1O8GA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with 5mm ca2+
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 135
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8gA00
1X0CA 4HWVA 2UVEA 2O1DA 1O88A 2QXZA 2NTBA 5C1CA 3KRGA 3GQAA 1AIRA 1O8GA 3FY3A 4NK6A 1BHEA 1OGOX 5AMVA 1DBOA 4AVZA 2VJIA 1O8DA 2NTQA 4OJOA 4YZQA 1NHCA 4PMHA 4XN3A 2NSPA 4YZAA 1IB4A 1QJVA 2PYGA 4XLAA 4XR6A 4XQFA 3GRHA 3B4NA 2X6WA 1WMRA 3VMWA 3T9GA 4URRA 1KTWA 1KCDA 4XOPA 4XKVA 3ZPPA 1HG8A 3JURA 2QX3A 3GQ8A 1O8FA 1OFLA 1PXZA 3WWGA 4MR0A 1OOCA 2NT6A 1JTAA 2NZMA 2X6YA 3SUCA 4XLCA 2VJJA 1BN8A 4OJLA 2BSPA 1RWRA 4I84A 2O04A 3VMVA 4C2LA 2NTPA 1O8HA 2ODLA 1GQ8A 1O8EA 2INUA 1IA5A 2PECA 1DBGA 4XORA 2Z8GA 3GQ7A 4XM3A 3UW0A 4Z05A 4XL9A 4YELA 4W8RA 1QCXA 1CZFA 4OZZA 1OFMA 3VSUA 3VSTA 1EE6A 4U49A 2X85A 3B90A 1JRGA 2UVFA 3EQOA 4XKWA 3GQ9A 1VBLA 2NSTA 4YZ0A 4XLFA 1IDKA 4OJ5A 2VBKA 4MXNA 4XLEA 4W8TA 1IDJA 1PLUA 2PYHA 4XONA 1OGMX 4U4BA 1XG2A 1O8KA 4OZYA 2O17A 3ZSCA 1RMGA 4OJPA 1K5CA 4XOTA 3LMWA 2VBMA 4Z03A 1O8IA 3EQNA 4XN0A 2INVA 2X6XA 4XNFA 4XMYA 2X3HA 4YEJA 1O8MA 4EW9A 4YZXA 1RU4A 4NK8A 4W8QA 2O0VA 5C1EA 4Z06A 2QY1A 2IQ7A 1H80A 4OJ6A 3VSVA 1KCCA 2EWEA 1PE9A 2O0WA 4XLHA 1O8LA 4W8SA 1O8JA 2NT9A 2VBEA 3B8YA
chains in the Genus database with same CATH superfamily
3ML3A 1X0CA 4HWVA 2UVEA 2QYUA 3N90A 1QA1A 2O1DA 1O88A 2QXZA 2VFOA 1TYWA 2NTBA 1TYXA 5C1CA 3KRGA 4YFOA 3GQAA 1AIRA 1O8GA 3FY3A 4NK6A 1BHEA 1OGOX 5JMCB 1K8FA 4JRAC 1DBOA 5AMVA 2IOUG 2VJIA 4AVZA 1O8DA 2NTQA 1TSPA 3PSSA 4OJOA 4YZQA 1DABA 4YC5A 1NHCA 4PMHA 4XN3A 1LLWA 1HF2A 2BX6A 2NSPA 2VFPA 3BH7B 4YZAA 4V02C 1IB4A 1QJVA 2PYGA 4XLAA 4XR6A 4XQFA 2W7ZA 3B4NA 1QRBA 3GRHA 2F3LA 1WMRA 1TYUA 2X6WA 3T9GA 3VMWA 2XTWA 4URRA 3SYJA 1KTWA 2J8KA 2VFNA 1KCDA 4XOPA 4XKVA 3ZPPA 1QRCA 1HG8A 3JURA 2QX3A 3GQ8A 1O8FA 1OFLA 1PXZA 3WWGA 2BM7A 4MR0A 1OOCA 2NT6A 1JTAA 3AK5A 2NZMA 3LYCA 2X6YA 3SUCA 4XLCA 2VJJA 1BN8A 3H09A 4OJLA 2BSPA 1RWRA 4I84A 2O04A 3VMVA 5DNSA 1TYVA 2NTPA 4C2LA 1O8HA 2ODLA 4XONA 1GQ8A 1O8EA 2INUA 1IA5A 2PECA 1DBGA 4OPWA 5JLVC 4XORA 1EA0A 2Z8GA 3GQ7A 4XM3A 3UW0A 4Z05A 4XL9A 4YELA 4W8RA 4KH3A 1LLZA 1QCXA 1QQ1A 1CZFA 4OZZA 1OFMA 2VFQA 3NB2A 2QZAA 3JX8A 3VSUA 3VSTA 1EE6A 4U49A 2X85A 2G0YA 1K4ZA 1JRGA 2UVFA 2XC1A 3B90A 3EQOA 3GQ9A 4XKWA 1VBLA 2NSTA 4YZ0A 4XLFA 3DU1X 1IDKA 1OFDA 4OJ5A 2VBKA 4MXNA 4XLEA 4W8TA 1IDJA 1PLUA 1LM1A 2PYHA 1OGMX 1CLWA 2XT4A 2YUHA 3LJYA 3N6ZA 4U4BA 3PETA 1XG2A 1O8KA 2BM5A 4OZYA 2O17A 2BM4A 3ZSCA 1RMGA 4OJPA 1K5CA 4XOTA 2B0RA 2XTXA 3LMWA 4OM9A 2J8IA 2VBMA 4Z03A 1OFEA 1O8IA 3EQNA 3P4GA 4XN0A 2INVA 2O6WA 2X6XA 3BH6B 4XNFA 2BM6A 3NAWA 1L1IA 2VFMA 4XMYA 2X3HA 4YEJA 1O8MA 3TH0A 4EW9A 3SQVA 1EZGA 4YZXA 3RIQA 1RU4A 4NK8A 4W8QA 4YDTA 2O0VA 5C1EA 3SZEA 3SY2A 2V5IA 4YEIA 4Z06A 2QY1A 2IQ7A 1KQ5A 1H80A 4OJ6A 3VSVA 1KCCA 2EWEA 1PE9A 1QA3A 2O0WA 3PSZA 4XLHA 4YCQA 1O8LA 1QA2A 2XT2A 1O8JA 4W8SA 1WXRA 2NT9A 2VBEA 3B8YA 2XTYA
chains in the Genus database with same CATH topology
1X0CA 4HWVA 2UVEA 2O1DA 1O88A 2QXZA 2NTBA 5C1CA 3KRGA 3GQAA 1AIRA 1O8GA 3FY3A 4NK6A 1BHEA 1OGOX 5AMVA 1DBOA 4AVZA 2VJIA 1O8DA 2NTQA 4OJOA 4YZQA 1NHCA 4PMHA 4XN3A 2NSPA 4YZAA 1IB4A 1QJVA 2PYGA 4XLAA 4XR6A 4XQFA 3GRHA 3B4NA 2X6WA 1WMRA 3VMWA 3T9GA 4URRA 1KTWA 1KCDA 4XOPA 4XKVA 3ZPPA 1HG8A 3JURA 2QX3A 3GQ8A 1O8FA 1OFLA 1PXZA 3WWGA 4MR0A 1OOCA 2NT6A 1JTAA 2NZMA 2X6YA 3SUCA 4XLCA 2VJJA 1BN8A 4OJLA 2BSPA 1RWRA 4I84A 2O04A 3VMVA 4C2LA 2NTPA 1O8HA 2ODLA 1GQ8A 1O8EA 2INUA 1IA5A 2PECA 1DBGA 4XORA 2Z8GA 3GQ7A 4XM3A 3UW0A 4Z05A 4XL9A 4YELA 4W8RA 1QCXA 1CZFA 4OZZA 1OFMA 3VSUA 3VSTA 1EE6A 4U49A 2X85A 3B90A 1JRGA 2UVFA 3EQOA 4XKWA 3GQ9A 1VBLA 2NSTA 4YZ0A 4XLFA 1IDKA 4OJ5A 2VBKA 4MXNA 4XLEA 4W8TA 1IDJA 1PLUA 2PYHA 4XONA 1OGMX 4U4BA 1XG2A 1O8KA 4OZYA 2O17A 3ZSCA 1RMGA 4OJPA 1K5CA 4XOTA 3LMWA 2VBMA 4Z03A 1O8IA 3EQNA 4XN0A 2INVA 2X6XA 4XNFA 4XMYA 2X3HA 4YEJA 1O8MA 4EW9A 4YZXA 1RU4A 4NK8A 4W8QA 2O0VA 5C1EA 4Z06A 2QY1A 2IQ7A 1H80A 4OJ6A 3VSVA 1KCCA 2EWEA 1PE9A 2O0WA 4XLHA 1O8LA 4W8SA 1O8JA 2NT9A 2VBEA 3B8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0C A;  4HWV A;  2UVE A;  2O1D A;  1O88 A;  2QXZ A;  2NTB A;  5C1C A;  3KRG A;  3GQA A;  1AIR A;  1O8G A;  3FY3 A;  4NK6 A;  1BHE A;  1OGO X;  5AMV A;  1DBO A;  4AVZ A;  2VJI A;  1O8D A;  2NTQ A;  4OJO A;  4YZQ A;  1NHC A;  4PMH A;  4XN3 A;  2NSP A;  4YZA A;  1IB4 A;  1QJV A;  2PYG A;  4XLA A;  4XR6 A;  4XQF A;  3GRH A;  3B4N A;  2X6W A;  1WMR A;  3VMW A;  3T9G A;  4URR A;  1KTW A;  1KCD A;  4XOP A;  4XKV A;  3ZPP A;  1HG8 A;  3JUR A;  2QX3 A;  3GQ8 A;  1O8F A;  1OFL A;  1PXZ A;  3WWG A;  4MR0 A;  1OOC A;  2NT6 A;  1JTA A;  2NZM A;  2X6Y A;  3SUC A;  4XLC A;  2VJJ A;  1BN8 A;  4OJL A;  2BSP A;  1RWR A;  4I84 A;  2O04 A;  3VMV A;  4C2L A;  2NTP A;  1O8H A;  2ODL A;  1GQ8 A;  1O8E A;  2INU A;  1IA5 A;  2PEC A;  1DBG A;  4XOR A;  2Z8G A;  3GQ7 A;  4XM3 A;  3UW0 A;  4Z05 A;  4XL9 A;  4YEL A;  4W8R A;  1QCX A;  1CZF A;  4OZZ A;  1OFM A;  3VSU A;  3VST A;  1EE6 A;  4U49 A;  2X85 A;  3B90 A;  1JRG A;  2UVF A;  3EQO A;  4XKW A;  3GQ9 A;  1VBL A;  2NST A;  4YZ0 A;  4XLF A;  1IDK A;  4OJ5 A;  2VBK A;  4MXN A;  4XLE A;  4W8T A;  1IDJ A;  1PLU A;  2PYH A;  4XON A;  1OGM X;  4U4B A;  1XG2 A;  1O8K A;  4OZY A;  2O17 A;  3ZSC A;  1RMG A;  4OJP A;  1K5C A;  4XOT A;  3LMW A;  2VBM A;  4Z03 A;  1O8I A;  3EQN A;  4XN0 A;  2INV A;  2X6X A;  4XNF A;  4XMY A;  2X3H A;  4YEJ A;  1O8M A;  4EW9 A;  4YZX A;  1RU4 A;  4NK8 A;  4W8Q A;  2O0V A;  5C1E A;  4Z06 A;  2QY1 A;  2IQ7 A;  1H80 A;  4OJ6 A;  3VSV A;  1KCC A;  2EWE A;  1PE9 A;  2O0W A;  4XLH A;  1O8L A;  4W8S A;  1O8J A;  2NT9 A;  2VBE A;  3B8Y A; 
#chains in the Genus database with same CATH topology
 3ML3 A;  1X0C A;  4HWV A;  2UVE A;  2QYU A;  3N90 A;  1QA1 A;  2O1D A;  1O88 A;  2QXZ A;  2VFO A;  1TYW A;  2NTB A;  1TYX A;  5C1C A;  3KRG A;  4YFO A;  3GQA A;  1AIR A;  1O8G A;  3FY3 A;  4NK6 A;  1BHE A;  1OGO X;  5JMC B;  1K8F A;  4JRA C;  1DBO A;  5AMV A;  2IOU G;  2VJI A;  4AVZ A;  1O8D A;  2NTQ A;  1TSP A;  3PSS A;  4OJO A;  4YZQ A;  1DAB A;  4YC5 A;  1NHC A;  4PMH A;  4XN3 A;  1LLW A;  1HF2 A;  2BX6 A;  2NSP A;  2VFP A;  3BH7 B;  4YZA A;  4V02 C;  1IB4 A;  1QJV A;  2PYG A;  4XLA A;  4XR6 A;  4XQF A;  2W7Z A;  3B4N A;  1QRB A;  3GRH A;  2F3L A;  1WMR A;  1TYU A;  2X6W A;  3T9G A;  3VMW A;  2XTW A;  4URR A;  3SYJ A;  1KTW A;  2J8K A;  2VFN A;  1KCD A;  4XOP A;  4XKV A;  3ZPP A;  1QRC A;  1HG8 A;  3JUR A;  2QX3 A;  3GQ8 A;  1O8F A;  1OFL A;  1PXZ A;  3WWG A;  2BM7 A;  4MR0 A;  1OOC A;  2NT6 A;  1JTA A;  3AK5 A;  2NZM A;  3LYC A;  2X6Y A;  3SUC A;  4XLC A;  2VJJ A;  1BN8 A;  3H09 A;  4OJL A;  2BSP A;  1RWR A;  4I84 A;  2O04 A;  3VMV A;  5DNS A;  1TYV A;  2NTP A;  4C2L A;  1O8H A;  2ODL A;  4XON A;  1GQ8 A;  1O8E A;  2INU A;  1IA5 A;  2PEC A;  1DBG A;  4OPW A;  5JLV C;  4XOR A;  1EA0 A;  2Z8G A;  3GQ7 A;  4XM3 A;  3UW0 A;  4Z05 A;  4XL9 A;  4YEL A;  4W8R A;  4KH3 A;  1LLZ A;  1QCX A;  1QQ1 A;  1CZF A;  4OZZ A;  1OFM A;  2VFQ A;  3NB2 A;  2QZA A;  3JX8 A;  3VSU A;  3VST A;  1EE6 A;  4U49 A;  2X85 A;  2G0Y A;  1K4Z A;  1JRG A;  2UVF A;  2XC1 A;  3B90 A;  3EQO A;  3GQ9 A;  4XKW A;  1VBL A;  2NST A;  4YZ0 A;  4XLF A;  3DU1 X;  1IDK A;  1OFD A;  4OJ5 A;  2VBK A;  4MXN A;  4XLE A;  4W8T A;  1IDJ A;  1PLU A;  1LM1 A;  2PYH A;  1OGM X;  1CLW A;  2XT4 A;  2YUH A;  3LJY A;  3N6Z A;  4U4B A;  3PET A;  1XG2 A;  1O8K A;  2BM5 A;  4OZY A;  2O17 A;  2BM4 A;  3ZSC A;  1RMG A;  4OJP A;  1K5C A;  4XOT A;  2B0R A;  2XTX A;  3LMW A;  4OM9 A;  2J8I A;  2VBM A;  4Z03 A;  1OFE A;  1O8I A;  3EQN A;  3P4G A;  4XN0 A;  2INV A;  2O6W A;  2X6X A;  3BH6 B;  4XNF A;  2BM6 A;  3NAW A;  1L1I A;  2VFM A;  4XMY A;  2X3H A;  4YEJ A;  1O8M A;  3TH0 A;  4EW9 A;  3SQV A;  1EZG A;  4YZX A;  3RIQ A;  1RU4 A;  4NK8 A;  4W8Q A;  4YDT A;  2O0V A;  5C1E A;  3SZE A;  3SY2 A;  2V5I A;  4YEI A;  4Z06 A;  2QY1 A;  2IQ7 A;  1KQ5 A;  1H80 A;  4OJ6 A;  3VSV A;  1KCC A;  2EWE A;  1PE9 A;  1QA3 A;  2O0W A;  3PSZ A;  4XLH A;  4YCQ A;  1O8L A;  1QA2 A;  2XT2 A;  1O8J A;  4W8S A;  1WXR A;  2NT9 A;  2VBE A;  3B8Y A;  2XTY A; 
#chains in the Genus database with same CATH homology
 1X0C A;  4HWV A;  2UVE A;  2O1D A;  1O88 A;  2QXZ A;  2NTB A;  5C1C A;  3KRG A;  3GQA A;  1AIR A;  1O8G A;  3FY3 A;  4NK6 A;  1BHE A;  1OGO X;  5AMV A;  1DBO A;  4AVZ A;  2VJI A;  1O8D A;  2NTQ A;  4OJO A;  4YZQ A;  1NHC A;  4PMH A;  4XN3 A;  2NSP A;  4YZA A;  1IB4 A;  1QJV A;  2PYG A;  4XLA A;  4XR6 A;  4XQF A;  3GRH A;  3B4N A;  2X6W A;  1WMR A;  3VMW A;  3T9G A;  4URR A;  1KTW A;  1KCD A;  4XOP A;  4XKV A;  3ZPP A;  1HG8 A;  3JUR A;  2QX3 A;  3GQ8 A;  1O8F A;  1OFL A;  1PXZ A;  3WWG A;  4MR0 A;  1OOC A;  2NT6 A;  1JTA A;  2NZM A;  2X6Y A;  3SUC A;  4XLC A;  2VJJ A;  1BN8 A;  4OJL A;  2BSP A;  1RWR A;  4I84 A;  2O04 A;  3VMV A;  4C2L A;  2NTP A;  1O8H A;  2ODL A;  1GQ8 A;  1O8E A;  2INU A;  1IA5 A;  2PEC A;  1DBG A;  4XOR A;  2Z8G A;  3GQ7 A;  4XM3 A;  3UW0 A;  4Z05 A;  4XL9 A;  4YEL A;  4W8R A;  1QCX A;  1CZF A;  4OZZ A;  1OFM A;  3VSU A;  3VST A;  1EE6 A;  4U49 A;  2X85 A;  3B90 A;  1JRG A;  2UVF A;  3EQO A;  4XKW A;  3GQ9 A;  1VBL A;  2NST A;  4YZ0 A;  4XLF A;  1IDK A;  4OJ5 A;  2VBK A;  4MXN A;  4XLE A;  4W8T A;  1IDJ A;  1PLU A;  2PYH A;  4XON A;  1OGM X;  4U4B A;  1XG2 A;  1O8K A;  4OZY A;  2O17 A;  3ZSC A;  1RMG A;  4OJP A;  1K5C A;  4XOT A;  3LMW A;  2VBM A;  4Z03 A;  1O8I A;  3EQN A;  4XN0 A;  2INV A;  2X6X A;  4XNF A;  4XMY A;  2X3H A;  4YEJ A;  1O8M A;  4EW9 A;  4YZX A;  1RU4 A;  4NK8 A;  4W8Q A;  2O0V A;  5C1E A;  4Z06 A;  2QY1 A;  2IQ7 A;  1H80 A;  4OJ6 A;  3VSV A;  1KCC A;  2EWE A;  1PE9 A;  2O0W A;  4XLH A;  1O8L A;  4W8S A;  1O8J A;  2NT9 A;  2VBE A;  3B8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...