4XKWA

Tailspike protein mutant d339n of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 233
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkwA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkwA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkwA02
1PE9A 1OGOX 4XMYA 1O8LA 2X6WA 2ODLA 3KRGA 1GQ8A 1K5CA 1BHEA 2O1DA 4NK8A 4XL9A 1KCDA 3VSTA 5AMVA 4OJ5A 4XN3A 1O8JA 1PLUA 4OZZA 4XN0A 2VJJA 1RMGA 4YZXA 1JRGA 3JURA 4XM3A 4MR0A 1O8EA 4W8SA 4AVZA 1IDJA 3VMVA 1O8KA 1DBOA 1O88A 2UVFA 4C2LA 4OJLA 4W8RA 3UW0A 4W8TA 3T9GA 3B8YA 1O8DA 2INVA 2VBMA 4YZAA 2Z8GA 4OZYA 5C1CA 5C1EA 4XONA 2PECA 4W8QA 4YEJA 1XG2A 1DBGA 3B4NA 4OJPA 1KTWA 2NSTA 2NSPA 3GQ8A 3FY3A 3VSUA 2NT6A 2BSPA 1O8FA 2X6XA 4U49A 2INUA 4XQFA 4YZ0A 1NHCA 1AIRA 2O0VA 2VBEA 2PYGA 4OJOA 3EQOA 2NTQA 1OFMA 1OGMX 2O04A 3ZPPA 3ZSCA 2QY1A 3GQAA 2O0WA 3GQ7A 4U4BA 1BN8A 2VJIA 3GRHA 1RWRA 2QX3A 3LMWA 4YZQA 2VBKA 2NTBA 1EE6A 1CZFA 4HWVA 1IA5A 1RU4A 3VMWA 4XKVA 4XNFA 1H80A 4NK6A 2NTPA 2UVEA 3EQNA 4XLEA 4I84A 3VSVA 4XR6A 1OOCA 3GQ9A 2X6YA 1JTAA 1VBLA 1IB4A 1OFLA 1O8HA 4MXNA 4Z03A 4Z06A 2PYHA 4URRA 1WMRA 4PMHA 1IDKA 2NZMA 4XORA 4OJ6A 4YELA 4XLFA 1HG8A 3B90A 4XOPA 4Z05A 1QCXA 2X3HA 2EWEA 2QXZA 4XOTA 3WWGA 4XLHA 3SUCA 1X0CA 2IQ7A 4XLCA 1O8MA 1PXZA 4XLAA 1O8IA 2O17A 1QJVA 2NT9A 1O8GA 2X85A 1KCCA 4EW9A 4XKWA
chains in the Genus database with same CATH superfamily
3L2QA 5FFZA 2HXOA 4WXDA 3P4GA 2Y75A 5EMNA 3BZKA 4FT8A 4UV9A 3T8RA 1OFCX 1O57A 1RR7A 4AIDA 4Z4ZA 1ZLJA 4LIUA 5JI6A 2F1LA 3RY8A 2ZXHA 3M8EA 2DIEA 2QTLA 2HKXA 5AMVA 2Z9OA 4R8HA 4I09A 1BA5A 2XOKA 3BY2A 4BQOA 3SY2A 1YJWI 5L3EA 5IT9K 3CRZA 3H35A 1HSTA 3K1MA 3FKJA 3N6ZA 1MJ9A 2LFBA 3V7RA 5LLQA 3PETA 1S7EA 3DLAA 3DBLB 2OZUA 3ELKA 3GBGA 3GF2A 3NEUA 4GYIA 4ZDPA 5E3NA 4OJLA 2IS4A 1SC7A 2KDZA 3I59B 2K9NA 1BN5A 3ISPA 1KZHA 5L3GA 5EF6A 4ZTJA 1GDTA 1FP2A 1A04A 1QG0A 4WZEA 1HCRA 1AHDP 4WZKA 4ACAA 5C1EA 1ONVA 3TO7A 2DA4A 3JR9A 2AO9A 2D3NA 3WYAA 2XF6A 4E0FA 2RC4A 5IPAA 3QP6A 2VFOA 2E36A 5FD6A 4XICA 1N25A 3CPXA 3ZZUA 5DCMA 3BJAA 5E79C 3W2WA 4C2TA 2QGUA 3W2VA 1B59A 1UB9A 2YU9J 2L5QA 4NC8A 2CF4A 2DA5A 2DTRA 1D0YA 3K0LA 4G7ZF 3C1DA 1QZZA 1GV2A 3BCBA 1P7JA 4HX4A 2G0YA 2GQFA 4OJOA 2XAFA 1MMAA 4C0SA 2BHYA 3GVKA 1K78B 3ZMSA 2VL8A 1W36C 3C18A 2JVHA 2VASA 2VLAA 4F55A 2QQBA 3ABUA 3S93A 2QQAA 2IT0A 4QVAA 2QENA 2M3AA 1QA1A 1I1GA 1WXRA 3K10A 3RPQA 1ETVA 1YQAA 1VQ8B 2Y0SN 2VE9A 4JX5A 4TKOB 1LLZA 2W24A 2FBIA 1AMOA 2E1CA 5HS9A 1PVEA 3V42A 3I4MJ 4IF4A 3B8HA 5F08A 1QZYA 3GTLJ 3G2BA 3HL2A 3QPHA 3SEQA 2L4MA 2JK3A 4P1VA 2QN6A 3VO2A 1U6GA 4AF6A 2X3UA 5FKLA 1XCBA 1KA8A 2F3LA 4UNOA 2W1OA 2L7MP 2EINH 2LRDA 5TR9A 1LFBA 3Q0WA 4NBQA 4B3FX 4YRVA 2DFHA 3LSGA 5D5UB 1E1QA 3OE7A 4LIVA 1NB9A 2V4JC 3P27A 2AXLA 3CJQB 1IF1A 3OEHA 2LLKA 2E19A 1NHAA 2F48A 2XKPA 3U2RA 4OP7A 3HGGA 1N07A 2LY1A 2V26A 1J59A 4WZTA 4Z03A 3BR5A 1WMRA 4S05A 1STZA 4N3GA 2O5RA 4BU2A 3BC9A 3K4CA 4AU7A 1A6IA 1OMIA 2JUGA 1KRHA 2K9SA 4IHTA 2O8KA 2XIGA 2V9VA 2X3HA 2X0LA 3RKWA 1YE9A 5LEJA 5IYWA 4XKCA 5IYNA 4RDJA 4OIPF 3WG7H 5IYRA 2DFIA 2BGCA 2JRTA 2XVCA 1FZPB 4EV0A 4XLAA 1S8NA 2MFZA 4MEXF 4DYRA 1V0EA 4AF7A 2ZZGA 3T5XA 1BW6A 3HBLA 1I3QJ 3KP6A 3OYBA 2ZJRF 3PSIA 1E17A 1VQMB 2YWGA 2FF4A 2YUSA 3BOQA 4E4HA 4AIJA 1DDIA 1WDTA 2KJBA 3A01B 2AHOA 1SVLA 3F21A 5B1BH 2O1DA 4NK8A 4S0HB 1G4DA 1DP7P 3H36A 5BPIA 1ZR2A 3PQJA 5F1RA 2NRAC 3P9IA 5J40A 4XBFA 3WHCA 3WODF 4DZPA 4XN0A 4G94A 5JVTA 3TBIA 4MTEA 4DIQA 4XM3A 2C5BA 4LBYA 3L00A 3GTOJ 1WOSA 4A2UA 2R6HA 1MDMA 1IO2A 2ZFWA 5JLXA 4HNTA 3G73A 4WXCA 2R9VA 2INVA 3B8YA 1U9NA 4RJLA 1QRYA 1U8BA 3TW7A 4EGYA 5HOOA 3HRMA 4LLLA 1VF9A 2VJ5A 4RGSA 3QYEA 1AIPA 2NSTA 2QDXA 2LKSA 1SAUA 3ONUA 4B48A 2XNDA 5H6QA 2BSPA 3KYLA 1TVCA 2PJRA 1FLIA 3AKZA 4B4CA 4QFMA 1R5GA 4BACA 1WJCA 3OV8A 2KIQA 4YFNF 1K73D 2DETA 1O3QA 2IW5A 1WJBA 2EIMH 2KFDA 3DTKA 1LPQA 1E3XA 3PENA 3RZOJ 1X2NA 1BX0A 3EQOA 3BG3A 1EP2B 5LGNA 2CO5A 1R5ID 1ZYRF 3M4OJ 4JQFA 2ZJ2A 2RC5A 3D5SC 2YR2A 1REPC 4LBWA 3CCYA 1UHSA 2OAZA 3KL9A 1MH4A 4E6KG 3P26A 4HX8A 5BMZA 2KVOA 3CMAB 2GXGA 4UUSA 2NAZA 3MKLA 1DPUA 1YW9A 4TMXA 2YSRA 3OSGA 4M6XA 2D2WA 3LOCA 1E0EA 2GJRA 4YZQA 2JN6A 3BG9A 3JCUC 1CLWA 4A5NA 1HSJA 3ZIAA 1E3OC 1F1ZA 2EZKA 2ZTNA 1CZFA 2YU3A 3TDUC 2UUZA 3U21A 1H88C 1R71A 4CZZA 5A2QK 1JUMA 2E34A 5ILVA 3IC7A 1MBGA 1OJLA 2R7TA 4RAZA 3Q6QA 2NTPA 4BY1J 4M53A 4RCYA 5J1RA 3OYCA 3L2VA 5GV8A 4NCNA 1I5ZA 4X0GA 3JSOA 2GPJA 2LK2A 1XG1A 4UB6C 3S32A 1LEBA 1ZR4A 2Z5UA 2L02A 3V8JA 5BOXA 3M07A 4MO7A 2R7DA 3ERED 1K9MD 3UNGC 1XB2A 2HR3A 4O5VA 2UXXA 1MMDA 4S04A 3MAJA 2VNHA 1QRBA 2YWFA 2J8IA 3W6JB 3AVYA 1W0JA 3QFRA 3PO3J 2DERA 2EWEA 4YHBA 1OGIA 3ZBUA 1TW2A 2L9RA 4O3MA 2EIJH 4LOCA 3H5RA 1Y0NA 3NARA 3U9GA 3CD6I 2KZGA 5FRMA 5IYDJ 1O8IA 2BE5F 4KDPA 4RGUA 3KP3A 2HU9A 1JUPA 4XKWA 4I02A 4RB1A 1BR4A 5DSZA 2M8GX 2V1NA 4MFEA 4ZCMA 4OPOA 3PA1A 4KH3A 5IP7J 2X6WA 2VI6A 2WYRA 3OS0A 4J19A 3OL4A 5DUIA 2CV2A 3FXLA 5EGOB 1LKXA 2Q2EA 2ZXJA 1Z05A 3CP2A 4DNTB 3VSTA 2IPQX 4QIWN 4LB5A 1H9GA 1JNYA 4Z2YA 1K8AD 2K9LA 3A35A 2KRFA 3J7ZI 2ME6A 2EA4A 3KX2A 1MZBA 3KEOA 3M8JA 1Y8RB 4ZH4F 1U3EM 4IHSA 1FSHA 4RGXA 2DT6A 5CYVA 3J7AO 5D5VB 1CNFA 2WJYA 1ZRCA 2NVQJ 5FA6A 3CCQB 4A3GJ 5ERIA 4Z4YA 3AG1H 4AM3A 2UWMA 1EXMA 4QTRA 3AAFA 3WE3A 3RKQA 2BPOA 2A6HF 2PJPA 1Z77A 3FDYA 4PFPA 3ZQGA 1G2HA 5E6TA 3DV8A 2ZL7A 4Y7NJ 4PC3A 3LAPA 1DDNA 3E6MA 5GADJ 3F22A 2A68F 3A1PA 5E17F 3LYCA 3S1RJ 3K70D 3CCMB 1W7PB 1X19A 1LVKA 1ZGWA 1LDKB 1FX7A 4CZCA 3V76A 3N4MA 2LBFB 1TNSA 1QGYA 4KICA 3OJWA 2CRGA 4PCQA 3QOEA 2NPFA 4IRGA 3ASNH 3OY9A 3WNCA 1DDGA 1EJ9A 3OS2A 5AN9A 2OK7A 1BN8A 2P6TA 2DYSH 2DY1A 2DJNA 1J9ZA 2LP0A 1MMNA 3V7SA 5B1AH 3FF5A 1VHOA 1HA8A 4HV5A 1BW5A 2JQ7A 2I1LA 2EB7A 3D26A 3CCLB 3DXJF 2P3MA 3GVAA 4HRIA 4IPAA 2VOOA 2VKVA 3LA2A 1QPIA 5JLWA 2LH9A 4KN4X 1S9HA 1TWAJ 3Q5FA 3CCUB 1LUJB 4CO8A 1BJZA 5KHDA 2HDNB 3WBJA 2FEZA 3ASQA 2QA4B 3VSKA 2WAQN 1OR7C 1I6HJ 4KJZA 4EJUA 2PEXA 2HGCA 3PFYA 2VZLA 1OFLA 1MNMC 2Q8KA 4TMVA 5FIUA 1QQIA 5LBQA 3BH7B 5KAFC 1FRQA 3KIOA 2XGCA 1JTXA 3PM1A 1QVTA 4M9ZA 1Z67A 4JRAC 1IAWA 3OEEA 2VQGA 4ITVA 3AVWA 2ZMEC 1WI3A 3FXJA 2DYRH 5GAEJ 4A0ZA 1Y0RA 5D8KB 2CNDA 5LRSA 1R00A 2GLOA 2X53S 2EFOA 2WAQA 3HKZN 3ML6A 3LSRA 4DYCA 4X7CA 1S72I 3HTSB 1UHMA 4Z4WA 3S16J 1KCCA 5ILSA 4OIQF 2A6EF 3GVJA 1YX5A 2HPIA 2AQEA 3K6GA 5E20A 4CH7A 3NRVA 5FLXZ 3L09A 4XMYA 4HV6A 1J2XA 1B6AA 5DNSA 2KISA 2OBTA 2K02A 2NVUB 1GT0C 3F23A 2RVCA 3A4CA 2X0KA 3DPLC 5F1JA 4UHTA 1WP6A 1TTTA 2H27A 1KCDA 1L3LA 5HDKA 4NQWA 5D5XB 1FNCA 5F4JA 2WB1A 3I71A 2HVQA 1W1WE 1H8HA 2W25A 3BWGA 4MR0A 4IHXA 5E1ZB 1PUEE 3F6OA 3F0CA 4IXAA 1RUNA 3S1NJ 1E3ZA 3GW2A 4U0VA 2M5SA 3KEWA 4P25A 2WC2A 3Q0VA 5JBQA 2ZBKA 5IY5H 3R6SA 2OPTA 3K1PA 3I4PA 3L2CA 3CC4B 3AL0C 3WTZA 1EA0A 2XB0X 4CYCA 4FTHA 2I8DA 1MRZA 3ASTA 3Q39A 1LM1A 2DT7B 4FISA 1JTYA 2JZYA 2D5VA 1G3WA 2BVLA 4N4OB 3B02A 1MBEA 1U5TB 3IKTA 3E6CC 2EFGA 3P7NA 4AWXB 1E43A 4FXUA 2DA6A 5CVJA 1SMYF 1GVDA 5DM7F 4DOZA 3PUNA 3QU6A 1BI0A 1LEAA 2H09A 1ZARA 4QHYA 2LY9A 1ZG1A 1YTYA 3CCEI 2VXZA 4LBZA 3CXCB 3BH4A 2KRCA 1YG2A 3VEPA 2XTXA 4ZZDA 4IJAA 1BBYA 2O04A 3A02A 4MHGA 3OYAA 1ZTRA 2F6CA 1Y0YA 1T6XA 3A3BA 4P3IA 2A05A 4U4BA 2XPUA 3CCVI 1T39A 1B72B 1TW3A 1RUOA 2PJRB 3LMWA 2A5YB 1TTYA 2VBTA 2JMWA 2QSHX 3JX8A 2RQPA 3RYPA 3H3ZA 2KMUA 1BC7C 4XKVA 1GXPA 2XNCA 2VIXA 1JKPC 4HEA2 1QUEA 1T0FA 5CLSA 1TQIA 3ONQA 2V7WA 3BQZA 3ABKH 1RRJA 2O7OA 4JYKA 4F52A 3E5XA 3HTUA 1T8IA 3OZVA 2C6YA 1XSVA 4U0WA 1S5LC 2DAOA 5TV2A 1WH7A 1MIJA 4BBRJ 4BJTA 3OYMA 3LSPA 4D1QA 1LVAA 4NBSA 4YAFA 4QLCU 2PYHA 4OM9A 5K1YA 3AK5A 2B0LA 2IBDA 2QZ8A 2L4AA 4LB6B 1U2RA 2E1RA 1FOYA 3Q3SA 3VODA 2TDXA 1QCXA 2PMZA 2GXBA 3RTRA 4EH1A 4XOTA 4P2NA 4EM2A 4X7FA 2BOLA 4A3BJ 4KIFA 1BX1A 3MMYB 4X7EA 4Z4RA 2H1KA 2A6TA 1H8EA 2EFPA 5HZAA 3CCJI 2CWEA 4BS9A 3EYYA 5EGOA 2TCTA 4OIRF 3QE2A 2OYNA 3JSPA 3NB2A 2VODA 2C4UA 3M8FA 1WJEA 3ZN1A 4OAZA 1X1PA 2E71A 1NJID 2WADA 1RKTA 1I18A 1ZM9A 1OR7A 2I5UA 3FXMA 5HNHA 4UVAA 2VYQA 2CW5A 4RPDA 4CYDA 2PX9A 1W35A 2DXIA 3QPLA 3E7LA 4I99C 3PNYA 4YAUA 2IP2A 1T6YA 5TGTA 2Q6OA 2QYOA 2R93J 2XGJA 2CQXA 3P9CA 4U0YA 2XPWA 3I0TA 1NH3A 1HW1A 1HF0A 3JURA 1UHWA 3LQRA 1YS7A 1IDJA 2L0KA 1VQ6I 1PUFA 2FNAA 2WY8Q 1WVRA 4DZJA 5IOYA 4QPQA 1IHMA 4M3EA 3CCMI 4PJNA 2L9VA 4CUGA 3AVXA 5M3FJ 4M3DA 3FHNA 4ACBA 4G1VA 1EFUA 4YCQA 3AVUA 3EUAA 2E2JJ 3G71B 2BM5A 4RAGA 2XZLA 5M5XJ 4HE6A 4D7NA 5GTHC 4IOCF 3A8IA 3GTGJ 5CPRB 1XTAA 3I54A 3CCJB 4FASD 4ZYDA 1K4SA 3KCCA 1ZM4A 2NT6A 3EETA 1YITB 1O8FA 2A69F 1R4NB 1E63A 3OR2C 3E1YE 1ZREA 2FA5A 2CUJA 4Z4VA 3H09A 4U49A 4PSWA 3HG9A 2DMNA 4IHVA 1OCOH 2V1DA 1G3YA 1D8KA 2Q6KA 4GFBA 1WWXA 2MLKA 4CYCB 1CNEA 2V7QA 1B1BA 4Z1MA 4ASNA 3W2IA 4Y7CA 1P6RA 1QPMA 3FBNB 3ZZ0A 3RSNA 4G6IA 5FLXK 1SFKA 3K4MA 2H8RA 2X1CA 4ZYGA 1HZEA 5GAGJ 1FNDA 2X9DA 2XPVA 2ZSHB 3G71I 2ZL6A 3GQ7A 2FX0A 3KEYA 3BPXA 3BCDA 4PABA 4L0ZB 3FWEA 4A3CJ 2FRHA 1KQ8A 2F4IA 1E64A 2DOFA 4GO1A 1XSXA 4G6TB 1OPCA 4MGRA 2FBKA 5F64A 3AVVA 3G4SI 2E7XA 3E5UA 3I5UA 2WBMA 4W97A 1Z7LA 2DMTA 1V0FA 2IGNA 5J1UA 4LMYA 1ZH5A 1QHGA 1R5NA 5LEKA 2HDCA 5A89A 4ANJA 3OYJA 3FJOA 4G7WA 4BUPA 3BROA 3DTIA 3JTHA 4F93B 2M30A 4KA4A 1YRNB 2LKPA 2M4KA 3C2HA 4KN7X 1WZ2A 3TH0A 3BY6A 3ROUA 1RIOH 1O8HA 4P9FA 5HLHA 1YFHA 5JR3A 2GXAA 3BDDA 3SQNA 3CMEI 4X07A 4KNYA 2D1HA 3K2AA 4XORA 4OPVA 3E20A 3LAJA 5DTDA 1J9IA 3OIOA 3CMYA 1S3JA 3EQLF 1G7CA 1L1IA 2RV8A 2LNBA 1NTCA 2QXZA 5M5YJ 4D5FA 3T8TA 1Z9CA 3LNNA 2IQ7A 1QX4A 2GOXB 4JX6A 2GQQA 2E5NA 4GQNA 2F5CA 4RAYA 1X3UA 4IRHA 3TP3A 1WPCA 3P9KA 4IHYA 1KJZA 4FN5A 2OTJB 1P2FA 2WR8A 3G1OA 2VNKA 2ZITA 3JRHA 5H5JA 3CC4I 4Q4ZF 1EZGA 1SFXA 4TSFA 5HKKA 2EWNA 4FHTA 4B8XA 5FRNA 2V4DA 3VYUB 4A3IJ 1V4RA 2EFQA 2EPFA 2HOTA 1MNDA 2TRTA 2JA6J 4L9TA 2IS6A 3A3GA 1XGNA 1FBUA 3ABMH 3EUHA 1TWHJ 2VJJA 4II3A 5FGMA 4EQQA 1A8PA 3W2FA 3JAMZ 4E7JA 1JKQC 3OIQA 4YAWA 2DJIA 4X05A 2CUEA 2E35A 2B5OA 1R22A 1MABA 2MABA 1U5TA 1TUIA 2RC6A 3TP0A 3ZXSA 2NNYA 2IEKA 2F4MB 1TBXA 4ZTFA 5KW9A 3T9GA 4BEHB 2VBMA 2VBVA 1NRKA 4OZYA 4OU0A 3OR1C 4UUSB 3GIRA 1MD0A 2ZO4A 4CCKA 2ISZA 1G6NA 1CF7A 2KKOA 5CKTA 3JRBA 2IOUG 3B4NA 2L9SA 2F5DA 1DGWY 3OOCA 4E7HA 3IHUA 2GBYA 2ZZEA 2O3FA 3DKYA 2HVSA 4RLFA 3HOUJ 2G7HA 3QYBA 2FBHA 2DK5A 2PBIA 2WB1N 4BHCA 3FX3A 1SKYB 1XD7A 1KGSA 4A12A 4BE2A 3L9FA 3PSZA 2BV3A 3BC8A 3GTKJ 2VNIA 3I4NJ 2A3SA 3WGHA 1KK2A 5THXA 4FWTA 1F20A 2P7CB 1JUSA 1BOBA 3OW2B 3BH6B 1R4MB 1TYXA 3HSEA 3DPUA 4KFCA 3KP2A 3OZWA 3LSKA 3E0JB 4XLPF 4LG0A 2BV6A 1AKHB 4EJWA 5IYPA 4AYBA 4ENKA 4ON0A 1UAAA 2GM4A 2M2EA 4WXHA 2QA4I 2C78A 1YW8A 4EM0B 3I56B 1RQPA 1JJ8C 2KRHA 4BYYA 1M1KD 1H9TA 1TWCJ 4F3QA 1DU0A 3BTJA 1FYMA 1D8JA 2R5ZB 1OKRA 3I55B 1XC5A 4HLXA 3OKXA 3H5AA 1R1UA 4YC5A 2CQNA 3OYGA 4G7XA 2K9QA 4OOIA 2XROA 3GZNB 1K78A 1W4MA 4G9YA 1EH6A 2ZNYA 2ZZQA 4L18B 4RD4A 1LB2A 4RBOA 2CQ7A 2CS3A 4HBLA 1QGAA 2OK8A 3AG4H 6PAXA 3BR3A 4XR6A 2ZXIA 2J7KA 1U78A 3K9TA 2IXSA 4HX7A 4IL6C 1VBLA 4MIMA 5IYBJ 3Q3AA 4KISA 4TMWA 5TY0A 1E79A 1FOWA 5DD4A 4E7IA 3HKZA 4B09A 1UMKA 4MYUA 4G1BA 3ASRA 4YALA 5FO1A 2XRNA 5C4XJ 1R5HA 2F43A 3OP1A 2DPUA 4XOPA 4DK1A 2LD5A 2D45A 4LJZF 1RR8C 4N0BA 2L9NA 1Z21A 2DBBA 2UXNA 4YDTA 4ZDOA 4M2LA 2JSPA 4RM0A 2Z99A 3ECOA 3DWLE 3ABTA 4L8JA 2R7XA 3FXRA 3T0YA 3RPUD 5FKNA 1FIPA 5ILUA 3I55I 3W2EA 4Q48A 3FHZA 1D2EA 5DS9A 1N05A 2MBFA 1E2XA 4B3AA 5DYMA 3IAM2 3W3CA 1BHEA 2J5PA 2P8TA 3IP4B 4XL9A 3S3MA 4BH9A 3RYRA 4CHUA 4Y4RA 4CICA 1QFZA 1ZHFA 1W34A 4ABZA 3R61A 1ZRDA 1PLUA 1I8DA 4E7LA 1T95A 4IZZA 2LBFA 3GMEA 2DQRA 2HCJB 3SUCA 4YIFA 1IN7A 3MWMA 1YHQB 1IN4A 4A6EA 2GZWA 4RD2A 3W2GA 4RD6A 3FK7A 4A3EJ 1UZCA 2E2HJ 2ETHA 4N4NB 3WTUC 2L7FP 3F8CA 4Y13A 4W8QA 1DBGA 4H9GA 2XAQA 3K1NA 1SM4A 3WTWC 5ICCA 5IP6A 4DGWB 3FY3A 2P6SA 2Z2SB 1OCRH 4QWQA 4RS8A 5IP9J 3S3NA 2XRLA 1LE8A 2KIMA 3M9AA 2DCUA 3L2UA 3LO8A 1H42A 1MSFC 5F6FA 3TGNA 1U9OA 1WQ2A 3RIRA 1SMTA 1P4MA 3MHPA 4LBVA 1YHQI 3J81Z 2OV7A 5JLVC 2E2IJ 3G6EB 3FPPA 3FM3A 1WOOA 3WGIA 1QUFA 4HSRA 3CW2A 1T6ZA 1VQ5B 2ELKA 4BXUA 2DPDA 3ZSCA 2ZSIB 1IG7A 4A3KJ 4IEJA 5HS8A 5C44J 4LITA 4DW6A 2JRMA 4Y9UA 2Z1DA 3FBIB 2UV1A 1RC9A 2K4JA 2VJIA 1ETWA 4AIKA 3GUDA 2V6EA 1M90D 2IJLA 2LF7A 1K6OA 2E1NA 1DUXC 4QVJA 5EYRA 4IX7A 1D5VA 1WJFA 4ESJA 4A3MJ 2DDBA 1ETQA 3OMYA 3R60A 1W5TA 5TJJA 3L2WA 2VUMJ 3GTJJ 4UZUA 2QEXB 4HWVA 1HDPA 1Q1HA 2JJ2A 3TEDA 2V7UA 5JMCB 1BLIA 2IRFG 5CVRA 1NBMA 1VQKB 2QBYB 4FCYA 1A6QA 3BG7A 1RQRA 2B63J 4MLOA 1OQYA 3KE2A 5L46A 2YX4A 1QRCA 1VHEA 1VQNB 4TV7A 1E3PA 3U6KA 3PVDA 1JTAA 5ICFA 5L3DA 1UD5A 1B4AA 4XRSG 2BW3B 3CUOA 5IT3A 3RCOA 3KEQA 3CLOA 4PMHA 3SZPA 3K7AJ 3VFZA 3OFNA 5J3LA 3ZMVA 3ASPA 3CMMA 1HG8A 2M34A 3ZPNA 3B6AA 3BCFA 3QFTA 1UCRA 4A6DA 2QTZA 2OTLI 3RDIA 1VLYA 4G12A 5KCMA 1F36A 4QV2A 2F4OB 2V7XA 1CQXA 3DBHB 4QSHA 1FPQA 1JGGA 3SJMA 5GP9A 1Z6RA 1V5EA 2J8KA 1B8IA 2VC1A 1FMWA 2RREA 3CMAI 4I6ZA 2BXZA 2QCOA 4R79A 3FK6A 4BPRA 5LHIA 1T38A 1EF4A 2DYIA 2BEOA 1P9QC 3JQQA 4HQEA 1O8LA 2M9HA 2RKHA 5AIQA 4W1UA 1R7JA 2BZTA 5HZBA 4GRIA 2OZ6A 1UD8A 4NDLA 2CG4A 4XN3A 5E3LA 2M87A 2GIZA 3QPSA 4EJOA 2OF7A 2BF4A 3VNUA 2YWEA 3HPHA 2HOSA 3SDBA 2Q6LA 3OJXA 3HIFA 1YOVB 4DQKA 2RGVA 1N0UA 2VQCA 1I6XA 9ANTA 3VMVA 3D1NI 4ZV4A 4N3NA 2IA0A 4B1RA 1CF7B 5F4OA 1DGRM 1PJ7A 1J5YA 1JT0A 2X1DA 1SVMA 1EH8A 3LSIA 3NQOA 1XX5A 2HFHA 5DCMB 3ZQHA 2W7NA 3OW7A 2XTYA 5EJCA 2DA1A 2BMWA 3QOPA 2GK6A 2MH2A 3H92A 2ZBVA 4YEJA 5HS7A 5J4YA 1J7KA 3KZIC 1R9TJ 1HKSA 2V7FA 5F0CA 4I7HA 4A5MA 3HOYJ 1HXDA 2H6CA 3ISXA 4G6DA 3O2PE 2FSWA 1E1RA 4Y15A 4EJTA 2RQQA 2M5WA 4IQ4A 2EV6A 3SJZA 2JA2A 4Q7JB 3U1KA 1YYVA 3HRSA 2JJ1A 1KYZA 2OJED 2ZNZA 4EMSA 5KNLA 1PDNC 2GJPA 4PC7A 5EZHA 2K86A 1AIRA 1NHCA 2ID3A 1W36D 2X6OA 2CMPA 2JUCA 4DBRA 3JRGA 1UD4A 3V8LA 2VBWA 2QBYA 3F8BA 5BSYA 3SZEA 2GIVA 4KIGA 1WKMA 4NC7A 1H89C 5D4RA 1ON1A 2H6BA 5KK1A 1IV6A 1JJ2B 4RM3A 2D9RA 1E62A 3MKYB 4L9JA 4CXFA 3OYKA 3OYFA 3S2HJ 4PC6A 3ASOH 3JU4A 1SEUA 2ELJA 1N0VC 4BQQA 2R92J 3HRUA 2QX3A 2HYJA 4A3JJ 5L3CA 2W82A 4ENMA 3DF8A 1GVHA 2OC6A 2EA2A 3LWFA 1WRJA 1SANA 3VMWA 4A93J 2WAFA 1KQSB 3J80Z 1SKQA 3MZHA 1MW7A 2OTLB 4XRMA 2CJJA 2Z3YA 4X1EA 1EFTA 2CQQA 1ETOA 3EQNA 1D8TA 3ZCOA 1JJ6C 1FWZA 3KLNA 4PJMA 2YWHA 1WSRA 3RQ4A 4DYQA 4XKBA 4P3YA 2F5FA 4IKFA 3KP5A 2CFOA 1LE8B 4BXFA 1YJ9B 3BG6A 1FJLA 3MN2A 2O03A 3QYFA 1HKTA 4OJ6A 1YI2B 1FT9A 3K4KA 1R36A 3A03A 1YJNI 1BQEA 2BVNA 4JMQA 1RI7A 4GXOA 4UAJA 3WE2A 1QU3A 3SKBA 2X1EA 3ZN0A 1IB0A 2KP6A 2LKXA 2B7EA 2IGKA 2XGXA 4OAYA 1D0XA 1QVGB 3TMOA 1XPXA 1Q82D 2QQ9A 5GPAA 2CV1A 2E1OA 3VMFA 4C2UA 2K5CA 1X2MA 4BJ5C 1Z6TA 2DQLA 2KT0A 1SD5A 3QU3A 3TKYA 3GQBA 4LGWA 1VI0A 3WXMA 1K28D 1UD2A 4NC6A 1VQLI 1O3RA 5FO0A 2Y48A 3RPUA 3IRRA 3DQVC 5E3MA 4KMFA 1KD1D 1TT0A 2VQHA 3OL3A 3H9QA 2RN7A 3SYJA 1YJWB 3VB2A 2XC7A 4CCLA 1XFOA 4LG0B 1X4OA 3HOXJ 5BQTA 1YJ9I 3MCAA 3GTQJ 4L9VA 2R7ZJ 1S29A 5EEGA 3IV5A 1K4TA 3OZUA 4W8RA 3UW0A 3D5RC 4E7KA 2B7CA 3DFGA 3PUFA 1KQ0A 5BS6A 1MBKA 4P12A 4TMZA 1XMXA 4YZAA 3SJPA 2Z8GA 2IGOA 4XONA 1VQPB 4BHPA 2GOMA 1QFJA 1VQ5I 1V55H 1D1NA 5HDNA 2C77A 5HDGA 5K5RA 1FY7A 1GAQA 3SQVA 4AIHA 5J8FA 5TRDA 1S4MA 4BDZA 1TNTA 4BGDA 1NK3P 5KAIC 3AVTA 4EATA 1RKWA 3M3YJ 2KQRA 1GO2A 2BY2A 2AS5F 5LGUA 3LL7A 3HPGA 3PQKA 4J01A 4QPOA 4ZJZA 4RMNA 3W5HA 4LK0F 3DEUA 3G4SB 2A07F 4FE4A 4TMTA 3R0AA 1TYWA 2FOWA 2HQAA 1FP1D 4IQJA 1VQ4B 2BY3A 3DCFA 4PJ0C 4I01A 1W7PA 3L2RA 4YG2F 1D1AA 1ULYA 3ERMA 5HLGA 1ODDA 4A0YA 1RWRA 5DD8A 2B9SA 4L5IA 3DP7A 3E1SA 2Y9YA 3CUQA 1OB5A 3KFWX 2DO7A 2MYSA 3W2AA 3EUHC 2L2OA 1HLVA 3O8GA 3CCSI 1GJRA 4RD1A 4M72A 3CF2A 2JVGA 2WJVA 1OCTC 3IAS2 3HOSA 4RB2C 1U5TC 3CF5F 5K5QA 1GR1A 3CZ6A 3Q9VA 1TSPA 3BR0A 1T2KA 2J5OA 2GWRA 3VSLA 3F72A 3SXYA 3SZTA 4DBQA 4AYBN 1YITI 2EZLA 4KT6A 2OBSA 3JQPA 2XZOA 2NS8A 2I10A 4PC2A 2DDAA 4URRA 1HQCA 3I64A 4NUBA 1BL0A 1W0TA 3CTAA 2C2WA 1UMQA 4J0QA 1KU9A 3IWFA 2BM7A 3DLLF 1H0MA 4HF2A 1R5BA 1W87A 3WNDA 2Y31A 4AVPA 1VQMI 2EV0A 1EA3A 2HI3A 5EDNA 1DU6A 1XB4A 4Y33A 4M6VA 1ZLKA 1IRGA 2XC1A 2C5HA 2EV5A 1JGSA 1X0CA 2QZAA 1B9NA 2V6CA 2LREA 2WY7Q 2NOJB 4PJJA 3WNBA 4X06A 2DCEA 1NG7A 4N9HA 2VBZA 5DM6F 3IKVA 4C43A 1ON2A 4X6AJ 2E60A 5E1XA 3HSRA 1B23P 1W9XA 1KU2A 2FU4A 3KP7A 1NB0A 1I3AA 1WJ5A 3LSTA 4PGGA 4WZLA 1W5CC 1PYVA 4LC0A 4IHWA 3WTSC 4HYEA 4RGRA 1OB0A 4OJ5A 4E70A 5ICGA 1UJ8A 4HLYA 2G7UA 5KVRA 1PP7U 3VWBA 1F43A 2NS0A 3SFZA 2OCCH 5J4VA 3EUKL 1TYUA 4H0EA 1R1VA 3TO9A 3CJRB 1XS9A 3MZ8A 1SFOJ 1DPRA 4HNUA 1JKRC 4ZGQB 2HPMA 1XGOA 1XMAA 2ECCA 3LMMA 2HTSA 1QBJA 4CGZA 3HJEA 1J09A 1YW7A 2HXIA 3ZP5A 2ECBA 1B9MA 1S0UA 5F4MA 1EKEA 1G59A 2BY1A 3GQ8A 4NNJA 1R1TA 1OISA 3F6VA 4KYWA 4Y9RA 3W5UA 2XF7A 4IW3B 3QFCA 4A3LJ 2PG4A 3RKYA 2JA5J 4DNCA 2O0VA 3CC2I 1ETYA 3SFIA 2BXYA 5D8LB 3FXUA 1W5SA 3H94A 3J81K 4KKUA 1WFXA 2QF7A 4OINF 1PJ5A 2F4NA 2GK7A 3ES9A 1IJFA 4HZFA 3REOA 1OFMA 1VQOB 1IRZA 3GQAA 3ONYA 2YS9A 1N77A 2IVMA 1T08B 2CC2A 2W6IA 5J3OA 1UFMA 3C2BA 3JW4A 4P55A 1ITYA 2HZDA 3A8KA 4P5OA 5L3FA 1TZLA 1MMSA 2XNJA 1ZM3A 1HW2A 2VFNA 2FE3A 1YX2A 2DK8A 4LFUA 3OOPA 2ADUA 2M8EA 1YLOA 4OOXA 4ROXA 3F9KA 1QNTA 1OYWA 2MSYA 3PNTA 3OYLA 2VKDA 3E3VA 1T0FC 1YI2I 3NE5B 5CVIA 1MBJA 3BZ6A 1H80A 3CO6C 5DV5A 1JA0A 3WU1B 2M45A 2VXDA 2HQ5A 3A0HC 3I9V2 3X2QH 3CP8A 4CA0A 1W0UA 5FKMA 1MKMA 1EP1B 1KK3A 3AGPA 1K61A 1OOCA 3TW6A 5E8GA 1X1CA 1G7TA 3ZGKA 5DN6A 4OMZA 5IT9Z 4QUZA 3V7AA 3BP8A 2K3FA 2L54A 3G3ZA 3WG9A 4WCGA 3COAC 2VPRA 3FXKA 4MXNA 3LJYA 5AIPA 2VBXA 2LOOA 5BSXA 4UB8C 2BBYA 2NVXJ 1U0JA 2LC2A 3QWLA 2EILH 4F7DA 5A2QZ 1R5OA 3G1MA 4P9UA 2NZMA 2DODA 4FX4A 5LMZA 2C4TA 3E97A 4C30A 4P9SA 4RD0A 4Z05A 3RIQA 2HS5A 1Z1DA 4TN1A 2X51A 1VQLB 4XLHA 3BR1A 4FQGA 3M7GA 4C3IJ 1COWA 1POGA 3JREA 1PXZA 1VQ7B 1MGTA 4PUSA 1MJAA 2K27A 4A3DJ 2PMUA 1Y6IA 4YAOA 4EW9A 2MC4A 3HUGA 1ERDA 2B7BA 2CSOA 5IYCJ 1F60A 1OGOX 3JRFA 3CCRI 4OPSA 2ODLA 3OAAA 4BKXA 2PFBA 1IB4A 1LLWA 3E6BA 2Y0MA 2M0MA 4IRIA 3R4KA 2KHMA 3ZRGA 5J6XA 2Y30A 1VQOI 2BM6A 3WY9A 5B66C 2R5YB 3GX4X 4CCNA 2LY2A 4HF1A 4Y52J 3MZYA 3CC7B 1GHCA 4UXNA 2HKOA 2EIXA 2ZB9A 1IN6A 2OA4A 3CO7C 3BJOA 4PGHA 2XAJA 2Z16A 4Q5SF 4HIZA 2R7VA 1FX0A 1WTHD 2NYXA 1GUUA 3S3OA 2PECA 3ZQCA 1G3SA 3O6BB 1OCPA 2HLDA 3K4NA 4HAMA 3N90A 4OPWA 1D3YA 1PJRA 2ZXWH 3GVLA 2NSPA 1GV5A 3HYIA 1HA3A 1U2WA 1I1SA 5J35A 4OOSA 2V31A 2Y9ZA 3TO6A 2JPCA 2FXAA 1ZKGA 1G7SA 4YFOA 3ML3A 1UD6A 2V1XA 3GFMA 2W4SA 4JP0A 2M4GA 3ZBTA 1LNWA 4P26A 1APLC 2W00A 3HAGA 3PUMA 2XGDA 3HUGB 4LK1F 2XDVA 3CC7I 1OB2A 2NTQA 2IS1A 1I7PA 2BM4A 2L7KA 2DT5A 2VBUA 4RDLA 5IK2A 1LFUP 2A61A 2XV4S 3G1LA 2XEXA 5M3MJ 1WJDA 2LF8A 4PK4A 1YRNA 1TLLA 2XB5A 5BPDA 3AG2H 1IJEA 3DEEA 2MD0A 3GLXA 1XDSA 2E5ZA 2RNJA 3K4BA 4Y17A 2R7SA 3K4LA 1BJKA 2DMUA 3J7AY 1EE6A 1BJAA 3MD2A 4TT3A 3DEWA 4KKTA 1Z7UA 1BPLA 1BIBA 1JKOC 2ZMEB 3QFSA 5J47A 3SLNA 4BBSJ 1WJAA 3FKSA 2OU2A 3JTGA 3K70C 3BY1A 1OYYA 4NQWB 2XAGA 3V7CA 2UVEA 4LD5A 4DNRB 4M3GA 5ICEA 3J7YJ 4IO9F 3QPTA 3OYIA 1Y1VJ 2ELHA 1MNEA 5E3OA 2VE8A 3CCLI 2EZHA 3ZQLA 3ASSA 4Z6YA 2BX6A 5GTIC 1KQ9A 3MKWB 4HSTA 3CB4A 3TQNA 2BVMA 2ISYA 1FEXA 2WV0A 3BTLA 1UD3A 2QUFA 4RA2A 4D0PA 4ENJA 4GDFA 2XZPA 5EZGA 5LGTA 4X8IA 3VYTB 4WWVA 2EFWA 1VZ0A 2LVSA 3NAUA 2R4GA 4I76A 4YELA 4N9IA 4M74A 3OS1A 2EFNA 1JI8A 1O3SA 1CGPA 3B90A 3K2ZA 4BQAA 1ACIA 2X8KA 1XMKA 5IOZA 1W7PD 1KQ5A 1YS6A 2M1BA 1IRFA 1FYKA 2HWVA 1O8MA 3IWZA 1ZRFA 1Q7YD 1D5YA 3HOZJ 2O17A 2VFMA 1ZQ3P 2NT9A 1V54H 1E3HA 2IA2A 1BM9A 2L3DA 5C3EJ 4K2EA 5LD2C 4FK8A 3QODA 3PSSA 2CK3A 2JA8J 3KRGA 4B4DA 1K5CA 2XTWA 1N75A 3WTVC 2MD5A 4RD3A 2ZC2A 2D74A 1ZUNB 3VDXA 3CQZJ 3S17J 3H9JA 1J75A 4CCJA 2AHQA 3C3WA 2ME0A 4R1HA 2P0WA 3CD6B 1NG6A 1O8EA 4AVZA 3DDYA 1O8KA 3FMRA 1O88A 2FJ1A 3EYIA 3K4JA 4B43A 1QVUA 1KU7A 2RAEA 3K69A 3B6CA 2DU9A 3CJTB 1O8DA 3FXOA 3MQ0A 1FC3A 3HRTA 3OIPA 5E18F 5DDGA 3CMEB 1QGZA 1BR1A 3FISA 1RNLA 2PIAA 2VONA 3U2QA 1Y56A 2H1LA 4B3XA 2CW8A 2V79A 3LQ6A 4G5GA 1ELOA 3WGGA 1PP8F 2CW7A 2D1VA 1OLTA 2WZPP 4KT5C 4XK4A 5C4JJ 1LDDA 1IV8A 2GREA 1I39A 1KK0A 3ULQB 2ZMEA 5EEHA 1BOAA 1Z3YA 1D1BA 2OBRA 2VC0A 1ZK8A 1EV7A 4ENNA 4A0XA 2K85A 3HDDA 4BL0B 1EFCA 1K79A 2XSDC 4AD9A 3Q6RA 4P6VF 4L5JA 1PUFB 2VQLA 2VN2A 1BI3A 3W6KB 2GA2A 4U87A 4L0YB 1M1EB 2XAHA 3JQRA 4WX9A 4X7DA 3H9GA 5HXBA 2E7WA 1MH3A 5ED4A 3R6KA 3ZZTA 2P5VA 3SYTA 3NWSA 2XSJC 5AONA 4AC0A 3GTPJ 1WCMJ 2HMAA 2CYYA 3KZZA 4M9SA 3CC2B 1CQTA 1FMVA 5DEQA 5H20A 4CCOA 3GFIA 2R0QC 1X1AA 2STWA 3PJRA 2JJ7A 2QM3A 2A5WA 3KP4A 1IXRC 3HEFA 3CLQA 2R7OA 4PSXA 1SVOA 1LFPA 4RDKA 1BMFA 4XLEA 4BE1A 1IUYA 2ZTGA 1EFRA 1Q81D 1YJNB 1P4WA 1IXSB 4MTDA 2EBIA 1WU8A 3MEXA 5K7HA 3KYCB 5CQEA 2HNHA 3QQAA 4H4KC 3SHFA 3A8JA 4ZYHA 3AGQA 1VQ9I 4WQMA 1IRXA 3TL4X 4A69C 3BJ6A 4UUTA 4D5CA 5JHFA 2M7BA 1X1BA 1YIJI 1Q9SA 1QA3A 4E7SA 2PMDA 4KUMA 2P5LC 1QZEA 5DUKA 2EQRA 2EH3A 4XSXF 1D0ZA 3JRCA 3O3KA 3VOEA 1F4KA 1TL8A 5LFAA 1MSEC 4OIOF 1NDHA 2M0CA 5A88A 1R6RA 2PQ8A 3WTXC 2EJRA 4HW0A 3G05A 5JHUA 1QJVA 3U1DA 2R5YA 1UG0A 3HXLA 3BR6A 4IVNA 4YXWA 3WU2C 2XHKA 4UVBA 5B6IA 2BW3A 1XN7A 3C7JA 1RPWA 4ESFA 3AL0B 4KKSA 1GQ8A 2K9MA 1KMHA 3BQJA 3ZMZA 2DW4A 3C2GA 5D4SA 1WI9A 2LTPA 3OPOA 1L0OC 3S2DJ 5HNFA 1T98A 5B3SH 1JE8A 2H8WA 1O8JA 4GYGA 4OZZA 2EIKH 1YIOA 2IA1A 1SD6A 2GJKA 3HOTA 4J00A 1XSDA 5LRRA 1VQ9B 1EP3B 2WTEA 3N97A 4X0CA 5K7FA 1JB9A 3CESA 2HOEA 2XAUA 3A0BC 3LQQA 2ESNA 4MFDA 4G7HF 2CW0F 1Y1WJ 5C1CA 3BPVA 1K83J 5D6EA 4BE0A 1XG2A 2Q1ZB 1YX3A 3WHBA 4OJPA 1B8IB 4EGZA 1QFYA 2JSCA 1VQ6B 1LDJA 5FO5A 4UY8I 3CUQB 1VQNI 4EVIA 4G7OF 3GFLA 1FBSA 4XLNF 4CSWA 5D5WB 1RESA 2Z33A 2INUA 4XQFA 3KPHA 2MGQA 3E5QA 3GSIA 3WBKA 5FLMJ 4YZ0A 3PFIA 4JK1X 1R23A 1IDYA 2VBEA 3EDPA 4RAFA 3S15J 3H3UA 2O6GE 3MMPA 1O4XA 2PYGA 5H2FC 4P22A 2COBA 1TWFJ 5D6FA 4KIBA 1N8RD 1X58A 2K7LA 3S8PA 1HBXG 1G3TA 5B5EC 1ORKA 3EPZA 2AQFA 1YO5C 1Y0UA 1QQ1A 2QY1A 2CH0A 2O0WA 1JA1A 4MNUA 1BIAA 3H3VK 2M7AA 3WQZA 2QSFX 2LDUA 2HZTA 3DKWA 2P4WA 4RDUA 2FMLA 3FKIJ 4V2FA 3A01A 4ESBA 3BQYA 1NK2P 3GRHA 2P81A 2BHZA 2JPBA 2HDWA 3P5JA 2MLGA 2FUG2 1GVJA 3FM5A 2K4BA 3W5VA 3CJNA 4KITB 5EG0A 1ETXA 3CCSB 2HOAA 3LSJA 3AFHA 2ZBUA 2XASA 2XT2A 4EEFG 1ZG3A 2CQKA 5TISC 2QMUA 1XGSA 2V5IA 1Z91A 4GGGA 4MEYF 4HQMA 4HE5A 1FSEA 3M1EA 3GCMA 1OFEA 1FNBA 1SFUA 3N05A 2WSSA 1OYIA 3KLOA 4AC9A 1YLFA 3F8MA 4NHJA 4KMUX 4PFOA 1AWCA 2B0RA 2DMPA 3BNWA 3SZGA 4ZZLA 4BXXJ 1J0RA 1USSA 4Z06A 1VLOA 1IDKA 1TT5B 2JWTA 1X1DA 1WSVA 1IUFA 4WWCA 1WSUA 2Q2EB 1BI1A 1S6LA 1SD7A 1XCVA 1UELB 3DKXA 3GZ6A 4F7ZA 3HB9A 2FQ4A 1FTTA 4E7ZA 4CDGA 2FVGA 1OCCH 4M9XA 2K40A 4D7MA 1KZLA 3R6JA 2RDPA 4G6QA 1ZGAA 2JTVA 1PJ6A 4M3FA 3GXOA 3S1MJ 2X85A 1O8GA 5KSWB 1TYVA 1WPKA 1G7RA 2YUHA 4HF0A 3HOVJ 4MQ9F 1PE9A 1VJSA 4B44A 4Z4TA 4HNVA 5EG0B 4C9YA 2ID6A 2KDOA 2DFFA 4LLGF 1ZAOA 4ETSA 4UZEA 1Q86D 2K3PA 2DN0A 4I2OA 4M4SA 3BTIA 2ZJPF 4BQNA 1FOKA 5GPCA 3ZPLA 4DQ2A 4NB5A 2PLYA 1DG1G 2PMHA 3LVBA 4F92B 1D1CA 2Y0SA 3A1YA 4MQVA 5FFXA 5H6RA 5FROA 1VQKI 1XE1A 1P4AA 4C2MJ 4YZXA 2GA1A 4EM1A 2PI0A 2O6WA 2QQ8A 3LA7A 4U7DA 4OMYA 1C0WA 4UVCA 5CJ9A 1FNMA 2BYVE 3SEZA 2HEOA 2JN9A 2V7VA 2R5ZA 3IH3A 2Q0OA 2CGPA 1N78A 4FETA 2KIUA 1QO0D 3Q0UA 2W85A 3RKXA 1HKQA 4M0LA 2NXNB 2Z6BD 2HVRA 4XRFA 4YEIA 2OCEA 1SFEA 2KJCA 4BNCA 1T6SA 3T1BA 4PJLA 2DFEA 3HHHA 2GAUA 1WORA 3JRAA 2LSOA 4XSZF 5EEAA 4YIRX 2BM1A 2WV1A 2BY0A 2ZJQF 2JIZA 1FDRA 3Q9SA 4BAYA 3DPTA 3FIWA 3H9NA 3LNQA 3I1FA 2DA2A 2MH9A 4WF2A 2VFQA 3BT9A 3HHGA 1MBHA 3I58A 4P96A 2N8GA 1UG2A 3OYEA 4ZYEA 4Q47A 3ZQFA 1IN5A 2FNPA 4C3JJ 1S72B 3I56I 2WAEA 1HOMA 2XUBA 5CQGA 2LYCA 2D3LA 2OQGA 3VR6A 3OOUA 3RI4A 5HODA 3ZQIA 4BEHA 5F0FA 3TOAA 2KPMA 2WZNA 3DBRB 4UUVA 3DU1X 2XF5A 3FZVA 2R7QA 1VFCA 2NNNA 3TDZC 2JA7J 1VNDA 2DOAA 5HLIA 5L3BA 1T5EA 3SEJA 3U6BA 1IW7F 2PLFA 2UZKA 3Q38A 4R71A 3MCZA 2R7WA 4XNFA 2WPDA 3ZMUA 1F5TA 4NK6A 1HC8A 1EH7A 2W7ZA 1BI2A 1OFDA 2IS2A 2MA3A 5FB2A 2FQ3A 3QSYA 3H1CA 2RNGA 2BN4A 2O61A 4U9UA 3MKZA 1IXCA 2MG4A 4O6JA 3I3LA 4I0BA 5HVQC 1ZN2A 3ESWB 2V9KA 1Y39A 1BC8C 3PA2A 1N08A 5J8CA 1OHHA 1R49A 1JXSA 3J80K 3GEZA 3ZMDA 3FXQA 3CDIA 1VQPI 3UR3C 1BR2A 3VYRB 3CCQI 2NS7A 4XLFA 1FBQA 2Y2ZA 3FMQA 3IH2A 4HDUA 2HDDA 4LLNA 1WOPA 1VF7A 5CVUA 5FKKA 1FNNA 3OWTA 1KU3A 2XKOA 1N06A 2MC3A 4V2GA 1Z3XA 2OQRA 1GAWA 1TP4A 1X3ZB 4PDKA 3IUOA 4XLCA 2KIFA 3PO2J 1Z0XA 1TWGJ 3S2WA 1P92A 1V3FA 3MVPA 4DJAA 1A36A 3W6VA 4RPBA 4Z4UA 3CCVB 2CV0A 2MW8A 2JDIA 4RB3C 3HM5A 2ZKZA 1ZG5A 2YPRA 4M6YA 1SD4A 3R0JA 3V8KA 3RQIA 3HC7A 2CU7A 2W48A 1KTVA 4WK8F 1W0KA 2ZL5A 4HG2A 1VQ4I 3BZCA 3T51B 5HLTA 2CFXA 1QGPA 5IYQA 3H0GJ 3BTCA 1QH0A 4M71A 1FIAA 3E6DA 1LJ9A 2L7ZA 4CCMA 1RMGA 4I0AA 1JRGA 2R7FA 3O8HA 4XD7A 3B82A 2FOKA 3H5NA 3PNVA 2OBPA 3GZ5A 1ZM2A 2DI3A 3VPRA 4C2LA 3A2KA 3DU6A 4EJVA 3RZDJ 2LG4A 3ZR8X 1B72A 3GFJA 4W8TA 3OYHA 1U8RA 3S14J 3ZQ7A 1XDUA 1T33A 1HF2A 1A31A 3ZC3A 3PIOF 1JT6A 2H94A 3QP5A 2W84A 2PN6A 1ZELA 2DA7A 3ECHA 3F3XA 3JRDA 4L9NA 1VQ7I 3JRIA 4P6YA 1X3WB 1QA6A 2IAIA 1I50J 2NOGA 5F0HA 3VSUA 1FOXA 1TQMA 4BDYA 4JBAA 3QRFF 2X6XA 1OCZH 1SAXA 2F2EA 3BCAA 4PAAA 2BM0A 3ZMTA 1K6YA 1IDZA 2QVOA 5JFRA 3GYHX 1QHHD 4PGOA 2YX7A 1DARA 1KYWA 2HQNA 1DQUA 2R3SA 3WTYC 2BGIA 1QVFB 2R7UA 1MDMB 2E1MB 3OYNA 4ZDLA 2P7VB 3RJPA 3SDGA 3LA3A 3ZPPA 3FMSA 2X4HA 3OYDA 3GO5A 4G8XA 3B73A 2BSAA 1R58A 4BHBA 2F1MA 1S7AA 1QA2A 2VKHA 3ZQQA 2LR8A 2G0EA 3HZJA 4HA8A 3W2HA 2ZZFA 1ZGJA 2DTZA 3IRQA 2VBKA 4HOBA 2NTBA 2HYGD 3MFKA 4IOAF 2VBSA 5CVVA 3WTTC 2FD5A 3F8FA 3BLYA 1S7OA 3NAWA 3HSFA 3CUQC 4PZJA 3HOWJ 2OUMA 4RLQA 2V7TA 3B78A 1XQBA 4OOVA 3J81k 2AXTC 2BGJA 2JT1A 2VFPA 3PSFA 5A8AA 5FL7A 2QWWA 4C3HJ 3JAMK 4M3BA 1VQ8I 2QEXI 2G9WA 3LSMA 3GQ9A 3KZYA 5FJ8J 4A3FJ 3CPWB 3LFUA 1G8XA 3D0SA 2ACJA 2F5EA 4RM2A 5GAHJ 2WA0A 1ETKA 1WH5A 1KC8D 2O9LA 3G6EI 1P4XA 3GWZA 4D9JA 4ZYAA 5FLVA 1HW5A 4M73A 2DOEA 1AU7A 4II2A 2PMZN 4V02C 3V4GA 2WWYA 4XIDA 3T56B 2QKLB 3SLDA 4RLZA 2HYFA 1PKVA 3ZOBA 3OSFA 5F27A 3F8NA 5DCFA 1GLNA 1KK1A 4DQLA 5GV7A 4ZCIA 1IGNA 1MMGA 2O8XA 3LQEA 5FKOA 4HDVA 2ESHA 3IL2A 3KYDB 3GTMJ 2XT4A 4K1XA 4HPQA 4ZGNB 1O3TA 2NV4A 1O7LA 1FYLA 1VTNC 1O7FA 5JVGF 1USTA 4JOMA 5FD5A 1HVXA 2VJ4A 4B47A 4P1WA 5E1WA 2FX3A 1JHHA 1K7AA 2VNJA 5BNGA 4CQJA 2CUFA 2V9PA 2KZVA 1V5GA 3T53B 1MJBA 4I98B 4W8SA 1B2RA 1DBOA 4M1KA 2QKMB 1IC8A 1EWYA 3LSHA 2DLLA 1V5VA 2UVFA 3CDLA 3L1PA 2EZIA 1Q1VA 2QYUA 4OWRB 5M5WJ 2FMYA 2VPLA 3NWTA 2E1BA 2VT2A 4RB0A 3UKGA 2V1UA 2VB6A 1FRNA 1IN8A 1XGMA 2VOPA 1AA7A 2F5VA 3ABLH 3LFKA 1KTWA 3CCUI 3L7WA 3PUBA 4UZFA 1H8AC 4JX4A 3DTEA 2QGGA 4YIIA 4FX0A 4L5EA 2PE3A 4U88A 1P7IA 3BR2A 2CUZA 2VBYA 3I53A 4AUXA 1FTZA 2Q6IA 1DP3A 1V5FA 1TC3C 1OGJA 1OGMX 2OD5A 1W2BB 1A35A 4B3GA 5K7ZA 3D5LA 1JHFA 1I27A 1WGXA 1TQPA 1H85A 2R7RA 1TLHB 3QAHA 5DS0A 4ASUA 5LHGA 2EK5A 4F91B 2HQRA 1F9NA 1X4PA 2VKEA 4UV8A 1K4ZA 3GLLA 3PL8A 4BJ6C 5K5OA 1MBFA 5E8IA 4U7BA 5H59A 3CCEB 3VNVA 2HTJA 1AOYA 2STTA 2OTJI 4LG3A 1IJWC 5F04A 1Y8QB 4XRSA 1IA5A 1RU4A 3HGYA 2COMA 2DA3A 4ZC3A 3S1QJ 4PC1A 3CDHA 1RZ4A 1K8FA 2KLOA 2L01A 2QSGX 2VT3A 1ENHA 4BY7J 2Y69H 2NVYJ 4I84A 3VSVA 2ICWG 1A5JA 1HDDC 4Y3OA 1YIJB 1AKHA 2W57A 2XGEA 2NVTJ 2X6YA 3KETA 3PIPF 4FE7A 2E1MC 5LHHA 3FPKA 4GCVA 1T56A 2ZFUA 3H0DA 2CRVA 2QLZA 3AG3H 4ZCLA 2IGMA 1KONA 2DMQA 3DU5A 2LZJA 4DK0A 5CDFA 2DOGA 3VO1A 1GXQA 2O0YA 3IH4A 2P5KA 2QE7A 2X48A 3I59A 3VYSB 4YFKF 1LQ1A 3TOBA 2KL4A 2CBXA 3ZUGA 4Z4SA 4V19K 1IZ1A 3WWGA 3M1CA 2DEUA 2LMDA 2ZCWA 3BG5A 1WHUA 1RETA 4YFXF 5J1YA 2W6JA 3CCRB 1DABA 4MYTA 5FNZA 3WU0A 4RCZA
chains in the Genus database with same CATH topology
1WJEA 3L2QA 4C2UA 4OAZA 2BW3A 2K5CA 4BJ5C 2WADA 3AL0B 4KKSA 1GQ8A 2K9MA 1KMHA 3GQBA 4LIUA 3C2GA 5HNHA 3OPOA 1K28D 5HNFA 1UD2A 2ZXHA 2DIEA 5AMVA 2DXIA 1O8JA 4OZZA 3DQVC 2XOKA 3PNYA 5TGTA 4BQOA 1TT0A 2VQHA 3OL3A 3H9QA 3H35A 3FKJA 2XC7A 4CCLA 2GJKA 3HOTA 3JURA 1X4OA 4J00A 3DLAA 1IDJA 2WY8Q 3GBGA 4ZDPA 4QPQA 4OJLA 4PJNA 4CUGA 2IS4A 4W8RA 3D5RC 4E7KA 3UW0A 3CESA 4ZTJA 3FHNA 2XAUA 4YZAA 3EUAA 2IGOA 2Z8GA 5C1CA 5C1EA 4XONA 1W36C 4BE0A 2XZLA 4E0FA 2D3NA 1XG2A 2GOMA 2Q1ZB 1YX3A 2XF6A 4OJPA 5CPRB 4FASD 3W2WA 4C2TA 2NT6A 3W2VA 4CSWA 1O8FA 2L5QA 4NC8A 4U49A 3OR2C 2INUA 4XQFA 2CUJA 4BDZA 4YZ0A 4BGDA 4PSWA 1D0YA 3HG9A 2VBEA 3BCBA 4EATA 2PYGA 4OJOA 1MMAA 2KQRA 4P22A 3GVKA 2V7QA 2VL8A 3S8PA 2VLAA 2JVHA 2VASA 3HPGA 3LL7A 4F55A 4QPOA 4ZJZA 3EPZA 4RMNA 4J01A 2AQFA 3FBNB 3RSNA 3S93A 4G6IA 1SFKA 3K4MA 1HZEA 2X1CA 2QY1A 2HQAA 2CH0A 2ZSHB 2M3AA 4IQJA 2O0WA 3GQ7A 3K10A 3KEYA 2M7AA 3BCDA 3WQZA 3L2RA 4TKOB 3GRHA 1D1AA 2F4IA 3V42A 2HDWA 4G6TB 1RWRA 2FUG2 3G2BA 3HL2A 3E1SA 3SEQA 2MYSA 4KITB 2WBMA 3EUHC 3W2AA 2L2OA 1Z7LA 1V0FA 2IGNA 3AFHA 1QHGA 2W1OA 3CF2A 2LRDA 2JVGA 2WJVA 4B3FX 3IAS2 4YRVA 3HOSA 3LSGA 4ANJA 3OYJA 1E1QA 3OE7A 4LIVA 3CZ6A 2V4JC 4G7WA 4BUPA 3CJQB 3DTIA 3OEHA 4F93B 3N05A 3VSLA 2WSSA 4DBQA 2XZOA 2M4KA 3C2HA 4KT6A 4PFOA 2LY1A 1O8HA 2V26A 3SZGA 4Z03A 4Z06A 4URRA 1WMRA 4NUBA 1IDKA 2O5RA 4BU2A 3BC9A 3K4CA 4AU7A 2JUGA 1X1DA 4XORA 2XGJA 1H8HA 2Q2EB 1UELB 3DKXA 1EA3A 2X3HA 4E7ZA 4Y33A 2QXZA 1KZLA 1YE9A 4XKCA 3LNNA 3SUCA 1X0CA 2IQ7A 2GOXB 2WY7Q 4XLAA 2LREA 4PJJA 2MFZA 2E5NA 2NOJB 1V0EA 2DCEA 4GQNA 2ZZGA 2X85A 1O8GA 1NG7A 3OYBA 1WPCA 3PSIA 4E4HA 1PE9A 2E60A 1VJSA 4B44A 1W9XA 4C9YA 1WJ5A 2O1DA 2KDOA 4NK8A 4TSFA 5HKKA 1PYVA 2K3PA 5FRNA 2V4DA 3VYUB 1OB0A 4BQNA 4OJ5A 1MNDA 2IS6A 3A3GA 4XN0A 2VJJA 4II3A 3TBIA 1D1CA 2Y0SA 3A1YA 4F92B 3VWBA 4E7JA 5FROA 4DIQA 4YZXA 4XM3A 3OIQA 3EUKL 2DJIA 3CJRB 2MABA 1MABA 4HNUA 3ZXSA 2HPMA 4ZTFA 4HNTA 2R9VA 3T9GA 4BEHB 2INVA 2VBMA 3B8YA 3SEZA 3LMMA 4OZYA 3OR1C 1J09A 4CCKA 5HOOA 1N78A 4FETA 5CKTA 3B4NA 2L9SA 1DGWY 2VJ5A 3OOCA 3QYEA 4E7HA 1G59A 2NSTA 3GQ8A 2ZZEA 4NNJA 1SAUA 3DKYA 4RLFA 4B48A 2HVSA 2XNDA 2Z6BD 3QYBA 1SKYB 3KYLA 2BSPA 2HVRA 2PJRA 2XF7A 3AKZA 4BE2A 3BC8A 4BACA 1WJCA 4PJLA 2O0VA 1WJBA 1BOBA 1E3XA 3DTKA 3H94A 2JIZA 3EQOA 4KKUA 1WFXA 3DPTA 3DPUA 2GK7A 4JQFA 1OFMA 3D5SC 3LSKA 3E0JB 3GQAA 1N77A 3OYEA 4AYBA 4E6KG 2W6IA 1UAAA 2KVOA 2WAEA 5CQGA 2LYCA 2D3LA 3VR6A 2HZDA 3OOUA 4P5OA 2KRHA 1TZLA 4BEHA 1E0EA 2GJRA 4YZQA 2KPMA 4F3QA 3ZIAA 2XF5A 2ZTNA 2R7QA 1CZFA 2UUZA 3H5AA 3U21A 2DOAA 3F9KA 3PNTA 1T5EA 3NE5B 3OYLA 2VKDA 3OYGA 1T0FC 4G7XA 2R7WA 4XNFA 2ZZQA 2WPDA 1H80A 2R7TA 4NK6A 2NTPA 2CS3A 2VXDA 3I9V2 4CA0A 3CP8A 3OYCA 3L2VA 2IS2A 4XR6A 1OOCA 2ZXIA 1X1CA 5DN6A 3ZGKA 4X0GA 2RNGA 3MKZA 2IXSA 3I3LA 3S32A 5HVQC 1VBLA 2V9KA 4MXNA 4KISA 1OHHA 1E79A 2LOOA 3UNGC 3HKZA 4E7IA 1U0JA 2LC2A 3UR3C 1BR2A 1MMDA 3VYRB 2NZMA 4XLFA 2F43A 4C30A 4XOPA 1VF7A 1W0JA 4DK1A 4Z05A 2EWEA 3OWTA 2X51A 2L9NA 4XLHA 1Z3XA 1Z21A 4ZDOA 1COWA 2JSPA 3H5RA 3IUOA 4XLCA 1PXZA 3DWLE 4L8JA 2R7XA 5FRMA 4PUSA 4DJAA 1O8IA 3RPUD 2HU9A 1Y6IA 2CV0A 4XKWA 2JDIA 4EW9A 1BR4A 2MC4A 2V1NA 1ERDA 1OGOX 2ODLA 2X6WA 3OS0A 3IAM2 3W3CA 3OAAA 1BHEA 3OL4A 3HC7A 2CV2A 3IP4B 1W0KA 2M0MA 4XL9A 4HG2A 3S3MA 1LKXA 4Y4RA 2KHMA 3ZRGA 3CP2A 5HLTA 3T51B 4DNTB 3VSTA 1PLUA 2K9LA 1I8DA 3A35A 4E7LA 3KX2A 1T95A 4CCMA 2LBFA 2LY2A 4CCNA 3M8JA 4IZZA 1RMGA 1JRGA 4XD7A 3H5NA 2DT6A 3PNVA 4C2LA 3A2KA 3DU6A 2WJYA 2LG4A 3ZR8X 4W8TA 2Z16A 4HIZA 2R7VA 1FX0A 1WTHD 3OYHA 3S3OA 4N4NB 2PECA 2UWMA 4W8QA 2HLDA 1DBGA 3K4NA 3FDYA 1ZELA 1PJRA 4PFPA 3GVLA 2NSPA 2V31A 4DGWB 3FY3A 3VSUA 2Z2SB 3S3NA 4BDYA 2X6XA 1UD6A 3BCAA 3L2UA 3K70D 2W4SA 1K6YA 1X19A 1LVKA 2M4GA 1QHHD 1LDKB 2W00A 4CZCA 3HAGA 2LBFB 3HUGB 1DQUA 2XDVA 2OV7A 2R7UA 2E1MB 3OYNA 3FPPA 4ZDLA 2NTQA 4HSRA 2IS1A 3QOEA 2L7KA 5IK2A 3ZPPA 3ZSCA 2ZSIB 3OYDA 3OY9A 1WJDA 4PK4A 4LITA 3OS2A 2Z1DA 2UV1A 3FBIB 2F1MA 3DEEA 2MD0A 2VJIA 2V6EA 2VKHA 1BN8A 2E5ZA 3K4BA 3ZQQA 1MMNA 2R7SA 3K4LA 2ZZFA 4IX7A 3J7AY 1HA8A 2VBKA 1WJFA 2NTBA 1EE6A 1NRKA 3L2WA 3OMYA 3MD2A 4TT3A 4HWVA 4KKTA 4UZUA 4HRIA 3BLYA 1BPLA 2JJ2A 2LH9A 1WJAA 3FKSA 2OUMA 3K70C 1S9HA 4RLQA 4NQWB 1BLIA 5KHDA 2UVEA 3PSFA 1NBMA 5FL7A 4DNRB 3VSKA 1OR7C 3BG7A 3OYIA 1MNEA 4KJZA 3LSMA 4MLOA 3GQ9A 3PFYA 1JTAA 1IB4A 1OFLA 3MKWB 1UD5A 4HSTA 3LFUA 1G8XA 2BW3B 2BVMA 4RM2A 3RCOA 1UD3A 2WA0A 4PMHA 2XZPA 3OFNA 3VYTB 3OEEA 4D9JA 1VZ0A 4ZYAA 3CMMA 2R4GA 2VQGA 4ITVA 4YELA 3OS1A 1JI8A 3ZPNA 4II2A 1HG8A 3BCFA 3B90A 2X8KA 3T56B 2QKLB 1VLYA 5KCMA 1PKVA 2X53S 1O8MA 2WAQA 1V5EA 1FMWA 1GLNA 2RREA 2O17A 2NT9A 1MMGA 4R79A 1KCCA 3GVJA 2HPIA 1YX5A 2AQEA 3K6GA 4CH7A 5LD2C 3QODA 2CK3A 1P9QC 4XMYA 1O8LA 4HPQA 3KRGA 1K5CA 1N75A 3A4CA 3DPLC 1WP6A 4GRIA 1UD8A 1KCDA 4JOMA 1HVXA 3VDXA 2VJ4A 4B47A 3H9JA 4P1WA 4XN3A 4CCJA 2WB1A 2HVQA 2P0WA 1NG6A 3HPHA 3SDBA 2KZVA 1V5GA 3T53B 4MR0A 1O8EA 4W8SA 4AVZA 3DDYA 2VQCA 1O8KA 3VMVA 1DBOA 3KEWA 1O88A 2QKMB 1E3ZA 2M5SA 3LSHA 3K4JA 2UVFA 1DGRM 4B43A 2X1DA 4OWRB 3LSIA 1O8DA 2VPLA 3NWTA 2E1BA 2W7NA 3OIPA 3AL0C 3OW7A 2GK6A 2VB6A 1BR1A 4YEJA 1Y56A 4B3XA 1AA7A 2F5VA 2CW8A 2I8DA 2V7FA 1KTWA 3PUBA 1E1RA 2DT7B 2CW7A 2RQQA 1OLTA 2WZPP 4IQ4A 2BVLA 2JA2A 3DTEA 4N4OB 2JJ1A 1E43A 4FXUA 5KNLA 2GJPA 1NHCA 1AIRA 1Z3YA 1D1BA 1W36D 4DOZA 2CMPA 2CUZA 4DBRA 1UD4A 4BL0B 1DP3A 2VXZA 1V5FA 3BH4A 2KRCA 4NC7A 1OGMX 2O04A 2VQLA 4B3GA 3OYAA 3D5LA 2F6CA 2R7RA 4U87A 4RM3A 4ASUA 4F91B 3A3BA 3MKYB 4U4BA 3H9GA 1X4PA 3OYKA 3PL8A 4BJ6C 3OYFA 3SYTA 3JU4A 3NWSA 2ELJA 2XSJC 4U7BA 4BQQA 2PJRB 2QX3A 3LMWA 2W82A 4LG3A 2OC6A 1FMVA 4CCOA 1IA5A 1X1AA 1RU4A 3VMWA 4ZC3A 3PJRA 2KMUA 4XKVA 2WAFA 2A5WA 2VIXA 4HEA2 2KLOA 2R7OA 1MW7A 4PSXA 1LFPA 3EQNA 1BMFA 4XLEA 4BE1A 3ONQA 2ZTGA 1EFRA 4I84A 3ZCOA 3VSVA 4Y3OA 4F52A 2X6YA 4PJMA 2E1MC 3RQ4A 4XKBA 2ZFUA 4BJTA 5CQEA 2HNHA 4H4KC 3OYMA 4D1QA 3H0DA 4IKFA 2PYHA 2CFOA 1KONA 2IGMA 4BXFA 3BG6A 3DU5A 2LZJA 4DK0A 5CDFA 3QYFA 1IRXA 3TL4X 5JHFA 4OJ6A 3K4KA 2M7BA 1X1BA 4JMQA 1I18A 1QU3A 2QE7A 4E7SA 1QCXA 2X1EA 3VYSB 2KP6A 2PMZA 2KL4A 3RTRA 2IGKA 4XOTA 3WWGA 1D0ZA 2BOLA 4OAYA 4Z1MA 3M1CA 1D0XA 3MMYB 5LFAA 2A6TA 1R6RA 1H8EA 2W6JA 3TMOA 3G05A 4BS9A 1QJVA 1UG0A 3HXLA 2CV1A 4YXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PE9 A;  1OGO X;  4XMY A;  1O8L A;  2X6W A;  2ODL A;  3KRG A;  1GQ8 A;  1K5C A;  1BHE A;  2O1D A;  4NK8 A;  4XL9 A;  1KCD A;  3VST A;  5AMV A;  4OJ5 A;  4XN3 A;  1O8J A;  1PLU A;  4OZZ A;  4XN0 A;  2VJJ A;  1RMG A;  4YZX A;  1JRG A;  3JUR A;  4XM3 A;  4MR0 A;  1O8E A;  4W8S A;  4AVZ A;  1IDJ A;  3VMV A;  1O8K A;  1DBO A;  1O88 A;  2UVF A;  4C2L A;  4OJL A;  4W8R A;  3UW0 A;  4W8T A;  3T9G A;  3B8Y A;  1O8D A;  2INV A;  2VBM A;  4YZA A;  2Z8G A;  4OZY A;  5C1C A;  5C1E A;  4XON A;  2PEC A;  4W8Q A;  4YEJ A;  1XG2 A;  1DBG A;  3B4N A;  4OJP A;  1KTW A;  2NST A;  2NSP A;  3GQ8 A;  3FY3 A;  3VSU A;  2NT6 A;  2BSP A;  1O8F A;  2X6X A;  4U49 A;  2INU A;  4XQF A;  4YZ0 A;  1NHC A;  1AIR A;  2O0V A;  2VBE A;  2PYG A;  4OJO A;  3EQO A;  2NTQ A;  1OFM A;  1OGM X;  2O04 A;  3ZPP A;  3ZSC A;  2QY1 A;  3GQA A;  2O0W A;  3GQ7 A;  4U4B A;  1BN8 A;  2VJI A;  3GRH A;  1RWR A;  2QX3 A;  3LMW A;  4YZQ A;  2VBK A;  2NTB A;  1EE6 A;  1CZF A;  4HWV A;  1IA5 A;  1RU4 A;  3VMW A;  4XKV A;  4XNF A;  1H80 A;  4NK6 A;  2NTP A;  2UVE A;  3EQN A;  4XLE A;  4I84 A;  3VSV A;  4XR6 A;  1OOC A;  3GQ9 A;  2X6Y A;  1JTA A;  1VBL A;  1IB4 A;  1OFL A;  1O8H A;  4MXN A;  4Z03 A;  4Z06 A;  2PYH A;  4URR A;  1WMR A;  4PMH A;  1IDK A;  2NZM A;  4XOR A;  4OJ6 A;  4YEL A;  4XLF A;  1HG8 A;  3B90 A;  4XOP A;  4Z05 A;  1QCX A;  2X3H A;  2EWE A;  2QXZ A;  4XOT A;  3WWG A;  4XLH A;  3SUC A;  1X0C A;  2IQ7 A;  4XLC A;  1O8M A;  1PXZ A;  4XLA A;  1O8I A;  2O17 A;  1QJV A;  2NT9 A;  1O8G A;  2X85 A;  1KCC A;  4EW9 A;  4XKW A; 
#chains in the Genus database with same CATH topology
 3L2Q A;  5FFZ A;  2HXO A;  4WXD A;  3P4G A;  2Y75 A;  5EMN A;  3BZK A;  4FT8 A;  4UV9 A;  3T8R A;  1OFC X;  1O57 A;  1RR7 A;  4AID A;  4Z4Z A;  1ZLJ A;  4LIU A;  5JI6 A;  2F1L A;  3RY8 A;  2ZXH A;  3M8E A;  2DIE A;  2QTL A;  2HKX A;  5AMV A;  2Z9O A;  4R8H A;  4I09 A;  1BA5 A;  2XOK A;  3BY2 A;  4BQO A;  3SY2 A;  1YJW I;  5L3E A;  5IT9 K;  3CRZ A;  3H35 A;  1HST A;  3K1M A;  3FKJ A;  3N6Z A;  1MJ9 A;  2LFB A;  3V7R A;  5LLQ A;  3PET A;  1S7E A;  3DLA A;  3DBL B;  2OZU A;  3ELK A;  3GBG A;  3GF2 A;  3NEU A;  4GYI A;  4ZDP A;  5E3N A;  4OJL A;  2IS4 A;  1SC7 A;  2KDZ A;  3I59 B;  2K9N A;  1BN5 A;  3ISP A;  1KZH A;  5L3G A;  5EF6 A;  4ZTJ A;  1GDT A;  1FP2 A;  1A04 A;  1QG0 A;  4WZE A;  1HCR A;  1AHD P;  4WZK A;  4ACA A;  5C1E A;  1ONV A;  3TO7 A;  2DA4 A;  3JR9 A;  2AO9 A;  2D3N A;  3WYA A;  2XF6 A;  4E0F A;  2RC4 A;  5IPA A;  3QP6 A;  2VFO A;  2E36 A;  5FD6 A;  4XIC A;  1N25 A;  3CPX A;  3ZZU A;  5DCM A;  3BJA A;  5E79 C;  3W2W A;  4C2T A;  2QGU A;  3W2V A;  1B59 A;  1UB9 A;  2YU9 J;  2L5Q A;  4NC8 A;  2CF4 A;  2DA5 A;  2DTR A;  1D0Y A;  3K0L A;  4G7Z F;  3C1D A;  1QZZ A;  1GV2 A;  3BCB A;  1P7J A;  4HX4 A;  2G0Y A;  2GQF A;  4OJO A;  2XAF A;  1MMA A;  4C0S A;  2BHY A;  3GVK A;  1K78 B;  3ZMS A;  2VL8 A;  1W36 C;  3C18 A;  2JVH A;  2VAS A;  2VLA A;  4F55 A;  2QQB A;  3ABU A;  3S93 A;  2QQA A;  2IT0 A;  4QVA A;  2QEN A;  2M3A A;  1QA1 A;  1I1G A;  1WXR A;  3K10 A;  3RPQ A;  1ETV A;  1YQA A;  1VQ8 B;  2Y0S N;  2VE9 A;  4JX5 A;  4TKO B;  1LLZ A;  2W24 A;  2FBI A;  1AMO A;  2E1C A;  5HS9 A;  1PVE A;  3V42 A;  3I4M J;  4IF4 A;  3B8H A;  5F08 A;  1QZY A;  3GTL J;  3G2B A;  3HL2 A;  3QPH A;  3SEQ A;  2L4M A;  2JK3 A;  4P1V A;  2QN6 A;  3VO2 A;  1U6G A;  4AF6 A;  2X3U A;  5FKL A;  1XCB A;  1KA8 A;  2F3L A;  4UNO A;  2W1O A;  2L7M P;  2EIN H;  2LRD A;  5TR9 A;  1LFB A;  3Q0W A;  4NBQ A;  4B3F X;  4YRV A;  2DFH A;  3LSG A;  5D5U B;  1E1Q A;  3OE7 A;  4LIV A;  1NB9 A;  2V4J C;  3P27 A;  2AXL A;  3CJQ B;  1IF1 A;  3OEH A;  2LLK A;  2E19 A;  1NHA A;  2F48 A;  2XKP A;  3U2R A;  4OP7 A;  3HGG A;  1N07 A;  2LY1 A;  2V26 A;  1J59 A;  4WZT A;  4Z03 A;  3BR5 A;  1WMR A;  4S05 A;  1STZ A;  4N3G A;  2O5R A;  4BU2 A;  3BC9 A;  3K4C A;  4AU7 A;  1A6I A;  1OMI A;  2JUG A;  1KRH A;  2K9S A;  4IHT A;  2O8K A;  2XIG A;  2V9V A;  2X3H A;  2X0L A;  3RKW A;  1YE9 A;  5LEJ A;  5IYW A;  4XKC A;  5IYN A;  4RDJ A;  4OIP F;  3WG7 H;  5IYR A;  2DFI A;  2BGC A;  2JRT A;  2XVC A;  1FZP B;  4EV0 A;  4XLA A;  1S8N A;  2MFZ A;  4MEX F;  4DYR A;  1V0E A;  4AF7 A;  2ZZG A;  3T5X A;  1BW6 A;  3HBL A;  1I3Q J;  3KP6 A;  3OYB A;  2ZJR F;  3PSI A;  1E17 A;  1VQM B;  2YWG A;  2FF4 A;  2YUS A;  3BOQ A;  4E4H A;  4AIJ A;  1DDI A;  1WDT A;  2KJB A;  3A01 B;  2AHO A;  1SVL A;  3F21 A;  5B1B H;  2O1D A;  4NK8 A;  4S0H B;  1G4D A;  1DP7 P;  3H36 A;  5BPI A;  1ZR2 A;  3PQJ A;  5F1R A;  2NRA C;  3P9I A;  5J40 A;  4XBF A;  3WHC A;  3WOD F;  4DZP A;  4XN0 A;  4G94 A;  5JVT A;  3TBI A;  4MTE A;  4DIQ A;  4XM3 A;  2C5B A;  4LBY A;  3L00 A;  3GTO J;  1WOS A;  4A2U A;  2R6H A;  1MDM A;  1IO2 A;  2ZFW A;  5JLX A;  4HNT A;  3G73 A;  4WXC A;  2R9V A;  2INV A;  3B8Y A;  1U9N A;  4RJL A;  1QRY A;  1U8B A;  3TW7 A;  4EGY A;  5HOO A;  3HRM A;  4LLL A;  1VF9 A;  2VJ5 A;  4RGS A;  3QYE A;  1AIP A;  2NST A;  2QDX A;  2LKS A;  1SAU A;  3ONU A;  4B48 A;  2XND A;  5H6Q A;  2BSP A;  3KYL A;  1TVC A;  2PJR A;  1FLI A;  3AKZ A;  4B4C A;  4QFM A;  1R5G A;  4BAC A;  1WJC A;  3OV8 A;  2KIQ A;  4YFN F;  1K73 D;  2DET A;  1O3Q A;  2IW5 A;  1WJB A;  2EIM H;  2KFD A;  3DTK A;  1LPQ A;  1E3X A;  3PEN A;  3RZO J;  1X2N A;  1BX0 A;  3EQO A;  3BG3 A;  1EP2 B;  5LGN A;  2CO5 A;  1R5I D;  1ZYR F;  3M4O J;  4JQF A;  2ZJ2 A;  2RC5 A;  3D5S C;  2YR2 A;  1REP C;  4LBW A;  3CCY A;  1UHS A;  2OAZ A;  3KL9 A;  1MH4 A;  4E6K G;  3P26 A;  4HX8 A;  5BMZ A;  2KVO A;  3CMA B;  2GXG A;  4UUS A;  2NAZ A;  3MKL A;  1DPU A;  1YW9 A;  4TMX A;  2YSR A;  3OSG A;  4M6X A;  2D2W A;  3LOC A;  1E0E A;  2GJR A;  4YZQ A;  2JN6 A;  3BG9 A;  3JCU C;  1CLW A;  4A5N A;  1HSJ A;  3ZIA A;  1E3O C;  1F1Z A;  2EZK A;  2ZTN A;  1CZF A;  2YU3 A;  3TDU C;  2UUZ A;  3U21 A;  1H88 C;  1R71 A;  4CZZ A;  5A2Q K;  1JUM A;  2E34 A;  5ILV A;  3IC7 A;  1MBG A;  1OJL A;  2R7T A;  4RAZ A;  3Q6Q A;  2NTP A;  4BY1 J;  4M53 A;  4RCY A;  5J1R A;  3OYC A;  3L2V A;  5GV8 A;  4NCN A;  1I5Z A;  4X0G A;  3JSO A;  2GPJ A;  2LK2 A;  1XG1 A;  4UB6 C;  3S32 A;  1LEB A;  1ZR4 A;  2Z5U A;  2L02 A;  3V8J A;  5BOX A;  3M07 A;  4MO7 A;  2R7D A;  3ERE D;  1K9M D;  3UNG C;  1XB2 A;  2HR3 A;  4O5V A;  2UXX A;  1MMD A;  4S04 A;  3MAJ A;  2VNH A;  1QRB A;  2YWF A;  2J8I A;  3W6J B;  3AVY A;  1W0J A;  3QFR A;  3PO3 J;  2DER A;  2EWE A;  4YHB A;  1OGI A;  3ZBU A;  1TW2 A;  2L9R A;  4O3M A;  2EIJ H;  4LOC A;  3H5R A;  1Y0N A;  3NAR A;  3U9G A;  3CD6 I;  2KZG A;  5FRM A;  5IYD J;  1O8I A;  2BE5 F;  4KDP A;  4RGU A;  3KP3 A;  2HU9 A;  1JUP A;  4XKW A;  4I02 A;  4RB1 A;  1BR4 A;  5DSZ A;  2M8G X;  2V1N A;  4MFE A;  4ZCM A;  4OPO A;  3PA1 A;  4KH3 A;  5IP7 J;  2X6W A;  2VI6 A;  2WYR A;  3OS0 A;  4J19 A;  3OL4 A;  5DUI A;  2CV2 A;  3FXL A;  5EGO B;  1LKX A;  2Q2E A;  2ZXJ A;  1Z05 A;  3CP2 A;  4DNT B;  3VST A;  2IPQ X;  4QIW N;  4LB5 A;  1H9G A;  1JNY A;  4Z2Y A;  1K8A D;  2K9L A;  3A35 A;  2KRF A;  3J7Z I;  2ME6 A;  2EA4 A;  3KX2 A;  1MZB A;  3KEO A;  3M8J A;  1Y8R B;  4ZH4 F;  1U3E M;  4IHS A;  1FSH A;  4RGX A;  2DT6 A;  5CYV A;  3J7A O;  5D5V B;  1CNF A;  2WJY A;  1ZRC A;  2NVQ J;  5FA6 A;  3CCQ B;  4A3G J;  5ERI A;  4Z4Y A;  3AG1 H;  4AM3 A;  2UWM A;  1EXM A;  4QTR A;  3AAF A;  3WE3 A;  3RKQ A;  2BPO A;  2A6H F;  2PJP A;  1Z77 A;  3FDY A;  4PFP A;  3ZQG A;  1G2H A;  5E6T A;  3DV8 A;  2ZL7 A;  4Y7N J;  4PC3 A;  3LAP A;  1DDN A;  3E6M A;  5GAD J;  3F22 A;  2A68 F;  3A1P A;  5E17 F;  3LYC A;  3S1R J;  3K70 D;  3CCM B;  1W7P B;  1X19 A;  1LVK A;  1ZGW A;  1LDK B;  1FX7 A;  4CZC A;  3V76 A;  3N4M A;  2LBF B;  1TNS A;  1QGY A;  4KIC A;  3OJW A;  2CRG A;  4PCQ A;  3QOE A;  2NPF A;  4IRG A;  3ASN H;  3OY9 A;  3WNC A;  1DDG A;  1EJ9 A;  3OS2 A;  5AN9 A;  2OK7 A;  1BN8 A;  2P6T A;  2DYS H;  2DY1 A;  2DJN A;  1J9Z A;  2LP0 A;  1MMN A;  3V7S A;  5B1A H;  3FF5 A;  1VHO A;  1HA8 A;  4HV5 A;  1BW5 A;  2JQ7 A;  2I1L A;  2EB7 A;  3D26 A;  3CCL B;  3DXJ F;  2P3M A;  3GVA A;  4HRI A;  4IPA A;  2VOO A;  2VKV A;  3LA2 A;  1QPI A;  5JLW A;  2LH9 A;  4KN4 X;  1S9H A;  1TWA J;  3Q5F A;  3CCU B;  1LUJ B;  4CO8 A;  1BJZ A;  5KHD A;  2HDN B;  3WBJ A;  2FEZ A;  3ASQ A;  2QA4 B;  3VSK A;  2WAQ N;  1OR7 C;  1I6H J;  4KJZ A;  4EJU A;  2PEX A;  2HGC A;  3PFY A;  2VZL A;  1OFL A;  1MNM C;  2Q8K A;  4TMV A;  5FIU A;  1QQI A;  5LBQ A;  3BH7 B;  5KAF C;  1FRQ A;  3KIO A;  2XGC A;  1JTX A;  3PM1 A;  1QVT A;  4M9Z A;  1Z67 A;  4JRA C;  1IAW A;  3OEE A;  2VQG A;  4ITV A;  3AVW A;  2ZME C;  1WI3 A;  3FXJ A;  2DYR H;  5GAE J;  4A0Z A;  1Y0R A;  5D8K B;  2CND A;  5LRS A;  1R00 A;  2GLO A;  2X53 S;  2EFO A;  2WAQ A;  3HKZ N;  3ML6 A;  3LSR A;  4DYC A;  4X7C A;  1S72 I;  3HTS B;  1UHM A;  4Z4W A;  3S16 J;  1KCC A;  5ILS A;  4OIQ F;  2A6E F;  3GVJ A;  1YX5 A;  2HPI A;  2AQE A;  3K6G A;  5E20 A;  4CH7 A;  3NRV A;  5FLX Z;  3L09 A;  4XMY A;  4HV6 A;  1J2X A;  1B6A A;  5DNS A;  2KIS A;  2OBT A;  2K02 A;  2NVU B;  1GT0 C;  3F23 A;  2RVC A;  3A4C A;  2X0K A;  3DPL C;  5F1J A;  4UHT A;  1WP6 A;  1TTT A;  2H27 A;  1KCD A;  1L3L A;  5HDK A;  4NQW A;  5D5X B;  1FNC A;  5F4J A;  2WB1 A;  3I71 A;  2HVQ A;  1W1W E;  1H8H A;  2W25 A;  3BWG A;  4MR0 A;  4IHX A;  5E1Z B;  1PUE E;  3F6O A;  3F0C A;  4IXA A;  1RUN A;  3S1N J;  1E3Z A;  3GW2 A;  4U0V A;  2M5S A;  3KEW A;  4P25 A;  2WC2 A;  3Q0V A;  5JBQ A;  2ZBK A;  5IY5 H;  3R6S A;  2OPT A;  3K1P A;  3I4P A;  3L2C A;  3CC4 B;  3AL0 C;  3WTZ A;  1EA0 A;  2XB0 X;  4CYC A;  4FTH A;  2I8D A;  1MRZ A;  3AST A;  3Q39 A;  1LM1 A;  2DT7 B;  4FIS A;  1JTY A;  2JZY A;  2D5V A;  1G3W A;  2BVL A;  4N4O B;  3B02 A;  1MBE A;  1U5T B;  3IKT A;  3E6C C;  2EFG A;  3P7N A;  4AWX B;  1E43 A;  4FXU A;  2DA6 A;  5CVJ A;  1SMY F;  1GVD A;  5DM7 F;  4DOZ A;  3PUN A;  3QU6 A;  1BI0 A;  1LEA A;  2H09 A;  1ZAR A;  4QHY A;  2LY9 A;  1ZG1 A;  1YTY A;  3CCE I;  2VXZ A;  4LBZ A;  3CXC B;  3BH4 A;  2KRC A;  1YG2 A;  3VEP A;  2XTX A;  4ZZD A;  4IJA A;  1BBY A;  2O04 A;  3A02 A;  4MHG A;  3OYA A;  1ZTR A;  2F6C A;  1Y0Y A;  1T6X A;  3A3B A;  4P3I A;  2A05 A;  4U4B A;  2XPU A;  3CCV I;  1T39 A;  1B72 B;  1TW3 A;  1RUO A;  2PJR B;  3LMW A;  2A5Y B;  1TTY A;  2VBT A;  2JMW A;  2QSH X;  3JX8 A;  2RQP A;  3RYP A;  3H3Z A;  2KMU A;  1BC7 C;  4XKV A;  1GXP A;  2XNC A;  2VIX A;  1JKP C;  4HEA 2;  1QUE A;  1T0F A;  5CLS A;  1TQI A;  3ONQ A;  2V7W A;  3BQZ A;  3ABK H;  1RRJ A;  2O7O A;  4JYK A;  4F52 A;  3E5X A;  3HTU A;  1T8I A;  3OZV A;  2C6Y A;  1XSV A;  4U0W A;  1S5L C;  2DAO A;  5TV2 A;  1WH7 A;  1MIJ A;  4BBR J;  4BJT A;  3OYM A;  3LSP A;  4D1Q A;  1LVA A;  4NBS A;  4YAF A;  4QLC U;  2PYH A;  4OM9 A;  5K1Y A;  3AK5 A;  2B0L A;  2IBD A;  2QZ8 A;  2L4A A;  4LB6 B;  1U2R A;  2E1R A;  1FOY A;  3Q3S A;  3VOD A;  2TDX A;  1QCX A;  2PMZ A;  2GXB A;  3RTR A;  4EH1 A;  4XOT A;  4P2N A;  4EM2 A;  4X7F A;  2BOL A;  4A3B J;  4KIF A;  1BX1 A;  3MMY B;  4X7E A;  4Z4R A;  2H1K A;  2A6T A;  1H8E A;  2EFP A;  5HZA A;  3CCJ I;  2CWE A;  4BS9 A;  3EYY A;  5EGO A;  2TCT A;  4OIR F;  3QE2 A;  2OYN A;  3JSP A;  3NB2 A;  2VOD A;  2C4U A;  3M8F A;  1WJE A;  3ZN1 A;  4OAZ A;  1X1P A;  2E71 A;  1NJI D;  2WAD A;  1RKT A;  1I18 A;  1ZM9 A;  1OR7 A;  2I5U A;  3FXM A;  5HNH A;  4UVA A;  2VYQ A;  2CW5 A;  4RPD A;  4CYD A;  2PX9 A;  1W35 A;  2DXI A;  3QPL A;  3E7L A;  4I99 C;  3PNY A;  4YAU A;  2IP2 A;  1T6Y A;  5TGT A;  2Q6O A;  2QYO A;  2R93 J;  2XGJ A;  2CQX A;  3P9C A;  4U0Y A;  2XPW A;  3I0T A;  1NH3 A;  1HW1 A;  1HF0 A;  3JUR A;  1UHW A;  3LQR A;  1YS7 A;  1IDJ A;  2L0K A;  1VQ6 I;  1PUF A;  2FNA A;  2WY8 Q;  1WVR A;  4DZJ A;  5IOY A;  4QPQ A;  1IHM A;  4M3E A;  3CCM I;  4PJN A;  2L9V A;  4CUG A;  3AVX A;  5M3F J;  4M3D A;  3FHN A;  4ACB A;  4G1V A;  1EFU A;  4YCQ A;  3AVU A;  3EUA A;  2E2J J;  3G71 B;  2BM5 A;  4RAG A;  2XZL A;  5M5X J;  4HE6 A;  4D7N A;  5GTH C;  4IOC F;  3A8I A;  3GTG J;  5CPR B;  1XTA A;  3I54 A;  3CCJ B;  4FAS D;  4ZYD A;  1K4S A;  3KCC A;  1ZM4 A;  2NT6 A;  3EET A;  1YIT B;  1O8F A;  2A69 F;  1R4N B;  1E63 A;  3OR2 C;  3E1Y E;  1ZRE A;  2FA5 A;  2CUJ A;  4Z4V A;  3H09 A;  4U49 A;  4PSW A;  3HG9 A;  2DMN A;  4IHV A;  1OCO H;  2V1D A;  1G3Y A;  1D8K A;  2Q6K A;  4GFB A;  1WWX A;  2MLK A;  4CYC B;  1CNE A;  2V7Q A;  1B1B A;  4Z1M A;  4ASN A;  3W2I A;  4Y7C A;  1P6R A;  1QPM A;  3FBN B;  3ZZ0 A;  3RSN A;  4G6I A;  5FLX K;  1SFK A;  3K4M A;  2H8R A;  2X1C A;  4ZYG A;  1HZE A;  5GAG J;  1FND A;  2X9D A;  2XPV A;  2ZSH B;  3G71 I;  2ZL6 A;  3GQ7 A;  2FX0 A;  3KEY A;  3BPX A;  3BCD A;  4PAB A;  4L0Z B;  3FWE A;  4A3C J;  2FRH A;  1KQ8 A;  2F4I A;  1E64 A;  2DOF A;  4GO1 A;  1XSX A;  4G6T B;  1OPC A;  4MGR A;  2FBK A;  5F64 A;  3AVV A;  3G4S I;  2E7X A;  3E5U A;  3I5U A;  2WBM A;  4W97 A;  1Z7L A;  2DMT A;  1V0F A;  2IGN A;  5J1U A;  4LMY A;  1ZH5 A;  1QHG A;  1R5N A;  5LEK A;  2HDC A;  5A89 A;  4ANJ A;  3OYJ A;  3FJO A;  4G7W A;  4BUP A;  3BRO A;  3DTI A;  3JTH A;  4F93 B;  2M30 A;  4KA4 A;  1YRN B;  2LKP A;  2M4K A;  3C2H A;  4KN7 X;  1WZ2 A;  3TH0 A;  3BY6 A;  3ROU A;  1RIO H;  1O8H A;  4P9F A;  5HLH A;  1YFH A;  5JR3 A;  2GXA A;  3BDD A;  3SQN A;  3CME I;  4X07 A;  4KNY A;  2D1H A;  3K2A A;  4XOR A;  4OPV A;  3E20 A;  3LAJ A;  5DTD A;  1J9I A;  3OIO A;  3CMY A;  1S3J A;  3EQL F;  1G7C A;  1L1I A;  2RV8 A;  2LNB A;  1NTC A;  2QXZ A;  5M5Y J;  4D5F A;  3T8T A;  1Z9C A;  3LNN A;  2IQ7 A;  1QX4 A;  2GOX B;  4JX6 A;  2GQQ A;  2E5N A;  4GQN A;  2F5C A;  4RAY A;  1X3U A;  4IRH A;  3TP3 A;  1WPC A;  3P9K A;  4IHY A;  1KJZ A;  4FN5 A;  2OTJ B;  1P2F A;  2WR8 A;  3G1O A;  2VNK A;  2ZIT A;  3JRH A;  5H5J A;  3CC4 I;  4Q4Z F;  1EZG A;  1SFX A;  4TSF A;  5HKK A;  2EWN A;  4FHT A;  4B8X A;  5FRN A;  2V4D A;  3VYU B;  4A3I J;  1V4R A;  2EFQ A;  2EPF A;  2HOT A;  1MND A;  2TRT A;  2JA6 J;  4L9T A;  2IS6 A;  3A3G A;  1XGN A;  1FBU A;  3ABM H;  3EUH A;  1TWH J;  2VJJ A;  4II3 A;  5FGM A;  4EQQ A;  1A8P A;  3W2F A;  3JAM Z;  4E7J A;  1JKQ C;  3OIQ A;  4YAW A;  2DJI A;  4X05 A;  2CUE A;  2E35 A;  2B5O A;  1R22 A;  1MAB A;  2MAB A;  1U5T A;  1TUI A;  2RC6 A;  3TP0 A;  3ZXS A;  2NNY A;  2IEK A;  2F4M B;  1TBX A;  4ZTF A;  5KW9 A;  3T9G A;  4BEH B;  2VBM A;  2VBV A;  1NRK A;  4OZY A;  4OU0 A;  3OR1 C;  4UUS B;  3GIR A;  1MD0 A;  2ZO4 A;  4CCK A;  2ISZ A;  1G6N A;  1CF7 A;  2KKO A;  5CKT A;  3JRB A;  2IOU G;  3B4N A;  2L9S A;  2F5D A;  1DGW Y;  3OOC A;  4E7H A;  3IHU A;  2GBY A;  2ZZE A;  2O3F A;  3DKY A;  2HVS A;  4RLF A;  3HOU J;  2G7H A;  3QYB A;  2FBH A;  2DK5 A;  2PBI A;  2WB1 N;  4BHC A;  3FX3 A;  1SKY B;  1XD7 A;  1KGS A;  4A12 A;  4BE2 A;  3L9F A;  3PSZ A;  2BV3 A;  3BC8 A;  3GTK J;  2VNI A;  3I4N J;  2A3S A;  3WGH A;  1KK2 A;  5THX A;  4FWT A;  1F20 A;  2P7C B;  1JUS A;  1BOB A;  3OW2 B;  3BH6 B;  1R4M B;  1TYX A;  3HSE A;  3DPU A;  4KFC A;  3KP2 A;  3OZW A;  3LSK A;  3E0J B;  4XLP F;  4LG0 A;  2BV6 A;  1AKH B;  4EJW A;  5IYP A;  4AYB A;  4ENK A;  4ON0 A;  1UAA A;  2GM4 A;  2M2E A;  4WXH A;  2QA4 I;  2C78 A;  1YW8 A;  4EM0 B;  3I56 B;  1RQP A;  1JJ8 C;  2KRH A;  4BYY A;  1M1K D;  1H9T A;  1TWC J;  4F3Q A;  1DU0 A;  3BTJ A;  1FYM A;  1D8J A;  2R5Z B;  1OKR A;  3I55 B;  1XC5 A;  4HLX A;  3OKX A;  3H5A A;  1R1U A;  4YC5 A;  2CQN A;  3OYG A;  4G7X A;  2K9Q A;  4OOI A;  2XRO A;  3GZN B;  1K78 A;  1W4M A;  4G9Y A;  1EH6 A;  2ZNY A;  2ZZQ A;  4L18 B;  4RD4 A;  1LB2 A;  4RBO A;  2CQ7 A;  2CS3 A;  4HBL A;  1QGA A;  2OK8 A;  3AG4 H;  6PAX A;  3BR3 A;  4XR6 A;  2ZXI A;  2J7K A;  1U78 A;  3K9T A;  2IXS A;  4HX7 A;  4IL6 C;  1VBL A;  4MIM A;  5IYB J;  3Q3A A;  4KIS A;  4TMW A;  5TY0 A;  1E79 A;  1FOW A;  5DD4 A;  4E7I A;  3HKZ A;  4B09 A;  1UMK A;  4MYU A;  4G1B A;  3ASR A;  4YAL A;  5FO1 A;  2XRN A;  5C4X J;  1R5H A;  2F43 A;  3OP1 A;  2DPU A;  4XOP A;  4DK1 A;  2LD5 A;  2D45 A;  4LJZ F;  1RR8 C;  4N0B A;  2L9N A;  1Z21 A;  2DBB A;  2UXN A;  4YDT A;  4ZDO A;  4M2L A;  2JSP A;  4RM0 A;  2Z99 A;  3ECO A;  3DWL E;  3ABT A;  4L8J A;  2R7X A;  3FXR A;  3T0Y A;  3RPU D;  5FKN A;  1FIP A;  5ILU A;  3I55 I;  3W2E A;  4Q48 A;  3FHZ A;  1D2E A;  5DS9 A;  1N05 A;  2MBF A;  1E2X A;  4B3A A;  5DYM A;  3IAM 2;  3W3C A;  1BHE A;  2J5P A;  2P8T A;  3IP4 B;  4XL9 A;  3S3M A;  4BH9 A;  3RYR A;  4CHU A;  4Y4R A;  4CIC A;  1QFZ A;  1ZHF A;  1W34 A;  4ABZ A;  3R61 A;  1ZRD A;  1PLU A;  1I8D A;  4E7L A;  1T95 A;  4IZZ A;  2LBF A;  3GME A;  2DQR A;  2HCJ B;  3SUC A;  4YIF A;  1IN7 A;  3MWM A;  1YHQ B;  1IN4 A;  4A6E A;  2GZW A;  4RD2 A;  3W2G A;  4RD6 A;  3FK7 A;  4A3E J;  1UZC A;  2E2H J;  2ETH A;  4N4N B;  3WTU C;  2L7F P;  3F8C A;  4Y13 A;  4W8Q A;  1DBG A;  4H9G A;  2XAQ A;  3K1N A;  1SM4 A;  3WTW C;  5ICC A;  5IP6 A;  4DGW B;  3FY3 A;  2P6S A;  2Z2S B;  1OCR H;  4QWQ A;  4RS8 A;  5IP9 J;  3S3N A;  2XRL A;  1LE8 A;  2KIM A;  3M9A A;  2DCU A;  3L2U A;  3LO8 A;  1H42 A;  1MSF C;  5F6F A;  3TGN A;  1U9O A;  1WQ2 A;  3RIR A;  1SMT A;  1P4M A;  3MHP A;  4LBV A;  1YHQ I;  3J81 Z;  2OV7 A;  5JLV C;  2E2I J;  3G6E B;  3FPP A;  3FM3 A;  1WOO A;  3WGI A;  1QUF A;  4HSR A;  3CW2 A;  1T6Z A;  1VQ5 B;  2ELK A;  4BXU A;  2DPD A;  3ZSC A;  2ZSI B;  1IG7 A;  4A3K J;  4IEJ A;  5HS8 A;  5C44 J;  4LIT A;  4DW6 A;  2JRM A;  4Y9U A;  2Z1D A;  3FBI B;  2UV1 A;  1RC9 A;  2K4J A;  2VJI A;  1ETW A;  4AIK A;  3GUD A;  2V6E A;  1M90 D;  2IJL A;  2LF7 A;  1K6O A;  2E1N A;  1DUX C;  4QVJ A;  5EYR A;  4IX7 A;  1D5V A;  1WJF A;  4ESJ A;  4A3M J;  2DDB A;  1ETQ A;  3OMY A;  3R60 A;  1W5T A;  5TJJ A;  3L2W A;  2VUM J;  3GTJ J;  4UZU A;  2QEX B;  4HWV A;  1HDP A;  1Q1H A;  2JJ2 A;  3TED A;  2V7U A;  5JMC B;  1BLI A;  2IRF G;  5CVR A;  1NBM A;  1VQK B;  2QBY B;  4FCY A;  1A6Q A;  3BG7 A;  1RQR A;  2B63 J;  4MLO A;  1OQY A;  3KE2 A;  5L46 A;  2YX4 A;  1QRC A;  1VHE A;  1VQN B;  4TV7 A;  1E3P A;  3U6K A;  3PVD A;  1JTA A;  5ICF A;  5L3D A;  1UD5 A;  1B4A A;  4XRS G;  2BW3 B;  3CUO A;  5IT3 A;  3RCO A;  3KEQ A;  3CLO A;  4PMH A;  3SZP A;  3K7A J;  3VFZ A;  3OFN A;  5J3L A;  3ZMV A;  3ASP A;  3CMM A;  1HG8 A;  2M34 A;  3ZPN A;  3B6A A;  3BCF A;  3QFT A;  1UCR A;  4A6D A;  2QTZ A;  2OTL I;  3RDI A;  1VLY A;  4G12 A;  5KCM A;  1F36 A;  4QV2 A;  2F4O B;  2V7X A;  1CQX A;  3DBH B;  4QSH A;  1FPQ A;  1JGG A;  3SJM A;  5GP9 A;  1Z6R A;  1V5E A;  2J8K A;  1B8I A;  2VC1 A;  1FMW A;  2RRE A;  3CMA I;  4I6Z A;  2BXZ A;  2QCO A;  4R79 A;  3FK6 A;  4BPR A;  5LHI A;  1T38 A;  1EF4 A;  2DYI A;  2BEO A;  1P9Q C;  3JQQ A;  4HQE A;  1O8L A;  2M9H A;  2RKH A;  5AIQ A;  4W1U A;  1R7J A;  2BZT A;  5HZB A;  4GRI A;  2OZ6 A;  1UD8 A;  4NDL A;  2CG4 A;  4XN3 A;  5E3L A;  2M87 A;  2GIZ A;  3QPS A;  4EJO A;  2OF7 A;  2BF4 A;  3VNU A;  2YWE A;  3HPH A;  2HOS A;  3SDB A;  2Q6L A;  3OJX A;  3HIF A;  1YOV B;  4DQK A;  2RGV A;  1N0U A;  2VQC A;  1I6X A;  9ANT A;  3VMV A;  3D1N I;  4ZV4 A;  4N3N A;  2IA0 A;  4B1R A;  1CF7 B;  5F4O A;  1DGR M;  1PJ7 A;  1J5Y A;  1JT0 A;  2X1D A;  1SVM A;  1EH8 A;  3LSI A;  3NQO A;  1XX5 A;  2HFH A;  5DCM B;  3ZQH A;  2W7N A;  3OW7 A;  2XTY A;  5EJC A;  2DA1 A;  2BMW A;  3QOP A;  2GK6 A;  2MH2 A;  3H92 A;  2ZBV A;  4YEJ A;  5HS7 A;  5J4Y A;  1J7K A;  3KZI C;  1R9T J;  1HKS A;  2V7F A;  5F0C A;  4I7H A;  4A5M A;  3HOY J;  1HXD A;  2H6C A;  3ISX A;  4G6D A;  3O2P E;  2FSW A;  1E1R A;  4Y15 A;  4EJT A;  2RQQ A;  2M5W A;  4IQ4 A;  2EV6 A;  3SJZ A;  2JA2 A;  4Q7J B;  3U1K A;  1YYV A;  3HRS A;  2JJ1 A;  1KYZ A;  2OJE D;  2ZNZ A;  4EMS A;  5KNL A;  1PDN C;  2GJP A;  4PC7 A;  5EZH A;  2K86 A;  1AIR A;  1NHC A;  2ID3 A;  1W36 D;  2X6O A;  2CMP A;  2JUC A;  4DBR A;  3JRG A;  1UD4 A;  3V8L A;  2VBW A;  2QBY A;  3F8B A;  5BSY A;  3SZE A;  2GIV A;  4KIG A;  1WKM A;  4NC7 A;  1H89 C;  5D4R A;  1ON1 A;  2H6B A;  5KK1 A;  1IV6 A;  1JJ2 B;  4RM3 A;  2D9R A;  1E62 A;  3MKY B;  4L9J A;  4CXF A;  3OYK A;  3OYF A;  3S2H J;  4PC6 A;  3ASO H;  3JU4 A;  1SEU A;  2ELJ A;  1N0V C;  4BQQ A;  2R92 J;  3HRU A;  2QX3 A;  2HYJ A;  4A3J J;  5L3C A;  2W82 A;  4ENM A;  3DF8 A;  1GVH A;  2OC6 A;  2EA2 A;  3LWF A;  1WRJ A;  1SAN A;  3VMW A;  4A93 J;  2WAF A;  1KQS B;  3J80 Z;  1SKQ A;  3MZH A;  1MW7 A;  2OTL B;  4XRM A;  2CJJ A;  2Z3Y A;  4X1E A;  1EFT A;  2CQQ A;  1ETO A;  3EQN A;  1D8T A;  3ZCO A;  1JJ6 C;  1FWZ A;  3KLN A;  4PJM A;  2YWH A;  1WSR A;  3RQ4 A;  4DYQ A;  4XKB A;  4P3Y A;  2F5F A;  4IKF A;  3KP5 A;  2CFO A;  1LE8 B;  4BXF A;  1YJ9 B;  3BG6 A;  1FJL A;  3MN2 A;  2O03 A;  3QYF A;  1HKT A;  4OJ6 A;  1YI2 B;  1FT9 A;  3K4K A;  1R36 A;  3A03 A;  1YJN I;  1BQE A;  2BVN A;  4JMQ A;  1RI7 A;  4GXO A;  4UAJ A;  3WE2 A;  1QU3 A;  3SKB A;  2X1E A;  3ZN0 A;  1IB0 A;  2KP6 A;  2LKX A;  2B7E A;  2IGK A;  2XGX A;  4OAY A;  1D0X A;  1QVG B;  3TMO A;  1XPX A;  1Q82 D;  2QQ9 A;  5GPA A;  2CV1 A;  2E1O A;  3VMF A;  4C2U A;  2K5C A;  1X2M A;  4BJ5 C;  1Z6T A;  2DQL A;  2KT0 A;  1SD5 A;  3QU3 A;  3TKY A;  3GQB A;  4LGW A;  1VI0 A;  3WXM A;  1K28 D;  1UD2 A;  4NC6 A;  1VQL I;  1O3R A;  5FO0 A;  2Y48 A;  3RPU A;  3IRR A;  3DQV C;  5E3M A;  4KMF A;  1KD1 D;  1TT0 A;  2VQH A;  3OL3 A;  3H9Q A;  2RN7 A;  3SYJ A;  1YJW B;  3VB2 A;  2XC7 A;  4CCL A;  1XFO A;  4LG0 B;  1X4O A;  3HOX J;  5BQT A;  1YJ9 I;  3MCA A;  3GTQ J;  4L9V A;  2R7Z J;  1S29 A;  5EEG A;  3IV5 A;  1K4T A;  3OZU A;  4W8R A;  3UW0 A;  3D5R C;  4E7K A;  2B7C A;  3DFG A;  3PUF A;  1KQ0 A;  5BS6 A;  1MBK A;  4P12 A;  4TMZ A;  1XMX A;  4YZA A;  3SJP A;  2Z8G A;  2IGO A;  4XON A;  1VQP B;  4BHP A;  2GOM A;  1QFJ A;  1VQ5 I;  1V55 H;  1D1N A;  5HDN A;  2C77 A;  5HDG A;  5K5R A;  1FY7 A;  1GAQ A;  3SQV A;  4AIH A;  5J8F A;  5TRD A;  1S4M A;  4BDZ A;  1TNT A;  4BGD A;  1NK3 P;  5KAI C;  3AVT A;  4EAT A;  1RKW A;  3M3Y J;  2KQR A;  1GO2 A;  2BY2 A;  2AS5 F;  5LGU A;  3LL7 A;  3HPG A;  3PQK A;  4J01 A;  4QPO A;  4ZJZ A;  4RMN A;  3W5H A;  4LK0 F;  3DEU A;  3G4S B;  2A07 F;  4FE4 A;  4TMT A;  3R0A A;  1TYW A;  2FOW A;  2HQA A;  1FP1 D;  4IQJ A;  1VQ4 B;  2BY3 A;  3DCF A;  4PJ0 C;  4I01 A;  1W7P A;  3L2R A;  4YG2 F;  1D1A A;  1ULY A;  3ERM A;  5HLG A;  1ODD A;  4A0Y A;  1RWR A;  5DD8 A;  2B9S A;  4L5I A;  3DP7 A;  3E1S A;  2Y9Y A;  3CUQ A;  1OB5 A;  3KFW X;  2DO7 A;  2MYS A;  3W2A A;  3EUH C;  2L2O A;  1HLV A;  3O8G A;  3CCS I;  1GJR A;  4RD1 A;  4M72 A;  3CF2 A;  2JVG A;  2WJV A;  1OCT C;  3IAS 2;  3HOS A;  4RB2 C;  1U5T C;  3CF5 F;  5K5Q A;  1GR1 A;  3CZ6 A;  3Q9V A;  1TSP A;  3BR0 A;  1T2K A;  2J5O A;  2GWR A;  3VSL A;  3F72 A;  3SXY A;  3SZT A;  4DBQ A;  4AYB N;  1YIT I;  2EZL A;  4KT6 A;  2OBS A;  3JQP A;  2XZO A;  2NS8 A;  2I10 A;  4PC2 A;  2DDA A;  4URR A;  1HQC A;  3I64 A;  4NUB A;  1BL0 A;  1W0T A;  3CTA A;  2C2W A;  1UMQ A;  4J0Q A;  1KU9 A;  3IWF A;  2BM7 A;  3DLL F;  1H0M A;  4HF2 A;  1R5B A;  1W87 A;  3WND A;  2Y31 A;  4AVP A;  1VQM I;  2EV0 A;  1EA3 A;  2HI3 A;  5EDN A;  1DU6 A;  1XB4 A;  4Y33 A;  4M6V A;  1ZLK A;  1IRG A;  2XC1 A;  2C5H A;  2EV5 A;  1JGS A;  1X0C A;  2QZA A;  1B9N A;  2V6C A;  2LRE A;  2WY7 Q;  2NOJ B;  4PJJ A;  3WNB A;  4X06 A;  2DCE A;  1NG7 A;  4N9H A;  2VBZ A;  5DM6 F;  3IKV A;  4C43 A;  1ON2 A;  4X6A J;  2E60 A;  5E1X A;  3HSR A;  1B23 P;  1W9X A;  1KU2 A;  2FU4 A;  3KP7 A;  1NB0 A;  1I3A A;  1WJ5 A;  3LST A;  4PGG A;  4WZL A;  1W5C C;  1PYV A;  4LC0 A;  4IHW A;  3WTS C;  4HYE A;  4RGR A;  1OB0 A;  4OJ5 A;  4E70 A;  5ICG A;  1UJ8 A;  4HLY A;  2G7U A;  5KVR A;  1PP7 U;  3VWB A;  1F43 A;  2NS0 A;  3SFZ A;  2OCC H;  5J4V A;  3EUK L;  1TYU A;  4H0E A;  1R1V A;  3TO9 A;  3CJR B;  1XS9 A;  3MZ8 A;  1SFO J;  1DPR A;  4HNU A;  1JKR C;  4ZGQ B;  2HPM A;  1XGO A;  1XMA A;  2ECC A;  3LMM A;  2HTS A;  1QBJ A;  4CGZ A;  3HJE A;  1J09 A;  1YW7 A;  2HXI A;  3ZP5 A;  2ECB A;  1B9M A;  1S0U A;  5F4M A;  1EKE A;  1G59 A;  2BY1 A;  3GQ8 A;  4NNJ A;  1R1T A;  1OIS A;  3F6V A;  4KYW A;  4Y9R A;  3W5U A;  2XF7 A;  4IW3 B;  3QFC A;  4A3L J;  2PG4 A;  3RKY A;  2JA5 J;  4DNC A;  2O0V A;  3CC2 I;  1ETY A;  3SFI A;  2BXY A;  5D8L B;  3FXU A;  1W5S A;  3H94 A;  3J81 K;  4KKU A;  1WFX A;  2QF7 A;  4OIN F;  1PJ5 A;  2F4N A;  2GK7 A;  3ES9 A;  1IJF A;  4HZF A;  3REO A;  1OFM A;  1VQO B;  1IRZ A;  3GQA A;  3ONY A;  2YS9 A;  1N77 A;  2IVM A;  1T08 B;  2CC2 A;  2W6I A;  5J3O A;  1UFM A;  3C2B A;  3JW4 A;  4P55 A;  1ITY A;  2HZD A;  3A8K A;  4P5O A;  5L3F A;  1TZL A;  1MMS A;  2XNJ A;  1ZM3 A;  1HW2 A;  2VFN A;  2FE3 A;  1YX2 A;  2DK8 A;  4LFU A;  3OOP A;  2ADU A;  2M8E A;  1YLO A;  4OOX A;  4ROX A;  3F9K A;  1QNT A;  1OYW A;  2MSY A;  3PNT A;  3OYL A;  2VKD A;  3E3V A;  1T0F C;  1YI2 I;  3NE5 B;  5CVI A;  1MBJ A;  3BZ6 A;  1H80 A;  3CO6 C;  5DV5 A;  1JA0 A;  3WU1 B;  2M45 A;  2VXD A;  2HQ5 A;  3A0H C;  3I9V 2;  3X2Q H;  3CP8 A;  4CA0 A;  1W0U A;  5FKM A;  1MKM A;  1EP1 B;  1KK3 A;  3AGP A;  1K61 A;  1OOC A;  3TW6 A;  5E8G A;  1X1C A;  1G7T A;  3ZGK A;  5DN6 A;  4OMZ A;  5IT9 Z;  4QUZ A;  3V7A A;  3BP8 A;  2K3F A;  2L54 A;  3G3Z A;  3WG9 A;  4WCG A;  3COA C;  2VPR A;  3FXK A;  4MXN A;  3LJY A;  5AIP A;  2VBX A;  2LOO A;  5BSX A;  4UB8 C;  2BBY A;  2NVX J;  1U0J A;  2LC2 A;  3QWL A;  2EIL H;  4F7D A;  5A2Q Z;  1R5O A;  3G1M A;  4P9U A;  2NZM A;  2DOD A;  4FX4 A;  5LMZ A;  2C4T A;  3E97 A;  4C30 A;  4P9S A;  4RD0 A;  4Z05 A;  3RIQ A;  2HS5 A;  1Z1D A;  4TN1 A;  2X51 A;  1VQL B;  4XLH A;  3BR1 A;  4FQG A;  3M7G A;  4C3I J;  1COW A;  1POG A;  3JRE A;  1PXZ A;  1VQ7 B;  1MGT A;  4PUS A;  1MJA A;  2K27 A;  4A3D J;  2PMU A;  1Y6I A;  4YAO A;  4EW9 A;  2MC4 A;  3HUG A;  1ERD A;  2B7B A;  2CSO A;  5IYC J;  1F60 A;  1OGO X;  3JRF A;  3CCR I;  4OPS A;  2ODL A;  3OAA A;  4BKX A;  2PFB A;  1IB4 A;  1LLW A;  3E6B A;  2Y0M A;  2M0M A;  4IRI A;  3R4K A;  2KHM A;  3ZRG A;  5J6X A;  2Y30 A;  1VQO I;  2BM6 A;  3WY9 A;  5B66 C;  2R5Y B;  3GX4 X;  4CCN A;  2LY2 A;  4HF1 A;  4Y52 J;  3MZY A;  3CC7 B;  1GHC A;  4UXN A;  2HKO A;  2EIX A;  2ZB9 A;  1IN6 A;  2OA4 A;  3CO7 C;  3BJO A;  4PGH A;  2XAJ A;  2Z16 A;  4Q5S F;  4HIZ A;  2R7V A;  1FX0 A;  1WTH D;  2NYX A;  1GUU A;  3S3O A;  2PEC A;  3ZQC A;  1G3S A;  3O6B B;  1OCP A;  2HLD A;  3K4N A;  4HAM A;  3N90 A;  4OPW A;  1D3Y A;  1PJR A;  2ZXW H;  3GVL A;  2NSP A;  1GV5 A;  3HYI A;  1HA3 A;  1U2W A;  1I1S A;  5J35 A;  4OOS A;  2V31 A;  2Y9Z A;  3TO6 A;  2JPC A;  2FXA A;  1ZKG A;  1G7S A;  4YFO A;  3ML3 A;  1UD6 A;  2V1X A;  3GFM A;  2W4S A;  4JP0 A;  2M4G A;  3ZBT A;  1LNW A;  4P26 A;  1APL C;  2W00 A;  3HAG A;  3PUM A;  2XGD A;  3HUG B;  4LK1 F;  2XDV A;  3CC7 I;  1OB2 A;  2NTQ A;  2IS1 A;  1I7P A;  2BM4 A;  2L7K A;  2DT5 A;  2VBU A;  4RDL A;  5IK2 A;  1LFU P;  2A61 A;  2XV4 S;  3G1L A;  2XEX A;  5M3M J;  1WJD A;  2LF8 A;  4PK4 A;  1YRN A;  1TLL A;  2XB5 A;  5BPD A;  3AG2 H;  1IJE A;  3DEE A;  2MD0 A;  3GLX A;  1XDS A;  2E5Z A;  2RNJ A;  3K4B A;  4Y17 A;  2R7S A;  3K4L A;  1BJK A;  2DMU A;  3J7A Y;  1EE6 A;  1BJA A;  3MD2 A;  4TT3 A;  3DEW A;  4KKT A;  1Z7U A;  1BPL A;  1BIB A;  1JKO C;  2ZME B;  3QFS A;  5J47 A;  3SLN A;  4BBS J;  1WJA A;  3FKS A;  2OU2 A;  3JTG A;  3K70 C;  3BY1 A;  1OYY A;  4NQW B;  2XAG A;  3V7C A;  2UVE A;  4LD5 A;  4DNR B;  4M3G A;  5ICE A;  3J7Y J;  4IO9 F;  3QPT A;  3OYI A;  1Y1V J;  2ELH A;  1MNE A;  5E3O A;  2VE8 A;  3CCL I;  2EZH A;  3ZQL A;  3ASS A;  4Z6Y A;  2BX6 A;  5GTI C;  1KQ9 A;  3MKW B;  4HST A;  3CB4 A;  3TQN A;  2BVM A;  2ISY A;  1FEX A;  2WV0 A;  3BTL A;  1UD3 A;  2QUF A;  4RA2 A;  4D0P A;  4ENJ A;  4GDF A;  2XZP A;  5EZG A;  5LGT A;  4X8I A;  3VYT B;  4WWV A;  2EFW A;  1VZ0 A;  2LVS A;  3NAU A;  2R4G A;  4I76 A;  4YEL A;  4N9I A;  4M74 A;  3OS1 A;  2EFN A;  1JI8 A;  1O3S A;  1CGP A;  3B90 A;  3K2Z A;  4BQA A;  1ACI A;  2X8K A;  1XMK A;  5IOZ A;  1W7P D;  1KQ5 A;  1YS6 A;  2M1B A;  1IRF A;  1FYK A;  2HWV A;  1O8M A;  3IWZ A;  1ZRF A;  1Q7Y D;  1D5Y A;  3HOZ J;  2O17 A;  2VFM A;  1ZQ3 P;  2NT9 A;  1V54 H;  1E3H A;  2IA2 A;  1BM9 A;  2L3D A;  5C3E J;  4K2E A;  5LD2 C;  4FK8 A;  3QOD A;  3PSS A;  2CK3 A;  2JA8 J;  3KRG A;  4B4D A;  1K5C A;  2XTW A;  1N75 A;  3WTV C;  2MD5 A;  4RD3 A;  2ZC2 A;  2D74 A;  1ZUN B;  3VDX A;  3CQZ J;  3S17 J;  3H9J A;  1J75 A;  4CCJ A;  2AHQ A;  3C3W A;  2ME0 A;  4R1H A;  2P0W A;  3CD6 B;  1NG6 A;  1O8E A;  4AVZ A;  3DDY A;  1O8K A;  3FMR A;  1O88 A;  2FJ1 A;  3EYI A;  3K4J A;  4B43 A;  1QVU A;  1KU7 A;  2RAE A;  3K69 A;  3B6C A;  2DU9 A;  3CJT B;  1O8D A;  3FXO A;  3MQ0 A;  1FC3 A;  3HRT A;  3OIP A;  5E18 F;  5DDG A;  3CME B;  1QGZ A;  1BR1 A;  3FIS A;  1RNL A;  2PIA A;  2VON A;  3U2Q A;  1Y56 A;  2H1L A;  4B3X A;  2CW8 A;  2V79 A;  3LQ6 A;  4G5G A;  1ELO A;  3WGG A;  1PP8 F;  2CW7 A;  2D1V A;  1OLT A;  2WZP P;  4KT5 C;  4XK4 A;  5C4J J;  1LDD A;  1IV8 A;  2GRE A;  1I39 A;  1KK0 A;  3ULQ B;  2ZME A;  5EEH A;  1BOA A;  1Z3Y A;  1D1B A;  2OBR A;  2VC0 A;  1ZK8 A;  1EV7 A;  4ENN A;  4A0X A;  2K85 A;  3HDD A;  4BL0 B;  1EFC A;  1K79 A;  2XSD C;  4AD9 A;  3Q6R A;  4P6V F;  4L5J A;  1PUF B;  2VQL A;  2VN2 A;  1BI3 A;  3W6K B;  2GA2 A;  4U87 A;  4L0Y B;  1M1E B;  2XAH A;  3JQR A;  4WX9 A;  4X7D A;  3H9G A;  5HXB A;  2E7W A;  1MH3 A;  5ED4 A;  3R6K A;  3ZZT A;  2P5V A;  3SYT A;  3NWS A;  2XSJ C;  5AON A;  4AC0 A;  3GTP J;  1WCM J;  2HMA A;  2CYY A;  3KZZ A;  4M9S A;  3CC2 B;  1CQT A;  1FMV A;  5DEQ A;  5H20 A;  4CCO A;  3GFI A;  2R0Q C;  1X1A A;  2STW A;  3PJR A;  2JJ7 A;  2QM3 A;  2A5W A;  3KP4 A;  1IXR C;  3HEF A;  3CLQ A;  2R7O A;  4PSX A;  1SVO A;  1LFP A;  4RDK A;  1BMF A;  4XLE A;  4BE1 A;  1IUY A;  2ZTG A;  1EFR A;  1Q81 D;  1YJN B;  1P4W A;  1IXS B;  4MTD A;  2EBI A;  1WU8 A;  3MEX A;  5K7H A;  3KYC B;  5CQE A;  2HNH A;  3QQA A;  4H4K C;  3SHF A;  3A8J A;  4ZYH A;  3AGQ A;  1VQ9 I;  4WQM A;  1IRX A;  3TL4 X;  4A69 C;  3BJ6 A;  4UUT A;  4D5C A;  5JHF A;  2M7B A;  1X1B A;  1YIJ I;  1Q9S A;  1QA3 A;  4E7S A;  2PMD A;  4KUM A;  2P5L C;  1QZE A;  5DUK A;  2EQR A;  2EH3 A;  4XSX F;  1D0Z A;  3JRC A;  3O3K A;  3VOE A;  1F4K A;  1TL8 A;  5LFA A;  1MSE C;  4OIO F;  1NDH A;  2M0C A;  5A88 A;  1R6R A;  2PQ8 A;  3WTX C;  2EJR A;  4HW0 A;  3G05 A;  5JHU A;  1QJV A;  3U1D A;  2R5Y A;  1UG0 A;  3HXL A;  3BR6 A;  4IVN A;  4YXW A;  3WU2 C;  2XHK A;  4UVB A;  5B6I A;  2BW3 A;  1XN7 A;  3C7J A;  1RPW A;  4ESF A;  3AL0 B;  4KKS A;  1GQ8 A;  2K9M A;  1KMH A;  3BQJ A;  3ZMZ A;  2DW4 A;  3C2G A;  5D4S A;  1WI9 A;  2LTP A;  3OPO A;  1L0O C;  3S2D J;  5HNF A;  1T98 A;  5B3S H;  1JE8 A;  2H8W A;  1O8J A;  4GYG A;  4OZZ A;  2EIK H;  1YIO A;  2IA1 A;  1SD6 A;  2GJK A;  3HOT A;  4J00 A;  1XSD A;  5LRR A;  1VQ9 B;  1EP3 B;  2WTE A;  3N97 A;  4X0C A;  5K7F A;  1JB9 A;  3CES A;  2HOE A;  2XAU A;  3A0B C;  3LQQ A;  2ESN A;  4MFD A;  4G7H F;  2CW0 F;  1Y1W J;  5C1C A;  3BPV A;  1K83 J;  5D6E A;  4BE0 A;  1XG2 A;  2Q1Z B;  1YX3 A;  3WHB A;  4OJP A;  1B8I B;  4EGZ A;  1QFY A;  2JSC A;  1VQ6 B;  1LDJ A;  5FO5 A;  4UY8 I;  3CUQ B;  1VQN I;  4EVI A;  4G7O F;  3GFL A;  1FBS A;  4XLN F;  4CSW A;  5D5W B;  1RES A;  2Z33 A;  2INU A;  4XQF A;  3KPH A;  2MGQ A;  3E5Q A;  3GSI A;  3WBK A;  5FLM J;  4YZ0 A;  3PFI A;  4JK1 X;  1R23 A;  1IDY A;  2VBE A;  3EDP A;  4RAF A;  3S15 J;  3H3U A;  2O6G E;  3MMP A;  1O4X A;  2PYG A;  5H2F C;  4P22 A;  2COB A;  1TWF J;  5D6F A;  4KIB A;  1N8R D;  1X58 A;  2K7L A;  3S8P A;  1HBX G;  1G3T A;  5B5E C;  1ORK A;  3EPZ A;  2AQF A;  1YO5 C;  1Y0U A;  1QQ1 A;  2QY1 A;  2CH0 A;  2O0W A;  1JA1 A;  4MNU A;  1BIA A;  3H3V K;  2M7A A;  3WQZ A;  2QSF X;  2LDU A;  2HZT A;  3DKW A;  2P4W A;  4RDU A;  2FML A;  3FKI J;  4V2F A;  3A01 A;  4ESB A;  3BQY A;  1NK2 P;  3GRH A;  2P81 A;  2BHZ A;  2JPB A;  2HDW A;  3P5J A;  2MLG A;  2FUG 2;  1GVJ A;  3FM5 A;  2K4B A;  3W5V A;  3CJN A;  4KIT B;  5EG0 A;  1ETX A;  3CCS B;  2HOA A;  3LSJ A;  3AFH A;  2ZBU A;  2XAS A;  2XT2 A;  4EEF G;  1ZG3 A;  2CQK A;  5TIS C;  2QMU A;  1XGS A;  2V5I A;  1Z91 A;  4GGG A;  4MEY F;  4HQM A;  4HE5 A;  1FSE A;  3M1E A;  3GCM A;  1OFE A;  1FNB A;  1SFU A;  3N05 A;  2WSS A;  1OYI A;  3KLO A;  4AC9 A;  1YLF A;  3F8M A;  4NHJ A;  4KMU X;  4PFO A;  1AWC A;  2B0R A;  2DMP A;  3BNW A;  3SZG A;  4ZZL A;  4BXX J;  1J0R A;  1USS A;  4Z06 A;  1VLO A;  1IDK A;  1TT5 B;  2JWT A;  1X1D A;  1WSV A;  1IUF A;  4WWC A;  1WSU A;  2Q2E B;  1BI1 A;  1S6L A;  1SD7 A;  1XCV A;  1UEL B;  3DKX A;  3GZ6 A;  4F7Z A;  3HB9 A;  2FQ4 A;  1FTT A;  4E7Z A;  4CDG A;  2FVG A;  1OCC H;  4M9X A;  2K40 A;  4D7M A;  1KZL A;  3R6J A;  2RDP A;  4G6Q A;  1ZGA A;  2JTV A;  1PJ6 A;  4M3F A;  3GXO A;  3S1M J;  2X85 A;  1O8G A;  5KSW B;  1TYV A;  1WPK A;  1G7R A;  2YUH A;  4HF0 A;  3HOV J;  4MQ9 F;  1PE9 A;  1VJS A;  4B44 A;  4Z4T A;  4HNV A;  5EG0 B;  4C9Y A;  2ID6 A;  2KDO A;  2DFF A;  4LLG F;  1ZAO A;  4ETS A;  4UZE A;  1Q86 D;  2K3P A;  2DN0 A;  4I2O A;  4M4S A;  3BTI A;  2ZJP F;  4BQN A;  1FOK A;  5GPC A;  3ZPL A;  4DQ2 A;  4NB5 A;  2PLY A;  1DG1 G;  2PMH A;  3LVB A;  4F92 B;  1D1C A;  2Y0S A;  3A1Y A;  4MQV A;  5FFX A;  5H6R A;  5FRO A;  1VQK I;  1XE1 A;  1P4A A;  4C2M J;  4YZX A;  2GA1 A;  4EM1 A;  2PI0 A;  2O6W A;  2QQ8 A;  3LA7 A;  4U7D A;  4OMY A;  1C0W A;  4UVC A;  5CJ9 A;  1FNM A;  2BYV E;  3SEZ A;  2HEO A;  2JN9 A;  2V7V A;  2R5Z A;  3IH3 A;  2Q0O A;  2CGP A;  1N78 A;  4FET A;  2KIU A;  1QO0 D;  3Q0U A;  2W85 A;  3RKX A;  1HKQ A;  4M0L A;  2NXN B;  2Z6B D;  2HVR A;  4XRF A;  4YEI A;  2OCE A;  1SFE A;  2KJC A;  4BNC A;  1T6S A;  3T1B A;  4PJL A;  2DFE A;  3HHH A;  2GAU A;  1WOR A;  3JRA A;  2LSO A;  4XSZ F;  5EEA A;  4YIR X;  2BM1 A;  2WV1 A;  2BY0 A;  2ZJQ F;  2JIZ A;  1FDR A;  3Q9S A;  4BAY A;  3DPT A;  3FIW A;  3H9N A;  3LNQ A;  3I1F A;  2DA2 A;  2MH9 A;  4WF2 A;  2VFQ A;  3BT9 A;  3HHG A;  1MBH A;  3I58 A;  4P96 A;  2N8G A;  1UG2 A;  3OYE A;  4ZYE A;  4Q47 A;  3ZQF A;  1IN5 A;  2FNP A;  4C3J J;  1S72 B;  3I56 I;  2WAE A;  1HOM A;  2XUB A;  5CQG A;  2LYC A;  2D3L A;  2OQG A;  3VR6 A;  3OOU A;  3RI4 A;  5HOD A;  3ZQI A;  4BEH A;  5F0F A;  3TOA A;  2KPM A;  2WZN A;  3DBR B;  4UUV A;  3DU1 X;  2XF5 A;  3FZV A;  2R7Q A;  1VFC A;  2NNN A;  3TDZ C;  2JA7 J;  1VND A;  2DOA A;  5HLI A;  5L3B A;  1T5E A;  3SEJ A;  3U6B A;  1IW7 F;  2PLF A;  2UZK A;  3Q38 A;  4R71 A;  3MCZ A;  2R7W A;  4XNF A;  2WPD A;  3ZMU A;  1F5T A;  4NK6 A;  1HC8 A;  1EH7 A;  2W7Z A;  1BI2 A;  1OFD A;  2IS2 A;  2MA3 A;  5FB2 A;  2FQ3 A;  3QSY A;  3H1C A;  2RNG A;  2BN4 A;  2O61 A;  4U9U A;  3MKZ A;  1IXC A;  2MG4 A;  4O6J A;  3I3L A;  4I0B A;  5HVQ C;  1ZN2 A;  3ESW B;  2V9K A;  1Y39 A;  1BC8 C;  3PA2 A;  1N08 A;  5J8C A;  1OHH A;  1R49 A;  1JXS A;  3J80 K;  3GEZ A;  3ZMD A;  3FXQ A;  3CDI A;  1VQP I;  3UR3 C;  1BR2 A;  3VYR B;  3CCQ I;  2NS7 A;  4XLF A;  1FBQ A;  2Y2Z A;  3FMQ A;  3IH2 A;  4HDU A;  2HDD A;  4LLN A;  1WOP A;  1VF7 A;  5CVU A;  5FKK A;  1FNN A;  3OWT A;  1KU3 A;  2XKO A;  1N06 A;  2MC3 A;  4V2G A;  1Z3X A;  2OQR A;  1GAW A;  1TP4 A;  1X3Z B;  4PDK A;  3IUO A;  4XLC A;  2KIF A;  3PO2 J;  1Z0X A;  1TWG J;  3S2W A;  1P92 A;  1V3F A;  3MVP A;  4DJA A;  1A36 A;  3W6V A;  4RPB A;  4Z4U A;  3CCV B;  2CV0 A;  2MW8 A;  2JDI A;  4RB3 C;  3HM5 A;  2ZKZ A;  1ZG5 A;  2YPR A;  4M6Y A;  1SD4 A;  3R0J A;  3V8K A;  3RQI A;  3HC7 A;  2CU7 A;  2W48 A;  1KTV A;  4WK8 F;  1W0K A;  2ZL5 A;  4HG2 A;  1VQ4 I;  3BZC A;  3T51 B;  5HLT A;  2CFX A;  1QGP A;  5IYQ A;  3H0G J;  3BTC A;  1QH0 A;  4M71 A;  1FIA A;  3E6D A;  1LJ9 A;  2L7Z A;  4CCM A;  1RMG A;  4I0A A;  1JRG A;  2R7F A;  3O8H A;  4XD7 A;  3B82 A;  2FOK A;  3H5N A;  3PNV A;  2OBP A;  3GZ5 A;  1ZM2 A;  2DI3 A;  3VPR A;  4C2L A;  3A2K A;  3DU6 A;  4EJV A;  3RZD J;  2LG4 A;  3ZR8 X;  1B72 A;  3GFJ A;  4W8T A;  3OYH A;  1U8R A;  3S14 J;  3ZQ7 A;  1XDU A;  1T33 A;  1HF2 A;  1A31 A;  3ZC3 A;  3PIO F;  1JT6 A;  2H94 A;  3QP5 A;  2W84 A;  2PN6 A;  1ZEL A;  2DA7 A;  3ECH A;  3F3X A;  3JRD A;  4L9N A;  1VQ7 I;  3JRI A;  4P6Y A;  1X3W B;  1QA6 A;  2IAI A;  1I50 J;  2NOG A;  5F0H A;  3VSU A;  1FOX A;  1TQM A;  4BDY A;  4JBA A;  3QRF F;  2X6X A;  1OCZ H;  1SAX A;  2F2E A;  3BCA A;  4PAA A;  2BM0 A;  3ZMT A;  1K6Y A;  1IDZ A;  2QVO A;  5JFR A;  3GYH X;  1QHH D;  4PGO A;  2YX7 A;  1DAR A;  1KYW A;  2HQN A;  1DQU A;  2R3S A;  3WTY C;  2BGI A;  1QVF B;  2R7U A;  1MDM B;  2E1M B;  3OYN A;  4ZDL A;  2P7V B;  3RJP A;  3SDG A;  3LA3 A;  3ZPP A;  3FMS A;  2X4H A;  3OYD A;  3GO5 A;  4G8X A;  3B73 A;  2BSA A;  1R58 A;  4BHB A;  2F1M A;  1S7A A;  1QA2 A;  2VKH A;  3ZQQ A;  2LR8 A;  2G0E A;  3HZJ A;  4HA8 A;  3W2H A;  2ZZF A;  1ZGJ A;  2DTZ A;  3IRQ A;  2VBK A;  4HOB A;  2NTB A;  2HYG D;  3MFK A;  4IOA F;  2VBS A;  5CVV A;  3WTT C;  2FD5 A;  3F8F A;  3BLY A;  1S7O A;  3NAW A;  3HSF A;  3CUQ C;  4PZJ A;  3HOW J;  2OUM A;  4RLQ A;  2V7T A;  3B78 A;  1XQB A;  4OOV A;  3J81 k;  2AXT C;  2BGJ A;  2JT1 A;  2VFP A;  3PSF A;  5A8A A;  5FL7 A;  2QWW A;  4C3H J;  3JAM K;  4M3B A;  1VQ8 I;  2QEX I;  2G9W A;  3LSM A;  3GQ9 A;  3KZY A;  5FJ8 J;  4A3F J;  3CPW B;  3LFU A;  1G8X A;  3D0S A;  2ACJ A;  2F5E A;  4RM2 A;  5GAH J;  2WA0 A;  1ETK A;  1WH5 A;  1KC8 D;  2O9L A;  3G6E I;  1P4X A;  3GWZ A;  4D9J A;  4ZYA A;  5FLV A;  1HW5 A;  4M73 A;  2DOE A;  1AU7 A;  4II2 A;  2PMZ N;  4V02 C;  3V4G A;  2WWY A;  4XID A;  3T56 B;  2QKL B;  3SLD A;  4RLZ A;  2HYF A;  1PKV A;  3ZOB A;  3OSF A;  5F27 A;  3F8N A;  5DCF A;  1GLN A;  1KK1 A;  4DQL A;  5GV7 A;  4ZCI A;  1IGN A;  1MMG A;  2O8X A;  3LQE A;  5FKO A;  4HDV A;  2ESH A;  3IL2 A;  3KYD B;  3GTM J;  2XT4 A;  4K1X A;  4HPQ A;  4ZGN B;  1O3T A;  2NV4 A;  1O7L A;  1FYL A;  1VTN C;  1O7F A;  5JVG F;  1UST A;  4JOM A;  5FD5 A;  1HVX A;  2VJ4 A;  4B47 A;  4P1W A;  5E1W A;  2FX3 A;  1JHH A;  1K7A A;  2VNJ A;  5BNG A;  4CQJ A;  2CUF A;  2V9P A;  2KZV A;  1V5G A;  3T53 B;  1MJB A;  4I98 B;  4W8S A;  1B2R A;  1DBO A;  4M1K A;  2QKM B;  1IC8 A;  1EWY A;  3LSH A;  2DLL A;  1V5V A;  2UVF A;  3CDL A;  3L1P A;  2EZI A;  1Q1V A;  2QYU A;  4OWR B;  5M5W J;  2FMY A;  2VPL A;  3NWT A;  2E1B A;  2VT2 A;  4RB0 A;  3UKG A;  2V1U A;  2VB6 A;  1FRN A;  1IN8 A;  1XGM A;  2VOP A;  1AA7 A;  2F5V A;  3ABL H;  3LFK A;  1KTW A;  3CCU I;  3L7W A;  3PUB A;  4UZF A;  1H8A C;  4JX4 A;  3DTE A;  2QGG A;  4YII A;  4FX0 A;  4L5E A;  2PE3 A;  4U88 A;  1P7I A;  3BR2 A;  2CUZ A;  2VBY A;  3I53 A;  4AUX A;  1FTZ A;  2Q6I A;  1DP3 A;  1V5F A;  1TC3 C;  1OGJ A;  1OGM X;  2OD5 A;  1W2B B;  1A35 A;  4B3G A;  5K7Z A;  3D5L A;  1JHF A;  1I27 A;  1WGX A;  1TQP A;  1H85 A;  2R7R A;  1TLH B;  3QAH A;  5DS0 A;  4ASU A;  5LHG A;  2EK5 A;  4F91 B;  2HQR A;  1F9N A;  1X4P A;  2VKE A;  4UV8 A;  1K4Z A;  3GLL A;  3PL8 A;  4BJ6 C;  5K5O A;  1MBF A;  5E8I A;  4U7B A;  5H59 A;  3CCE B;  3VNV A;  2HTJ A;  1AOY A;  2STT A;  2OTJ I;  4LG3 A;  1IJW C;  5F04 A;  1Y8Q B;  4XRS A;  1IA5 A;  1RU4 A;  3HGY A;  2COM A;  2DA3 A;  4ZC3 A;  3S1Q J;  4PC1 A;  3CDH A;  1RZ4 A;  1K8F A;  2KLO A;  2L01 A;  2QSG X;  2VT3 A;  1ENH A;  4BY7 J;  2Y69 H;  2NVY J;  4I84 A;  3VSV A;  2ICW G;  1A5J A;  1HDD C;  4Y3O A;  1YIJ B;  1AKH A;  2W57 A;  2XGE A;  2NVT J;  2X6Y A;  3KET A;  3PIP F;  4FE7 A;  2E1M C;  5LHH A;  3FPK A;  4GCV A;  1T56 A;  2ZFU A;  3H0D A;  2CRV A;  2QLZ A;  3AG3 H;  4ZCL A;  2IGM A;  1KON A;  2DMQ A;  3DU5 A;  2LZJ A;  4DK0 A;  5CDF A;  2DOG A;  3VO1 A;  1GXQ A;  2O0Y A;  3IH4 A;  2P5K A;  2QE7 A;  2X48 A;  3I59 A;  3VYS B;  4YFK F;  1LQ1 A;  3TOB A;  2KL4 A;  2CBX A;  3ZUG A;  4Z4S A;  4V19 K;  1IZ1 A;  3WWG A;  3M1C A;  2DEU A;  2LMD A;  2ZCW A;  3BG5 A;  1WHU A;  1RET A;  4YFX F;  5J1Y A;  2W6J A;  3CCR B;  1DAB A;  4MYT A;  5FNZ A;  3WU0 A;  4RCZ A; 
#chains in the Genus database with same CATH homology
 1WJE A;  3L2Q A;  4C2U A;  4OAZ A;  2BW3 A;  2K5C A;  4BJ5 C;  2WAD A;  3AL0 B;  4KKS A;  1GQ8 A;  2K9M A;  1KMH A;  3GQB A;  4LIU A;  3C2G A;  5HNH A;  3OPO A;  1K28 D;  5HNF A;  1UD2 A;  2ZXH A;  2DIE A;  5AMV A;  2DXI A;  1O8J A;  4OZZ A;  3DQV C;  2XOK A;  3PNY A;  5TGT A;  4BQO A;  1TT0 A;  2VQH A;  3OL3 A;  3H9Q A;  3H35 A;  3FKJ A;  2XC7 A;  4CCL A;  2GJK A;  3HOT A;  3JUR A;  1X4O A;  4J00 A;  3DLA A;  1IDJ A;  2WY8 Q;  3GBG A;  4ZDP A;  4QPQ A;  4OJL A;  4PJN A;  4CUG A;  2IS4 A;  4W8R A;  3D5R C;  4E7K A;  3UW0 A;  3CES A;  4ZTJ A;  3FHN A;  2XAU A;  4YZA A;  3EUA A;  2IGO A;  2Z8G A;  5C1C A;  5C1E A;  4XON A;  1W36 C;  4BE0 A;  2XZL A;  4E0F A;  2D3N A;  1XG2 A;  2GOM A;  2Q1Z B;  1YX3 A;  2XF6 A;  4OJP A;  5CPR B;  4FAS D;  3W2W A;  4C2T A;  2NT6 A;  3W2V A;  4CSW A;  1O8F A;  2L5Q A;  4NC8 A;  4U49 A;  3OR2 C;  2INU A;  4XQF A;  2CUJ A;  4BDZ A;  4YZ0 A;  4BGD A;  4PSW A;  1D0Y A;  3HG9 A;  2VBE A;  3BCB A;  4EAT A;  2PYG A;  4OJO A;  1MMA A;  2KQR A;  4P22 A;  3GVK A;  2V7Q A;  2VL8 A;  3S8P A;  2VLA A;  2JVH A;  2VAS A;  3HPG A;  3LL7 A;  4F55 A;  4QPO A;  4ZJZ A;  3EPZ A;  4RMN A;  4J01 A;  2AQF A;  3FBN B;  3RSN A;  3S93 A;  4G6I A;  1SFK A;  3K4M A;  1HZE A;  2X1C A;  2QY1 A;  2HQA A;  2CH0 A;  2ZSH B;  2M3A A;  4IQJ A;  2O0W A;  3GQ7 A;  3K10 A;  3KEY A;  2M7A A;  3BCD A;  3WQZ A;  3L2R A;  4TKO B;  3GRH A;  1D1A A;  2F4I A;  3V42 A;  2HDW A;  4G6T B;  1RWR A;  2FUG 2;  3G2B A;  3HL2 A;  3E1S A;  3SEQ A;  2MYS A;  4KIT B;  2WBM A;  3EUH C;  3W2A A;  2L2O A;  1Z7L A;  1V0F A;  2IGN A;  3AFH A;  1QHG A;  2W1O A;  3CF2 A;  2LRD A;  2JVG A;  2WJV A;  4B3F X;  3IAS 2;  4YRV A;  3HOS A;  3LSG A;  4ANJ A;  3OYJ A;  1E1Q A;  3OE7 A;  4LIV A;  3CZ6 A;  2V4J C;  4G7W A;  4BUP A;  3CJQ B;  3DTI A;  3OEH A;  4F93 B;  3N05 A;  3VSL A;  2WSS A;  4DBQ A;  2XZO A;  2M4K A;  3C2H A;  4KT6 A;  4PFO A;  2LY1 A;  1O8H A;  2V26 A;  3SZG A;  4Z03 A;  4Z06 A;  4URR A;  1WMR A;  4NUB A;  1IDK A;  2O5R A;  4BU2 A;  3BC9 A;  3K4C A;  4AU7 A;  2JUG A;  1X1D A;  4XOR A;  2XGJ A;  1H8H A;  2Q2E B;  1UEL B;  3DKX A;  1EA3 A;  2X3H A;  4E7Z A;  4Y33 A;  2QXZ A;  1KZL A;  1YE9 A;  4XKC A;  3LNN A;  3SUC A;  1X0C A;  2IQ7 A;  2GOX B;  2WY7 Q;  4XLA A;  2LRE A;  4PJJ A;  2MFZ A;  2E5N A;  2NOJ B;  1V0E A;  2DCE A;  4GQN A;  2ZZG A;  2X85 A;  1O8G A;  1NG7 A;  3OYB A;  1WPC A;  3PSI A;  4E4H A;  1PE9 A;  2E60 A;  1VJS A;  4B44 A;  1W9X A;  4C9Y A;  1WJ5 A;  2O1D A;  2KDO A;  4NK8 A;  4TSF A;  5HKK A;  1PYV A;  2K3P A;  5FRN A;  2V4D A;  3VYU B;  1OB0 A;  4BQN A;  4OJ5 A;  1MND A;  2IS6 A;  3A3G A;  4XN0 A;  2VJJ A;  4II3 A;  3TBI A;  1D1C A;  2Y0S A;  3A1Y A;  4F92 B;  3VWB A;  4E7J A;  5FRO A;  4DIQ A;  4YZX A;  4XM3 A;  3OIQ A;  3EUK L;  2DJI A;  3CJR B;  2MAB A;  1MAB A;  4HNU A;  3ZXS A;  2HPM A;  4ZTF A;  4HNT A;  2R9V A;  3T9G A;  4BEH B;  2INV A;  2VBM A;  3B8Y A;  3SEZ A;  3LMM A;  4OZY A;  3OR1 C;  1J09 A;  4CCK A;  5HOO A;  1N78 A;  4FET A;  5CKT A;  3B4N A;  2L9S A;  1DGW Y;  2VJ5 A;  3OOC A;  3QYE A;  4E7H A;  1G59 A;  2NST A;  3GQ8 A;  2ZZE A;  4NNJ A;  1SAU A;  3DKY A;  4RLF A;  4B48 A;  2HVS A;  2XND A;  2Z6B D;  3QYB A;  1SKY B;  3KYL A;  2BSP A;  2HVR A;  2PJR A;  2XF7 A;  3AKZ A;  4BE2 A;  3BC8 A;  4BAC A;  1WJC A;  4PJL A;  2O0V A;  1WJB A;  1BOB A;  1E3X A;  3DTK A;  3H94 A;  2JIZ A;  3EQO A;  4KKU A;  1WFX A;  3DPT A;  3DPU A;  2GK7 A;  4JQF A;  1OFM A;  3D5S C;  3LSK A;  3E0J B;  3GQA A;  1N77 A;  3OYE A;  4AYB A;  4E6K G;  2W6I A;  1UAA A;  2KVO A;  2WAE A;  5CQG A;  2LYC A;  2D3L A;  3VR6 A;  2HZD A;  3OOU A;  4P5O A;  2KRH A;  1TZL A;  4BEH A;  1E0E A;  2GJR A;  4YZQ A;  2KPM A;  4F3Q A;  3ZIA A;  2XF5 A;  2ZTN A;  2R7Q A;  1CZF A;  2UUZ A;  3H5A A;  3U21 A;  2DOA A;  3F9K A;  3PNT A;  1T5E A;  3NE5 B;  3OYL A;  2VKD A;  3OYG A;  1T0F C;  4G7X A;  2R7W A;  4XNF A;  2ZZQ A;  2WPD A;  1H80 A;  2R7T A;  4NK6 A;  2NTP A;  2CS3 A;  2VXD A;  3I9V 2;  4CA0 A;  3CP8 A;  3OYC A;  3L2V A;  2IS2 A;  4XR6 A;  1OOC A;  2ZXI A;  1X1C A;  5DN6 A;  3ZGK A;  4X0G A;  2RNG A;  3MKZ A;  2IXS A;  3I3L A;  3S32 A;  5HVQ C;  1VBL A;  2V9K A;  4MXN A;  4KIS A;  1OHH A;  1E79 A;  2LOO A;  3UNG C;  3HKZ A;  4E7I A;  1U0J A;  2LC2 A;  3UR3 C;  1BR2 A;  1MMD A;  3VYR B;  2NZM A;  4XLF A;  2F43 A;  4C30 A;  4XOP A;  1VF7 A;  1W0J A;  4DK1 A;  4Z05 A;  2EWE A;  3OWT A;  2X51 A;  2L9N A;  4XLH A;  1Z3X A;  1Z21 A;  4ZDO A;  1COW A;  2JSP A;  3H5R A;  3IUO A;  4XLC A;  1PXZ A;  3DWL E;  4L8J A;  2R7X A;  5FRM A;  4PUS A;  4DJA A;  1O8I A;  3RPU D;  2HU9 A;  1Y6I A;  2CV0 A;  4XKW A;  2JDI A;  4EW9 A;  1BR4 A;  2MC4 A;  2V1N A;  1ERD A;  1OGO X;  2ODL A;  2X6W A;  3OS0 A;  3IAM 2;  3W3C A;  3OAA A;  1BHE A;  3OL4 A;  3HC7 A;  2CV2 A;  3IP4 B;  1W0K A;  2M0M A;  4XL9 A;  4HG2 A;  3S3M A;  1LKX A;  4Y4R A;  2KHM A;  3ZRG A;  3CP2 A;  5HLT A;  3T51 B;  4DNT B;  3VST A;  1PLU A;  2K9L A;  1I8D A;  3A35 A;  4E7L A;  3KX2 A;  1T95 A;  4CCM A;  2LBF A;  2LY2 A;  4CCN A;  3M8J A;  4IZZ A;  1RMG A;  1JRG A;  4XD7 A;  3H5N A;  2DT6 A;  3PNV A;  4C2L A;  3A2K A;  3DU6 A;  2WJY A;  2LG4 A;  3ZR8 X;  4W8T A;  2Z16 A;  4HIZ A;  2R7V A;  1FX0 A;  1WTH D;  3OYH A;  3S3O A;  4N4N B;  2PEC A;  2UWM A;  4W8Q A;  2HLD A;  1DBG A;  3K4N A;  3FDY A;  1ZEL A;  1PJR A;  4PFP A;  3GVL A;  2NSP A;  2V31 A;  4DGW B;  3FY3 A;  3VSU A;  2Z2S B;  3S3N A;  4BDY A;  2X6X A;  1UD6 A;  3BCA A;  3L2U A;  3K70 D;  2W4S A;  1K6Y A;  1X19 A;  1LVK A;  2M4G A;  1QHH D;  1LDK B;  2W00 A;  4CZC A;  3HAG A;  2LBF B;  3HUG B;  1DQU A;  2XDV A;  2OV7 A;  2R7U A;  2E1M B;  3OYN A;  3FPP A;  4ZDL A;  2NTQ A;  4HSR A;  2IS1 A;  3QOE A;  2L7K A;  5IK2 A;  3ZPP A;  3ZSC A;  2ZSI B;  3OYD A;  3OY9 A;  1WJD A;  4PK4 A;  4LIT A;  3OS2 A;  2Z1D A;  2UV1 A;  3FBI B;  2F1M A;  3DEE A;  2MD0 A;  2VJI A;  2V6E A;  2VKH A;  1BN8 A;  2E5Z A;  3K4B A;  3ZQQ A;  1MMN A;  2R7S A;  3K4L A;  2ZZF A;  4IX7 A;  3J7A Y;  1HA8 A;  2VBK A;  1WJF A;  2NTB A;  1EE6 A;  1NRK A;  3L2W A;  3OMY A;  3MD2 A;  4TT3 A;  4HWV A;  4KKT A;  4UZU A;  4HRI A;  3BLY A;  1BPL A;  2JJ2 A;  2LH9 A;  1WJA A;  3FKS A;  2OUM A;  3K70 C;  1S9H A;  4RLQ A;  4NQW B;  1BLI A;  5KHD A;  2UVE A;  3PSF A;  1NBM A;  5FL7 A;  4DNR B;  3VSK A;  1OR7 C;  3BG7 A;  3OYI A;  1MNE A;  4KJZ A;  3LSM A;  4MLO A;  3GQ9 A;  3PFY A;  1JTA A;  1IB4 A;  1OFL A;  3MKW B;  1UD5 A;  4HST A;  3LFU A;  1G8X A;  2BW3 B;  2BVM A;  4RM2 A;  3RCO A;  1UD3 A;  2WA0 A;  4PMH A;  2XZP A;  3OFN A;  3VYT B;  3OEE A;  4D9J A;  1VZ0 A;  4ZYA A;  3CMM A;  2R4G A;  2VQG A;  4ITV A;  4YEL A;  3OS1 A;  1JI8 A;  3ZPN A;  4II2 A;  1HG8 A;  3BCF A;  3B90 A;  2X8K A;  3T56 B;  2QKL B;  1VLY A;  5KCM A;  1PKV A;  2X53 S;  1O8M A;  2WAQ A;  1V5E A;  1FMW A;  1GLN A;  2RRE A;  2O17 A;  2NT9 A;  1MMG A;  4R79 A;  1KCC A;  3GVJ A;  2HPI A;  1YX5 A;  2AQE A;  3K6G A;  4CH7 A;  5LD2 C;  3QOD A;  2CK3 A;  1P9Q C;  4XMY A;  1O8L A;  4HPQ A;  3KRG A;  1K5C A;  1N75 A;  3A4C A;  3DPL C;  1WP6 A;  4GRI A;  1UD8 A;  1KCD A;  4JOM A;  1HVX A;  3VDX A;  2VJ4 A;  4B47 A;  3H9J A;  4P1W A;  4XN3 A;  4CCJ A;  2WB1 A;  2HVQ A;  2P0W A;  1NG6 A;  3HPH A;  3SDB A;  2KZV A;  1V5G A;  3T53 B;  4MR0 A;  1O8E A;  4W8S A;  4AVZ A;  3DDY A;  2VQC A;  1O8K A;  3VMV A;  1DBO A;  3KEW A;  1O88 A;  2QKM B;  1E3Z A;  2M5S A;  3LSH A;  3K4J A;  2UVF A;  1DGR M;  4B43 A;  2X1D A;  4OWR B;  3LSI A;  1O8D A;  2VPL A;  3NWT A;  2E1B A;  2W7N A;  3OIP A;  3AL0 C;  3OW7 A;  2GK6 A;  2VB6 A;  1BR1 A;  4YEJ A;  1Y56 A;  4B3X A;  1AA7 A;  2F5V A;  2CW8 A;  2I8D A;  2V7F A;  1KTW A;  3PUB A;  1E1R A;  2DT7 B;  2CW7 A;  2RQQ A;  1OLT A;  2WZP P;  4IQ4 A;  2BVL A;  2JA2 A;  3DTE A;  4N4O B;  2JJ1 A;  1E43 A;  4FXU A;  5KNL A;  2GJP A;  1NHC A;  1AIR A;  1Z3Y A;  1D1B A;  1W36 D;  4DOZ A;  2CMP A;  2CUZ A;  4DBR A;  1UD4 A;  4BL0 B;  1DP3 A;  2VXZ A;  1V5F A;  3BH4 A;  2KRC A;  4NC7 A;  1OGM X;  2O04 A;  2VQL A;  4B3G A;  3OYA A;  3D5L A;  2F6C A;  2R7R A;  4U87 A;  4RM3 A;  4ASU A;  4F91 B;  3A3B A;  3MKY B;  4U4B A;  3H9G A;  1X4P A;  3OYK A;  3PL8 A;  4BJ6 C;  3OYF A;  3SYT A;  3JU4 A;  3NWS A;  2ELJ A;  2XSJ C;  4U7B A;  4BQQ A;  2PJR B;  2QX3 A;  3LMW A;  2W82 A;  4LG3 A;  2OC6 A;  1FMV A;  4CCO A;  1IA5 A;  1X1A A;  1RU4 A;  3VMW A;  4ZC3 A;  3PJR A;  2KMU A;  4XKV A;  2WAF A;  2A5W A;  2VIX A;  4HEA 2;  2KLO A;  2R7O A;  1MW7 A;  4PSX A;  1LFP A;  3EQN A;  1BMF A;  4XLE A;  4BE1 A;  3ONQ A;  2ZTG A;  1EFR A;  4I84 A;  3ZCO A;  3VSV A;  4Y3O A;  4F52 A;  2X6Y A;  4PJM A;  2E1M C;  3RQ4 A;  4XKB A;  2ZFU A;  4BJT A;  5CQE A;  2HNH A;  4H4K C;  3OYM A;  4D1Q A;  3H0D A;  4IKF A;  2PYH A;  2CFO A;  1KON A;  2IGM A;  4BXF A;  3BG6 A;  3DU5 A;  2LZJ A;  4DK0 A;  5CDF A;  3QYF A;  1IRX A;  3TL4 X;  5JHF A;  4OJ6 A;  3K4K A;  2M7B A;  1X1B A;  4JMQ A;  1I18 A;  1QU3 A;  2QE7 A;  4E7S A;  1QCX A;  2X1E A;  3VYS B;  2KP6 A;  2PMZ A;  2KL4 A;  3RTR A;  2IGK A;  4XOT A;  3WWG A;  1D0Z A;  2BOL A;  4OAY A;  4Z1M A;  3M1C A;  1D0X A;  3MMY B;  5LFA A;  2A6T A;  1R6R A;  1H8E A;  2W6J A;  3TMO A;  3G05 A;  4BS9 A;  1QJV A;  1UG0 A;  3HXL A;  2CV1 A;  4YXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...