1O8GA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with 5mm ca2+
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
352
structure length
352
Chain Sequence
b'ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 135
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8gA00
2NT6A 3VSTA 4OJ6A 1O88A 1OOCA 1IDKA 2BSPA 4XONA 4XORA 1IB4A 4XQFA 4YZ0A 4XLFA 2PYHA 4XOPA 2IQ7A 2VBEA 3WWGA 2ODLA 3ZSCA 1O8MA 2QXZA 1AIRA 1O8JA 1O8FA 2Z8GA 1JRGA 2O1DA 1OFMA 4OJLA 4MR0A 1KCCA 1NHCA 1XG2A 3FY3A 4NK8A 1GQ8A 2NSPA 4YZAA 4XN3A 2NTPA 1OGOX 1RMGA 3B4NA 4XLCA 2UVEA 2X3HA 4URRA 3VSUA 2X6XA 4YEJA 3GQ9A 2O0VA 2O04A 1IA5A 4OJOA 4OJ5A 4W8RA 2VJJA 4YELA 2VBKA 2INUA 1EE6A 1DBOA 4Z06A 4NK6A 1X0CA 4XOTA 3VMVA 3GQ7A 2INVA 4XNFA 1DBGA 3B90A 4XMYA 1O8HA 1WMRA 4XN0A 1O8IA 4W8SA 1RWRA 2UVFA 3GRHA 1OGMX 2NTBA 3B8YA 2O0WA 2EWEA 4XKVA 1O8GA 4I84A 2QX3A 2VBMA 1PLUA 4W8TA 3JURA 4OZZA 4PMHA 3SUCA 3EQNA 5C1EA 1O8EA 2QY1A 1QCXA 2NT9A 4XLEA 3VMWA 4XLAA 4OJPA 2VJIA 1IDJA 4YZXA 1O8DA 1PXZA 3T9GA 4EW9A 1CZFA 4Z05A 1H80A 4XM3A 1K5CA 1RU4A 1KCDA 2O17A 2PECA 1BHEA 3KRGA 3VSVA 4XL9A 5C1CA 4Z03A 3ZPPA 4C2LA 1O8LA 3EQOA 2X6WA 4OZYA 4U49A 2NSTA 5AMVA 1KTWA 4U4BA 4W8QA 4AVZA 1PE9A 1HG8A 4XKWA 3UW0A 2X6YA 4HWVA 4YZQA 2NZMA 1JTAA 1O8KA 4XLHA 1QJVA 2X85A 1OFLA 2NTQA 1VBLA 3GQAA 3GQ8A 2PYGA 1BN8A 4MXNA 3LMWA 4XR6A
chains in the Genus database with same CATH superfamily
2NT6A 2VFNA 3VSTA 1K4ZA 2VFQA 4OJ6A 1O88A 2G0YA 1OOCA 1IDKA 2BSPA 4XONA 4XORA 1IB4A 4XQFA 4YZ0A 3SY2A 2QYUA 4XLFA 2PYHA 4XOPA 2IQ7A 2VBEA 3WWGA 2IOUG 2BM4A 2ODLA 3BH6B 3ZSCA 1O8MA 2QXZA 1AIRA 1O8JA 1O8FA 1LM1A 2Z8GA 1JRGA 2B0RA 2O1DA 1OFMA 3LYCA 4OJLA 4MR0A 5JLVC 1KCCA 1NHCA 1XG2A 1HF2A 3FY3A 2J8IA 4NK8A 1GQ8A 2NSPA 3NB2A 4YZAA 3ML3A 4XN3A 2YUHA 2BM5A 1QQ1A 2BM6A 2NTPA 2VFMA 2O6WA 2XTXA 3PETA 1OGOX 1RMGA 1LLZA 1EA0A 3B4NA 4XLCA 2UVEA 2X3HA 4URRA 3VSUA 2X6XA 4YEJA 3GQ9A 2XTWA 2O0VA 2O04A 1IA5A 4OJOA 4OJ5A 3BH7B 4W8RA 2VJJA 4KH3A 1KQ5A 2INUA 2VBKA 4YELA 1CLWA 1DBOA 1EE6A 4Z06A 3PSSA 2VFPA 1QA2A 1TYWA 4NK6A 1X0CA 4XOTA 3VMVA 3GQ7A 2INVA 4XNFA 1DBGA 3B90A 3AK5A 2XT2A 4XMYA 1O8HA 1WMRA 4JRAC 4XN0A 2QZAA 1O8IA 1TYXA 3DU1X 1RWRA 4W8SA 1DABA 2UVFA 3GRHA 2F3LA 2VFOA 1LLWA 1OGMX 1QRCA 2NTBA 1K8FA 3B8YA 2O0WA 2EWEA 4XKVA 1O8GA 4I84A 2QX3A 2VBMA 1PLUA 4W8TA 4OPWA 3JURA 4OZZA 1TYVA 4PMHA 1WXRA 1OFEA 3SUCA 3EQNA 1EZGA 2J8KA 2XT4A 1O8EA 5C1EA 2QY1A 1QCXA 2NT9A 4XLEA 3VMWA 4XLAA 4OJPA 2VJIA 1QRBA 4YCQA 3SZEA 1IDJA 4YZXA 1O8DA 3N6ZA 4YEIA 1PXZA 2W7ZA 3T9GA 1QA1A 3RIQA 4EW9A 1CZFA 4Z05A 1H80A 4XM3A 3SYJA 4YC5A 4YFOA 1K5CA 1RU4A 2XC1A 5DNSA 4OM9A 3N90A 1KCDA 2O17A 2BM7A 2PECA 2BX6A 1L1IA 1BHEA 3KRGA 3VSVA 4XL9A 5C1CA 3LJYA 4Z03A 3H09A 3P4GA 2XTYA 3JX8A 4YDTA 3ZPPA 4C2LA 1O8LA 3EQOA 1QA3A 3PSZA 2X6WA 4OZYA 4U49A 2NSTA 5AMVA 1KTWA 1OFDA 4U4BA 4W8QA 4AVZA 1PE9A 1HG8A 4XKWA 3UW0A 2X6YA 2V5IA 4HWVA 4YZQA 2NZMA 1JTAA 1O8KA 4XLHA 1QJVA 2X85A 3NAWA 1OFLA 2NTQA 3SQVA 1VBLA 3GQAA 3GQ8A 2PYGA 1TSPA 5JMCB 1BN8A 4MXNA 1TYUA 3LMWA 3TH0A 4XR6A 4V02C
chains in the Genus database with same CATH topology
2NT6A 3VSTA 4OJ6A 1O88A 1OOCA 1IDKA 2BSPA 4XONA 4XORA 1IB4A 4XQFA 4YZ0A 4XLFA 2PYHA 4XOPA 2IQ7A 2VBEA 3WWGA 2ODLA 3ZSCA 1O8MA 2QXZA 1AIRA 1O8JA 1O8FA 2Z8GA 1JRGA 2O1DA 1OFMA 4OJLA 4MR0A 1KCCA 1NHCA 1XG2A 3FY3A 4NK8A 1GQ8A 2NSPA 4YZAA 4XN3A 2NTPA 1OGOX 1RMGA 3B4NA 4XLCA 2UVEA 2X3HA 4URRA 3VSUA 2X6XA 4YEJA 3GQ9A 2O0VA 2O04A 1IA5A 4OJOA 4OJ5A 4W8RA 2VJJA 4YELA 2VBKA 2INUA 1EE6A 1DBOA 4Z06A 4NK6A 1X0CA 4XOTA 3VMVA 3GQ7A 2INVA 4XNFA 1DBGA 3B90A 4XMYA 1O8HA 1WMRA 4XN0A 1O8IA 4W8SA 1RWRA 2UVFA 3GRHA 1OGMX 2NTBA 3B8YA 2O0WA 2EWEA 4XKVA 1O8GA 4I84A 2QX3A 2VBMA 1PLUA 4W8TA 3JURA 4OZZA 4PMHA 3SUCA 3EQNA 5C1EA 1O8EA 2QY1A 1QCXA 2NT9A 4XLEA 3VMWA 4XLAA 4OJPA 2VJIA 1IDJA 4YZXA 1O8DA 1PXZA 3T9GA 4EW9A 1CZFA 4Z05A 1H80A 4XM3A 1K5CA 1RU4A 1KCDA 2O17A 2PECA 1BHEA 3KRGA 3VSVA 4XL9A 5C1CA 4Z03A 3ZPPA 4C2LA 1O8LA 3EQOA 2X6WA 4OZYA 4U49A 2NSTA 5AMVA 1KTWA 4U4BA 4W8QA 4AVZA 1PE9A 1HG8A 4XKWA 3UW0A 2X6YA 4HWVA 4YZQA 2NZMA 1JTAA 1O8KA 4XLHA 1QJVA 2X85A 1OFLA 2NTQA 1VBLA 3GQAA 3GQ8A 2PYGA 1BN8A 4MXNA 3LMWA 4XR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NT6 A;  3VST A;  4OJ6 A;  1O88 A;  1OOC A;  1IDK A;  2BSP A;  4XON A;  4XOR A;  1IB4 A;  4XQF A;  4YZ0 A;  4XLF A;  2PYH A;  4XOP A;  2IQ7 A;  2VBE A;  3WWG A;  2ODL A;  3ZSC A;  1O8M A;  2QXZ A;  1AIR A;  1O8J A;  1O8F A;  2Z8G A;  1JRG A;  2O1D A;  1OFM A;  4OJL A;  4MR0 A;  1KCC A;  1NHC A;  1XG2 A;  3FY3 A;  4NK8 A;  1GQ8 A;  2NSP A;  4YZA A;  4XN3 A;  2NTP A;  1OGO X;  1RMG A;  3B4N A;  4XLC A;  2UVE A;  2X3H A;  4URR A;  3VSU A;  2X6X A;  4YEJ A;  3GQ9 A;  2O0V A;  2O04 A;  1IA5 A;  4OJO A;  4OJ5 A;  4W8R A;  2VJJ A;  4YEL A;  2VBK A;  2INU A;  1EE6 A;  1DBO A;  4Z06 A;  4NK6 A;  1X0C A;  4XOT A;  3VMV A;  3GQ7 A;  2INV A;  4XNF A;  1DBG A;  3B90 A;  4XMY A;  1O8H A;  1WMR A;  4XN0 A;  1O8I A;  4W8S A;  1RWR A;  2UVF A;  3GRH A;  1OGM X;  2NTB A;  3B8Y A;  2O0W A;  2EWE A;  4XKV A;  1O8G A;  4I84 A;  2QX3 A;  2VBM A;  1PLU A;  4W8T A;  3JUR A;  4OZZ A;  4PMH A;  3SUC A;  3EQN A;  5C1E A;  1O8E A;  2QY1 A;  1QCX A;  2NT9 A;  4XLE A;  3VMW A;  4XLA A;  4OJP A;  2VJI A;  1IDJ A;  4YZX A;  1O8D A;  1PXZ A;  3T9G A;  4EW9 A;  1CZF A;  4Z05 A;  1H80 A;  4XM3 A;  1K5C A;  1RU4 A;  1KCD A;  2O17 A;  2PEC A;  1BHE A;  3KRG A;  3VSV A;  4XL9 A;  5C1C A;  4Z03 A;  3ZPP A;  4C2L A;  1O8L A;  3EQO A;  2X6W A;  4OZY A;  4U49 A;  2NST A;  5AMV A;  1KTW A;  4U4B A;  4W8Q A;  4AVZ A;  1PE9 A;  1HG8 A;  4XKW A;  3UW0 A;  2X6Y A;  4HWV A;  4YZQ A;  2NZM A;  1JTA A;  1O8K A;  4XLH A;  1QJV A;  2X85 A;  1OFL A;  2NTQ A;  1VBL A;  3GQA A;  3GQ8 A;  2PYG A;  1BN8 A;  4MXN A;  3LMW A;  4XR6 A; 
#chains in the Genus database with same CATH topology
 2NT6 A;  2VFN A;  3VST A;  1K4Z A;  2VFQ A;  4OJ6 A;  1O88 A;  2G0Y A;  1OOC A;  1IDK A;  2BSP A;  4XON A;  4XOR A;  1IB4 A;  4XQF A;  4YZ0 A;  3SY2 A;  2QYU A;  4XLF A;  2PYH A;  4XOP A;  2IQ7 A;  2VBE A;  3WWG A;  2IOU G;  2BM4 A;  2ODL A;  3BH6 B;  3ZSC A;  1O8M A;  2QXZ A;  1AIR A;  1O8J A;  1O8F A;  1LM1 A;  2Z8G A;  1JRG A;  2B0R A;  2O1D A;  1OFM A;  3LYC A;  4OJL A;  4MR0 A;  5JLV C;  1KCC A;  1NHC A;  1XG2 A;  1HF2 A;  3FY3 A;  2J8I A;  4NK8 A;  1GQ8 A;  2NSP A;  3NB2 A;  4YZA A;  3ML3 A;  4XN3 A;  2YUH A;  2BM5 A;  1QQ1 A;  2BM6 A;  2NTP A;  2VFM A;  2O6W A;  2XTX A;  3PET A;  1OGO X;  1RMG A;  1LLZ A;  1EA0 A;  3B4N A;  4XLC A;  2UVE A;  2X3H A;  4URR A;  3VSU A;  2X6X A;  4YEJ A;  3GQ9 A;  2XTW A;  2O0V A;  2O04 A;  1IA5 A;  4OJO A;  4OJ5 A;  3BH7 B;  4W8R A;  2VJJ A;  4KH3 A;  1KQ5 A;  2INU A;  2VBK A;  4YEL A;  1CLW A;  1DBO A;  1EE6 A;  4Z06 A;  3PSS A;  2VFP A;  1QA2 A;  1TYW A;  4NK6 A;  1X0C A;  4XOT A;  3VMV A;  3GQ7 A;  2INV A;  4XNF A;  1DBG A;  3B90 A;  3AK5 A;  2XT2 A;  4XMY A;  1O8H A;  1WMR A;  4JRA C;  4XN0 A;  2QZA A;  1O8I A;  1TYX A;  3DU1 X;  1RWR A;  4W8S A;  1DAB A;  2UVF A;  3GRH A;  2F3L A;  2VFO A;  1LLW A;  1OGM X;  1QRC A;  2NTB A;  1K8F A;  3B8Y A;  2O0W A;  2EWE A;  4XKV A;  1O8G A;  4I84 A;  2QX3 A;  2VBM A;  1PLU A;  4W8T A;  4OPW A;  3JUR A;  4OZZ A;  1TYV A;  4PMH A;  1WXR A;  1OFE A;  3SUC A;  3EQN A;  1EZG A;  2J8K A;  2XT4 A;  1O8E A;  5C1E A;  2QY1 A;  1QCX A;  2NT9 A;  4XLE A;  3VMW A;  4XLA A;  4OJP A;  2VJI A;  1QRB A;  4YCQ A;  3SZE A;  1IDJ A;  4YZX A;  1O8D A;  3N6Z A;  4YEI A;  1PXZ A;  2W7Z A;  3T9G A;  1QA1 A;  3RIQ A;  4EW9 A;  1CZF A;  4Z05 A;  1H80 A;  4XM3 A;  3SYJ A;  4YC5 A;  4YFO A;  1K5C A;  1RU4 A;  2XC1 A;  5DNS A;  4OM9 A;  3N90 A;  1KCD A;  2O17 A;  2BM7 A;  2PEC A;  2BX6 A;  1L1I A;  1BHE A;  3KRG A;  3VSV A;  4XL9 A;  5C1C A;  3LJY A;  4Z03 A;  3H09 A;  3P4G A;  2XTY A;  3JX8 A;  4YDT A;  3ZPP A;  4C2L A;  1O8L A;  3EQO A;  1QA3 A;  3PSZ A;  2X6W A;  4OZY A;  4U49 A;  2NST A;  5AMV A;  1KTW A;  1OFD A;  4U4B A;  4W8Q A;  4AVZ A;  1PE9 A;  1HG8 A;  4XKW A;  3UW0 A;  2X6Y A;  2V5I A;  4HWV A;  4YZQ A;  2NZM A;  1JTA A;  1O8K A;  4XLH A;  1QJV A;  2X85 A;  3NAW A;  1OFL A;  2NTQ A;  3SQV A;  1VBL A;  3GQA A;  3GQ8 A;  2PYG A;  1TSP A;  5JMC B;  1BN8 A;  4MXN A;  1TYU A;  3LMW A;  3TH0 A;  4XR6 A;  4V02 C; 
#chains in the Genus database with same CATH homology
 2NT6 A;  3VST A;  4OJ6 A;  1O88 A;  1OOC A;  1IDK A;  2BSP A;  4XON A;  4XOR A;  1IB4 A;  4XQF A;  4YZ0 A;  4XLF A;  2PYH A;  4XOP A;  2IQ7 A;  2VBE A;  3WWG A;  2ODL A;  3ZSC A;  1O8M A;  2QXZ A;  1AIR A;  1O8J A;  1O8F A;  2Z8G A;  1JRG A;  2O1D A;  1OFM A;  4OJL A;  4MR0 A;  1KCC A;  1NHC A;  1XG2 A;  3FY3 A;  4NK8 A;  1GQ8 A;  2NSP A;  4YZA A;  4XN3 A;  2NTP A;  1OGO X;  1RMG A;  3B4N A;  4XLC A;  2UVE A;  2X3H A;  4URR A;  3VSU A;  2X6X A;  4YEJ A;  3GQ9 A;  2O0V A;  2O04 A;  1IA5 A;  4OJO A;  4OJ5 A;  4W8R A;  2VJJ A;  4YEL A;  2VBK A;  2INU A;  1EE6 A;  1DBO A;  4Z06 A;  4NK6 A;  1X0C A;  4XOT A;  3VMV A;  3GQ7 A;  2INV A;  4XNF A;  1DBG A;  3B90 A;  4XMY A;  1O8H A;  1WMR A;  4XN0 A;  1O8I A;  4W8S A;  1RWR A;  2UVF A;  3GRH A;  1OGM X;  2NTB A;  3B8Y A;  2O0W A;  2EWE A;  4XKV A;  1O8G A;  4I84 A;  2QX3 A;  2VBM A;  1PLU A;  4W8T A;  3JUR A;  4OZZ A;  4PMH A;  3SUC A;  3EQN A;  5C1E A;  1O8E A;  2QY1 A;  1QCX A;  2NT9 A;  4XLE A;  3VMW A;  4XLA A;  4OJP A;  2VJI A;  1IDJ A;  4YZX A;  1O8D A;  1PXZ A;  3T9G A;  4EW9 A;  1CZF A;  4Z05 A;  1H80 A;  4XM3 A;  1K5C A;  1RU4 A;  1KCD A;  2O17 A;  2PEC A;  1BHE A;  3KRG A;  3VSV A;  4XL9 A;  5C1C A;  4Z03 A;  3ZPP A;  4C2L A;  1O8L A;  3EQO A;  2X6W A;  4OZY A;  4U49 A;  2NST A;  5AMV A;  1KTW A;  4U4B A;  4W8Q A;  4AVZ A;  1PE9 A;  1HG8 A;  4XKW A;  3UW0 A;  2X6Y A;  4HWV A;  4YZQ A;  2NZM A;  1JTA A;  1O8K A;  4XLH A;  1QJV A;  2X85 A;  1OFL A;  2NTQ A;  1VBL A;  3GQA A;  3GQ8 A;  2PYG A;  1BN8 A;  4MXN A;  3LMW A;  4XR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...