LBFA 1R1UA 4LG3A 4KIGA 4BJTA 5K5QA 5F64A 5DDGA 4ASUA 2DETA 1XSXA 2FBHA 1R4MB 5HLIA 4XIDA 2XT4A 2VI6A 4U87A 3RZOJ 3K7AJ 1DP3A 2ZL5A 3C1DA 3PSIA 2DQRA 2PIAA 2CQKA 2NRAC 4AC0A 2DT5A 1R58A 1JGSA 4EJTA 3RIQA 2EA4A 3I1FA 2MYSA 3DP7A 3DTIA 2F3LA 3A4CA 3FHZA 4ESFA 1VQ8B 3WG7H 3E6CC 2ADUA 3F0CA 1MD0A 3R61A 2MLGA 2VKEA 4ZDPA 1JRGA 1ZAOA 3P7NA 1FMVA 4M6YA 2OK8A 1VNDA 3OE7A 5E1WA 5FRNA 1OFLA 1SD7A 1T6XA 1XFOA 2V7UA 5TR9A 1NTCA 3RCOA 1RETA 5E3OA 3PNTA 2HR3A 2KRFA 4LLGF 3QFRA 3U6KA 1ZRDA 4TMXA 3AL0B 2DY1A 2HVRA 4ASNA 1K28D 4Q7JB 4TMWA 3OAAA 3HOVJ 3HPGA 3WU0A 4IHYA 1XB2A 3CW2A 2B63J 4IRHA 1P4AA 1YQAA 4EJOA 1RKTA 1R5BA 1VF9A 3Q39A 1VQMB 5AMVA 2FJ1A 5LLQA 1G3TA 5IYNA 3O8HA 4XLEA 2VLAA 3ASTA 2OTJB 2RV8A 3K4BA 1NHAA 2PLFA 1H9GA 3E3VA 4A93J 1MMSA 1GR1A 2M4KA 3G1OA 3K2ZA 4RD4A 2E5ZA 4XBFA 3RIRA 2JDIA 5H5JA 1I39A 4DW6A 1FRNA 1V5EA 4B3XA 1FYLA 4ZCMA 2BVMA 2DFIA 2DOEA 2IAIA 1YRNB 1DG1G 3SJZA 1IXCA 3G4SI 2XAGA 3DPUA 3HUGA 1BR2A 4CA0A 3LSIA 1WSUA 1MNMC 2OBPA 1T56A 2A6TA 2PFBA 3QPHA 5CVRA 2F6CA 4MTEA 3SFIA 2JIZA 3OEHA 1Z9CA 2FX3A 4HOBA 3JQQA 4OPVA 3B78A 3ASSA 4PAAA 1FWZA 5F4OA 2YUSA 4ENKA 3H9NA 2GM4A 1WOSA 2F5DA 2Y30A 4WZKA 2IPQX 1O8FA 4YZAA 2KIFA 1IDZA 2L7FP 2ZKZA 3WY9A 4OIQF 3PFYA 1K83J 4ANJA 1V5VA 3PNYA 4KN7X 3HAGA 2JJ2A 4CQJA 2QCOA 2ZXIA 4MGRA 1T6SA 4NCNA 3CMAB 2QVOA 4IPAA 2Z3YA 2IXSA 2VOPA 3FXRA 2R93J 1NHCA 2XIGA 1RC9A 2KIUA 2QA4I 2L54A 4BACA 2CO5A 2M30A 5TISC 1XX5A 3W2AA 2NT9A 2EIXA 2Z8GA 2MD5A 2QYUA 5HLGA 5BSYA 2K40A 3ZN1A 5HVQC 2QTZA 5F04A 3IHUA 4OIRF 3GQ9A 2YPRA 3H94A 2YS9A 3BR5A 1IJFA 1K8FA 1YJWB 1MSEC 4UV8A 3FK6A 5K5RA 1YI2I 4LBWA 4XORA 4BBSJ 2M87A 1WDTA 2HVSA 1EWYA 3G71B 3CCUI 3E0JB 1DPRA 3NWTA 4UZEA 3TEDA 3L2WA 3S1MJ 2E7XA 1I27A 1WORA 1FLIA 4M9ZA 3L00A 1B4AA 3OOCA 2XKOA 3PSSA 4EATA 1AOYA 3FZVA 1N08A 1KCCA 1JKPC 2EFQA 3K0LA 1NG6A 3MFKA 2B7CA 3TQNA 5CQGA 3R6KA 3IL2A 4YZXA 3JRBA 2WJYA 2NXNB 3G6EI 3I54A 4B1RA 4CYCB 1J9IA 1YO5C 2M5SA 1BW5A 3ZZ0A 2R7ZJ 1ZH5A 1RUNA 1DQUA 2H09A 2PQ8A 2ZFWA 4DNCA 5IOZA 5DM7F 1VLYA 2WB1N 3BG6A 2V31A 3SQVA 4UNOA 5DCMA 2A07F 3TMOA 4FQGA 3GXOA 1YX2A 4YIRX 4P3YA 4LMYA 2VBVA 4P3IA 4N0BA 2ZXJA 4MLOA 1IN8A 3ECOA 1HKQA 3K10A 3PSZA 1YFHA 2BMWA 1IDKA 1FZPB 1K78A 1Y0UA 3HOXJ 3CO7C 3TO9A 4HNUA 4GGGA 2D45A 1U9NA 3CCLI 2CNDA 2NVQJ 2JVHA 3E5XA 2MA3A 2ZXWH 3W2WA 1F9NA 1WHUA 5C3EJ 3IH3A 4KISA 5HZAA 2QZ8A 1GQ8A 2B7EA 1J59A 5FO0A 3H0DA 3AVVA 4QLCU 2LMDA 2Q6IA 3W2FA 2M0MA 5GV7A 2R92J 1O7LA 4NUBA 2ELJA 4FWTA 4CHUA 3JURA 3QOPA 1B9NA 2Y48A 2KDOA 4Z4WA 1QA3A 1E17A 2ZFUA 5D6FA 1E3OC 3U2QA 4HQEA 3HOUJ 4LBZA 2P7VB 4L9TA 2RC4A 4PDKA 4CCMA 4BNCA 4RD2A 2A5YB 2AQFA 3VWBA 3KZIC 5HLHA 1K6YA 2IBDA 4CZZA 2KISA 3AKZA 2UWMA 3CD6I 3PM1A 2ZNZA 2E19A 1S9HA 3OR2C 2X1DA 4KKTA 3VSLA 3WTWC 2QGGA 1JA1A 3S16J 3MZHA 1VQPB 2XRNA 1KMHA 3TL4X 5M5YJ 1QRYA 1VQ9B 1YIOA 5KAFC 3UR3C 2PMUA 3FK7A 4X8IA 5LD2C 4HYEA 5GPAA 1QFYA 3ZQCA 1Y8QB 3HC7A 3OKXA 2GK7A 4DYCA 1RU4A 2IOUG 1OQYA 2ISYA 2ZMEB 1LLWA 3IRQA 3CF5F 1MBHA 3WXMA 1D1CA 3M8JA 4CO8A 3K4NA 5HNFA 5LMZA 4XKBA 4JX4A 3BZ6A 4C3IJ 3SFZA 1SMTA 4UY8I 2WZNA 3X2QH 3FKJA 5HS7A 2QEXB 1XG1A 2FU4A 2XZPA 3QAHA 1BX1A 2W7NA 3DEWA 3EUHC 4MYTA 3CJQB 2QLZA 2WAFA 3CCMI 1KK2A 5CVVA 2OBTA 2O8KA 1A04A 1XB4A 2R7UA 1B2RA 4AVPA 3CCJI 1IJEA 2ME0A 1ENHA 4RAGA 3CF2A 2HDDA 4DK1A 1LFBA 4LK1F 3VPRA 1YW9A 3O2PE 2DT7B 2D3LA 3GCMA 2L7MP 3CC2I 3D5LA 3Q5FA 2VBSA 1K6OA 1R5HA 1IN5A 4KKSA 1ZM3A 5ILUA 3FKIJ 2LLKA 3J7AY 1VQ4B 2LG4A 1STZA 5FKOA 5J3LA 3E1YE 2OF7A 2VJIA 4M6VA 1R00A 4P5OA 4BJ6C 1X1BA 1SEUA 3OYCA 2P8TA 3C18A 5THXA 3CDHA 1TLLA 1ETKA 2VBEA 1Q1HA 2B9SA 3WTSC 3AFHA 1WOPA 1VQ8I 1BJKA 3DTEA 2R6HA 2HGCA 1REPC 3FMSA 4OMYA 2E1CA 1MBFA 1T6YA 2DA6A 4ETSA 2BE5F 3WQZA 1Z21A 4F55A 3EUAA 4RAYA 3GFLA 3PIOF 3KEYA 1IRXA 1L1IA 3BT9A 3BCDA 1R5OA 2GIVA 5GAHJ 1HZEA 3RY8A 3N97A 2B0RA 1G7CA 3FX3A 2H6CA 2ZNYA 1N05A 3GEZA 3LO8A 1HSJA 4YAWA 1XTAA 4XONA 5ILVA 1VQOB 4JMQA 2QSHX 3W6KB 3I53A 2WZPP 3KP7A 4P26A 1T0FA 2MH2A 2LOOA 2R7VA 2E71A 2OTJI 2PG4A 1ZGWA 3OOPA 2EA2A 3VNUA 1O8MA 4URRA 2G0EA 3FMRA 3ZGKA 3OYGA 1JHFA 4BL0B 3HTSB 2DA5A 1LM1A 3UW0A 2V79A 4G6QA 2WY8Q 2CU7A 2DA7A 4AUXA 2Z1DA 5FJ8J 3LAJA 4FCYA 2HOSA 1QG0A 3OZVA 3GFMA 4KITB 5FO1A 2DMQA 2O17A 3B90A 2IVMA 2DFFA 2IGOA 2J5PA 1X4PA 5TGTA 1MABA 2LY9A 5D8LB 4N4NB 3VNVA 4OPWA 1Z6RA 4G8XA 3MD2A 2FSWA 4P22A 2L3DA 4WXDA 3JR9A 3QSYA 1Z3YA 1FBUA 2D2WA 3ML6A 2GIZA 1K4TA 3CPWB 1W7PA 2AQEA 2Y0SA 4XRSG 4PCQA 3AVUA 4DZPA 2F1MA 1ON2A 2X6OA 3DEEA 3HXLA 2PECA 5JMCB 3KZZA 3BLYA 3G73A 2JA6J 5FA6A 2LFBA 4ZYDA 3JTHA 3VR6A 2QY1A 4BEHB 5IYWA 3FWEA 3IKVA 2A5WA 2WV0A 2DK5A 4Y13A 1QUFA 2E1RA 2ZZQA 4HA8A 1QVUA 1HBXG 3PA1A 2X85A 1WJFA 1WJAA 3L9FA 2EB7A 3U21A 4RDJA 4EM2A 2W24A 2V9PA 3O3KA 3ULQB 2LY2A 1BIAA 3WTTC 2ACJA 3TBIA 1FYMA 3DDYA 4ZH4F 3G71I 2PE3A 5H59A 3D5RC 1OR7A 3FM3A 2WR8A 4CICA 1QA2A 2KJCA 2GJPA 3SKBA 3HHHA 4FE4A 2ODLA 2QX3A 1O8DA 2M8GX 4UUTA 2XB0X 2QWWA 3KP6A 2FNAA 3V7SA 4HF1A 2W6IA 3RKWA 5B3SH 2ELHA 3U2RA 5GV8A 3J7ZI 1QPMA 2XDVA 4RDUA 3OL3A 1D1NA 2K4JA 4GYGA 4X0CA 2VASA 4PGGA 4LLLA 3K70C 1WZ2A 4J0QA 2XAJA 3AG2H 2BXZA 2ETHA 2OCCH 2K9MA 2E60A 4II3A 2YU3A 3W2IA 2UVFA 1JJ8C 5D5XB 2X53S 4D9JA 2ELKA 4MEXF 4BQNA 1Z3XA 5HNHA 1QBJA 1G7SA 4ESBA 3JAMK 2DTRA 2K7LA 2PI0A 1OFEA 2P0WA 4EQQA 4LIUA 3COAC 2NTQA 4HX8A 4CCJA 3JRIA 2IA1A 2ZMEA 1UB9A 1HKSA 5CLSA 2GA2A 5A2QK 3S32A 2HMAA 1ZELA 2DOAA 3W6VA 4XOTA 2DK8A 2OC6A 2WJVA 3ZOBA 4MYUA 3QOEA 2H1KA 1OMIA 3M07A 3MEXA 4P1WA 4IOAF 1OGMX 1PUFB 4NC8A 3K70D 3MKWB 4Y15A 2DCUA 1JTAA 3S1NJ 1X1AA 2YWEA 1IAWA 2DMUA 4OIOF 4BUPA 3VEPA 2XVCA 4L5JA 3OZUA 1O7FA 4RM0A 3G3ZA 4HX4A 1TW3A 3EYIA 5EF6A 2J8KA 3GTGJ 2OQGA 5CDFA 2RVCA 4XD7A 2DCEA 4P55A 1EKEA 4M2LA 3I0TA 4UVBA 1DDIA 2WC2A 5B5EC 1ZN2A 2CK3A 3FKSA 1R36A 2AXLA 4Z4TA 2EFGA 3AVTA 2XPWA 4RBOA 3S2HJ 1QZEA 4JOMA 3CP2A 1TVCA 2IP2A 3CZ6A 3ZPNA 5FNZA 2JTVA 4A3CJ 4RGXA 3J7AO 1ZM4A 1PXZA 3BJ6A 3ZQLA 2LYCA 5IT9Z 4IHXA 4KKUA 4TT3A 1X0CA 4IF4A 3OYEA 4YFOA 1IA5A 1VQ9I 5B66C 3L2CA 5KK1A 2EPFA 1YLOA 1YS6A 3BR6A 3MZ8A 1T8IA 4GFBA 2V7VA 3W5VA 3LA2A 4W8QA 3G4SB 3PFIA 4NBSA 2F4NA 2CV0A 2C5BA 4AYBA 1ODDA 4D0PA 2P5LC 1JA0A 3R0AA 4WWVA 5LEJA 4MXNA 3H92A 4AYBN 2ZL7A 1DBOA 1T95A 2HVQA 5J35A 2C78A 1Y39A 1CGPA 3BY6A 5F08A 1UAAA 1IRZA 3ZIAA 1WQ2A 4PC6A 4F92B 4RM2A 1R4NB 1GHCA 2X6YA 2IS1A 3WU2C 2QEXI 2PLYA 4N3GA 3WTUC 5IYRA 1FC3A 2Y9YA 2JRTA 2E2JJ 1O8JA 4NDLA 3HRMA 3GO5A 3F3XA 2FX0A 2M45A 3CC4I 2DMTA 4YZ0A 2M34A 2R7DA 2V7WA 2LF7A 3OYFA 1IC8A 4E7KA 1IDYA 2WV1A 4BXXJ 3V8JA 2GOXB 5L3GA 3BQZA 3ERED 1KK3A 3QU6A 1ZHFA 1B23P 2UVEA 3I4MJ 4RB3C 1CNFA 2G0YA 4CCKA 1XSVA 2KT0A 3KYLA 1ZQ3P 2DA3A 4IHSA 2RGVA 2GXGA 3CMYA 1YI2B 3L7WA 1S7EA 3RZDJ 3GBGA 2YX7A 4NBQA 1VQ4I 4G6DA 1OGJA 3W5UA 1FBQA 3LFUA 3TW7A 1LLZA 2X51A 4IX7A 1G3SA 3M1CA 1OCRH 5HDNA 4HF2A 1J2XA 2MG4A 4MNUA 1R9TJ 2K85A 3MKYB 2LKPA 2C6YA 2V1UA 1WCMJ 5F27A 1JT0A 2OZUA 3M4OJ 3I58A 2H6BA 2XNJA 3AL0C 4PC3A 1M90D 3J81K 4BE1A 4ITVA 2QSGX 3OYJA 4OZZA 1W5CC 3BH7B 3VYSB 3CUQB 3S1QJ 2FBIA 1E1QA 5B6IA 2M7AA 2DA1A 4V2GA 3OYKA 1JB9A 4Z4ZA 2ZITA 2O0WA 1SAXA 1RUOA 2HI3A 1HSTA 3QYFA 3T0YA 2VQGA 3ZRGA 1GV5A 2XEXA 4BEHA 3BG3A 3ABTA 4Y33A 5FKKA 1V0FA 4Z2YA 1MIJA 2NVXJ 4QVAA 2O6WA 3ONUA 3DKWA 4HDUA 1O88A 1VQOI 1R23A 3JREA 3A1YA 3GX4X 3PO3J 5IYQA 3CLQA 4AIDA 1TT5B 4BY1J 4RD1A 1Z7LA 4RPBA 4TKOB 4AWXB 5DV5A 4BHBA 5BQTA 1SC7A 1G3WA 3K1NA 3OL4A 2CW8A 4L9VA 3PUBA 2PMDA 3K4LA 5JLVC 4X07A 4XQFA 3L09A 3I56I 2Q6OA 2ISZA 3CESA 1EZGA 2M0CA 3FF5A 4M1KA 3NARA 1ZR4A 2XF7A 3PQJA 4PGHA 5D5VB 2Z99A 3H9GA 3KIOA 2QKLB 1DDNA 1BC8C 1G7RA 3H1CA 1N75A 2B7BA 3LQQA 1YLFA 1H80A 2BW3A 4H9GA 1F43A 3CDIA 2NAZA 1XMAA 3HRTA 4Z05A 4UB8C 3AGPA 4V02C 1W0UA 4A0ZA 3LNNA 5JLXA 1UCRA 1P9QC 1S0UA 1KK0A 1EH6A 3HSEA 1EH8A 3HB9A 1Y6IA 4ZYAA 4A0XA 5HOOA 1SKQA 2PYHA 2QN6A 1AA7A 2CGPA 2NVYJ 1UMQA 2VJ5A 1ETOA 3H35A 4JX6A 4QSHA 1HC8A 1MMDA 3JRFA 1E3PA 2M8EA 2O3FA 3G2BA 1EE6A 3RKQA 4UVAA 4R1HA 3TO7A 1X3ZB 2D74A 3HRUA 1QVFB 1KQ8A 3LFKA 3H5NA 2E2HJ 1MRZA 3B8YA 3WGHA 3F72A 4Z06A 1K4SA 3CCYA 2GQFA 1IDJA 3LJYA 1IUYA 1FP1D 3E5UA 1W5SA 2KDZA 1XCBA 4RB1A 1KU7A 1TLHB 3P5JA 1DU0A 2IA0A 1PUFA 4UXNA 3ASQA 1TYUA 3U6BA 1G7TA 1KYZA 2HKOA 1PVEA 3U1DA 4RB2C 4W8RA 3VYRB 1W9XA 2DYIA 1CQTA 2KHMA 1N8RD 4CUGA 3WE3A 1D5VA 3LYCA 2CYYA 2JA5J 2BHYA 3AGQA 3QP5A 3VSKA 1JXSA 2FMLA 1JUSA 2JSCA 3DPLC 5IT3A 1DPUA 2L9VA 2V1NA 1ETQA 3MKLA 3PQKA 4WF2A 1VTNC 3H9JA 3HJEA 5EG0B 3BTLA 1V54H 3M7GA 4Z4YA 3CCJB 4M6XA 5E18F 5JVTA 4NC6A 1GVJA 2QMUA 1U6GA 2M2EA 3KLOA 3OJXA 3CMEB 1EA3A 3CDLA 2JA2A 5GTHC 2OQRA 2EV6A 2XSJC 3A0HC 3C7JA 4BQQA 5TV2A 2FBKA 4C3JJ 5TY0A 5GPCA 2EIKH 3ABMH 5LGNA 2QQ9A 2DN0A 3ZBTA 2VBUA 1MW7A 2R5ZA 2OBSA 2C4UA 3K2AA 5DSZA 3ERMA 4ZCLA 2VT3A 1W7PD 2DERA 4W8SA 2KRCA 1OR7C 2BM0A 3B73A 2E1OA 4HNVA 1YOVB 5CPRB 1V0EA 2JQ7A 1Q7YD 2V1XA 1W0KA 5E8IA 2VFOA 2FE3A 3M9AA 3HRSA 4D7MA 4IKFA 4BQOA 3LVBA 3REOA 2GXAA 5DEQA 1P92A 3DBLB 3KP2A 2F4MB 2NOJB 2Q0OA 3W2VA 3GTOJ 1H8HA 2V26A 3K1MA 5DUIA 4OIPF 2BM1A 1WWXA 1W34A 3DBRB 4KMUX 4IEJA 1MH4A 5LGUA 1FEXA 4OOXA 3SY2A 2L4AA 2ZZGA 1T33A 4OMZA 2UZKA 4OPOA 2FQ3A 3BR0A 4HEA2 3BQYA 2Q6KA 1MGTA 1PYVA 3E20A 2R7XA 3VO1A 1O8KA 1SFXA 2P81A 2W7ZA 2O8XA 2DQLA 4XNFA 3VB2A 4DIQA 2HQNA 2QTLA 1QJVA 2ZJPF 2M5WA 4CCLA 1LKXA 2F5EA 3OYBA 2RN7A 2QF7A 4Q47A 2XV4S 1YIJI 1BL0A 2ZMEC 4P9UA 2RC6A 2XB5A 1NBMA 2OYNA 4F52A 5B1BH 1ERDA 1O57A 2IA2A 2L2OA 5ICCA 3WODF 1UHSA 4JRAC 4P2NA 2XSDC 1QNTA 1H88C 1BIBA 3DU1X 4GCVA 2KRHA 4V2FA 2ZB9A 1TTYA 3LSGA 2HOAA 4TV7A 5E1XA 1D3YA 2Y2ZA 4OOSA 3KRGA 3MMPA 3JRDA 3BTCA 3J7YJ 3QFCA 2VN2A 4AF7A 1HKTA 2MFZA 3LQRA 4X7CA 4A3EJ 3W2GA 2QQ8A 2OD5A 4U88A 2MABA 2F4IA 1H89C 3BC9A 1L3LA 4KA4A 4PFOA 1Q81D 3M3YJ 1BJZA 3K4JA 3OMYA 1Q1VA 3G1MA 1T39A 1SFUA 2BGCA 3K69A 4FTHA 2DOFA 1V3FA 3LL7A 2EWNA 2O7OA 3KEWA 2VQHA 3VMWA 3KP5A 1A35A 2EZIA 3PO2J 2V7XA 2MLKA 3SZTA 4EEFG 4XSXF 4DQLA 2BHZA 1PJ6A 1TWGJ 5FFZA 5C4JJ 5EEAA 1H42A 1NB0A 1QRBA 1JKRC 1CLWA 4FT8A 1K9MD 3SZPA 4AC9A 2F1LA 2E34A 4BHPA 2W4SA 2VONA 3DV8A 1OFCX 4P12A 2L7KA 3IUOA 3KP4A 4OAYA 4QHYA 3EQNA 5LRSA 4W1UA 1ACIA 4HBLA 1QGYA 4YXWA 2DPUA 1DBGA 2ZC2A 2H8WA 1TL8A 3JRCA 3R60A 1Z7UA 1PJ7A 2HWVA 3S3NA 1ZM9A 3VSUA 1SVLA 3T8TA 1XSDA 1IHMA 1OCPA 3BCFA 2IEKA 2OPTA 3TO6A 3QPLA 2Q1ZB 2Z33A 2NV4A 2XGXA 5F1RA 1XGMA 2CQXA 2W1OA 3DFGA 1BX0A 2P5VA 2P6SA 3ZC3A 1BMFA 3FBIB 2WSSA 4A5MA 2CUJA 3DLAA 4F7DA 1MJ9A 2HTSA 2JN9A 3VSVA 3WE2A 3VMVA 4P9FA 4XRSA 1PJRA 3HGGA 2LNBA 3N6ZA 1FNBA 2FA5A 3V7AA 4ENNA 3CRZA 1KJZA 3PUMA 1YJ9B 5FD5A 1OCCH 2UXNA 1GUUA 1WJDA 3CTAA 4WXHA 3H3UA 4ABZA 5B1AH 2R7QA 1Y0NA 1OCTC 2JJ1A 4G7WA 3Q0UA 1XDSA 1H8AC 2G7UA 1DGWY 3HOYJ 4EVIA 1TQPA 4I02A 1LNWA 3DEUA 4NNJA 5D4SA 3IWFA 4CCOA 4YZQA 2R7TA 5DYMA 1GXQA 2I5UA 3KLNA 1YX5A 2DXIA 4XRFA 2E1MB 2GAUA 3Q3SA 2NNNA 4IVNA 1RR8C 2DAOA 2X0KA 3N90A 1X2NA 4G94A 4ZYEA 4KMFA 4I0BA 2MC3A 2LREA 3H36A 4BH9A 1FJLA 2ICWG 5DCFA 3RQ4A 2A6EF 1JKQC 1COWA 3A8IA 4BXUA 2MSYA 3VODA 1UMKA 1FIAA 2BSAA 2B5OA 5J3OA 1GJRA 3ZQFA 4YALA 1O8HA 4BQAA 1ZRFA 4YHBA 3F6OA 1SMYF 1SD5A 2MBFA 1C0WA 2R7RA 1APLC 5DNSA 2XAQA 4FETA 5AIQA 2BM6A 2INUA 1WI3A 2L01A 3WTVC 1GXPA 2GK6A 1NH3A 2BXYA 1IG7A 3GZ6A 2VPLA 2HDWA 3PENA 2E35A 3K4CA 4RLQA 1IJWC 2FNPA 5HDKA 3DF8A 3BP8A 1F5TA 1ZR2A 1R5NA 1NDHA 1LEBA 2DTZA 1W35A 3RPUA 4K2EA 1D0ZA 1AHDP 1J9ZA 1V4RA 3E6MA 3A0BC 4MR0A 3M8FA 4LIVA 3NB2A 3F8FA 3BY1A 4FHTA 4I09A 3ASPA 3WTYC 1KD1D 3CCEI 1TUIA 1HA3A 4YFXF 4B47A 5IYPA 4MHGA 3LMWA 2VC0A 2A69F 2VNIA 3OP1A 1O8IA 3EPZA 2VUMJ 3BR3A 1QHHD 5ERIA 1SD4A 2O0YA 2ZCWA 4A0YA 1KRHA 3F8CA 3I71A 3GFJA 3K4KA 5CVJA 3AAFA 4CH7A 3BTJA 1B72B 1FX0A 3OV8A 2Y9ZA 4OM9A 3OYIA 1GO2A 1MBJA 4M9XA 4DQKA 3SZEA 5K1YA 2R7FA 2JSPA 2PMHA 5F0CA 2R5YB 3OSGA 4X1EA 3FDYA 3IC7A 4R71A 3ZPPA 4L9NA 2DO7A 2K86A 3CC4B 3BG5A 5ICEA 2AXTC 3CJRB 4WWCA 4Z1MA 4C2LA 2JPCA 5BS6A 4J01A 4GDFA 1U2RA 2EIJH 2YWGA 1Z0XA 1RPWA 1JJ2B 2VQCA 1KYWA 5CKTA 1Q9SA 2DA4A 1MMNA 2KZVA 3ZZUA 2XC1A 3IAS2 5ED4A 3CMEI 3MKZA 2Z9OA 3ZBUA 1I18A 4G1VA 3R0JA 1YRNA 1UG0A 2ZL6A 2V7QA 1I1GA 3RJPA 1ZYRF 2Z16A 4KH3A 2BYVE 1IN7A 1HDDC 3OPOA 1VQLI 3WTXC 1I6HJ 2NT6A 3BDDA 1HG8A 1DARA 1QA6A 1GAWA 5HS9A 1FTZA 4PJ0C 4XM3A 1ZG1A 2KZGA 2QQBA 2NS0A 3AG4H 4YAOA 2VPRA 1KA8A 5EDNA 5JVGF 3UNGC 2GQQA 5DUKA 5DS9A 4X05A 1LFUP 1WP6A 5LHGA 1FSHA 1S8NA 5FO5A 1EF4A 2O0VA 1FOXA 1VQ5I 4RJLA 3GTQJ 2DMPA 2JA8J 1POGA 1P2FA 4D5FA 4L0YB 4J19A 2QDXA 1MSFC 1A31A 2FUG2 4PGOA 1IRGA 4HZFA 3GQAA 2VKVA 2IS2A 2KVOA 1BN8A 2FQ4A 3HDDA 1CNEA 1T6ZA 3DKXA 1WJBA 3WG9A 2DI3A 5J1RA 4FX4A 1BPLA 4RLFA 1H8EA 1CF7B 1DP7P 4A3FJ 1MBKA 2JT1A 2O04A 4EJVA 4WX9A 5F6FA 2LKSA 4B3FX 2AHQA 4O6JA 3PSFA 3H5RA 2C77A 4TMZA 2P6TA 3SEZA 3JRAA 1E3ZA 4F7ZA 2ZZEA 4E7ZA 1DU6A 3BY2A 1ZM2A 5DN6A 1O3QA 5L3CA 2HNHA 5J8FA 3OYMA 4YAUA 3S3MA 1NG7A 1NK3P 1KK1A 4U4BA 3I56B 3VYTB 2X6WA 1HW2A 1BN5A 3VFZA 1W36C 4AIHA 1ZKGA 4CYCA 3H5AA 3C2HA 5E3NA 3TOAA 5K7HA 3OW2B 2X3HA 4YDTA 3R4KA 5A88A 3CCVI 1OKRA 3D0SA 4WXCA 2OAZA 1T98A 4V19K 3KEQA 3RI4A 1BR1A 3I9V2 5AN9A 2EFWA 2EWEA 2H27A 3P9IA 1HOMA 3OIQA 3LWFA 3WHBA 4A3MJ 4I76A 4RGUA 5BNGA 1D1BA 2M1BA 2Y0SN 3LAPA 1D2EA 1JHHA 4RGSA 2H1LA 1JUMA 3SHFA 1MJBA 4PMHA 4QIWN 4PABA 1GLNA 3GTKJ 2DFHA 2XKPA 1OISA 2RKHA 2A05A 2CRGA 1JI8A 1R6RA 3OJWA 3EQOA 2NS7A 5IT9K 1LDKB 5C1CA 3HBLA 4UZUA 3B02A 2XNCA 1QVGB 1XMXA 2CUEA 1AU7A 2HEOA 4X7EA 1YYVA 4M71A 4FK8A 5J6XA 3D26A 4A69C 2M7BA 4HLYA 1I5ZA 4UV9A 3GMEA 5HLTA 5M5XJ 3GFIA 2W48A 2GLOA 2EIMH 3K6GA 2P3MA 1JJ6C 4P6YA 2DA2A 4MFDA 3CUQC 2HXIA 3GQ7A 3F8MA 3OY9A 2I10A 2FRHA 2K4BA 3CMMA 4ON0A 1TYXA 3LMMA 1WJEA 4EGYA 3P26A 4M3EA 3CUOA 4B3AA 1QH0A 3GF2A 4ACBA 3VOEA 1S4MA 4X7DA 1YW7A 3GQBA 2K27A 4PJNA 4BS9A 2EFOA 4KFCA 4QFMA 4HW0A 1VHEA 1Z05A 2PJRB 3RYRA 2OJED 3WU1B 1XMKA 2PYGA 1K61A 2GPJA 3OS1A 1BA5A 1BM9A 2V4JC 2WAEA 3ZP5A 2XC7A 2VE8A 4ENMA 1P4MA 4FX0A 3W2EA 1KC8D 3Q9VA 4AM3A 2JMWA 1UD8A 3FXUA 4M74A 1YJ9I 5LRRA 3LSJA 2F43A 5FGMA 5L3FA 4YELA 1EJ9A 1VQ7I 2XHKA 4RA2A 4DNRB 4KIFA 2EINH 3HOZJ 1YW8A 4Y9UA 2B0LA 4RGRA 5CVUA 4FXUA 1PE9A 2YWFA 1QCXA 4M3DA 1UHMA 2TCTA 1B72A 2R7OA 2UXXA 3KYCB 1ON1A 3QRFF 5DTDA 4Z4SA 2XZLA 3PIPF 2EV0A 2CMPA 2KIMA 4I01A 4LD5A 3OS2A 1IB0A 1LVAA 1QA1A 1IXSB 2QYOA 4ROXA 3I59B 1YJNB 1OFMA 3ZMUA 4FE7A 2KP6A 2D1VA 2R5YA 4YIFA 1HXDA 4LK0F 4R8HA 3E5QA 4I2OA 1GV2A 4LFUA 2IJLA 4O3MA 2Q2EB 2E7WA 1BI3A 1QUEA 2QXZA 4F93B 3IAM2 1B1BA 1U8RA 1BW6A 3ZQIA 3TW6A 1QFZA 3Q38A 4QV2A 2V9VA 1ZREA 3GVKA 1X19A 3TP3A 4HPQA 3OYNA 1N77A 1TWFJ 1AIRA 4QPOA 4RDKA 1WU8A 3KCCA 1KQ9A 2GA1A 1DABA 5ILSA 2VFMA 1W5TA 2VKHA 2XPVA 1EFRA 3PVDA 4OP7A 1YIJB 4J00A 3CC7I 1ORKA 3KEOA 3GZ5A 1FP2A 2QM3A 4GXOA 4XN3A 3OEEA 1JNYA 1RQPA 4MO7A 3VSTA 3OOUA 1KQSB 4M3FA 4N3NA 1UFMA 4YC5A 2XGCA 3V4GA 4PSXA 5HDGA 4HWVA 1YHQI 4ZYHA 2FVGA 4NB5A 5DD8A 1V55H 2ZJQF 2HYJA 4UUVA 2NVUB 5FIUA 1EFUA 2HLDA 2NSPA 1FNNA 3IKTA 2VC1A 1IUFA 4JP0A 3TDZC 4H0EA 4P6VF 3W2HA 2P5KA 3GRHA 1E2XA 4QTRA 2A3SA 5F0FA 2WPDA 1RKWA 4IHTA 1Z1DA 2C5HA 3WTZA 2LF8A 4E70A 2VNHA 4JYKA 1T2KA 4ZGNB 4AU7A 4HX7A 2X6XA 4FN5A 1USSA 1FYKA 3GTMJ 1IN6A 4HF0A 3B8HA 2JA7J 3JU4A 2LBFB 3HSRA 5HXBA 2F48A 3JRHA 3PL8A 3EETA 2XGEA 1CF7A 1UHWA 3KFWX 2CQ7A 5H6QA 1O8EA 3P27A 2EFNA 3CB4A 4XSZF 2KJBA 1OCOH 1EXMA 3I3LA 3L2RA 1XGOA 2JVGA 5IK2A 2DW4A 4XLAA 1ZG5A 1S6LA 2LR8A 5DD4A 3GYHX 1VI0A 1I8DA 3I4PA 2QBYB 2XTYA 4WQMA 4MIMA 2QGUA 1QVTA 4D5CA 1QHGA 3FISA 1ZLKA 3ZMSA 4H4KC 1ZTRA 2NSTA 1SAUA 1J5YA 3KETA 5IOYA 1OYWA 1ZLJA 1P7IA 1O3RA 2MD0A 1AKHB 2XF6A 1FT9A 1Y8RB 5DM6F 1FNDA 1H0MA 4NQWB 4IQ4A 2F5FA 4BDZA 4ZZDA 1N0VC 4UHTA 5D8KB 5JR3A 3ZQGA 1KTWA 4RD0A 4JX5A 2NTBA 1F36A 3W6JB 4WK8F 1O3SA 5A8AA 3BPVA 3S93A 3WNDA 4DK0A 1OJLA 2DBBA 4MQ9F 2VT2A 2ECBA 4I7HA 1QZZA 4BDYA 1JGGA 3N4MA 1XQBA 2CW5A 1XGSA 4DGWB 2X3UA 4BJ5C 2I8DA 1VJSA 5GAEJ 2BOLA 4ESJA 3ROUA 2LDUA 2VE9A 1AIPA 1EP1B 5C44J 1O8LA 2XTXA 3ZN0A 2V6CA 3S8PA 1X1DA 2DODA 4A5NA 4BU2A 2BVLA 4I98B 1TYWA 3QP6A 2YU9J 1T08B 2EFPA 2FD5A 5CYVA 4CGZA 2ID6A 3S3OA 1JUPA 2FOWA 2LP0A 1SFKA 3DXJF 3MHPA 3CCQB 1A8PA 1OB2A 1OB0A 2ZZFA 1D1AA 4GRIA 1WGXA 5IP9J 1BOAA 2ZTNA 3I5UA 2BGIA 3NQOA 3T9GA 1IB4A 1N25A 2J5OA 1AWCA 4IOCF 4Y9RA 4WZLA 4HV6A 4DQ2A 2KFDA 2EJRA 4BAYA 2C2WA 3AG3H 4E6KG 2PJRA 3CJTB 3HOSA 3S15J 1FOWA 2ZO4A 1NB9A 5FB2A 5LGTA 3SLDA 4RS8A 1BI2A 4AF6A 2QQAA 1OGOX 1BJAA 3HKZA 2GBYA 2RAEA 3UKGA 3JSOA 1RNLA 2VXDA 3F21A 2IGMA 4D7NA 1ULYA 1QFJA 4TMVA 3HG9A 3PUNA 2D9RA 5IYDJ 4E0FA 3SQNA 3TH0A 2JUGA 3GVAA 1G8XA 1VQNI 1O4XA 3LSPA 4Q5SF 3BNWA 3QYEA 4KJZA 4KIBA 3QYBA 4E7SA 4ZDOA 3J80Z 2D1HA 5FRMA 1BQEA 4RPDA 1OPCA 3CCEB 5M3FJ 2LC2A 3H0GJ 2KPMA 1XS9A 1S7OA 1JE8A 5IP6A 1A6IA 4M0LA 4PC1A 3I59A 4LOCA 4PK4A 3NAUA 1RQRA 5TRDA 1H9TA 4AIKA 3ML3A 2RNJA 1W2BB 1R1TA 3WBJA 2EZLA 5KHDA 1M1KD 4C3HJ 1EH7A 4OJ5A 1U3EM 3GIRA 2VIXA 2KQRA 2NZMA 3L2VA 2LSOA 1FNMA 2IW5A 3QFSA 2L0KA 1U5TB 4GO1A 2MGQA 3HPHA 4JBAA 2XGJA 1DGRM 3RPQA 5CVIA 3E1SA 2YX4A 4G1BA 1I3AA 5LHIA 2Y69H 4C2TA 2FXAA 2F2EA 3BJOA 3BROA 3GTPJ 2NS8A 2IS4A 2W84A 3GQ8A 4YRVA 4EW9A 4X7FA 1S5LC 2DFEA 4OJPA 2VQLA 2E1MC 3IP4B 4KT6A 3WGIA 4BE2A 1G4DA 2BV3A 2FEZA 4Z03A 1KZHA 3HOTA 1A36A 1PKVA 2K02A 2XNDA 2LD5A 4BXFA 5KSWB 4HE6A 4RAZA 2NTPA 2Y0MA 2FOKA 4XN0A 1PLUA 4G9YA 2QUFA 4C0SA 1WKMA 1HVXA 4G7XA 4G7OF 1NJID 1QZYA 1TQIA 1UELB 3A03A 3F9KA 2ME6A 2K9NA 4E7IA 4TMTA 3BZCA 5EMNA 1VQLB 2CS3A 1K4ZA 2ZSHB 3NEUA 5BMZA 5H6RA 1BI0A 2K3PA 1BBYA 4B09A 4D1QA 2F5CA 1WXRA 4IRIA 1T38A 4PJLA 3U9GA 1YJNI 3MVPA 2ID3A 3ZZTA 1B6AA 1GVHA 1BLIA 2PN6A 2I1LA 1D8KA 3RKYA 2INVA 2VOOA 3OIOA 4YFKF 2CH0A 1VQ5B 2QZAA 2VBMA 2E1BA 3ZMTA 5AIPA 5ICGA 1W0TA 3NE5B 1FY7A 4DYRA 5HODA 1QU3A 2TDXA 4U9UA 2LTPA 5M5WJ 4G7ZF 2R9VA 3TOBA 1WVRA 3ESWB 5EZGA 5HZBA 4JK1X 2XROA 2QE7A 1W87A 4HLXA 1LB2A 4KICA 1G59A 5E79C 3A01B 3E97A 3H09A 2F5VA 1ETVA 1R7JA 3HTUA 5K7ZA 2DYRH 5J4YA 4NHJA 2CW0F 4DBRA 2W6JA 2QBYA 2BPOA 4B8XA 3GZNB 3CLOA 3T56B 1ZUNB 3WGGA 1OB5A 3IWZA 3M8EA 4XOPA 2NYXA 2CQQA 4HQMA 4HG2A 3AVXA 4XK4A 3LQEA 1AKHA 1JTYA 1S29A 4P1VA 2DMNA 1HW1A 2X4HA 1IN4A 4XLHA 4NQWA 4MTDA 1JKOC 2DOGA 2OTLB 4UUSB 4F91B 3B6AA 4JQFA 3S14J 2CUFA 1WSRA 3OYAA 1U8BA 5FLXK 1FPQA 1Y1VJ 1B9MA 2L9NA 4E7JA 4K1XA 5F4JA 3CCVB 3CUQA 2BEOA 2EK5A 1FX7A 4WCGA 1X58A 3I4NJ 4XKCA 1OCZH 1MMAA 2IGNA 2PEXA 1HA8A 2MH9A 1Y0RA 2UUZA 3OYHA 2DIEA 2HU9A 3G05A 4A3JJ 3A2KA 1IZ1A 1R1VA 2VBWA 1VZ0A 3S2DJ 2Z2SB 2X8KA 3CCRI 1B8IB 1K7AA 4GQNA 3N05A 5LBQA 2QSFX 2EBIA 3ISPA 1PUEE 1RWRA 2DJIA 4IQJA 3ASRA 1OHHA 5L3EA 2M9HA 4C30A 3Q0WA 2BM5A 5H20A 1FTTA 4PC2A 2GJRA 1LJ9A 1JT6A 1W4MA 4LG0B 1LEAA 2K9QA 2KL4A 3IH2A 1R71A 2IRFG 2Q6LA 3CPXA 5GP9A 1H85A 3I64A 3A02A 4PZJA 4EM0B 2DU9A 5K5OA 3ONQA 3WWGA 2BBYA 4Z6YA 5FKLA 5FKNA 4ZTFA 5HS8A 4UB6C 1KZLA 3F8NA 2WAQA 2YWHA 3FMQA 4X6AJ 1ZGJA 1FMWA 3BG7A 2WAQN 1BC7C 2O9LA 3ZUGA 4W8TA 3IV5A 1WFXA 1L0OC 2MC4A 4EH1A 1G2HA 1WI9A 1SD6A 4MFEA 4A2UA 2K5CA 5GTIC 3ZCOA 3QE2A 1BHEA 4F3QA 5FL7A 2EILH 3QPTA 3BPXA 4QUZA 1IRFA 3RYPA 3B6CA 2GOMA 3EDPA 1FBSA 4Y7CA 5HKKA 2HKXA 1K73D 2O5RA 1OFDA 2FMYA 3OYDA 2Y75A 3S1RJ 3BH6B 5A89A 2EV5A 9ANTA 2OBRA 3BC8A 4I84A 1S3JA 2G9WA 2JUCA 4I0AA 4PJMA 1UD6A 3T51B 3J81k 3ABKH 4DOZA 3KPHA 5H2FC 1SM4A 1VQ7B 4DNTB 2BF4A 4U49A 4IHVA 2A68F 4PC7A 3G1LA 4UAJA 4IXAA 4A6DA 5L46A 2WB1A 3V8KA 3U1KA 1J7KA 3GUDA 1T5EA 2JPBA 2R7WA 3CCQI 2LK2A 3SEJA 1QQIA 4M72A 1ZARA 3P4GA 3C3WA 1XC5A 5E17F 3R6JA 4XRMA 1R5GA 1W7PB 4UVCA 3L1PA 4Y52J 4PJJA 5E1ZB 3F6VA 5J1YA 2GREA 3Q6QA 5FLXZ 4C43A 2PX9A 1U5TA 3SZGA 1UZCA 1W1WE 3KZYA 4EJWA 3OSFA 4II2A 4U0WA 5EG0A 2HZDA 2CW7A 3ZXSA 1YS7A 3TKYA 4AD9A 1RMGA 4LBYA 1ETWA 5JFRA 1N07A 3ISXA 1SANA 1VLOA 4IW3B 4ZV4A 2IQ7A 1QPIA 3VMFA 4GYIA 3BCAA 2F4OB 2CG4A 1I50J 3DBHB 1I6XA 1D5YA 4HRIA 4WZTA 4YFNF 2X9DA 2W00A 4KN4X 2X0LA 4M3GA 3CC7B 2AS5F 3LSKA 5D6EA 4C2UA 4B44A 3GLLA 3A3BA 1WJ5A 1KONA 2KMUA 4LITA 1RR7A 2ZBKA 2P4WA 3QQAA 5E3LA 2COBA 2VBKA 1S7AA 4O5VA 1LUJB 3K1PA 2DDAA 5JHFA 4P9SA 3HSFA 4TN1A 5DS0A 1IV8A 2AHOA 1YHQB 3FY3A 1U9OA 1TNSA 2JWTA 4BBRJ 4DZJA 1RRJA 2OA4A 5LFAA 5J1UA 1EP2B 3ASNH 4FISA 1Z77A 5BSXA 5JI6A 2EZKA 4A12A 1S72B 2ZJ2A 2JK3A 3SDGA 1LQ1A 2V7FA 4A6EA 5EGOB 4DYQA 4BGDA 1YITI 1X1PA 4ENJA 1Y56A 4IL6C 3AVWA 1I7PA 4I99C 1J0RA 3I55B 3MCZA 1X4OA 3SYTA 4AIJA 1K79A 3QODA 3A01A 1FSEA 4L5EA 2K9LA 1E1RA 1XCVA 4Y4RA 2HPIA 1GT0C 3HHGA 3PJRA 3JSPA 5KNLA 3FM5A 3BQJA 3AG1H 3VDXA 3ONYA 1TYVA 4ZJZA 1VQ6I 1JTXA 3QPSA 2K3FA 5BOXA 2HQ5A 3CCSB 4RDLA 1MZBA 1GDTA 3K4MA 3OS0A 3HYIA 4AVZA 2A6HF 3KX2A 3P9CA 3QU3A 3ASOH 3CP8A 2HTJA 2BM4A 1KU9A 1OYIA 1RZ4A 3RQIA 4ZC3A 3F23A 4UUSA 2VBYA 2VJ4A 3DTKA 1E3HA 3ZQQA 3RKXA 4UZFA 4I6ZA 4E7HA 1TZLA 1O3TA 3WYAA 2CV2A 3ZR8X 2COMA 2XASA 3BZKA 3W5HA 2HOTA 2O03A 4Y3OA 1MBGA 2BV6A 2TRTA 5JHUA 4OJ6A 1VF7A 4YCQA 4U0YA 1TBXA 4HNTA 1CQXA 5C1EA 1LPQA 5JLWA 1DDGA 1QRCA 3V7CA 1XE1A 2JRMA 4L8JA 2HS5A 3FIWA 4BYYA 1UD2A 3FJOA 5GAGJ 2X1CA 3RTRA 1W0JA 4M9SA 1B8IA 1ZG3A 2XAUA 3ZQ7A 3ZMVA 1KQ5A 1D8TA 2EQRA 3TP0A 3FPPA 1HF2A 1QX4A 2P7CB 3HM5A 1IW7F 3OR1C 2NVTJ 1RESA 2L9SA 4EJUA 2OK7A 3K9TA 4HAMA 4LG0A 2X1EA 4L9JA 2HDNB 2VXZA 2CUZA 1X2MA 2RQPA 4BY7J 3VYUB 2CQNA 1XDUA 3JX8A 3NRVA 4M3BA 3GW2A 1AMOA 3NAWA 3T8RA 3FXLA 3MAJA 2H8RA 5LHHA 1WOOA 2JZYA 3WBKA 5GADJ 1IV6A 1FRQA 2V9KA 1MDMB 3JTGA 5E3MA 1MJAA 1HLVA 4B4DA 4XICA 2GJKA 3PA2A 3H9QA 2ZSIB 2R7SA 3LSHA 5BPIA 3Q9SA 1FOKA 2Z6BD 4P96A 1VQKB 3Q0VA 2OTLI 5L3BA 1X3WB 1YX3A 2L5QA 3OYLA 1UD3A 4XKWA 4KDPA 1E79A 2ESHA 1VQMI 4ZGQB 3HGYA 3SJPA 2NOGA 2XF5A 1P4XA 2OCEA 2CSOA 3T53B 1OYYA 3A8JA 3BG9A 2NPFA 3LNQA 3T1BA 5E6TA 4ZDLA 1A5JA 1ETYA 1FOYA 3ZSCA 3BCBA 1YG2A 1X1CA 1LFPA 4U7BA 3L2UA 3ZMDA 3LA3A 3LSRA 1TNTA 3GWZA 5IP7J 1EV7A 3RDIA 4LLNA 1EFCA 1VQNB 2BZTA 2LZJA 2R0QC 3GTJJ 3WHCA 4B48A 4ZYGA 4CZCA 5J47A 1O8GA 1W36D 3TGNA 3D1NI 2V4DA 5F4MA 2HQRA 2R3SA 4Z4VA 3L2QA 2ECCA 3KYDB 1N78A 4ACAA 3DCFA 2J7KA 4EV0A 2CC2A 1NRKA 4L5IA 2WA0A 2HOEA 3E7LA 1PP8F 3MCAA 3CMAI 2VBXA 2XGDA 3PNVA 4OINF 1OGIA 2CF4A 4NK8A 4XLNF 5KCMA 2W85A 2E36A 2RQQA 4EM1A 3HEFA 1ETXA 1V5FA 2MW8A 1Y0YA 4OOVA 3PETA 1E64A 4BE0A 4NK6A 4HSTA 1X3UA 1KGSA 4NC7A 2KIQA 3Q6RA 2XAHA 1I3QJ 1LE8B 1UD5A 1P7JA 5F0HA 2RC5A 1WRJA 1G6NA 4BHCA 1YJWI 5BPDA 4XMYA 1Y1WJ 3VO2A 1BI1A 3HOWJ 3SYJA 3JRGA 1LDJA 3JQPA 4A3DJ 3MZYA 3KE2A 2GXBA 2ZTGA 1CZFA 2BM7A 4EMSA 4RCZA 4S05A 4XR6A 3RSNA 3MN2A 4C9YA 4YG2F 4EGZA 4YAFA 2VFNA 4W97A 2CV1A 5J8CA 5CQEA 1P4WA 2OZ6A 2XRLA 4OJLA 1SVMA 4XLPF 1VHOA 5AONA 1XN7A 3A8KA 1YE9A 1HF0A 4U0VA 5ICFA 4U7DA 2IT0A 4KUMA 1J09A 2BW3B 3OWTA 1J75A 1Q82D 5K7FA 1R22A 2BN4A 1K8AD 4IHWA 2HZTA 4RM3A 4HIZA 4XL9A 2IS6A 5EGOA 1HDPA 2LVSA 2DYSH 3BR2A 3FXQA 2D5VA 4DJAA 6PAXA 2HCJB 3BWGA 1Q86D 3JCUC 2NNYA 1LVKA 2BSPA 2DEUA 5FROA 1HCRA 2AO9A 2H94A 1U78A 2O6GE 1UD4A 4M73A 3ECHA 4XKVA 1XPXA 2OU2A 3MMYB 2HDCA 2STTA 3FPKA 1TT0A 3E6BA 4Q48A 1HQCA 3HZJA 4CDGA 2WBMA 5EZHA 2X48A 4N4OB 2QENA 3A35A 2KLOA 2CFOA 1ITYA 2HYGD 1V5GA 2HPMA 5D5UB 4RB0A 5JBQA 4OU0A 4LBVA 2XUBA 3CJNA 4MQVA 4G5GA 3DKYA 3GSIA 3SXYA 1OOCA 2JN6A 2BY0A 2W57A 1ZGAA 3GVLA 2QKMB 3O8GA 4M53A 2HXOA 4OOIA 2DDBA 3OFNA 4YIIA 3IH4A 5EYRA 3LOCA 3OW7A 4X06A 1IO2A 1LDDA 2HQAA 4RAFA 2XT2A 3M1EA 4MEYF 3DWLE 5IY5H 5IPAA 3CXCB 4Y7NJ 1U5TC 4M4SA 3W3CA 4CCNA 4A3KJ 3BTIA 1UJ8A 4LB6B 5LEKA 2VFPA 5EEHA 5CJ9A 1U2WA 1SVOA 4PSWA 2XZOA
chains in the Genus database with same CATH topology
2CUJA 1HZEA 3DLAA 3VSVA 3HPHA 1WJCA 2XGJA 3VMVA 1DGRM 4OAZA 2XOKA 1MNDA 3E1SA 1PJRA 3BH4A 4XONA 4JMQA 4C2TA 4OWRB 2WZPP 4CSWA 2IS4A 4XLCA 1WJDA 2LOOA 3VSUA 4G7WA 4YRVA 2R7VA 2R7QA 2JJ1A 3GQ8A 4EW9A 4OJPA 2VQLA 2E1MC 3IP4B 4KT6A 1DGWY 4BE2A 1WTHD 1O8MA 4Z03A 1PKVA 3HOTA 4URRA 4NNJA 4YZQA 4CCOA 3ZGKA 3OYGA 4BL0B 2R7TA 4OJOA 2XNDA 3UW0A 1YX5A 4BXFA 2WY8Q 2DXIA 2Z1DA 2E1MB 2NTPA 4XN0A 2RREA 3B90A 4KITB 1PLUA 2O17A 1HVXA 4ZTJA 4G7XA 2LREA 2IGOA 1COWA 1UELB 3DU6A 3F9KA 3RQ4A 4E7IA 1X4PA 2UV1A 5TGTA 1MABA 2CS3A 2ZSHB 4N4NB 1O8HA 2K3PA 3MD2A 4G6TB 4P22A 4D1QA 1Z3YA 4PJLA 3NWSA 3SDBA 1BOBA 1WMRA 2AQEA 2Y0SA 2R7RA 4FETA 3B4NA 2INUA 3RPUD 4B3GA 1BLIA 2F1MA 1K5CA 3C2GA 2GK6A 2INVA 2OV7A 2VPLA 2HDWA 3DEEA 3HXLA 2CH0A 2PECA 2VBMA 3K4CA 4RLQA 2E1BA 3BLYA 2D3NA 4X0GA 3NE5B 1QU3A 2R9VA 3VR6A 1D0ZA 2QY1A 4BEHB 1OLTA 2ZZQA 2A5WA 4MR0A 2QE7A 4LIVA 4RMNA 2RNGA 2X85A 1G59A 1WJFA 2ZXHA 1WJAA 2F5VA 3U21A 3LMWA 4B47A 3FBNB 2LY2A 2DT6A 4DBRA 3TBIA 2W6JA 3DDYA 1O8IA 3EPZA 3DPTA 2LH9A 4FASD 3T56B 3D5RC 1QHHD 3HUGB 4XOPA 2R4GA 2GJPA 2QX3A 2ODLA 3K4KA 1FX0A 4CH7A 4HG2A 2LRDA 1O8DA 2W82A 2V6EA 2WSSA 2W6IA 3OYIA 2WADA 4XLHA 3DQVC 2XDVA 3OL3A 4F91B 4JQFA 2JSPA 3OYAA 1VBLA 4YEJA 2L9NA 2VASA 4E7JA 3FDYA 3ZPPA 4IZZA 3K70C 3HL2A 3A3GA 4XKCA 3CJRB 1MMAA 2IGNA 2E60A 2K9MA 2VJJA 4II3A 4J01A 4Z1MA 2UVFA 3FHNA 3V42A 1HA8A 4C2LA 2X53S 1SKYB 2UUZA 1BR4A 2IGKA 4D9JA 2HU9A 3OYHA 2DIEA 3G05A 2VQCA 4PFPA 4XLFA 4BQNA 3A2KA 1Z3XA 3EUKL 5CKTA 1E3XA 1MMNA 1VZ0A 5HNHA 2Z2SB 2X8KA 3LSMA 2KZVA 4GQNA 3IAS2 3N05A 1RWRA 2P0WA 4LIUA 3MKZA 2DJIA 4IQJA 2NTQA 1I18A 1OHHA 4CCJA 4C30A 1E43A 2GJRA 1UG0A 2VB6A 3S32A 1ZELA 2V7QA 2Z16A 1D0YA 2DOAA 2KL4A 4XOTA 2OC6A 3OPOA 2WJVA 4DBQA 4TSFA 3QOEA 2NT6A 4P1WA 1OGMX 4E7LA 4NC8A 3K70D 3MKWB 1HG8A 1XG2A 1JTAA 3ONQA 1X1AA 3WWGA 1MMGA 4XM3A 4BUPA 3UNGC 4ZTFA 1WP6A 3SEQA 1WPCA 1KZLA 2M4GA 2WAQA 2O0VA 5CDFA 1FMWA 3BG7A 4G6IA 2DCEA 4XD7A 4W8TA 1T0FC 2VL8A 1WFXA 2CK3A 2MC4A 2M3AA 3FKSA 2K5CA 2FUG2 3ZCOA 1BHEA 4JOMA 4F3QA 3CP2A 5FL7A 3GQAA 2IS2A 2KVOA 1BN8A 2GOMA 3CZ6A 3ZPNA 3SUCA 3DKXA 1WJBA 5HKKA 1PXZA 2O5RA 4KKUA 2LYCA 4PUSA 3OYDA 1BPLA 4TT3A 4RLFA 1H8EA 3OYEA 1X0CA 1IA5A 3BC8A 4I84A 4PJMA 1UD6A 3T51B 2O04A 4DOZA 4B3FX 3PSFA 4QPQA 4DNTB 3H5RA 4R79A 3SEZA 3OIPA 1E3ZA 4U49A 2ZZEA 4W8QA 4E7ZA 5DN6A 3OYMA 2HNHA 2CV0A 1MNEA 4AYBA 2E5NA 3S3MA 2WB1A 1NG7A 4MXNA 4U4BA 2O1DA 4B43A 4E4HA 1T5EA 2R7WA 1DBOA 1T95A 2HVQA 3ZIAA 3VYTB 2X6WA 1UAAA 1D0XA 1W36C 2LY1A 4F92B 4RM2A 2X6YA 3D5SC 2PMZA 3H5AA 2IS1A 4OZYA 3C2HA 2X3HA 1KCDA 1E0EA 4PJJA 1U0JA 1O8JA 3SZGA 3DU5A 3GVJA 1BR1A 2OUMA 3I9V2 4II2A 2EWEA 2VKDA 2HZDA 2WY7Q 2CW7A 4YZ0A 3OIQA 3ZXSA 4HSRA 3OYFA 1D1BA 4E7KA 1RMGA 2GOXB 2LBFA 4LG3A 4BJTA 4ASUA 2IQ7A 2UVEA 3BCAA 4PMHA 4CCKA 4U87A 1GLNA 3KYLA 4HRIA 1DP3A 3PSIA 2W00A 1JI8A 1R6RA 3EQOA 3LSKA 1LDKB 4C2UA 3GBGA 4B44A 3A3BA 5C1CA 4UZUA 1WJ5A 1KONA 2MYSA 2KMUA 3DTIA 4LITA 3A4CA 3LFUA 2VBKA 2X51A 4IX7A 3M1CA 2M7BA 5JHFA 5HLTA 3K6GA 3MKYB 4ZDPA 1JRGA 3FY3A 1FMVA 3GQ7A 3AL0C 3OY9A 3OE7A 5FRNA 1OFLA 4BE1A 5LFAA 4ITVA 3RCOA 3OYJA 3CMMA 3PNTA 4OZZA 3LMMA 1WJEA 3VYSB 1E1QA 2M7AA 3AL0B 2HVRA 1K28D 3OYKA 3OAAA 2O0WA 3HPGA 2V7FA 3GQBA 3QYFA 4BGDA 2VQGA 4PJNA 3ZRGA 4BS9A 1Y56A 5AMVA 4BEHA 4Y33A 2PYGA 2PJRB 1V0FA 4XLEA 3OS1A 2VLAA 2V4JC 1X4OA 2WAEA 3SYTA 2XC7A 3K4BA 1O88A 3QODA 1E1RA 2K9LA 3A1YA 4Y4RA 2M4KA 2HPIA 1UD8A 2E5ZA 3PJRA 2JDIA 5KNLA 2F43A 4TKOB 1V5EA 1Z7LA 4YELA 4B3XA 2BVMA 3VDXA 4DNRB 4ZJZA 3OL4A 2CW8A 3DPUA 4FXUA 1BR2A 3PUBA 3K4LA 3LSIA 4CA0A 3K4MA 3OS0A 1QCXA 4AVZA 2A6TA 4XQFA 2JIZA 2R7OA 2F6CA 3OEHA 2XZLA 3KX2A 3CESA 3CP8A 3OS2A 2CMPA 4ZC3A 2XF7A 2VJ4A 3DTKA 3ZQQA 1OFMA 1O8FA 4YZAA 2KP6A 3H9GA 1TZLA 2QKLB 4E7HA 1H80A 1N75A 3PFYA 4ANJA 3ZR8X 2CV2A 2BW3A 3PNYA 4Z05A 3HAGA 4Y3OA 2JJ2A 2ZXIA 4OJ6A 3LNNA 1VF7A 2IXSA 1P9QC 1NHCA 4HNTA 5C1EA 2PYHA 2Q2EB 1Y6IA 4ZYAA 5HOOA 1AA7A 4BACA 4L8JA 2QXZA 4F93B 3IAM2 1UD2A 3W2AA 2NT9A 2VJ5A 2Z8GA 3H35A 2X1CA 3RTRA 1W0JA 3GVKA 1MMDA 1X19A 1N77A 4HPQA 2XAUA 5HVQC 3OYNA 3G2BA 1EE6A 3GQ9A 1AIRA 4QPOA 3H94A 3FPPA 3OR1C 2L9SA 3H5NA 2VKHA 1EFRA 3B8YA 4Z06A 4XORA 4J00A 1IDJA 2X1EA 4XN3A 2HVSA 3OEEA 2VXZA 2CUZA 3E0JB 3NWTA 3VYUB 3VSTA 3L2WA 3OOUA 3OOCA 4EATA 4PSXA 1NG6A 4W8RA 3VYRB 4HWVA 5CQGA 1W9XA 4YZXA 2WJYA 2KHMA 4CUGA 2V9KA 2M5SA 2HLDA 2NSPA 3VSKA 2GJKA 1DQUA 3H9QA 2ZSIB 2R7SA 3LSHA 1VLYA 2V31A 3BG6A 3DPLC 2Z6BD 3GRHA 2V1NA 3TMOA 2WPDA 1YX3A 2L5QA 3H9JA 3OYLA 1UD3A 4XKWA 4MLOA 1E79A 4AU7A 2X6XA 3K10A 1IDKA 2XF5A 3JU4A 2LBFB 3T53B 4HNUA 3PL8A 1EA3A 2JVHA 4ZDLA 3W2WA 2JA2A 3ZSCA 3BCBA 2XSJC 4BQQA 1X1CA 1LFPA 4KISA 1O8EA 4U7BA 3L2UA 1GQ8A 3H0DA 1MW7A 3I3LA 2M0MA 3L2RA 2LZJA 2KRCA 2JVGA 1OR7C 5IK2A 4W8SA 4B48A 4CZCA 4XLAA 1O8GA 4NUBA 2ELJA 1W36D 2V4DA 5CPRB 1I8DA 1V0EA 3JURA 1W0KA 2KDOA 3L2QA 2ZFUA 1N78A 1QHGA 4IKFA 4BQOA 4H4KC 2NSTA 1SAUA 4CCMA 1NRKA 2NOJB 3W2VA 2WA0A 1H8HA 2V26A 2AQFA 2MD0A 3VWBA 2XF6A 4NK8A 3PNVA 1K6YA 5KCMA 4NQWB 3AKZA 2UWMA 4IQ4A 2ZZGA 2RQQA 4BDZA 1V5FA 1S9HA 4BE0A 1KTWA 3OR2C 4HEA2 4HSTA 4NK6A 2NTBA 1PYVA 2X1DA 2R7XA 3VSLA 4NC7A 4KKTA 1O8KA 4XNFA 3S93A 4DIQA 4DK0A 1QJVA 4CCLA 4BDYA 1UD5A 1LKXA 3OYBA 1KMHA 3TL4X 4DGWB 4BJ5C 2I8DA 1VJSA 4XMYA 2BOLA 3UR3C 1O8LA 1NBMA 4F52A 5LD2C 1ERDA 2L2OA 3S8PA 1X1DA 4BU2A 2ZTGA 2BVLA 1CZFA 4XR6A 3HC7A 3RSNA 4C9YA 2GK7A 1RU4A 3S3OA 2CV1A 1D1CA 5CQEA 3M8JA 1SFKA 2KRHA 5HNFA 3K4NA 4OJLA 3LSGA 4XKBA 3KRGA 1OB0A 2ZZFA 3FKJA 1YE9A 1D1AA 2MFZA 4GRIA 2XZPA 2ZTNA 1J09A 2BW3B 3OWTA 3EUHC 2W7NA 2MABA 2F4IA 3CJQB 3BC9A 3T9GA 1IB4A 2WAFA 4PFOA 4RM3A 3K4JA 3OMYA 4HIZA 4XL9A 2IS6A 2R7UA 4DJAA 3LL7A 4E6KG 2BSPA 1LVKA 2PJRA 2VQHA 5FROA 3HOSA 3KEWA 3VMWA 1UD4A 3CF2A 4DK1A 4XKVA 1OGOX 2DT7B 3MMYB 2D3LA 3HKZA 1TT0A 3D5LA 2VXDA 2WBMA 2IGMA 3HG9A 4N4OB 2W4SA 3A35A 2KLOA 2CFOA 2L7KA 3IUOA 1V5GA 2JUGA 4OAYA 1G8XA 2HPMA 4KKSA 4E0FA 1KCCA 1PE9A 3QYEA 4KJZA 4E7SA 3QYBA 4ZDOA 3EQNA 3J7AY 5FRMA 2LG4A 3DKYA 4YXWA 1OOCA 2VJIA 4BJ6C 1DBGA 2LC2A 4P5OA 1X1BA 2KPMA 3GVLA 3OYCA 2QKMB 2VBEA 3OFNA 3S3NA 3AFHA 4PK4A 3DTEA 3OW7A 2HQAA 3BCFA 3DWLE 5KHDA 2Q1ZB 3WQZA 4OJ5A 1Z21A 2VIXA 2KQRA 3EUAA 3W3CA 4CCNA 4F55A 2W1OA 2NZMA 3KEYA 1IRXA 3L2VA 3BCDA 4PSWA 1BMFA 3FBIB 2XZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W8S A;  2O0W A;  4XLA A;  4XOT A;  1O8G A;  3VSV A;  3VMV A;  5AMV A;  2PYG A;  2NT6 A;  3JUR A;  1OGM X;  4XON A;  1HG8 A;  4XLE A;  1XG2 A;  1JTA A;  1O88 A;  3WWG A;  4XM3 A;  2NST A;  4XLC A;  3VSU A;  3GQ8 A;  4EW9 A;  4OJP A;  4Z03 A;  4NK8 A;  1O8M A;  4YEL A;  4URR A;  4YZQ A;  3UW0 A;  4OJO A;  2O0V A;  4NK6 A;  1KTW A;  1QCX A;  2NTP A;  4W8T A;  4XN0 A;  2NTB A;  4AVZ A;  4XQF A;  1O8K A;  3B90 A;  1PLU A;  2O17 A;  4XNF A;  1BHE A;  1QJV A;  3GQA A;  1BN8 A;  1O8H A;  3SUC A;  1OFM A;  1O8F A;  4YZA A;  1PXZ A;  4XMY A;  1X0C A;  1H80 A;  1IA5 A;  1O8L A;  4I84 A;  1WMR A;  4Z05 A;  2O04 A;  3B4N A;  1CZF A;  2INU A;  4OJ6 A;  4XR6 A;  1K5C A;  1NHC A;  1RU4 A;  5C1E A;  2PYH A;  2INV A;  4U49 A;  4W8Q A;  2QXZ A;  2PEC A;  2VBM A;  2NT9 A;  2Z8G A;  4OJL A;  4MXN A;  4U4B A;  2O1D A;  3KRG A;  1DBO A;  1EE6 A;  2QY1 A;  3GQ9 A;  2X6W A;  1AIR A;  4MR0 A;  2X6Y A;  4OZY A;  3T9G A;  2X3H A;  1IB4 A;  1KCD A;  2X85 A;  3B8Y A;  4Z06 A;  4XOR A;  1IDJ A;  4XL9 A;  1O8J A;  4XN3 A;  3LMW A;  3VST A;  2BSP A;  2EWE A;  3VMW A;  1O8I A;  4YZ0 A;  1RMG A;  4XOP A;  4XKV A;  4HWV A;  1OGO X;  4W8R A;  2QX3 A;  2ODL A;  4YZX A;  1O8D A;  2IQ7 A;  2UVE A;  4XLH A;  2NSP A;  4PMH A;  1KCC A;  3GRH A;  1PE9 A;  3EQN A;  1VBL A;  4YEJ A;  3ZPP A;  4XKW A;  1OOC A;  3EQO A;  2VJI A;  1DBG A;  5C1C A;  2X6X A;  2UVF A;  2VBE A;  2VBK A;  2VJJ A;  1IDK A;  4C2L A;  4XLF A;  1JRG A;  3FY3 A;  3GQ7 A;  3ZSC A;  1OFL A;  1RWR A;  4OJ5 A;  1O8E A;  1GQ8 A;  2NTQ A;  2NZM A;  4OZZ A; 
#chains in the Genus database with same CATH topology
 1EA0 A;  2C4T A;  4KNY A;  1FNC A;  1QGP A;  1S72 I;  1WJC A;  3V76 A;  4OAZ A;  1VQP I;  2XOK A;  1MND A;  2CRV A;  3BH4 A;  4LGW A;  1FIP A;  3EQL F;  4OWR B;  4CSW A;  3BR1 A;  4XLC A;  3ES9 A;  3I55 I;  1QGZ A;  3FXJ A;  2R5Z B;  4HE5 A;  3CCR B;  1WTH D;  2JJ7 A;  2GZW A;  1UST A;  4Q4Z F;  5L3D A;  3IRR A;  3SLN A;  4OJO A;  1EP3 B;  2Z5U A;  4YEI A;  1VFC A;  2HYF A;  2RRE A;  3FXO A;  4IJA A;  1PP7 U;  2FF4 A;  3CCS I;  3QWL A;  4ZTJ A;  4ZZL A;  3J80 K;  1WH7 A;  1MDM A;  3DU6 A;  5EEG A;  4L18 B;  3HIF A;  2UV1 A;  3S2W A;  4LJZ F;  2LKX A;  1MBE A;  4G6T B;  1GAQ A;  3Q3A A;  3P9K A;  2J8I A;  3NWS A;  1E62 A;  3SDB A;  1BOB A;  1F4K A;  1WMR A;  2L9R A;  2BX6 A;  3S17 J;  3B4N A;  4OPS A;  2QA4 B;  3ZPL A;  3RPU D;  2CJJ A;  4B3G A;  5KAI C;  3TDU C;  4A3L J;  1KU2 A;  1TWA J;  3C2G A;  3JW4 A;  2ZJR F;  3JQR A;  1K5C A;  2OV7 A;  1SFO J;  3A1P A;  4N9H A;  3JAM Z;  2D3N A;  1RIO H;  4BKX A;  4IO9 F;  3BOQ A;  4X0G A;  4A3G J;  2CFX A;  3E6D A;  4Z4U A;  4RLZ A;  1Z67 A;  1WSV A;  1GVD A;  3ZQH A;  1WPK A;  1OLT A;  1Z91 A;  5A2Q Z;  2BVN A;  4RMN A;  2CWE A;  1ONV A;  2KKO A;  2RNG A;  3AVY A;  2YSR A;  2ZXH A;  5EJC A;  3CCU B;  1TW2 A;  2PBI A;  5J40 A;  4A3I J;  3BJA A;  5FLV A;  3FBN B;  5FD6 A;  2DT6 A;  1FDR A;  5KW9 A;  2ZBU A;  3V7R A;  4CXF A;  2YUH A;  2K9S A;  3DPT A;  2LH9 A;  1R5I D;  2O61 A;  4FAS D;  1KU3 A;  5F1J A;  1R49 A;  3HUG B;  3V8L A;  1E63 A;  3G6E B;  1IF1 A;  2A61 A;  2R4G A;  2L7Z A;  4G7H F;  1PJ5 A;  1XD7 A;  1YTY A;  2LRD A;  4LC0 A;  2W82 A;  2V6E A;  3GTL J;  2DPD A;  2W25 A;  3MQ0 A;  2WAD A;  5D4R A;  5C4X J;  4QWQ A;  3DQV C;  4RCY A;  2L02 A;  4CYD A;  4Y17 A;  2STW A;  1VBL A;  2VBT A;  4YEJ A;  2EZH A;  1RI7 A;  1VQK I;  3O6B B;  4IZZ A;  3HL2 A;  4A3B J;  1LE8 A;  1TQM A;  1UG2 A;  3A3G A;  2VJJ A;  3CCL B;  3B82 A;  3FHN A;  3KP3 A;  3V42 A;  1QGA A;  1SKY B;  1BR4 A;  2IGK A;  4BPR A;  2XAF A;  2ESN A;  1KQ0 A;  4PFP A;  4XLF A;  1E3X A;  1MH3 A;  2N8G A;  3EUK L;  1TC3 C;  2V5I A;  3LSM A;  5FLM J;  1IGN A;  3WNC A;  1QQ1 A;  1TWC J;  2L4M A;  1G3Y A;  1TP4 A;  2YR2 A;  3KL9 A;  2E2I J;  1ZK8 A;  3HKZ N;  1QO0 D;  5KVR A;  1E43 A;  2VB6 A;  1N06 A;  1MKM A;  1D0Y A;  5FKM A;  2VNJ A;  4B4C A;  4G12 A;  4DBQ A;  4TSF A;  1PDN C;  1XGN A;  1TSP A;  4E7L A;  1XG2 A;  2VFQ A;  3PUF A;  1IXR C;  3FXM A;  3LST A;  1MMG A;  4C2M J;  1I1S A;  3H3V K;  4P25 A;  1TTT A;  2VYQ A;  4HV5 A;  3H3Z A;  3FXK A;  2PJP A;  3CD6 B;  3SEQ A;  1WPC A;  3EUH A;  3LQ6 A;  2M4G A;  3SJM A;  2BY1 A;  1ZRC A;  5D5W B;  4ZCI A;  4RD6 A;  1D8J A;  4G6I A;  5DCM B;  1T0F C;  2VL8 A;  3DLL F;  2Q2E A;  3F22 A;  1N0U A;  3AK5 A;  2M3A A;  4KYW A;  3GLX A;  3CQZ J;  2ZBV A;  1DUX C;  4KT5 C;  3QFT A;  4QVJ A;  1HW5 A;  1YIT B;  2CBX A;  3CO6 C;  2DLL A;  2BY2 A;  1M1E B;  4HDV A;  1K78 B;  1ELO A;  2WTE A;  3SUC A;  3ELK A;  2VOD A;  2Y31 A;  5TJJ A;  4PUS A;  2VBZ A;  5E8G A;  5FFX A;  2XPU A;  3MWM A;  2BGJ A;  2Q8K A;  4S04 A;  1P6R A;  3EYY A;  2V7T A;  4QPQ A;  3OZW A;  1A6Q A;  2XTW A;  1F1Z A;  1TWH J;  4R79 A;  2V1D A;  1VQ6 B;  2G7H A;  3OIP A;  1NK2 P;  1SFE A;  1MNE A;  1KTV A;  2BY3 A;  2E1N A;  2E5N A;  5J4V A;  3ABL H;  1F20 A;  3J81 Z;  3WNB A;  2WYR A;  4B43 A;  4E4H A;  2O1D A;  2WWY A;  4Z4R A;  1D0X A;  3LA7 A;  2HFH A;  2LY1 A;  3T5X A;  2GWR A;  3CCM B;  4LB5 A;  2VNK A;  2PMZ A;  3D5S C;  5E20 A;  5IYB J;  5M3M J;  4L0Z B;  3ABU A;  1F60 A;  4WZE A;  1E0E A;  4OZY A;  1KCD A;  1B59 A;  2PMZ N;  1U0J A;  2EH3 A;  4S0H B;  4RD3 A;  1WH5 A;  3DU5 A;  5IYC J;  2DJN A;  3ZMZ A;  3F8B A;  4N9I A;  3GVJ A;  4IRG A;  3R6S A;  2OUM A;  2VKD A;  2VZL A;  2WY7 Q;  3C2B A;  1EFT A;  1Z6T A;  4HSR A;  3CC2 B;  2RDP A;  2LBF A;  1R1U A;  4LG3 A;  4KIG A;  4BJT A;  5K5Q A;  5F64 A;  5DDG A;  4ASU A;  2DET A;  1XSX A;  2FBH A;  1R4M B;  5HLI A;  4XID A;  2XT4 A;  2VI6 A;  4U87 A;  3RZO J;  3K7A J;  1DP3 A;  2ZL5 A;  3C1D A;  3PSI A;  2DQR A;  2PIA A;  2CQK A;  2NRA C;  4AC0 A;  2DT5 A;  1R58 A;  1JGS A;  4EJT A;  3RIQ A;  2EA4 A;  3I1F A;  2MYS A;  3DP7 A;  3DTI A;  2F3L A;  3A4C A;  3FHZ A;  4ESF A;  1VQ8 B;  3WG7 H;  3E6C C;  2ADU A;  3F0C A;  1MD0 A;  3R61 A;  2MLG A;  2VKE A;  4ZDP A;  1JRG A;  1ZAO A;  3P7N A;  1FMV A;  4M6Y A;  2OK8 A;  1VND A;  3OE7 A;  5E1W A;  5FRN A;  1OFL A;  1SD7 A;  1T6X A;  1XFO A;  2V7U A;  5TR9 A;  1NTC A;  3RCO A;  1RET A;  5E3O A;  3PNT A;  2HR3 A;  2KRF A;  4LLG F;  3QFR A;  3U6K A;  1ZRD A;  4TMX A;  3AL0 B;  2DY1 A;  2HVR A;  4ASN A;  1K28 D;  4Q7J B;  4TMW A;  3OAA A;  3HOV J;  3HPG A;  3WU0 A;  4IHY A;  1XB2 A;  3CW2 A;  2B63 J;  4IRH A;  1P4A A;  1YQA A;  4EJO A;  1RKT A;  1R5B A;  1VF9 A;  3Q39 A;  1VQM B;  5AMV A;  2FJ1 A;  5LLQ A;  1G3T A;  5IYN A;  3O8H A;  4XLE A;  2VLA A;  3AST A;  2OTJ B;  2RV8 A;  3K4B A;  1NHA A;  2PLF A;  1H9G A;  3E3V A;  4A93 J;  1MMS A;  1GR1 A;  2M4K A;  3G1O A;  3K2Z A;  4RD4 A;  2E5Z A;  4XBF A;  3RIR A;  2JDI A;  5H5J A;  1I39 A;  4DW6 A;  1FRN A;  1V5E A;  4B3X A;  1FYL A;  4ZCM A;  2BVM A;  2DFI A;  2DOE A;  2IAI A;  1YRN B;  1DG1 G;  3SJZ A;  1IXC A;  3G4S I;  2XAG A;  3DPU A;  3HUG A;  1BR2 A;  4CA0 A;  3LSI A;  1WSU A;  1MNM C;  2OBP A;  1T56 A;  2A6T A;  2PFB A;  3QPH A;  5CVR A;  2F6C A;  4MTE A;  3SFI A;  2JIZ A;  3OEH A;  1Z9C A;  2FX3 A;  4HOB A;  3JQQ A;  4OPV A;  3B78 A;  3ASS A;  4PAA A;  1FWZ A;  5F4O A;  2YUS A;  4ENK A;  3H9N A;  2GM4 A;  1WOS A;  2F5D A;  2Y30 A;  4WZK A;  2IPQ X;  1O8F A;  4YZA A;  2KIF A;  1IDZ A;  2L7F P;  2ZKZ A;  3WY9 A;  4OIQ F;  3PFY A;  1K83 J;  4ANJ A;  1V5V A;  3PNY A;  4KN7 X;  3HAG A;  2JJ2 A;  4CQJ A;  2QCO A;  2ZXI A;  4MGR A;  1T6S A;  4NCN A;  3CMA B;  2QVO A;  4IPA A;  2Z3Y A;  2IXS A;  2VOP A;  3FXR A;  2R93 J;  1NHC A;  2XIG A;  1RC9 A;  2KIU A;  2QA4 I;  2L54 A;  4BAC A;  2CO5 A;  2M30 A;  5TIS C;  1XX5 A;  3W2A A;  2NT9 A;  2EIX A;  2Z8G A;  2MD5 A;  2QYU A;  5HLG A;  5BSY A;  2K40 A;  3ZN1 A;  5HVQ C;  2QTZ A;  5F04 A;  3IHU A;  4OIR F;  3GQ9 A;  2YPR A;  3H94 A;  2YS9 A;  3BR5 A;  1IJF A;  1K8F A;  1YJW B;  1MSE C;  4UV8 A;  3FK6 A;  5K5R A;  1YI2 I;  4LBW A;  4XOR A;  4BBS J;  2M87 A;  1WDT A;  2HVS A;  1EWY A;  3G71 B;  3CCU I;  3E0J B;  1DPR A;  3NWT A;  4UZE A;  3TED A;  3L2W A;  3S1M J;  2E7X A;  1I27 A;  1WOR A;  1FLI A;  4M9Z A;  3L00 A;  1B4A A;  3OOC A;  2XKO A;  3PSS A;  4EAT A;  1AOY A;  3FZV A;  1N08 A;  1KCC A;  1JKP C;  2EFQ A;  3K0L A;  1NG6 A;  3MFK A;  2B7C A;  3TQN A;  5CQG A;  3R6K A;  3IL2 A;  4YZX A;  3JRB A;  2WJY A;  2NXN B;  3G6E I;  3I54 A;  4B1R A;  4CYC B;  1J9I A;  1YO5 C;  2M5S A;  1BW5 A;  3ZZ0 A;  2R7Z J;  1ZH5 A;  1RUN A;  1DQU A;  2H09 A;  2PQ8 A;  2ZFW A;  4DNC A;  5IOZ A;  5DM7 F;  1VLY A;  2WB1 N;  3BG6 A;  2V31 A;  3SQV A;  4UNO A;  5DCM A;  2A07 F;  3TMO A;  4FQG A;  3GXO A;  1YX2 A;  4YIR X;  4P3Y A;  4LMY A;  2VBV A;  4P3I A;  4N0B A;  2ZXJ A;  4MLO A;  1IN8 A;  3ECO A;  1HKQ A;  3K10 A;  3PSZ A;  1YFH A;  2BMW A;  1IDK A;  1FZP B;  1K78 A;  1Y0U A;  3HOX J;  3CO7 C;  3TO9 A;  4HNU A;  4GGG A;  2D45 A;  1U9N A;  3CCL I;  2CND A;  2NVQ J;  2JVH A;  3E5X A;  2MA3 A;  2ZXW H;  3W2W A;  1F9N A;  1WHU A;  5C3E J;  3IH3 A;  4KIS A;  5HZA A;  2QZ8 A;  1GQ8 A;  2B7E A;  1J59 A;  5FO0 A;  3H0D A;  3AVV A;  4QLC U;  2LMD A;  2Q6I A;  3W2F A;  2M0M A;  5GV7 A;  2R92 J;  1O7L A;  4NUB A;  2ELJ A;  4FWT A;  4CHU A;  3JUR A;  3QOP A;  1B9N A;  2Y48 A;  2KDO A;  4Z4W A;  1QA3 A;  1E17 A;  2ZFU A;  5D6F A;  1E3O C;  3U2Q A;  4HQE A;  3HOU J;  4LBZ A;  2P7V B;  4L9T A;  2RC4 A;  4PDK A;  4CCM A;  4BNC A;  4RD2 A;  2A5Y B;  2AQF A;  3VWB A;  3KZI C;  5HLH A;  1K6Y A;  2IBD A;  4CZZ A;  2KIS A;  3AKZ A;  2UWM A;  3CD6 I;  3PM1 A;  2ZNZ A;  2E19 A;  1S9H A;  3OR2 C;  2X1D A;  4KKT A;  3VSL A;  3WTW C;  2QGG A;  1JA1 A;  3S16 J;  3MZH A;  1VQP B;  2XRN A;  1KMH A;  3TL4 X;  5M5Y J;  1QRY A;  1VQ9 B;  1YIO A;  5KAF C;  3UR3 C;  2PMU A;  3FK7 A;  4X8I A;  5LD2 C;  4HYE A;  5GPA A;  1QFY A;  3ZQC A;  1Y8Q B;  3HC7 A;  3OKX A;  2GK7 A;  4DYC A;  1RU4 A;  2IOU G;  1OQY A;  2ISY A;  2ZME B;  1LLW A;  3IRQ A;  3CF5 F;  1MBH A;  3WXM A;  1D1C A;  3M8J A;  4CO8 A;  3K4N A;  5HNF A;  5LMZ A;  4XKB A;  4JX4 A;  3BZ6 A;  4C3I J;  3SFZ A;  1SMT A;  4UY8 I;  2WZN A;  3X2Q H;  3FKJ A;  5HS7 A;  2QEX B;  1XG1 A;  2FU4 A;  2XZP A;  3QAH A;  1BX1 A;  2W7N A;  3DEW A;  3EUH C;  4MYT A;  3CJQ B;  2QLZ A;  2WAF A;  3CCM I;  1KK2 A;  5CVV A;  2OBT A;  2O8K A;  1A04 A;  1XB4 A;  2R7U A;  1B2R A;  4AVP A;  3CCJ I;  1IJE A;  2ME0 A;  1ENH A;  4RAG A;  3CF2 A;  2HDD A;  4DK1 A;  1LFB A;  4LK1 F;  3VPR A;  1YW9 A;  3O2P E;  2DT7 B;  2D3L A;  3GCM A;  2L7M P;  3CC2 I;  3D5L A;  3Q5F A;  2VBS A;  1K6O A;  1R5H A;  1IN5 A;  4KKS A;  1ZM3 A;  5ILU A;  3FKI J;  2LLK A;  3J7A Y;  1VQ4 B;  2LG4 A;  1STZ A;  5FKO A;  5J3L A;  3E1Y E;  2OF7 A;  2VJI A;  4M6V A;  1R00 A;  4P5O A;  4BJ6 C;  1X1B A;  1SEU A;  3OYC A;  2P8T A;  3C18 A;  5THX A;  3CDH A;  1TLL A;  1ETK A;  2VBE A;  1Q1H A;  2B9S A;  3WTS C;  3AFH A;  1WOP A;  1VQ8 I;  1BJK A;  3DTE A;  2R6H A;  2HGC A;  1REP C;  3FMS A;  4OMY A;  2E1C A;  1MBF A;  1T6Y A;  2DA6 A;  4ETS A;  2BE5 F;  3WQZ A;  1Z21 A;  4F55 A;  3EUA A;  4RAY A;  3GFL A;  3PIO F;  3KEY A;  1IRX A;  1L1I A;  3BT9 A;  3BCD A;  1R5O A;  2GIV A;  5GAH J;  1HZE A;  3RY8 A;  3N97 A;  2B0R A;  1G7C A;  3FX3 A;  2H6C A;  2ZNY A;  1N05 A;  3GEZ A;  3LO8 A;  1HSJ A;  4YAW A;  1XTA A;  4XON A;  5ILV A;  1VQO B;  4JMQ A;  2QSH X;  3W6K B;  3I53 A;  2WZP P;  3KP7 A;  4P26 A;  1T0F A;  2MH2 A;  2LOO A;  2R7V A;  2E71 A;  2OTJ I;  2PG4 A;  1ZGW A;  3OOP A;  2EA2 A;  3VNU A;  1O8M A;  4URR A;  2G0E A;  3FMR A;  3ZGK A;  3OYG A;  1JHF A;  4BL0 B;  3HTS B;  2DA5 A;  1LM1 A;  3UW0 A;  2V79 A;  4G6Q A;  2WY8 Q;  2CU7 A;  2DA7 A;  4AUX A;  2Z1D A;  5FJ8 J;  3LAJ A;  4FCY A;  2HOS A;  1QG0 A;  3OZV A;  3GFM A;  4KIT B;  5FO1 A;  2DMQ A;  2O17 A;  3B90 A;  2IVM A;  2DFF A;  2IGO A;  2J5P A;  1X4P A;  5TGT A;  1MAB A;  2LY9 A;  5D8L B;  4N4N B;  3VNV A;  4OPW A;  1Z6R A;  4G8X A;  3MD2 A;  2FSW A;  4P22 A;  2L3D A;  4WXD A;  3JR9 A;  3QSY A;  1Z3Y A;  1FBU A;  2D2W A;  3ML6 A;  2GIZ A;  1K4T A;  3CPW B;  1W7P A;  2AQE A;  2Y0S A;  4XRS G;  4PCQ A;  3AVU A;  4DZP A;  2F1M A;  1ON2 A;  2X6O A;  3DEE A;  3HXL A;  2PEC A;  5JMC B;  3KZZ A;  3BLY A;  3G73 A;  2JA6 J;  5FA6 A;  2LFB A;  4ZYD A;  3JTH A;  3VR6 A;  2QY1 A;  4BEH B;  5IYW A;  3FWE A;  3IKV A;  2A5W A;  2WV0 A;  2DK5 A;  4Y13 A;  1QUF A;  2E1R A;  2ZZQ A;  4HA8 A;  1QVU A;  1HBX G;  3PA1 A;  2X85 A;  1WJF A;  1WJA A;  3L9F A;  2EB7 A;  3U21 A;  4RDJ A;  4EM2 A;  2W24 A;  2V9P A;  3O3K A;  3ULQ B;  2LY2 A;  1BIA A;  3WTT C;  2ACJ A;  3TBI A;  1FYM A;  3DDY A;  4ZH4 F;  3G71 I;  2PE3 A;  5H59 A;  3D5R C;  1OR7 A;  3FM3 A;  2WR8 A;  4CIC A;  1QA2 A;  2KJC A;  2GJP A;  3SKB A;  3HHH A;  4FE4 A;  2ODL A;  2QX3 A;  1O8D A;  2M8G X;  4UUT A;  2XB0 X;  2QWW A;  3KP6 A;  2FNA A;  3V7S A;  4HF1 A;  2W6I A;  3RKW A;  5B3S H;  2ELH A;  3U2R A;  5GV8 A;  3J7Z I;  1QPM A;  2XDV A;  4RDU A;  3OL3 A;  1D1N A;  2K4J A;  4GYG A;  4X0C A;  2VAS A;  4PGG A;  4LLL A;  3K70 C;  1WZ2 A;  4J0Q A;  2XAJ A;  3AG2 H;  2BXZ A;  2ETH A;  2OCC H;  2K9M A;  2E60 A;  4II3 A;  2YU3 A;  3W2I A;  2UVF A;  1JJ8 C;  5D5X B;  2X53 S;  4D9J A;  2ELK A;  4MEX F;  4BQN A;  1Z3X A;  5HNH A;  1QBJ A;  1G7S A;  4ESB A;  3JAM K;  2DTR A;  2K7L A;  2PI0 A;  1OFE A;  2P0W A;  4EQQ A;  4LIU A;  3COA C;  2NTQ A;  4HX8 A;  4CCJ A;  3JRI A;  2IA1 A;  2ZME A;  1UB9 A;  1HKS A;  5CLS A;  2GA2 A;  5A2Q K;  3S32 A;  2HMA A;  1ZEL A;  2DOA A;  3W6V A;  4XOT A;  2DK8 A;  2OC6 A;  2WJV A;  3ZOB A;  4MYU A;  3QOE A;  2H1K A;  1OMI A;  3M07 A;  3MEX A;  4P1W A;  4IOA F;  1OGM X;  1PUF B;  4NC8 A;  3K70 D;  3MKW B;  4Y15 A;  2DCU A;  1JTA A;  3S1N J;  1X1A A;  2YWE A;  1IAW A;  2DMU A;  4OIO F;  4BUP A;  3VEP A;  2XVC A;  4L5J A;  3OZU A;  1O7F A;  4RM0 A;  3G3Z A;  4HX4 A;  1TW3 A;  3EYI A;  5EF6 A;  2J8K A;  3GTG J;  2OQG A;  5CDF A;  2RVC A;  4XD7 A;  2DCE A;  4P55 A;  1EKE A;  4M2L A;  3I0T A;  4UVB A;  1DDI A;  2WC2 A;  5B5E C;  1ZN2 A;  2CK3 A;  3FKS A;  1R36 A;  2AXL A;  4Z4T A;  2EFG A;  3AVT A;  2XPW A;  4RBO A;  3S2H J;  1QZE A;  4JOM A;  3CP2 A;  1TVC A;  2IP2 A;  3CZ6 A;  3ZPN A;  5FNZ A;  2JTV A;  4A3C J;  4RGX A;  3J7A O;  1ZM4 A;  1PXZ A;  3BJ6 A;  3ZQL A;  2LYC A;  5IT9 Z;  4IHX A;  4KKU A;  4TT3 A;  1X0C A;  4IF4 A;  3OYE A;  4YFO A;  1IA5 A;  1VQ9 I;  5B66 C;  3L2C A;  5KK1 A;  2EPF A;  1YLO A;  1YS6 A;  3BR6 A;  3MZ8 A;  1T8I A;  4GFB A;  2V7V A;  3W5V A;  3LA2 A;  4W8Q A;  3G4S B;  3PFI A;  4NBS A;  2F4N A;  2CV0 A;  2C5B A;  4AYB A;  1ODD A;  4D0P A;  2P5L C;  1JA0 A;  3R0A A;  4WWV A;  5LEJ A;  4MXN A;  3H92 A;  4AYB N;  2ZL7 A;  1DBO A;  1T95 A;  2HVQ A;  5J35 A;  2C78 A;  1Y39 A;  1CGP A;  3BY6 A;  5F08 A;  1UAA A;  1IRZ A;  3ZIA A;  1WQ2 A;  4PC6 A;  4F92 B;  4RM2 A;  1R4N B;  1GHC A;  2X6Y A;  2IS1 A;  3WU2 C;  2QEX I;  2PLY A;  4N3G A;  3WTU C;  5IYR A;  1FC3 A;  2Y9Y A;  2JRT A;  2E2J J;  1O8J A;  4NDL A;  3HRM A;  3GO5 A;  3F3X A;  2FX0 A;  2M45 A;  3CC4 I;  2DMT A;  4YZ0 A;  2M34 A;  2R7D A;  2V7W A;  2LF7 A;  3OYF A;  1IC8 A;  4E7K A;  1IDY A;  2WV1 A;  4BXX J;  3V8J A;  2GOX B;  5L3G A;  3BQZ A;  3ERE D;  1KK3 A;  3QU6 A;  1ZHF A;  1B23 P;  2UVE A;  3I4M J;  4RB3 C;  1CNF A;  2G0Y A;  4CCK A;  1XSV A;  2KT0 A;  3KYL A;  1ZQ3 P;  2DA3 A;  4IHS A;  2RGV A;  2GXG A;  3CMY A;  1YI2 B;  3L7W A;  1S7E A;  3RZD J;  3GBG A;  2YX7 A;  4NBQ A;  1VQ4 I;  4G6D A;  1OGJ A;  3W5U A;  1FBQ A;  3LFU A;  3TW7 A;  1LLZ A;  2X51 A;  4IX7 A;  1G3S A;  3M1C A;  1OCR H;  5HDN A;  4HF2 A;  1J2X A;  2MG4 A;  4MNU A;  1R9T J;  2K85 A;  3MKY B;  2LKP A;  2C6Y A;  2V1U A;  1WCM J;  5F27 A;  1JT0 A;  2OZU A;  3M4O J;  3I58 A;  2H6B A;  2XNJ A;  3AL0 C;  4PC3 A;  1M90 D;  3J81 K;  4BE1 A;  4ITV A;  2QSG X;  3OYJ A;  4OZZ A;  1W5C C;  3BH7 B;  3VYS B;  3CUQ B;  3S1Q J;  2FBI A;  1E1Q A;  5B6I A;  2M7A A;  2DA1 A;  4V2G A;  3OYK A;  1JB9 A;  4Z4Z A;  2ZIT A;  2O0W A;  1SAX A;  1RUO A;  2HI3 A;  1HST A;  3QYF A;  3T0Y A;  2VQG A;  3ZRG A;  1GV5 A;  2XEX A;  4BEH A;  3BG3 A;  3ABT A;  4Y33 A;  5FKK A;  1V0F A;  4Z2Y A;  1MIJ A;  2NVX J;  4QVA A;  2O6W A;  3ONU A;  3DKW A;  4HDU A;  1O88 A;  1VQO I;  1R23 A;  3JRE A;  3A1Y A;  3GX4 X;  3PO3 J;  5IYQ A;  3CLQ A;  4AID A;  1TT5 B;  4BY1 J;  4RD1 A;  1Z7L A;  4RPB A;  4TKO B;  4AWX B;  5DV5 A;  4BHB A;  5BQT A;  1SC7 A;  1G3W A;  3K1N A;  3OL4 A;  2CW8 A;  4L9V A;  3PUB A;  2PMD A;  3K4L A;  5JLV C;  4X07 A;  4XQF A;  3L09 A;  3I56 I;  2Q6O A;  2ISZ A;  3CES A;  1EZG A;  2M0C A;  3FF5 A;  4M1K A;  3NAR A;  1ZR4 A;  2XF7 A;  3PQJ A;  4PGH A;  5D5V B;  2Z99 A;  3H9G A;  3KIO A;  2QKL B;  1DDN A;  1BC8 C;  1G7R A;  3H1C A;  1N75 A;  2B7B A;  3LQQ A;  1YLF A;  1H80 A;  2BW3 A;  4H9G A;  1F43 A;  3CDI A;  2NAZ A;  1XMA A;  3HRT A;  4Z05 A;  4UB8 C;  3AGP A;  4V02 C;  1W0U A;  4A0Z A;  3LNN A;  5JLX A;  1UCR A;  1P9Q C;  1S0U A;  1KK0 A;  1EH6 A;  3HSE A;  1EH8 A;  3HB9 A;  1Y6I A;  4ZYA A;  4A0X A;  5HOO A;  1SKQ A;  2PYH A;  2QN6 A;  1AA7 A;  2CGP A;  2NVY J;  1UMQ A;  2VJ5 A;  1ETO A;  3H35 A;  4JX6 A;  4QSH A;  1HC8 A;  1MMD A;  3JRF A;  1E3P A;  2M8E A;  2O3F A;  3G2B A;  1EE6 A;  3RKQ A;  4UVA A;  4R1H A;  3TO7 A;  1X3Z B;  2D74 A;  3HRU A;  1QVF B;  1KQ8 A;  3LFK A;  3H5N A;  2E2H J;  1MRZ A;  3B8Y A;  3WGH A;  3F72 A;  4Z06 A;  1K4S A;  3CCY A;  2GQF A;  1IDJ A;  3LJY A;  1IUY A;  1FP1 D;  3E5U A;  1W5S A;  2KDZ A;  1XCB A;  4RB1 A;  1KU7 A;  1TLH B;  3P5J A;  1DU0 A;  2IA0 A;  1PUF A;  4UXN A;  3ASQ A;  1TYU A;  3U6B A;  1G7T A;  1KYZ A;  2HKO A;  1PVE A;  3U1D A;  4RB2 C;  4W8R A;  3VYR B;  1W9X A;  2DYI A;  1CQT A;  2KHM A;  1N8R D;  4CUG A;  3WE3 A;  1D5V A;  3LYC A;  2CYY A;  2JA5 J;  2BHY A;  3AGQ A;  3QP5 A;  3VSK A;  1JXS A;  2FML A;  1JUS A;  2JSC A;  3DPL C;  5IT3 A;  1DPU A;  2L9V A;  2V1N A;  1ETQ A;  3MKL A;  3PQK A;  4WF2 A;  1VTN C;  3H9J A;  3HJE A;  5EG0 B;  3BTL A;  1V54 H;  3M7G A;  4Z4Y A;  3CCJ B;  4M6X A;  5E18 F;  5JVT A;  4NC6 A;  1GVJ A;  2QMU A;  1U6G A;  2M2E A;  3KLO A;  3OJX A;  3CME B;  1EA3 A;  3CDL A;  2JA2 A;  5GTH C;  2OQR A;  2EV6 A;  2XSJ C;  3A0H C;  3C7J A;  4BQQ A;  5TV2 A;  2FBK A;  4C3J J;  5TY0 A;  5GPC A;  2EIK H;  3ABM H;  5LGN A;  2QQ9 A;  2DN0 A;  3ZBT A;  2VBU A;  1MW7 A;  2R5Z A;  2OBS A;  2C4U A;  3K2A A;  5DSZ A;  3ERM A;  4ZCL A;  2VT3 A;  1W7P D;  2DER A;  4W8S A;  2KRC A;  1OR7 C;  2BM0 A;  3B73 A;  2E1O A;  4HNV A;  1YOV B;  5CPR B;  1V0E A;  2JQ7 A;  1Q7Y D;  2V1X A;  1W0K A;  5E8I A;  2VFO A;  2FE3 A;  3M9A A;  3HRS A;  4D7M A;  4IKF A;  4BQO A;  3LVB A;  3REO A;  2GXA A;  5DEQ A;  1P92 A;  3DBL B;  3KP2 A;  2F4M B;  2NOJ B;  2Q0O A;  3W2V A;  3GTO J;  1H8H A;  2V26 A;  3K1M A;  5DUI A;  4OIP F;  2BM1 A;  1WWX A;  1W34 A;  3DBR B;  4KMU X;  4IEJ A;  1MH4 A;  5LGU A;  1FEX A;  4OOX A;  3SY2 A;  2L4A A;  2ZZG A;  1T33 A;  4OMZ A;  2UZK A;  4OPO A;  2FQ3 A;  3BR0 A;  4HEA 2;  3BQY A;  2Q6K A;  1MGT A;  1PYV A;  3E20 A;  2R7X A;  3VO1 A;  1O8K A;  1SFX A;  2P81 A;  2W7Z A;  2O8X A;  2DQL A;  4XNF A;  3VB2 A;  4DIQ A;  2HQN A;  2QTL A;  1QJV A;  2ZJP F;  2M5W A;  4CCL A;  1LKX A;  2F5E A;  3OYB A;  2RN7 A;  2QF7 A;  4Q47 A;  2XV4 S;  1YIJ I;  1BL0 A;  2ZME C;  4P9U A;  2RC6 A;  2XB5 A;  1NBM A;  2OYN A;  4F52 A;  5B1B H;  1ERD A;  1O57 A;  2IA2 A;  2L2O A;  5ICC A;  3WOD F;  1UHS A;  4JRA C;  4P2N A;  2XSD C;  1QNT A;  1H88 C;  1BIB A;  3DU1 X;  4GCV A;  2KRH A;  4V2F A;  2ZB9 A;  1TTY A;  3LSG A;  2HOA A;  4TV7 A;  5E1X A;  1D3Y A;  2Y2Z A;  4OOS A;  3KRG A;  3MMP A;  3JRD A;  3BTC A;  3J7Y J;  3QFC A;  2VN2 A;  4AF7 A;  1HKT A;  2MFZ A;  3LQR A;  4X7C A;  4A3E J;  3W2G A;  2QQ8 A;  2OD5 A;  4U88 A;  2MAB A;  2F4I A;  1H89 C;  3BC9 A;  1L3L A;  4KA4 A;  4PFO A;  1Q81 D;  3M3Y J;  1BJZ A;  3K4J A;  3OMY A;  1Q1V A;  3G1M A;  1T39 A;  1SFU A;  2BGC A;  3K69 A;  4FTH A;  2DOF A;  1V3F A;  3LL7 A;  2EWN A;  2O7O A;  3KEW A;  2VQH A;  3VMW A;  3KP5 A;  1A35 A;  2EZI A;  3PO2 J;  2V7X A;  2MLK A;  3SZT A;  4EEF G;  4XSX F;  4DQL A;  2BHZ A;  1PJ6 A;  1TWG J;  5FFZ A;  5C4J J;  5EEA A;  1H42 A;  1NB0 A;  1QRB A;  1JKR C;  1CLW A;  4FT8 A;  1K9M D;  3SZP A;  4AC9 A;  2F1L A;  2E34 A;  4BHP A;  2W4S A;  2VON A;  3DV8 A;  1OFC X;  4P12 A;  2L7K A;  3IUO A;  3KP4 A;  4OAY A;  4QHY A;  3EQN A;  5LRS A;  4W1U A;  1ACI A;  4HBL A;  1QGY A;  4YXW A;  2DPU A;  1DBG A;  2ZC2 A;  2H8W A;  1TL8 A;  3JRC A;  3R60 A;  1Z7U A;  1PJ7 A;  2HWV A;  3S3N A;  1ZM9 A;  3VSU A;  1SVL A;  3T8T A;  1XSD A;  1IHM A;  1OCP A;  3BCF A;  2IEK A;  2OPT A;  3TO6 A;  3QPL A;  2Q1Z B;  2Z33 A;  2NV4 A;  2XGX A;  5F1R A;  1XGM A;  2CQX A;  2W1O A;  3DFG A;  1BX0 A;  2P5V A;  2P6S A;  3ZC3 A;  1BMF A;  3FBI B;  2WSS A;  4A5M A;  2CUJ A;  3DLA A;  4F7D A;  1MJ9 A;  2HTS A;  2JN9 A;  3VSV A;  3WE2 A;  3VMV A;  4P9F A;  4XRS A;  1PJR A;  3HGG A;  2LNB A;  3N6Z A;  1FNB A;  2FA5 A;  3V7A A;  4ENN A;  3CRZ A;  1KJZ A;  3PUM A;  1YJ9 B;  5FD5 A;  1OCC H;  2UXN A;  1GUU A;  1WJD A;  3CTA A;  4WXH A;  3H3U A;  4ABZ A;  5B1A H;  2R7Q A;  1Y0N A;  1OCT C;  2JJ1 A;  4G7W A;  3Q0U A;  1XDS A;  1H8A C;  2G7U A;  1DGW Y;  3HOY J;  4EVI A;  1TQP A;  4I02 A;  1LNW A;  3DEU A;  4NNJ A;  5D4S A;  3IWF A;  4CCO A;  4YZQ A;  2R7T A;  5DYM A;  1GXQ A;  2I5U A;  3KLN A;  1YX5 A;  2DXI A;  4XRF A;  2E1M B;  2GAU A;  3Q3S A;  2NNN A;  4IVN A;  1RR8 C;  2DAO A;  2X0K A;  3N90 A;  1X2N A;  4G94 A;  4ZYE A;  4KMF A;  4I0B A;  2MC3 A;  2LRE A;  3H36 A;  4BH9 A;  1FJL A;  2ICW G;  5DCF A;  3RQ4 A;  2A6E F;  1JKQ C;  1COW A;  3A8I A;  4BXU A;  2MSY A;  3VOD A;  1UMK A;  1FIA A;  2BSA A;  2B5O A;  5J3O A;  1GJR A;  3ZQF A;  4YAL A;  1O8H A;  4BQA A;  1ZRF A;  4YHB A;  3F6O A;  1SMY F;  1SD5 A;  2MBF A;  1C0W A;  2R7R A;  1APL C;  5DNS A;  2XAQ A;  4FET A;  5AIQ A;  2BM6 A;  2INU A;  1WI3 A;  2L01 A;  3WTV C;  1GXP A;  2GK6 A;  1NH3 A;  2BXY A;  1IG7 A;  3GZ6 A;  2VPL A;  2HDW A;  3PEN A;  2E35 A;  3K4C A;  4RLQ A;  1IJW C;  2FNP A;  5HDK A;  3DF8 A;  3BP8 A;  1F5T A;  1ZR2 A;  1R5N A;  1NDH A;  1LEB A;  2DTZ A;  1W35 A;  3RPU A;  4K2E A;  1D0Z A;  1AHD P;  1J9Z A;  1V4R A;  3E6M A;  3A0B C;  4MR0 A;  3M8F A;  4LIV A;  3NB2 A;  3F8F A;  3BY1 A;  4FHT A;  4I09 A;  3ASP A;  3WTY C;  1KD1 D;  3CCE I;  1TUI A;  1HA3 A;  4YFX F;  4B47 A;  5IYP A;  4MHG A;  3LMW A;  2VC0 A;  2A69 F;  2VNI A;  3OP1 A;  1O8I A;  3EPZ A;  2VUM J;  3BR3 A;  1QHH D;  5ERI A;  1SD4 A;  2O0Y A;  2ZCW A;  4A0Y A;  1KRH A;  3F8C A;  3I71 A;  3GFJ A;  3K4K A;  5CVJ A;  3AAF A;  4CH7 A;  3BTJ A;  1B72 B;  1FX0 A;  3OV8 A;  2Y9Z A;  4OM9 A;  3OYI A;  1GO2 A;  1MBJ A;  4M9X A;  4DQK A;  3SZE A;  5K1Y A;  2R7F A;  2JSP A;  2PMH A;  5F0C A;  2R5Y B;  3OSG A;  4X1E A;  3FDY A;  3IC7 A;  4R71 A;  3ZPP A;  4L9N A;  2DO7 A;  2K86 A;  3CC4 B;  3BG5 A;  5ICE A;  2AXT C;  3CJR B;  4WWC A;  4Z1M A;  4C2L A;  2JPC A;  5BS6 A;  4J01 A;  4GDF A;  1U2R A;  2EIJ H;  2YWG A;  1Z0X A;  1RPW A;  1JJ2 B;  2VQC A;  1KYW A;  5CKT A;  1Q9S A;  2DA4 A;  1MMN A;  2KZV A;  3ZZU A;  2XC1 A;  3IAS 2;  5ED4 A;  3CME I;  3MKZ A;  2Z9O A;  3ZBU A;  1I18 A;  4G1V A;  3R0J A;  1YRN A;  1UG0 A;  2ZL6 A;  2V7Q A;  1I1G A;  3RJP A;  1ZYR F;  2Z16 A;  4KH3 A;  2BYV E;  1IN7 A;  1HDD C;  3OPO A;  1VQL I;  3WTX C;  1I6H J;  2NT6 A;  3BDD A;  1HG8 A;  1DAR A;  1QA6 A;  1GAW A;  5HS9 A;  1FTZ A;  4PJ0 C;  4XM3 A;  1ZG1 A;  2KZG A;  2QQB A;  2NS0 A;  3AG4 H;  4YAO A;  2VPR A;  1KA8 A;  5EDN A;  5JVG F;  3UNG C;  2GQQ A;  5DUK A;  5DS9 A;  4X05 A;  1LFU P;  1WP6 A;  5LHG A;  1FSH A;  1S8N A;  5FO5 A;  1EF4 A;  2O0V A;  1FOX A;  1VQ5 I;  4RJL A;  3GTQ J;  2DMP A;  2JA8 J;  1POG A;  1P2F A;  4D5F A;  4L0Y B;  4J19 A;  2QDX A;  1MSF C;  1A31 A;  2FUG 2;  4PGO A;  1IRG A;  4HZF A;  3GQA A;  2VKV A;  2IS2 A;  2KVO A;  1BN8 A;  2FQ4 A;  3HDD A;  1CNE A;  1T6Z A;  3DKX A;  1WJB A;  3WG9 A;  2DI3 A;  5J1R A;  4FX4 A;  1BPL A;  4RLF A;  1H8E A;  1CF7 B;  1DP7 P;  4A3F J;  1MBK A;  2JT1 A;  2O04 A;  4EJV A;  4WX9 A;  5F6F A;  2LKS A;  4B3F X;  2AHQ A;  4O6J A;  3PSF A;  3H5R A;  2C77 A;  4TMZ A;  2P6T A;  3SEZ A;  3JRA A;  1E3Z A;  4F7Z A;  2ZZE A;  4E7Z A;  1DU6 A;  3BY2 A;  1ZM2 A;  5DN6 A;  1O3Q A;  5L3C A;  2HNH A;  5J8F A;  3OYM A;  4YAU A;  3S3M A;  1NG7 A;  1NK3 P;  1KK1 A;  4U4B A;  3I56 B;  3VYT B;  2X6W A;  1HW2 A;  1BN5 A;  3VFZ A;  1W36 C;  4AIH A;  1ZKG A;  4CYC A;  3H5A A;  3C2H A;  5E3N A;  3TOA A;  5K7H A;  3OW2 B;  2X3H A;  4YDT A;  3R4K A;  5A88 A;  3CCV I;  1OKR A;  3D0S A;  4WXC A;  2OAZ A;  1T98 A;  4V19 K;  3KEQ A;  3RI4 A;  1BR1 A;  3I9V 2;  5AN9 A;  2EFW A;  2EWE A;  2H27 A;  3P9I A;  1HOM A;  3OIQ A;  3LWF A;  3WHB A;  4A3M J;  4I76 A;  4RGU A;  5BNG A;  1D1B A;  2M1B A;  2Y0S N;  3LAP A;  1D2E A;  1JHH A;  4RGS A;  2H1L A;  1JUM A;  3SHF A;  1MJB A;  4PMH A;  4QIW N;  4PAB A;  1GLN A;  3GTK J;  2DFH A;  2XKP A;  1OIS A;  2RKH A;  2A05 A;  2CRG A;  1JI8 A;  1R6R A;  3OJW A;  3EQO A;  2NS7 A;  5IT9 K;  1LDK B;  5C1C A;  3HBL A;  4UZU A;  3B02 A;  2XNC A;  1QVG B;  1XMX A;  2CUE A;  1AU7 A;  2HEO A;  4X7E A;  1YYV A;  4M71 A;  4FK8 A;  5J6X A;  3D26 A;  4A69 C;  2M7B A;  4HLY A;  1I5Z A;  4UV9 A;  3GME A;  5HLT A;  5M5X J;  3GFI A;  2W48 A;  2GLO A;  2EIM H;  3K6G A;  2P3M A;  1JJ6 C;  4P6Y A;  2DA2 A;  4MFD A;  3CUQ C;  2HXI A;  3GQ7 A;  3F8M A;  3OY9 A;  2I10 A;  2FRH A;  2K4B A;  3CMM A;  4ON0 A;  1TYX A;  3LMM A;  1WJE A;  4EGY A;  3P26 A;  4M3E A;  3CUO A;  4B3A A;  1QH0 A;  3GF2 A;  4ACB A;  3VOE A;  1S4M A;  4X7D A;  1YW7 A;  3GQB A;  2K27 A;  4PJN A;  4BS9 A;  2EFO A;  4KFC A;  4QFM A;  4HW0 A;  1VHE A;  1Z05 A;  2PJR B;  3RYR A;  2OJE D;  3WU1 B;  1XMK A;  2PYG A;  1K61 A;  2GPJ A;  3OS1 A;  1BA5 A;  1BM9 A;  2V4J C;  2WAE A;  3ZP5 A;  2XC7 A;  2VE8 A;  4ENM A;  1P4M A;  4FX0 A;  3W2E A;  1KC8 D;  3Q9V A;  4AM3 A;  2JMW A;  1UD8 A;  3FXU A;  4M74 A;  1YJ9 I;  5LRR A;  3LSJ A;  2F43 A;  5FGM A;  5L3F A;  4YEL A;  1EJ9 A;  1VQ7 I;  2XHK A;  4RA2 A;  4DNR B;  4KIF A;  2EIN H;  3HOZ J;  1YW8 A;  4Y9U A;  2B0L A;  4RGR A;  5CVU A;  4FXU A;  1PE9 A;  2YWF A;  1QCX A;  4M3D A;  1UHM A;  2TCT A;  1B72 A;  2R7O A;  2UXX A;  3KYC B;  1ON1 A;  3QRF F;  5DTD A;  4Z4S A;  2XZL A;  3PIP F;  2EV0 A;  2CMP A;  2KIM A;  4I01 A;  4LD5 A;  3OS2 A;  1IB0 A;  1LVA A;  1QA1 A;  1IXS B;  2QYO A;  4ROX A;  3I59 B;  1YJN B;  1OFM A;  3ZMU A;  4FE7 A;  2KP6 A;  2D1V A;  2R5Y A;  4YIF A;  1HXD A;  4LK0 F;  4R8H A;  3E5Q A;  4I2O A;  1GV2 A;  4LFU A;  2IJL A;  4O3M A;  2Q2E B;  2E7W A;  1BI3 A;  1QUE A;  2QXZ A;  4F93 B;  3IAM 2;  1B1B A;  1U8R A;  1BW6 A;  3ZQI A;  3TW6 A;  1QFZ A;  3Q38 A;  4QV2 A;  2V9V A;  1ZRE A;  3GVK A;  1X19 A;  3TP3 A;  4HPQ A;  3OYN A;  1N77 A;  1TWF J;  1AIR A;  4QPO A;  4RDK A;  1WU8 A;  3KCC A;  1KQ9 A;  2GA1 A;  1DAB A;  5ILS A;  2VFM A;  1W5T A;  2VKH A;  2XPV A;  1EFR A;  3PVD A;  4OP7 A;  1YIJ B;  4J00 A;  3CC7 I;  1ORK A;  3KEO A;  3GZ5 A;  1FP2 A;  2QM3 A;  4GXO A;  4XN3 A;  3OEE A;  1JNY A;  1RQP A;  4MO7 A;  3VST A;  3OOU A;  1KQS B;  4M3F A;  4N3N A;  1UFM A;  4YC5 A;  2XGC A;  3V4G A;  4PSX A;  5HDG A;  4HWV A;  1YHQ I;  4ZYH A;  2FVG A;  4NB5 A;  5DD8 A;  1V55 H;  2ZJQ F;  2HYJ A;  4UUV A;  2NVU B;  5FIU A;  1EFU A;  2HLD A;  2NSP A;  1FNN A;  3IKT A;  2VC1 A;  1IUF A;  4JP0 A;  3TDZ C;  4H0E A;  4P6V F;  3W2H A;  2P5K A;  3GRH A;  1E2X A;  4QTR A;  2A3S A;  5F0F A;  2WPD A;  1RKW A;  4IHT A;  1Z1D A;  2C5H A;  3WTZ A;  2LF8 A;  4E70 A;  2VNH A;  4JYK A;  1T2K A;  4ZGN B;  4AU7 A;  4HX7 A;  2X6X A;  4FN5 A;  1USS A;  1FYK A;  3GTM J;  1IN6 A;  4HF0 A;  3B8H A;  2JA7 J;  3JU4 A;  2LBF B;  3HSR A;  5HXB A;  2F48 A;  3JRH A;  3PL8 A;  3EET A;  2XGE A;  1CF7 A;  1UHW A;  3KFW X;  2CQ7 A;  5H6Q A;  1O8E A;  3P27 A;  2EFN A;  3CB4 A;  4XSZ F;  2KJB A;  1OCO H;  1EXM A;  3I3L A;  3L2R A;  1XGO A;  2JVG A;  5IK2 A;  2DW4 A;  4XLA A;  1ZG5 A;  1S6L A;  2LR8 A;  5DD4 A;  3GYH X;  1VI0 A;  1I8D A;  3I4P A;  2QBY B;  2XTY A;  4WQM A;  4MIM A;  2QGU A;  1QVT A;  4D5C A;  1QHG A;  3FIS A;  1ZLK A;  3ZMS A;  4H4K C;  1ZTR A;  2NST A;  1SAU A;  1J5Y A;  3KET A;  5IOY A;  1OYW A;  1ZLJ A;  1P7I A;  1O3R A;  2MD0 A;  1AKH B;  2XF6 A;  1FT9 A;  1Y8R B;  5DM6 F;  1FND A;  1H0M A;  4NQW B;  4IQ4 A;  2F5F A;  4BDZ A;  4ZZD A;  1N0V C;  4UHT A;  5D8K B;  5JR3 A;  3ZQG A;  1KTW A;  4RD0 A;  4JX5 A;  2NTB A;  1F36 A;  3W6J B;  4WK8 F;  1O3S A;  5A8A A;  3BPV A;  3S93 A;  3WND A;  4DK0 A;  1OJL A;  2DBB A;  4MQ9 F;  2VT2 A;  2ECB A;  4I7H A;  1QZZ A;  4BDY A;  1JGG A;  3N4M A;  1XQB A;  2CW5 A;  1XGS A;  4DGW B;  2X3U A;  4BJ5 C;  2I8D A;  1VJS A;  5GAE J;  2BOL A;  4ESJ A;  3ROU A;  2LDU A;  2VE9 A;  1AIP A;  1EP1 B;  5C44 J;  1O8L A;  2XTX A;  3ZN0 A;  2V6C A;  3S8P A;  1X1D A;  2DOD A;  4A5N A;  4BU2 A;  2BVL A;  4I98 B;  1TYW A;  3QP6 A;  2YU9 J;  1T08 B;  2EFP A;  2FD5 A;  5CYV A;  4CGZ A;  2ID6 A;  3S3O A;  1JUP A;  2FOW A;  2LP0 A;  1SFK A;  3DXJ F;  3MHP A;  3CCQ B;  1A8P A;  1OB2 A;  1OB0 A;  2ZZF A;  1D1A A;  4GRI A;  1WGX A;  5IP9 J;  1BOA A;  2ZTN A;  3I5U A;  2BGI A;  3NQO A;  3T9G A;  1IB4 A;  1N25 A;  2J5O A;  1AWC A;  4IOC F;  4Y9R A;  4WZL A;  4HV6 A;  4DQ2 A;  2KFD A;  2EJR A;  4BAY A;  2C2W A;  3AG3 H;  4E6K G;  2PJR A;  3CJT B;  3HOS A;  3S15 J;  1FOW A;  2ZO4 A;  1NB9 A;  5FB2 A;  5LGT A;  3SLD A;  4RS8 A;  1BI2 A;  4AF6 A;  2QQA A;  1OGO X;  1BJA A;  3HKZ A;  2GBY A;  2RAE A;  3UKG A;  3JSO A;  1RNL A;  2VXD A;  3F21 A;  2IGM A;  4D7N A;  1ULY A;  1QFJ A;  4TMV A;  3HG9 A;  3PUN A;  2D9R A;  5IYD J;  4E0F A;  3SQN A;  3TH0 A;  2JUG A;  3GVA A;  1G8X A;  1VQN I;  1O4X A;  3LSP A;  4Q5S F;  3BNW A;  3QYE A;  4KJZ A;  4KIB A;  3QYB A;  4E7S A;  4ZDO A;  3J80 Z;  2D1H A;  5FRM A;  1BQE A;  4RPD A;  1OPC A;  3CCE B;  5M3F J;  2LC2 A;  3H0G J;  2KPM A;  1XS9 A;  1S7O A;  1JE8 A;  5IP6 A;  1A6I A;  4M0L A;  4PC1 A;  3I59 A;  4LOC A;  4PK4 A;  3NAU A;  1RQR A;  5TRD A;  1H9T A;  4AIK A;  3ML3 A;  2RNJ A;  1W2B B;  1R1T A;  3WBJ A;  2EZL A;  5KHD A;  1M1K D;  4C3H J;  1EH7 A;  4OJ5 A;  1U3E M;  3GIR A;  2VIX A;  2KQR A;  2NZM A;  3L2V A;  2LSO A;  1FNM A;  2IW5 A;  3QFS A;  2L0K A;  1U5T B;  4GO1 A;  2MGQ A;  3HPH A;  4JBA A;  2XGJ A;  1DGR M;  3RPQ A;  5CVI A;  3E1S A;  2YX4 A;  4G1B A;  1I3A A;  5LHI A;  2Y69 H;  4C2T A;  2FXA A;  2F2E A;  3BJO A;  3BRO A;  3GTP J;  2NS8 A;  2IS4 A;  2W84 A;  3GQ8 A;  4YRV A;  4EW9 A;  4X7F A;  1S5L C;  2DFE A;  4OJP A;  2VQL A;  2E1M C;  3IP4 B;  4KT6 A;  3WGI A;  4BE2 A;  1G4D A;  2BV3 A;  2FEZ A;  4Z03 A;  1KZH A;  3HOT A;  1A36 A;  1PKV A;  2K02 A;  2XND A;  2LD5 A;  4BXF A;  5KSW B;  4HE6 A;  4RAZ A;  2NTP A;  2Y0M A;  2FOK A;  4XN0 A;  1PLU A;  4G9Y A;  2QUF A;  4C0S A;  1WKM A;  1HVX A;  4G7X A;  4G7O F;  1NJI D;  1QZY A;  1TQI A;  1UEL B;  3A03 A;  3F9K A;  2ME6 A;  2K9N A;  4E7I A;  4TMT A;  3BZC A;  5EMN A;  1VQL B;  2CS3 A;  1K4Z A;  2ZSH B;  3NEU A;  5BMZ A;  5H6R A;  1BI0 A;  2K3P A;  1BBY A;  4B09 A;  4D1Q A;  2F5C A;  1WXR A;  4IRI A;  1T38 A;  4PJL A;  3U9G A;  1YJN I;  3MVP A;  2ID3 A;  3ZZT A;  1B6A A;  1GVH A;  1BLI A;  2PN6 A;  2I1L A;  1D8K A;  3RKY A;  2INV A;  2VOO A;  3OIO A;  4YFK F;  2CH0 A;  1VQ5 B;  2QZA A;  2VBM A;  2E1B A;  3ZMT A;  5AIP A;  5ICG A;  1W0T A;  3NE5 B;  1FY7 A;  4DYR A;  5HOD A;  1QU3 A;  2TDX A;  4U9U A;  2LTP A;  5M5W J;  4G7Z F;  2R9V A;  3TOB A;  1WVR A;  3ESW B;  5EZG A;  5HZB A;  4JK1 X;  2XRO A;  2QE7 A;  1W87 A;  4HLX A;  1LB2 A;  4KIC A;  1G59 A;  5E79 C;  3A01 B;  3E97 A;  3H09 A;  2F5V A;  1ETV A;  1R7J A;  3HTU A;  5K7Z A;  2DYR H;  5J4Y A;  4NHJ A;  2CW0 F;  4DBR A;  2W6J A;  2QBY A;  2BPO A;  4B8X A;  3GZN B;  3CLO A;  3T56 B;  1ZUN B;  3WGG A;  1OB5 A;  3IWZ A;  3M8E A;  4XOP A;  2NYX A;  2CQQ A;  4HQM A;  4HG2 A;  3AVX A;  4XK4 A;  3LQE A;  1AKH A;  1JTY A;  1S29 A;  4P1V A;  2DMN A;  1HW1 A;  2X4H A;  1IN4 A;  4XLH A;  4NQW A;  4MTD A;  1JKO C;  2DOG A;  2OTL B;  4UUS B;  4F91 B;  3B6A A;  4JQF A;  3S14 J;  2CUF A;  1WSR A;  3OYA A;  1U8B A;  5FLX K;  1FPQ A;  1Y1V J;  1B9M A;  2L9N A;  4E7J A;  4K1X A;  5F4J A;  3CCV B;  3CUQ A;  2BEO A;  2EK5 A;  1FX7 A;  4WCG A;  1X58 A;  3I4N J;  4XKC A;  1OCZ H;  1MMA A;  2IGN A;  2PEX A;  1HA8 A;  2MH9 A;  1Y0R A;  2UUZ A;  3OYH A;  2DIE A;  2HU9 A;  3G05 A;  4A3J J;  3A2K A;  1IZ1 A;  1R1V A;  2VBW A;  1VZ0 A;  3S2D J;  2Z2S B;  2X8K A;  3CCR I;  1B8I B;  1K7A A;  4GQN A;  3N05 A;  5LBQ A;  2QSF X;  2EBI A;  3ISP A;  1PUE E;  1RWR A;  2DJI A;  4IQJ A;  3ASR A;  1OHH A;  5L3E A;  2M9H A;  4C30 A;  3Q0W A;  2BM5 A;  5H20 A;  1FTT A;  4PC2 A;  2GJR A;  1LJ9 A;  1JT6 A;  1W4M A;  4LG0 B;  1LEA A;  2K9Q A;  2KL4 A;  3IH2 A;  1R71 A;  2IRF G;  2Q6L A;  3CPX A;  5GP9 A;  1H85 A;  3I64 A;  3A02 A;  4PZJ A;  4EM0 B;  2DU9 A;  5K5O A;  3ONQ A;  3WWG A;  2BBY A;  4Z6Y A;  5FKL A;  5FKN A;  4ZTF A;  5HS8 A;  4UB6 C;  1KZL A;  3F8N A;  2WAQ A;  2YWH A;  3FMQ A;  4X6A J;  1ZGJ A;  1FMW A;  3BG7 A;  2WAQ N;  1BC7 C;  2O9L A;  3ZUG A;  4W8T A;  3IV5 A;  1WFX A;  1L0O C;  2MC4 A;  4EH1 A;  1G2H A;  1WI9 A;  1SD6 A;  4MFE A;  4A2U A;  2K5C A;  5GTI C;  3ZCO A;  3QE2 A;  1BHE A;  4F3Q A;  5FL7 A;  2EIL H;  3QPT A;  3BPX A;  4QUZ A;  1IRF A;  3RYP A;  3B6C A;  2GOM A;  3EDP A;  1FBS A;  4Y7C A;  5HKK A;  2HKX A;  1K73 D;  2O5R A;  1OFD A;  2FMY A;  3OYD A;  2Y75 A;  3S1R J;  3BH6 B;  5A89 A;  2EV5 A;  9ANT A;  2OBR A;  3BC8 A;  4I84 A;  1S3J A;  2G9W A;  2JUC A;  4I0A A;  4PJM A;  1UD6 A;  3T51 B;  3J81 k;  3ABK H;  4DOZ A;  3KPH A;  5H2F C;  1SM4 A;  1VQ7 B;  4DNT B;  2BF4 A;  4U49 A;  4IHV A;  2A68 F;  4PC7 A;  3G1L A;  4UAJ A;  4IXA A;  4A6D A;  5L46 A;  2WB1 A;  3V8K A;  3U1K A;  1J7K A;  3GUD A;  1T5E A;  2JPB A;  2R7W A;  3CCQ I;  2LK2 A;  3SEJ A;  1QQI A;  4M72 A;  1ZAR A;  3P4G A;  3C3W A;  1XC5 A;  5E17 F;  3R6J A;  4XRM A;  1R5G A;  1W7P B;  4UVC A;  3L1P A;  4Y52 J;  4PJJ A;  5E1Z B;  3F6V A;  5J1Y A;  2GRE A;  3Q6Q A;  5FLX Z;  4C43 A;  2PX9 A;  1U5T A;  3SZG A;  1UZC A;  1W1W E;  3KZY A;  4EJW A;  3OSF A;  4II2 A;  4U0W A;  5EG0 A;  2HZD A;  2CW7 A;  3ZXS A;  1YS7 A;  3TKY A;  4AD9 A;  1RMG A;  4LBY A;  1ETW A;  5JFR A;  1N07 A;  3ISX A;  1SAN A;  1VLO A;  4IW3 B;  4ZV4 A;  2IQ7 A;  1QPI A;  3VMF A;  4GYI A;  3BCA A;  2F4O B;  2CG4 A;  1I50 J;  3DBH B;  1I6X A;  1D5Y A;  4HRI A;  4WZT A;  4YFN F;  2X9D A;  2W00 A;  4KN4 X;  2X0L A;  4M3G A;  3CC7 B;  2AS5 F;  3LSK A;  5D6E A;  4C2U A;  4B44 A;  3GLL A;  3A3B A;  1WJ5 A;  1KON A;  2KMU A;  4LIT A;  1RR7 A;  2ZBK A;  2P4W A;  3QQA A;  5E3L A;  2COB A;  2VBK A;  1S7A A;  4O5V A;  1LUJ B;  3K1P A;  2DDA A;  5JHF A;  4P9S A;  3HSF A;  4TN1 A;  5DS0 A;  1IV8 A;  2AHO A;  1YHQ B;  3FY3 A;  1U9O A;  1TNS A;  2JWT A;  4BBR J;  4DZJ A;  1RRJ A;  2OA4 A;  5LFA A;  5J1U A;  1EP2 B;  3ASN H;  4FIS A;  1Z77 A;  5BSX A;  5JI6 A;  2EZK A;  4A12 A;  1S72 B;  2ZJ2 A;  2JK3 A;  3SDG A;  1LQ1 A;  2V7F A;  4A6E A;  5EGO B;  4DYQ A;  4BGD A;  1YIT I;  1X1P A;  4ENJ A;  1Y56 A;  4IL6 C;  3AVW A;  1I7P A;  4I99 C;  1J0R A;  3I55 B;  3MCZ A;  1X4O A;  3SYT A;  4AIJ A;  1K79 A;  3QOD A;  3A01 A;  1FSE A;  4L5E A;  2K9L A;  1E1R A;  1XCV A;  4Y4R A;  2HPI A;  1GT0 C;  3HHG A;  3PJR A;  3JSP A;  5KNL A;  3FM5 A;  3BQJ A;  3AG1 H;  3VDX A;  3ONY A;  1TYV A;  4ZJZ A;  1VQ6 I;  1JTX A;  3QPS A;  2K3F A;  5BOX A;  2HQ5 A;  3CCS B;  4RDL A;  1MZB A;  1GDT A;  3K4M A;  3OS0 A;  3HYI A;  4AVZ A;  2A6H F;  3KX2 A;  3P9C A;  3QU3 A;  3ASO H;  3CP8 A;  2HTJ A;  2BM4 A;  1KU9 A;  1OYI A;  1RZ4 A;  3RQI A;  4ZC3 A;  3F23 A;  4UUS A;  2VBY A;  2VJ4 A;  3DTK A;  1E3H A;  3ZQQ A;  3RKX A;  4UZF A;  4I6Z A;  4E7H A;  1TZL A;  1O3T A;  3WYA A;  2CV2 A;  3ZR8 X;  2COM A;  2XAS A;  3BZK A;  3W5H A;  2HOT A;  2O03 A;  4Y3O A;  1MBG A;  2BV6 A;  2TRT A;  5JHU A;  4OJ6 A;  1VF7 A;  4YCQ A;  4U0Y A;  1TBX A;  4HNT A;  1CQX A;  5C1E A;  1LPQ A;  5JLW A;  1DDG A;  1QRC A;  3V7C A;  1XE1 A;  2JRM A;  4L8J A;  2HS5 A;  3FIW A;  4BYY A;  1UD2 A;  3FJO A;  5GAG J;  2X1C A;  3RTR A;  1W0J A;  4M9S A;  1B8I A;  1ZG3 A;  2XAU A;  3ZQ7 A;  3ZMV A;  1KQ5 A;  1D8T A;  2EQR A;  3TP0 A;  3FPP A;  1HF2 A;  1QX4 A;  2P7C B;  3HM5 A;  1IW7 F;  3OR1 C;  2NVT J;  1RES A;  2L9S A;  4EJU A;  2OK7 A;  3K9T A;  4HAM A;  4LG0 A;  2X1E A;  4L9J A;  2HDN B;  2VXZ A;  2CUZ A;  1X2M A;  2RQP A;  4BY7 J;  3VYU B;  2CQN A;  1XDU A;  3JX8 A;  3NRV A;  4M3B A;  3GW2 A;  1AMO A;  3NAW A;  3T8R A;  3FXL A;  3MAJ A;  2H8R A;  5LHH A;  1WOO A;  2JZY A;  3WBK A;  5GAD J;  1IV6 A;  1FRQ A;  2V9K A;  1MDM B;  3JTG A;  5E3M A;  1MJA A;  1HLV A;  4B4D A;  4XIC A;  2GJK A;  3PA2 A;  3H9Q A;  2ZSI B;  2R7S A;  3LSH A;  5BPI A;  3Q9S A;  1FOK A;  2Z6B D;  4P96 A;  1VQK B;  3Q0V A;  2OTL I;  5L3B A;  1X3W B;  1YX3 A;  2L5Q A;  3OYL A;  1UD3 A;  4XKW A;  4KDP A;  1E79 A;  2ESH A;  1VQM I;  4ZGQ B;  3HGY A;  3SJP A;  2NOG A;  2XF5 A;  1P4X A;  2OCE A;  2CSO A;  3T53 B;  1OYY A;  3A8J A;  3BG9 A;  2NPF A;  3LNQ A;  3T1B A;  5E6T A;  4ZDL A;  1A5J A;  1ETY A;  1FOY A;  3ZSC A;  3BCB A;  1YG2 A;  1X1C A;  1LFP A;  4U7B A;  3L2U A;  3ZMD A;  3LA3 A;  3LSR A;  1TNT A;  3GWZ A;  5IP7 J;  1EV7 A;  3RDI A;  4LLN A;  1EFC A;  1VQN B;  2BZT A;  2LZJ A;  2R0Q C;  3GTJ J;  3WHC A;  4B48 A;  4ZYG A;  4CZC A;  5J47 A;  1O8G A;  1W36 D;  3TGN A;  3D1N I;  2V4D A;  5F4M A;  2HQR A;  2R3S A;  4Z4V A;  3L2Q A;  2ECC A;  3KYD B;  1N78 A;  4ACA A;  3DCF A;  2J7K A;  4EV0 A;  2CC2 A;  1NRK A;  4L5I A;  2WA0 A;  2HOE A;  3E7L A;  1PP8 F;  3MCA A;  3CMA I;  2VBX A;  2XGD A;  3PNV A;  4OIN F;  1OGI A;  2CF4 A;  4NK8 A;  4XLN F;  5KCM A;  2W85 A;  2E36 A;  2RQQ A;  4EM1 A;  3HEF A;  1ETX A;  1V5F A;  2MW8 A;  1Y0Y A;  4OOV A;  3PET A;  1E64 A;  4BE0 A;  4NK6 A;  4HST A;  1X3U A;  1KGS A;  4NC7 A;  2KIQ A;  3Q6R A;  2XAH A;  1I3Q J;  1LE8 B;  1UD5 A;  1P7J A;  5F0H A;  2RC5 A;  1WRJ A;  1G6N A;  4BHC A;  1YJW I;  5BPD A;  4XMY A;  1Y1W J;  3VO2 A;  1BI1 A;  3HOW J;  3SYJ A;  3JRG A;  1LDJ A;  3JQP A;  4A3D J;  3MZY A;  3KE2 A;  2GXB A;  2ZTG A;  1CZF A;  2BM7 A;  4EMS A;  4RCZ A;  4S05 A;  4XR6 A;  3RSN A;  3MN2 A;  4C9Y A;  4YG2 F;  4EGZ A;  4YAF A;  2VFN A;  4W97 A;  2CV1 A;  5J8C A;  5CQE A;  1P4W A;  2OZ6 A;  2XRL A;  4OJL A;  1SVM A;  4XLP F;  1VHO A;  5AON A;  1XN7 A;  3A8K A;  1YE9 A;  1HF0 A;  4U0V A;  5ICF A;  4U7D A;  2IT0 A;  4KUM A;  1J09 A;  2BW3 B;  3OWT A;  1J75 A;  1Q82 D;  5K7F A;  1R22 A;  2BN4 A;  1K8A D;  4IHW A;  2HZT A;  4RM3 A;  4HIZ A;  4XL9 A;  2IS6 A;  5EGO A;  1HDP A;  2LVS A;  2DYS H;  3BR2 A;  3FXQ A;  2D5V A;  4DJA A;  6PAX A;  2HCJ B;  3BWG A;  1Q86 D;  3JCU C;  2NNY A;  1LVK A;  2BSP A;  2DEU A;  5FRO A;  1HCR A;  2AO9 A;  2H94 A;  1U78 A;  2O6G E;  1UD4 A;  4M73 A;  3ECH A;  4XKV A;  1XPX A;  2OU2 A;  3MMY B;  2HDC A;  2STT A;  3FPK A;  1TT0 A;  3E6B A;  4Q48 A;  1HQC A;  3HZJ A;  4CDG A;  2WBM A;  5EZH A;  2X48 A;  4N4O B;  2QEN A;  3A35 A;  2KLO A;  2CFO A;  1ITY A;  2HYG D;  1V5G A;  2HPM A;  5D5U B;  4RB0 A;  5JBQ A;  4OU0 A;  4LBV A;  2XUB A;  3CJN A;  4MQV A;  4G5G A;  3DKY A;  3GSI A;  3SXY A;  1OOC A;  2JN6 A;  2BY0 A;  2W57 A;  1ZGA A;  3GVL A;  2QKM B;  3O8G A;  4M53 A;  2HXO A;  4OOI A;  2DDB A;  3OFN A;  4YII A;  3IH4 A;  5EYR A;  3LOC A;  3OW7 A;  4X06 A;  1IO2 A;  1LDD A;  2HQA A;  4RAF A;  2XT2 A;  3M1E A;  4MEY F;  3DWL E;  5IY5 H;  5IPA A;  3CXC B;  4Y7N J;  1U5T C;  4M4S A;  3W3C A;  4CCN A;  4A3K J;  3BTI A;  1UJ8 A;  4LB6 B;  5LEK A;  2VFP A;  5EEH A;  5CJ9 A;  1U2W A;  1SVO A;  4PSW A;  2XZO A; 
#chains in the Genus database with same CATH homology
 2CUJ A;  1HZE A;  3DLA A;  3VSV A;  3HPH A;  1WJC A;  2XGJ A;  3VMV A;  1DGR M;  4OAZ A;  2XOK A;  1MND A;  3E1S A;  1PJR A;  3BH4 A;  4XON A;  4JMQ A;  4C2T A;  4OWR B;  2WZP P;  4CSW A;  2IS4 A;  4XLC A;  1WJD A;  2LOO A;  3VSU A;  4G7W A;  4YRV A;  2R7V A;  2R7Q A;  2JJ1 A;  3GQ8 A;  4EW9 A;  4OJP A;  2VQL A;  2E1M C;  3IP4 B;  4KT6 A;  1DGW Y;  4BE2 A;  1WTH D;  1O8M A;  4Z03 A;  1PKV A;  3HOT A;  4URR A;  4NNJ A;  4YZQ A;  4CCO A;  3ZGK A;  3OYG A;  4BL0 B;  2R7T A;  4OJO A;  2XND A;  3UW0 A;  1YX5 A;  4BXF A;  2WY8 Q;  2DXI A;  2Z1D A;  2E1M B;  2NTP A;  4XN0 A;  2RRE A;  3B90 A;  4KIT B;  1PLU A;  2O17 A;  1HVX A;  4ZTJ A;  4G7X A;  2LRE A;  2IGO A;  1COW A;  1UEL B;  3DU6 A;  3F9K A;  3RQ4 A;  4E7I A;  1X4P A;  2UV1 A;  5TGT A;  1MAB A;  2CS3 A;  2ZSH B;  4N4N B;  1O8H A;  2K3P A;  3MD2 A;  4G6T B;  4P22 A;  4D1Q A;  1Z3Y A;  4PJL A;  3NWS A;  3SDB A;  1BOB A;  1WMR A;  2AQE A;  2Y0S A;  2R7R A;  4FET A;  3B4N A;  2INU A;  3RPU D;  4B3G A;  1BLI A;  2F1M A;  1K5C A;  3C2G A;  2GK6 A;  2INV A;  2OV7 A;  2VPL A;  2HDW A;  3DEE A;  3HXL A;  2CH0 A;  2PEC A;  2VBM A;  3K4C A;  4RLQ A;  2E1B A;  3BLY A;  2D3N A;  4X0G A;  3NE5 B;  1QU3 A;  2R9V A;  3VR6 A;  1D0Z A;  2QY1 A;  4BEH B;  1OLT A;  2ZZQ A;  2A5W A;  4MR0 A;  2QE7 A;  4LIV A;  4RMN A;  2RNG A;  2X85 A;  1G59 A;  1WJF A;  2ZXH A;  1WJA A;  2F5V A;  3U21 A;  3LMW A;  4B47 A;  3FBN B;  2LY2 A;  2DT6 A;  4DBR A;  3TBI A;  2W6J A;  3DDY A;  1O8I A;  3EPZ A;  3DPT A;  2LH9 A;  4FAS D;  3T56 B;  3D5R C;  1QHH D;  3HUG B;  4XOP A;  2R4G A;  2GJP A;  2QX3 A;  2ODL A;  3K4K A;  1FX0 A;  4CH7 A;  4HG2 A;  2LRD A;  1O8D A;  2W82 A;  2V6E A;  2WSS A;  2W6I A;  3OYI A;  2WAD A;  4XLH A;  3DQV C;  2XDV A;  3OL3 A;  4F91 B;  4JQF A;  2JSP A;  3OYA A;  1VBL A;  4YEJ A;  2L9N A;  2VAS A;  4E7J A;  3FDY A;  3ZPP A;  4IZZ A;  3K70 C;  3HL2 A;  3A3G A;  4XKC A;  3CJR B;  1MMA A;  2IGN A;  2E60 A;  2K9M A;  2VJJ A;  4II3 A;  4J01 A;  4Z1M A;  2UVF A;  3FHN A;  3V42 A;  1HA8 A;  4C2L A;  2X53 S;  1SKY B;  2UUZ A;  1BR4 A;  2IGK A;  4D9J A;  2HU9 A;  3OYH A;  2DIE A;  3G05 A;  2VQC A;  4PFP A;  4XLF A;  4BQN A;  3A2K A;  1Z3X A;  3EUK L;  5CKT A;  1E3X A;  1MMN A;  1VZ0 A;  5HNH A;  2Z2S B;  2X8K A;  3LSM A;  2KZV A;  4GQN A;  3IAS 2;  3N05 A;  1RWR A;  2P0W A;  4LIU A;  3MKZ A;  2DJI A;  4IQJ A;  2NTQ A;  1I18 A;  1OHH A;  4CCJ A;  4C30 A;  1E43 A;  2GJR A;  1UG0 A;  2VB6 A;  3S32 A;  1ZEL A;  2V7Q A;  2Z16 A;  1D0Y A;  2DOA A;  2KL4 A;  4XOT A;  2OC6 A;  3OPO A;  2WJV A;  4DBQ A;  4TSF A;  3QOE A;  2NT6 A;  4P1W A;  1OGM X;  4E7L A;  4NC8 A;  3K70 D;  3MKW B;  1HG8 A;  1XG2 A;  1JTA A;  3ONQ A;  1X1A A;  3WWG A;  1MMG A;  4XM3 A;  4BUP A;  3UNG C;  4ZTF A;  1WP6 A;  3SEQ A;  1WPC A;  1KZL A;  2M4G A;  2WAQ A;  2O0V A;  5CDF A;  1FMW A;  3BG7 A;  4G6I A;  2DCE A;  4XD7 A;  4W8T A;  1T0F C;  2VL8 A;  1WFX A;  2CK3 A;  2MC4 A;  2M3A A;  3FKS A;  2K5C A;  2FUG 2;  3ZCO A;  1BHE A;  4JOM A;  4F3Q A;  3CP2 A;  5FL7 A;  3GQA A;  2IS2 A;  2KVO A;  1BN8 A;  2GOM A;  3CZ6 A;  3ZPN A;  3SUC A;  3DKX A;  1WJB A;  5HKK A;  1PXZ A;  2O5R A;  4KKU A;  2LYC A;  4PUS A;  3OYD A;  1BPL A;  4TT3 A;  4RLF A;  1H8E A;  3OYE A;  1X0C A;  1IA5 A;  3BC8 A;  4I84 A;  4PJM A;  1UD6 A;  3T51 B;  2O04 A;  4DOZ A;  4B3F X;  3PSF A;  4QPQ A;  4DNT B;  3H5R A;  4R79 A;  3SEZ A;  3OIP A;  1E3Z A;  4U49 A;  2ZZE A;  4W8Q A;  4E7Z A;  5DN6 A;  3OYM A;  2HNH A;  2CV0 A;  1MNE A;  4AYB A;  2E5N A;  3S3M A;  2WB1 A;  1NG7 A;  4MXN A;  4U4B A;  2O1D A;  4B43 A;  4E4H A;  1T5E A;  2R7W A;  1DBO A;  1T95 A;  2HVQ A;  3ZIA A;  3VYT B;  2X6W A;  1UAA A;  1D0X A;  1W36 C;  2LY1 A;  4F92 B;  4RM2 A;  2X6Y A;  3D5S C;  2PMZ A;  3H5A A;  2IS1 A;  4OZY A;  3C2H A;  2X3H A;  1KCD A;  1E0E A;  4PJJ A;  1U0J A;  1O8J A;  3SZG A;  3DU5 A;  3GVJ A;  1BR1 A;  2OUM A;  3I9V 2;  4II2 A;  2EWE A;  2VKD A;  2HZD A;  2WY7 Q;  2CW7 A;  4YZ0 A;  3OIQ A;  3ZXS A;  4HSR A;  3OYF A;  1D1B A;  4E7K A;  1RMG A;  2GOX B;  2LBF A;  4LG3 A;  4BJT A;  4ASU A;  2IQ7 A;  2UVE A;  3BCA A;  4PMH A;  4CCK A;  4U87 A;  1GLN A;  3KYL A;  4HRI A;  1DP3 A;  3PSI A;  2W00 A;  1JI8 A;  1R6R A;  3EQO A;  3LSK A;  1LDK B;  4C2U A;  3GBG A;  4B44 A;  3A3B A;  5C1C A;  4UZU A;  1WJ5 A;  1KON A;  2MYS A;  2KMU A;  3DTI A;  4LIT A;  3A4C A;  3LFU A;  2VBK A;  2X51 A;  4IX7 A;  3M1C A;  2M7B A;  5JHF A;  5HLT A;  3K6G A;  3MKY B;  4ZDP A;  1JRG A;  3FY3 A;  1FMV A;  3GQ7 A;  3AL0 C;  3OY9 A;  3OE7 A;  5FRN A;  1OFL A;  4BE1 A;  5LFA A;  4ITV A;  3RCO A;  3OYJ A;  3CMM A;  3PNT A;  4OZZ A;  3LMM A;  1WJE A;  3VYS B;  1E1Q A;  2M7A A;  3AL0 B;  2HVR A;  1K28 D;  3OYK A;  3OAA A;  2O0W A;  3HPG A;  2V7F A;  3GQB A;  3QYF A;  4BGD A;  2VQG A;  4PJN A;  3ZRG A;  4BS9 A;  1Y56 A;  5AMV A;  4BEH A;  4Y33 A;  2PYG A;  2PJR B;  1V0F A;  4XLE A;  3OS1 A;  2VLA A;  2V4J C;  1X4O A;  2WAE A;  3SYT A;  2XC7 A;  3K4B A;  1O88 A;  3QOD A;  1E1R A;  2K9L A;  3A1Y A;  4Y4R A;  2M4K A;  2HPI A;  1UD8 A;  2E5Z A;  3PJR A;  2JDI A;  5KNL A;  2F43 A;  4TKO B;  1V5E A;  1Z7L A;  4YEL A;  4B3X A;  2BVM A;  3VDX A;  4DNR B;  4ZJZ A;  3OL4 A;  2CW8 A;  3DPU A;  4FXU A;  1BR2 A;  3PUB A;  3K4L A;  3LSI A;  4CA0 A;  3K4M A;  3OS0 A;  1QCX A;  4AVZ A;  2A6T A;  4XQF A;  2JIZ A;  2R7O A;  2F6C A;  3OEH A;  2XZL A;  3KX2 A;  3CES A;  3CP8 A;  3OS2 A;  2CMP A;  4ZC3 A;  2XF7 A;  2VJ4 A;  3DTK A;  3ZQQ A;  1OFM A;  1O8F A;  4YZA A;  2KP6 A;  3H9G A;  1TZL A;  2QKL B;  4E7H A;  1H80 A;  1N75 A;  3PFY A;  4ANJ A;  3ZR8 X;  2CV2 A;  2BW3 A;  3PNY A;  4Z05 A;  3HAG A;  4Y3O A;  2JJ2 A;  2ZXI A;  4OJ6 A;  3LNN A;  1VF7 A;  2IXS A;  1P9Q C;  1NHC A;  4HNT A;  5C1E A;  2PYH A;  2Q2E B;  1Y6I A;  4ZYA A;  5HOO A;  1AA7 A;  4BAC A;  4L8J A;  2QXZ A;  4F93 B;  3IAM 2;  1UD2 A;  3W2A A;  2NT9 A;  2VJ5 A;  2Z8G A;  3H35 A;  2X1C A;  3RTR A;  1W0J A;  3GVK A;  1MMD A;  1X19 A;  1N77 A;  4HPQ A;  2XAU A;  5HVQ C;  3OYN A;  3G2B A;  1EE6 A;  3GQ9 A;  1AIR A;  4QPO A;  3H94 A;  3FPP A;  3OR1 C;  2L9S A;  3H5N A;  2VKH A;  1EFR A;  3B8Y A;  4Z06 A;  4XOR A;  4J00 A;  1IDJ A;  2X1E A;  4XN3 A;  2HVS A;  3OEE A;  2VXZ A;  2CUZ A;  3E0J B;  3NWT A;  3VYU B;  3VST A;  3L2W A;  3OOU A;  3OOC A;  4EAT A;  4PSX A;  1NG6 A;  4W8R A;  3VYR B;  4HWV A;  5CQG A;  1W9X A;  4YZX A;  2WJY A;  2KHM A;  4CUG A;  2V9K A;  2M5S A;  2HLD A;  2NSP A;  3VSK A;  2GJK A;  1DQU A;  3H9Q A;  2ZSI B;  2R7S A;  3LSH A;  1VLY A;  2V31 A;  3BG6 A;  3DPL C;  2Z6B D;  3GRH A;  2V1N A;  3TMO A;  2WPD A;  1YX3 A;  2L5Q A;  3H9J A;  3OYL A;  1UD3 A;  4XKW A;  4MLO A;  1E79 A;  4AU7 A;  2X6X A;  3K10 A;  1IDK A;  2XF5 A;  3JU4 A;  2LBF B;  3T53 B;  4HNU A;  3PL8 A;  1EA3 A;  2JVH A;  4ZDL A;  3W2W A;  2JA2 A;  3ZSC A;  3BCB A;  2XSJ C;  4BQQ A;  1X1C A;  1LFP A;  4KIS A;  1O8E A;  4U7B A;  3L2U A;  1GQ8 A;  3H0D A;  1MW7 A;  3I3L A;  2M0M A;  3L2R A;  2LZJ A;  2KRC A;  2JVG A;  1OR7 C;  5IK2 A;  4W8S A;  4B48 A;  4CZC A;  4XLA A;  1O8G A;  4NUB A;  2ELJ A;  1W36 D;  2V4D A;  5CPR B;  1I8D A;  1V0E A;  3JUR A;  1W0K A;  2KDO A;  3L2Q A;  2ZFU A;  1N78 A;  1QHG A;  4IKF A;  4BQO A;  4H4K C;  2NST A;  1SAU A;  4CCM A;  1NRK A;  2NOJ B;  3W2V A;  2WA0 A;  1H8H A;  2V26 A;  2AQF A;  2MD0 A;  3VWB A;  2XF6 A;  4NK8 A;  3PNV A;  1K6Y A;  5KCM A;  4NQW B;  3AKZ A;  2UWM A;  4IQ4 A;  2ZZG A;  2RQQ A;  4BDZ A;  1V5F A;  1S9H A;  4BE0 A;  1KTW A;  3OR2 C;  4HEA 2;  4HST A;  4NK6 A;  2NTB A;  1PYV A;  2X1D A;  2R7X A;  3VSL A;  4NC7 A;  4KKT A;  1O8K A;  4XNF A;  3S93 A;  4DIQ A;  4DK0 A;  1QJV A;  4CCL A;  4BDY A;  1UD5 A;  1LKX A;  3OYB A;  1KMH A;  3TL4 X;  4DGW B;  4BJ5 C;  2I8D A;  1VJS A;  4XMY A;  2BOL A;  3UR3 C;  1O8L A;  1NBM A;  4F52 A;  5LD2 C;  1ERD A;  2L2O A;  3S8P A;  1X1D A;  4BU2 A;  2ZTG A;  2BVL A;  1CZF A;  4XR6 A;  3HC7 A;  3RSN A;  4C9Y A;  2GK7 A;  1RU4 A;  3S3O A;  2CV1 A;  1D1C A;  5CQE A;  3M8J A;  1SFK A;  2KRH A;  5HNF A;  3K4N A;  4OJL A;  3LSG A;  4XKB A;  3KRG A;  1OB0 A;  2ZZF A;  3FKJ A;  1YE9 A;  1D1A A;  2MFZ A;  4GRI A;  2XZP A;  2ZTN A;  1J09 A;  2BW3 B;  3OWT A;  3EUH C;  2W7N A;  2MAB A;  2F4I A;  3CJQ B;  3BC9 A;  3T9G A;  1IB4 A;  2WAF A;  4PFO A;  4RM3 A;  3K4J A;  3OMY A;  4HIZ A;  4XL9 A;  2IS6 A;  2R7U A;  4DJA A;  3LL7 A;  4E6K G;  2BSP A;  1LVK A;  2PJR A;  2VQH A;  5FRO A;  3HOS A;  3KEW A;  3VMW A;  1UD4 A;  3CF2 A;  4DK1 A;  4XKV A;  1OGO X;  2DT7 B;  3MMY B;  2D3L A;  3HKZ A;  1TT0 A;  3D5L A;  2VXD A;  2WBM A;  2IGM A;  3HG9 A;  4N4O B;  2W4S A;  3A35 A;  2KLO A;  2CFO A;  2L7K A;  3IUO A;  1V5G A;  2JUG A;  4OAY A;  1G8X A;  2HPM A;  4KKS A;  4E0F A;  1KCC A;  1PE9 A;  3QYE A;  4KJZ A;  4E7S A;  3QYB A;  4ZDO A;  3EQN A;  3J7A Y;  5FRM A;  2LG4 A;  3DKY A;  4YXW A;  1OOC A;  2VJI A;  4BJ6 C;  1DBG A;  2LC2 A;  4P5O A;  1X1B A;  2KPM A;  3GVL A;  3OYC A;  2QKM B;  2VBE A;  3OFN A;  3S3N A;  3AFH A;  4PK4 A;  3DTE A;  3OW7 A;  2HQA A;  3BCF A;  3DWL E;  5KHD A;  2Q1Z B;  3WQZ A;  4OJ5 A;  1Z21 A;  2VIX A;  2KQR A;  3EUA A;  3W3C A;  4CCN A;  4F55 A;  2W1O A;  2NZM A;  3KEY A;  1IRX A;  3L2V A;  3BCD A;  4PSW A;  1BMF A;  3FBI B;  2XZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...