4XKWA

Tailspike protein mutant d339n of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
total genus 233
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkwA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkwA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkwA02
2BSPA 1VBLA 4U4BA 2VJJA 4YZAA 2UVEA 3VSTA 1JTAA 1XG2A 1O8MA 1IB4A 1OOCA 3GQ9A 1RWRA 1JRGA 2IQ7A 2QY1A 4XN3A 1PXZA 4XKWA 2O1DA 1WMRA 2VBMA 4XLCA 4MXNA 4NK8A 4W8QA 4Z06A 4XR6A 4XKVA 1RU4A 4OJOA 2O04A 4XLEA 4OJ5A 4OJLA 1QCXA 1KCDA 2X6YA 1PLUA 1DBOA 1NHCA 3ZSCA 4Z05A 4XLFA 4XNFA 3ZPPA 3WWGA 2NTBA 4XQFA 4XL9A 2UVFA 1O8JA 4W8SA 3GQ7A 3VMVA 4XOTA 3GRHA 4XM3A 1IDKA 4XMYA 4U49A 1O88A 4YZXA 3FY3A 2VJIA 3B4NA 2PYGA 2ODLA 1X0CA 4MR0A 1KCCA 2PYHA 4OJ6A 4YELA 3GQ8A 2X3HA 4XN0A 4XLAA 1RMGA 2NZMA 4EW9A 5AMVA 1EE6A 3EQNA 2X6XA 2QXZA 1KTWA 4C2LA 4URRA 1O8FA 4PMHA 1AIRA 1O8DA 3GQAA 2INUA 2NT9A 1H80A 1O8GA 3VMWA 1HG8A 1OGOX 2EWEA 4OZYA 4XONA 4Z03A 1K5CA 2NSPA 4HWVA 1PE9A 3JURA 3T9GA 1OFLA 4YZ0A 2O17A 4W8TA 4OJPA 3UW0A 1OFMA 2INVA 2NTPA 1IA5A 1O8KA 4YZQA 2O0VA 1O8EA 1BHEA 3B90A 3VSUA 1O8IA 1GQ8A 4XOPA 1BN8A 4NK6A 2X85A 4AVZA 1QJVA 1CZFA 1O8LA 1OGMX 5C1EA 2PECA 4I84A 3LMWA 5C1CA 4XORA 4OZZA 2Z8GA 4XLHA 2NSTA 2QX3A 2O0WA 1O8HA 4YEJA 1DBGA 2VBKA 3B8YA 3SUCA 3VSVA 4W8RA 1IDJA 3KRGA 2NTQA 2VBEA 3EQOA 2NT6A 2X6WA
chains in the Genus database with same CATH superfamily
3TW7A 3CC2I 3ECHA 2IGMA 2KISA 3P9IA 1R9TJ 2VJJA 4EVIA 3OYFA 1A8PA 3FKJA 2FJ1A 4E7JA 1T6YA 3MEXA 5LHHA 4H4KC 5EZHA 3WBKA 2GOXB 3GCMA 3TW6A 2F4OB 1ZQ3P 2V1NA 4X7DA 1TYUA 1G7TA 2QSGX 2VBMA 4LIVA 3MFKA 2M4GA 1W0JA 5EEHA 4BJ5C 2YWHA 1NHAA 1RR7A 2DA5A 2KL4A 3ZPNA 4BQAA 1MSEC 3OJWA 3LSPA 2DA4A 3QOPA 4NBQA 2O04A 2JPCA 1OB0A 5B66C 2DA6A 3HB9A 5GPCA 1NHCA 2CV1A 4XD7A 3I9V2 4M2LA 1QGPA 1TVCA 1QVFB 5DUIA 1KMHA 2HQ5A 1X2NA 3HYIA 4OP7A 1YI2B 1X3ZB 2R92J 2V7XA 1QRBA 3V7AA 2GPJA 1QZEA 3OW2B 2OZ6A 1FMWA 1Z7UA 5HLTA 3D5SC 4FHTA 1S7EA 2XSJC 4U49A 4A3CJ 4M74A 1KTVA 1TWFJ 4IOCF 1W4MA 3I4PA 3PM1A 4EJOA 3O3KA 3CDLA 2ZJPF 3SJMA 1B72B 5IT9K 2RC5A 1DABA 3DKYA 1EV7A 3KYCB 3R60A 4MHGA 1WRJA 1Z7LA 2E1OA 1X4OA 2L5QA 4CCMA 5ICGA 1N0UA 5DD8A 2R7DA 5BSYA 4XLAA 4DJAA 3PNYA 2CWEA 3PUFA 4BE2A 3K9TA 2QF7A 3FBIB 3R6KA 3MCZA 5LHIA 5F27A 3PO3J 4ROXA 2R6HA 2PFBA 3HL2A 1AIRA 3ZZTA 5DUKA 2VNHA 2DMQA 3PUMA 4ZTJA 1BQEA 1I3AA 3KZIC 3NWTA 1QRYA 5HNFA 2H6BA 3M9AA 2VUMJ 5HODA 4TMTA 4OZYA 4Z03A 1ENHA 3CUQB 1I7PA 4X8IA 2V7QA 4IHYA 1KU3A 2VJ5A 4N0BA 1XD7A 3J80K 3A0BC 2P81A 3WTVC 3DCFA 3QPLA 2INVA 1POGA 3ZMTA 1DU0A 1Q1VA 2X85A 2Q0OA 4BACA 2DO7A 4FISA 4XIDA 2ZMEA 1QU3A 1UHWA 3CC2B 3ELKA 2V1XA 3K1PA 2A6TA 2HCJB 3TGNA 2QX3A 1N05A 1X3WB 1T33A 2HTJA 4A93J 5CPRB 2E1MC 2DFFA 4E7SA 4OIPF 1KK3A 2JJ7A 3CMAB 2H09A 5HDNA 3FXUA 1PYVA 5D8KB 2C78A 3QP5A 2W6IA 3BJOA 2V6EA 3BQYA 2KJBA 1RC9A 2B7EA 3N4MA 3LFKA 2XUBA 5FFXA 2J8KA 4D7MA 2H1LA 3OS2A 1XDSA 4DNTB 1SFKA 2HNHA 3GZNB 1E62A 2L3DA 2O3FA 3TH0A 4DZPA 1YG2A 3V8LA 1QFYA 1R36A 2KDOA 3L7WA 3TP3A 1HSJA 3TQNA 4EEFG 3D1NI 1OCOH 2YWEA 3RKWA 2CQXA 3FPPA 1K28D 3BNWA 4CXFA 1WOPA 3DXJF 1W9XA 3HC7A 1U5TB 5F0HA 3WQZA 2V7FA 4HLYA 3I59B 4M4SA 1RWRA 2ZJ2A 3WE2A 2FOKA 5EZGA 5D8LB 4A3DJ 4CA0A 4Y52J 1ZGAA 2QY1A 2AXLA 3KP4A 1FBSA 3HJEA 4YFXF 2R7ZJ 1P2FA 1RNLA 1YW7A 3M1CA 4V19K 4UB8C 2F5VA 4D9JA 4B1RA 5IY5H 2LTPA 1VLYA 2LRDA 1P9QC 1M90D 3TO7A 1E1RA 1IHMA 2VNIA 3AG1H 1QG0A 4UUTA 1W35A 1P7JA 1W5TA 4Z4YA 1OISA 2PJPA 2EB7A 1FP1D 3EPZA 1J75A 1KZHA 1BLIA 1AKHB 2YS9A 1LVAA 3PIOF 3BR3A 4G9YA 2DMTA 1T39A 2GK7A 2ME6A 1SVLA 2X6YA 4XLPF 2CS3A 2ZTNA 3ZBUA 1OYYA 3DTKA 1XGMA 2X1EA 2J7KA 3E20A 2WV1A 4KIBA 4G94A 3FISA 4RAZA 4G7XA 5F1JA 1XS9A 4QFMA 3VO2A 2DJIA 4XM3A 3FKIJ 3CCVI 1D0YA 2W00A 1MDMB 1TTYA 3F8FA 3CP8A 2K3FA 3AAFA 2ZSHB 2ZL7A 2CFOA 4M3EA 1ZHFA 2RN7A 5IP7J 4LG0B 1XDUA 1YIOA 1IN6A 1QQIA 4II3A 3B82A 2LH9A 1O7FA 1X1BA 4ZYEA 1ZM2A 3OJXA 2XAHA 2XIGA 3ABKH 4H0EA 1X1PA 4YAUA 3B78A 1YHQB 3L9FA 1LNWA 2VKEA 1Z9CA 1C0WA 3BPVA 2GZWA 2V9KA 4O5VA 5F6FA 2VZLA 1IG7A 4IHTA 2K27A 3GMEA 1NB0A 1NDHA 4IJAA 4P9UA 1QHHD 4P3YA 3FBNB 2LLKA 1FNMA 2K4BA 4F91B 3X2QH 1SC7A 5FROA 5FLXZ 3IWFA 3JRAA 2NSPA 1TT5B 3O2PE 2OTJI 3LNQA 1UMKA 3Q39A 1JUMA 1OCPA 2O17A 4ZGQB 2GM4A 2DK5A 2NNYA 2CJJA 1O8EA 2D1HA 2WAFA 3FXRA 1TYXA 3D0SA 1SM4A 2V31A 1XG1A 4P12A 4U87A 4A3LJ 1PJRA 4KJZA 3A01A 1OHHA 5FKKA 2ZL5A 4M72A 1IW7F 2Z8GA 3GXOA 2KIUA 4TSFA 2NSTA 1WXRA 1Y0YA 3LFUA 3K1MA 4FX4A 4UVAA 4N9HA 3Q6QA 4LBYA 3BG5A 2IOUG 4JX5A 5HKKA 4LLNA 2IAIA 1P4MA 3WYAA 4YALA 3OV8A 1NJID 1FWZA 1JUSA 2YU3A 1XE1A 3OR1C 4ZTFA 4DYQA 4EJUA 4BJTA 3SZGA 2CQNA 1ZH5A 3LWFA 3SYTA 2BN4A 3VOEA 1IJEA 4M3BA 1Z67A 2AS5F 1IDZA 3OYNA 2FF4A 1S8NA 4OOIA 2DCEA 1LDKB 1MMGA 4B09A 2BGCA 3BCBA 4UB6C 1AU7A 3DU5A 4HV6A 4HZFA 4QWQA 5D5UB 3CTAA 2NRAC 4E6KG 1A04A 3K4JA 2DPUA 2VFMA 2XGEA 1HSTA 1WJFA 2XGXA 4CCOA 2JK3A 2X4HA 1HCRA 1EH6A 2W7ZA 1KK0A 2GLOA 2LMDA 1WTHD 1U0JA 3K4NA 4E7LA 1WMRA 1N07A 3CCVB 4A6DA 2FX3A 3KIOA 3IV5A 3DDYA 5BPDA 1HQCA 3W2WA 1IAWA 2R93J 1HDPA 1QZYA 1T08B 2YWGA 2XVCA 4AM3A 1VQLI 3LA2A 4OJ5A 3SFZA 5DS0A 4RS8A 1FYMA 4HPQA 2AHOA 3HHGA 2VKHA 5LEKA 4BJ6C 2XAUA 4F93B 5IYNA 1QBJA 4RD0A 4XNFA 1LEAA 5LD2C 4XL9A 4MNUA 3WU2C 5FB2A 4S04A 2UV1A 2UXNA 3MHPA 1FY7A 2BY1A 5B1AH 3CCJI 1H0MA 3K2AA 1B8IA 4BE1A 1H8HA 4BQNA 3BCAA 2LDUA 3KEOA 4RA2A 4KDPA 1X0CA 1SMTA 3CO6C 3BQZA 1HXDA 1HW2A 1LFBA 1BR2A 3LAJA 3MKYB 1SFUA 3CC7I 3AVUA 3SFIA 1I18A 4BAYA 2F5CA 2XB0X 5J4VA 4RJLA 2DA7A 4M71A 3G1OA 4QVJA 1GDTA 3PNVA 2X48A 2HGCA 3ECOA 3HPHA 2XF5A 4OOXA 3TBIA 3OYBA 1R1VA 5KK1A 4RAFA 2VODA 2ZZFA 4IRGA 2R7WA 4H9GA 1F9NA 1A5JA 2QWWA 3IRQA 4DQLA 4NUBA 4UVCA 3M1EA 1U3EM 1UD4A 4HF0A 1R5ID 4ENNA 4CQJA 2QEXI 2V5IA 3GUDA 4HWVA 4TMWA 1BR1A 1H9TA 2PBIA 1NBMA 2QLZA 5JVGF 4RPBA 4L0YB 4AVPA 3DKXA 1TTTA 2OA4A 2V4JC 3H3VK 2EV0A 3GQBA 1F60A 4WXDA 1OFMA 1A6QA 2GJRA 2JRMA 3W5VA 3RKQA 4RM3A 3ZQHA 2A61A 4HX7A 3C1DA 1LB2A 3F8NA 1EFUA 4BH9A 2LKPA 3DP7A 5JFRA 4UNOA 1E3XA 3M8FA 1DQUA 4IO9F 1EH8A 3I5UA 4LBZA 3SYJA 4WF2A 2E60A 4HE6A 4S05A 4OMZA 5EEAA 1DU6A 3R6SA 3ONYA 4C0SA 1EKEA 3SEQA 3WHCA 4CO8A 1W36D 3WGIA 1QVUA 4ETSA 5LLQA 3OOUA 2CV2A 2IGOA 2YPRA 4PABA 3KE2A 1PP7U 4OPOA 2A69F 1ETXA 3GIRA 3BG7A 4BHBA 1RETA 1VF9A 1BJKA 1X58A 4MO7A 2HWVA 4UXNA 4YRVA 4X7FA 5BS6A 4UY8I 2OCCH 3W6JB 1VQLB 1WSVA 3QODA 3JRBA 4IHVA 1M1EB 5BSXA 5ILUA 2P6SA 3A2KA 5EJCA 1OFEA 1B4AA 3GQ9A 4QVAA 5DTDA 2VL8A 3QU3A 4P2NA 2VQCA 2E2JJ 3RI4A 2ZO4A 4XLCA 2ZCWA 4ZH4F 1SAXA 3FM5A 4HEA2 1TC3C 4B3AA 4A3GJ 3CCJB 1KRHA 3JAMZ 3VNUA 2M4KA 1W87A 5L3BA 1IRZA 3S93A 4LOCA 5C4XJ 2XC7A 4V02C 2C5BA 2RREA 3T5XA 4OJLA 1KA8A 3GO5A 3CC7B 1ULYA 4ZYDA 5KAFC 2XRNA 2M5WA 2PLFA 3CUQC 5H6QA 5E8IA 2VBVA 1XB4A 2NTBA 3CC4I 4Q4ZF 3GTGJ 3CCQI 2V7VA 1TLHB 2C77A 2VOOA 5B3SH 4RD3A 3PL8A 1FPQA 2ID6A 3RYPA 3E6DA 2DJNA 3IH4A 3K7AJ 1X2MA 2VJ4A 1VQ4I 3A3BA 3J81k 2VXZA 4CCJA 2LY9A 4DOZA 2VJIA 1IV6A 2BHYA 4ENMA 1YX2A 1WJEA 5E18F 2COMA 3ASPA 2G7HA 3LSKA 3UR3C 1J9ZA 2QEXB 1K4SA 3NB2A 2ZKZA 3M7GA 4S0HB 1YJ9I 2HKXA 5FKMA 4OINF 1YJNI 1OCZH 3BT9A 1SANA 3R0JA 4Z4WA 4PZJA 2YU9J 2NZMA 1SFEA 4LB5A 3W2FA 1YIJI 1HW1A 4NQWA 3CMYA 2LP0A 4E7KA 1KU7A 3KLNA 5LGNA 4LLLA 3TMOA 4Q7JB 4ZGNB 3VPRA 3DEEA 2XF6A 5CVRA 2R5YA 2FNPA 4PFOA 4IX7A 1OJLA 2LNBA 1VQ5I 2C6YA 4PMHA 2VN2A 1WDTA 4HW0A 4MIMA 3MN2A 5IYQA 5JLVC 4AC0A 2WSSA 1LPQA 1HVXA 2ME0A 4CYCB 2R5ZA 2DMUA 1ORKA 1QH0A 2JJ1A 2HVQA 2ICWG 4CCKA 2HYFA 4EM1A 4EV0A 2NVTJ 4N3NA 2EFQA 2ZZQA 2ZFUA 4A3BJ 1ZRDA 1Z21A 2R7OA 2GXBA 2ZMEB 1ZK8A 3L2QA 4UZFA 1IRFA 4EJWA 3AL0B 3CCRI 1BJZA 3BROA 3N05A 1TWHJ 4D5CA 1BHEA 5JR3A 3VSUA 3ES9A 4ZCLA 1CZFA 2LVSA 2YX4A 3Q0WA 1JTYA 3VYSB 1FRQA 3LSIA 3RIQA 1WQ2A 2W4SA 2V4DA 1BIAA 4DQ2A 1VZ0A 5EG0B 4PC6A 2RAEA 3R6JA 4U9UA 2RKHA 3S1NJ 2OYNA 4RCZA 3B8YA 2PMDA 4CZCA 2VONA 4W8RA 1MD0A 3K4KA 2Q8KA 3E1YE 4NCNA 4OPVA 3P5JA 3ASRA 1YW8A 4G1BA 1FJLA 2VQHA 4Y9UA 2QA4B 2WZPP 4UUSA 2GJPA 1ZM3A 5A2QZ 2B7CA 2QMUA 4CCNA 1UD5A 2CF4A 4ZCMA 4GCVA 3PA2A 3HEFA 3H5RA 1Q82D 4MLOA 2XGJA 5FD6A 1ZR4A 2WWYA 4E0FA 3HRSA 2F6CA 3WTYC 1YO5C 4BNCA 1REPC 1G2HA 3CMEB 3GFJA 1BPLA 2CRVA 3U9GA 1T56A 4AD9A 5LGTA 5JHUA 3H3ZA 2DFIA 1H9GA 3I0TA 4II2A 2XKPA 4I98B 4D5FA 2AHQA 4ZYHA 5LEJA 3ERED 2JQ7A 2ID3A 4P6YA 2ZFWA 1DPRA 1I1GA 4UVBA 3CC4B 4KYWA 4YIRX 1WI3A 2E5ZA 4A69C 2DA3A 4NK8A 3LJYA 2MW8A 1SD5A 1XGSA 2DFEA 3RYRA 3K10A 3OS0A 3MKZA 5E1WA 1F4KA 1GVDA 3W2GA 3IAM2 2QENA 4CYDA 1VQ4B 3CZ6A 3N90A 2JVGA 1IN4A 2HOEA 1RU4A 1ZG3A 2DQLA 4N4NB 3G4SI 3ZQQA 4UAJA 2CYYA 2EILH 5J1UA 4HQEA 3QWLA 1W2BB 3CCMI 1YJNB 3KP6A 1E79A 1B59A 1D1CA 5IYCJ 1T5EA 3IAS2 2QTZA 4RDJA 2QQ8A 5CVIA 3I55I 2ETHA 2CUJA 4A0YA 1F1ZA 4KN7X 4TKOB 3KEYA 1OKRA 1L0OC 3W3CA 1RQRA 2MC3A 1U6GA 4HF2A 2BXZA 1HBXG 4UZEA 3GWZA 3GRHA 2VT3A 2XSDC 3Q38A 4IW3B 2YUHA 3BR0A 2JA2A 3P26A 4PCQA 5CDFA 3BH4A 5JVTA 3WTXC 3C18A 3F72A 2MH9A 3T56B 1MBGA 4F7ZA 3L1PA 3HTUA 3MKLA 2X3HA 2PMHA 2V79A 4BY1J 1H8AC 1WH5A 2DW4A 2R7RA 1D8TA 1RMGA 1EWYA 3PIPF 1YX5A 3EQNA 5AN9A 2D74A 4YHBA 4IRIA 1KONA 5DEQA 5KNLA 1ITYA 4CZZA 1N8RD 4GRIA 4U7BA 3R4KA 2VIXA 3QYEA 1Z3YA 5M3FJ 1TWGJ 1ACIA 2R7VA 4KMFA 2QE7A 3S16J 3HIFA 3WNCA 4XONA 4DIQA 3W2IA 1Y1VJ 3JURA 2WA0A 1OFLA 4X6AJ 1DGWY 4A3MJ 4IHSA 4Z4ZA 1ZKGA 2ECBA 1MBEA 4OJPA 5CVJA 2ZSIB 3AG4H 3E5XA 4O6JA 1ETVA 4MQVA 2FD5A 3VEPA 3Q3SA 3J81K 4PC2A 3I53A 3DPLC 4EJVA 3MMYB 3CRZA 1IC8A 2Y0SN 2M2EA 3T8RA 1I6XA 1P4WA 3ZUGA 1O8LA 1YI2I 1K73D 2E1NA 2QBYB 1XSDA 2DQRA 3A8KA 1OR7C 3CCUI 4RB3C 5FLXK 4X0GA 3SQVA 2NNNA 1XC5A 4E7HA 1AWCA 2Y0SA 1LFUP 2AO9A 3JSOA 1JHHA 2K86A 4WX9A 4I01A 1QHGA 2H1KA 3PUNA 4A5MA 3SKBA 2QN6A 1BMFA 1SD4A 2YSRA 3FXQA 2W84A 1MZBA 1TT0A 3CJRB 2DEUA 2DDBA 2W25A 2E1BA 4XICA 4KH3A 2BVLA 2JUCA 1RQPA 3HKZN 1GVJA 3H9QA 4P9SA 1JNYA 3ZZ0A 4M0LA 1DP7P 4X0CA 2RQPA 2CW7A 5H2FC 3V76A 3VSTA 1XCBA 3ZPLA 2KIFA 2Q6OA 1I3QJ 3BDDA 4Z1MA 3ZN1A 3G1LA 3DU1X 1J09A 1KQ0A 4L0ZB 2XTXA 5IYRA 1TYWA 4R71A 3S17J 4KUMA 3GTMJ 3HKZA 3H9JA 4I76A 2IS6A 3A8IA 4RD4A 3H1CA 2A6HF 4AUXA 1QZZA 3FMQA 4HA8A 4NB5A 1K79A 3FZVA 1N0VC 2HEOA 4OIOF 1IXSB 1W7PD 2CMPA 2QVOA 4JRAC 4DQKA 1KQ8A 4JOMA 1BI0A 2VLAA 3ZIAA 3TO9A 4XK4A 2E7XA 2J5PA 4X06A 1HA8A 2XNJA 1LE8A 1B8IB 2EZHA 1HF2A 5GV7A 1MH3A 1VNDA 2LY1A 4L5JA 4A5NA 3K0LA 3SDBA 1AA7A 3WWGA 2OTLI 3W2VA 5LBQA 3E3VA 3H3UA 3CMAI 5F64A 3UKGA 3GQ7A 1XX5A 4XOTA 1DP3A 2L7FP 4AU7A 1SKQA 3MKWB 3KYDB 2HXOA 5B6IA 4C9YA 1O88A 4DBRA 1XGOA 2IGKA 2E19A 2F1MA 2ZZGA 2EA4A 1P92A 1ERDA 1G59A 3CJQB 1S3JA 2GA2A 4YELA 1T95A 4F92B 4UUVA 4NNJA 2HOSA 4BEHB 4WWVA 1ZRFA 4P26A 2ZBUA 2EQRA 2LSOA 1R00A 3VYRB 2EBIA 2V9VA 5F0CA 4RD2A 3U6BA 3ABTA 5D4RA 1VI0A 3E0JB 4IHXA 2NVQJ 4B3GA 1KTWA 1RZ4A 4MYUA 1I27A 4CICA 4C2LA 4LD5A 3OL3A 5J47A 1VQ9I 2KHMA 2Y9YA 5FL7A 3CO7C 3T1BA 3VYUB 1KJZA 4D0PA 2EFNA 1WSRA 2JJ2A 3KL9A 1OGOX 2DOGA 4WZLA 3CCUB 2ZBVA 2QCOA 2R7QA 2HYGD 3BOQA 3QFCA 1YYVA 4UZUA 4OIRF 1QNTA 5CQEA 4I02A 1GXQA 2XTWA 2D1VA 4QIWN 3OOCA 2FBKA 3RZDJ 3W2AA 1KYWA 1Y0RA 1W7PA 1EH7A 3EUHA 3CPXA 1S6LA 3S2WA 1BN8A 3PQKA 4JP0A 3CW2A 3TEDA 5C1EA 2CRGA 3IKTA 4JK1X 1GVHA 4QV2A 2BYVE 2X9DA 1VJSA 2O0WA 4ENKA 2J5OA 4Y33A 3S14J 2VOPA 2EWNA 1PVEA 2DYSH 2E5NA 3OMYA 5IYBJ 2STTA 2OBSA 3QPHA 5F4OA 2QYUA 1GR1A 3S1QJ 2O61A 1OGIA 1AIPA 1ZTRA 1IDJA 5D5XB 1FP2A 1UZCA 4HG2A 4AWXB 4KA4A 2M7BA 3RZOJ 5GV8A 4PC7A 3JRHA 4HIZA 1J7KA 4ACAA 3FKSA 5H20A 3WTWC 2KZGA 3K69A 5E17F 4YXWA 3WXMA 1YHQI 3EQOA 1E2XA 1D8JA 1Y8QB 5DNSA 3ISXA 2X6WA 1ZGJA 4HX8A 3N6ZA 4PGGA 2LKXA 3ABUA 3M8EA 1R5GA 1V3FA 2IVMA 3LA3A 4BS9A 3GW2A 3DKWA 4YFKF 3QFSA 3RJPA 4RGXA 2WV0A 4HNTA 2GXAA 1YITB 3BR2A 2BE5F 2GIVA 3OYMA 3BQJA 1QGZA 2OTLB 1B1BA 4C2TA 4R1HA 4X1EA 1XPXA 2MBFA 4QTRA 2DODA 1ONVA 3OY9A 1ZREA 1IXCA 1I39A 3K4MA 3BY6A 3AG2H 4MFDA 5AONA 2D9RA 2XGDA 3TP0A 2Y69H 4XR6A 2R4GA 1H85A 4QPOA 3KP7A 4PDKA 4FQGA 1J0RA 3WU0A 1W1WE 2ZITA 3L00A 3SXYA 3KYLA 3ZP5A 2PMZN 1V0EA 2Q6LA 2FMYA 1OCRH 5HS8A 2HVRA 4XSZF 1FT9A 3FHZA 1COWA 1ZM4A 3NEUA 2B63J 2WAEA 4QUZA 3G71B 1F36A 2W6JA 3PSZA 4XQFA 4G6TB 2ZMEC 1HKTA 2XKOA 5J6XA 4ZC3A 3AL0C 3MMPA 2BZTA 2PMZA 4BHPA 1WFXA 3BTJA 2VKDA 1GXPA 3GTQJ 1VQ9B 3OOPA 4C2UA 3LSHA 4FT8A 1VQ8I 3PSFA 4NQWB 5HLGA 2ELHA 4BYYA 1NRKA 2D3NA 2VBYA 2Q6KA 2EFOA 4WZKA 4OWRB 1O3RA 4JMQA 3GQ8A 1S72B 1LLWA 3GVJA 1IGNA 1VQPI 5HNHA 4MEXF 2RC6A 3VNVA 1Z77A 4B4DA 1EE6A 5B5EC 3VWBA 2R5ZB 4E70A 3TDZC 5AIPA 3LNNA 5LMZA 4XBFA 2YWFA 1WU8A 3F8CA 5HLIA 1O8DA 5M5WJ 1SFXA 1MNEA 3OEEA 2GJKA 2P7VB 3O6BB 2D3LA 5B1BH 3VODA 2LR8A 3E6MA 3QFRA 5J1YA 3K4LA 2I1LA 3OR2C 3U21A 2CW5A 4KT5C 4PC3A 1ZELA 2MLKA 2NTPA 3ZMVA 1O8KA 2WAQN 3PFIA 4UV9A 5EGOA 5J8CA 1ZM9A 3B90A 2ZBKA 3LO8A 1O4XA 1R5HA 4AVZA 2L0KA 2DYIA 2VFOA 1TP4A 3VR6A 2E36A 3BR6A 1B9MA 3HUGA 3CDHA 3IWZA 4E7ZA 4J19A 4OZZA 4LK1F 3DWLE 4B4CA 4K2EA 2K9MA 3CXCB 4UUSB 3RKXA 5C4JJ 3DBRB 4HE5A 1MMSA 3P9CA 1P7IA 2X1CA 4FX0A 3ZC3A 2WY8Q 2XAFA 2CUFA 4D7NA 1FYKA 2V7UA 1R4MB 3PVDA 2UWMA 4X7EA 4M9XA 2WB1N 3IP4B 3VFZA 1TQPA 3OYCA 1BJAA 2VFNA 1DDIA 2IP2A 1MMDA 2GWRA 2IXSA 2K9SA 3B6AA 3CDIA 3EYYA 3Q9SA 2LREA 3CP2A 4I0BA 2O8KA 2FVGA 2F48A 3ZR8X 2XT4A 3ZQIA 2OC6A 1ZG1A 5TGTA 4HRIA 2CGPA 2RC4A 4RPDA 2WB1A 2OBRA 4DZJA 4CCLA 3V8KA 2ISZA 4LMYA 1MJAA 3SDGA 2JUGA 1WPCA 1U9NA 3N97A 5A2QK 2XGCA 4Z06A 3OKXA 4U0VA 2CW8A 1VQ8B 1WJBA 5D5VB 5KSWB 2FXAA 3JW4A 4QHYA 2C5HA 1UG2A 3HRTA 2O0YA 4EM2A 2K7LA 2BM4A 5A88A 4KKSA 3AGPA 1Z3XA 2JT1A 5DCFA 1VQPB 3WTUC 3JRCA 5J4YA 4A3KJ 2R7FA 1EP1B 3V7CA 3BG3A 3ULQB 3LSTA 3S3NA 2HQRA 3KZYA 4ZDLA 3CD6I 1XSXA 2UZKA 4YIIA 5FO0A 2FX0A 2L9VA 1LQ1A 4MFEA 2ACJA 1ETYA 1OCTC 1VQMB 1S9HA 2CG4A 2ISYA 2VXDA 5FKNA 2NS0A 4F52A 2KVOA 1DUXC 1HA3A 2F2EA 1OFDA 2DY1A 4GFBA 2DT6A 3WE3A 1OFCX 1HOMA 3H0DA 2A5WA 2E35A 1HKQA 2XPWA 4EGZA 1DG1G 5ILSA 3AVTA 1JUPA 3WG9A 2XRLA 2OBTA 4PAAA 4Z4VA 1G7RA 5L3EA 4JQFA 1OYIA 2FA5A 1R23A 5DN6A 4KISA 4CSWA 2LBFA 4OAYA 3BJAA 4HYEA 3BG9A 2A3SA 4Y15A 1IUYA 3S3OA 1H80A 4ZZLA 2DOEA 3RTRA 2HXIA 2X8KA 1FSEA 5H6RA 3OW7A 2JSCA 2DXIA 1MRZA 1MH4A 1G3SA 4GXOA 2HMAA 2BVNA 3JRGA 2VFQA 2L54A 1X4PA 2BHZA 2WBMA 3IC7A 3P9KA 4M9ZA 1J9IA 2J8IA 4YC5A 1I1SA 2IT0A 4F7DA 4LITA 4BE0A 4O3MA 5CKTA 4RAYA 2DIEA 3AVXA 1TUIA 3OIOA 4YCQA 1KYZA 5FKOA 3ZMZA 1RKTA 2O6WA 2NS8A 2G7UA 3PO2J 4BQOA 3FHNA 4V2FA 3A1YA 2VC0A 3S2HJ 1BOAA 3MAJA 2PX9A 5IOYA 3L2CA 4YEIA 5C1CA 1RESA 3AG3H 5J40A 1F5TA 2RV8A 3SZPA 4OU0A 1EXMA 3EDPA 1Y39A 5M5XJ 3F23A 4BDYA 1ELOA 5GP9A 1E63A 4M6YA 4KICA 1STZA 4F55A 2X0KA 3TO6A 2XAJA 5JBQA 1K8AD 1GUUA 2HU9A 3AGQA 3BH6B 2NVXJ 3CLQA 1BL0A 3LMMA 4RLZA 1RUOA 5GAGJ 2KRCA 3L2VA 4X7CA 4BDZA 4GQNA 4OAZA 1YLOA 5HS7A 1KQ5A 2GQFA 5HDKA 2Z99A 5F0FA 3HTSB 1ZAOA 4AIHA 5K7HA 3CMMA 5LHGA 3GTKJ 2CU7A 3E5QA 1MJ9A 4Z6YA 4EGYA 1MJBA 2O8XA 4HQMA 1JRGA 5K5RA 3FPKA 3ESWB 1N77A 3ZQ7A 2VI6A 1UMQA 1VTNC 1VQ7I 3V4GA 1CF7A 3FXKA 5TY0A 1PXZA 3CD6B 1ETKA 1FC3A 3BR1A 4OMYA 2Q2EA 2K9NA 3EYIA 1IN7A 1Z0XA 4PK4A 5HLHA 1QO0D 4LGWA 1X3UA 1LE8B 3M3YJ 1NB9A 2IS4A 3J80Z 2NS7A 2BM1A 4OJOA 1FMVA 5HS9A 3BTCA 3BZCA 2ADUA 1PLUA 3VSKA 2O5RA 5KHDA 2E34A 2X0LA 3JSPA 3ASQA 1PP8F 1ZARA 3MVPA 1QA1A 4A6EA 1KU2A 1W5SA 1U78A 5DYMA 3S2DJ 2EIMH 4FWTA 5DD4A 3D5LA 3KPHA 3MZYA 5IK2A 3CB4A 2QQAA 1LDJA 3PQJA 5GAEJ 3QU6A 1UD6A 2PJRA 2P5LC 3K4BA 3HHHA 2Y0MA 5L3FA 3OYGA 2QA4I 4KT6A 1R5OA 1IZ1A 4LC0A 4HV5A 4WWCA 1FBQA 1P6RA 2Z33A 4BPRA 4Y3OA 1K4TA 1QUEA 1ZN2A 2GXGA 2BX6A 2DK8A 4QPQA 4JX4A 2M7AA 3FWEA 3CMEI 1BR4A 4ESBA 5AMVA 2CH0A 2L9SA 3BZ6A 3OIPA 4JYKA 5FD5A 2MFZA 3ZCOA 2JRTA 4A3JJ 3DV8A 2VBWA 2LK2A 2BV6A 2A07F 3AFHA 2HR3A 3SEZA 3KFWX 5LFAA 4RGRA 3QAHA 1I5ZA 5DV5A 1GO2A 2INUA 5BNGA 2VBZA 3C3WA 1WJ5A 2IS1A 2V26A 2WR8A 1HG8A 2H6CA 2Y75A 3ZZUA 2VNJA 2A6EF 3GVAA 2KIMA 3SHFA 2GAUA 4HSRA 4P9FA 4YZ0A 1IJWC 3K70D 3NWSA 1OLTA 2COBA 2BPOA 3I71A 4BY7J 4IRHA 3VO1A 2WZNA 1TW2A 4PJNA 3W2EA 3WGGA 3GYHX 1BC7C 4RD1A 1RI7A 2DYRH 3K1NA 4YZQA 4ANJA 2OQGA 1O3SA 2ZNYA 3E6BA 2XDVA 1WJCA 4NK6A 1SAUA 1OGMX 1UHMA 3FK6A 1VQKB 3EUKL 1V5VA 1Y6IA 4Y7CA 3Q0VA 2IRFG 1BX1A 1XFOA 3SLNA 1SVMA 4B47A 3F8MA 2UUZA 4RGUA 5ICCA 1FOKA 2X1DA 4XLNF 4QSHA 3F9KA 5KCMA 3LQRA 1FLIA 3VSVA 1Q1HA 1U5TA 2JWTA 3GF2A 4AC9A 1WKMA 3OYDA 2DTRA 1Y1WJ 1TQMA 2JVHA 1VQ7B 2WPDA 2M87A 3OYJA 1VQNB 2HKOA 5DM6F 4RCYA 2NTQA 2VBEA 1W36C 2NYXA 1EFCA 1USTA 1WI9A 3ZBTA 4GYIA 1MNDA 1JT0A 3OPOA 1YS7A 1MBHA 3U1DA 3WBJA 2HS5A 1WJAA 1WZ2A 4ENJA 1AKHA 3NE5B 1EP2B 2Z9OA 3NARA 3UNGC 1E3ZA 1OGJA 1Y8RB 2W1OA 3VB2A 1GAQA 2EFPA 3HGGA 5HOOA 3M4OJ 2B7BA 3PJRA 2QDXA 3FIWA 5A89A 2BY2A 2F4MB 2OV7A 2CSOA 5ERIA 2HVSA 4XKWA 2B5OA 1FOWA 3EUAA 3GZ5A 1PUEE 2HZDA 5EDNA 4HDUA 4FASD 4DK0A 4JBAA 1PKVA 2CQKA 2E2HJ 1U2RA 2HFHA 2N8GA 2Z3YA 4M73A 1BOBA 3S1RJ 1ZGWA 1W5CC 3WG7H 3DLLF 4LG0A 1FSHA 2QZAA 3CF2A 2ZZEA 3DEWA 3FK7A 3OYHA 1R4NB 4MGRA 4XLFA 4CUGA 3CCYA 4AF7A 2ZC2A 1IRGA 5HZAA 1L1IA 4OOVA 3JU4A 5FO5A 4EM0B 4RBOA 1KD1D 1UG0A 5TJJA 4C30A 1WGXA 2G9WA 2BVMA 4XMYA 3GX4X 2XEXA 1U8RA 2PLYA 3F6OA 3ZQFA 2K85A 4C2MJ 4MR0A 2LOOA 2EV6A 1JHFA 1R71A 3GVKA 4A3IJ 4OJ6A 5GADJ 4FN5A 5BPIA 3K6GA 4XKCA 4NDLA 4J0QA 1OQYA 1UELB 1MW7A 3WU1B 3ASSA 4C43A 1ZG5A 5TV2A 1BW6A 1K6OA 1D2EA 2GIZA 2C2WA 4XRSG 2IA2A 3WGHA 3CJNA 5CVUA 1X1CA 2K02A 4I99C 4RLQA 2VBSA 5E8GA 1X1DA 1O3TA 2PI0A 4BU2A 3WODF 3OYKA 1B9NA 2QM3A 5E79C 2QSFX 1UB9A 4BL0B 2XZOA 1YRNA 1ETOA 2L9NA 3E6CC 1O8GA 2EIKH 3IH2A 4CDGA 3LAPA 2W48A 2BV3A 2FNAA 5JLWA 1PE9A 2FBHA 2VYQA 1MNMC 4M3FA 1IXRC 5F08A 5JLXA 3L2WA 1FNBA 1WJDA 2QSHX 5F4MA 1TYVA 2KIQA 1D5VA 1V0FA 3BY2A 2GREA 3P4GA 4OPSA 1LUJB 4ZDPA 3FJOA 1GQ8A 4PC1A 5J3OA 1QJVA 1T0FA 3EQLF 1Y0UA 2EZKA 4DW6A 3G73A 3ML3A 3CCEI 1DDGA 4RDKA 2VBTA 4N3GA 3U1KA 3I4NJ 4A3FJ 2BM6A 1LKXA 2OZUA 2E71A 2ZXJA 1DDNA 2LFBA 2IJLA 1QPMA 3NAUA 5E1ZB 3C7JA 2MD5A 2MSYA 3E97A 2OPTA 4KITB 2JA7J 1MABA 1XMAA 3MQ0A 1FOXA 2R7TA 1SD6A 2VQLA 1JXSA 2LF7A 1NH3A 2VQGA 4IXAA 3A01B 5GPAA 3GEZA 1PJ7A 1RKWA 4B8XA 4AF6A 3GFMA 3L2RA 1KQSB 4ON0A 2IA0A 2V7WA 1R1TA 2NOJB 1YS6A 3BJ6A 4LIUA 3H9NA 1SMYF 4LK0F 1SEUA 3DPTA 2QKLB 2M5SA 3A3GA 3E7LA 2F5DA 2E2IJ 2UVEA 3QPSA 3HAGA 3SZEA 3PFYA 4IZZA 1A31A 1IB4A 2CQQA 5IT3A 1E3HA 3JCUC 2W7NA 1QA6A 5IYPA 2QGGA 2CW0F 4TN1A 1JA0A 1YTYA 4OPWA 2DT7B 2AQEA 5K5QA 1VFCA 4XN3A 2NPFA 2DDAA 2HDCA 5E3LA 1SVOA 2XF7A 2IPQX 3BTIA 1D5YA 5H59A 3AVYA 2Y2ZA 2JTVA 2JN6A 1FYLA 3WNBA 3W6KB 3OWTA 4MTDA 4PJJA 3QOEA 2WYRA 4PJ0C 2KP6A 2G0EA 1P4AA 2FUG2 1S7OA 3ISPA 3M07A 1SD7A 3JRFA 4IKFA 1E1QA 1SKYB 4P6VF 2LZJA 1DBOA 1TNTA 3IH3A 5KW9A 3PNTA 2JZYA 4DNRB 3ZMUA 4P25A 1G4DA 1H88C 4OM9A 1PJ6A 4Z4TA 2M0MA 4MEYF 4BKXA 4RDLA 2CUEA 3P27A 3AVWA 2F1LA 3GFLA 4M3GA 2HTSA 4Q5SF 1PJ5A 2VASA 4F3QA 3U6KA 1BC8C 2HQAA 3QP6A 2XNCA 4P5OA 2WJYA 2XTYA 4RB1A 1H89C 4PUSA 1AHDP 5FRMA 1BW5A 1G7CA 1KK2A 1KCCA 4GDFA 5M5YJ 2DOFA 3F6VA 3W5UA 4LG3A 4YAFA 2BBYA 1QGAA 2FQ3A 2QQBA 1Q86D 2DAOA 2XZLA 1TSPA 3QRFF 3V7SA 1T6SA 3LSMA 2OAZA 2X6XA 2DI3A 1XTAA 1IN5A 3P7NA 1TW3A 2D2WA 2EZLA 3JTGA 1JB9A 1YITI 2FBIA 2XNDA 1O8FA 1IJFA 1MIJA 4NC7A 3J7ZI 3L2UA 2P3MA 3CCEB 2B0RA 3DF8A 2H8RA 2NT9A 6PAXA 2F4NA 4I09A 4C3JJ 2K9QA 4I0AA 1D8KA 4IEJA 4ESJA 1JGSA 3OP1A 3QE2A 2IGNA 3FXJA 1VLOA 3MCAA 2ZTGA 3CCLI 2C4UA 3HBLA 1OMIA 4IVNA 3FMRA 4G7HF 1HZEA 4KMUX 1MBKA 2ZB9A 5EF6A 3G1MA 3HGYA 1O7LA 3LVBA 1K78A 1FNDA 3RPUD 3PA1A 5D4SA 3G71I 3SQNA 1Q7YD 3JTHA 4G6QA 4A2UA 1GJRA 4I84A 4G8XA 3LMWA 1YFHA 1TNSA 2HZTA 2TRTA 3LL7A 1ZLKA 3SJPA 2OD5A 3FX3A 4KN4X 2MH2A 3T0YA 1RR8C 1DBGA 2KQRA 2AQFA 1XQBA 3LQEA 1SFOJ 1F20A 3BP8A 3SUCA 5JI6A 3E1SA 1IV8A 4A0ZA 4CHUA 5FO1A 3JRIA 2FMLA 1R22A 2M1BA 2ESHA 2OJED 3DBLB 3KZZA 2M8EA 3FMSA 4B48A 3LSRA 2R7XA 4B43A 1S72I 4Z2YA 2FEZA 4YIFA 4RLFA 3PETA 3DLAA 3OIQA 4PGHA 3DEUA 1BM9A 1N78A 3J7YJ 2D45A 3HXLA 4BQQA 1R58A 2I8DA 2KRFA 5K7FA 2Z2SB 1NTCA 4BHCA 3MZ8A 3H5AA 3VSLA 1TLLA 1CF7B 2F5FA 2Q2EB 1IO2A 2EV5A 2JA8J 2M45A 1CNEA 3R61A 4I7HA 3JREA 1OOCA 2KJCA 4ESFA 3FF5A 1W0KA 2OF7A 1BA5A 2EPFA 3IHUA 4MXNA 4HF1A 2XV4S 4PJMA 4BXFA 5E3OA 2KZVA 2FQ4A 3WTTC 3OYAA 1WPKA 1B6AA 3FXMA 3QYFA 4KKTA 2Q1ZB 4LJZF 3Q0UA 4ITVA 1CNFA 4M1KA 2DA2A 1E43A 3OE7A 4RM0A 5FNZA 1CQXA 3H0GJ 3T53B 3DFGA 2BW3A 2K3PA 1PUFA 2OUMA 2LD5A 5LGUA 5F04A 1E17A 3A4CA 5DDGA 4CH7A 2NV4A 2XZPA 4P1VA 2KDZA 3HSFA 2PJRB 3EUHC 1UAAA 3ZSCA 3RPUA 1LEBA 1BI1A 2KKOA 3OL4A 3ZPPA 1TWCJ 2M3AA 5ICEA 3ZQCA 3ABMH 1OB5A 4HLXA 3CJTB 1V5FA 3OYIA 2VPLA 2CBXA 2HLDA 2MC4A 4P3IA 1IDKA 2R7UA 3ZQLA 1VQ6I 2CC2A 5IOZA 4Q48A 5CVVA 2E1RA 2PMUA 4ACBA 4HAMA 2P0WA 3AK5A 4CYCA 1VF7A 2KT0A 1XN7A 4XN0A 2XC1A 2F4IA 2LG4A 3CCLB 5F4JA 1DPUA 3FDYA 4LLGF 5ILVA 4Q47A 2GOMA 4ZJZA 2EINH 4G12A 1K4ZA 1ZLJA 1HLVA 2VB6A 1MMNA 4BBSJ 1QQ1A 2QXZA 3GVLA 2B9SA 1LFPA 2ZXHA 3OAAA 4FE7A 4ZV4A 2YR2A 2XHKA 1F43A 1PDNC 4LB6B 3F3XA 4FTHA 2WC2A 2Y30A 3EETA 3V7RA 1TL8A 5BOXA 1K5CA 5F1RA 2DOAA 2EFWA 1UFMA 1FX7A 2CQ7A 3O8HA 3RSNA 4RM2A 5EEGA 3JAMK 5EG0A 2ZJRF 4DK1A 4G7ZF 2JA6J 3PSIA 3QQAA 3HM5A 1Z6TA 1UCRA 4XRFA 2XT2A 3ERMA 2R5YB 3ZN0A 3H94A 1XMKA 2CUZA 3BPXA 1XGNA 4XRMA 4N9IA 3WNDA 4KFCA 3LA7A 4P55A 4YFNF 3ASNH 5HDGA 2L02A 2WJVA 5FLVA 1FNNA 1O57A 2FU4A 4J01A 1T2KA 3F22A 4HDVA 5ICFA 1FNCA 1Q81D 3S15J 2P6TA 3TOBA 1EA3A 2HDDA 1VQMI 2BM0A 3JQQA 2VBKA 1D1AA 5HXBA 1MGTA 3ASTA 3H36A 1R5NA 4XRSA 2VPRA 2NAZA 4TMVA 3H35A 1QX4A 1TBXA 4N4OB 3JQRA 1IN8A 2W57A 3BZKA 3AKZA 3AVVA 4HX4A 1Q9SA 1A6IA 2BEOA 2IEKA 1TQIA 4ZZDA 1V54H 5EYRA 1L3LA 1VBLA 1X1AA 4U4BA 2OK7A 3WHBA 3T8TA 4YZAA 3SJZA 4RAGA 1I50J 1MMAA 4R79A 3GSIA 3BTLA 3QSYA 1JTAA 1QFJA 5JMCB 2ZXWH 2P7CB 4D1QA 3BLYA 2K40A 2F3LA 4DYRA 4KKUA 5IP6A 1W0UA 2H27A 2WAQA 4YAOA 2O1DA 5J3LA 3RDIA 3RY8A 3F8BA 1XSVA 1A36A 1VQ6B 3OZWA 4Y4RA 2Z16A 3QYBA 4XKVA 3OZVA 2HDNB 5FJ8J 1J2XA 3G05A 1YW9A 1D0XA 1GAWA 4EQQA 3ZQGA 3J81Z 5FGMA 3JR9A 4I2OA 1N08A 1TZLA 3C2BA 1G7SA 4ZDOA 4L5EA 1OYWA 5D6EA 5K5OA 1HC8A 4L9TA 4RB0A 5ED4A 3W6VA 1D3YA 2DCUA 3PUBA 4RDUA 1T8IA 2UVFA 3W5HA 1JKOC 3B73A 1T38A 3OSGA 1XB2A 1FDRA 3BCFA 3G6EI 1S5LC 3CLOA 1BX0A 3NRVA 1FZPB 1EF4A 4HBLA 2MGQA 3DBHB 3OSFA 2K9LA 1NG6A 3I64A 1APLC 3U2RA 4M6VA 3BG6A 2H94A 1WSUA 1QFZA 4U0YA 1YRNB 1H42A 5L3GA 3OEHA 4AIDA 2V6CA 4Z4RA 2FSWA 1WH7A 4URRA 2K4JA 4ASNA 5M3MJ 4ZYGA 4K1XA 3ZGKA 4P96A 1FOYA 2I10A 2BY0A 3GTJJ 4A12A 3FXLA 1V4RA 3TL4X 2ZXIA 1QRCA 3ZRGA 5J8FA 1DARA 1QVTA 2QBYA 3S3MA 4DNCA 3CF5F 5IP9J 4WK8F 3BH7B 4L9JA 2MABA 2X51A 2L4MA 4U88A 2IA1A 4HOBA 2C4TA 4TMXA 3UW0A 4RMNA 2VNKA 5THXA 3LOCA 1WP6A 1U9OA 1QUFA 1UJ8A 4M3DA 3HOXJ 1R5BA 4E4HA 2BM5A 4NC6A 1QA2A 2YX7A 1LDDA 2DN0A 5E3MA 1TWAJ 1G3TA 1O8IA 2DA1A 2M0CA 1XCVA 1K8FA 4Y17A 1EA0A 2DBBA 2V1DA 2QKMB 4I6ZA 2Z6BD 4BUPA 5IYDJ 3O8GA 1D1NA 4PGOA 4Y7NJ 1YJWI 4DYCA 3GTOJ 3HOWJ 1T98A 1KGSA 1WOSA 4OIQF 1WCMJ 1ZR2A 3TOAA 3HOUJ 3BY1A 4EJTA 2GK6A 2QYOA 3A0HC 2I5UA 2M30A 1KZLA 3GTLJ 3CUOA 2RVCA 3K2ZA 1J5YA 2ECCA 2KLOA 2JSPA 2AXTC 2HPMA 1YQAA 1V55H 4JX6A 5J35A 2DERA 1NG7A 3RPQA 3HDDA 2A5YB 2EJRA 1ON1A 5DCMA 4AIKA 1T6ZA 5FIUA 2CFXA 1OB2A 4DGWB 4C3HJ 2E1CA 5KAIC 1EJ9A 1KU9A 2CV0A 1FIPA 2MG4A 2P5KA 3S8PA 2NVUB 3JRDA 2XAQA 3GTPJ 2JDIA 4W8QA 1H8EA 5EMNA 2O9LA 4MTEA 2OTJB 2L7KA 3G6EB 1RPWA 5IT9Z 4YDTA 1W34A 4E7IA 2H8WA 4M53A 4XLEA 4NBSA 3KCCA 1QCXA 4U0WA 2XAGA 3CPWB 4PSXA 2PEXA 3NQOA 2W24A 4ABZA 1VQKI 3L09A 4Z05A 2MA3A 5E20A 4BEHA 1HDDC 3MD2A 4W8SA 2LF8A 2EH3A 1Z1DA 3V8JA 4L8JA 4TMZA 5L46A 4U7DA 1VHOA 5FA6A 3HOVJ 3FXOA 2L7ZA 3I58A 4IHWA 1VQNI 1S4MA 2PYHA 2VFPA 3Q5FA 4B44A 1G6NA 2ZL6A 4TT3A 1K9MD 1FBUA 4RGSA 1U2WA 1T6XA 4FCYA 4NC8A 1CQTA 2DU9A 2JPBA 3GBGA 4FXUA 3T51B 5A8AA 1B72A 4X05A 4WXCA 1USSA 1JGGA 5FKLA 2TDXA 2HYJA 3H5NA 5TR9A 3ML6A 4BXUA 1FTTA 3BCDA 2Y48A 1JJ2B 1KK1A 5GTIC 2W85A 2HPIA 2R3SA 2BOLA 1JA1A 2FE3A 2OQRA 3LQQA 3GQAA 1B2RA 2EA2A 4BBRJ 3VMWA 4J00A 3Q3AA 1UD8A 3MWMA 5E6TA 3C2HA 1K78B 4GO1A 1YJWB 1QVGB 1M1KD 3JX8A 1YE9A 5DS9A 3LSJA 1K61A 2XOKA 4TV7A 4W8TA 5D5WB 5E3NA 3KETA 1KC8D 1QA3A 2RQQA 4M9SA 3V42A 2RNJA 3CUQA 3H9GA 1U8BA 3GLXA 5DSZA 2PECA 4L9NA 2YUSA 5CJ9A 2BF4A 4WZTA 5HZBA 2A05A 5CLSA 1LLZA 3JQPA 1GT0C 4YEJA 3A35A 2FOWA 1Y0NA 3G2BA 3RCOA 3ABLH 3HRUA 2OCEA 2DETA 4KIGA 4R8HA 3KP2A 2O6GE 1WHUA 5HVQC 1W7PB 1BIBA 3S1MJ 1G3WA 5C44J 2BY3A 2EIXA 4WQMA 2CK3A 5IPAA 3MZHA 1LM1A 2MD0A 5FRNA 1D1BA 5LRRA 4AYBN 4LFUA 2WADA 2HOAA 3HOTA 2V7TA 4UHTA 2WTEA 2EZIA 4L5IA 2BMWA 1EFRA 4EMSA 1YLFA 1GV2A 1E0EA 2R9VA 1OCCH 2GBYA 4WXHA 2LKSA 1ZYRF 3RKYA 2L2OA 1XG2A 1IB0A 1BN5A 1GLNA 2HDWA 1JJ6C 2EFGA 2P5VA 1KQ9A 2JA5J 4G1VA 2KFDA 1I6HJ 4AYBA 1UD2A 4G5GA 3HRMA 1JT6A 1MSFC 2BW3B 1JKRC 1PUFB 5BMZA 2CNDA 2NXNB 3B6CA 3I56I 4G7WA 2MLGA 1JKPC 3I59A 2OBPA 3A03A 1LVKA 4L9VA 3HOYJ 2E1MB 2ELKA 2QUFA 3HOSA 4PFPA 2QTLA 2RDPA 3A8JA 4WZEA 2VE9A 2Z1DA 3DQVC 2L4AA 4NHJA 2CO5A 2JIZA 4HNUA 5D6FA 1R7JA 2KPMA 4MQ9F 2DMPA 3KEQA 1O8JA 4GYGA 2VBUA 3CQZJ 4PJLA 3KEWA 3VMVA 5BQTA 4M6XA 4X07A 4YAWA 1RUNA 5FLMJ 1R6RA 2BSAA 4YZXA 4EH1A 3FY3A 2OU2A 1S0UA 2PE3A 3B4NA 1Z91A 1A35A 5L3CA 3S32A 2ZJQF 3LSGA 3J7AY 1N06A 1U5TC 4FK8A 2HI3A 2UXXA 2Y9ZA 4A3EJ 4IQJA 2HQNA 2WY7Q 1E3OC 3WY9A 4HSTA 1MDMA 3NAWA 5H5JA 4B3FX 3E5UA 3QFTA 3B02A 1HF0A 2BXYA 3HOZJ 3B8HA 5JHFA 3U2QA 4YFOA 2LYCA 2PG4A 1FTZA 1O3QA 4V2GA 5DM7F 2F43A 4PSWA 1WVRA 3M8JA 3COAC 1CLWA 4ASUA 3OS1A 2XPUA 4Z4UA 2R0QC 3D5RC 1G3YA 3VMFA 1E64A 1R1UA 2HOTA 2EWEA 3KP5A 2GA1A 3T9GA 2G0YA 3SLDA 3BC9A 1HKSA 2Z5UA 3IRRA 1HW5A 3CESA 2R7SA 2P4WA 3K70C 1IDYA 4YG2F 1AOYA 1FRNA 1ODDA 3D26A 3OZUA 2IW5A 2IS2A 1G8XA 2W82A 1RIOH 3H09A 1S29A 3ZMDA 4G6DA 4Y9RA 5J1RA 3KLOA 2RNGA 4Y13A 2GQQA 1N25A 3HSRA 1JKQC 1O8HA 2V1UA 1V5EA 2ZNZA 5GTHC 2K5CA 3WTZA 3CCQB 1YX3A 4DBQA 2PIAA 1K83J 3RQ4A 5EGOB 3KRGA 1CGPA 4HNVA 1BI2A 3REOA 3OYEA 2VBXA 3DPUA 3HPGA 4FETA 2BGJA 4P22A 3I56B 3HUGB 1YJ9B 3CCSI 3DU6A 2NT6A 3OFNA 1S7AA 3IKVA 1K7AA 2EK5A 1J59A 2BSPA 3DTEA 5FFZA 2D5VA 1QGYA 1YIJB 2QZ8A 1FEXA 1EZGA 1MKMA 2KMUA 3GLLA 1RRJA 4L18B 2M8GX 2EIJH 3SEJA 1FIAA 3KX2A 1O8MA 2X3UA 3DTIA 4CGZA 1VQ5B 3FM3A 2IQ7A 3ZMSA 4A0XA 3F0CA 1EP3B 1QPIA 4LBWA 2NOGA 3R0AA 4IOAF 3F21A 1W0TA 3G3ZA 2DT5A 5E1XA 5CQGA 3ZXSA 1VQOI 1R49A 3I1FA 4RD6A 3VDXA 3ZOBA 3ONQA 4IF4A 1B23P 1JI8A 2XB5A 3GZ6A 1BBYA 3I3LA 4XKBA 1WORA 2BGIA 3Q6RA 2VT2A 3CCRB 3SZTA 1ON2A 3VYTB 2VC1A 1EFTA 2X53S 4UV8A 3HZJA 1KCDA 2JN9A 2DLLA 2FRHA 4XSXF 1ETQA 1GHCA 4IL6C 4ZCIA 1JE8A 1I8DA 1GV5A 1UD3A 1AMOA 1OR7A 1T0FC 4KIFA 3IUOA 3KP3A 5IYWA 3ASOH 3W2HA 2A68F 1NK3P 2STWA 1JJ8C 3PENA 2LY2A 1IF1A 2XASA 2NVYJ 1JTXA 2PYGA 2ODLA 3TKYA 4OOSA 2B0LA 4QLCU 2L7MP 1Z6RA 2BM7A 3TDUC 1Z05A 2OK8A 2XROA 2DPDA 1IRXA 1X19A 1DGRM 2QGUA 1Y56A 5L3DA 4LBVA 2DMNA 1D0ZA 4EW9A 4BGDA 1OPCA 4IPAA 3BC8A 3OYLA 1ZUNB 3Q9VA 3BR5A 4KNYA 3HSEA 2M34A 9ANTA 5TRDA 4RB2C 1WOOA 3I54A 2VE8A 2PN6A 1N75A 2ESNA 2O03A 1UHSA 1VHEA 2PQ8A 2V9PA 4W1UA 2XPVA 2E7WA 2Y31A 4IQ4A 2P8TA 3ROUA 4EATA 3LYCA 2X6OA 3C2GA 5TISC 3ONUA 1FX0A 2IBDA 2O7OA 5AIQA 5GAHJ 4G7OF 3RIRA 4W97A 5K1YA 1ZRCA 1IUFA 4C3IJ 4MYTA 4Z4SA 2ELJA 5C3EJ 1IA5A 3IL2A 2VKVA 1WWXA 2F5EA 1BI3A 1K6YA 1MBFA 3QPTA 2LBFB 4G6IA 3G4SB 2MYSA 4B3XA 1V5GA 2O0VA 2L9RA 5LRSA 3LQ6A 1NK2P 3PSSA 1MBJA 4XOPA 3RQIA 4WCGA 3CCSB 3CCMB 4AIJA 2QQ9A 5KVRA 2LC2A 2TCTA 4XORA 3WTSC 3J7AO 5CYVA 2DTZA 1LJ9A 4XLHA 4BXXJ 1XMXA 3I55B 2L01A 3A02A 3A1PA 4GGGA 3K4CA 5K7ZA 1P4XA 3SY2A 2KRHA 3I4MJ 3BWGA 4ZYAA 3GFIA 3H92A 3HG9A 2JMWA 4P1WA 2RGVA 2Q6IA 1YOVB 1E3PA 5DCMB 1ETWA 1VQOB 2M9HA 2DFHA 4FE4A
chains in the Genus database with same CATH topology
4BDZA 4E0FA 4GQNA 4OAZA 2F6CA 2IGMA 1VBLA 1X1AA 4U4BA 1BPLA 2VJJA 4YZAA 4II2A 1MMAA 3CMMA 4R79A 3OYFA 1JTAA 3FKJA 4D1QA 3BLYA 4E7JA 1JRGA 4H4KC 2GOXB 1N77A 4KKUA 2E5ZA 2V1NA 2WAQA 1PXZA 2VBMA 4LIVA 2O1DA 3OS0A 4NK8A 2M4GA 1W0JA 3MKZA 3K10A 4BJ5C 2KL4A 3IAM2 4PK4A 4Y4RA 2Z16A 3CZ6A 3QYBA 4XKVA 2JVGA 1RU4A 2IS4A 4N4NB 3ZQQA 4OJOA 1FMVA 2O04A 3G05A 1D0XA 1OB0A 1TZLA 1E79A 1D1CA 4ZDOA 1PLUA 3VSKA 2O5RA 1T5EA 5KHDA 1NHCA 2CV1A 3IAS2 4XD7A 3I9V2 1KMHA 2CUJA 4TKOB 3PUBA 2UVFA 3KEYA 3W3CA 3D5LA 5IK2A 1FMWA 3GRHA 5HLTA 3D5SC 2XSJC 1UD6A 4U49A 2PJRA 3BCFA 3K4BA 2JA2A 3OYGA 4KT6A 5CDFA 3BH4A 3DKYA 1Z7LA 2L5QA 1X4OA 4Y3OA 4CCMA 2K9LA 3T56B 2X3HA 1NG6A 4QPQA 4XLAA 2M7AA 2R7RA 4DJAA 1RMGA 3BG6A 1BR4A 1YX5A 3PNYA 4BE2A 3EQNA 5AMVA 2CH0A 2L9SA 3OIPA 3ZCOA 2MFZA 1KONA 5KNLA 3OEHA 3FBIB 4GRIA 4U7BA 4URRA 2VIXA 3QYEA 1Z3YA 1AIRA 3AFHA 3HL2A 3SEZA 5LFAA 3ZGKA 2INUA 4ZTJA 2R7VA 3NWTA 1HG8A 1WJ5A 3TL4X 2V26A 2ZXIA 5HNFA 4XONA 3ZRGA 4DIQA 2IS1A 2QE7A 4OZYA 4Z03A 3S3MA 2V7QA 3JURA 4HSRA 2WA0A 1OFLA 4YZ0A 1DGWY 3K70D 2VJ5A 2MABA 2X51A 3NWSA 1OLTA 4OJPA 3UW0A 2ZSIB 4RMNA 4PJNA 1WP6A 2INVA 4YZQA 4E4HA 3DPLC 3MMYB 4ANJA 1O8IA 2XDVA 1WJCA 4NK6A 2X85A 1SAUA 4BACA 1QU3A 1O8LA 1OGMX 3EUKL 1Y6IA 2QKMB 2Z6BD 2A6TA 4BUPA 2QX3A 4B47A 2UUZA 1OR7C 4X0GA 5CPRB 2E1MC 4E7SA 2X1DA 4E7HA 3F9KA 5KCMA 3VSVA 1PYVA 2W6IA 2Y0SA 2GK6A 2V6EA 3OYDA 1KZLA 2JVHA 1QHGA 2WPDA 3OYJA 2NTQA 3OS2A 2VBEA 4DNTB 1SFKA 2HNHA 1W36C 1BMFA 3CJRB 1TT0A 2KLOA 2JSPA 2HPMA 2E1BA 2KDOA 2BVLA 1MNDA 3OPOA 3H9QA 1NG7A 3FPPA 1K28D 1WJAA 4MLOA 2CW7A 1W9XA 3HC7A 3WQZA 3VSTA 2V7FA 3NE5B 4DGWB 3UNGC 1E3ZA 4Z1MA 1RWRA 2W1OA 5HOOA 3PJRA 4CA0A 1J09A 2OV7A 2CV0A 2QY1A 2HVSA 3S8PA 4XKWA 3M1CA 2JDIA 2IS6A 3HKZA 3H9JA 1H8EA 2F5VA 4D9JA 1VLYA 4W8QA 3EUAA 2LRDA 1P9QC 2L7KA 1E1RA 2HZDA 4DK0A 4FASD 4E7IA 2CMPA 1PKVA 3EPZA 4XLEA 4JOMA 1BLIA 1BOBA 2VLAA 3ZIAA 2GK7A 1QCXA 2X6YA 2CS3A 4PSXA 1HA8A 2ZTNA 3CF2A 2ZZEA 3DTKA 3OYHA 2X1EA 4CUGA 4Z05A 4XLFA 2LY1A 4BEHA 3SDBA 1AA7A 3WWGA 3W2VA 4G7XA 3MD2A 3JU4A 3GQ7A 4W8SA 1UG0A 2DJIA 4XOTA 4C30A 4XM3A 1DP3A 4AU7A 1D0YA 2BVMA 2W00A 4XMYA 3MKWB 4L8JA 4C9YA 1O88A 4DBRA 3CP8A 2IGKA 2ZSHB 2F1MA 2CFOA 2ZZGA 1ERDA 2LOOA 4MR0A 1G59A 3GVKA 3CJQB 2PYHA 4OJ6A 4YELA 4B44A 1T95A 3K6GA 4II3A 4XKCA 4NNJA 2LH9A 4F92B 4TT3A 1X1BA 1UELB 4BEHB 1MW7A 4NC8A 4FXUA 3GBGA 3T51B 3VYRB 3E0JB 4B3GA 1KTWA 3H5NA 3BCDA 2V9KA 4C2LA 1X1CA 4RLQA 2HPIA 1X1DA 3OL3A 2KHMA 2BOLA 5FL7A 4BU2A 3OYKA 3GQAA 1QHHD 3FBNB 2XZOA 4BL0B 3VYUB 4F91B 1O8GA 2L9NA 3VMWA 2JJ2A 1OGOX 5FROA 4J00A 1UD8A 2NSPA 2R7QA 3C2HA 1PE9A 1YE9A 4UZUA 2O17A 2XOKA 5CQEA 3L2WA 4W8TA 1WJDA 3OOCA 2RQQA 3V42A 3W2AA 1V0FA 1O8EA 2WAFA 3H9GA 1GQ8A 4ZDPA 2V31A 1BN8A 1QJVA 4U87A 1PJRA 4KJZA 1OHHA 5C1EA 2PECA 1VJSA 2Z8GA 4TSFA 2NSTA 2O0WA 4Y33A 1LKXA 3LFUA 3A35A 4YEJA 3OMYA 2E5NA 3G2BA 3RCOA 5HKKA 4KITB 1MABA 1IDJA 5HVQC 4HG2A 3OR1C 2M7BA 2R7TA 4ZTFA 2VQLA 4BJTA 3SZGA 4HIZA 2VQGA 2CK3A 3FKSA 2MD0A 5FRNA 1D1BA 3SYTA 4YXWA 3EQOA 2WADA 3HOTA 3OYNA 2X6WA 3L2RA 2DCEA 1LDKB 1MMGA 2NOJB 4LIUA 3BCBA 1EFRA 3DU5A 3DPTA 1E0EA 2QKLB 4BS9A 2M5SA 2R9VA 3A3GA 4E6KG 2UVEA 3K4JA 4HNTA 2L2OA 3HAGA 1XG2A 1GLNA 3PFYA 4IZZA 2HDWA 1IB4A 3OYMA 1WJFA 4CCOA 2W7NA 4AYBA 4C2TA 1UD2A 2DT7B 2AQEA 3OY9A 1WTHD 1U0JA 3K4NA 3K4MA 4XN3A 2BW3B 4E7LA 1WMRA 2XF7A 4G7WA 4XR6A 2R4GA 4QPOA 3ZPNA 3OWTA 3DDYA 3W2WA 3KYLA 1LVKA 4PJJA 3QOEA 2E1MB 1V0EA 2KP6A 4OJ5A 2FUG2 3HOSA 4HPQA 4IKFA 1E1QA 1SKYB 4PFPA 2HVRA 2LZJA 2VKHA 1COWA 4BJ6C 2XAUA 2Z1DA 3DQVC 4F93B 1DBOA 3PNTA 4DNRB 2WAEA 2JIZA 4XNFA 4HNUA 2KPMA 5LD2C 2W6JA 4XQFA 4G6TB 4XL9A 1O8JA 3KEWA 4PJLA 2M0MA 3VMVA 3AL0C 4ZC3A 2UV1A 2PMZA 1WFXA 2VKDA 2VASA 4F3QA 2HQAA 1R6RA 4YZXA 4P5OA 4BE1A 4BQNA 1H8HA 3BCAA 2WJYA 3B4NA 4C2UA 3FY3A 3LSHA 1X0CA 3PSFA 4NQWB 4PUSA 3S32A 5FRMA 3LSGA 3J7AY 1NRKA 2D3NA 1KCCA 4LG3A 2WY7Q 4IQJA 4OWRB 1BR2A 4HSTA 3MKYB 4JMQA 1I18A 3GQ8A 4B3FX 3GVJA 2XZLA 5HNHA 5JHFA 2LYCA 1EE6A 3LSMA 3PNVA 3VWBA 2X6XA 3HPHA 2F43A 2XF5A 4PSWA 3TBIA 3OYBA 3LNNA 2ZZFA 2R7WA 3M8JA 1O8FA 2XNDA 4ASUA 4NUBA 4NC7A 3OS1A 1O8DA 1MNEA 3L2UA 1UD4A 2GJKA 3D5RC 3OEEA 2NT9A 2D3LA 2EWEA 4HWVA 1BR1A 3K4LA 1NBMA 3T9GA 3OR2C 2IGNA 3U21A 2ZTGA 3DKXA 2V4JC 3GQBA 3BC9A 1HZEA 1ZELA 1OFMA 2GJRA 2NTPA 1O8KA 3CESA 2R7SA 3K70C 4RM3A 3B90A 3RPUD 2IS2A 1G8XA 2W82A 4AVZA 3VR6A 4I84A 3LMWA 4E7ZA 4OZZA 2RNGA 1E3XA 1DQUA 3DWLE 3LL7A 2K9MA 1O8HA 1V5EA 1DBGA 2K5CA 2KQRA 2AQFA 2E60A 1YX3A 4DBQA 3SUCA 3SEQA 3E1SA 1W36D 2X1CA 3RQ4A 3OOUA 2CV2A 3KRGA 2WY8Q 2IGOA 4B48A 3OYEA 2UWMA 2R7XA 4B43A 3DPUA 3HPGA 4FETA 3BG7A 4P22A 3HUGB 3IP4B 4RLFA 3DLAA 3DU6A 3OIQA 1N78A 3OYCA 2NT6A 3OFNA 3HXLA 4BQQA 4YRVA 2I8DA 2BSPA 1MMDA 2IXSA 1VF7A 3DTEA 2Z2SB 3QODA 3H5AA 3VSLA 2LREA 3CP2A 2KMUA 3ZR8X 2Q2EB 2OC6A 3A2KA 3KX2A 5TGTA 4HRIA 1O8MA 1OOCA 3GQ9A 3DTIA 1W0KA 2WB1A 2IQ7A 2VL8A 4CCLA 2VQCA 2JUGA 4MXNA 1WPCA 4PJMA 4BXFA 4XLCA 2KZVA 3ZXSA 4HEA2 5CQGA 3OYAA 4Z06A 3VDXA 3QYFA 3ONQA 4KKTA 2CW8A 2Q1ZB 1JI8A 2M4KA 1WJBA 4ITVA 4XKBA 3I3LA 3OE7A 3S93A 1E43A 3T53B 2XC7A 2RREA 4OJLA 2BW3A 2K3PA 2OUMA 2XZPA 3VYTB 1KCDA 3A4CA 2X53S 4CH7A 4KKSA 1Z3XA 2PJRB 3EUHC 1UAAA 1I8DA 3ZSCA 3OL4A 1UD3A 3ZPPA 1T0FC 3IUOA 2M3AA 2NTBA 3S3NA 1V5FA 3OYIA 4ZDLA 2VPLA 3PL8A 2HLDA 2LY2A 2MC4A 1IDKA 2R7UA 3A3BA 2VJ4A 2VXZA 4CCJA 4DOZA 2VJIA 2PYGA 2ODLA 1S9HA 1WJEA 2VXDA 3LSKA 3UR3C 4F52A 2KVOA 2P0WA 2DT6A 4XN0A 1IRXA 2F4IA 1X19A 1DGRM 2LG4A 3H0DA 1Y56A 2A5WA 3FDYA 2NZMA 4EW9A 1D0ZA 2GOMA 4ZJZA 4BGDA 4E7KA 3BC8A 3OYLA 2VB6A 1MMNA 3TMOA 4JQFA 2QXZA 3DEEA 2XF6A 3GVLA 4KISA 4IX7A 5DN6A 4PFOA 2XGJA 4PMHA 4CSWA 1LFPA 2LBFA 4OAYA 2ZXHA 3OAAA 2WSSA 1H80A 1N75A 3S3OA 1HVXA 3RTRA 2X8KA 2JJ1A 1K5CA 3OW7A 2HVQA 2DXIA 4CCKA 4IQ4A 4EATA 2DOAA 3C2GA 2ZZQA 2ZFUA 1FX0A 3RSNA 1X4PA 1Z21A 2R7OA 2WBMA 4RM2A 4DK1A 3PSIA 3L2QA 4LITA 4BE0A 3AL0B 2ELJA 5CKTA 3H94A 2DIEA 1IA5A 1K6YA 4G6IA 2CUZA 3N05A 2LBFB 2O0VA 2MYSA 4B3XA 1V5GA 1BHEA 3VSUA 4XOPA 4BQOA 3FHNA 1CZFA 3A1YA 2LC2A 5C1CA 4XORA 2WJVA 3VYSB 4J01A 3LSIA 4XLHA 2W4SA 2V4DA 1VZ0A 3K4CA 1EA3A 2VBKA 3B8YA 1D1AA 4CZCA 2KRHA 4BDYA 4W8RA 3K4KA 4ZYAA 3HG9A 4F55A 3H35A 2HU9A 2VQHA 4P1WA 2WZPP 2GJPA 4N4OB 4CCNA 1UD5A 3LMMA 3H5RA 3AKZA 2KRCA 3L2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSP A;  1VBL A;  4U4B A;  2VJJ A;  4YZA A;  2UVE A;  3VST A;  1JTA A;  1XG2 A;  1O8M A;  1IB4 A;  1OOC A;  3GQ9 A;  1RWR A;  1JRG A;  2IQ7 A;  2QY1 A;  4XN3 A;  1PXZ A;  4XKW A;  2O1D A;  1WMR A;  2VBM A;  4XLC A;  4MXN A;  4NK8 A;  4W8Q A;  4Z06 A;  4XR6 A;  4XKV A;  1RU4 A;  4OJO A;  2O04 A;  4XLE A;  4OJ5 A;  4OJL A;  1QCX A;  1KCD A;  2X6Y A;  1PLU A;  1DBO A;  1NHC A;  3ZSC A;  4Z05 A;  4XLF A;  4XNF A;  3ZPP A;  3WWG A;  2NTB A;  4XQF A;  4XL9 A;  2UVF A;  1O8J A;  4W8S A;  3GQ7 A;  3VMV A;  4XOT A;  3GRH A;  4XM3 A;  1IDK A;  4XMY A;  4U49 A;  1O88 A;  4YZX A;  3FY3 A;  2VJI A;  3B4N A;  2PYG A;  2ODL A;  1X0C A;  4MR0 A;  1KCC A;  2PYH A;  4OJ6 A;  4YEL A;  3GQ8 A;  2X3H A;  4XN0 A;  4XLA A;  1RMG A;  2NZM A;  4EW9 A;  5AMV A;  1EE6 A;  3EQN A;  2X6X A;  2QXZ A;  1KTW A;  4C2L A;  4URR A;  1O8F A;  4PMH A;  1AIR A;  1O8D A;  3GQA A;  2INU A;  2NT9 A;  1H80 A;  1O8G A;  3VMW A;  1HG8 A;  1OGO X;  2EWE A;  4OZY A;  4XON A;  4Z03 A;  1K5C A;  2NSP A;  4HWV A;  1PE9 A;  3JUR A;  3T9G A;  1OFL A;  4YZ0 A;  2O17 A;  4W8T A;  4OJP A;  3UW0 A;  1OFM A;  2INV A;  2NTP A;  1IA5 A;  1O8K A;  4YZQ A;  2O0V A;  1O8E A;  1BHE A;  3B90 A;  3VSU A;  1O8I A;  1GQ8 A;  4XOP A;  1BN8 A;  4NK6 A;  2X85 A;  4AVZ A;  1QJV A;  1CZF A;  1O8L A;  1OGM X;  5C1E A;  2PEC A;  4I84 A;  3LMW A;  5C1C A;  4XOR A;  4OZZ A;  2Z8G A;  4XLH A;  2NST A;  2QX3 A;  2O0W A;  1O8H A;  4YEJ A;  1DBG A;  2VBK A;  3B8Y A;  3SUC A;  3VSV A;  4W8R A;  1IDJ A;  3KRG A;  2NTQ A;  2VBE A;  3EQO A;  2NT6 A;  2X6W A; 
#chains in the Genus database with same CATH topology
 3TW7 A;  3CC2 I;  3ECH A;  2IGM A;  2KIS A;  3P9I A;  1R9T J;  2VJJ A;  4EVI A;  3OYF A;  1A8P A;  3FKJ A;  2FJ1 A;  4E7J A;  1T6Y A;  3MEX A;  5LHH A;  4H4K C;  5EZH A;  3WBK A;  2GOX B;  3GCM A;  3TW6 A;  2F4O B;  1ZQ3 P;  2V1N A;  4X7D A;  1TYU A;  1G7T A;  2QSG X;  2VBM A;  4LIV A;  3MFK A;  2M4G A;  1W0J A;  5EEH A;  4BJ5 C;  2YWH A;  1NHA A;  1RR7 A;  2DA5 A;  2KL4 A;  3ZPN A;  4BQA A;  1MSE C;  3OJW A;  3LSP A;  2DA4 A;  3QOP A;  4NBQ A;  2O04 A;  2JPC A;  1OB0 A;  5B66 C;  2DA6 A;  3HB9 A;  5GPC A;  1NHC A;  2CV1 A;  4XD7 A;  3I9V 2;  4M2L A;  1QGP A;  1TVC A;  1QVF B;  5DUI A;  1KMH A;  2HQ5 A;  1X2N A;  3HYI A;  4OP7 A;  1YI2 B;  1X3Z B;  2R92 J;  2V7X A;  1QRB A;  3V7A A;  2GPJ A;  1QZE A;  3OW2 B;  2OZ6 A;  1FMW A;  1Z7U A;  5HLT A;  3D5S C;  4FHT A;  1S7E A;  2XSJ C;  4U49 A;  4A3C J;  4M74 A;  1KTV A;  1TWF J;  4IOC F;  1W4M A;  3I4P A;  3PM1 A;  4EJO A;  3O3K A;  3CDL A;  2ZJP F;  3SJM A;  1B72 B;  5IT9 K;  2RC5 A;  1DAB A;  3DKY A;  1EV7 A;  3KYC B;  3R60 A;  4MHG A;  1WRJ A;  1Z7L A;  2E1O A;  1X4O A;  2L5Q A;  4CCM A;  5ICG A;  1N0U A;  5DD8 A;  2R7D A;  5BSY A;  4XLA A;  4DJA A;  3PNY A;  2CWE A;  3PUF A;  4BE2 A;  3K9T A;  2QF7 A;  3FBI B;  3R6K A;  3MCZ A;  5LHI A;  5F27 A;  3PO3 J;  4ROX A;  2R6H A;  2PFB A;  3HL2 A;  1AIR A;  3ZZT A;  5DUK A;  2VNH A;  2DMQ A;  3PUM A;  4ZTJ A;  1BQE A;  1I3A A;  3KZI C;  3NWT A;  1QRY A;  5HNF A;  2H6B A;  3M9A A;  2VUM J;  5HOD A;  4TMT A;  4OZY A;  4Z03 A;  1ENH A;  3CUQ B;  1I7P A;  4X8I A;  2V7Q A;  4IHY A;  1KU3 A;  2VJ5 A;  4N0B A;  1XD7 A;  3J80 K;  3A0B C;  2P81 A;  3WTV C;  3DCF A;  3QPL A;  2INV A;  1POG A;  3ZMT A;  1DU0 A;  1Q1V A;  2X85 A;  2Q0O A;  4BAC A;  2DO7 A;  4FIS A;  4XID A;  2ZME A;  1QU3 A;  1UHW A;  3CC2 B;  3ELK A;  2V1X A;  3K1P A;  2A6T A;  2HCJ B;  3TGN A;  2QX3 A;  1N05 A;  1X3W B;  1T33 A;  2HTJ A;  4A93 J;  5CPR B;  2E1M C;  2DFF A;  4E7S A;  4OIP F;  1KK3 A;  2JJ7 A;  3CMA B;  2H09 A;  5HDN A;  3FXU A;  1PYV A;  5D8K B;  2C78 A;  3QP5 A;  2W6I A;  3BJO A;  2V6E A;  3BQY A;  2KJB A;  1RC9 A;  2B7E A;  3N4M A;  3LFK A;  2XUB A;  5FFX A;  2J8K A;  4D7M A;  2H1L A;  3OS2 A;  1XDS A;  4DNT B;  1SFK A;  2HNH A;  3GZN B;  1E62 A;  2L3D A;  2O3F A;  3TH0 A;  4DZP A;  1YG2 A;  3V8L A;  1QFY A;  1R36 A;  2KDO A;  3L7W A;  3TP3 A;  1HSJ A;  3TQN A;  4EEF G;  3D1N I;  1OCO H;  2YWE A;  3RKW A;  2CQX A;  3FPP A;  1K28 D;  3BNW A;  4CXF A;  1WOP A;  3DXJ F;  1W9X A;  3HC7 A;  1U5T B;  5F0H A;  3WQZ A;  2V7F A;  4HLY A;  3I59 B;  4M4S A;  1RWR A;  2ZJ2 A;  3WE2 A;  2FOK A;  5EZG A;  5D8L B;  4A3D J;  4CA0 A;  4Y52 J;  1ZGA A;  2QY1 A;  2AXL A;  3KP4 A;  1FBS A;  3HJE A;  4YFX F;  2R7Z J;  1P2F A;  1RNL A;  1YW7 A;  3M1C A;  4V19 K;  4UB8 C;  2F5V A;  4D9J A;  4B1R A;  5IY5 H;  2LTP A;  1VLY A;  2LRD A;  1P9Q C;  1M90 D;  3TO7 A;  1E1R A;  1IHM A;  2VNI A;  3AG1 H;  1QG0 A;  4UUT A;  1W35 A;  1P7J A;  1W5T A;  4Z4Y A;  1OIS A;  2PJP A;  2EB7 A;  1FP1 D;  3EPZ A;  1J75 A;  1KZH A;  1BLI A;  1AKH B;  2YS9 A;  1LVA A;  3PIO F;  3BR3 A;  4G9Y A;  2DMT A;  1T39 A;  2GK7 A;  2ME6 A;  1SVL A;  2X6Y A;  4XLP F;  2CS3 A;  2ZTN A;  3ZBU A;  1OYY A;  3DTK A;  1XGM A;  2X1E A;  2J7K A;  3E20 A;  2WV1 A;  4KIB A;  4G94 A;  3FIS A;  4RAZ A;  4G7X A;  5F1J A;  1XS9 A;  4QFM A;  3VO2 A;  2DJI A;  4XM3 A;  3FKI J;  3CCV I;  1D0Y A;  2W00 A;  1MDM B;  1TTY A;  3F8F A;  3CP8 A;  2K3F A;  3AAF A;  2ZSH B;  2ZL7 A;  2CFO A;  4M3E A;  1ZHF A;  2RN7 A;  5IP7 J;  4LG0 B;  1XDU A;  1YIO A;  1IN6 A;  1QQI A;  4II3 A;  3B82 A;  2LH9 A;  1O7F A;  1X1B A;  4ZYE A;  1ZM2 A;  3OJX A;  2XAH A;  2XIG A;  3ABK H;  4H0E A;  1X1P A;  4YAU A;  3B78 A;  1YHQ B;  3L9F A;  1LNW A;  2VKE A;  1Z9C A;  1C0W A;  3BPV A;  2GZW A;  2V9K A;  4O5V A;  5F6F A;  2VZL A;  1IG7 A;  4IHT A;  2K27 A;  3GME A;  1NB0 A;  1NDH A;  4IJA A;  4P9U A;  1QHH D;  4P3Y A;  3FBN B;  2LLK A;  1FNM A;  2K4B A;  4F91 B;  3X2Q H;  1SC7 A;  5FRO A;  5FLX Z;  3IWF A;  3JRA A;  2NSP A;  1TT5 B;  3O2P E;  2OTJ I;  3LNQ A;  1UMK A;  3Q39 A;  1JUM A;  1OCP A;  2O17 A;  4ZGQ B;  2GM4 A;  2DK5 A;  2NNY A;  2CJJ A;  1O8E A;  2D1H A;  2WAF A;  3FXR A;  1TYX A;  3D0S A;  1SM4 A;  2V31 A;  1XG1 A;  4P12 A;  4U87 A;  4A3L J;  1PJR A;  4KJZ A;  3A01 A;  1OHH A;  5FKK A;  2ZL5 A;  4M72 A;  1IW7 F;  2Z8G A;  3GXO A;  2KIU A;  4TSF A;  2NST A;  1WXR A;  1Y0Y A;  3LFU A;  3K1M A;  4FX4 A;  4UVA A;  4N9H A;  3Q6Q A;  4LBY A;  3BG5 A;  2IOU G;  4JX5 A;  5HKK A;  4LLN A;  2IAI A;  1P4M A;  3WYA A;  4YAL A;  3OV8 A;  1NJI D;  1FWZ A;  1JUS A;  2YU3 A;  1XE1 A;  3OR1 C;  4ZTF A;  4DYQ A;  4EJU A;  4BJT A;  3SZG A;  2CQN A;  1ZH5 A;  3LWF A;  3SYT A;  2BN4 A;  3VOE A;  1IJE A;  4M3B A;  1Z67 A;  2AS5 F;  1IDZ A;  3OYN A;  2FF4 A;  1S8N A;  4OOI A;  2DCE A;  1LDK B;  1MMG A;  4B09 A;  2BGC A;  3BCB A;  4UB6 C;  1AU7 A;  3DU5 A;  4HV6 A;  4HZF A;  4QWQ A;  5D5U B;  3CTA A;  2NRA C;  4E6K G;  1A04 A;  3K4J A;  2DPU A;  2VFM A;  2XGE A;  1HST A;  1WJF A;  2XGX A;  4CCO A;  2JK3 A;  2X4H A;  1HCR A;  1EH6 A;  2W7Z A;  1KK0 A;  2GLO A;  2LMD A;  1WTH D;  1U0J A;  3K4N A;  4E7L A;  1WMR A;  1N07 A;  3CCV B;  4A6D A;  2FX3 A;  3KIO A;  3IV5 A;  3DDY A;  5BPD A;  1HQC A;  3W2W A;  1IAW A;  2R93 J;  1HDP A;  1QZY A;  1T08 B;  2YWG A;  2XVC A;  4AM3 A;  1VQL I;  3LA2 A;  4OJ5 A;  3SFZ A;  5DS0 A;  4RS8 A;  1FYM A;  4HPQ A;  2AHO A;  3HHG A;  2VKH A;  5LEK A;  4BJ6 C;  2XAU A;  4F93 B;  5IYN A;  1QBJ A;  4RD0 A;  4XNF A;  1LEA A;  5LD2 C;  4XL9 A;  4MNU A;  3WU2 C;  5FB2 A;  4S04 A;  2UV1 A;  2UXN A;  3MHP A;  1FY7 A;  2BY1 A;  5B1A H;  3CCJ I;  1H0M A;  3K2A A;  1B8I A;  4BE1 A;  1H8H A;  4BQN A;  3BCA A;  2LDU A;  3KEO A;  4RA2 A;  4KDP A;  1X0C A;  1SMT A;  3CO6 C;  3BQZ A;  1HXD A;  1HW2 A;  1LFB A;  1BR2 A;  3LAJ A;  3MKY B;  1SFU A;  3CC7 I;  3AVU A;  3SFI A;  1I18 A;  4BAY A;  2F5C A;  2XB0 X;  5J4V A;  4RJL A;  2DA7 A;  4M71 A;  3G1O A;  4QVJ A;  1GDT A;  3PNV A;  2X48 A;  2HGC A;  3ECO A;  3HPH A;  2XF5 A;  4OOX A;  3TBI A;  3OYB A;  1R1V A;  5KK1 A;  4RAF A;  2VOD A;  2ZZF A;  4IRG A;  2R7W A;  4H9G A;  1F9N A;  1A5J A;  2QWW A;  3IRQ A;  4DQL A;  4NUB A;  4UVC A;  3M1E A;  1U3E M;  1UD4 A;  4HF0 A;  1R5I D;  4ENN A;  4CQJ A;  2QEX I;  2V5I A;  3GUD A;  4HWV A;  4TMW A;  1BR1 A;  1H9T A;  2PBI A;  1NBM A;  2QLZ A;  5JVG F;  4RPB A;  4L0Y B;  4AVP A;  3DKX A;  1TTT A;  2OA4 A;  2V4J C;  3H3V K;  2EV0 A;  3GQB A;  1F60 A;  4WXD A;  1OFM A;  1A6Q A;  2GJR A;  2JRM A;  3W5V A;  3RKQ A;  4RM3 A;  3ZQH A;  2A61 A;  4HX7 A;  3C1D A;  1LB2 A;  3F8N A;  1EFU A;  4BH9 A;  2LKP A;  3DP7 A;  5JFR A;  4UNO A;  1E3X A;  3M8F A;  1DQU A;  4IO9 F;  1EH8 A;  3I5U A;  4LBZ A;  3SYJ A;  4WF2 A;  2E60 A;  4HE6 A;  4S05 A;  4OMZ A;  5EEA A;  1DU6 A;  3R6S A;  3ONY A;  4C0S A;  1EKE A;  3SEQ A;  3WHC A;  4CO8 A;  1W36 D;  3WGI A;  1QVU A;  4ETS A;  5LLQ A;  3OOU A;  2CV2 A;  2IGO A;  2YPR A;  4PAB A;  3KE2 A;  1PP7 U;  4OPO A;  2A69 F;  1ETX A;  3GIR A;  3BG7 A;  4BHB A;  1RET A;  1VF9 A;  1BJK A;  1X58 A;  4MO7 A;  2HWV A;  4UXN A;  4YRV A;  4X7F A;  5BS6 A;  4UY8 I;  2OCC H;  3W6J B;  1VQL B;  1WSV A;  3QOD A;  3JRB A;  4IHV A;  1M1E B;  5BSX A;  5ILU A;  2P6S A;  3A2K A;  5EJC A;  1OFE A;  1B4A A;  3GQ9 A;  4QVA A;  5DTD A;  2VL8 A;  3QU3 A;  4P2N A;  2VQC A;  2E2J J;  3RI4 A;  2ZO4 A;  4XLC A;  2ZCW A;  4ZH4 F;  1SAX A;  3FM5 A;  4HEA 2;  1TC3 C;  4B3A A;  4A3G J;  3CCJ B;  1KRH A;  3JAM Z;  3VNU A;  2M4K A;  1W87 A;  5L3B A;  1IRZ A;  3S93 A;  4LOC A;  5C4X J;  2XC7 A;  4V02 C;  2C5B A;  2RRE A;  3T5X A;  4OJL A;  1KA8 A;  3GO5 A;  3CC7 B;  1ULY A;  4ZYD A;  5KAF C;  2XRN A;  2M5W A;  2PLF A;  3CUQ C;  5H6Q A;  5E8I A;  2VBV A;  1XB4 A;  2NTB A;  3CC4 I;  4Q4Z F;  3GTG J;  3CCQ I;  2V7V A;  1TLH B;  2C77 A;  2VOO A;  5B3S H;  4RD3 A;  3PL8 A;  1FPQ A;  2ID6 A;  3RYP A;  3E6D A;  2DJN A;  3IH4 A;  3K7A J;  1X2M A;  2VJ4 A;  1VQ4 I;  3A3B A;  3J81 k;  2VXZ A;  4CCJ A;  2LY9 A;  4DOZ A;  2VJI A;  1IV6 A;  2BHY A;  4ENM A;  1YX2 A;  1WJE A;  5E18 F;  2COM A;  3ASP A;  2G7H A;  3LSK A;  3UR3 C;  1J9Z A;  2QEX B;  1K4S A;  3NB2 A;  2ZKZ A;  3M7G A;  4S0H B;  1YJ9 I;  2HKX A;  5FKM A;  4OIN F;  1YJN I;  1OCZ H;  3BT9 A;  1SAN A;  3R0J A;  4Z4W A;  4PZJ A;  2YU9 J;  2NZM A;  1SFE A;  4LB5 A;  3W2F A;  1YIJ I;  1HW1 A;  4NQW A;  3CMY A;  2LP0 A;  4E7K A;  1KU7 A;  3KLN A;  5LGN A;  4LLL A;  3TMO A;  4Q7J B;  4ZGN B;  3VPR A;  3DEE A;  2XF6 A;  5CVR A;  2R5Y A;  2FNP A;  4PFO A;  4IX7 A;  1OJL A;  2LNB A;  1VQ5 I;  2C6Y A;  4PMH A;  2VN2 A;  1WDT A;  4HW0 A;  4MIM A;  3MN2 A;  5IYQ A;  5JLV C;  4AC0 A;  2WSS A;  1LPQ A;  1HVX A;  2ME0 A;  4CYC B;  2R5Z A;  2DMU A;  1ORK A;  1QH0 A;  2JJ1 A;  2HVQ A;  2ICW G;  4CCK A;  2HYF A;  4EM1 A;  4EV0 A;  2NVT J;  4N3N A;  2EFQ A;  2ZZQ A;  2ZFU A;  4A3B J;  1ZRD A;  1Z21 A;  2R7O A;  2GXB A;  2ZME B;  1ZK8 A;  3L2Q A;  4UZF A;  1IRF A;  4EJW A;  3AL0 B;  3CCR I;  1BJZ A;  3BRO A;  3N05 A;  1TWH J;  4D5C A;  1BHE A;  5JR3 A;  3VSU A;  3ES9 A;  4ZCL A;  1CZF A;  2LVS A;  2YX4 A;  3Q0W A;  1JTY A;  3VYS B;  1FRQ A;  3LSI A;  3RIQ A;  1WQ2 A;  2W4S A;  2V4D A;  1BIA A;  4DQ2 A;  1VZ0 A;  5EG0 B;  4PC6 A;  2RAE A;  3R6J A;  4U9U A;  2RKH A;  3S1N J;  2OYN A;  4RCZ A;  3B8Y A;  2PMD A;  4CZC A;  2VON A;  4W8R A;  1MD0 A;  3K4K A;  2Q8K A;  3E1Y E;  4NCN A;  4OPV A;  3P5J A;  3ASR A;  1YW8 A;  4G1B A;  1FJL A;  2VQH A;  4Y9U A;  2QA4 B;  2WZP P;  4UUS A;  2GJP A;  1ZM3 A;  5A2Q Z;  2B7C A;  2QMU A;  4CCN A;  1UD5 A;  2CF4 A;  4ZCM A;  4GCV A;  3PA2 A;  3HEF A;  3H5R A;  1Q82 D;  4MLO A;  2XGJ A;  5FD6 A;  1ZR4 A;  2WWY A;  4E0F A;  3HRS A;  2F6C A;  3WTY C;  1YO5 C;  4BNC A;  1REP C;  1G2H A;  3CME B;  3GFJ A;  1BPL A;  2CRV A;  3U9G A;  1T56 A;  4AD9 A;  5LGT A;  5JHU A;  3H3Z A;  2DFI A;  1H9G A;  3I0T A;  4II2 A;  2XKP A;  4I98 B;  4D5F A;  2AHQ A;  4ZYH A;  5LEJ A;  3ERE D;  2JQ7 A;  2ID3 A;  4P6Y A;  2ZFW A;  1DPR A;  1I1G A;  4UVB A;  3CC4 B;  4KYW A;  4YIR X;  1WI3 A;  2E5Z A;  4A69 C;  2DA3 A;  4NK8 A;  3LJY A;  2MW8 A;  1SD5 A;  1XGS A;  2DFE A;  3RYR A;  3K10 A;  3OS0 A;  3MKZ A;  5E1W A;  1F4K A;  1GVD A;  3W2G A;  3IAM 2;  2QEN A;  4CYD A;  1VQ4 B;  3CZ6 A;  3N90 A;  2JVG A;  1IN4 A;  2HOE A;  1RU4 A;  1ZG3 A;  2DQL A;  4N4N B;  3G4S I;  3ZQQ A;  4UAJ A;  2CYY A;  2EIL H;  5J1U A;  4HQE A;  3QWL A;  1W2B B;  3CCM I;  1YJN B;  3KP6 A;  1E79 A;  1B59 A;  1D1C A;  5IYC J;  1T5E A;  3IAS 2;  2QTZ A;  4RDJ A;  2QQ8 A;  5CVI A;  3I55 I;  2ETH A;  2CUJ A;  4A0Y A;  1F1Z A;  4KN7 X;  4TKO B;  3KEY A;  1OKR A;  1L0O C;  3W3C A;  1RQR A;  2MC3 A;  1U6G A;  4HF2 A;  2BXZ A;  1HBX G;  4UZE A;  3GWZ A;  3GRH A;  2VT3 A;  2XSD C;  3Q38 A;  4IW3 B;  2YUH A;  3BR0 A;  2JA2 A;  3P26 A;  4PCQ A;  5CDF A;  3BH4 A;  5JVT A;  3WTX C;  3C18 A;  3F72 A;  2MH9 A;  3T56 B;  1MBG A;  4F7Z A;  3L1P A;  3HTU A;  3MKL A;  2X3H A;  2PMH A;  2V79 A;  4BY1 J;  1H8A C;  1WH5 A;  2DW4 A;  2R7R A;  1D8T A;  1RMG A;  1EWY A;  3PIP F;  1YX5 A;  3EQN A;  5AN9 A;  2D74 A;  4YHB A;  4IRI A;  1KON A;  5DEQ A;  5KNL A;  1ITY A;  4CZZ A;  1N8R D;  4GRI A;  4U7B A;  3R4K A;  2VIX A;  3QYE A;  1Z3Y A;  5M3F J;  1TWG J;  1ACI A;  2R7V A;  4KMF A;  2QE7 A;  3S16 J;  3HIF A;  3WNC A;  4XON A;  4DIQ A;  3W2I A;  1Y1V J;  3JUR A;  2WA0 A;  1OFL A;  4X6A J;  1DGW Y;  4A3M J;  4IHS A;  4Z4Z A;  1ZKG A;  2ECB A;  1MBE A;  4OJP A;  5CVJ A;  2ZSI B;  3AG4 H;  3E5X A;  4O6J A;  1ETV A;  4MQV A;  2FD5 A;  3VEP A;  3Q3S A;  3J81 K;  4PC2 A;  3I53 A;  3DPL C;  4EJV A;  3MMY B;  3CRZ A;  1IC8 A;  2Y0S N;  2M2E A;  3T8R A;  1I6X A;  1P4W A;  3ZUG A;  1O8L A;  1YI2 I;  1K73 D;  2E1N A;  2QBY B;  1XSD A;  2DQR A;  3A8K A;  1OR7 C;  3CCU I;  4RB3 C;  5FLX K;  4X0G A;  3SQV A;  2NNN A;  1XC5 A;  4E7H A;  1AWC A;  2Y0S A;  1LFU P;  2AO9 A;  3JSO A;  1JHH A;  2K86 A;  4WX9 A;  4I01 A;  1QHG A;  2H1K A;  3PUN A;  4A5M A;  3SKB A;  2QN6 A;  1BMF A;  1SD4 A;  2YSR A;  3FXQ A;  2W84 A;  1MZB A;  1TT0 A;  3CJR B;  2DEU A;  2DDB A;  2W25 A;  2E1B A;  4XIC A;  4KH3 A;  2BVL A;  2JUC A;  1RQP A;  3HKZ N;  1GVJ A;  3H9Q A;  4P9S A;  1JNY A;  3ZZ0 A;  4M0L A;  1DP7 P;  4X0C A;  2RQP A;  2CW7 A;  5H2F C;  3V76 A;  3VST A;  1XCB A;  3ZPL A;  2KIF A;  2Q6O A;  1I3Q J;  3BDD A;  4Z1M A;  3ZN1 A;  3G1L A;  3DU1 X;  1J09 A;  1KQ0 A;  4L0Z B;  2XTX A;  5IYR A;  1TYW A;  4R71 A;  3S17 J;  4KUM A;  3GTM J;  3HKZ A;  3H9J A;  4I76 A;  2IS6 A;  3A8I A;  4RD4 A;  3H1C A;  2A6H F;  4AUX A;  1QZZ A;  3FMQ A;  4HA8 A;  4NB5 A;  1K79 A;  3FZV A;  1N0V C;  2HEO A;  4OIO F;  1IXS B;  1W7P D;  2CMP A;  2QVO A;  4JRA C;  4DQK A;  1KQ8 A;  4JOM A;  1BI0 A;  2VLA A;  3ZIA A;  3TO9 A;  4XK4 A;  2E7X A;  2J5P A;  4X06 A;  1HA8 A;  2XNJ A;  1LE8 A;  1B8I B;  2EZH A;  1HF2 A;  5GV7 A;  1MH3 A;  1VND A;  2LY1 A;  4L5J A;  4A5N A;  3K0L A;  3SDB A;  1AA7 A;  3WWG A;  2OTL I;  3W2V A;  5LBQ A;  3E3V A;  3H3U A;  3CMA I;  5F64 A;  3UKG A;  3GQ7 A;  1XX5 A;  4XOT A;  1DP3 A;  2L7F P;  4AU7 A;  1SKQ A;  3MKW B;  3KYD B;  2HXO A;  5B6I A;  4C9Y A;  1O88 A;  4DBR A;  1XGO A;  2IGK A;  2E19 A;  2F1M A;  2ZZG A;  2EA4 A;  1P92 A;  1ERD A;  1G59 A;  3CJQ B;  1S3J A;  2GA2 A;  4YEL A;  1T95 A;  4F92 B;  4UUV A;  4NNJ A;  2HOS A;  4BEH B;  4WWV A;  1ZRF A;  4P26 A;  2ZBU A;  2EQR A;  2LSO A;  1R00 A;  3VYR B;  2EBI A;  2V9V A;  5F0C A;  4RD2 A;  3U6B A;  3ABT A;  5D4R A;  1VI0 A;  3E0J B;  4IHX A;  2NVQ J;  4B3G A;  1KTW A;  1RZ4 A;  4MYU A;  1I27 A;  4CIC A;  4C2L A;  4LD5 A;  3OL3 A;  5J47 A;  1VQ9 I;  2KHM A;  2Y9Y A;  5FL7 A;  3CO7 C;  3T1B A;  3VYU B;  1KJZ A;  4D0P A;  2EFN A;  1WSR A;  2JJ2 A;  3KL9 A;  1OGO X;  2DOG A;  4WZL A;  3CCU B;  2ZBV A;  2QCO A;  2R7Q A;  2HYG D;  3BOQ A;  3QFC A;  1YYV A;  4UZU A;  4OIR F;  1QNT A;  5CQE A;  4I02 A;  1GXQ A;  2XTW A;  2D1V A;  4QIW N;  3OOC A;  2FBK A;  3RZD J;  3W2A A;  1KYW A;  1Y0R A;  1W7P A;  1EH7 A;  3EUH A;  3CPX A;  1S6L A;  3S2W A;  1BN8 A;  3PQK A;  4JP0 A;  3CW2 A;  3TED A;  5C1E A;  2CRG A;  3IKT A;  4JK1 X;  1GVH A;  4QV2 A;  2BYV E;  2X9D A;  1VJS A;  2O0W A;  4ENK A;  2J5O A;  4Y33 A;  3S14 J;  2VOP A;  2EWN A;  1PVE A;  2DYS H;  2E5N A;  3OMY A;  5IYB J;  2STT A;  2OBS A;  3QPH A;  5F4O A;  2QYU A;  1GR1 A;  3S1Q J;  2O61 A;  1OGI A;  1AIP A;  1ZTR A;  1IDJ A;  5D5X B;  1FP2 A;  1UZC A;  4HG2 A;  4AWX B;  4KA4 A;  2M7B A;  3RZO J;  5GV8 A;  4PC7 A;  3JRH A;  4HIZ A;  1J7K A;  4ACA A;  3FKS A;  5H20 A;  3WTW C;  2KZG A;  3K69 A;  5E17 F;  4YXW A;  3WXM A;  1YHQ I;  3EQO A;  1E2X A;  1D8J A;  1Y8Q B;  5DNS A;  3ISX A;  2X6W A;  1ZGJ A;  4HX8 A;  3N6Z A;  4PGG A;  2LKX A;  3ABU A;  3M8E A;  1R5G A;  1V3F A;  2IVM A;  3LA3 A;  4BS9 A;  3GW2 A;  3DKW A;  4YFK F;  3QFS A;  3RJP A;  4RGX A;  2WV0 A;  4HNT A;  2GXA A;  1YIT B;  3BR2 A;  2BE5 F;  2GIV A;  3OYM A;  3BQJ A;  1QGZ A;  2OTL B;  1B1B A;  4C2T A;  4R1H A;  4X1E A;  1XPX A;  2MBF A;  4QTR A;  2DOD A;  1ONV A;  3OY9 A;  1ZRE A;  1IXC A;  1I39 A;  3K4M A;  3BY6 A;  3AG2 H;  4MFD A;  5AON A;  2D9R A;  2XGD A;  3TP0 A;  2Y69 H;  4XR6 A;  2R4G A;  1H85 A;  4QPO A;  3KP7 A;  4PDK A;  4FQG A;  1J0R A;  3WU0 A;  1W1W E;  2ZIT A;  3L00 A;  3SXY A;  3KYL A;  3ZP5 A;  2PMZ N;  1V0E A;  2Q6L A;  2FMY A;  1OCR H;  5HS8 A;  2HVR A;  4XSZ F;  1FT9 A;  3FHZ A;  1COW A;  1ZM4 A;  3NEU A;  2B63 J;  2WAE A;  4QUZ A;  3G71 B;  1F36 A;  2W6J A;  3PSZ A;  4XQF A;  4G6T B;  2ZME C;  1HKT A;  2XKO A;  5J6X A;  4ZC3 A;  3AL0 C;  3MMP A;  2BZT A;  2PMZ A;  4BHP A;  1WFX A;  3BTJ A;  2VKD A;  1GXP A;  3GTQ J;  1VQ9 B;  3OOP A;  4C2U A;  3LSH A;  4FT8 A;  1VQ8 I;  3PSF A;  4NQW B;  5HLG A;  2ELH A;  4BYY A;  1NRK A;  2D3N A;  2VBY A;  2Q6K A;  2EFO A;  4WZK A;  4OWR B;  1O3R A;  4JMQ A;  3GQ8 A;  1S72 B;  1LLW A;  3GVJ A;  1IGN A;  1VQP I;  5HNH A;  4MEX F;  2RC6 A;  3VNV A;  1Z77 A;  4B4D A;  1EE6 A;  5B5E C;  3VWB A;  2R5Z B;  4E70 A;  3TDZ C;  5AIP A;  3LNN A;  5LMZ A;  4XBF A;  2YWF A;  1WU8 A;  3F8C A;  5HLI A;  1O8D A;  5M5W J;  1SFX A;  1MNE A;  3OEE A;  2GJK A;  2P7V B;  3O6B B;  2D3L A;  5B1B H;  3VOD A;  2LR8 A;  3E6M A;  3QFR A;  5J1Y A;  3K4L A;  2I1L A;  3OR2 C;  3U21 A;  2CW5 A;  4KT5 C;  4PC3 A;  1ZEL A;  2MLK A;  2NTP A;  3ZMV A;  1O8K A;  2WAQ N;  3PFI A;  4UV9 A;  5EGO A;  5J8C A;  1ZM9 A;  3B90 A;  2ZBK A;  3LO8 A;  1O4X A;  1R5H A;  4AVZ A;  2L0K A;  2DYI A;  2VFO A;  1TP4 A;  3VR6 A;  2E36 A;  3BR6 A;  1B9M A;  3HUG A;  3CDH A;  3IWZ A;  4E7Z A;  4J19 A;  4OZZ A;  4LK1 F;  3DWL E;  4B4C A;  4K2E A;  2K9M A;  3CXC B;  4UUS B;  3RKX A;  5C4J J;  3DBR B;  4HE5 A;  1MMS A;  3P9C A;  1P7I A;  2X1C A;  4FX0 A;  3ZC3 A;  2WY8 Q;  2XAF A;  2CUF A;  4D7N A;  1FYK A;  2V7U A;  1R4M B;  3PVD A;  2UWM A;  4X7E A;  4M9X A;  2WB1 N;  3IP4 B;  3VFZ A;  1TQP A;  3OYC A;  1BJA A;  2VFN A;  1DDI A;  2IP2 A;  1MMD A;  2GWR A;  2IXS A;  2K9S A;  3B6A A;  3CDI A;  3EYY A;  3Q9S A;  2LRE A;  3CP2 A;  4I0B A;  2O8K A;  2FVG A;  2F48 A;  3ZR8 X;  2XT4 A;  3ZQI A;  2OC6 A;  1ZG1 A;  5TGT A;  4HRI A;  2CGP A;  2RC4 A;  4RPD A;  2WB1 A;  2OBR A;  4DZJ A;  4CCL A;  3V8K A;  2ISZ A;  4LMY A;  1MJA A;  3SDG A;  2JUG A;  1WPC A;  1U9N A;  3N97 A;  5A2Q K;  2XGC A;  4Z06 A;  3OKX A;  4U0V A;  2CW8 A;  1VQ8 B;  1WJB A;  5D5V B;  5KSW B;  2FXA A;  3JW4 A;  4QHY A;  2C5H A;  1UG2 A;  3HRT A;  2O0Y A;  4EM2 A;  2K7L A;  2BM4 A;  5A88 A;  4KKS A;  3AGP A;  1Z3X A;  2JT1 A;  5DCF A;  1VQP B;  3WTU C;  3JRC A;  5J4Y A;  4A3K J;  2R7F A;  1EP1 B;  3V7C A;  3BG3 A;  3ULQ B;  3LST A;  3S3N A;  2HQR A;  3KZY A;  4ZDL A;  3CD6 I;  1XSX A;  2UZK A;  4YII A;  5FO0 A;  2FX0 A;  2L9V A;  1LQ1 A;  4MFE A;  2ACJ A;  1ETY A;  1OCT C;  1VQM B;  1S9H A;  2CG4 A;  2ISY A;  2VXD A;  5FKN A;  2NS0 A;  4F52 A;  2KVO A;  1DUX C;  1HA3 A;  2F2E A;  1OFD A;  2DY1 A;  4GFB A;  2DT6 A;  3WE3 A;  1OFC X;  1HOM A;  3H0D A;  2A5W A;  2E35 A;  1HKQ A;  2XPW A;  4EGZ A;  1DG1 G;  5ILS A;  3AVT A;  1JUP A;  3WG9 A;  2XRL A;  2OBT A;  4PAA A;  4Z4V A;  1G7R A;  5L3E A;  4JQF A;  1OYI A;  2FA5 A;  1R23 A;  5DN6 A;  4KIS A;  4CSW A;  2LBF A;  4OAY A;  3BJA A;  4HYE A;  3BG9 A;  2A3S A;  4Y15 A;  1IUY A;  3S3O A;  1H80 A;  4ZZL A;  2DOE A;  3RTR A;  2HXI A;  2X8K A;  1FSE A;  5H6R A;  3OW7 A;  2JSC A;  2DXI A;  1MRZ A;  1MH4 A;  1G3S A;  4GXO A;  2HMA A;  2BVN A;  3JRG A;  2VFQ A;  2L54 A;  1X4P A;  2BHZ A;  2WBM A;  3IC7 A;  3P9K A;  4M9Z A;  1J9I A;  2J8I A;  4YC5 A;  1I1S A;  2IT0 A;  4F7D A;  4LIT A;  4BE0 A;  4O3M A;  5CKT A;  4RAY A;  2DIE A;  3AVX A;  1TUI A;  3OIO A;  4YCQ A;  1KYZ A;  5FKO A;  3ZMZ A;  1RKT A;  2O6W A;  2NS8 A;  2G7U A;  3PO2 J;  4BQO A;  3FHN A;  4V2F A;  3A1Y A;  2VC0 A;  3S2H J;  1BOA A;  3MAJ A;  2PX9 A;  5IOY A;  3L2C A;  4YEI A;  5C1C A;  1RES A;  3AG3 H;  5J40 A;  1F5T A;  2RV8 A;  3SZP A;  4OU0 A;  1EXM A;  3EDP A;  1Y39 A;  5M5X J;  3F23 A;  4BDY A;  1ELO A;  5GP9 A;  1E63 A;  4M6Y A;  4KIC A;  1STZ A;  4F55 A;  2X0K A;  3TO6 A;  2XAJ A;  5JBQ A;  1K8A D;  1GUU A;  2HU9 A;  3AGQ A;  3BH6 B;  2NVX J;  3CLQ A;  1BL0 A;  3LMM A;  4RLZ A;  1RUO A;  5GAG J;  2KRC A;  3L2V A;  4X7C A;  4BDZ A;  4GQN A;  4OAZ A;  1YLO A;  5HS7 A;  1KQ5 A;  2GQF A;  5HDK A;  2Z99 A;  5F0F A;  3HTS B;  1ZAO A;  4AIH A;  5K7H A;  3CMM A;  5LHG A;  3GTK J;  2CU7 A;  3E5Q A;  1MJ9 A;  4Z6Y A;  4EGY A;  1MJB A;  2O8X A;  4HQM A;  1JRG A;  5K5R A;  3FPK A;  3ESW B;  1N77 A;  3ZQ7 A;  2VI6 A;  1UMQ A;  1VTN C;  1VQ7 I;  3V4G A;  1CF7 A;  3FXK A;  5TY0 A;  1PXZ A;  3CD6 B;  1ETK A;  1FC3 A;  3BR1 A;  4OMY A;  2Q2E A;  2K9N A;  3EYI A;  1IN7 A;  1Z0X A;  4PK4 A;  5HLH A;  1QO0 D;  4LGW A;  1X3U A;  1LE8 B;  3M3Y J;  1NB9 A;  2IS4 A;  3J80 Z;  2NS7 A;  2BM1 A;  4OJO A;  1FMV A;  5HS9 A;  3BTC A;  3BZC A;  2ADU A;  1PLU A;  3VSK A;  2O5R A;  5KHD A;  2E34 A;  2X0L A;  3JSP A;  3ASQ A;  1PP8 F;  1ZAR A;  3MVP A;  1QA1 A;  4A6E A;  1KU2 A;  1W5S A;  1U78 A;  5DYM A;  3S2D J;  2EIM H;  4FWT A;  5DD4 A;  3D5L A;  3KPH A;  3MZY A;  5IK2 A;  3CB4 A;  2QQA A;  1LDJ A;  3PQJ A;  5GAE J;  3QU6 A;  1UD6 A;  2PJR A;  2P5L C;  3K4B A;  3HHH A;  2Y0M A;  5L3F A;  3OYG A;  2QA4 I;  4KT6 A;  1R5O A;  1IZ1 A;  4LC0 A;  4HV5 A;  4WWC A;  1FBQ A;  1P6R A;  2Z33 A;  4BPR A;  4Y3O A;  1K4T A;  1QUE A;  1ZN2 A;  2GXG A;  2BX6 A;  2DK8 A;  4QPQ A;  4JX4 A;  2M7A A;  3FWE A;  3CME I;  1BR4 A;  4ESB A;  5AMV A;  2CH0 A;  2L9S A;  3BZ6 A;  3OIP A;  4JYK A;  5FD5 A;  2MFZ A;  3ZCO A;  2JRT A;  4A3J J;  3DV8 A;  2VBW A;  2LK2 A;  2BV6 A;  2A07 F;  3AFH A;  2HR3 A;  3SEZ A;  3KFW X;  5LFA A;  4RGR A;  3QAH A;  1I5Z A;  5DV5 A;  1GO2 A;  2INU A;  5BNG A;  2VBZ A;  3C3W A;  1WJ5 A;  2IS1 A;  2V26 A;  2WR8 A;  1HG8 A;  2H6C A;  2Y75 A;  3ZZU A;  2VNJ A;  2A6E F;  3GVA A;  2KIM A;  3SHF A;  2GAU A;  4HSR A;  4P9F A;  4YZ0 A;  1IJW C;  3K70 D;  3NWS A;  1OLT A;  2COB A;  2BPO A;  3I71 A;  4BY7 J;  4IRH A;  3VO1 A;  2WZN A;  1TW2 A;  4PJN A;  3W2E A;  3WGG A;  3GYH X;  1BC7 C;  4RD1 A;  1RI7 A;  2DYR H;  3K1N A;  4YZQ A;  4ANJ A;  2OQG A;  1O3S A;  2ZNY A;  3E6B A;  2XDV A;  1WJC A;  4NK6 A;  1SAU A;  1OGM X;  1UHM A;  3FK6 A;  1VQK B;  3EUK L;  1V5V A;  1Y6I A;  4Y7C A;  3Q0V A;  2IRF G;  1BX1 A;  1XFO A;  3SLN A;  1SVM A;  4B47 A;  3F8M A;  2UUZ A;  4RGU A;  5ICC A;  1FOK A;  2X1D A;  4XLN F;  4QSH A;  3F9K A;  5KCM A;  3LQR A;  1FLI A;  3VSV A;  1Q1H A;  1U5T A;  2JWT A;  3GF2 A;  4AC9 A;  1WKM A;  3OYD A;  2DTR A;  1Y1W J;  1TQM A;  2JVH A;  1VQ7 B;  2WPD A;  2M87 A;  3OYJ A;  1VQN B;  2HKO A;  5DM6 F;  4RCY A;  2NTQ A;  2VBE A;  1W36 C;  2NYX A;  1EFC A;  1UST A;  1WI9 A;  3ZBT A;  4GYI A;  1MND A;  1JT0 A;  3OPO A;  1YS7 A;  1MBH A;  3U1D A;  3WBJ A;  2HS5 A;  1WJA A;  1WZ2 A;  4ENJ A;  1AKH A;  3NE5 B;  1EP2 B;  2Z9O A;  3NAR A;  3UNG C;  1E3Z A;  1OGJ A;  1Y8R B;  2W1O A;  3VB2 A;  1GAQ A;  2EFP A;  3HGG A;  5HOO A;  3M4O J;  2B7B A;  3PJR A;  2QDX A;  3FIW A;  5A89 A;  2BY2 A;  2F4M B;  2OV7 A;  2CSO A;  5ERI A;  2HVS A;  4XKW A;  2B5O A;  1FOW A;  3EUA A;  3GZ5 A;  1PUE E;  2HZD A;  5EDN A;  4HDU A;  4FAS D;  4DK0 A;  4JBA A;  1PKV A;  2CQK A;  2E2H J;  1U2R A;  2HFH A;  2N8G A;  2Z3Y A;  4M73 A;  1BOB A;  3S1R J;  1ZGW A;  1W5C C;  3WG7 H;  3DLL F;  4LG0 A;  1FSH A;  2QZA A;  3CF2 A;  2ZZE A;  3DEW A;  3FK7 A;  3OYH A;  1R4N B;  4MGR A;  4XLF A;  4CUG A;  3CCY A;  4AF7 A;  2ZC2 A;  1IRG A;  5HZA A;  1L1I A;  4OOV A;  3JU4 A;  5FO5 A;  4EM0 B;  4RBO A;  1KD1 D;  1UG0 A;  5TJJ A;  4C30 A;  1WGX A;  2G9W A;  2BVM A;  4XMY A;  3GX4 X;  2XEX A;  1U8R A;  2PLY A;  3F6O A;  3ZQF A;  2K85 A;  4C2M J;  4MR0 A;  2LOO A;  2EV6 A;  1JHF A;  1R71 A;  3GVK A;  4A3I J;  4OJ6 A;  5GAD J;  4FN5 A;  5BPI A;  3K6G A;  4XKC A;  4NDL A;  4J0Q A;  1OQY A;  1UEL B;  1MW7 A;  3WU1 B;  3ASS A;  4C43 A;  1ZG5 A;  5TV2 A;  1BW6 A;  1K6O A;  1D2E A;  2GIZ A;  2C2W A;  4XRS G;  2IA2 A;  3WGH A;  3CJN A;  5CVU A;  1X1C A;  2K02 A;  4I99 C;  4RLQ A;  2VBS A;  5E8G A;  1X1D A;  1O3T A;  2PI0 A;  4BU2 A;  3WOD F;  3OYK A;  1B9N A;  2QM3 A;  5E79 C;  2QSF X;  1UB9 A;  4BL0 B;  2XZO A;  1YRN A;  1ETO A;  2L9N A;  3E6C C;  1O8G A;  2EIK H;  3IH2 A;  4CDG A;  3LAP A;  2W48 A;  2BV3 A;  2FNA A;  5JLW A;  1PE9 A;  2FBH A;  2VYQ A;  1MNM C;  4M3F A;  1IXR C;  5F08 A;  5JLX A;  3L2W A;  1FNB A;  1WJD A;  2QSH X;  5F4M A;  1TYV A;  2KIQ A;  1D5V A;  1V0F A;  3BY2 A;  2GRE A;  3P4G A;  4OPS A;  1LUJ B;  4ZDP A;  3FJO A;  1GQ8 A;  4PC1 A;  5J3O A;  1QJV A;  1T0F A;  3EQL F;  1Y0U A;  2EZK A;  4DW6 A;  3G73 A;  3ML3 A;  3CCE I;  1DDG A;  4RDK A;  2VBT A;  4N3G A;  3U1K A;  3I4N J;  4A3F J;  2BM6 A;  1LKX A;  2OZU A;  2E71 A;  2ZXJ A;  1DDN A;  2LFB A;  2IJL A;  1QPM A;  3NAU A;  5E1Z B;  3C7J A;  2MD5 A;  2MSY A;  3E97 A;  2OPT A;  4KIT B;  2JA7 J;  1MAB A;  1XMA A;  3MQ0 A;  1FOX A;  2R7T A;  1SD6 A;  2VQL A;  1JXS A;  2LF7 A;  1NH3 A;  2VQG A;  4IXA A;  3A01 B;  5GPA A;  3GEZ A;  1PJ7 A;  1RKW A;  4B8X A;  4AF6 A;  3GFM A;  3L2R A;  1KQS B;  4ON0 A;  2IA0 A;  2V7W A;  1R1T A;  2NOJ B;  1YS6 A;  3BJ6 A;  4LIU A;  3H9N A;  1SMY F;  4LK0 F;  1SEU A;  3DPT A;  2QKL B;  2M5S A;  3A3G A;  3E7L A;  2F5D A;  2E2I J;  2UVE A;  3QPS A;  3HAG A;  3SZE A;  3PFY A;  4IZZ A;  1A31 A;  1IB4 A;  2CQQ A;  5IT3 A;  1E3H A;  3JCU C;  2W7N A;  1QA6 A;  5IYP A;  2QGG A;  2CW0 F;  4TN1 A;  1JA0 A;  1YTY A;  4OPW A;  2DT7 B;  2AQE A;  5K5Q A;  1VFC A;  4XN3 A;  2NPF A;  2DDA A;  2HDC A;  5E3L A;  1SVO A;  2XF7 A;  2IPQ X;  3BTI A;  1D5Y A;  5H59 A;  3AVY A;  2Y2Z A;  2JTV A;  2JN6 A;  1FYL A;  3WNB A;  3W6K B;  3OWT A;  4MTD A;  4PJJ A;  3QOE A;  2WYR A;  4PJ0 C;  2KP6 A;  2G0E A;  1P4A A;  2FUG 2;  1S7O A;  3ISP A;  3M07 A;  1SD7 A;  3JRF A;  4IKF A;  1E1Q A;  1SKY B;  4P6V F;  2LZJ A;  1DBO A;  1TNT A;  3IH3 A;  5KW9 A;  3PNT A;  2JZY A;  4DNR B;  3ZMU A;  4P25 A;  1G4D A;  1H88 C;  4OM9 A;  1PJ6 A;  4Z4T A;  2M0M A;  4MEY F;  4BKX A;  4RDL A;  2CUE A;  3P27 A;  3AVW A;  2F1L A;  3GFL A;  4M3G A;  2HTS A;  4Q5S F;  1PJ5 A;  2VAS A;  4F3Q A;  3U6K A;  1BC8 C;  2HQA A;  3QP6 A;  2XNC A;  4P5O A;  2WJY A;  2XTY A;  4RB1 A;  1H89 C;  4PUS A;  1AHD P;  5FRM A;  1BW5 A;  1G7C A;  1KK2 A;  1KCC A;  4GDF A;  5M5Y J;  2DOF A;  3F6V A;  3W5U A;  4LG3 A;  4YAF A;  2BBY A;  1QGA A;  2FQ3 A;  2QQB A;  1Q86 D;  2DAO A;  2XZL A;  1TSP A;  3QRF F;  3V7S A;  1T6S A;  3LSM A;  2OAZ A;  2X6X A;  2DI3 A;  1XTA A;  1IN5 A;  3P7N A;  1TW3 A;  2D2W A;  2EZL A;  3JTG A;  1JB9 A;  1YIT I;  2FBI A;  2XND A;  1O8F A;  1IJF A;  1MIJ A;  4NC7 A;  3J7Z I;  3L2U A;  2P3M A;  3CCE B;  2B0R A;  3DF8 A;  2H8R A;  2NT9 A;  6PAX A;  2F4N A;  4I09 A;  4C3J J;  2K9Q A;  4I0A A;  1D8K A;  4IEJ A;  4ESJ A;  1JGS A;  3OP1 A;  3QE2 A;  2IGN A;  3FXJ A;  1VLO A;  3MCA A;  2ZTG A;  3CCL I;  2C4U A;  3HBL A;  1OMI A;  4IVN A;  3FMR A;  4G7H F;  1HZE A;  4KMU X;  1MBK A;  2ZB9 A;  5EF6 A;  3G1M A;  3HGY A;  1O7L A;  3LVB A;  1K78 A;  1FND A;  3RPU D;  3PA1 A;  5D4S A;  3G71 I;  3SQN A;  1Q7Y D;  3JTH A;  4G6Q A;  4A2U A;  1GJR A;  4I84 A;  4G8X A;  3LMW A;  1YFH A;  1TNS A;  2HZT A;  2TRT A;  3LL7 A;  1ZLK A;  3SJP A;  2OD5 A;  3FX3 A;  4KN4 X;  2MH2 A;  3T0Y A;  1RR8 C;  1DBG A;  2KQR A;  2AQF A;  1XQB A;  3LQE A;  1SFO J;  1F20 A;  3BP8 A;  3SUC A;  5JI6 A;  3E1S A;  1IV8 A;  4A0Z A;  4CHU A;  5FO1 A;  3JRI A;  2FML A;  1R22 A;  2M1B A;  2ESH A;  2OJE D;  3DBL B;  3KZZ A;  2M8E A;  3FMS A;  4B48 A;  3LSR A;  2R7X A;  4B43 A;  1S72 I;  4Z2Y A;  2FEZ A;  4YIF A;  4RLF A;  3PET A;  3DLA A;  3OIQ A;  4PGH A;  3DEU A;  1BM9 A;  1N78 A;  3J7Y J;  2D45 A;  3HXL A;  4BQQ A;  1R58 A;  2I8D A;  2KRF A;  5K7F A;  2Z2S B;  1NTC A;  4BHC A;  3MZ8 A;  3H5A A;  3VSL A;  1TLL A;  1CF7 B;  2F5F A;  2Q2E B;  1IO2 A;  2EV5 A;  2JA8 J;  2M45 A;  1CNE A;  3R61 A;  4I7H A;  3JRE A;  1OOC A;  2KJC A;  4ESF A;  3FF5 A;  1W0K A;  2OF7 A;  1BA5 A;  2EPF A;  3IHU A;  4MXN A;  4HF1 A;  2XV4 S;  4PJM A;  4BXF A;  5E3O A;  2KZV A;  2FQ4 A;  3WTT C;  3OYA A;  1WPK A;  1B6A A;  3FXM A;  3QYF A;  4KKT A;  2Q1Z B;  4LJZ F;  3Q0U A;  4ITV A;  1CNF A;  4M1K A;  2DA2 A;  1E43 A;  3OE7 A;  4RM0 A;  5FNZ A;  1CQX A;  3H0G J;  3T53 B;  3DFG A;  2BW3 A;  2K3P A;  1PUF A;  2OUM A;  2LD5 A;  5LGU A;  5F04 A;  1E17 A;  3A4C A;  5DDG A;  4CH7 A;  2NV4 A;  2XZP A;  4P1V A;  2KDZ A;  3HSF A;  2PJR B;  3EUH C;  1UAA A;  3ZSC A;  3RPU A;  1LEB A;  1BI1 A;  2KKO A;  3OL4 A;  3ZPP A;  1TWC J;  2M3A A;  5ICE A;  3ZQC A;  3ABM H;  1OB5 A;  4HLX A;  3CJT B;  1V5F A;  3OYI A;  2VPL A;  2CBX A;  2HLD A;  2MC4 A;  4P3I A;  1IDK A;  2R7U A;  3ZQL A;  1VQ6 I;  2CC2 A;  5IOZ A;  4Q48 A;  5CVV A;  2E1R A;  2PMU A;  4ACB A;  4HAM A;  2P0W A;  3AK5 A;  4CYC A;  1VF7 A;  2KT0 A;  1XN7 A;  4XN0 A;  2XC1 A;  2F4I A;  2LG4 A;  3CCL B;  5F4J A;  1DPU A;  3FDY A;  4LLG F;  5ILV A;  4Q47 A;  2GOM A;  4ZJZ A;  2EIN H;  4G12 A;  1K4Z A;  1ZLJ A;  1HLV A;  2VB6 A;  1MMN A;  4BBS J;  1QQ1 A;  2QXZ A;  3GVL A;  2B9S A;  1LFP A;  2ZXH A;  3OAA A;  4FE7 A;  4ZV4 A;  2YR2 A;  2XHK A;  1F43 A;  1PDN C;  4LB6 B;  3F3X A;  4FTH A;  2WC2 A;  2Y30 A;  3EET A;  3V7R A;  1TL8 A;  5BOX A;  1K5C A;  5F1R A;  2DOA A;  2EFW A;  1UFM A;  1FX7 A;  2CQ7 A;  3O8H A;  3RSN A;  4RM2 A;  5EEG A;  3JAM K;  5EG0 A;  2ZJR F;  4DK1 A;  4G7Z F;  2JA6 J;  3PSI A;  3QQA A;  3HM5 A;  1Z6T A;  1UCR A;  4XRF A;  2XT2 A;  3ERM A;  2R5Y B;  3ZN0 A;  3H94 A;  1XMK A;  2CUZ A;  3BPX A;  1XGN A;  4XRM A;  4N9I A;  3WND A;  4KFC A;  3LA7 A;  4P55 A;  4YFN F;  3ASN H;  5HDG A;  2L02 A;  2WJV A;  5FLV A;  1FNN A;  1O57 A;  2FU4 A;  4J01 A;  1T2K A;  3F22 A;  4HDV A;  5ICF A;  1FNC A;  1Q81 D;  3S15 J;  2P6T A;  3TOB A;  1EA3 A;  2HDD A;  1VQM I;  2BM0 A;  3JQQ A;  2VBK A;  1D1A A;  5HXB A;  1MGT A;  3AST A;  3H36 A;  1R5N A;  4XRS A;  2VPR A;  2NAZ A;  4TMV A;  3H35 A;  1QX4 A;  1TBX A;  4N4O B;  3JQR A;  1IN8 A;  2W57 A;  3BZK A;  3AKZ A;  3AVV A;  4HX4 A;  1Q9S A;  1A6I A;  2BEO A;  2IEK A;  1TQI A;  4ZZD A;  1V54 H;  5EYR A;  1L3L A;  1VBL A;  1X1A A;  4U4B A;  2OK7 A;  3WHB A;  3T8T A;  4YZA A;  3SJZ A;  4RAG A;  1I50 J;  1MMA A;  4R79 A;  3GSI A;  3BTL A;  3QSY A;  1JTA A;  1QFJ A;  5JMC B;  2ZXW H;  2P7C B;  4D1Q A;  3BLY A;  2K40 A;  2F3L A;  4DYR A;  4KKU A;  5IP6 A;  1W0U A;  2H27 A;  2WAQ A;  4YAO A;  2O1D A;  5J3L A;  3RDI A;  3RY8 A;  3F8B A;  1XSV A;  1A36 A;  1VQ6 B;  3OZW A;  4Y4R A;  2Z16 A;  3QYB A;  4XKV A;  3OZV A;  2HDN B;  5FJ8 J;  1J2X A;  3G05 A;  1YW9 A;  1D0X A;  1GAW A;  4EQQ A;  3ZQG A;  3J81 Z;  5FGM A;  3JR9 A;  4I2O A;  1N08 A;  1TZL A;  3C2B A;  1G7S A;  4ZDO A;  4L5E A;  1OYW A;  5D6E A;  5K5O A;  1HC8 A;  4L9T A;  4RB0 A;  5ED4 A;  3W6V A;  1D3Y A;  2DCU A;  3PUB A;  4RDU A;  1T8I A;  2UVF A;  3W5H A;  1JKO C;  3B73 A;  1T38 A;  3OSG A;  1XB2 A;  1FDR A;  3BCF A;  3G6E I;  1S5L C;  3CLO A;  1BX0 A;  3NRV A;  1FZP B;  1EF4 A;  4HBL A;  2MGQ A;  3DBH B;  3OSF A;  2K9L A;  1NG6 A;  3I64 A;  1APL C;  3U2R A;  4M6V A;  3BG6 A;  2H94 A;  1WSU A;  1QFZ A;  4U0Y A;  1YRN B;  1H42 A;  5L3G A;  3OEH A;  4AID A;  2V6C A;  4Z4R A;  2FSW A;  1WH7 A;  4URR A;  2K4J A;  4ASN A;  5M3M J;  4ZYG A;  4K1X A;  3ZGK A;  4P96 A;  1FOY A;  2I10 A;  2BY0 A;  3GTJ J;  4A12 A;  3FXL A;  1V4R A;  3TL4 X;  2ZXI A;  1QRC A;  3ZRG A;  5J8F A;  1DAR A;  1QVT A;  2QBY A;  3S3M A;  4DNC A;  3CF5 F;  5IP9 J;  4WK8 F;  3BH7 B;  4L9J A;  2MAB A;  2X51 A;  2L4M A;  4U88 A;  2IA1 A;  4HOB A;  2C4T A;  4TMX A;  3UW0 A;  4RMN A;  2VNK A;  5THX A;  3LOC A;  1WP6 A;  1U9O A;  1QUF A;  1UJ8 A;  4M3D A;  3HOX J;  1R5B A;  4E4H A;  2BM5 A;  4NC6 A;  1QA2 A;  2YX7 A;  1LDD A;  2DN0 A;  5E3M A;  1TWA J;  1G3T A;  1O8I A;  2DA1 A;  2M0C A;  1XCV A;  1K8F A;  4Y17 A;  1EA0 A;  2DBB A;  2V1D A;  2QKM B;  4I6Z A;  2Z6B D;  4BUP A;  5IYD J;  3O8G A;  1D1N A;  4PGO A;  4Y7N J;  1YJW I;  4DYC A;  3GTO J;  3HOW J;  1T98 A;  1KGS A;  1WOS A;  4OIQ F;  1WCM J;  1ZR2 A;  3TOA A;  3HOU J;  3BY1 A;  4EJT A;  2GK6 A;  2QYO A;  3A0H C;  2I5U A;  2M30 A;  1KZL A;  3GTL J;  3CUO A;  2RVC A;  3K2Z A;  1J5Y A;  2ECC A;  2KLO A;  2JSP A;  2AXT C;  2HPM A;  1YQA A;  1V55 H;  4JX6 A;  5J35 A;  2DER A;  1NG7 A;  3RPQ A;  3HDD A;  2A5Y B;  2EJR A;  1ON1 A;  5DCM A;  4AIK A;  1T6Z A;  5FIU A;  2CFX A;  1OB2 A;  4DGW B;  4C3H J;  2E1C A;  5KAI C;  1EJ9 A;  1KU9 A;  2CV0 A;  1FIP A;  2MG4 A;  2P5K A;  3S8P A;  2NVU B;  3JRD A;  2XAQ A;  3GTP J;  2JDI A;  4W8Q A;  1H8E A;  5EMN A;  2O9L A;  4MTE A;  2OTJ B;  2L7K A;  3G6E B;  1RPW A;  5IT9 Z;  4YDT A;  1W34 A;  4E7I A;  2H8W A;  4M53 A;  4XLE A;  4NBS A;  3KCC A;  1QCX A;  4U0W A;  2XAG A;  3CPW B;  4PSX A;  2PEX A;  3NQO A;  2W24 A;  4ABZ A;  1VQK I;  3L09 A;  4Z05 A;  2MA3 A;  5E20 A;  4BEH A;  1HDD C;  3MD2 A;  4W8S A;  2LF8 A;  2EH3 A;  1Z1D A;  3V8J A;  4L8J A;  4TMZ A;  5L46 A;  4U7D A;  1VHO A;  5FA6 A;  3HOV J;  3FXO A;  2L7Z A;  3I58 A;  4IHW A;  1VQN I;  1S4M A;  2PYH A;  2VFP A;  3Q5F A;  4B44 A;  1G6N A;  2ZL6 A;  4TT3 A;  1K9M D;  1FBU A;  4RGS A;  1U2W A;  1T6X A;  4FCY A;  4NC8 A;  1CQT A;  2DU9 A;  2JPB A;  3GBG A;  4FXU A;  3T51 B;  5A8A A;  1B72 A;  4X05 A;  4WXC A;  1USS A;  1JGG A;  5FKL A;  2TDX A;  2HYJ A;  3H5N A;  5TR9 A;  3ML6 A;  4BXU A;  1FTT A;  3BCD A;  2Y48 A;  1JJ2 B;  1KK1 A;  5GTI C;  2W85 A;  2HPI A;  2R3S A;  2BOL A;  1JA1 A;  2FE3 A;  2OQR A;  3LQQ A;  3GQA A;  1B2R A;  2EA2 A;  4BBR J;  3VMW A;  4J00 A;  3Q3A A;  1UD8 A;  3MWM A;  5E6T A;  3C2H A;  1K78 B;  4GO1 A;  1YJW B;  1QVG B;  1M1K D;  3JX8 A;  1YE9 A;  5DS9 A;  3LSJ A;  1K61 A;  2XOK A;  4TV7 A;  4W8T A;  5D5W B;  5E3N A;  3KET A;  1KC8 D;  1QA3 A;  2RQQ A;  4M9S A;  3V42 A;  2RNJ A;  3CUQ A;  3H9G A;  1U8B A;  3GLX A;  5DSZ A;  2PEC A;  4L9N A;  2YUS A;  5CJ9 A;  2BF4 A;  4WZT A;  5HZB A;  2A05 A;  5CLS A;  1LLZ A;  3JQP A;  1GT0 C;  4YEJ A;  3A35 A;  2FOW A;  1Y0N A;  3G2B A;  3RCO A;  3ABL H;  3HRU A;  2OCE A;  2DET A;  4KIG A;  4R8H A;  3KP2 A;  2O6G E;  1WHU A;  5HVQ C;  1W7P B;  1BIB A;  3S1M J;  1G3W A;  5C44 J;  2BY3 A;  2EIX A;  4WQM A;  2CK3 A;  5IPA A;  3MZH A;  1LM1 A;  2MD0 A;  5FRN A;  1D1B A;  5LRR A;  4AYB N;  4LFU A;  2WAD A;  2HOA A;  3HOT A;  2V7T A;  4UHT A;  2WTE A;  2EZI A;  4L5I A;  2BMW A;  1EFR A;  4EMS A;  1YLF A;  1GV2 A;  1E0E A;  2R9V A;  1OCC H;  2GBY A;  4WXH A;  2LKS A;  1ZYR F;  3RKY A;  2L2O A;  1XG2 A;  1IB0 A;  1BN5 A;  1GLN A;  2HDW A;  1JJ6 C;  2EFG A;  2P5V A;  1KQ9 A;  2JA5 J;  4G1V A;  2KFD A;  1I6H J;  4AYB A;  1UD2 A;  4G5G A;  3HRM A;  1JT6 A;  1MSF C;  2BW3 B;  1JKR C;  1PUF B;  5BMZ A;  2CND A;  2NXN B;  3B6C A;  3I56 I;  4G7W A;  2MLG A;  1JKP C;  3I59 A;  2OBP A;  3A03 A;  1LVK A;  4L9V A;  3HOY J;  2E1M B;  2ELK A;  2QUF A;  3HOS A;  4PFP A;  2QTL A;  2RDP A;  3A8J A;  4WZE A;  2VE9 A;  2Z1D A;  3DQV C;  2L4A A;  4NHJ A;  2CO5 A;  2JIZ A;  4HNU A;  5D6F A;  1R7J A;  2KPM A;  4MQ9 F;  2DMP A;  3KEQ A;  1O8J A;  4GYG A;  2VBU A;  3CQZ J;  4PJL A;  3KEW A;  3VMV A;  5BQT A;  4M6X A;  4X07 A;  4YAW A;  1RUN A;  5FLM J;  1R6R A;  2BSA A;  4YZX A;  4EH1 A;  3FY3 A;  2OU2 A;  1S0U A;  2PE3 A;  3B4N A;  1Z91 A;  1A35 A;  5L3C A;  3S32 A;  2ZJQ F;  3LSG A;  3J7A Y;  1N06 A;  1U5T C;  4FK8 A;  2HI3 A;  2UXX A;  2Y9Z A;  4A3E J;  4IQJ A;  2HQN A;  2WY7 Q;  1E3O C;  3WY9 A;  4HST A;  1MDM A;  3NAW A;  5H5J A;  4B3F X;  3E5U A;  3QFT A;  3B02 A;  1HF0 A;  2BXY A;  3HOZ J;  3B8H A;  5JHF A;  3U2Q A;  4YFO A;  2LYC A;  2PG4 A;  1FTZ A;  1O3Q A;  4V2G A;  5DM7 F;  2F43 A;  4PSW A;  1WVR A;  3M8J A;  3COA C;  1CLW A;  4ASU A;  3OS1 A;  2XPU A;  4Z4U A;  2R0Q C;  3D5R C;  1G3Y A;  3VMF A;  1E64 A;  1R1U A;  2HOT A;  2EWE A;  3KP5 A;  2GA1 A;  3T9G A;  2G0Y A;  3SLD A;  3BC9 A;  1HKS A;  2Z5U A;  3IRR A;  1HW5 A;  3CES A;  2R7S A;  2P4W A;  3K70 C;  1IDY A;  4YG2 F;  1AOY A;  1FRN A;  1ODD A;  3D26 A;  3OZU A;  2IW5 A;  2IS2 A;  1G8X A;  2W82 A;  1RIO H;  3H09 A;  1S29 A;  3ZMD A;  4G6D A;  4Y9R A;  5J1R A;  3KLO A;  2RNG A;  4Y13 A;  2GQQ A;  1N25 A;  3HSR A;  1JKQ C;  1O8H A;  2V1U A;  1V5E A;  2ZNZ A;  5GTH C;  2K5C A;  3WTZ A;  3CCQ B;  1YX3 A;  4DBQ A;  2PIA A;  1K83 J;  3RQ4 A;  5EGO B;  3KRG A;  1CGP A;  4HNV A;  1BI2 A;  3REO A;  3OYE A;  2VBX A;  3DPU A;  3HPG A;  4FET A;  2BGJ A;  4P22 A;  3I56 B;  3HUG B;  1YJ9 B;  3CCS I;  3DU6 A;  2NT6 A;  3OFN A;  1S7A A;  3IKV A;  1K7A A;  2EK5 A;  1J59 A;  2BSP A;  3DTE A;  5FFZ A;  2D5V A;  1QGY A;  1YIJ B;  2QZ8 A;  1FEX A;  1EZG A;  1MKM A;  2KMU A;  3GLL A;  1RRJ A;  4L18 B;  2M8G X;  2EIJ H;  3SEJ A;  1FIA A;  3KX2 A;  1O8M A;  2X3U A;  3DTI A;  4CGZ A;  1VQ5 B;  3FM3 A;  2IQ7 A;  3ZMS A;  4A0X A;  3F0C A;  1EP3 B;  1QPI A;  4LBW A;  2NOG A;  3R0A A;  4IOA F;  3F21 A;  1W0T A;  3G3Z A;  2DT5 A;  5E1X A;  5CQG A;  3ZXS A;  1VQO I;  1R49 A;  3I1F A;  4RD6 A;  3VDX A;  3ZOB A;  3ONQ A;  4IF4 A;  1B23 P;  1JI8 A;  2XB5 A;  3GZ6 A;  1BBY A;  3I3L A;  4XKB A;  1WOR A;  2BGI A;  3Q6R A;  2VT2 A;  3CCR B;  3SZT A;  1ON2 A;  3VYT B;  2VC1 A;  1EFT A;  2X53 S;  4UV8 A;  3HZJ A;  1KCD A;  2JN9 A;  2DLL A;  2FRH A;  4XSX F;  1ETQ A;  1GHC A;  4IL6 C;  4ZCI A;  1JE8 A;  1I8D A;  1GV5 A;  1UD3 A;  1AMO A;  1OR7 A;  1T0F C;  4KIF A;  3IUO A;  3KP3 A;  5IYW A;  3ASO H;  3W2H A;  2A68 F;  1NK3 P;  2STW A;  1JJ8 C;  3PEN A;  2LY2 A;  1IF1 A;  2XAS A;  2NVY J;  1JTX A;  2PYG A;  2ODL A;  3TKY A;  4OOS A;  2B0L A;  4QLC U;  2L7M P;  1Z6R A;  2BM7 A;  3TDU C;  1Z05 A;  2OK8 A;  2XRO A;  2DPD A;  1IRX A;  1X19 A;  1DGR M;  2QGU A;  1Y56 A;  5L3D A;  4LBV A;  2DMN A;  1D0Z A;  4EW9 A;  4BGD A;  1OPC A;  4IPA A;  3BC8 A;  3OYL A;  1ZUN B;  3Q9V A;  3BR5 A;  4KNY A;  3HSE A;  2M34 A;  9ANT A;  5TRD A;  4RB2 C;  1WOO A;  3I54 A;  2VE8 A;  2PN6 A;  1N75 A;  2ESN A;  2O03 A;  1UHS A;  1VHE A;  2PQ8 A;  2V9P A;  4W1U A;  2XPV A;  2E7W A;  2Y31 A;  4IQ4 A;  2P8T A;  3ROU A;  4EAT A;  3LYC A;  2X6O A;  3C2G A;  5TIS C;  3ONU A;  1FX0 A;  2IBD A;  2O7O A;  5AIQ A;  5GAH J;  4G7O F;  3RIR A;  4W97 A;  5K1Y A;  1ZRC A;  1IUF A;  4C3I J;  4MYT A;  4Z4S A;  2ELJ A;  5C3E J;  1IA5 A;  3IL2 A;  2VKV A;  1WWX A;  2F5E A;  1BI3 A;  1K6Y A;  1MBF A;  3QPT A;  2LBF B;  4G6I A;  3G4S B;  2MYS A;  4B3X A;  1V5G A;  2O0V A;  2L9R A;  5LRS A;  3LQ6 A;  1NK2 P;  3PSS A;  1MBJ A;  4XOP A;  3RQI A;  4WCG A;  3CCS B;  3CCM B;  4AIJ A;  2QQ9 A;  5KVR A;  2LC2 A;  2TCT A;  4XOR A;  3WTS C;  3J7A O;  5CYV A;  2DTZ A;  1LJ9 A;  4XLH A;  4BXX J;  1XMX A;  3I55 B;  2L01 A;  3A02 A;  3A1P A;  4GGG A;  3K4C A;  5K7Z A;  1P4X A;  3SY2 A;  2KRH A;  3I4M J;  3BWG A;  4ZYA A;  3GFI A;  3H92 A;  3HG9 A;  2JMW A;  4P1W A;  2RGV A;  2Q6I A;  1YOV B;  1E3P A;  5DCM B;  1ETW A;  1VQO B;  2M9H A;  2DFH A;  4FE4 A; 
#chains in the Genus database with same CATH homology
 4BDZ A;  4E0F A;  4GQN A;  4OAZ A;  2F6C A;  2IGM A;  1VBL A;  1X1A A;  4U4B A;  1BPL A;  2VJJ A;  4YZA A;  4II2 A;  1MMA A;  3CMM A;  4R79 A;  3OYF A;  1JTA A;  3FKJ A;  4D1Q A;  3BLY A;  4E7J A;  1JRG A;  4H4K C;  2GOX B;  1N77 A;  4KKU A;  2E5Z A;  2V1N A;  2WAQ A;  1PXZ A;  2VBM A;  4LIV A;  2O1D A;  3OS0 A;  4NK8 A;  2M4G A;  1W0J A;  3MKZ A;  3K10 A;  4BJ5 C;  2KL4 A;  3IAM 2;  4PK4 A;  4Y4R A;  2Z16 A;  3CZ6 A;  3QYB A;  4XKV A;  2JVG A;  1RU4 A;  2IS4 A;  4N4N B;  3ZQQ A;  4OJO A;  1FMV A;  2O04 A;  3G05 A;  1D0X A;  1OB0 A;  1TZL A;  1E79 A;  1D1C A;  4ZDO A;  1PLU A;  3VSK A;  2O5R A;  1T5E A;  5KHD A;  1NHC A;  2CV1 A;  3IAS 2;  4XD7 A;  3I9V 2;  1KMH A;  2CUJ A;  4TKO B;  3PUB A;  2UVF A;  3KEY A;  3W3C A;  3D5L A;  5IK2 A;  1FMW A;  3GRH A;  5HLT A;  3D5S C;  2XSJ C;  1UD6 A;  4U49 A;  2PJR A;  3BCF A;  3K4B A;  2JA2 A;  3OYG A;  4KT6 A;  5CDF A;  3BH4 A;  3DKY A;  1Z7L A;  2L5Q A;  1X4O A;  4Y3O A;  4CCM A;  2K9L A;  3T56 B;  2X3H A;  1NG6 A;  4QPQ A;  4XLA A;  2M7A A;  2R7R A;  4DJA A;  1RMG A;  3BG6 A;  1BR4 A;  1YX5 A;  3PNY A;  4BE2 A;  3EQN A;  5AMV A;  2CH0 A;  2L9S A;  3OIP A;  3ZCO A;  2MFZ A;  1KON A;  5KNL A;  3OEH A;  3FBI B;  4GRI A;  4U7B A;  4URR A;  2VIX A;  3QYE A;  1Z3Y A;  1AIR A;  3AFH A;  3HL2 A;  3SEZ A;  5LFA A;  3ZGK A;  2INU A;  4ZTJ A;  2R7V A;  3NWT A;  1HG8 A;  1WJ5 A;  3TL4 X;  2V26 A;  2ZXI A;  5HNF A;  4XON A;  3ZRG A;  4DIQ A;  2IS1 A;  2QE7 A;  4OZY A;  4Z03 A;  3S3M A;  2V7Q A;  3JUR A;  4HSR A;  2WA0 A;  1OFL A;  4YZ0 A;  1DGW Y;  3K70 D;  2VJ5 A;  2MAB A;  2X51 A;  3NWS A;  1OLT A;  4OJP A;  3UW0 A;  2ZSI B;  4RMN A;  4PJN A;  1WP6 A;  2INV A;  4YZQ A;  4E4H A;  3DPL C;  3MMY B;  4ANJ A;  1O8I A;  2XDV A;  1WJC A;  4NK6 A;  2X85 A;  1SAU A;  4BAC A;  1QU3 A;  1O8L A;  1OGM X;  3EUK L;  1Y6I A;  2QKM B;  2Z6B D;  2A6T A;  4BUP A;  2QX3 A;  4B47 A;  2UUZ A;  1OR7 C;  4X0G A;  5CPR B;  2E1M C;  4E7S A;  2X1D A;  4E7H A;  3F9K A;  5KCM A;  3VSV A;  1PYV A;  2W6I A;  2Y0S A;  2GK6 A;  2V6E A;  3OYD A;  1KZL A;  2JVH A;  1QHG A;  2WPD A;  3OYJ A;  2NTQ A;  3OS2 A;  2VBE A;  4DNT B;  1SFK A;  2HNH A;  1W36 C;  1BMF A;  3CJR B;  1TT0 A;  2KLO A;  2JSP A;  2HPM A;  2E1B A;  2KDO A;  2BVL A;  1MND A;  3OPO A;  3H9Q A;  1NG7 A;  3FPP A;  1K28 D;  1WJA A;  4MLO A;  2CW7 A;  1W9X A;  3HC7 A;  3WQZ A;  3VST A;  2V7F A;  3NE5 B;  4DGW B;  3UNG C;  1E3Z A;  4Z1M A;  1RWR A;  2W1O A;  5HOO A;  3PJR A;  4CA0 A;  1J09 A;  2OV7 A;  2CV0 A;  2QY1 A;  2HVS A;  3S8P A;  4XKW A;  3M1C A;  2JDI A;  2IS6 A;  3HKZ A;  3H9J A;  1H8E A;  2F5V A;  4D9J A;  1VLY A;  4W8Q A;  3EUA A;  2LRD A;  1P9Q C;  2L7K A;  1E1R A;  2HZD A;  4DK0 A;  4FAS D;  4E7I A;  2CMP A;  1PKV A;  3EPZ A;  4XLE A;  4JOM A;  1BLI A;  1BOB A;  2VLA A;  3ZIA A;  2GK7 A;  1QCX A;  2X6Y A;  2CS3 A;  4PSX A;  1HA8 A;  2ZTN A;  3CF2 A;  2ZZE A;  3DTK A;  3OYH A;  2X1E A;  4CUG A;  4Z05 A;  4XLF A;  2LY1 A;  4BEH A;  3SDB A;  1AA7 A;  3WWG A;  3W2V A;  4G7X A;  3MD2 A;  3JU4 A;  3GQ7 A;  4W8S A;  1UG0 A;  2DJI A;  4XOT A;  4C30 A;  4XM3 A;  1DP3 A;  4AU7 A;  1D0Y A;  2BVM A;  2W00 A;  4XMY A;  3MKW B;  4L8J A;  4C9Y A;  1O88 A;  4DBR A;  3CP8 A;  2IGK A;  2ZSH B;  2F1M A;  2CFO A;  2ZZG A;  1ERD A;  2LOO A;  4MR0 A;  1G59 A;  3GVK A;  3CJQ B;  2PYH A;  4OJ6 A;  4YEL A;  4B44 A;  1T95 A;  3K6G A;  4II3 A;  4XKC A;  4NNJ A;  2LH9 A;  4F92 B;  4TT3 A;  1X1B A;  1UEL B;  4BEH B;  1MW7 A;  4NC8 A;  4FXU A;  3GBG A;  3T51 B;  3VYR B;  3E0J B;  4B3G A;  1KTW A;  3H5N A;  3BCD A;  2V9K A;  4C2L A;  1X1C A;  4RLQ A;  2HPI A;  1X1D A;  3OL3 A;  2KHM A;  2BOL A;  5FL7 A;  4BU2 A;  3OYK A;  3GQA A;  1QHH D;  3FBN B;  2XZO A;  4BL0 B;  3VYU B;  4F91 B;  1O8G A;  2L9N A;  3VMW A;  2JJ2 A;  1OGO X;  5FRO A;  4J00 A;  1UD8 A;  2NSP A;  2R7Q A;  3C2H A;  1PE9 A;  1YE9 A;  4UZU A;  2O17 A;  2XOK A;  5CQE A;  3L2W A;  4W8T A;  1WJD A;  3OOC A;  2RQQ A;  3V42 A;  3W2A A;  1V0F A;  1O8E A;  2WAF A;  3H9G A;  1GQ8 A;  4ZDP A;  2V31 A;  1BN8 A;  1QJV A;  4U87 A;  1PJR A;  4KJZ A;  1OHH A;  5C1E A;  2PEC A;  1VJS A;  2Z8G A;  4TSF A;  2NST A;  2O0W A;  4Y33 A;  1LKX A;  3LFU A;  3A35 A;  4YEJ A;  3OMY A;  2E5N A;  3G2B A;  3RCO A;  5HKK A;  4KIT B;  1MAB A;  1IDJ A;  5HVQ C;  4HG2 A;  3OR1 C;  2M7B A;  2R7T A;  4ZTF A;  2VQL A;  4BJT A;  3SZG A;  4HIZ A;  2VQG A;  2CK3 A;  3FKS A;  2MD0 A;  5FRN A;  1D1B A;  3SYT A;  4YXW A;  3EQO A;  2WAD A;  3HOT A;  3OYN A;  2X6W A;  3L2R A;  2DCE A;  1LDK B;  1MMG A;  2NOJ B;  4LIU A;  3BCB A;  1EFR A;  3DU5 A;  3DPT A;  1E0E A;  2QKL B;  4BS9 A;  2M5S A;  2R9V A;  3A3G A;  4E6K G;  2UVE A;  3K4J A;  4HNT A;  2L2O A;  3HAG A;  1XG2 A;  1GLN A;  3PFY A;  4IZZ A;  2HDW A;  1IB4 A;  3OYM A;  1WJF A;  4CCO A;  2W7N A;  4AYB A;  4C2T A;  1UD2 A;  2DT7 B;  2AQE A;  3OY9 A;  1WTH D;  1U0J A;  3K4N A;  3K4M A;  4XN3 A;  2BW3 B;  4E7L A;  1WMR A;  2XF7 A;  4G7W A;  4XR6 A;  2R4G A;  4QPO A;  3ZPN A;  3OWT A;  3DDY A;  3W2W A;  3KYL A;  1LVK A;  4PJJ A;  3QOE A;  2E1M B;  1V0E A;  2KP6 A;  4OJ5 A;  2FUG 2;  3HOS A;  4HPQ A;  4IKF A;  1E1Q A;  1SKY B;  4PFP A;  2HVR A;  2LZJ A;  2VKH A;  1COW A;  4BJ6 C;  2XAU A;  2Z1D A;  3DQV C;  4F93 B;  1DBO A;  3PNT A;  4DNR B;  2WAE A;  2JIZ A;  4XNF A;  4HNU A;  2KPM A;  5LD2 C;  2W6J A;  4XQF A;  4G6T B;  4XL9 A;  1O8J A;  3KEW A;  4PJL A;  2M0M A;  3VMV A;  3AL0 C;  4ZC3 A;  2UV1 A;  2PMZ A;  1WFX A;  2VKD A;  2VAS A;  4F3Q A;  2HQA A;  1R6R A;  4YZX A;  4P5O A;  4BE1 A;  4BQN A;  1H8H A;  3BCA A;  2WJY A;  3B4N A;  4C2U A;  3FY3 A;  3LSH A;  1X0C A;  3PSF A;  4NQW B;  4PUS A;  3S32 A;  5FRM A;  3LSG A;  3J7A Y;  1NRK A;  2D3N A;  1KCC A;  4LG3 A;  2WY7 Q;  4IQJ A;  4OWR B;  1BR2 A;  4HST A;  3MKY B;  4JMQ A;  1I18 A;  3GQ8 A;  4B3F X;  3GVJ A;  2XZL A;  5HNH A;  5JHF A;  2LYC A;  1EE6 A;  3LSM A;  3PNV A;  3VWB A;  2X6X A;  3HPH A;  2F43 A;  2XF5 A;  4PSW A;  3TBI A;  3OYB A;  3LNN A;  2ZZF A;  2R7W A;  3M8J A;  1O8F A;  2XND A;  4ASU A;  4NUB A;  4NC7 A;  3OS1 A;  1O8D A;  1MNE A;  3L2U A;  1UD4 A;  2GJK A;  3D5R C;  3OEE A;  2NT9 A;  2D3L A;  2EWE A;  4HWV A;  1BR1 A;  3K4L A;  1NBM A;  3T9G A;  3OR2 C;  2IGN A;  3U21 A;  2ZTG A;  3DKX A;  2V4J C;  3GQB A;  3BC9 A;  1HZE A;  1ZEL A;  1OFM A;  2GJR A;  2NTP A;  1O8K A;  3CES A;  2R7S A;  3K70 C;  4RM3 A;  3B90 A;  3RPU D;  2IS2 A;  1G8X A;  2W82 A;  4AVZ A;  3VR6 A;  4I84 A;  3LMW A;  4E7Z A;  4OZZ A;  2RNG A;  1E3X A;  1DQU A;  3DWL E;  3LL7 A;  2K9M A;  1O8H A;  1V5E A;  1DBG A;  2K5C A;  2KQR A;  2AQF A;  2E60 A;  1YX3 A;  4DBQ A;  3SUC A;  3SEQ A;  3E1S A;  1W36 D;  2X1C A;  3RQ4 A;  3OOU A;  2CV2 A;  3KRG A;  2WY8 Q;  2IGO A;  4B48 A;  3OYE A;  2UWM A;  2R7X A;  4B43 A;  3DPU A;  3HPG A;  4FET A;  3BG7 A;  4P22 A;  3HUG B;  3IP4 B;  4RLF A;  3DLA A;  3DU6 A;  3OIQ A;  1N78 A;  3OYC A;  2NT6 A;  3OFN A;  3HXL A;  4BQQ A;  4YRV A;  2I8D A;  2BSP A;  1MMD A;  2IXS A;  1VF7 A;  3DTE A;  2Z2S B;  3QOD A;  3H5A A;  3VSL A;  2LRE A;  3CP2 A;  2KMU A;  3ZR8 X;  2Q2E B;  2OC6 A;  3A2K A;  3KX2 A;  5TGT A;  4HRI A;  1O8M A;  1OOC A;  3GQ9 A;  3DTI A;  1W0K A;  2WB1 A;  2IQ7 A;  2VL8 A;  4CCL A;  2VQC A;  2JUG A;  4MXN A;  1WPC A;  4PJM A;  4BXF A;  4XLC A;  2KZV A;  3ZXS A;  4HEA 2;  5CQG A;  3OYA A;  4Z06 A;  3VDX A;  3QYF A;  3ONQ A;  4KKT A;  2CW8 A;  2Q1Z B;  1JI8 A;  2M4K A;  1WJB A;  4ITV A;  4XKB A;  3I3L A;  3OE7 A;  3S93 A;  1E43 A;  3T53 B;  2XC7 A;  2RRE A;  4OJL A;  2BW3 A;  2K3P A;  2OUM A;  2XZP A;  3VYT B;  1KCD A;  3A4C A;  2X53 S;  4CH7 A;  4KKS A;  1Z3X A;  2PJR B;  3EUH C;  1UAA A;  1I8D A;  3ZSC A;  3OL4 A;  1UD3 A;  3ZPP A;  1T0F C;  3IUO A;  2M3A A;  2NTB A;  3S3N A;  1V5F A;  3OYI A;  4ZDL A;  2VPL A;  3PL8 A;  2HLD A;  2LY2 A;  2MC4 A;  1IDK A;  2R7U A;  3A3B A;  2VJ4 A;  2VXZ A;  4CCJ A;  4DOZ A;  2VJI A;  2PYG A;  2ODL A;  1S9H A;  1WJE A;  2VXD A;  3LSK A;  3UR3 C;  4F52 A;  2KVO A;  2P0W A;  2DT6 A;  4XN0 A;  1IRX A;  2F4I A;  1X19 A;  1DGR M;  2LG4 A;  3H0D A;  1Y56 A;  2A5W A;  3FDY A;  2NZM A;  4EW9 A;  1D0Z A;  2GOM A;  4ZJZ A;  4BGD A;  4E7K A;  3BC8 A;  3OYL A;  2VB6 A;  1MMN A;  3TMO A;  4JQF A;  2QXZ A;  3DEE A;  2XF6 A;  3GVL A;  4KIS A;  4IX7 A;  5DN6 A;  4PFO A;  2XGJ A;  4PMH A;  4CSW A;  1LFP A;  2LBF A;  4OAY A;  2ZXH A;  3OAA A;  2WSS A;  1H80 A;  1N75 A;  3S3O A;  1HVX A;  3RTR A;  2X8K A;  2JJ1 A;  1K5C A;  3OW7 A;  2HVQ A;  2DXI A;  4CCK A;  4IQ4 A;  4EAT A;  2DOA A;  3C2G A;  2ZZQ A;  2ZFU A;  1FX0 A;  3RSN A;  1X4P A;  1Z21 A;  2R7O A;  2WBM A;  4RM2 A;  4DK1 A;  3PSI A;  3L2Q A;  4LIT A;  4BE0 A;  3AL0 B;  2ELJ A;  5CKT A;  3H94 A;  2DIE A;  1IA5 A;  1K6Y A;  4G6I A;  2CUZ A;  3N05 A;  2LBF B;  2O0V A;  2MYS A;  4B3X A;  1V5G A;  1BHE A;  3VSU A;  4XOP A;  4BQO A;  3FHN A;  1CZF A;  3A1Y A;  2LC2 A;  5C1C A;  4XOR A;  2WJV A;  3VYS B;  4J01 A;  3LSI A;  4XLH A;  2W4S A;  2V4D A;  1VZ0 A;  3K4C A;  1EA3 A;  2VBK A;  3B8Y A;  1D1A A;  4CZC A;  2KRH A;  4BDY A;  4W8R A;  3K4K A;  4ZYA A;  3HG9 A;  4F55 A;  3H35 A;  2HU9 A;  2VQH A;  4P1W A;  2WZP P;  2GJP A;  4N4O B;  4CCN A;  1UD5 A;  3LMM A;  3H5R A;  3AKZ A;  2KRC A;  3L2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...