4XKWA

Tailspike protein mutant d339n of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 233
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkwA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkwA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkwA02
1DBOA 4OJ5A 4YZAA 2INVA 4W8TA 4MXNA 4XKWA 4C2LA 2NT9A 4U4BA 3GQAA 1QJVA 4XL9A 3WWGA 4XMYA 1WMRA 3VSUA 2O04A 3LMWA 2PYHA 4XLFA 3UW0A 1O8EA 4Z03A 4XLHA 2PECA 2X3HA 2NTQA 1O8GA 2NT6A 4XM3A 2QXZA 4YEJA 4NK6A 4YZXA 2O1DA 4XN3A 4YELA 4OZYA 5C1CA 4OJLA 1O8HA 1RU4A 1PLUA 4XOPA 1O8MA 1OOCA 2O17A 2VBKA 4Z06A 1AIRA 1JRGA 2NSPA 2O0WA 1GQ8A 2QX3A 4EW9A 1KCDA 2NZMA 1O8KA 1XG2A 2X85A 1OFLA 2IQ7A 2ODLA 4OJOA 1BHEA 4HWVA 4XORA 4W8SA 1QCXA 4XKVA 2UVEA 3VSVA 2VJIA 4XR6A 2NTPA 1JTAA 2NTBA 2Z8GA 4MR0A 3GQ8A 5C1EA 3VSTA 4XOTA 4YZQA 2X6WA 4XLCA 2BSPA 4XLEA 3KRGA 1OGMX 1PXZA 1O88A 3EQOA 3ZPPA 4OZZA 3EQNA 1IDJA 3JURA 2EWEA 4NK8A 4OJ6A 2X6XA 1O8LA 1OGOX 2VJJA 3GQ9A 1IA5A 4Z05A 1EE6A 2INUA 2VBMA 5AMVA 4XNFA 1IDKA 4I84A 1H80A 4W8RA 1VBLA 1RWRA 1O8FA 1CZFA 4YZ0A 3VMVA 3SUCA 3T9GA 1OFMA 1X0CA 2VBEA 3B90A 1HG8A 1KCCA 3B4NA 1NHCA 1PE9A 1K5CA 4AVZA 2QY1A 4XLAA 4OJPA 1O8JA 2O0VA 1KTWA 1O8IA 1IB4A 3FY3A 4U49A 3ZSCA 3VMWA 3GQ7A 4XONA 1BN8A 3GRHA 4XN0A 4URRA 4W8QA 3B8YA 1DBGA 2X6YA 2PYGA 1O8DA 2NSTA 1RMGA 4PMHA 4XQFA 2UVFA
chains in the Genus database with same CATH superfamily
5F6FA 4R8HA 3MZ8A 2JA2A 1U8RA 2JIZA 4ZCLA 1HLVA 4FETA 4F3QA 3BZCA 2FBKA 4V2FA 3I4MJ 4YZAA 2OTJI 4FWTA 1XS9A 4OPWA 5DTDA 1ZRDA 2K5CA 3E6BA 2M4KA 3BR1A 4XMYA 4QVAA 3E1SA 2RN7A 4XLPF 4C2UA 4AC0A 4KICA 4BUPA 2DA4A 3SJMA 3H3VK 1FDRA 1MD0A 4YG2F 4A93J 1E63A 4EJTA 1VHOA 1TYXA 2X3HA 2CK3A 3RQIA 3T1BA 4TT3A 5JHUA 4HX4A 3A8IA 3M8EA 5FKLA 2VPRA 1BC8C 2O3FA 3LSIA 4EM0B 2XAJA 3A02A 2ACJA 2X53S 1G3YA 4LGWA 4PDKA 5JLWA 1VQ7I 2ELJA 4CICA 4UUTA 3KIOA 3AVUA 2JQ7A 3BG3A 2JK3A 3I58A 5E8IA 2QSFX 5GP9A 3LSRA 2P3MA 2GIVA 1CQXA 4I98B 2O17A 4Z06A 1Z91A 1KTVA 2YPRA 5FO5A 1W87A 2UWMA 2DOAA 5FFXA 1GO2A 1AIRA 2IAIA 2WZNA 4B3XA 2HOAA 5EMNA 1XGOA 1HF2A 5CLSA 4HSRA 2LZJA 1K8FA 4BHBA 4WWVA 2DA7A 4LBYA 3FKIJ 1KK0A 3CLQA 4OJOA 5DS9A 1KK1A 3LVBA 4QFMA 4HWVA 1L1IA 2EJRA 3FXQA 1W5TA 3LSPA 1UD6A 3PSZA 1F60A 2YWHA 3UKGA 4AM3A 1U5TB 5ILSA 3A01A 1G7TA 5THXA 1D0XA 1FBQA 3DXJF 1MMSA 4RD1A 4QVJA 2BW3A 4LLLA 3LQ6A 3CCSB 3QPTA 1B4AA 3CW2A 5AIPA 2H6CA 4NC7A 1ELOA 4TMWA 3BTJA 3VSKA 2W57A 1CF7B 3BJAA 2ME6A 3BQJA 3FKSA 4OZZA 2A61A 2R7QA 1PDNC 3G1OA 4DNTB 4DZJA 3NE5B 3FPKA 4XKCA 1O8LA 1K6YA 1W0TA 5LGUA 2ZSIB 2VJJA 1PJ6A 3A3GA 3P4GA 4DNCA 1T0FC 4M3FA 3DTIA 3J80K 3OYEA 4J0QA 4ZCMA 3W5HA 4GCVA 1TP4A 2M5SA 1ZG3A 3OKXA 4TN1A 1IDKA 4BL0B 5ICCA 2V7FA 1MKMA 4B3GA 1O8FA 1VI0A 2WPDA 5TJJA 1HKQA 2F4IA 2M1BA 4U87A 1QGZA 1YX5A 3Q39A 2DA3A 2VASA 5IYBJ 1E79A 3T9GA 3X2QH 1REPC 1JHFA 3B90A 2KLOA 3BQZA 4MYUA 4AUXA 4RB3C 2A69F 1YYVA 2CQNA 3KZZA 4D7MA 2Z33A 2F5DA 3WHBA 1SFKA 2KZGA 3B4NA 3E5XA 3V7SA 1QQ1A 2IS1A 2KP6A 2JTVA 4IPAA 5F1JA 4M4SA 3GTJJ 1IN6A 1U2WA 1ZREA 3QAHA 2VZLA 1BW5A 2QKLB 4OPSA 4BEHB 5E6TA 2V79A 5GTHC 2XRLA 1UJ8A 2BHZA 2Z2SB 2VE8A 3BJOA 2JMWA 3JRHA 1B9NA 2LF8A 5A2QK 2XUBA 3P27A 2ZL5A 1QRBA 3CUOA 2EIKH 2ESNA 3DBRB 4CDGA 5IPAA 3N90A 4IHVA 2BOLA 5H6RA 3CZ6A 3L2WA 1USSA 1VF7A 4IKFA 1QZYA 2HDWA 2JZYA 2KIFA 2L3DA 3KPHA 1MBEA 2GXBA 2XZPA 4XKWA 3RPUA 4I6ZA 1F9NA 4I02A 4TMZA 3PUFA 1WGXA 2DPDA 1I18A 3M1CA 2ZFUA 3T53B 2EIJH 4XLFA 3PQKA 1EJ9A 4JP0A 5GPCA 1EP2B 3CMMA 1D1CA 1YW7A 2WV0A 1ENHA 4KIGA 4RGRA 1GDTA 3QYEA 2ECCA 4S04A 3GUDA 3PFIA 4XSXF 2BM1A 3MQ0A 1SFOJ 3H0DA 4IRIA 2F5VA 1LE8B 2XNCA 1HXDA 4N4NB 1Q82D 1UD5A 1OB0A 2OBRA 2VKEA 3TBIA 5D5XB 2JA7J 4IHXA 2R5ZB 3PO3J 3J81K 4C2TA 4GYGA 3VODA 2M9HA 1JB9A 2RVCA 2VNJA 2XZLA 1W0KA 4CCNA 4BNCA 3D5RC 3QYFA 3ZMSA 3CC7B 4ZZDA 2Z99A 2O6GE 4OIRF 2O7OA 1OR7C 4X07A 2X85A 4KKTA 1I27A 5BNGA 2BHYA 4IRGA 2EZHA 2F48A 4HDUA 3GZ5A 3BY6A 1YFHA 4KFCA 1RC9A 3I71A 2CV0A 4KT5C 2M4GA 2VFMA 1R00A 3RJPA 2VJIA 4X6AJ 2VBYA 2OK8A 3CD6B 4WZLA 1YHQB 3EDPA 5FKKA 2VONA 1LEBA 1G59A 2HKOA 3HXLA 3K1PA 3TDUC 2A5YB 1Y0YA 2JA6J 1W9XA 1WQ2A 4KJZA 2M8EA 1BX1A 2VBSA 5HDNA 4Z4ZA 4PC6A 3AVWA 5ICEA 2K85A 5HS7A 2CBXA 5EEAA 2XAUA 3FXKA 1W35A 4OJ6A 1E43A 4WWCA 1VQOI 3K1NA 1YW9A 2DO7A 3HKZN 1ZUNB 2VUMJ 4A3IJ 3FIWA 1RR8C 4Z4RA 1S7AA 2VBMA 3OYAA 3OYDA 2WYRA 2V7UA 4IXAA 4OWRB 2G0EA 3QOEA 4OOSA 5ERIA 2K4BA 1ZLKA 2YWFA 1X2NA 5K5RA 1KU9A 3FM5A 4RB0A 4YZ0A 3OZVA 1ZK8A 3M07A 2R5YB 1YX3A 3KP3A 5E79C 1J5YA 1V54H 2Z1DA 2CW5A 1O3QA 3QP6A 1T38A 5KHDA 2EFGA 2IGMA 1YITI 1JA1A 1K5CA 4HF0A 3FMQA 3F72A 1E1QA 1I7PA 1AMOA 4A3KJ 5JBQA 3H9QA 1VQ5B 4X7EA 2CW8A 2DY1A 4F7DA 2V1UA 2EWNA 3AFHA 3I3LA 3J80Z 4YIIA 4A3CJ 5LBQA 2KPMA 2F43A 3S93A 3QQAA 2OTLB 2X4HA 1TQIA 3H3ZA 4RD0A 3H9JA 4BACA 1IV6A 2R0QC 1FMWA 2ZSHB 3MVPA 2DAOA 4XQFA 1P9QC 4N0BA 3V4GA 5HZBA 4RGUA 2NAZA 4F52A 2PJPA 4F93B 4P25A 2H8WA 2XDVA 3CF2A 1HDPA 1H9TA 5BQTA 1WVRA 4TMVA 4OINF 3FISA 4P1WA 4XICA 3A01B 4ZCIA 3LL7A 3M9AA 3VSUA 1QVFB 3KYLA 2BPOA 1P2FA 3J7YJ 2XAHA 2O04A 1BIBA 1DGWY 2YUSA 4UXNA 2L01A 3F21A 3HIFA 5DCMA 1TNSA 1OYIA 2BSAA 3W6VA 3VFZA 3HPHA 4DQKA 3ZIAA 3AVYA 2DA6A 2ZC2A 5K1YA 3VMFA 2V26A 3ZQGA 2V6CA 4H4KC 4YEJA 3AVXA 2HR3A 3A0BC 3KFWX 2BY2A 4D5CA 4FCYA 2BV6A 2Z9OA 2GJRA 4OPVA 1TW3A 2VXZA 3AG4H 5FNZA 1U2RA 3ZMZA 1K7AA 2NRAC 4A3LJ 4P26A 1RU4A 4RM3A 1PLUA 2B7EA 3CP8A 2VFNA 4V02C 3J7ZI 1I5ZA 4PJLA 2XSJC 3OYGA 5E1ZB 2QSGX 1PJ5A 4RD4A 2WBMA 4HF2A 1JRGA 1R6RA 3BOQA 1Z05A 3SZEA 1N77A 3HSFA 1HSTA 3BR6A 5FLMJ 2QE7A 1S72B 1WI3A 1WJDA 2XPWA 1TYVA 5DM6F 4PGGA 1N0VC 4DW6A 2E1OA 4MNUA 3QFRA 3BP8A 4XOTA 3RQ4A 1YJ9B 1LFUP 2QA4B 1Z1DA 2ESHA 5GADJ 3I1FA 3HOUJ 4M3DA 3L2RA 1S29A 5E3LA 2EV6A 2R7RA 1K6OA 1MBFA 3CMAI 2MYSA 4BDZA 5B6IA 2KHMA 4RAFA 3M8JA 3CCUI 4JX4A 2F2EA 3U9GA 2X1DA 2KJCA 3F22A 3KL9A 3ONYA 3HOVJ 4YAUA 5HZAA 5FROA 1FOWA 4A2UA 3PM1A 4KYWA 3GXOA 1UB9A 1MMDA 3A0HC 3KETA 1BL0A 1VQ6B 4FTHA 4Q48A 1LDJA 2MH2A 1O3TA 2VBUA 2XAFA 3DPTA 3ZQCA 3GTMJ 2JN9A 1E3PA 9ANTA 4G7XA 2RQPA 4YALA 3U2QA 2DTRA 3FBNB 3KYCB 5EEGA 1VQPB 3PFYA 2ZB9A 3PL8A 1H42A 2OYNA 1Z77A 1OKRA 3T8TA 4Q5SF 1J2XA 1OMIA 1QG0A 3VMVA 1W1WE 3RCOA 1CLWA 2Y2ZA 1YQAA 4D7NA 3DEWA 4LBZA 2JRTA 2C2WA 3OMYA 4ZH4F 1FOKA 4GDFA 1VQ9B 4U0WA 1KMHA 1OFDA 3IWFA 3BG7A 3WYAA 1J7KA 1HZEA 1JUPA 4X7CA 3VYSB 1KTWA 2O0VA 1RETA 1X1CA 1UAAA 2X9DA 3DQVC 2QBYA 4LB6B 4M1KA 3SY2A 2EB7A 4RDJA 4CUGA 4XONA 2VBXA 1HCRA 4CZZA 3RYRA 4PJNA 1SFXA 1MJ9A 2K7LA 4OU0A 3PUMA 3W3CA 3EPZA 2XF7A 3Q0UA 4LB5A 2QYOA 3J7AY 3AL0B 2R6HA 1A04A 1Q81D 4M6XA 3SZPA 1YIJI 2M34A 2CQQA 3S2WA 4MXNA 4ENMA 4AIKA 4Q4ZF 1IRZA 3VDXA 3O3KA 3CCLI 2V7WA 1QJVA 3IC7A 2CO5A 2MG4A 2ECBA 1UHSA 2V7TA 4BY7J 1QZZA 3HZJA 4G6DA 2CUEA 3KYDB 2R4GA 5F08A 4XLHA 5K5QA 4U0YA 4N3NA 2A6EF 3VO1A 2EINH 3D1NI 2OF7A 4O6JA 2E1RA 3DU5A 4RLFA 4XM3A 5LHIA 3LSGA 3V7CA 3RPUD 3CCMI 3REOA 1ZM3A 4RAYA 2EIXA 5EF6A 4YELA 3U2RA 2IGOA 2YU3A 3OSFA 4OJLA 5F0CA 3AAFA 5A88A 1LKXA 3ZZTA 2J8KA 3KP4A 1IRGA 4GXOA 1NG7A 1FIAA 4ENKA 2YSRA 2CUJA 3TL4X 3QU6A 1SD7A 1AKHA 3DF8A 2DFEA 2LBFB 1HF0A 1EFTA 2O0WA 1T6SA 2VNHA 1T8IA 1U5TC 2XIGA 1LLWA 1ETXA 1X1PA 2M7AA 1T39A 2W25A 5GAGJ 4RDLA 5KCMA 1GV2A 4XD7A 4B4DA 2ODLA 1QRYA 2PMZN 3ASOH 3OPOA 2E1MB 5JI6A 3JW4A 5K7ZA 4XKVA 2YX7A 2CV2A 3TQNA 3CCJI 1S72I 1I6HJ 3GCMA 4ON0A 2JVGA 5C1EA 2LRDA 5C4XJ 1LFPA 3V8KA 4UUVA 1IXCA 1KGSA 3HC7A 2HDNB 3IAM2 3F23A 3TKYA 3WHCA 1EA0A 1IDJA 1DARA 4G7WA 3WY9A 2HZDA 2ZZEA 1B59A 5DCFA 3HSRA 1OGIA 1S5LC 2OQRA 3SDBA 2K27A 4BS9A 3IUOA 1B8IA 1X2MA 2XROA 1EE6A 4E7HA 3ASQA 1OCZH 2QEXI 5AMVA 2R7OA 1SVMA 3QP5A 4I99C 2RQQA 4IW3B 2QYUA 2BY0A 3HOXJ 5C3EJ 3NAUA 5FRNA 4EM1A 2HMAA 1RWRA 1DGRM 4RGXA 4A5MA 1ETKA 1P4XA 1OGJA 1WDTA 4X8IA 1V5VA 5BSXA 3OYLA 1FMVA 1FNMA 4F7ZA 3ISPA 2V9VA 1VNDA 2OPTA 4CCLA 1DG1G 3CCQI 4WF2A 3W2WA 3GWZA 2XSDC 3KCCA 3GVKA 4D0PA 2V9PA 3BH4A 2F1LA 3PNVA 4QHYA 3JRFA 4RB2C 3MCAA 3G3ZA 4BEHA 3EUHC 4DBRA 1BN8A 1P92A 1IN8A 4S0HB 4ENJA 2VXDA 4W8QA 2EQRA 1QZEA 4EGYA 3V76A 1KU7A 4KITB 3CCRB 3BC9A 1TWAJ 4B48A 1N78A 1Z7LA 3ECOA 1FC3A 3I9V2 5LGNA 3GIRA 5B3SH 2XHKA 1R36A 1I3QJ 1RKWA 1DP7P 4FXUA 4P22A 2DYIA 1K9MD 1IRXA 1VQ8I 1LLZA 3TO7A 4Y52J 4C2LA 1ERDA 2NT9A 3ONUA 4P55A 3Q0WA 5IYPA 5L3FA 3T0YA 2VFOA 3GMEA 3RKWA 3LSHA 3H5RA 3Q6QA 4N3GA 2JVHA 2QWWA 2MD5A 2XTXA 2O61A 1G3WA 1KC8D 1ZRCA 5HLHA 2XPVA 1S7OA 1X1DA 1MMNA 4OOIA 2VE9A 4J19A 3N6ZA 3HEFA 5F0HA 3T56B 5E18F 3WG9A 2LY1A 2W48A 2YUHA 3WTYC 4G7OF 1FEXA 3P26A 3TDZC 3OIQA 3HOTA 1A5JA 1MZBA 2VL8A 4U7BA 4P9FA 3FDYA 2R5ZA 4V19K 1ZH5A 1KK2A 4HE6A 2GZWA 5CVRA 4D9JA 1ORKA 1SFUA 2E34A 2JT1A 3VNVA 2HS5A 1NK2P 1IJFA 4BHCA 2ZJPF 5BSYA 1Q1HA 1NG6A 1XSVA 3TGNA 2KL4A 1IXRC 4KKSA 4Y3OA 3SHFA 1K83J 3ZOBA 2FJ1A 4HSTA 1EFRA 4MEYF 3O6BB 2ZNZA 1I1GA 5ILVA 1BM9A 1VQPI 3S17J 4OMZA 5H5JA 2XVCA 4OOVA 4M6VA 3TO9A 1I3AA 2E1BA 2WSSA 5K7HA 2VBWA 3HHHA 4FK8A 4HA8A 2IP2A 3ZQHA 3FPPA 2B9SA 1VQ8B 3F3XA 1ZKGA 5BPDA 3CLOA 5EGOA 2W1OA 2WR8A 5EZHA 5KSWB 3ZPPA 4QV2A 1DPRA 3JSPA 3EQNA 4NUBA 1TT5B 1JHHA 3C2BA 1RR7A 1V5GA 1SVOA 4OP7A 2DFFA 1OB2A 4UB8C 3WXMA 2LSOA 3A03A 1B8IB 3I56B 2BM4A 4YCQA 1WP6A 3TW6A 2VJ5A 2XNJA 4G6IA 2IOUG 4M74A 1NRKA 4I0BA 4MLOA 1Q86D 4D1QA 1FZPB 5ICFA 4DNRB 4NQWB 1ZN2A 2RAEA 2X48A 5FKOA 1WU8A 4TMXA 2H1KA 3SFIA 1IUYA 1UMKA 5JFRA 4XIDA 1WPKA 2KZVA 3WBJA 1TNTA 3I53A 4RDKA 3ES9A 5L3BA 3BTCA 1OJLA 3GX4X 1KU2A 3PSSA 1P6RA 4PC3A 2R7DA 3GFJA 4B44A 4OJPA 4IZZA 1O8JA 5C44J 4UVAA 1U8BA 4HRIA 4F92B 2R92J 2VQCA 3B02A 2M0CA 3CUQC 4NB5A 2RNGA 2Z3YA 4Z1MA 2LVSA 4RBOA 3OS1A 3OW7A 2PE3A 3FK7A 5CYVA 1JKPC 4RPDA 4A3GJ 3E6DA 2ZZQA 5LLQA 3LSMA 1LDDA 2P7CB 2V1DA 4J01A 1RUNA 3H36A 1E0EA 1NJID 3KLNA 4CZCA 1D1NA 5L3GA 1BW6A 1CQTA 2ISZA 4J00A 1E1RA 1GV5A 3BNWA 4MTDA 1VQ5I 2D9RA 2VBTA 3BTIA 3PUNA 1SD5A 1X3ZB 4XL9A 2STTA 2DOGA 4BAYA 5E1WA 1Y6IA 2HPIA 3CCYA 3MAJA 4D5FA 3ZQLA 4HF1A 1BJZA 3IRQA 2W82A 1LJ9A 2XGXA 2V4JC 3AG3H 1GAQA 1N05A 1VJSA 5HS9A 1Y56A 5DYMA 1YE9A 3OYMA 1WKMA 1K61A 2BVNA 4XRSG 3HL2A 4BY1J 2NOJB 4EATA 3LSJA 3GLXA 3NWTA 3J7AO 2F4MB 3FXMA 1U9OA 3R60A 5F4OA 3QWLA 1VQMB 1KA8A 2PJRA 3E3VA 2VT3A 3DWLE 2M30A 1TLLA 4E70A 5IYQA 1B72A 1XC5A 2X0KA 1FNDA 2L5QA 1O4XA 3PA2A 2W7ZA 4L9TA 2HI3A 2IGNA 1EH7A 2W4SA 5K5OA 2NSPA 2QENA 2KRHA 4B4CA 1BIAA 3AGQA 3MEXA 2MW8A 4LJZF 2CWEA 3ZBUA 2FX3A 3L2UA 1IDYA 2B0RA 3KZYA 1I50J 1W36D 3W2EA 2JJ2A 4MR0A 4MQ9F 1IZ1A 3HTSB 4IVNA 4XLCA 2BSPA 5K7FA 2NVYJ 3W6KB 5D6EA 3RSNA 3OJWA 1BQEA 1EWYA 4X7FA 1T95A 1WWXA 2P5KA 1XSDA 1UHWA 1KZLA 4FQGA 4HW0A 1QFZA 5FLVA 3SQVA 5HODA 2KIMA 1VHEA 4DK1A 3OYJA 3LJYA 2STWA 4A6DA 2INUA 2LG4A 3IH3A 1XMXA 4ZDLA 4BPRA 1T5EA 1DDNA 5BPIA 4CYDA 4CXFA 3GZ6A 4TSFA 1R5GA 1YJNB 4OAYA 1VQLI 3L09A 1VBLA 2Z5UA 1VQKB 3OZWA 3CF5F 1TQMA 5DM7F 3WTWC 3I55I 3BCDA 4ENNA 1ACIA 3CCQB 4GO1A 2RV8A 1Y39A 1HSJA 4CA0A 1FSEA 1LE8A 2V6EA 1R4NB 3DBHB 2VC0A 1IHMA 2C4TA 4RAGA 4ZTFA 1DUXC 4GGGA 1KCCA 1JA0A 4M9XA 1NHCA 1HDDC 3CO6C 3BCAA 1IGNA 1SD4A 3GFLA 3GEZA 4DIQA 3KLOA 1BR2A 3CB4A 3BDDA 3BPXA 3WE2A 1YS6A 5L3EA 2CGPA 4C3HJ 3CCRI 1GLNA 2CJJA 2MBFA 1SD6A 1YJ9I 4KMUX 5F64A 3SKBA 4OM9A 3AG2H 4A3DJ 3SDGA 2OK7A 2W84A 1QA6A 3HOYJ 2NV4A 5LD2C 4RM2A 3B6AA 1NK3P 4Z4WA 2LKXA 1FOXA 1NBMA 5DD8A 4MIMA 4XRFA 1QFJA 1E3OC 2OV7A 4LC0A 2HDCA 4W97A 3AGPA 3WGHA 3TP3A 4B3AA 1GUUA 4NC6A 1Z3XA 2LC2A 3SLDA 2XB5A 1JTXA 2BGIA 3HGYA 2DK8A 1JGSA 3PO2J 1RNLA 2CYYA 1S9HA 2PX9A 4A69C 5EGOB 2F5FA 1UZCA 4G1BA 2VFQA 3OL3A 2NVUB 2CSOA 4BQQA 2R5YA 4RCZA 1ZR2A 3HOZJ 4MFDA 2WY7Q 1MNMC 3U6BA 2LTPA 4L8JA 4L5IA 4HLXA 3U6KA 1XGSA 1WHUA 3SZTA 5F1RA 3V8LA 1NDHA 4HNTA 5TV2A 2DDBA 1ZQ3P 3F8MA 1H88C 3WNCA 1N06A 2O8KA 4RPBA 3WNDA 2DJIA 4XOPA 4B3FX 3K2ZA 5IP7J 3L1PA 1R4MB 2JUGA 3UR3C 1IUFA 2LBFA 3IP4B 1D0ZA 5CQEA 1ZHFA 1N07A 2D1HA 1C0WA 3W2IA 2BMWA 3AL0C 3OL4A 1KCDA 1SMYF 2H8RA 3V42A 4L0ZB 3L2VA 1TTYA 2Q0OA 4H0EA 2R7ZJ 5LMZA 2BEOA 3CCLB 1S6LA 2LFBA 1FNNA 3E97A 3OYKA 4BBSJ 4W8SA 5J1YA 1QCXA 4ZYDA 2L7FP 3AKZA 3S16J 3QODA 3G1MA 1T6ZA 2NTBA 3NAWA 3OJXA 3H9GA 2YR2A 5A2QZ 4ROXA 5FRMA 3ABMH 4BE0A 3OYHA 3NQOA 5DUIA 4GQNA 2LKPA 2AXTC 4UHTA 4AF6A 2HEOA 2DT6A 1TTTA 1I6XA 1K4TA 1Z3YA 3N97A 1MSEC 1WSRA 1X1BA 2EWEA 1W7PB 4NK8A 1SAXA 3FMSA 4M9ZA 2V9KA 2X6XA 2WJYA 2R7TA 1D0YA 1KQ9A 2OBSA 3BY1A 2XKOA 3OE7A 3S15J 1KD1D 3IH2A 4FX0A 3OW2B 2UXNA 2FOWA 2DK5A 4Z4TA 3ML6A 3VSLA 4XNFA 1W5SA 4WZKA 5IYDJ 1WJCA 2QUFA 3IRRA 2EV0A 4HYEA 3QYBA 1FYMA 2BM5A 2D74A 2LMDA 5M5WJ 3A4CA 3S32A 2F5EA 1KK3A 3E20A 4IF4A 1FYKA 4NCNA 2DI3A 4ZYEA 1IXSB 2OZ6A 2C77A 2LREA 5AONA 2D3NA 3BH6B 3CCSI 1ZR4A 1BX0A 2FSWA 3KP7A 2P81A 3OWTA 4XLAA 2V31A 3G6EB 1FLIA 2LLKA 3QSYA 2FOKA 3FM3A 4UVCA 3ZMDA 1KONA 3DDYA 5HLIA 2GA1A 5TRDA 1CNEA 3FMRA 2FNPA 3BH7B 3LOCA 2A05A 3RYPA 1FRQA 1QGPA 1BA5A 2I8DA 5E3OA 2HVRA 5HS8A 2COBA 1ODDA 2BM0A 3QPSA 1YX2A 4RA2A 2NSTA 1O3SA 2DLLA 2QEXB 4LD5A 1SAUA 3H5AA 2IVMA 1FTTA 4ZYHA 4JBAA 4DQLA 3RZOJ 5FIUA 3ZR8X 4ZYAA 1LEAA 1OCOH 1S8NA 4PK4A 1G3TA 1V3FA 2NVTJ 3ABLH 4W8TA 3GQAA 1WRJA 4NHJA 1OCRH 1DPUA 5IYRA 4G7HF 3C3WA 3H0GJ 2X3UA 3S3OA 1IRFA 1OCPA 2EA2A 3ASTA 4WX9A 1V55H 4P6VF 1V5FA 3OYIA 5KNLA 1WORA 2IJLA 5GV8A 2NS8A 1Q7YD 2CUZA 3JRBA 3Q5FA 2NTQA 2PMDA 3K6GA 4LLNA 3QPLA 1JE8A 1QA2A 5FL7A 4BHPA 1QNTA 2QZ8A 4HZFA 4XN3A 4DOZA 3G4SI 4OZYA 3IH4A 2JA8J 3OAAA 1GR1A 2DBBA 1KQ5A 5IY5H 3BCFA 2FX0A 4MHGA 3FXJA 1XE1A 1WXRA 1IN5A 4FE7A 4A3MJ 3CRZA 4PGOA 2E1MC 2D2WA 4G5GA 3GVJA 2W85A 2YU9J 3DEEA 1GVDA 2J5PA 1JUSA 2XASA 3OY9A 1F43A 1BI3A 3B78A 2M2EA 2HCJB 1EA3A 2Q8KA 4RAZA 4XORA 3RKQA 2VOPA 5F0FA 2HYFA 2IS6A 3B8HA 4HIZA 3G4SB 1I39A 1R5OA 3R0JA 3GQ8A 3OOPA 3FJOA 2DCEA 2BY1A 3SZGA 4E7SA 2VN2A 5E17F 4Y33A 1HA3A 4P6YA 2GQQA 1KYWA 3MWMA 2BYVE 5D4SA 4BJ6C 1F1ZA 3BJ6A 2E2IJ 5FD5A 1LFBA 3OS0A 1O88A 1PXZA 5DNSA 1POGA 2XZOA 4AYBN 1WZ2A 2P7VB 3HPGA 3VNUA 5GV7A 4R79A 2CV1A 1DU0A 3FKJA 4NBSA 1W7PD 1XB4A 2EZLA 3VO2A 4FN5A 1G8XA 2TRTA 4BU2A 2BXZA 4E7IA 1ZLJA 1QHHD 1FT9A 3L2CA 4ANJA 3A3BA 3CCVI 2K9NA 2WAQN 2HOTA 4Z4SA 5KAIC 3E1YE 3CDIA 2OU2A 1ZYRF 4XSZF 3VYRB 3IKVA 2E1CA 2ZJQF 2XB0X 2BF4A 2QTLA 1WH7A 3MMPA 1TQPA 4MGRA 1HC8A 4CCMA 3CPXA 1ZM2A 2R93J 3SEZA 3OYBA 3PVDA 5DCMB 1H8EA 2YS9A 2FD5A 1H8HA 4HQMA 3SEJA 2JRMA 1B1BA 1MBJA 4L5EA 3ZC3A 4KIFA 1ITYA 1ZGAA 3JRDA 4P2NA 5D5WB 2XGDA 1G6NA 3VYUB 3W2GA 5J3LA 2V1NA 1QO0D 1N08A 4WZTA 4NNJA 4Y15A 2DFHA 4IOAF 4B43A 1FSHA 5KW9A 4EM2A 1RQPA 2BM6A 1R5NA 2J7KA 4E0FA 4U49A 1IB4A 3LSTA 1JTYA 4E6KG 3B6CA 1Y0RA 4XRSA 2KQRA 3BT9A 2B0LA 3OOUA 1S7EA 3PNTA 2Y0MA 1LUJB 2IGKA 3M8FA 4FISA 2HKXA 5B66C 3HKZA 2BZTA 2DOFA 3QRFF 3B8YA 1T6YA 3BWGA 1MJBA 1O8DA 2XGEA 1UHMA 1HW5A 2WAQA 3JRGA 2LH9A 4Z2YA 1HQCA 3A2KA 4C3IJ 5TGTA 3RIQA 3F6OA 3HJEA 2OBTA 1JKQC 4RJLA 3S1RJ 4OIQF 2P5VA 3LA2A 4RD3A 1B23P 1F5TA 2WADA 1YLFA 3EYYA 2DMNA 2WB1N 1A36A 3CCVB 2F5CA 4WXHA 3Q38A 1Y1VJ 2DMUA 5TY0A 5IT9K 3CCJB 4F55A 3ZPLA 2IBDA 3HYIA 5CVJA 3SXYA 1J75A 1D5VA 2QSHX 1PVEA 4IL6C 4IHTA 1FIPA 3HOSA 4C0SA 5LEKA 1MDMB 4UUSA 1W4MA 2PG4A 4FT8A 5M5XJ 1DDGA 1BJKA 1EP3B 4YZXA 2HTJA 3K4CA 1BOBA 2DN0A 2VODA 2DMPA 1X3WB 1G2HA 1JT0A 1GVHA 4QLCU 2HXOA 2E7XA 4IO9F 1V0FA 2H09A 4ZGNB 1MBGA 3V7RA 1IJWC 2E1NA 5CDFA 1ZM4A 1NTCA 2H27A 1MJAA 3K4BA 1OCCH 2DODA 4CQJA 4EVIA 2PN6A 4PSWA 2QX3A 4EW9A 1U6GA 4X0GA 3RKXA 1A6QA 4X1EA 2KIUA 1PKVA 2QN6A 4NDLA 2Q6KA 2ADUA 4IJAA 3WTVC 4A12A 4ZJZA 3OYFA 1OFLA 2RNJA 5H2FC 1YIOA 2HVSA 2VPLA 2CRVA 4HLYA 1PYVA 3VSVA 3KEQA 1O7FA 2Z8GA 2K3PA 4LK0F 4BH9A 2QF7A 2O8XA 3RIRA 2EFOA 1GT0C 3D0SA 2IA0A 2BV3A 3DPLC 4QPOA 1GHCA 3WBKA 5J6XA 3G73A 4XLNF 3ZN1A 2XKPA 2GQFA 2OA4A 2EBIA 1FNBA 2VQHA 1TYWA 2WZPP 5M5YJ 3FWEA 1FX0A 1ZELA 4CYCA 3BR5A 4AWXB 2L4MA 5FJ8J 3CMEB 4G1VA 2WA0A 2HDDA 5TISC 3BR2A 3F9KA 4Q7JB 2AS5F 3EYIA 1RI7A 4TMTA 1F20A 1CNFA 4BYYA 2XTWA 5D5VB 5CVUA 3QFSA 2VIXA 4L5JA 4EGZA 4RGSA 5F27A 3OZUA 5HLGA 1K4ZA 2R3SA 2O6WA 1U9NA 2KKOA 4HPQA 4X7DA 4M71A 3JCUC 2MFZA 4BXUA 1MH4A 3L7WA 5D4RA 5DN6A 4ITVA 4RD2A 4PCQA 3MD2A 2DQRA 4DGWB 5HNFA 3ZSCA 3I54A 2X6OA 2VBZA 5LRSA 4HQEA 3PUBA 1Z6TA 2L54A 3IV5A 1DBGA 4YC5A 1FJLA 1OFCX 3F8CA 1IG7A 4IHYA 4OIOF 3A1YA 3W2VA 4U0VA 4LMYA 3K0LA 1K79A 4AC9A 3SYJA 2MLKA 5HNHA 2EA4A 2GK7A 4OJ5A 1Y0UA 5ICGA 2M0MA 2D3LA 3ULQB 2NXNB 4Z4VA 3EUHA 3SYTA 3FXRA 1BMFA 3QFCA 1WH5A 2R7SA 1RKTA 2QDXA 1R1UA 1Z9CA 2PYHA 2RGVA 2OAZA 4C30A 4KH3A 1MBKA 1A8PA 1E3XA 3HAGA 2OC6A 4L18B 2AXLA 2XTYA 4FX4A 2K9SA 1ZTRA 3JSOA 2NT6A 2O9LA 3ABKH 4AD9A 1R5HA 2PEXA 3IHUA 3CC2I 2ELKA 2LKSA 2FEZA 4NK6A 2K40A 3ROUA 2ZBVA 2PBIA 5IP6A 5LGTA 3K4LA 2ETHA 2B7CA 1K78A 1SMTA 2XF6A 4DYQA 2ELHA 4YFOA 2E5ZA 1E17A 5GAHJ 4N4OB 3JQRA 3FXLA 2XAQA 1WJFA 3I64A 3FX3A 2VJ4A 4KT6A 1W0UA 1ETVA 1V5EA 1AIPA 1OISA 1SM4A 1H8AC 4CCKA 3MKLA 2P6SA 1JJ2B 2NOGA 3TO6A 4UY8I 3DP7A 5ED4A 4A3FJ 5TR9A 3CP2A 2CQXA 2IPQX 3RKYA 1R9TJ 2UVEA 1QHGA 3F8BA 4XR6A 4G7ZF 5J35A 2OQGA 5FLXZ 2PFBA 3Q6RA 2X6WA 3K1MA 5CVVA 3CMAB 3R0AA 1T6XA 2OCEA 1WCMJ 1ULYA 4MEXF 2PMUA 2GXAA 1FRNA 1KZHA 2R9VA 5FFZA 2XGCA 4XRMA 4A3JJ 2P6TA 1MNDA 2ZTNA 2HQ5A 2HQNA 1TSPA 5A89A 1S0UA 2ZJRF 3OR2C 4DBQA 2Y75A 3DFGA 4OAZA 5B1AH 3ZQQA 1RIOH 1D8TA 2ID6A 4CGZA 1XSXA 1COWA 4Z05A 4PJMA 1O8KA 4MQVA 4ZGQB 3Q3SA 2ZFWA 3S3NA 1J59A 3P9KA 3CMEI 4A3EJ 1T98A 3W5UA 2WJVA 2RKHA 3KEOA 1EFUA 2ZNYA 1TUIA 2OTJB 1NB0A 1DU6A 3WNBA 3RPQA 5DD4A 2Y9YA 1VQNB 3H1CA 4YDTA 4YFNF 1KQSB 3LMMA 2TDXA 5IT3A 3I4NJ 1N75A 2HNHA 1BPLA 1QH0A 2OZUA 3E7LA 3H09A 3C7JA 4MO7A 2UXXA 3G05A 5GAEJ 1PJRA 4M3GA 3ZMUA 3PJRA 4PC7A 1X4OA 2HGCA 1L3LA 1B72B 2HYJA 3IAS2 2FMLA 1JI8A 4KIBA 1HOMA 4LITA 5HLTA 4UAJA 3FY3A 2FBHA 4C9YA 3JR9A 3VMWA 1X3UA 3QPHA 3PNYA 2JJ1A 4WK8F 3K2AA 2UZKA 2DA1A 3U21A 1YJWB 1MIJA 2XNDA 2V5IA 1P4AA 2B5OA 3LWFA 2KJBA 2ZMEB 2EFNA 3AK5A 2UVFA 1UCRA 4M9SA 1TVCA 4NC8A 1RQRA 2NS7A 1VZ0A 1DBOA 4BXFA 1AA7A 1QGAA 4CYCB 2X51A 4PSXA 1HW2A 5DSZA 3AVTA 1KU3A 3DU1X 1L0OC 3FHNA 4YRVA 1EF4A 4Z4YA 3SJPA 3E5UA 2GOMA 3CC4I 1XTAA 2V1XA 2E35A 1Y0NA 2OTLI 3LMWA 4IQJA 3UW0A 2D1VA 3NEUA 5JLXA 3GFIA 2X1CA 2OD5A 2PECA 5IK2A 2CW7A 2G9WA 2GOXB 4GFBA 4E7KA 3ASSA 3BG6A 3HRUA 4HV6A 5HDKA 3FHZA 1BI2A 4RB1A 2JN6A 4CHUA 1DP3A 4Q47A 3VPRA 4P9UA 4RD6A 2X1EA 3S1NJ 4AIHA 3S2HJ 1FP2A 4KNYA 5IYNA 3CC4B 1W36C 5LRRA 5J3OA 1JNYA 2CRGA 3S8PA 3I55B 1FOYA 2A5WA 2QQAA 3SQNA 2BY3A 2K9MA 3EUKL 1PUFB 1D1AA 3FZVA 1AOYA 1I8DA 3SFZA 4QPQA 3FBIB 2ZXWH 4BJTA 1VQ4B 1XG2A 3EQLF 2E71A 3G71I 3CC7I 1NB9A 1BHEA 1BC7C 1LNWA 4KMFA 3F8NA 2XC7A 2OJED 1M1KD 1XN7A 1WPCA 3EETA 1LVAA 2QQ8A 4ESBA 2GPJA 4P3YA 1VQ6I 4QIWN 3RZDJ 1G7SA 4YZQA 1U78A 4M0LA 3SJZA 4P96A 2K86A 3OR1C 3SEQA 1R71A 3ERMA 1VLOA 3PENA 1Z0XA 1WJEA 3CJQB 1I1SA 1EH6A 2HQAA 1P7JA 1EP1B 3EQOA 2EFPA 2MLGA 3JREA 4XK4A 4HNVA 1R1VA 3G71B 5JLVC 4YAOA 2E7WA 4XBFA 3P9CA 2DXIA 2VC1A 1UD8A 1XFOA 3HM5A 1SEUA 3PETA 4KKUA 4L9JA 3HRMA 1XGMA 3LAJA 4UV9A 1YS7A 2W00A 1OB5A 4P12A 3HSEA 2WTEA 2IA1A 5F4MA 1B6AA 3S14J 2GLOA 2ZO4A 3LQQA 1YRNB 3LA3A 2V7QA 2IXSA 1FWZA 2G7UA 2EZKA 3HBLA 3BROA 1MSFC 4OIPF 2ZITA 5J4YA 4U88A 1OFMA 2VBEA 4GRIA 5A8AA 2C78A 3JRIA 2L7MP 4LG0B 3GTGJ 2W6JA 2QY1A 4II3A 3M4OJ 3MKWB 3LSKA 1OFEA 3ZQ7A 5L3CA 1R5BA 2L7ZA 2DMQA 3LFUA 4I0AA 3JTGA 1JXSA 1K8AD 2DT7B 5IP9J 2FU4A 2WAEA 3ZQFA 3OSGA 3FXOA 5J47A 2QA4I 4M53A 2CG4A 3E0JB 2LK2A 3MZYA 2EV5A 2PYGA 2H94A 2R7VA 4UZEA 3Q0VA 2VBKA 5E3MA 3H3UA 1BJAA 1YJWI 2GIZA 2BGCA 1YO5C 1UMQA 5CPRB 3ZMTA 2BW3B 4RS8A 2B63J 3AG1H 3GVLA 5DEQA 3PSIA 5M3FJ 1U0JA 3WTSC 2A07F 1O3RA 1FBSA 1G3SA 3GW2A 1WMRA 2IRFG 3ZCOA 3LNQA 1JKRC 4ZYGA 4ZV4A 4ESJA 4KISA 4H9GA 1ON1A 3KP6A 2O5RA 1PUFA 1T33A 4UUSB 4HX7A 1VTNC 4YIRX 5FGMA 3G1LA 3ISXA 3A1PA 2F4NA 1GXQA 1QUEA 5HXBA 1E3HA 5FKMA 3O2PE 2DEUA 1YI2B 2HVQA 1TL8A 4IQ4A 2P4WA 1BI1A 3LA7A 1OOCA 2K3FA 5D5UB 2C6YA 1TT0A 1SKQA 2R7FA 3WU2C 2KRFA 2L2OA 3NB2A 1TWFJ 1A35A 1YOVB 2L9NA 2VLAA 3KP5A 3TEDA 1LB2A 2IQ7A 2AQEA 3QE2A 3RDIA 1W2BB 2R7XA 4LOCA 3HUGB 1ETYA 2VKVA 3SLNA 3BTLA 2QCOA 3DEUA 4LLGF 1TC3C 1UFMA 2ZL7A 1H89C 2ZXHA 4BJ5C 1XG1A 5E8GA 1HW1A 1TW2A 3MMYB 2PQ8A 3M7GA 4CO8A 4EV0A 4KN7X 3TOBA 1XMKA 3ZPNA 2VBVA 1YIJB 3ZXSA 4ASNA 1QVGB 4JMQA 2ZJ2A 2VQLA 1R23A 2XF5A 2H1LA 3VOEA 2GWRA 4XLEA 2DQLA 4QTRA 1OGMX 1V4RA 5IOYA 3EUAA 2JJ7A 2LY9A 2HOSA 2D5VA 4DK0A 1N0UA 3JURA 3WGGA 4FHTA 2RDPA 4Z4UA 2KRCA 5KK1A 3PIOF 3CCUB 3DBLB 2R7WA 2B7BA 3HB9A 3OEHA 4X05A 3B73A 2L4AA 1FX7A 2RREA 4RLQA 3BG5A 4Y7NJ 5CVIA 3W2FA 2WC2A 4OMYA 1S3JA 3KX2A 5J1UA 4YIFA 3C18A 4BE2A 3ABTA 3MZHA 3GTKJ 2KT0A 4G8XA 4C2MJ 3H5NA 1JUMA 3DPUA 4B47A 2A68F 3J81Z 3WTUC 3OS2A 3SUCA 4NBQA 3ESWB 3F0CA 1KYZA 2MABA 1BR4A 4Z6YA 1PP8F 4RM0A 3JAMK 2L7KA 1TWHJ 4Y7CA 2E60A 4BBRJ 1J9IA 1T2KA 4P1VA 1FPQA 1QVUA 3D26A 4YXWA 4LK1F 4M73A 4YFXF 5E1XA 3L9FA 2DU9A 4GYIA 4M6YA 5B1BH 4IHWA 4PUSA 4A0XA 2V7XA 1WI9A 4L9NA 1ZM9A 4WXCA 3HRTA 2LNBA 1BI0A 2KFDA 4I7HA 5D8KB 4PABA 2I10A 3GYHX 1XCVA 1PP7U 3KP2A 4PGHA 5J40A 1ZARA 3WU1B 2MC3A 2CFXA 2JWTA 1MRZA 5L3DA 5BOXA 3DCFA 2H6BA 2VFPA 2O03A 1G7RA 2R7UA 4HE5A 1MGTA 2I1LA 2HPMA 1VQLB 3HDDA 5EG0A 2VOOA 3U1DA 4K1XA 3OIPA 4M2LA 2Y30A 4II2A 3WWGA 2WWYA 2LR8A 2P0WA 4AIJA 2F4OB 1H9GA 5AIQA 1AWCA 2HLDA 1XMAA 3VB2A 3OV8A 4PAAA 1ETQA 3GFMA 1IAWA 3OYCA 2ZBUA 3DTEA 2CMPA 4Z03A 2V7VA 4JOMA 1EFCA 4IOCF 5LFAA 1R1TA 2QGUA 2QXZA 1W7PA 2Y69H 1E3ZA 3A8JA 1G7CA 1YLOA 2MD0A 2BVLA 2CS3A 1QBJA 2PLFA 2TCTA 3PQJA 2PIAA 5JHFA 1B9MA 1K78B 1QQIA 2E2HJ 3GTOJ 1QU3A 5F4JA 4YAWA 2E19A 1FNCA 2PMZA 3GTQJ 1VLYA 2MH9A 4M3EA 3K9TA 3JQQA 3A8KA 3WQZA 4LIVA 3M1EA 3H94A 2ZXIA 4EQQA 4AVPA 3IL2A 1MBHA 2NZMA 3GLLA 2HTSA 2NNYA 3OEEA 2MC4A 3R4KA 1Y1WJ 1QVTA 3VYTB 4EMSA 2Y0SA 2L0KA 2K9LA 4OOXA 4MFEA 5EZGA 2FUG2 3K4NA 3QOPA 3F8FA 1A31A 3MKZA 5DS0A 2MA3A 1YTYA 3ZBTA 4EEFG 4LBWA 2X0LA 2JUCA 2Z16A 2IS2A 5BS6A 3I56I 3T51B 5J8FA 5LHHA 2XAGA 3TOAA 2DETA 1J9ZA 3CC2B 4ASUA 2GXGA 2M7BA 3TMOA 3LO8A 4HDVA 1X19A 3DKWA 4PFPA 3QU3A 3TP0A 1AU7A 3IKTA 3ZP5A 3E6CC 3ZZUA 2JPBA 5IT9Z 6PAXA 1OGOX 2COMA 2QGGA 2F3LA 3V7AA 1RPWA 3H92A 4LFUA 1UD4A 4X0CA 1IA5A 1W34A 2KMUA 3V8JA 2FA5A 2FNAA 3G2BA 4M3BA 2XRNA 5D6FA 1ZGWA 1RRJA 4JYKA 1XPXA 1TLHB 1VFCA 2DCUA 1F36A 4I01A 2VB6A 1MDMA 1XB2A 2FXAA 2VNKA 2HXIA 3BZKA 4E7JA 3GTLJ 1KQ0A 1MMGA 2BE5F 1N25A 3R6KA 2QLZA 3OYNA 1VQOB 1X0CA 2Q2EB 3JU4A 3D5SC 3Q9SA 4O3MA 2XT4A 4JQFA 5JVTA 2XGJA 3DU6A 1W0JA 3DV8A 4I09A 3VR6A 1GAWA 3K4JA 2DIEA 2BVMA 3K4MA 3JQPA 1ETOA 4ZZLA 1FYLA 3ZZ0A 2CC2A 1WSVA 2FRHA 2RC5A 3CD6I 1J09A 5CQGA 3NARA 2Q6OA 4U7DA 2VI6A 3I59B 4XN0A 1IB0A 1EZGA 3OP1A 3GBGA 3LQRA 2ICWG 3ASPA 1OHHA 1EV7A 2FQ3A 1WJBA 1TYUA 3Q9VA 1K73D 3HTUA 2UUZA 2A3SA 4PC1A 1IN4A 3ZUGA 3HUGA 1Y8RB 1FTZA 2L9RA 4RDUA 2XV4S 3ASNH 2DT5A 1ZGJA 4U4BA 2XC1A 3Q3AA 5EG0B 1KJZA 3ZRGA 1SKYB 4P3IA 3HHGA 1T56A 2AHQA 3T8RA 2KVOA 1JT6A 3S3MA 2DW4A 3CTAA 1ZAOA 2LDUA 2FQ4A 4ABZA 5KVRA 2YWEA 1O8EA 1GJRA 3N4MA 2ZBKA 1ZG5A 1G4DA 1MNEA 4V2GA 3I0TA 4WCGA 1TWCJ 1WSUA 1QX4A 1HKSA 4YAFA 3PSFA 1VQNI 4AU7A 4ACAA 4ACBA 2IT0A 2O1DA 5LEJA 1D8JA 3BR3A 2GA2A 2CW0F 1CGPA 5DDGA 1HVXA 2W6IA 3MN2A 2GJKA 2NPFA 1O8HA 1VF9A 4PJ0C 3RI4A 3W2HA 2M3AA 1DDIA 4UB6C 4DYCA 1R7JA 4EJOA 2DOEA 2DDAA 3HGGA 1Z6RA 2WY8Q 3O8GA 1TZLA 4MYTA 1APLC 3K69A 1UG2A 1SANA 1IW7F 4N9IA 3DTKA 3AVVA 4HX8A 4AF7A 1JJ8C 1NH3A 3W6JB 2EIMH 3C2GA 5H59A 4HV5A 1BN5A 1JGGA 2ME0A 1QRCA 4TV7A 2GAUA 2A6TA 2VQGA 4LIUA 4BDYA 1JTAA 1FBUA 3BY2A 5FD6A 2WV1A 2C5HA 2OCCH 2QKMB 3IWZA 1WJ5A 3KZIC 3P5JA 1GVJA 3K70C 1IDZA 3L2QA 2K4JA 3FF5A 1Q9SA 1UELB 2NS0A 3CO7C 4KDPA 4ETSA 3KRGA 4CH7A 5B5EC 2QZAA 2IW5A 1VQKI 4EJVA 1LPQA 2VKDA 3ECHA 4N9HA 5J4VA 2PLYA 2ZZGA 4DZPA 3H35A 2LYCA 4KN4X 3ZMVA 2ZKZA 2P5LC 1E64A 4EJUA 4EH1A 3MCZA 2PJRB 2ZXJA 3HRSA 3GQBA 4MTEA 1LVKA 4UVBA 4W8RA 4XKBA 1OYYA 5CKTA 1AKHB 3OOCA 1YRNA 1OR7A 3S1MJ 3ZGKA 4G94A 1JJ6C 3NRVA 4A0YA 5IYWA 1RZ4A 4PC2A 2JDIA 3I59A 4OPOA 1XDSA 3H9NA 2JA5J 3CCEI 2HWVA 1HG8A 3WGIA 3E5QA 2QQ9A 3ELKA 4DYRA 3G6EI 4EJWA 4UV8A 3HG9A 3E6MA 1VQ4I 2F6CA 4LG0A 1OPCA 3VWBA 4IX7A 1M90D 4LG3A 4JX6A 1MABA 1XX5A 1O8IA 1MW7A 4IRHA 1YJNI 4G12A 2FVGA 3MFKA 3A35A 4K2EA 2DYRH 3LNNA 4UNOA 3NWSA 4URRA 5BMZA 2XPUA 1IF1A 4IHSA 5FLXK 2YWGA 3CCEB 1S4MA 1RMGA 2C4UA 5JR3A 5H20A 4KUMA 2LD5A 4IEJA 2BM7A 1WOOA 4BQNA 1RUOA 5M3MJ 2FMYA 2AHOA 3CJRB 3K7AJ 5FO0A 4YHBA 4G9YA 1D8KA 4A5NA 2ZZFA 2IS4A 1KRHA 2Q1ZB 1YW8A 1D5YA 3OFNA 2QVOA 3FXUA 5HKKA 3GTPJ 2CNDA 3K10A 3LYCA 2E36A 3P9IA 1KQ8A 2CF4A 3WODF 1YHQI 1BR1A 1Z67A 4DQ2A 1PUEE 1VQ9I 2Y9ZA 4Y17A 2JSPA 1R49A 1Y8QB 2NVXJ 2KDOA 1T0FA 5FKNA 4YFKF 5D8LB 3CESA 4F91B 3TH0A 5EEHA 4UZFA 3WTZA 1IC8A 4ZDOA 5E3NA 2DPUA 2F1MA 2QMUA 3R6SA 2FF4A 3CUQA 4ZC3A 4HNUA 3JRCA 3LAPA 2K9QA 1NHAA 4BKXA 2O0YA 3BR0A 2ID3A 1E2XA 4RLZA 4HG2A 4L0YB 2GK6A 4C3JJ 4DJAA 1P4MA 2HYGD 2DYSH 3GZNB 1OQYA 2OBPA 5H6QA 3JAMZ 1VQMI 2QBYB 2CUFA 4CCJA 4Y9UA 1QFYA 1GQ8A 2L02A 3MHPA 2DMTA 2IEKA 2Y48A 2RC4A 3P7NA 2NNNA 2BX6A 2LY2A 1BBYA 2E2JJ 3RY8A 2EK5A 2WB1A 4HOBA 1J0RA 1HKTA 3VSTA 3R61A 1O57A 5FB2A 1W5CC 3WE3A 2D45A 2ISYA 4Y13A 4A3BJ 1Z7UA 1MMAA 3O8HA 3ONQA 3M3YJ 2PI0A 1SVLA 4RCYA 3GF2A 4Y4RA 1TWGJ 4WZEA 1YI2I 1Q1VA 1F4KA 2JSCA 2QQBA 4WQMA 2DTZA 4JK1X 3S2DJ 5L46A 4FE4A 2GM4A 5J1RA 1YITB 1TBXA 4HBLA 4AYBA 3BG9A 3HOWJ 2DA5A 3ASRA 2N8GA 2DA2A 1PJ7A 3CDLA 3KE2A 1BOAA 4I84A 2NYXA 3BPVA 2VNIA 1ONVA 4QSHA 1IJEA 4UZUA 3KEWA 2CU7A 1FP1D 4BGDA 2DERA 3ZN0A 1XCBA 2YX4A 2CFOA 4A0ZA 1A6IA 1CZFA 4JRAC 2EPFA 1EKEA 2VYQA 2DFIA 2X8KA 3CMYA 3U1KA 4U9UA 1QA1A 2VT2A 2ZTGA 3CJNA 1AHDP 1M1EB 2J8IA 3PA1A 2XT2A 3RTRA 1PE9A 3PIPF 1U5TA 1STZA 2AO9A 2GBYA 2W24A 4AVZA 3WTTC 1XGNA 3ML3A 3N05A 4L9VA 4BXXJ 2CQ7A 3QFTA 2J5OA 2G0YA 4B09A 4E7LA 3C2HA 2AQFA 4E7ZA 5GPAA 3I4PA 4CCOA 1GXPA 1Z21A 3GRHA 4PJJA 2C5BA 5IOZA 2EZIA 5J8CA 4PMHA 3ERED 1XD7A 3GO5A 1ON2A 1QUFA 1DQUA 3CDHA 1T08B 2RC6A 4CSWA 1SC7A 1D2EA 1U3EM 1QGYA 2INVA 1WFXA 3BZ6A 1ETWA 4B1RA 3CUQB 4WXDA 2E5NA 2MSYA 2V4DA 4HEA2 4S05A 5HVQC 4M72A 1DABA 1K28D 1N8RD 1D3YA 3COAC 4B8XA 3CXCB 1R58A 1RESA 5JMCB 1WOSA 2L9VA 2HU9A 4X06A 1X1AA 2M45A 2KIQA 2VKHA 5F04A 4LBVA 1O8GA 3I5UA 4HAMA 3K4KA 4I2OA 1V0EA 3DLLF 4C43A 1VQ7B 5KAFC 2ZL6A 5ILUA 3D5LA 4FASD 2EILH 4A6EA 1XQBA 5HOOA 1EXMA 1UD3A 5LHGA 5C1CA 2OUMA 1EH8A 2QM3A 5AN9A 3GVAA 2DJNA 4NQWA 3VEPA 4P5OA 2NVQJ 2Y0SN 3DKXA 1O8MA 3KEYA 3ZQIA 1IN7A 2K02A 3WG7H 3C1DA 5IYCJ 4QWQA 3CPWB 2CQKA 3J81k 5C4JJ 2EFWA 2JPCA 2L9SA 2Q6LA 4AIDA 2Z6BD 1LM1A 1IO2A 4R1HA 5EYRA 1MH3A 3BC8A 3BQYA 2ZMEC 1X4PA 4I76A 2MGQA 4G6QA 2M8GX 1WJAA 4PZJA 3WTXC 1K4SA 3MKYB 2XEXA 2M87A 4Y9RA 2GREA 1IV8A 4G6TB 2ZMEA 1QPIA 2KISA 4YEIA 3JTHA 1ZRFA 2Q6IA 3W5VA 3CJTB 2BGJA 1WTHD 2P8TA 2PMHA 2NTPA 4P9SA 1B2RA 2CH0A 3W2AA 4TKOB 1OCTC 3TW7A 4BE1A 3BCBA 2HQRA 3JX8A 4QUZA 1XDUA 1HBXG 1H85A 3UNGC 2LOOA 1E62A 1P7IA 2FE3A 1X58A 4JX5A 5EJCA 1D1BA 2FBIA 2LF7A 3DLAA 1USTA 5EDNA 2KDZA 2HOEA 5DUKA 2HZTA 4ZDPA 1BLIA 3CQZJ 3GSIA 3BLYA 2BBYA 2ZCWA 1P4WA 3DKYA 3GQ9A 2LP0A 4ESFA 1H0MA 2XOKA 1HA8A 3CCMB 4BQAA 2EFQA 5CJ9A 1QPMA 2WAFA 1H80A 1JKOC 2BXYA 3JRAA 1LQ1A 2Y31A 5E20A 3R6JA 1LDKB 1QA3A 2A6HF 2UV1A 1R5ID 4BQOA 2QTZA 4R71A 4W1UA 1ZG1A 3F6VA 1SFEA 5GTIC 1WOPA 3K70D 3B82A 1YG2A 3OIOA 1OYWA 3T5XA 3FK6A 3WU0A 4ZTJA 3LQEA 1R22A 3S1QJ 4E4HA 5DV5A 4PFOA 3L00A 1UG0A 5JVGF 2GJPA 1UD2A 2I5UA 2BN4A 2HFHA 3GQ7A 5FA6A 3LFKA 2IA2A 4KA4A 4RMNA 1OLTA 2X6YA 2M5WA 4O5VA 2Q2EA 2G7HA 3ABUA 5HDGA 2W7NA 1CF7A 5FO1A 1O7LA 2EH3A 1FY7A
chains in the Genus database with same CATH topology
2LH9A 3I9V2 2JA2A 3A2KA 2JIZA 4FXUA 4P22A 2R7UA 4FETA 5TGTA 4F3QA 1IRXA 4YZAA 2HPMA 4C2LA 1ERDA 2NT9A 2K5CA 3OIPA 2M4KA 4II2A 3WWGA 2WADA 4XMYA 2P0WA 3E1SA 3LSHA 4C2UA 2HLDA 3H5RA 4F55A 4BUPA 2JVHA 3OYCA 3DTEA 2CMPA 4Z03A 2X3HA 1X1DA 1MMNA 4JOMA 3HOSA 2CK3A 5LFAA 3T56B 4TT3A 2QXZA 2LY1A 1E3ZA 2MD0A 2BVLA 2CS3A 3LSIA 3OIQA 3HOTA 4YZXA 3K4CA 1BOBA 2VL8A 4U7BA 3OAAA 3FDYA 2X53S 2ELJA 5JHFA 4D9JA 1V0FA 1QU3A 2PMZA 1VLYA 2O17A 5CDFA 4Z06A 1NG6A 3WQZA 2KL4A 4LIVA 3H94A 3K4BA 2UWMA 4Y3OA 2DOAA 4KKSA 2ZXIA 1AIRA 4HSTA 4B3XA 4PSWA 1EFRA 2QX3A 4EW9A 2NZMA 1O8KA 4X0GA 2LZJA 4HSRA 1PKVA 2MC4A 3OEEA 1OFLA 3VYTB 2Y0SA 3OYFA 4OJOA 2K9LA 4HWVA 1UD6A 2FUG2 3K4NA 2HVSA 2VPLA 2E1BA 3MKZA 2WSSA 1PYVA 3VSVA 2Z8GA 2K3PA 3FPPA 1D0XA 2Z16A 2IS2A 2BW3A 3T51B 2W1OA 4NC7A 3DPLC 4QPOA 3VSKA 3ZPPA 3FKSA 4ASUA 4OZZA 3EQNA 2M7BA 3TMOA 2R7QA 2VQHA 4DNTB 1X19A 4NUBA 4PFPA 3NE5B 2WZPP 4XKCA 1FX0A 1O8LA 1ZELA 1K6YA 1V5GA 1OGOX 2ZSIB 2VJJA 3A3GA 1T0FC 3DTIA 2WA0A 3OYEA 1UD4A 1IA5A 2KMUA 3F9KA 2M5SA 1WP6A 2VJ5A 4G6IA 3G2BA 1NRKA 1IDKA 4MLOA 4BL0B 4D1QA 2V7FA 4DNRB 4B3GA 4NQWB 1O8FA 2WPDA 2F4IA 4U87A 2VB6A 1YX5A 4E7JA 2VASA 2VIXA 1E79A 3T9GA 1MMGA 2KZVA 1X0CA 3B90A 2KLOA 3OYNA 2Q2EB 3JU4A 3D5SC 4HPQA 4JQFA 2XGJA 3B4NA 1SFKA 2MFZA 3DU6A 1W0JA 2IS1A 4B44A 2KP6A 3VR6A 4OJPA 3K4JA 2DIEA 2BVMA 3K4MA 4IZZA 5DN6A 1O8JA 4ITVA 4HRIA 4F92B 2QKLB 3MD2A 2VQCA 4DGWB 5HNFA 3ZSCA 4BEHB 2RNGA 1J09A 5CQGA 3OS1A 3OW7A 2Z2SB 4Z1MA 3PUBA 4XN0A 1DBGA 2ZZQA 3GBGA 3LSMA 1OHHA 1WJBA 3A1YA 3W2VA 4J01A 1E0EA 2BOLA 2UUZA 3CZ6A 3L2WA 4CZCA 1VF7A 4IKFA 2UVEA 5HNHA 2GK7A 2HDWA 4J00A 1E1RA 4OJ5A 2XZPA 2M0MA 4XKWA 2D3LA 4U4BA 4XL9A 3SYTA 3ZRGA 1BMFA 1SKYB 1I18A 3M1CA 2ZFUA 1Y6IA 2HPIA 2KVOA 3S3MA 3T53B 2R7SA 2PYHA 4XLFA 1O8EA 4C30A 3CMMA 1D1CA 1MNEA 2W82A 1E3XA 2OC6A 2V4JC 3HAGA 3QYEA 3PSFA 4AU7A 1VJSA 1Y56A 2NT6A 1YE9A 3OYMA 3H0DA 4NK6A 2F5VA 3HL2A 2NOJB 4EATA 4N4NB 3NWTA 1UD5A 1HVXA 1OB0A 2W6IA 2O1DA 3TBIA 1O8HA 2GJKA 2PJRA 4C2TA 3DWLE 3K4LA 2M3AA 2XF6A 2XZLA 2L5QA 1W0KA 2WY8Q 4CCNA 1TZLA 3D5RC 2E5ZA 3QYFA 2IGNA 4N4OB 2W4SA 2NSPA 3DTKA 1WJFA 2KRHA 2VJ4A 4KT6A 1V5EA 1OR7C 2X85A 3C2GA 4KKTA 4CCKA 3CP2A 2CV0A 2VQGA 2A6TA 2M4GA 4LIUA 1QHGA 3L2UA 2VJIA 4XR6A 4BDYA 1JTAA 1W36D 2JJ2A 4MR0A 2QKMB 1WJ5A 2X6WA 1G59A 3HXLA 4XLCA 3K70C 2BSPA 3L2QA 3RSNA 1W9XA 1UELB 4KJZA 3KRGA 2R9VA 4CH7A 1MNDA 2VKDA 2ZTNA 2ZZGA 1T95A 2XAUA 3H35A 2LYCA 3OR2C 4DBQA 4OJ6A 1E43A 1KZLA 4OAZA 3ZQQA 4DK1A 3OYJA 2PJRB 1COWA 2INUA 4Z05A 4PJMA 2LG4A 2VBMA 3GQBA 3S3NA 3OYAA 3OYDA 4ZDLA 1LVKA 1T5EA 4W8RA 4OWRB 4XKBA 5CKTA 2WJVA 3QOEA 3OOCA 4TSFA 1VBLA 4OAYA 3ZGKA 4YZ0A 2JDIA 3BCDA 3LMMA 1YX3A 1N75A 2HNHA 4CA0A 1BPLA 2Z1DA 2V6EA 1HG8A 5KHDA 4ZTFA 1KCCA 1NHCA 2IGMA 3HG9A 1K5CA 3G05A 1PJRA 2F6CA 3VWBA 1E1QA 3BCAA 3PJRA 1X4OA 4IX7A 4LG3A 4DIQA 1BR2A 3IAS2 3H9QA 1MABA 1JI8A 1O8IA 2CW8A 4LITA 1MW7A 5HLTA 3AFHA 3I3LA 3FY3A 4C9YA 3VMWA 3A35A 1GLNA 2KPMA 3PNYA 3S93A 2F43A 3NWSA 2JJ1A 3LNNA 4URRA 3U21A 3H9JA 4BACA 2XNDA 1FMWA 2ZSHB 1RMGA 4XQFA 1P9QC 2UVFA 5LD2C 4RM2A 4NC8A 4BQNA 1NBMA 1VZ0A 1DBOA 4BXFA 1AA7A 4F52A 2OV7A 4F93B 2X51A 3CJRB 4PSXA 2XDVA 3CF2A 3FHNA 4YRVA 1Z3XA 2LC2A 2IS4A 2Q1ZB 2ZZFA 4P1WA 3OFNA 2GOMA 3LL7A 5HKKA 3VSUA 3KYLA 3K10A 2O04A 1S9HA 4IQJA 3LMWA 3UW0A 1DGWY 1BR1A 3OL3A 4BQQA 2JSPA 2X1CA 2WY7Q 2PECA 2KDOA 3HPHA 4L8JA 5IK2A 3ZIAA 2CW7A 2GOXB 4E7KA 2V26A 3CESA 4F91B 3BG6A 1DP3A 4H4KC 4YEJA 4HNTA 4ZDOA 2F1MA 4ZC3A 4HNUA 2GJRA 2VXZA 2X1EA 1RU4A 4RM3A 1W36C 2DJIA 4HG2A 4XOPA 2GK6A 3CP8A 4B3FX 3S8PA 4DJAA 1PLUA 2A5WA 2JUGA 3UR3C 2K9MA 4PJLA 2LBFA 2XSJC 3EUKL 3IP4B 3OYGA 1D0ZA 5CQEA 4CCJA 1D1AA 2WBMA 1JRGA 1R6RA 3AL0C 1I8DA 1GQ8A 4QPQA 3OL4A 1KCDA 3FBIB 4BJTA 3V42A 1N77A 3L2VA 1XG2A 2LY2A 2QE7A 3OYKA 1BHEA 4W8SA 1QCXA 2WB1A 2XC7A 1WJDA 3AKZA 1WPCA 3QODA 2NTBA 3VSTA 3H9GA 3RQ4A 4XOTA 4YZQA 5FRMA 4BE0A 3OYHA 3OR1C 3SEQA 4GQNA 1MMAA 3L2RA 3ONQA 1WJEA 3CJQB 2R7RA 2DT6A 2HQAA 3EQOA 2MYSA 4BDZA 1Z3YA 2KHMA 3M8JA 1X1BA 2EWEA 4NK8A 4Y4RA 2X1DA 2DXIA 2V9KA 2X6XA 1UD8A 2R7TA 1D0YA 2WJYA 5FROA 3OE7A 4KKUA 1MMDA 4AYBA 3DPTA 4G7XA 3VSLA 2W00A 4XNFA 4I84A 1WJCA 4UZUA 3QYBA 3KEWA 3FBNB 4BGDA 3A4CA 3PFYA 3PL8A 3S32A 2CFOA 1CZFA 2V7QA 2IXSA 3VMVA 3RCOA 2X8KA 1OFMA 2VBEA 2LREA 4GRIA 2ZTGA 2D3NA 3OMYA 3RTRA 1PE9A 1KMHA 4AVZA 3BG7A 2W6JA 2QY1A 4II3A 3OWTA 4XLAA 3LSKA 3MKWB 1HZEA 2V31A 3N05A 3VYSB 1KTWA 2O0VA 1X1CA 3LFUA 1UAAA 3DQVC 1KONA 2DT7B 3DDYA 4E7LA 2WAEA 2AQFA 3C2HA 4E7ZA 4CCOA 4CUGA 4XONA 1Z21A 3GRHA 2I8DA 4PJJA 3E0JB 4PJNA 2HVRA 2PYGA 3W3CA 2R7VA 2NSTA 3EPZA 2XF7A 4PMHA 2VBKA 1SAUA 3H5AA 1DQUA 3J7AY 3AL0B 3ZR8X 4CSWA 5CPRB 4ZYAA 4PK4A 2INVA 4W8TA 4MXNA 2BW3B 1WFXA 3GVLA 3PSIA 3GQAA 3VDXA 1U0JA 1QJVA 2E5NA 1WMRA 3S3OA 3ZCOA 2V4DA 4HEA2 5HVQC 1K28D 4KISA 1V5FA 3OYIA 5KNLA 2O5RA 2R4GA 4XLHA 2HU9A 2CUZA 2NTQA 1X1AA 2VKHA 1O8GA 3K6GA 3DU5A 4RLFA 3K4KA 4XM3A 1V0EA 3LSGA 5FL7A 3RPUD 3D5LA 4FASD 4XN3A 4YELA 4DOZA 5HOOA 1UD3A 4OZYA 2IGOA 4OJLA 2OUMA 5C1CA 3BCFA 1LKXA 2HVQA 4IQ4A 4P5OA 1NG7A 3DKXA 1O8MA 3KEYA 1OOCA 1TT0A 2E1MC 2CUJA 3TL4X 3GVJA 3DEEA 2LBFB 2L9SA 2L2OA 2O0WA 2Z6BD 3OY9A 2L9NA 2M7AA 3BC8A 2VLAA 1X4PA 5KCMA 2IQ7A 4XD7A 2AQEA 2ODLA 1WJAA 1EA3A 2R7XA 3HUGB 3MKYB 3OPOA 2E1MB 4XORA 4G6TB 2IS6A 4HIZA 4XKVA 2CV2A 2ZXHA 4BJ5C 1WTHD 2NTPA 3MMYB 3GQ8A 5C1EA 2DCEA 2JVGA 2LRDA 1LFPA 3SZGA 3ZXSA 2CH0A 4E7SA 4Y33A 3W2AA 4JMQA 4TKOB 4BE1A 2VQLA 2XF5A 4BJ6C 3BCBA 3HC7A 4XLEA 3IAM2 1OGMX 1O88A 3OS0A 1PXZA 3EUAA 3UNGC 2XZOA 1IDJA 2LOOA 4G7WA 4DK0A 3HPGA 3JURA 2HZDA 4R79A 1D1BA 2CV1A 3FKJA 3DLAA 2ZZEA 1BLIA 3ZPNA 4ZDPA 1G8XA 4BU2A 2KRCA 3BLYA 3SDBA 4E7IA 3DKYA 2R7WA 3GQ9A 4BS9A 1QHHD 3IUOA 3OEHA 2XOKA 1EE6A 4ANJA 3A3BA 2RREA 4RLQA 4E7HA 1HA8A 5AMVA 2R7OA 2RQQA 3VYRB 2WAFA 1H80A 3KX2A 5FRNA 4BE2A 1RWRA 1LDKB 1DGRM 2UV1A 3H5NA 3DPUA 4B47A 4BQOA 4CCMA 3OS2A 3SUCA 3OYLA 1FMVA 3SEZA 3OYBA 1H8EA 1H8HA 2MABA 1BR4A 3K70D 2L7KA 4CCLA 4ZTJA 2E60A 3W2WA 4YXWA 4E4HA 3VYUB 3GVKA 4PFOA 1UG0A 2V1NA 2GJPA 3BH4A 1UD2A 4NNJA 4B43A 3PNVA 1IB4A 4PUSA 4E0FA 4U49A 4E6KG 3GQ7A 4BEHA 3EUHC 4DBRA 1BN8A 2KQRA 3PNTA 4ZJZA 3OOUA 2IGKA 2VXDA 4RMNA 1OLTA 3B8YA 4W8QA 3HKZA 2X6YA 4KITB 2W7NA 3BC9A 1O8DA 4B48A 1N78A 1Z7LA 2WAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBO A;  4OJ5 A;  4YZA A;  2INV A;  4W8T A;  4MXN A;  4XKW A;  4C2L A;  2NT9 A;  4U4B A;  3GQA A;  1QJV A;  4XL9 A;  3WWG A;  4XMY A;  1WMR A;  3VSU A;  2O04 A;  3LMW A;  2PYH A;  4XLF A;  3UW0 A;  1O8E A;  4Z03 A;  4XLH A;  2PEC A;  2X3H A;  2NTQ A;  1O8G A;  2NT6 A;  4XM3 A;  2QXZ A;  4YEJ A;  4NK6 A;  4YZX A;  2O1D A;  4XN3 A;  4YEL A;  4OZY A;  5C1C A;  4OJL A;  1O8H A;  1RU4 A;  1PLU A;  4XOP A;  1O8M A;  1OOC A;  2O17 A;  2VBK A;  4Z06 A;  1AIR A;  1JRG A;  2NSP A;  2O0W A;  1GQ8 A;  2QX3 A;  4EW9 A;  1KCD A;  2NZM A;  1O8K A;  1XG2 A;  2X85 A;  1OFL A;  2IQ7 A;  2ODL A;  4OJO A;  1BHE A;  4HWV A;  4XOR A;  4W8S A;  1QCX A;  4XKV A;  2UVE A;  3VSV A;  2VJI A;  4XR6 A;  2NTP A;  1JTA A;  2NTB A;  2Z8G A;  4MR0 A;  3GQ8 A;  5C1E A;  3VST A;  4XOT A;  4YZQ A;  2X6W A;  4XLC A;  2BSP A;  4XLE A;  3KRG A;  1OGM X;  1PXZ A;  1O88 A;  3EQO A;  3ZPP A;  4OZZ A;  3EQN A;  1IDJ A;  3JUR A;  2EWE A;  4NK8 A;  4OJ6 A;  2X6X A;  1O8L A;  1OGO X;  2VJJ A;  3GQ9 A;  1IA5 A;  4Z05 A;  1EE6 A;  2INU A;  2VBM A;  5AMV A;  4XNF A;  1IDK A;  4I84 A;  1H80 A;  4W8R A;  1VBL A;  1RWR A;  1O8F A;  1CZF A;  4YZ0 A;  3VMV A;  3SUC A;  3T9G A;  1OFM A;  1X0C A;  2VBE A;  3B90 A;  1HG8 A;  1KCC A;  3B4N A;  1NHC A;  1PE9 A;  1K5C A;  4AVZ A;  2QY1 A;  4XLA A;  4OJP A;  1O8J A;  2O0V A;  1KTW A;  1O8I A;  1IB4 A;  3FY3 A;  4U49 A;  3ZSC A;  3VMW A;  3GQ7 A;  4XON A;  1BN8 A;  3GRH A;  4XN0 A;  4URR A;  4W8Q A;  3B8Y A;  1DBG A;  2X6Y A;  2PYG A;  1O8D A;  2NST A;  1RMG A;  4PMH A;  4XQF A;  2UVF A; 
#chains in the Genus database with same CATH topology
 5F6F A;  4R8H A;  3MZ8 A;  2JA2 A;  1U8R A;  2JIZ A;  4ZCL A;  1HLV A;  4FET A;  4F3Q A;  3BZC A;  2FBK A;  4V2F A;  3I4M J;  4YZA A;  2OTJ I;  4FWT A;  1XS9 A;  4OPW A;  5DTD A;  1ZRD A;  2K5C A;  3E6B A;  2M4K A;  3BR1 A;  4XMY A;  4QVA A;  3E1S A;  2RN7 A;  4XLP F;  4C2U A;  4AC0 A;  4KIC A;  4BUP A;  2DA4 A;  3SJM A;  3H3V K;  1FDR A;  1MD0 A;  4YG2 F;  4A93 J;  1E63 A;  4EJT A;  1VHO A;  1TYX A;  2X3H A;  2CK3 A;  3RQI A;  3T1B A;  4TT3 A;  5JHU A;  4HX4 A;  3A8I A;  3M8E A;  5FKL A;  2VPR A;  1BC8 C;  2O3F A;  3LSI A;  4EM0 B;  2XAJ A;  3A02 A;  2ACJ A;  2X53 S;  1G3Y A;  4LGW A;  4PDK A;  5JLW A;  1VQ7 I;  2ELJ A;  4CIC A;  4UUT A;  3KIO A;  3AVU A;  2JQ7 A;  3BG3 A;  2JK3 A;  3I58 A;  5E8I A;  2QSF X;  5GP9 A;  3LSR A;  2P3M A;  2GIV A;  1CQX A;  4I98 B;  2O17 A;  4Z06 A;  1Z91 A;  1KTV A;  2YPR A;  5FO5 A;  1W87 A;  2UWM A;  2DOA A;  5FFX A;  1GO2 A;  1AIR A;  2IAI A;  2WZN A;  4B3X A;  2HOA A;  5EMN A;  1XGO A;  1HF2 A;  5CLS A;  4HSR A;  2LZJ A;  1K8F A;  4BHB A;  4WWV A;  2DA7 A;  4LBY A;  3FKI J;  1KK0 A;  3CLQ A;  4OJO A;  5DS9 A;  1KK1 A;  3LVB A;  4QFM A;  4HWV A;  1L1I A;  2EJR A;  3FXQ A;  1W5T A;  3LSP A;  1UD6 A;  3PSZ A;  1F60 A;  2YWH A;  3UKG A;  4AM3 A;  1U5T B;  5ILS A;  3A01 A;  1G7T A;  5THX A;  1D0X A;  1FBQ A;  3DXJ F;  1MMS A;  4RD1 A;  4QVJ A;  2BW3 A;  4LLL A;  3LQ6 A;  3CCS B;  3QPT A;  1B4A A;  3CW2 A;  5AIP A;  2H6C A;  4NC7 A;  1ELO A;  4TMW A;  3BTJ A;  3VSK A;  2W57 A;  1CF7 B;  3BJA A;  2ME6 A;  3BQJ A;  3FKS A;  4OZZ A;  2A61 A;  2R7Q A;  1PDN C;  3G1O A;  4DNT B;  4DZJ A;  3NE5 B;  3FPK A;  4XKC A;  1O8L A;  1K6Y A;  1W0T A;  5LGU A;  2ZSI B;  2VJJ A;  1PJ6 A;  3A3G A;  3P4G A;  4DNC A;  1T0F C;  4M3F A;  3DTI A;  3J80 K;  3OYE A;  4J0Q A;  4ZCM A;  3W5H A;  4GCV A;  1TP4 A;  2M5S A;  1ZG3 A;  3OKX A;  4TN1 A;  1IDK A;  4BL0 B;  5ICC A;  2V7F A;  1MKM A;  4B3G A;  1O8F A;  1VI0 A;  2WPD A;  5TJJ A;  1HKQ A;  2F4I A;  2M1B A;  4U87 A;  1QGZ A;  1YX5 A;  3Q39 A;  2DA3 A;  2VAS A;  5IYB J;  1E79 A;  3T9G A;  3X2Q H;  1REP C;  1JHF A;  3B90 A;  2KLO A;  3BQZ A;  4MYU A;  4AUX A;  4RB3 C;  2A69 F;  1YYV A;  2CQN A;  3KZZ A;  4D7M A;  2Z33 A;  2F5D A;  3WHB A;  1SFK A;  2KZG A;  3B4N A;  3E5X A;  3V7S A;  1QQ1 A;  2IS1 A;  2KP6 A;  2JTV A;  4IPA A;  5F1J A;  4M4S A;  3GTJ J;  1IN6 A;  1U2W A;  1ZRE A;  3QAH A;  2VZL A;  1BW5 A;  2QKL B;  4OPS A;  4BEH B;  5E6T A;  2V79 A;  5GTH C;  2XRL A;  1UJ8 A;  2BHZ A;  2Z2S B;  2VE8 A;  3BJO A;  2JMW A;  3JRH A;  1B9N A;  2LF8 A;  5A2Q K;  2XUB A;  3P27 A;  2ZL5 A;  1QRB A;  3CUO A;  2EIK H;  2ESN A;  3DBR B;  4CDG A;  5IPA A;  3N90 A;  4IHV A;  2BOL A;  5H6R A;  3CZ6 A;  3L2W A;  1USS A;  1VF7 A;  4IKF A;  1QZY A;  2HDW A;  2JZY A;  2KIF A;  2L3D A;  3KPH A;  1MBE A;  2GXB A;  2XZP A;  4XKW A;  3RPU A;  4I6Z A;  1F9N A;  4I02 A;  4TMZ A;  3PUF A;  1WGX A;  2DPD A;  1I18 A;  3M1C A;  2ZFU A;  3T53 B;  2EIJ H;  4XLF A;  3PQK A;  1EJ9 A;  4JP0 A;  5GPC A;  1EP2 B;  3CMM A;  1D1C A;  1YW7 A;  2WV0 A;  1ENH A;  4KIG A;  4RGR A;  1GDT A;  3QYE A;  2ECC A;  4S04 A;  3GUD A;  3PFI A;  4XSX F;  2BM1 A;  3MQ0 A;  1SFO J;  3H0D A;  4IRI A;  2F5V A;  1LE8 B;  2XNC A;  1HXD A;  4N4N B;  1Q82 D;  1UD5 A;  1OB0 A;  2OBR A;  2VKE A;  3TBI A;  5D5X B;  2JA7 J;  4IHX A;  2R5Z B;  3PO3 J;  3J81 K;  4C2T A;  4GYG A;  3VOD A;  2M9H A;  1JB9 A;  2RVC A;  2VNJ A;  2XZL A;  1W0K A;  4CCN A;  4BNC A;  3D5R C;  3QYF A;  3ZMS A;  3CC7 B;  4ZZD A;  2Z99 A;  2O6G E;  4OIR F;  2O7O A;  1OR7 C;  4X07 A;  2X85 A;  4KKT A;  1I27 A;  5BNG A;  2BHY A;  4IRG A;  2EZH A;  2F48 A;  4HDU A;  3GZ5 A;  3BY6 A;  1YFH A;  4KFC A;  1RC9 A;  3I71 A;  2CV0 A;  4KT5 C;  2M4G A;  2VFM A;  1R00 A;  3RJP A;  2VJI A;  4X6A J;  2VBY A;  2OK8 A;  3CD6 B;  4WZL A;  1YHQ B;  3EDP A;  5FKK A;  2VON A;  1LEB A;  1G59 A;  2HKO A;  3HXL A;  3K1P A;  3TDU C;  2A5Y B;  1Y0Y A;  2JA6 J;  1W9X A;  1WQ2 A;  4KJZ A;  2M8E A;  1BX1 A;  2VBS A;  5HDN A;  4Z4Z A;  4PC6 A;  3AVW A;  5ICE A;  2K85 A;  5HS7 A;  2CBX A;  5EEA A;  2XAU A;  3FXK A;  1W35 A;  4OJ6 A;  1E43 A;  4WWC A;  1VQO I;  3K1N A;  1YW9 A;  2DO7 A;  3HKZ N;  1ZUN B;  2VUM J;  4A3I J;  3FIW A;  1RR8 C;  4Z4R A;  1S7A A;  2VBM A;  3OYA A;  3OYD A;  2WYR A;  2V7U A;  4IXA A;  4OWR B;  2G0E A;  3QOE A;  4OOS A;  5ERI A;  2K4B A;  1ZLK A;  2YWF A;  1X2N A;  5K5R A;  1KU9 A;  3FM5 A;  4RB0 A;  4YZ0 A;  3OZV A;  1ZK8 A;  3M07 A;  2R5Y B;  1YX3 A;  3KP3 A;  5E79 C;  1J5Y A;  1V54 H;  2Z1D A;  2CW5 A;  1O3Q A;  3QP6 A;  1T38 A;  5KHD A;  2EFG A;  2IGM A;  1YIT I;  1JA1 A;  1K5C A;  4HF0 A;  3FMQ A;  3F72 A;  1E1Q A;  1I7P A;  1AMO A;  4A3K J;  5JBQ A;  3H9Q A;  1VQ5 B;  4X7E A;  2CW8 A;  2DY1 A;  4F7D A;  2V1U A;  2EWN A;  3AFH A;  3I3L A;  3J80 Z;  4YII A;  4A3C J;  5LBQ A;  2KPM A;  2F43 A;  3S93 A;  3QQA A;  2OTL B;  2X4H A;  1TQI A;  3H3Z A;  4RD0 A;  3H9J A;  4BAC A;  1IV6 A;  2R0Q C;  1FMW A;  2ZSH B;  3MVP A;  2DAO A;  4XQF A;  1P9Q C;  4N0B A;  3V4G A;  5HZB A;  4RGU A;  2NAZ A;  4F52 A;  2PJP A;  4F93 B;  4P25 A;  2H8W A;  2XDV A;  3CF2 A;  1HDP A;  1H9T A;  5BQT A;  1WVR A;  4TMV A;  4OIN F;  3FIS A;  4P1W A;  4XIC A;  3A01 B;  4ZCI A;  3LL7 A;  3M9A A;  3VSU A;  1QVF B;  3KYL A;  2BPO A;  1P2F A;  3J7Y J;  2XAH A;  2O04 A;  1BIB A;  1DGW Y;  2YUS A;  4UXN A;  2L01 A;  3F21 A;  3HIF A;  5DCM A;  1TNS A;  1OYI A;  2BSA A;  3W6V A;  3VFZ A;  3HPH A;  4DQK A;  3ZIA A;  3AVY A;  2DA6 A;  2ZC2 A;  5K1Y A;  3VMF A;  2V26 A;  3ZQG A;  2V6C A;  4H4K C;  4YEJ A;  3AVX A;  2HR3 A;  3A0B C;  3KFW X;  2BY2 A;  4D5C A;  4FCY A;  2BV6 A;  2Z9O A;  2GJR A;  4OPV A;  1TW3 A;  2VXZ A;  3AG4 H;  5FNZ A;  1U2R A;  3ZMZ A;  1K7A A;  2NRA C;  4A3L J;  4P26 A;  1RU4 A;  4RM3 A;  1PLU A;  2B7E A;  3CP8 A;  2VFN A;  4V02 C;  3J7Z I;  1I5Z A;  4PJL A;  2XSJ C;  3OYG A;  5E1Z B;  2QSG X;  1PJ5 A;  4RD4 A;  2WBM A;  4HF2 A;  1JRG A;  1R6R A;  3BOQ A;  1Z05 A;  3SZE A;  1N77 A;  3HSF A;  1HST A;  3BR6 A;  5FLM J;  2QE7 A;  1S72 B;  1WI3 A;  1WJD A;  2XPW A;  1TYV A;  5DM6 F;  4PGG A;  1N0V C;  4DW6 A;  2E1O A;  4MNU A;  3QFR A;  3BP8 A;  4XOT A;  3RQ4 A;  1YJ9 B;  1LFU P;  2QA4 B;  1Z1D A;  2ESH A;  5GAD J;  3I1F A;  3HOU J;  4M3D A;  3L2R A;  1S29 A;  5E3L A;  2EV6 A;  2R7R A;  1K6O A;  1MBF A;  3CMA I;  2MYS A;  4BDZ A;  5B6I A;  2KHM A;  4RAF A;  3M8J A;  3CCU I;  4JX4 A;  2F2E A;  3U9G A;  2X1D A;  2KJC A;  3F22 A;  3KL9 A;  3ONY A;  3HOV J;  4YAU A;  5HZA A;  5FRO A;  1FOW A;  4A2U A;  3PM1 A;  4KYW A;  3GXO A;  1UB9 A;  1MMD A;  3A0H C;  3KET A;  1BL0 A;  1VQ6 B;  4FTH A;  4Q48 A;  1LDJ A;  2MH2 A;  1O3T A;  2VBU A;  2XAF A;  3DPT A;  3ZQC A;  3GTM J;  2JN9 A;  1E3P A;  9ANT A;  4G7X A;  2RQP A;  4YAL A;  3U2Q A;  2DTR A;  3FBN B;  3KYC B;  5EEG A;  1VQP B;  3PFY A;  2ZB9 A;  3PL8 A;  1H42 A;  2OYN A;  1Z77 A;  1OKR A;  3T8T A;  4Q5S F;  1J2X A;  1OMI A;  1QG0 A;  3VMV A;  1W1W E;  3RCO A;  1CLW A;  2Y2Z A;  1YQA A;  4D7N A;  3DEW A;  4LBZ A;  2JRT A;  2C2W A;  3OMY A;  4ZH4 F;  1FOK A;  4GDF A;  1VQ9 B;  4U0W A;  1KMH A;  1OFD A;  3IWF A;  3BG7 A;  3WYA A;  1J7K A;  1HZE A;  1JUP A;  4X7C A;  3VYS B;  1KTW A;  2O0V A;  1RET A;  1X1C A;  1UAA A;  2X9D A;  3DQV C;  2QBY A;  4LB6 B;  4M1K A;  3SY2 A;  2EB7 A;  4RDJ A;  4CUG A;  4XON A;  2VBX A;  1HCR A;  4CZZ A;  3RYR A;  4PJN A;  1SFX A;  1MJ9 A;  2K7L A;  4OU0 A;  3PUM A;  3W3C A;  3EPZ A;  2XF7 A;  3Q0U A;  4LB5 A;  2QYO A;  3J7A Y;  3AL0 B;  2R6H A;  1A04 A;  1Q81 D;  4M6X A;  3SZP A;  1YIJ I;  2M34 A;  2CQQ A;  3S2W A;  4MXN A;  4ENM A;  4AIK A;  4Q4Z F;  1IRZ A;  3VDX A;  3O3K A;  3CCL I;  2V7W A;  1QJV A;  3IC7 A;  2CO5 A;  2MG4 A;  2ECB A;  1UHS A;  2V7T A;  4BY7 J;  1QZZ A;  3HZJ A;  4G6D A;  2CUE A;  3KYD B;  2R4G A;  5F08 A;  4XLH A;  5K5Q A;  4U0Y A;  4N3N A;  2A6E F;  3VO1 A;  2EIN H;  3D1N I;  2OF7 A;  4O6J A;  2E1R A;  3DU5 A;  4RLF A;  4XM3 A;  5LHI A;  3LSG A;  3V7C A;  3RPU D;  3CCM I;  3REO A;  1ZM3 A;  4RAY A;  2EIX A;  5EF6 A;  4YEL A;  3U2R A;  2IGO A;  2YU3 A;  3OSF A;  4OJL A;  5F0C A;  3AAF A;  5A88 A;  1LKX A;  3ZZT A;  2J8K A;  3KP4 A;  1IRG A;  4GXO A;  1NG7 A;  1FIA A;  4ENK A;  2YSR A;  2CUJ A;  3TL4 X;  3QU6 A;  1SD7 A;  1AKH A;  3DF8 A;  2DFE A;  2LBF B;  1HF0 A;  1EFT A;  2O0W A;  1T6S A;  2VNH A;  1T8I A;  1U5T C;  2XIG A;  1LLW A;  1ETX A;  1X1P A;  2M7A A;  1T39 A;  2W25 A;  5GAG J;  4RDL A;  5KCM A;  1GV2 A;  4XD7 A;  4B4D A;  2ODL A;  1QRY A;  2PMZ N;  3ASO H;  3OPO A;  2E1M B;  5JI6 A;  3JW4 A;  5K7Z A;  4XKV A;  2YX7 A;  2CV2 A;  3TQN A;  3CCJ I;  1S72 I;  1I6H J;  3GCM A;  4ON0 A;  2JVG A;  5C1E A;  2LRD A;  5C4X J;  1LFP A;  3V8K A;  4UUV A;  1IXC A;  1KGS A;  3HC7 A;  2HDN B;  3IAM 2;  3F23 A;  3TKY A;  3WHC A;  1EA0 A;  1IDJ A;  1DAR A;  4G7W A;  3WY9 A;  2HZD A;  2ZZE A;  1B59 A;  5DCF A;  3HSR A;  1OGI A;  1S5L C;  2OQR A;  3SDB A;  2K27 A;  4BS9 A;  3IUO A;  1B8I A;  1X2M A;  2XRO A;  1EE6 A;  4E7H A;  3ASQ A;  1OCZ H;  2QEX I;  5AMV A;  2R7O A;  1SVM A;  3QP5 A;  4I99 C;  2RQQ A;  4IW3 B;  2QYU A;  2BY0 A;  3HOX J;  5C3E J;  3NAU A;  5FRN A;  4EM1 A;  2HMA A;  1RWR A;  1DGR M;  4RGX A;  4A5M A;  1ETK A;  1P4X A;  1OGJ A;  1WDT A;  4X8I A;  1V5V A;  5BSX A;  3OYL A;  1FMV A;  1FNM A;  4F7Z A;  3ISP A;  2V9V A;  1VND A;  2OPT A;  4CCL A;  1DG1 G;  3CCQ I;  4WF2 A;  3W2W A;  3GWZ A;  2XSD C;  3KCC A;  3GVK A;  4D0P A;  2V9P A;  3BH4 A;  2F1L A;  3PNV A;  4QHY A;  3JRF A;  4RB2 C;  3MCA A;  3G3Z A;  4BEH A;  3EUH C;  4DBR A;  1BN8 A;  1P92 A;  1IN8 A;  4S0H B;  4ENJ A;  2VXD A;  4W8Q A;  2EQR A;  1QZE A;  4EGY A;  3V76 A;  1KU7 A;  4KIT B;  3CCR B;  3BC9 A;  1TWA J;  4B48 A;  1N78 A;  1Z7L A;  3ECO A;  1FC3 A;  3I9V 2;  5LGN A;  3GIR A;  5B3S H;  2XHK A;  1R36 A;  1I3Q J;  1RKW A;  1DP7 P;  4FXU A;  4P22 A;  2DYI A;  1K9M D;  1IRX A;  1VQ8 I;  1LLZ A;  3TO7 A;  4Y52 J;  4C2L A;  1ERD A;  2NT9 A;  3ONU A;  4P55 A;  3Q0W A;  5IYP A;  5L3F A;  3T0Y A;  2VFO A;  3GME A;  3RKW A;  3LSH A;  3H5R A;  3Q6Q A;  4N3G A;  2JVH A;  2QWW A;  2MD5 A;  2XTX A;  2O61 A;  1G3W A;  1KC8 D;  1ZRC A;  5HLH A;  2XPV A;  1S7O A;  1X1D A;  1MMN A;  4OOI A;  2VE9 A;  4J19 A;  3N6Z A;  3HEF A;  5F0H A;  3T56 B;  5E18 F;  3WG9 A;  2LY1 A;  2W48 A;  2YUH A;  3WTY C;  4G7O F;  1FEX A;  3P26 A;  3TDZ C;  3OIQ A;  3HOT A;  1A5J A;  1MZB A;  2VL8 A;  4U7B A;  4P9F A;  3FDY A;  2R5Z A;  4V19 K;  1ZH5 A;  1KK2 A;  4HE6 A;  2GZW A;  5CVR A;  4D9J A;  1ORK A;  1SFU A;  2E34 A;  2JT1 A;  3VNV A;  2HS5 A;  1NK2 P;  1IJF A;  4BHC A;  2ZJP F;  5BSY A;  1Q1H A;  1NG6 A;  1XSV A;  3TGN A;  2KL4 A;  1IXR C;  4KKS A;  4Y3O A;  3SHF A;  1K83 J;  3ZOB A;  2FJ1 A;  4HST A;  1EFR A;  4MEY F;  3O6B B;  2ZNZ A;  1I1G A;  5ILV A;  1BM9 A;  1VQP I;  3S17 J;  4OMZ A;  5H5J A;  2XVC A;  4OOV A;  4M6V A;  3TO9 A;  1I3A A;  2E1B A;  2WSS A;  5K7H A;  2VBW A;  3HHH A;  4FK8 A;  4HA8 A;  2IP2 A;  3ZQH A;  3FPP A;  2B9S A;  1VQ8 B;  3F3X A;  1ZKG A;  5BPD A;  3CLO A;  5EGO A;  2W1O A;  2WR8 A;  5EZH A;  5KSW B;  3ZPP A;  4QV2 A;  1DPR A;  3JSP A;  3EQN A;  4NUB A;  1TT5 B;  1JHH A;  3C2B A;  1RR7 A;  1V5G A;  1SVO A;  4OP7 A;  2DFF A;  1OB2 A;  4UB8 C;  3WXM A;  2LSO A;  3A03 A;  1B8I B;  3I56 B;  2BM4 A;  4YCQ A;  1WP6 A;  3TW6 A;  2VJ5 A;  2XNJ A;  4G6I A;  2IOU G;  4M74 A;  1NRK A;  4I0B A;  4MLO A;  1Q86 D;  4D1Q A;  1FZP B;  5ICF A;  4DNR B;  4NQW B;  1ZN2 A;  2RAE A;  2X48 A;  5FKO A;  1WU8 A;  4TMX A;  2H1K A;  3SFI A;  1IUY A;  1UMK A;  5JFR A;  4XID A;  1WPK A;  2KZV A;  3WBJ A;  1TNT A;  3I53 A;  4RDK A;  3ES9 A;  5L3B A;  3BTC A;  1OJL A;  3GX4 X;  1KU2 A;  3PSS A;  1P6R A;  4PC3 A;  2R7D A;  3GFJ A;  4B44 A;  4OJP A;  4IZZ A;  1O8J A;  5C44 J;  4UVA A;  1U8B A;  4HRI A;  4F92 B;  2R92 J;  2VQC A;  3B02 A;  2M0C A;  3CUQ C;  4NB5 A;  2RNG A;  2Z3Y A;  4Z1M A;  2LVS A;  4RBO A;  3OS1 A;  3OW7 A;  2PE3 A;  3FK7 A;  5CYV A;  1JKP C;  4RPD A;  4A3G J;  3E6D A;  2ZZQ A;  5LLQ A;  3LSM A;  1LDD A;  2P7C B;  2V1D A;  4J01 A;  1RUN A;  3H36 A;  1E0E A;  1NJI D;  3KLN A;  4CZC A;  1D1N A;  5L3G A;  1BW6 A;  1CQT A;  2ISZ A;  4J00 A;  1E1R A;  1GV5 A;  3BNW A;  4MTD A;  1VQ5 I;  2D9R A;  2VBT A;  3BTI A;  3PUN A;  1SD5 A;  1X3Z B;  4XL9 A;  2STT A;  2DOG A;  4BAY A;  5E1W A;  1Y6I A;  2HPI A;  3CCY A;  3MAJ A;  4D5F A;  3ZQL A;  4HF1 A;  1BJZ A;  3IRQ A;  2W82 A;  1LJ9 A;  2XGX A;  2V4J C;  3AG3 H;  1GAQ A;  1N05 A;  1VJS A;  5HS9 A;  1Y56 A;  5DYM A;  1YE9 A;  3OYM A;  1WKM A;  1K61 A;  2BVN A;  4XRS G;  3HL2 A;  4BY1 J;  2NOJ B;  4EAT A;  3LSJ A;  3GLX A;  3NWT A;  3J7A O;  2F4M B;  3FXM A;  1U9O A;  3R60 A;  5F4O A;  3QWL A;  1VQM B;  1KA8 A;  2PJR A;  3E3V A;  2VT3 A;  3DWL E;  2M30 A;  1TLL A;  4E70 A;  5IYQ A;  1B72 A;  1XC5 A;  2X0K A;  1FND A;  2L5Q A;  1O4X A;  3PA2 A;  2W7Z A;  4L9T A;  2HI3 A;  2IGN A;  1EH7 A;  2W4S A;  5K5O A;  2NSP A;  2QEN A;  2KRH A;  4B4C A;  1BIA A;  3AGQ A;  3MEX A;  2MW8 A;  4LJZ F;  2CWE A;  3ZBU A;  2FX3 A;  3L2U A;  1IDY A;  2B0R A;  3KZY A;  1I50 J;  1W36 D;  3W2E A;  2JJ2 A;  4MR0 A;  4MQ9 F;  1IZ1 A;  3HTS B;  4IVN A;  4XLC A;  2BSP A;  5K7F A;  2NVY J;  3W6K B;  5D6E A;  3RSN A;  3OJW A;  1BQE A;  1EWY A;  4X7F A;  1T95 A;  1WWX A;  2P5K A;  1XSD A;  1UHW A;  1KZL A;  4FQG A;  4HW0 A;  1QFZ A;  5FLV A;  3SQV A;  5HOD A;  2KIM A;  1VHE A;  4DK1 A;  3OYJ A;  3LJY A;  2STW A;  4A6D A;  2INU A;  2LG4 A;  3IH3 A;  1XMX A;  4ZDL A;  4BPR A;  1T5E A;  1DDN A;  5BPI A;  4CYD A;  4CXF A;  3GZ6 A;  4TSF A;  1R5G A;  1YJN B;  4OAY A;  1VQL I;  3L09 A;  1VBL A;  2Z5U A;  1VQK B;  3OZW A;  3CF5 F;  1TQM A;  5DM7 F;  3WTW C;  3I55 I;  3BCD A;  4ENN A;  1ACI A;  3CCQ B;  4GO1 A;  2RV8 A;  1Y39 A;  1HSJ A;  4CA0 A;  1FSE A;  1LE8 A;  2V6E A;  1R4N B;  3DBH B;  2VC0 A;  1IHM A;  2C4T A;  4RAG A;  4ZTF A;  1DUX C;  4GGG A;  1KCC A;  1JA0 A;  4M9X A;  1NHC A;  1HDD C;  3CO6 C;  3BCA A;  1IGN A;  1SD4 A;  3GFL A;  3GEZ A;  4DIQ A;  3KLO A;  1BR2 A;  3CB4 A;  3BDD A;  3BPX A;  3WE2 A;  1YS6 A;  5L3E A;  2CGP A;  4C3H J;  3CCR I;  1GLN A;  2CJJ A;  2MBF A;  1SD6 A;  1YJ9 I;  4KMU X;  5F64 A;  3SKB A;  4OM9 A;  3AG2 H;  4A3D J;  3SDG A;  2OK7 A;  2W84 A;  1QA6 A;  3HOY J;  2NV4 A;  5LD2 C;  4RM2 A;  3B6A A;  1NK3 P;  4Z4W A;  2LKX A;  1FOX A;  1NBM A;  5DD8 A;  4MIM A;  4XRF A;  1QFJ A;  1E3O C;  2OV7 A;  4LC0 A;  2HDC A;  4W97 A;  3AGP A;  3WGH A;  3TP3 A;  4B3A A;  1GUU A;  4NC6 A;  1Z3X A;  2LC2 A;  3SLD A;  2XB5 A;  1JTX A;  2BGI A;  3HGY A;  2DK8 A;  1JGS A;  3PO2 J;  1RNL A;  2CYY A;  1S9H A;  2PX9 A;  4A69 C;  5EGO B;  2F5F A;  1UZC A;  4G1B A;  2VFQ A;  3OL3 A;  2NVU B;  2CSO A;  4BQQ A;  2R5Y A;  4RCZ A;  1ZR2 A;  3HOZ J;  4MFD A;  2WY7 Q;  1MNM C;  3U6B A;  2LTP A;  4L8J A;  4L5I A;  4HLX A;  3U6K A;  1XGS A;  1WHU A;  3SZT A;  5F1R A;  3V8L A;  1NDH A;  4HNT A;  5TV2 A;  2DDB A;  1ZQ3 P;  3F8M A;  1H88 C;  3WNC A;  1N06 A;  2O8K A;  4RPB A;  3WND A;  2DJI A;  4XOP A;  4B3F X;  3K2Z A;  5IP7 J;  3L1P A;  1R4M B;  2JUG A;  3UR3 C;  1IUF A;  2LBF A;  3IP4 B;  1D0Z A;  5CQE A;  1ZHF A;  1N07 A;  2D1H A;  1C0W A;  3W2I A;  2BMW A;  3AL0 C;  3OL4 A;  1KCD A;  1SMY F;  2H8R A;  3V42 A;  4L0Z B;  3L2V A;  1TTY A;  2Q0O A;  4H0E A;  2R7Z J;  5LMZ A;  2BEO A;  3CCL B;  1S6L A;  2LFB A;  1FNN A;  3E97 A;  3OYK A;  4BBS J;  4W8S A;  5J1Y A;  1QCX A;  4ZYD A;  2L7F P;  3AKZ A;  3S16 J;  3QOD A;  3G1M A;  1T6Z A;  2NTB A;  3NAW A;  3OJX A;  3H9G A;  2YR2 A;  5A2Q Z;  4ROX A;  5FRM A;  3ABM H;  4BE0 A;  3OYH A;  3NQO A;  5DUI A;  4GQN A;  2LKP A;  2AXT C;  4UHT A;  4AF6 A;  2HEO A;  2DT6 A;  1TTT A;  1I6X A;  1K4T A;  1Z3Y A;  3N97 A;  1MSE C;  1WSR A;  1X1B A;  2EWE A;  1W7P B;  4NK8 A;  1SAX A;  3FMS A;  4M9Z A;  2V9K A;  2X6X A;  2WJY A;  2R7T A;  1D0Y A;  1KQ9 A;  2OBS A;  3BY1 A;  2XKO A;  3OE7 A;  3S15 J;  1KD1 D;  3IH2 A;  4FX0 A;  3OW2 B;  2UXN A;  2FOW A;  2DK5 A;  4Z4T A;  3ML6 A;  3VSL A;  4XNF A;  1W5S A;  4WZK A;  5IYD J;  1WJC A;  2QUF A;  3IRR A;  2EV0 A;  4HYE A;  3QYB A;  1FYM A;  2BM5 A;  2D74 A;  2LMD A;  5M5W J;  3A4C A;  3S32 A;  2F5E A;  1KK3 A;  3E20 A;  4IF4 A;  1FYK A;  4NCN A;  2DI3 A;  4ZYE A;  1IXS B;  2OZ6 A;  2C77 A;  2LRE A;  5AON A;  2D3N A;  3BH6 B;  3CCS I;  1ZR4 A;  1BX0 A;  2FSW A;  3KP7 A;  2P81 A;  3OWT A;  4XLA A;  2V31 A;  3G6E B;  1FLI A;  2LLK A;  3QSY A;  2FOK A;  3FM3 A;  4UVC A;  3ZMD A;  1KON A;  3DDY A;  5HLI A;  2GA1 A;  5TRD A;  1CNE A;  3FMR A;  2FNP A;  3BH7 B;  3LOC A;  2A05 A;  3RYP A;  1FRQ A;  1QGP A;  1BA5 A;  2I8D A;  5E3O A;  2HVR A;  5HS8 A;  2COB A;  1ODD A;  2BM0 A;  3QPS A;  1YX2 A;  4RA2 A;  2NST A;  1O3S A;  2DLL A;  2QEX B;  4LD5 A;  1SAU A;  3H5A A;  2IVM A;  1FTT A;  4ZYH A;  4JBA A;  4DQL A;  3RZO J;  5FIU A;  3ZR8 X;  4ZYA A;  1LEA A;  1OCO H;  1S8N A;  4PK4 A;  1G3T A;  1V3F A;  2NVT J;  3ABL H;  4W8T A;  3GQA A;  1WRJ A;  4NHJ A;  1OCR H;  1DPU A;  5IYR A;  4G7H F;  3C3W A;  3H0G J;  2X3U A;  3S3O A;  1IRF A;  1OCP A;  2EA2 A;  3AST A;  4WX9 A;  1V55 H;  4P6V F;  1V5F A;  3OYI A;  5KNL A;  1WOR A;  2IJL A;  5GV8 A;  2NS8 A;  1Q7Y D;  2CUZ A;  3JRB A;  3Q5F A;  2NTQ A;  2PMD A;  3K6G A;  4LLN A;  3QPL A;  1JE8 A;  1QA2 A;  5FL7 A;  4BHP A;  1QNT A;  2QZ8 A;  4HZF A;  4XN3 A;  4DOZ A;  3G4S I;  4OZY A;  3IH4 A;  2JA8 J;  3OAA A;  1GR1 A;  2DBB A;  1KQ5 A;  5IY5 H;  3BCF A;  2FX0 A;  4MHG A;  3FXJ A;  1XE1 A;  1WXR A;  1IN5 A;  4FE7 A;  4A3M J;  3CRZ A;  4PGO A;  2E1M C;  2D2W A;  4G5G A;  3GVJ A;  2W85 A;  2YU9 J;  3DEE A;  1GVD A;  2J5P A;  1JUS A;  2XAS A;  3OY9 A;  1F43 A;  1BI3 A;  3B78 A;  2M2E A;  2HCJ B;  1EA3 A;  2Q8K A;  4RAZ A;  4XOR A;  3RKQ A;  2VOP A;  5F0F A;  2HYF A;  2IS6 A;  3B8H A;  4HIZ A;  3G4S B;  1I39 A;  1R5O A;  3R0J A;  3GQ8 A;  3OOP A;  3FJO A;  2DCE A;  2BY1 A;  3SZG A;  4E7S A;  2VN2 A;  5E17 F;  4Y33 A;  1HA3 A;  4P6Y A;  2GQQ A;  1KYW A;  3MWM A;  2BYV E;  5D4S A;  4BJ6 C;  1F1Z A;  3BJ6 A;  2E2I J;  5FD5 A;  1LFB A;  3OS0 A;  1O88 A;  1PXZ A;  5DNS A;  1POG A;  2XZO A;  4AYB N;  1WZ2 A;  2P7V B;  3HPG A;  3VNU A;  5GV7 A;  4R79 A;  2CV1 A;  1DU0 A;  3FKJ A;  4NBS A;  1W7P D;  1XB4 A;  2EZL A;  3VO2 A;  4FN5 A;  1G8X A;  2TRT A;  4BU2 A;  2BXZ A;  4E7I A;  1ZLJ A;  1QHH D;  1FT9 A;  3L2C A;  4ANJ A;  3A3B A;  3CCV I;  2K9N A;  2WAQ N;  2HOT A;  4Z4S A;  5KAI C;  3E1Y E;  3CDI A;  2OU2 A;  1ZYR F;  4XSZ F;  3VYR B;  3IKV A;  2E1C A;  2ZJQ F;  2XB0 X;  2BF4 A;  2QTL A;  1WH7 A;  3MMP A;  1TQP A;  4MGR A;  1HC8 A;  4CCM A;  3CPX A;  1ZM2 A;  2R93 J;  3SEZ A;  3OYB A;  3PVD A;  5DCM B;  1H8E A;  2YS9 A;  2FD5 A;  1H8H A;  4HQM A;  3SEJ A;  2JRM A;  1B1B A;  1MBJ A;  4L5E A;  3ZC3 A;  4KIF A;  1ITY A;  1ZGA A;  3JRD A;  4P2N A;  5D5W B;  2XGD A;  1G6N A;  3VYU B;  3W2G A;  5J3L A;  2V1N A;  1QO0 D;  1N08 A;  4WZT A;  4NNJ A;  4Y15 A;  2DFH A;  4IOA F;  4B43 A;  1FSH A;  5KW9 A;  4EM2 A;  1RQP A;  2BM6 A;  1R5N A;  2J7K A;  4E0F A;  4U49 A;  1IB4 A;  3LST A;  1JTY A;  4E6K G;  3B6C A;  1Y0R A;  4XRS A;  2KQR A;  3BT9 A;  2B0L A;  3OOU A;  1S7E A;  3PNT A;  2Y0M A;  1LUJ B;  2IGK A;  3M8F A;  4FIS A;  2HKX A;  5B66 C;  3HKZ A;  2BZT A;  2DOF A;  3QRF F;  3B8Y A;  1T6Y A;  3BWG A;  1MJB A;  1O8D A;  2XGE A;  1UHM A;  1HW5 A;  2WAQ A;  3JRG A;  2LH9 A;  4Z2Y A;  1HQC A;  3A2K A;  4C3I J;  5TGT A;  3RIQ A;  3F6O A;  3HJE A;  2OBT A;  1JKQ C;  4RJL A;  3S1R J;  4OIQ F;  2P5V A;  3LA2 A;  4RD3 A;  1B23 P;  1F5T A;  2WAD A;  1YLF A;  3EYY A;  2DMN A;  2WB1 N;  1A36 A;  3CCV B;  2F5C A;  4WXH A;  3Q38 A;  1Y1V J;  2DMU A;  5TY0 A;  5IT9 K;  3CCJ B;  4F55 A;  3ZPL A;  2IBD A;  3HYI A;  5CVJ A;  3SXY A;  1J75 A;  1D5V A;  2QSH X;  1PVE A;  4IL6 C;  4IHT A;  1FIP A;  3HOS A;  4C0S A;  5LEK A;  1MDM B;  4UUS A;  1W4M A;  2PG4 A;  4FT8 A;  5M5X J;  1DDG A;  1BJK A;  1EP3 B;  4YZX A;  2HTJ A;  3K4C A;  1BOB A;  2DN0 A;  2VOD A;  2DMP A;  1X3W B;  1G2H A;  1JT0 A;  1GVH A;  4QLC U;  2HXO A;  2E7X A;  4IO9 F;  1V0F A;  2H09 A;  4ZGN B;  1MBG A;  3V7R A;  1IJW C;  2E1N A;  5CDF A;  1ZM4 A;  1NTC A;  2H27 A;  1MJA A;  3K4B A;  1OCC H;  2DOD A;  4CQJ A;  4EVI A;  2PN6 A;  4PSW A;  2QX3 A;  4EW9 A;  1U6G A;  4X0G A;  3RKX A;  1A6Q A;  4X1E A;  2KIU A;  1PKV A;  2QN6 A;  4NDL A;  2Q6K A;  2ADU A;  4IJA A;  3WTV C;  4A12 A;  4ZJZ A;  3OYF A;  1OFL A;  2RNJ A;  5H2F C;  1YIO A;  2HVS A;  2VPL A;  2CRV A;  4HLY A;  1PYV A;  3VSV A;  3KEQ A;  1O7F A;  2Z8G A;  2K3P A;  4LK0 F;  4BH9 A;  2QF7 A;  2O8X A;  3RIR A;  2EFO A;  1GT0 C;  3D0S A;  2IA0 A;  2BV3 A;  3DPL C;  4QPO A;  1GHC A;  3WBK A;  5J6X A;  3G73 A;  4XLN F;  3ZN1 A;  2XKP A;  2GQF A;  2OA4 A;  2EBI A;  1FNB A;  2VQH A;  1TYW A;  2WZP P;  5M5Y J;  3FWE A;  1FX0 A;  1ZEL A;  4CYC A;  3BR5 A;  4AWX B;  2L4M A;  5FJ8 J;  3CME B;  4G1V A;  2WA0 A;  2HDD A;  5TIS C;  3BR2 A;  3F9K A;  4Q7J B;  2AS5 F;  3EYI A;  1RI7 A;  4TMT A;  1F20 A;  1CNF A;  4BYY A;  2XTW A;  5D5V B;  5CVU A;  3QFS A;  2VIX A;  4L5J A;  4EGZ A;  4RGS A;  5F27 A;  3OZU A;  5HLG A;  1K4Z A;  2R3S A;  2O6W A;  1U9N A;  2KKO A;  4HPQ A;  4X7D A;  4M71 A;  3JCU C;  2MFZ A;  4BXU A;  1MH4 A;  3L7W A;  5D4R A;  5DN6 A;  4ITV A;  4RD2 A;  4PCQ A;  3MD2 A;  2DQR A;  4DGW B;  5HNF A;  3ZSC A;  3I54 A;  2X6O A;  2VBZ A;  5LRS A;  4HQE A;  3PUB A;  1Z6T A;  2L54 A;  3IV5 A;  1DBG A;  4YC5 A;  1FJL A;  1OFC X;  3F8C A;  1IG7 A;  4IHY A;  4OIO F;  3A1Y A;  3W2V A;  4U0V A;  4LMY A;  3K0L A;  1K79 A;  4AC9 A;  3SYJ A;  2MLK A;  5HNH A;  2EA4 A;  2GK7 A;  4OJ5 A;  1Y0U A;  5ICG A;  2M0M A;  2D3L A;  3ULQ B;  2NXN B;  4Z4V A;  3EUH A;  3SYT A;  3FXR A;  1BMF A;  3QFC A;  1WH5 A;  2R7S A;  1RKT A;  2QDX A;  1R1U A;  1Z9C A;  2PYH A;  2RGV A;  2OAZ A;  4C30 A;  4KH3 A;  1MBK A;  1A8P A;  1E3X A;  3HAG A;  2OC6 A;  4L18 B;  2AXL A;  2XTY A;  4FX4 A;  2K9S A;  1ZTR A;  3JSO A;  2NT6 A;  2O9L A;  3ABK H;  4AD9 A;  1R5H A;  2PEX A;  3IHU A;  3CC2 I;  2ELK A;  2LKS A;  2FEZ A;  4NK6 A;  2K40 A;  3ROU A;  2ZBV A;  2PBI A;  5IP6 A;  5LGT A;  3K4L A;  2ETH A;  2B7C A;  1K78 A;  1SMT A;  2XF6 A;  4DYQ A;  2ELH A;  4YFO A;  2E5Z A;  1E17 A;  5GAH J;  4N4O B;  3JQR A;  3FXL A;  2XAQ A;  1WJF A;  3I64 A;  3FX3 A;  2VJ4 A;  4KT6 A;  1W0U A;  1ETV A;  1V5E A;  1AIP A;  1OIS A;  1SM4 A;  1H8A C;  4CCK A;  3MKL A;  2P6S A;  1JJ2 B;  2NOG A;  3TO6 A;  4UY8 I;  3DP7 A;  5ED4 A;  4A3F J;  5TR9 A;  3CP2 A;  2CQX A;  2IPQ X;  3RKY A;  1R9T J;  2UVE A;  1QHG A;  3F8B A;  4XR6 A;  4G7Z F;  5J35 A;  2OQG A;  5FLX Z;  2PFB A;  3Q6R A;  2X6W A;  3K1M A;  5CVV A;  3CMA B;  3R0A A;  1T6X A;  2OCE A;  1WCM J;  1ULY A;  4MEX F;  2PMU A;  2GXA A;  1FRN A;  1KZH A;  2R9V A;  5FFZ A;  2XGC A;  4XRM A;  4A3J J;  2P6T A;  1MND A;  2ZTN A;  2HQ5 A;  2HQN A;  1TSP A;  5A89 A;  1S0U A;  2ZJR F;  3OR2 C;  4DBQ A;  2Y75 A;  3DFG A;  4OAZ A;  5B1A H;  3ZQQ A;  1RIO H;  1D8T A;  2ID6 A;  4CGZ A;  1XSX A;  1COW A;  4Z05 A;  4PJM A;  1O8K A;  4MQV A;  4ZGQ B;  3Q3S A;  2ZFW A;  3S3N A;  1J59 A;  3P9K A;  3CME I;  4A3E J;  1T98 A;  3W5U A;  2WJV A;  2RKH A;  3KEO A;  1EFU A;  2ZNY A;  1TUI A;  2OTJ B;  1NB0 A;  1DU6 A;  3WNB A;  3RPQ A;  5DD4 A;  2Y9Y A;  1VQN B;  3H1C A;  4YDT A;  4YFN F;  1KQS B;  3LMM A;  2TDX A;  5IT3 A;  3I4N J;  1N75 A;  2HNH A;  1BPL A;  1QH0 A;  2OZU A;  3E7L A;  3H09 A;  3C7J A;  4MO7 A;  2UXX A;  3G05 A;  5GAE J;  1PJR A;  4M3G A;  3ZMU A;  3PJR A;  4PC7 A;  1X4O A;  2HGC A;  1L3L A;  1B72 B;  2HYJ A;  3IAS 2;  2FML A;  1JI8 A;  4KIB A;  1HOM A;  4LIT A;  5HLT A;  4UAJ A;  3FY3 A;  2FBH A;  4C9Y A;  3JR9 A;  3VMW A;  1X3U A;  3QPH A;  3PNY A;  2JJ1 A;  4WK8 F;  3K2A A;  2UZK A;  2DA1 A;  3U21 A;  1YJW B;  1MIJ A;  2XND A;  2V5I A;  1P4A A;  2B5O A;  3LWF A;  2KJB A;  2ZME B;  2EFN A;  3AK5 A;  2UVF A;  1UCR A;  4M9S A;  1TVC A;  4NC8 A;  1RQR A;  2NS7 A;  1VZ0 A;  1DBO A;  4BXF A;  1AA7 A;  1QGA A;  4CYC B;  2X51 A;  4PSX A;  1HW2 A;  5DSZ A;  3AVT A;  1KU3 A;  3DU1 X;  1L0O C;  3FHN A;  4YRV A;  1EF4 A;  4Z4Y A;  3SJP A;  3E5U A;  2GOM A;  3CC4 I;  1XTA A;  2V1X A;  2E35 A;  1Y0N A;  2OTL I;  3LMW A;  4IQJ A;  3UW0 A;  2D1V A;  3NEU A;  5JLX A;  3GFI A;  2X1C A;  2OD5 A;  2PEC A;  5IK2 A;  2CW7 A;  2G9W A;  2GOX B;  4GFB A;  4E7K A;  3ASS A;  3BG6 A;  3HRU A;  4HV6 A;  5HDK A;  3FHZ A;  1BI2 A;  4RB1 A;  2JN6 A;  4CHU A;  1DP3 A;  4Q47 A;  3VPR A;  4P9U A;  4RD6 A;  2X1E A;  3S1N J;  4AIH A;  3S2H J;  1FP2 A;  4KNY A;  5IYN A;  3CC4 B;  1W36 C;  5LRR A;  5J3O A;  1JNY A;  2CRG A;  3S8P A;  3I55 B;  1FOY A;  2A5W A;  2QQA A;  3SQN A;  2BY3 A;  2K9M A;  3EUK L;  1PUF B;  1D1A A;  3FZV A;  1AOY A;  1I8D A;  3SFZ A;  4QPQ A;  3FBI B;  2ZXW H;  4BJT A;  1VQ4 B;  1XG2 A;  3EQL F;  2E71 A;  3G71 I;  3CC7 I;  1NB9 A;  1BHE A;  1BC7 C;  1LNW A;  4KMF A;  3F8N A;  2XC7 A;  2OJE D;  1M1K D;  1XN7 A;  1WPC A;  3EET A;  1LVA A;  2QQ8 A;  4ESB A;  2GPJ A;  4P3Y A;  1VQ6 I;  4QIW N;  3RZD J;  1G7S A;  4YZQ A;  1U78 A;  4M0L A;  3SJZ A;  4P96 A;  2K86 A;  3OR1 C;  3SEQ A;  1R71 A;  3ERM A;  1VLO A;  3PEN A;  1Z0X A;  1WJE A;  3CJQ B;  1I1S A;  1EH6 A;  2HQA A;  1P7J A;  1EP1 B;  3EQO A;  2EFP A;  2MLG A;  3JRE A;  4XK4 A;  4HNV A;  1R1V A;  3G71 B;  5JLV C;  4YAO A;  2E7W A;  4XBF A;  3P9C A;  2DXI A;  2VC1 A;  1UD8 A;  1XFO A;  3HM5 A;  1SEU A;  3PET A;  4KKU A;  4L9J A;  3HRM A;  1XGM A;  3LAJ A;  4UV9 A;  1YS7 A;  2W00 A;  1OB5 A;  4P12 A;  3HSE A;  2WTE A;  2IA1 A;  5F4M A;  1B6A A;  3S14 J;  2GLO A;  2ZO4 A;  3LQQ A;  1YRN B;  3LA3 A;  2V7Q A;  2IXS A;  1FWZ A;  2G7U A;  2EZK A;  3HBL A;  3BRO A;  1MSF C;  4OIP F;  2ZIT A;  5J4Y A;  4U88 A;  1OFM A;  2VBE A;  4GRI A;  5A8A A;  2C78 A;  3JRI A;  2L7M P;  4LG0 B;  3GTG J;  2W6J A;  2QY1 A;  4II3 A;  3M4O J;  3MKW B;  3LSK A;  1OFE A;  3ZQ7 A;  5L3C A;  1R5B A;  2L7Z A;  2DMQ A;  3LFU A;  4I0A A;  3JTG A;  1JXS A;  1K8A D;  2DT7 B;  5IP9 J;  2FU4 A;  2WAE A;  3ZQF A;  3OSG A;  3FXO A;  5J47 A;  2QA4 I;  4M53 A;  2CG4 A;  3E0J B;  2LK2 A;  3MZY A;  2EV5 A;  2PYG A;  2H94 A;  2R7V A;  4UZE A;  3Q0V A;  2VBK A;  5E3M A;  3H3U A;  1BJA A;  1YJW I;  2GIZ A;  2BGC A;  1YO5 C;  1UMQ A;  5CPR B;  3ZMT A;  2BW3 B;  4RS8 A;  2B63 J;  3AG1 H;  3GVL A;  5DEQ A;  3PSI A;  5M3F J;  1U0J A;  3WTS C;  2A07 F;  1O3R A;  1FBS A;  1G3S A;  3GW2 A;  1WMR A;  2IRF G;  3ZCO A;  3LNQ A;  1JKR C;  4ZYG A;  4ZV4 A;  4ESJ A;  4KIS A;  4H9G A;  1ON1 A;  3KP6 A;  2O5R A;  1PUF A;  1T33 A;  4UUS B;  4HX7 A;  1VTN C;  4YIR X;  5FGM A;  3G1L A;  3ISX A;  3A1P A;  2F4N A;  1GXQ A;  1QUE A;  5HXB A;  1E3H A;  5FKM A;  3O2P E;  2DEU A;  1YI2 B;  2HVQ A;  1TL8 A;  4IQ4 A;  2P4W A;  1BI1 A;  3LA7 A;  1OOC A;  2K3F A;  5D5U B;  2C6Y A;  1TT0 A;  1SKQ A;  2R7F A;  3WU2 C;  2KRF A;  2L2O A;  3NB2 A;  1TWF J;  1A35 A;  1YOV B;  2L9N A;  2VLA A;  3KP5 A;  3TED A;  1LB2 A;  2IQ7 A;  2AQE A;  3QE2 A;  3RDI A;  1W2B B;  2R7X A;  4LOC A;  3HUG B;  1ETY A;  2VKV A;  3SLN A;  3BTL A;  2QCO A;  3DEU A;  4LLG F;  1TC3 C;  1UFM A;  2ZL7 A;  1H89 C;  2ZXH A;  4BJ5 C;  1XG1 A;  5E8G A;  1HW1 A;  1TW2 A;  3MMY B;  2PQ8 A;  3M7G A;  4CO8 A;  4EV0 A;  4KN7 X;  3TOB A;  1XMK A;  3ZPN A;  2VBV A;  1YIJ B;  3ZXS A;  4ASN A;  1QVG B;  4JMQ A;  2ZJ2 A;  2VQL A;  1R23 A;  2XF5 A;  2H1L A;  3VOE A;  2GWR A;  4XLE A;  2DQL A;  4QTR A;  1OGM X;  1V4R A;  5IOY A;  3EUA A;  2JJ7 A;  2LY9 A;  2HOS A;  2D5V A;  4DK0 A;  1N0U A;  3JUR A;  3WGG A;  4FHT A;  2RDP A;  4Z4U A;  2KRC A;  5KK1 A;  3PIO F;  3CCU B;  3DBL B;  2R7W A;  2B7B A;  3HB9 A;  3OEH A;  4X05 A;  3B73 A;  2L4A A;  1FX7 A;  2RRE A;  4RLQ A;  3BG5 A;  4Y7N J;  5CVI A;  3W2F A;  2WC2 A;  4OMY A;  1S3J A;  3KX2 A;  5J1U A;  4YIF A;  3C18 A;  4BE2 A;  3ABT A;  3MZH A;  3GTK J;  2KT0 A;  4G8X A;  4C2M J;  3H5N A;  1JUM A;  3DPU A;  4B47 A;  2A68 F;  3J81 Z;  3WTU C;  3OS2 A;  3SUC A;  4NBQ A;  3ESW B;  3F0C A;  1KYZ A;  2MAB A;  1BR4 A;  4Z6Y A;  1PP8 F;  4RM0 A;  3JAM K;  2L7K A;  1TWH J;  4Y7C A;  2E60 A;  4BBR J;  1J9I A;  1T2K A;  4P1V A;  1FPQ A;  1QVU A;  3D26 A;  4YXW A;  4LK1 F;  4M73 A;  4YFX F;  5E1X A;  3L9F A;  2DU9 A;  4GYI A;  4M6Y A;  5B1B H;  4IHW A;  4PUS A;  4A0X A;  2V7X A;  1WI9 A;  4L9N A;  1ZM9 A;  4WXC A;  3HRT A;  2LNB A;  1BI0 A;  2KFD A;  4I7H A;  5D8K B;  4PAB A;  2I10 A;  3GYH X;  1XCV A;  1PP7 U;  3KP2 A;  4PGH A;  5J40 A;  1ZAR A;  3WU1 B;  2MC3 A;  2CFX A;  2JWT A;  1MRZ A;  5L3D A;  5BOX A;  3DCF A;  2H6B A;  2VFP A;  2O03 A;  1G7R A;  2R7U A;  4HE5 A;  1MGT A;  2I1L A;  2HPM A;  1VQL B;  3HDD A;  5EG0 A;  2VOO A;  3U1D A;  4K1X A;  3OIP A;  4M2L A;  2Y30 A;  4II2 A;  3WWG A;  2WWY A;  2LR8 A;  2P0W A;  4AIJ A;  2F4O B;  1H9G A;  5AIQ A;  1AWC A;  2HLD A;  1XMA A;  3VB2 A;  3OV8 A;  4PAA A;  1ETQ A;  3GFM A;  1IAW A;  3OYC A;  2ZBU A;  3DTE A;  2CMP A;  4Z03 A;  2V7V A;  4JOM A;  1EFC A;  4IOC F;  5LFA A;  1R1T A;  2QGU A;  2QXZ A;  1W7P A;  2Y69 H;  1E3Z A;  3A8J A;  1G7C A;  1YLO A;  2MD0 A;  2BVL A;  2CS3 A;  1QBJ A;  2PLF A;  2TCT A;  3PQJ A;  2PIA A;  5JHF A;  1B9M A;  1K78 B;  1QQI A;  2E2H J;  3GTO J;  1QU3 A;  5F4J A;  4YAW A;  2E19 A;  1FNC A;  2PMZ A;  3GTQ J;  1VLY A;  2MH9 A;  4M3E A;  3K9T A;  3JQQ A;  3A8K A;  3WQZ A;  4LIV A;  3M1E A;  3H94 A;  2ZXI A;  4EQQ A;  4AVP A;  3IL2 A;  1MBH A;  2NZM A;  3GLL A;  2HTS A;  2NNY A;  3OEE A;  2MC4 A;  3R4K A;  1Y1W J;  1QVT A;  3VYT B;  4EMS A;  2Y0S A;  2L0K A;  2K9L A;  4OOX A;  4MFE A;  5EZG A;  2FUG 2;  3K4N A;  3QOP A;  3F8F A;  1A31 A;  3MKZ A;  5DS0 A;  2MA3 A;  1YTY A;  3ZBT A;  4EEF G;  4LBW A;  2X0L A;  2JUC A;  2Z16 A;  2IS2 A;  5BS6 A;  3I56 I;  3T51 B;  5J8F A;  5LHH A;  2XAG A;  3TOA A;  2DET A;  1J9Z A;  3CC2 B;  4ASU A;  2GXG A;  2M7B A;  3TMO A;  3LO8 A;  4HDV A;  1X19 A;  3DKW A;  4PFP A;  3QU3 A;  3TP0 A;  1AU7 A;  3IKT A;  3ZP5 A;  3E6C C;  3ZZU A;  2JPB A;  5IT9 Z;  6PAX A;  1OGO X;  2COM A;  2QGG A;  2F3L A;  3V7A A;  1RPW A;  3H92 A;  4LFU A;  1UD4 A;  4X0C A;  1IA5 A;  1W34 A;  2KMU A;  3V8J A;  2FA5 A;  2FNA A;  3G2B A;  4M3B A;  2XRN A;  5D6F A;  1ZGW A;  1RRJ A;  4JYK A;  1XPX A;  1TLH B;  1VFC A;  2DCU A;  1F36 A;  4I01 A;  2VB6 A;  1MDM A;  1XB2 A;  2FXA A;  2VNK A;  2HXI A;  3BZK A;  4E7J A;  3GTL J;  1KQ0 A;  1MMG A;  2BE5 F;  1N25 A;  3R6K A;  2QLZ A;  3OYN A;  1VQO B;  1X0C A;  2Q2E B;  3JU4 A;  3D5S C;  3Q9S A;  4O3M A;  2XT4 A;  4JQF A;  5JVT A;  2XGJ A;  3DU6 A;  1W0J A;  3DV8 A;  4I09 A;  3VR6 A;  1GAW A;  3K4J A;  2DIE A;  2BVM A;  3K4M A;  3JQP A;  1ETO A;  4ZZL A;  1FYL A;  3ZZ0 A;  2CC2 A;  1WSV A;  2FRH A;  2RC5 A;  3CD6 I;  1J09 A;  5CQG A;  3NAR A;  2Q6O A;  4U7D A;  2VI6 A;  3I59 B;  4XN0 A;  1IB0 A;  1EZG A;  3OP1 A;  3GBG A;  3LQR A;  2ICW G;  3ASP A;  1OHH A;  1EV7 A;  2FQ3 A;  1WJB A;  1TYU A;  3Q9V A;  1K73 D;  3HTU A;  2UUZ A;  2A3S A;  4PC1 A;  1IN4 A;  3ZUG A;  3HUG A;  1Y8R B;  1FTZ A;  2L9R A;  4RDU A;  2XV4 S;  3ASN H;  2DT5 A;  1ZGJ A;  4U4B A;  2XC1 A;  3Q3A A;  5EG0 B;  1KJZ A;  3ZRG A;  1SKY B;  4P3I A;  3HHG A;  1T56 A;  2AHQ A;  3T8R A;  2KVO A;  1JT6 A;  3S3M A;  2DW4 A;  3CTA A;  1ZAO A;  2LDU A;  2FQ4 A;  4ABZ A;  5KVR A;  2YWE A;  1O8E A;  1GJR A;  3N4M A;  2ZBK A;  1ZG5 A;  1G4D A;  1MNE A;  4V2G A;  3I0T A;  4WCG A;  1TWC J;  1WSU A;  1QX4 A;  1HKS A;  4YAF A;  3PSF A;  1VQN I;  4AU7 A;  4ACA A;  4ACB A;  2IT0 A;  2O1D A;  5LEJ A;  1D8J A;  3BR3 A;  2GA2 A;  2CW0 F;  1CGP A;  5DDG A;  1HVX A;  2W6I A;  3MN2 A;  2GJK A;  2NPF A;  1O8H A;  1VF9 A;  4PJ0 C;  3RI4 A;  3W2H A;  2M3A A;  1DDI A;  4UB6 C;  4DYC A;  1R7J A;  4EJO A;  2DOE A;  2DDA A;  3HGG A;  1Z6R A;  2WY8 Q;  3O8G A;  1TZL A;  4MYT A;  1APL C;  3K69 A;  1UG2 A;  1SAN A;  1IW7 F;  4N9I A;  3DTK A;  3AVV A;  4HX8 A;  4AF7 A;  1JJ8 C;  1NH3 A;  3W6J B;  2EIM H;  3C2G A;  5H59 A;  4HV5 A;  1BN5 A;  1JGG A;  2ME0 A;  1QRC A;  4TV7 A;  2GAU A;  2A6T A;  2VQG A;  4LIU A;  4BDY A;  1JTA A;  1FBU A;  3BY2 A;  5FD6 A;  2WV1 A;  2C5H A;  2OCC H;  2QKM B;  3IWZ A;  1WJ5 A;  3KZI C;  3P5J A;  1GVJ A;  3K70 C;  1IDZ A;  3L2Q A;  2K4J A;  3FF5 A;  1Q9S A;  1UEL B;  2NS0 A;  3CO7 C;  4KDP A;  4ETS A;  3KRG A;  4CH7 A;  5B5E C;  2QZA A;  2IW5 A;  1VQK I;  4EJV A;  1LPQ A;  2VKD A;  3ECH A;  4N9H A;  5J4V A;  2PLY A;  2ZZG A;  4DZP A;  3H35 A;  2LYC A;  4KN4 X;  3ZMV A;  2ZKZ A;  2P5L C;  1E64 A;  4EJU A;  4EH1 A;  3MCZ A;  2PJR B;  2ZXJ A;  3HRS A;  3GQB A;  4MTE A;  1LVK A;  4UVB A;  4W8R A;  4XKB A;  1OYY A;  5CKT A;  1AKH B;  3OOC A;  1YRN A;  1OR7 A;  3S1M J;  3ZGK A;  4G94 A;  1JJ6 C;  3NRV A;  4A0Y A;  5IYW A;  1RZ4 A;  4PC2 A;  2JDI A;  3I59 A;  4OPO A;  1XDS A;  3H9N A;  2JA5 J;  3CCE I;  2HWV A;  1HG8 A;  3WGI A;  3E5Q A;  2QQ9 A;  3ELK A;  4DYR A;  3G6E I;  4EJW A;  4UV8 A;  3HG9 A;  3E6M A;  1VQ4 I;  2F6C A;  4LG0 A;  1OPC A;  3VWB A;  4IX7 A;  1M90 D;  4LG3 A;  4JX6 A;  1MAB A;  1XX5 A;  1O8I A;  1MW7 A;  4IRH A;  1YJN I;  4G12 A;  2FVG A;  3MFK A;  3A35 A;  4K2E A;  2DYR H;  3LNN A;  4UNO A;  3NWS A;  4URR A;  5BMZ A;  2XPU A;  1IF1 A;  4IHS A;  5FLX K;  2YWG A;  3CCE B;  1S4M A;  1RMG A;  2C4U A;  5JR3 A;  5H20 A;  4KUM A;  2LD5 A;  4IEJ A;  2BM7 A;  1WOO A;  4BQN A;  1RUO A;  5M3M J;  2FMY A;  2AHO A;  3CJR B;  3K7A J;  5FO0 A;  4YHB A;  4G9Y A;  1D8K A;  4A5N A;  2ZZF A;  2IS4 A;  1KRH A;  2Q1Z B;  1YW8 A;  1D5Y A;  3OFN A;  2QVO A;  3FXU A;  5HKK A;  3GTP J;  2CND A;  3K10 A;  3LYC A;  2E36 A;  3P9I A;  1KQ8 A;  2CF4 A;  3WOD F;  1YHQ I;  1BR1 A;  1Z67 A;  4DQ2 A;  1PUE E;  1VQ9 I;  2Y9Z A;  4Y17 A;  2JSP A;  1R49 A;  1Y8Q B;  2NVX J;  2KDO A;  1T0F A;  5FKN A;  4YFK F;  5D8L B;  3CES A;  4F91 B;  3TH0 A;  5EEH A;  4UZF A;  3WTZ A;  1IC8 A;  4ZDO A;  5E3N A;  2DPU A;  2F1M A;  2QMU A;  3R6S A;  2FF4 A;  3CUQ A;  4ZC3 A;  4HNU A;  3JRC A;  3LAP A;  2K9Q A;  1NHA A;  4BKX A;  2O0Y A;  3BR0 A;  2ID3 A;  1E2X A;  4RLZ A;  4HG2 A;  4L0Y B;  2GK6 A;  4C3J J;  4DJA A;  1P4M A;  2HYG D;  2DYS H;  3GZN B;  1OQY A;  2OBP A;  5H6Q A;  3JAM Z;  1VQM I;  2QBY B;  2CUF A;  4CCJ A;  4Y9U A;  1QFY A;  1GQ8 A;  2L02 A;  3MHP A;  2DMT A;  2IEK A;  2Y48 A;  2RC4 A;  3P7N A;  2NNN A;  2BX6 A;  2LY2 A;  1BBY A;  2E2J J;  3RY8 A;  2EK5 A;  2WB1 A;  4HOB A;  1J0R A;  1HKT A;  3VST A;  3R61 A;  1O57 A;  5FB2 A;  1W5C C;  3WE3 A;  2D45 A;  2ISY A;  4Y13 A;  4A3B J;  1Z7U A;  1MMA A;  3O8H A;  3ONQ A;  3M3Y J;  2PI0 A;  1SVL A;  4RCY A;  3GF2 A;  4Y4R A;  1TWG J;  4WZE A;  1YI2 I;  1Q1V A;  1F4K A;  2JSC A;  2QQB A;  4WQM A;  2DTZ A;  4JK1 X;  3S2D J;  5L46 A;  4FE4 A;  2GM4 A;  5J1R A;  1YIT B;  1TBX A;  4HBL A;  4AYB A;  3BG9 A;  3HOW J;  2DA5 A;  3ASR A;  2N8G A;  2DA2 A;  1PJ7 A;  3CDL A;  3KE2 A;  1BOA A;  4I84 A;  2NYX A;  3BPV A;  2VNI A;  1ONV A;  4QSH A;  1IJE A;  4UZU A;  3KEW A;  2CU7 A;  1FP1 D;  4BGD A;  2DER A;  3ZN0 A;  1XCB A;  2YX4 A;  2CFO A;  4A0Z A;  1A6I A;  1CZF A;  4JRA C;  2EPF A;  1EKE A;  2VYQ A;  2DFI A;  2X8K A;  3CMY A;  3U1K A;  4U9U A;  1QA1 A;  2VT2 A;  2ZTG A;  3CJN A;  1AHD P;  1M1E B;  2J8I A;  3PA1 A;  2XT2 A;  3RTR A;  1PE9 A;  3PIP F;  1U5T A;  1STZ A;  2AO9 A;  2GBY A;  2W24 A;  4AVZ A;  3WTT C;  1XGN A;  3ML3 A;  3N05 A;  4L9V A;  4BXX J;  2CQ7 A;  3QFT A;  2J5O A;  2G0Y A;  4B09 A;  4E7L A;  3C2H A;  2AQF A;  4E7Z A;  5GPA A;  3I4P A;  4CCO A;  1GXP A;  1Z21 A;  3GRH A;  4PJJ A;  2C5B A;  5IOZ A;  2EZI A;  5J8C A;  4PMH A;  3ERE D;  1XD7 A;  3GO5 A;  1ON2 A;  1QUF A;  1DQU A;  3CDH A;  1T08 B;  2RC6 A;  4CSW A;  1SC7 A;  1D2E A;  1U3E M;  1QGY A;  2INV A;  1WFX A;  3BZ6 A;  1ETW A;  4B1R A;  3CUQ B;  4WXD A;  2E5N A;  2MSY A;  2V4D A;  4HEA 2;  4S05 A;  5HVQ C;  4M72 A;  1DAB A;  1K28 D;  1N8R D;  1D3Y A;  3COA C;  4B8X A;  3CXC B;  1R58 A;  1RES A;  5JMC B;  1WOS A;  2L9V A;  2HU9 A;  4X06 A;  1X1A A;  2M45 A;  2KIQ A;  2VKH A;  5F04 A;  4LBV A;  1O8G A;  3I5U A;  4HAM A;  3K4K A;  4I2O A;  1V0E A;  3DLL F;  4C43 A;  1VQ7 B;  5KAF C;  2ZL6 A;  5ILU A;  3D5L A;  4FAS D;  2EIL H;  4A6E A;  1XQB A;  5HOO A;  1EXM A;  1UD3 A;  5LHG A;  5C1C A;  2OUM A;  1EH8 A;  2QM3 A;  5AN9 A;  3GVA A;  2DJN A;  4NQW A;  3VEP A;  4P5O A;  2NVQ J;  2Y0S N;  3DKX A;  1O8M A;  3KEY A;  3ZQI A;  1IN7 A;  2K02 A;  3WG7 H;  3C1D A;  5IYC J;  4QWQ A;  3CPW B;  2CQK A;  3J81 k;  5C4J J;  2EFW A;  2JPC A;  2L9S A;  2Q6L A;  4AID A;  2Z6B D;  1LM1 A;  1IO2 A;  4R1H A;  5EYR A;  1MH3 A;  3BC8 A;  3BQY A;  2ZME C;  1X4P A;  4I76 A;  2MGQ A;  4G6Q A;  2M8G X;  1WJA A;  4PZJ A;  3WTX C;  1K4S A;  3MKY B;  2XEX A;  2M87 A;  4Y9R A;  2GRE A;  1IV8 A;  4G6T B;  2ZME A;  1QPI A;  2KIS A;  4YEI A;  3JTH A;  1ZRF A;  2Q6I A;  3W5V A;  3CJT B;  2BGJ A;  1WTH D;  2P8T A;  2PMH A;  2NTP A;  4P9S A;  1B2R A;  2CH0 A;  3W2A A;  4TKO B;  1OCT C;  3TW7 A;  4BE1 A;  3BCB A;  2HQR A;  3JX8 A;  4QUZ A;  1XDU A;  1HBX G;  1H85 A;  3UNG C;  2LOO A;  1E62 A;  1P7I A;  2FE3 A;  1X58 A;  4JX5 A;  5EJC A;  1D1B A;  2FBI A;  2LF7 A;  3DLA A;  1UST A;  5EDN A;  2KDZ A;  2HOE A;  5DUK A;  2HZT A;  4ZDP A;  1BLI A;  3CQZ J;  3GSI A;  3BLY A;  2BBY A;  2ZCW A;  1P4W A;  3DKY A;  3GQ9 A;  2LP0 A;  4ESF A;  1H0M A;  2XOK A;  1HA8 A;  3CCM B;  4BQA A;  2EFQ A;  5CJ9 A;  1QPM A;  2WAF A;  1H80 A;  1JKO C;  2BXY A;  3JRA A;  1LQ1 A;  2Y31 A;  5E20 A;  3R6J A;  1LDK B;  1QA3 A;  2A6H F;  2UV1 A;  1R5I D;  4BQO A;  2QTZ A;  4R71 A;  4W1U A;  1ZG1 A;  3F6V A;  1SFE A;  5GTI C;  1WOP A;  3K70 D;  3B82 A;  1YG2 A;  3OIO A;  1OYW A;  3T5X A;  3FK6 A;  3WU0 A;  4ZTJ A;  3LQE A;  1R22 A;  3S1Q J;  4E4H A;  5DV5 A;  4PFO A;  3L00 A;  1UG0 A;  5JVG F;  2GJP A;  1UD2 A;  2I5U A;  2BN4 A;  2HFH A;  3GQ7 A;  5FA6 A;  3LFK A;  2IA2 A;  4KA4 A;  4RMN A;  1OLT A;  2X6Y A;  2M5W A;  4O5V A;  2Q2E A;  2G7H A;  3ABU A;  5HDG A;  2W7N A;  1CF7 A;  5FO1 A;  1O7L A;  2EH3 A;  1FY7 A; 
#chains in the Genus database with same CATH homology
 2LH9 A;  3I9V 2;  2JA2 A;  3A2K A;  2JIZ A;  4FXU A;  4P22 A;  2R7U A;  4FET A;  5TGT A;  4F3Q A;  1IRX A;  4YZA A;  2HPM A;  4C2L A;  1ERD A;  2NT9 A;  2K5C A;  3OIP A;  2M4K A;  4II2 A;  3WWG A;  2WAD A;  4XMY A;  2P0W A;  3E1S A;  3LSH A;  4C2U A;  2HLD A;  3H5R A;  4F55 A;  4BUP A;  2JVH A;  3OYC A;  3DTE A;  2CMP A;  4Z03 A;  2X3H A;  1X1D A;  1MMN A;  4JOM A;  3HOS A;  2CK3 A;  5LFA A;  3T56 B;  4TT3 A;  2QXZ A;  2LY1 A;  1E3Z A;  2MD0 A;  2BVL A;  2CS3 A;  3LSI A;  3OIQ A;  3HOT A;  4YZX A;  3K4C A;  1BOB A;  2VL8 A;  4U7B A;  3OAA A;  3FDY A;  2X53 S;  2ELJ A;  5JHF A;  4D9J A;  1V0F A;  1QU3 A;  2PMZ A;  1VLY A;  2O17 A;  5CDF A;  4Z06 A;  1NG6 A;  3WQZ A;  2KL4 A;  4LIV A;  3H94 A;  3K4B A;  2UWM A;  4Y3O A;  2DOA A;  4KKS A;  2ZXI A;  1AIR A;  4HST A;  4B3X A;  4PSW A;  1EFR A;  2QX3 A;  4EW9 A;  2NZM A;  1O8K A;  4X0G A;  2LZJ A;  4HSR A;  1PKV A;  2MC4 A;  3OEE A;  1OFL A;  3VYT B;  2Y0S A;  3OYF A;  4OJO A;  2K9L A;  4HWV A;  1UD6 A;  2FUG 2;  3K4N A;  2HVS A;  2VPL A;  2E1B A;  3MKZ A;  2WSS A;  1PYV A;  3VSV A;  2Z8G A;  2K3P A;  3FPP A;  1D0X A;  2Z16 A;  2IS2 A;  2BW3 A;  3T51 B;  2W1O A;  4NC7 A;  3DPL C;  4QPO A;  3VSK A;  3ZPP A;  3FKS A;  4ASU A;  4OZZ A;  3EQN A;  2M7B A;  3TMO A;  2R7Q A;  2VQH A;  4DNT B;  1X19 A;  4NUB A;  4PFP A;  3NE5 B;  2WZP P;  4XKC A;  1FX0 A;  1O8L A;  1ZEL A;  1K6Y A;  1V5G A;  1OGO X;  2ZSI B;  2VJJ A;  3A3G A;  1T0F C;  3DTI A;  2WA0 A;  3OYE A;  1UD4 A;  1IA5 A;  2KMU A;  3F9K A;  2M5S A;  1WP6 A;  2VJ5 A;  4G6I A;  3G2B A;  1NRK A;  1IDK A;  4MLO A;  4BL0 B;  4D1Q A;  2V7F A;  4DNR B;  4B3G A;  4NQW B;  1O8F A;  2WPD A;  2F4I A;  4U87 A;  2VB6 A;  1YX5 A;  4E7J A;  2VAS A;  2VIX A;  1E79 A;  3T9G A;  1MMG A;  2KZV A;  1X0C A;  3B90 A;  2KLO A;  3OYN A;  2Q2E B;  3JU4 A;  3D5S C;  4HPQ A;  4JQF A;  2XGJ A;  3B4N A;  1SFK A;  2MFZ A;  3DU6 A;  1W0J A;  2IS1 A;  4B44 A;  2KP6 A;  3VR6 A;  4OJP A;  3K4J A;  2DIE A;  2BVM A;  3K4M A;  4IZZ A;  5DN6 A;  1O8J A;  4ITV A;  4HRI A;  4F92 B;  2QKL B;  3MD2 A;  2VQC A;  4DGW B;  5HNF A;  3ZSC A;  4BEH B;  2RNG A;  1J09 A;  5CQG A;  3OS1 A;  3OW7 A;  2Z2S B;  4Z1M A;  3PUB A;  4XN0 A;  1DBG A;  2ZZQ A;  3GBG A;  3LSM A;  1OHH A;  1WJB A;  3A1Y A;  3W2V A;  4J01 A;  1E0E A;  2BOL A;  2UUZ A;  3CZ6 A;  3L2W A;  4CZC A;  1VF7 A;  4IKF A;  2UVE A;  5HNH A;  2GK7 A;  2HDW A;  4J00 A;  1E1R A;  4OJ5 A;  2XZP A;  2M0M A;  4XKW A;  2D3L A;  4U4B A;  4XL9 A;  3SYT A;  3ZRG A;  1BMF A;  1SKY B;  1I18 A;  3M1C A;  2ZFU A;  1Y6I A;  2HPI A;  2KVO A;  3S3M A;  3T53 B;  2R7S A;  2PYH A;  4XLF A;  1O8E A;  4C30 A;  3CMM A;  1D1C A;  1MNE A;  2W82 A;  1E3X A;  2OC6 A;  2V4J C;  3HAG A;  3QYE A;  3PSF A;  4AU7 A;  1VJS A;  1Y56 A;  2NT6 A;  1YE9 A;  3OYM A;  3H0D A;  4NK6 A;  2F5V A;  3HL2 A;  2NOJ B;  4EAT A;  4N4N B;  3NWT A;  1UD5 A;  1HVX A;  1OB0 A;  2W6I A;  2O1D A;  3TBI A;  1O8H A;  2GJK A;  2PJR A;  4C2T A;  3DWL E;  3K4L A;  2M3A A;  2XF6 A;  2XZL A;  2L5Q A;  1W0K A;  2WY8 Q;  4CCN A;  1TZL A;  3D5R C;  2E5Z A;  3QYF A;  2IGN A;  4N4O B;  2W4S A;  2NSP A;  3DTK A;  1WJF A;  2KRH A;  2VJ4 A;  4KT6 A;  1V5E A;  1OR7 C;  2X85 A;  3C2G A;  4KKT A;  4CCK A;  3CP2 A;  2CV0 A;  2VQG A;  2A6T A;  2M4G A;  4LIU A;  1QHG A;  3L2U A;  2VJI A;  4XR6 A;  4BDY A;  1JTA A;  1W36 D;  2JJ2 A;  4MR0 A;  2QKM B;  1WJ5 A;  2X6W A;  1G59 A;  3HXL A;  4XLC A;  3K70 C;  2BSP A;  3L2Q A;  3RSN A;  1W9X A;  1UEL B;  4KJZ A;  3KRG A;  2R9V A;  4CH7 A;  1MND A;  2VKD A;  2ZTN A;  2ZZG A;  1T95 A;  2XAU A;  3H35 A;  2LYC A;  3OR2 C;  4DBQ A;  4OJ6 A;  1E43 A;  1KZL A;  4OAZ A;  3ZQQ A;  4DK1 A;  3OYJ A;  2PJR B;  1COW A;  2INU A;  4Z05 A;  4PJM A;  2LG4 A;  2VBM A;  3GQB A;  3S3N A;  3OYA A;  3OYD A;  4ZDL A;  1LVK A;  1T5E A;  4W8R A;  4OWR B;  4XKB A;  5CKT A;  2WJV A;  3QOE A;  3OOC A;  4TSF A;  1VBL A;  4OAY A;  3ZGK A;  4YZ0 A;  2JDI A;  3BCD A;  3LMM A;  1YX3 A;  1N75 A;  2HNH A;  4CA0 A;  1BPL A;  2Z1D A;  2V6E A;  1HG8 A;  5KHD A;  4ZTF A;  1KCC A;  1NHC A;  2IGM A;  3HG9 A;  1K5C A;  3G05 A;  1PJR A;  2F6C A;  3VWB A;  1E1Q A;  3BCA A;  3PJR A;  1X4O A;  4IX7 A;  4LG3 A;  4DIQ A;  1BR2 A;  3IAS 2;  3H9Q A;  1MAB A;  1JI8 A;  1O8I A;  2CW8 A;  4LIT A;  1MW7 A;  5HLT A;  3AFH A;  3I3L A;  3FY3 A;  4C9Y A;  3VMW A;  3A35 A;  1GLN A;  2KPM A;  3PNY A;  3S93 A;  2F43 A;  3NWS A;  2JJ1 A;  3LNN A;  4URR A;  3U21 A;  3H9J A;  4BAC A;  2XND A;  1FMW A;  2ZSH B;  1RMG A;  4XQF A;  1P9Q C;  2UVF A;  5LD2 C;  4RM2 A;  4NC8 A;  4BQN A;  1NBM A;  1VZ0 A;  1DBO A;  4BXF A;  1AA7 A;  4F52 A;  2OV7 A;  4F93 B;  2X51 A;  3CJR B;  4PSX A;  2XDV A;  3CF2 A;  3FHN A;  4YRV A;  1Z3X A;  2LC2 A;  2IS4 A;  2Q1Z B;  2ZZF A;  4P1W A;  3OFN A;  2GOM A;  3LL7 A;  5HKK A;  3VSU A;  3KYL A;  3K10 A;  2O04 A;  1S9H A;  4IQJ A;  3LMW A;  3UW0 A;  1DGW Y;  1BR1 A;  3OL3 A;  4BQQ A;  2JSP A;  2X1C A;  2WY7 Q;  2PEC A;  2KDO A;  3HPH A;  4L8J A;  5IK2 A;  3ZIA A;  2CW7 A;  2GOX B;  4E7K A;  2V26 A;  3CES A;  4F91 B;  3BG6 A;  1DP3 A;  4H4K C;  4YEJ A;  4HNT A;  4ZDO A;  2F1M A;  4ZC3 A;  4HNU A;  2GJR A;  2VXZ A;  2X1E A;  1RU4 A;  4RM3 A;  1W36 C;  2DJI A;  4HG2 A;  4XOP A;  2GK6 A;  3CP8 A;  4B3F X;  3S8P A;  4DJA A;  1PLU A;  2A5W A;  2JUG A;  3UR3 C;  2K9M A;  4PJL A;  2LBF A;  2XSJ C;  3EUK L;  3IP4 B;  3OYG A;  1D0Z A;  5CQE A;  4CCJ A;  1D1A A;  2WBM A;  1JRG A;  1R6R A;  3AL0 C;  1I8D A;  1GQ8 A;  4QPQ A;  3OL4 A;  1KCD A;  3FBI B;  4BJT A;  3V42 A;  1N77 A;  3L2V A;  1XG2 A;  2LY2 A;  2QE7 A;  3OYK A;  1BHE A;  4W8S A;  1QCX A;  2WB1 A;  2XC7 A;  1WJD A;  3AKZ A;  1WPC A;  3QOD A;  2NTB A;  3VST A;  3H9G A;  3RQ4 A;  4XOT A;  4YZQ A;  5FRM A;  4BE0 A;  3OYH A;  3OR1 C;  3SEQ A;  4GQN A;  1MMA A;  3L2R A;  3ONQ A;  1WJE A;  3CJQ B;  2R7R A;  2DT6 A;  2HQA A;  3EQO A;  2MYS A;  4BDZ A;  1Z3Y A;  2KHM A;  3M8J A;  1X1B A;  2EWE A;  4NK8 A;  4Y4R A;  2X1D A;  2DXI A;  2V9K A;  2X6X A;  1UD8 A;  2R7T A;  1D0Y A;  2WJY A;  5FRO A;  3OE7 A;  4KKU A;  1MMD A;  4AYB A;  3DPT A;  4G7X A;  3VSL A;  2W00 A;  4XNF A;  4I84 A;  1WJC A;  4UZU A;  3QYB A;  3KEW A;  3FBN B;  4BGD A;  3A4C A;  3PFY A;  3PL8 A;  3S32 A;  2CFO A;  1CZF A;  2V7Q A;  2IXS A;  3VMV A;  3RCO A;  2X8K A;  1OFM A;  2VBE A;  2LRE A;  4GRI A;  2ZTG A;  2D3N A;  3OMY A;  3RTR A;  1PE9 A;  1KMH A;  4AVZ A;  3BG7 A;  2W6J A;  2QY1 A;  4II3 A;  3OWT A;  4XLA A;  3LSK A;  3MKW B;  1HZE A;  2V31 A;  3N05 A;  3VYS B;  1KTW A;  2O0V A;  1X1C A;  3LFU A;  1UAA A;  3DQV C;  1KON A;  2DT7 B;  3DDY A;  4E7L A;  2WAE A;  2AQF A;  3C2H A;  4E7Z A;  4CCO A;  4CUG A;  4XON A;  1Z21 A;  3GRH A;  2I8D A;  4PJJ A;  3E0J B;  4PJN A;  2HVR A;  2PYG A;  3W3C A;  2R7V A;  2NST A;  3EPZ A;  2XF7 A;  4PMH A;  2VBK A;  1SAU A;  3H5A A;  1DQU A;  3J7A Y;  3AL0 B;  3ZR8 X;  4CSW A;  5CPR B;  4ZYA A;  4PK4 A;  2INV A;  4W8T A;  4MXN A;  2BW3 B;  1WFX A;  3GVL A;  3PSI A;  3GQA A;  3VDX A;  1U0J A;  1QJV A;  2E5N A;  1WMR A;  3S3O A;  3ZCO A;  2V4D A;  4HEA 2;  5HVQ C;  1K28 D;  4KIS A;  1V5F A;  3OYI A;  5KNL A;  2O5R A;  2R4G A;  4XLH A;  2HU9 A;  2CUZ A;  2NTQ A;  1X1A A;  2VKH A;  1O8G A;  3K6G A;  3DU5 A;  4RLF A;  3K4K A;  4XM3 A;  1V0E A;  3LSG A;  5FL7 A;  3RPU D;  3D5L A;  4FAS D;  4XN3 A;  4YEL A;  4DOZ A;  5HOO A;  1UD3 A;  4OZY A;  2IGO A;  4OJL A;  2OUM A;  5C1C A;  3BCF A;  1LKX A;  2HVQ A;  4IQ4 A;  4P5O A;  1NG7 A;  3DKX A;  1O8M A;  3KEY A;  1OOC A;  1TT0 A;  2E1M C;  2CUJ A;  3TL4 X;  3GVJ A;  3DEE A;  2LBF B;  2L9S A;  2L2O A;  2O0W A;  2Z6B D;  3OY9 A;  2L9N A;  2M7A A;  3BC8 A;  2VLA A;  1X4P A;  5KCM A;  2IQ7 A;  4XD7 A;  2AQE A;  2ODL A;  1WJA A;  1EA3 A;  2R7X A;  3HUG B;  3MKY B;  3OPO A;  2E1M B;  4XOR A;  4G6T B;  2IS6 A;  4HIZ A;  4XKV A;  2CV2 A;  2ZXH A;  4BJ5 C;  1WTH D;  2NTP A;  3MMY B;  3GQ8 A;  5C1E A;  2DCE A;  2JVG A;  2LRD A;  1LFP A;  3SZG A;  3ZXS A;  2CH0 A;  4E7S A;  4Y33 A;  3W2A A;  4JMQ A;  4TKO B;  4BE1 A;  2VQL A;  2XF5 A;  4BJ6 C;  3BCB A;  3HC7 A;  4XLE A;  3IAM 2;  1OGM X;  1O88 A;  3OS0 A;  1PXZ A;  3EUA A;  3UNG C;  2XZO A;  1IDJ A;  2LOO A;  4G7W A;  4DK0 A;  3HPG A;  3JUR A;  2HZD A;  4R79 A;  1D1B A;  2CV1 A;  3FKJ A;  3DLA A;  2ZZE A;  1BLI A;  3ZPN A;  4ZDP A;  1G8X A;  4BU2 A;  2KRC A;  3BLY A;  3SDB A;  4E7I A;  3DKY A;  2R7W A;  3GQ9 A;  4BS9 A;  1QHH D;  3IUO A;  3OEH A;  2XOK A;  1EE6 A;  4ANJ A;  3A3B A;  2RRE A;  4RLQ A;  4E7H A;  1HA8 A;  5AMV A;  2R7O A;  2RQQ A;  3VYR B;  2WAF A;  1H80 A;  3KX2 A;  5FRN A;  4BE2 A;  1RWR A;  1LDK B;  1DGR M;  2UV1 A;  3H5N A;  3DPU A;  4B47 A;  4BQO A;  4CCM A;  3OS2 A;  3SUC A;  3OYL A;  1FMV A;  3SEZ A;  3OYB A;  1H8E A;  1H8H A;  2MAB A;  1BR4 A;  3K70 D;  2L7K A;  4CCL A;  4ZTJ A;  2E60 A;  3W2W A;  4YXW A;  4E4H A;  3VYU B;  3GVK A;  4PFO A;  1UG0 A;  2V1N A;  2GJP A;  3BH4 A;  1UD2 A;  4NNJ A;  4B43 A;  3PNV A;  1IB4 A;  4PUS A;  4E0F A;  4U49 A;  4E6K G;  3GQ7 A;  4BEH A;  3EUH C;  4DBR A;  1BN8 A;  2KQR A;  3PNT A;  4ZJZ A;  3OOU A;  2IGK A;  2VXD A;  4RMN A;  1OLT A;  3B8Y A;  4W8Q A;  3HKZ A;  2X6Y A;  4KIT B;  2W7N A;  3BC9 A;  1O8D A;  4B48 A;  1N78 A;  1Z7L A;  2WAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...