1O8GA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with 5mm ca2+
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 135
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8gA00
4MR0A 1O8GA 1AIRA 2NSPA 2PECA 2NZMA 4W8SA 2O0WA 4XORA 4U49A 2NT9A 2QY1A 3SUCA 2X6XA 2X85A 4Z06A 2NT6A 2VJJA 1WMRA 1EE6A 3B90A 4XLCA 2NTPA 4YELA 4Z05A 4OJPA 1KCDA 1JRGA 2ODLA 4OJLA 1O8EA 4XMYA 1PLUA 2INUA 4I84A 4XM3A 5C1CA 3T9GA 1RMGA 1OFMA 3VMVA 2NTBA 4XQFA 4Z03A 1KCCA 1H80A 1CZFA 4XNFA 1NHCA 4XLEA 1HG8A 2Z8GA 1BHEA 3UW0A 2UVEA 1QCXA 1IA5A 3VSUA 2VJIA 4W8TA 4XKWA 1X0CA 1RWRA 1O8KA 2NTQA 4XLHA 1O8IA 2O0VA 1RU4A 4OJOA 4W8RA 4XKVA 1OOCA 2O1DA 1QJVA 2PYHA 5C1EA 1PXZA 4NK6A 3FY3A 4OJ6A 1K5CA 1O8JA 3WWGA 2IQ7A 4NK8A 1O8HA 1PE9A 1VBLA 4XONA 2UVFA 4XLFA 1JTAA 1O88A 1IB4A 4AVZA 2NSTA 3GQAA 4HWVA 1O8DA 4XL9A 1XG2A 2INVA 4XLAA 1O8LA 1GQ8A 3JURA 4U4BA 2PYGA 4PMHA 3VSTA 3B4NA 3VMWA 1KTWA 3VSVA 1IDJA 1DBOA 4EW9A 2O04A 1O8MA 3GQ7A 4YZAA 4XN0A 4C2LA 2O17A 1OGOX 3LMWA 2X3HA 1O8FA 2QX3A 3EQNA 4XOPA 3ZSCA 1OFLA 2QXZA 4YZQA 3GRHA 4XN3A 2VBMA 4YEJA 3KRGA 1DBGA 5AMVA 2X6YA 2EWEA 1OGMX 4OZYA 3B8YA 2BSPA 2X6WA 4XOTA 1IDKA 2VBKA 3EQOA 3GQ8A 4YZ0A 4MXNA 1BN8A 4OZZA 4XR6A 2VBEA 3ZPPA 4URRA 3GQ9A 4W8QA 4YZXA 4OJ5A
chains in the Genus database with same CATH superfamily
4MR0A 1O8GA 1AIRA 2NSPA 3P4GA 2PECA 2NZMA 2G0YA 3JX8A 1EZGA 1LM1A 4W8SA 2O0WA 4XLHA 4XORA 4U49A 2NT9A 2BM5A 2QY1A 3SUCA 2X6XA 2F3LA 2X85A 4Z06A 2NT6A 2VJJA 1WMRA 1EE6A 3B90A 4XLCA 2NTPA 4YELA 4Z05A 4OJPA 1KCDA 1JRGA 2ODLA 4OJLA 1O8EA 4XMYA 3BH7B 1PLUA 2INUA 4I84A 3N90A 3SY2A 4XM3A 5C1CA 3T9GA 1RMGA 2O6WA 3DU1X 1OFMA 3VMVA 1CLWA 2NTBA 2BM7A 4XQFA 4Z03A 1KCCA 1H80A 1CZFA 2XTYA 1EA0A 4XNFA 1NHCA 4XLEA 4OM9A 2BM6A 5DNSA 1HG8A 3RIQA 1K4ZA 1DABA 2Z8GA 1BHEA 2VFNA 3LYCA 3NAWA 3UW0A 1QA3A 2UVEA 1QCXA 1QRCA 1IA5A 3VSUA 2VJIA 1QA1A 4W8TA 4XKWA 1X0CA 1RWRA 3TH0A 1TSPA 1O8KA 2NTQA 2BM4A 2XC1A 1O8IA 2O0VA 1RU4A 4OJOA 4W8RA 4XKVA 1OOCA 1HF2A 2O1DA 1QJVA 2PYHA 5C1EA 1L1IA 2XT2A 1PXZA 4NK6A 2J8KA 3FY3A 4OJ6A 1K5CA 1O8JA 2XTWA 3WWGA 2IQ7A 4NK8A 2QZAA 1O8HA 2B0RA 4KH3A 1PE9A 1VBLA 4XONA 3SQVA 2UVFA 2J8IA 4XLFA 1JTAA 3PSSA 1O88A 1KQ5A 1IB4A 1OFEA 3LJYA 2W7ZA 4AVZA 2NSTA 3GQAA 4HWVA 1O8DA 4XL9A 2INVA 1XG2A 2BX6A 4XLAA 4YEIA 1O8LA 1TYXA 3PSZA 1GQ8A 3JURA 4U4BA 2PYGA 1QQ1A 2YUHA 4PMHA 3VSTA 3B4NA 1QA2A 3VMWA 1KTWA 3PETA 4V02C 1IDJA 1DBOA 1QRBA 2O04A 3VSVA 4EW9A 1O8MA 3GQ7A 4YZAA 5JMCB 4XN0A 4C2LA 2O17A 1OGOX 3LMWA 2X3HA 2XTXA 1O8FA 1TYVA 2QX3A 3EQNA 4XOPA 1TYWA 1LLWA 4YCQA 3AK5A 3ZSCA 3SZEA 1OFLA 1TYUA 2QXZA 2VFMA 4YZQA 3GRHA 4XN3A 2QYUA 2VBMA 2VFOA 2XT4A 4YEJA 3N6ZA 3KRGA 1DBGA 3ML3A 5AMVA 2X6YA 3BH6B 2EWEA 1OGMX 4OZYA 1K8FA 1OFDA 3B8YA 2BSPA 4JRAC 2X6WA 4OPWA 4YFOA 3H09A 2IOUG 4XOTA 1IDKA 2VBKA 2V5IA 3EQOA 3GQ8A 4YC5A 4YZ0A 4MXNA 1BN8A 3SYJA 5JLVC 4OZZA 4XR6A 2VFQA 2VBEA 3ZPPA 3NB2A 1WXRA 4URRA 3GQ9A 2VFPA 4W8QA 4YDTA 4YZXA 4OJ5A 1LLZA
chains in the Genus database with same CATH topology
4MR0A 1O8GA 1AIRA 2NSPA 2PECA 2NZMA 4W8SA 2O0WA 4XORA 4U49A 2NT9A 2QY1A 3SUCA 2X6XA 2X85A 4Z06A 2NT6A 2VJJA 1WMRA 1EE6A 3B90A 4XLCA 2NTPA 4YELA 4Z05A 4OJPA 1KCDA 1JRGA 2ODLA 4OJLA 1O8EA 4XMYA 1PLUA 2INUA 4I84A 4XM3A 5C1CA 3T9GA 1RMGA 1OFMA 3VMVA 2NTBA 4XQFA 4Z03A 1KCCA 1H80A 1CZFA 4XNFA 1NHCA 4XLEA 1HG8A 2Z8GA 1BHEA 3UW0A 2UVEA 1QCXA 1IA5A 3VSUA 2VJIA 4W8TA 4XKWA 1X0CA 1RWRA 1O8KA 2NTQA 4XLHA 1O8IA 2O0VA 1RU4A 4OJOA 4W8RA 4XKVA 1OOCA 2O1DA 1QJVA 2PYHA 5C1EA 1PXZA 4NK6A 3FY3A 4OJ6A 1K5CA 1O8JA 3WWGA 2IQ7A 4NK8A 1O8HA 1PE9A 1VBLA 4XONA 2UVFA 4XLFA 1JTAA 1O88A 1IB4A 4AVZA 2NSTA 3GQAA 4HWVA 1O8DA 4XL9A 1XG2A 2INVA 4XLAA 1O8LA 1GQ8A 3JURA 4U4BA 2PYGA 4PMHA 3VSTA 3B4NA 3VMWA 1KTWA 3VSVA 1IDJA 1DBOA 4EW9A 2O04A 1O8MA 3GQ7A 4YZAA 4XN0A 4C2LA 2O17A 1OGOX 3LMWA 2X3HA 1O8FA 2QX3A 3EQNA 4XOPA 3ZSCA 1OFLA 2QXZA 4YZQA 3GRHA 4XN3A 2VBMA 4YEJA 3KRGA 1DBGA 5AMVA 2X6YA 2EWEA 1OGMX 4OZYA 3B8YA 2BSPA 2X6WA 4XOTA 1IDKA 2VBKA 3EQOA 3GQ8A 4YZ0A 4MXNA 1BN8A 4OZZA 4XR6A 2VBEA 3ZPPA 4URRA 3GQ9A 4W8QA 4YZXA 4OJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MR0 A;  1O8G A;  1AIR A;  2NSP A;  2PEC A;  2NZM A;  4W8S A;  2O0W A;  4XOR A;  4U49 A;  2NT9 A;  2QY1 A;  3SUC A;  2X6X A;  2X85 A;  4Z06 A;  2NT6 A;  2VJJ A;  1WMR A;  1EE6 A;  3B90 A;  4XLC A;  2NTP A;  4YEL A;  4Z05 A;  4OJP A;  1KCD A;  1JRG A;  2ODL A;  4OJL A;  1O8E A;  4XMY A;  1PLU A;  2INU A;  4I84 A;  4XM3 A;  5C1C A;  3T9G A;  1RMG A;  1OFM A;  3VMV A;  2NTB A;  4XQF A;  4Z03 A;  1KCC A;  1H80 A;  1CZF A;  4XNF A;  1NHC A;  4XLE A;  1HG8 A;  2Z8G A;  1BHE A;  3UW0 A;  2UVE A;  1QCX A;  1IA5 A;  3VSU A;  2VJI A;  4W8T A;  4XKW A;  1X0C A;  1RWR A;  1O8K A;  2NTQ A;  4XLH A;  1O8I A;  2O0V A;  1RU4 A;  4OJO A;  4W8R A;  4XKV A;  1OOC A;  2O1D A;  1QJV A;  2PYH A;  5C1E A;  1PXZ A;  4NK6 A;  3FY3 A;  4OJ6 A;  1K5C A;  1O8J A;  3WWG A;  2IQ7 A;  4NK8 A;  1O8H A;  1PE9 A;  1VBL A;  4XON A;  2UVF A;  4XLF A;  1JTA A;  1O88 A;  1IB4 A;  4AVZ A;  2NST A;  3GQA A;  4HWV A;  1O8D A;  4XL9 A;  1XG2 A;  2INV A;  4XLA A;  1O8L A;  1GQ8 A;  3JUR A;  4U4B A;  2PYG A;  4PMH A;  3VST A;  3B4N A;  3VMW A;  1KTW A;  3VSV A;  1IDJ A;  1DBO A;  4EW9 A;  2O04 A;  1O8M A;  3GQ7 A;  4YZA A;  4XN0 A;  4C2L A;  2O17 A;  1OGO X;  3LMW A;  2X3H A;  1O8F A;  2QX3 A;  3EQN A;  4XOP A;  3ZSC A;  1OFL A;  2QXZ A;  4YZQ A;  3GRH A;  4XN3 A;  2VBM A;  4YEJ A;  3KRG A;  1DBG A;  5AMV A;  2X6Y A;  2EWE A;  1OGM X;  4OZY A;  3B8Y A;  2BSP A;  2X6W A;  4XOT A;  1IDK A;  2VBK A;  3EQO A;  3GQ8 A;  4YZ0 A;  4MXN A;  1BN8 A;  4OZZ A;  4XR6 A;  2VBE A;  3ZPP A;  4URR A;  3GQ9 A;  4W8Q A;  4YZX A;  4OJ5 A; 
#chains in the Genus database with same CATH topology
 4MR0 A;  1O8G A;  1AIR A;  2NSP A;  3P4G A;  2PEC A;  2NZM A;  2G0Y A;  3JX8 A;  1EZG A;  1LM1 A;  4W8S A;  2O0W A;  4XLH A;  4XOR A;  4U49 A;  2NT9 A;  2BM5 A;  2QY1 A;  3SUC A;  2X6X A;  2F3L A;  2X85 A;  4Z06 A;  2NT6 A;  2VJJ A;  1WMR A;  1EE6 A;  3B90 A;  4XLC A;  2NTP A;  4YEL A;  4Z05 A;  4OJP A;  1KCD A;  1JRG A;  2ODL A;  4OJL A;  1O8E A;  4XMY A;  3BH7 B;  1PLU A;  2INU A;  4I84 A;  3N90 A;  3SY2 A;  4XM3 A;  5C1C A;  3T9G A;  1RMG A;  2O6W A;  3DU1 X;  1OFM A;  3VMV A;  1CLW A;  2NTB A;  2BM7 A;  4XQF A;  4Z03 A;  1KCC A;  1H80 A;  1CZF A;  2XTY A;  1EA0 A;  4XNF A;  1NHC A;  4XLE A;  4OM9 A;  2BM6 A;  5DNS A;  1HG8 A;  3RIQ A;  1K4Z A;  1DAB A;  2Z8G A;  1BHE A;  2VFN A;  3LYC A;  3NAW A;  3UW0 A;  1QA3 A;  2UVE A;  1QCX A;  1QRC A;  1IA5 A;  3VSU A;  2VJI A;  1QA1 A;  4W8T A;  4XKW A;  1X0C A;  1RWR A;  3TH0 A;  1TSP A;  1O8K A;  2NTQ A;  2BM4 A;  2XC1 A;  1O8I A;  2O0V A;  1RU4 A;  4OJO A;  4W8R A;  4XKV A;  1OOC A;  1HF2 A;  2O1D A;  1QJV A;  2PYH A;  5C1E A;  1L1I A;  2XT2 A;  1PXZ A;  4NK6 A;  2J8K A;  3FY3 A;  4OJ6 A;  1K5C A;  1O8J A;  2XTW A;  3WWG A;  2IQ7 A;  4NK8 A;  2QZA A;  1O8H A;  2B0R A;  4KH3 A;  1PE9 A;  1VBL A;  4XON A;  3SQV A;  2UVF A;  2J8I A;  4XLF A;  1JTA A;  3PSS A;  1O88 A;  1KQ5 A;  1IB4 A;  1OFE A;  3LJY A;  2W7Z A;  4AVZ A;  2NST A;  3GQA A;  4HWV A;  1O8D A;  4XL9 A;  2INV A;  1XG2 A;  2BX6 A;  4XLA A;  4YEI A;  1O8L A;  1TYX A;  3PSZ A;  1GQ8 A;  3JUR A;  4U4B A;  2PYG A;  1QQ1 A;  2YUH A;  4PMH A;  3VST A;  3B4N A;  1QA2 A;  3VMW A;  1KTW A;  3PET A;  4V02 C;  1IDJ A;  1DBO A;  1QRB A;  2O04 A;  3VSV A;  4EW9 A;  1O8M A;  3GQ7 A;  4YZA A;  5JMC B;  4XN0 A;  4C2L A;  2O17 A;  1OGO X;  3LMW A;  2X3H A;  2XTX A;  1O8F A;  1TYV A;  2QX3 A;  3EQN A;  4XOP A;  1TYW A;  1LLW A;  4YCQ A;  3AK5 A;  3ZSC A;  3SZE A;  1OFL A;  1TYU A;  2QXZ A;  2VFM A;  4YZQ A;  3GRH A;  4XN3 A;  2QYU A;  2VBM A;  2VFO A;  2XT4 A;  4YEJ A;  3N6Z A;  3KRG A;  1DBG A;  3ML3 A;  5AMV A;  2X6Y A;  3BH6 B;  2EWE A;  1OGM X;  4OZY A;  1K8F A;  1OFD A;  3B8Y A;  2BSP A;  4JRA C;  2X6W A;  4OPW A;  4YFO A;  3H09 A;  2IOU G;  4XOT A;  1IDK A;  2VBK A;  2V5I A;  3EQO A;  3GQ8 A;  4YC5 A;  4YZ0 A;  4MXN A;  1BN8 A;  3SYJ A;  5JLV C;  4OZZ A;  4XR6 A;  2VFQ A;  2VBE A;  3ZPP A;  3NB2 A;  1WXR A;  4URR A;  3GQ9 A;  2VFP A;  4W8Q A;  4YDT A;  4YZX A;  4OJ5 A;  1LLZ A; 
#chains in the Genus database with same CATH homology
 4MR0 A;  1O8G A;  1AIR A;  2NSP A;  2PEC A;  2NZM A;  4W8S A;  2O0W A;  4XOR A;  4U49 A;  2NT9 A;  2QY1 A;  3SUC A;  2X6X A;  2X85 A;  4Z06 A;  2NT6 A;  2VJJ A;  1WMR A;  1EE6 A;  3B90 A;  4XLC A;  2NTP A;  4YEL A;  4Z05 A;  4OJP A;  1KCD A;  1JRG A;  2ODL A;  4OJL A;  1O8E A;  4XMY A;  1PLU A;  2INU A;  4I84 A;  4XM3 A;  5C1C A;  3T9G A;  1RMG A;  1OFM A;  3VMV A;  2NTB A;  4XQF A;  4Z03 A;  1KCC A;  1H80 A;  1CZF A;  4XNF A;  1NHC A;  4XLE A;  1HG8 A;  2Z8G A;  1BHE A;  3UW0 A;  2UVE A;  1QCX A;  1IA5 A;  3VSU A;  2VJI A;  4W8T A;  4XKW A;  1X0C A;  1RWR A;  1O8K A;  2NTQ A;  4XLH A;  1O8I A;  2O0V A;  1RU4 A;  4OJO A;  4W8R A;  4XKV A;  1OOC A;  2O1D A;  1QJV A;  2PYH A;  5C1E A;  1PXZ A;  4NK6 A;  3FY3 A;  4OJ6 A;  1K5C A;  1O8J A;  3WWG A;  2IQ7 A;  4NK8 A;  1O8H A;  1PE9 A;  1VBL A;  4XON A;  2UVF A;  4XLF A;  1JTA A;  1O88 A;  1IB4 A;  4AVZ A;  2NST A;  3GQA A;  4HWV A;  1O8D A;  4XL9 A;  1XG2 A;  2INV A;  4XLA A;  1O8L A;  1GQ8 A;  3JUR A;  4U4B A;  2PYG A;  4PMH A;  3VST A;  3B4N A;  3VMW A;  1KTW A;  3VSV A;  1IDJ A;  1DBO A;  4EW9 A;  2O04 A;  1O8M A;  3GQ7 A;  4YZA A;  4XN0 A;  4C2L A;  2O17 A;  1OGO X;  3LMW A;  2X3H A;  1O8F A;  2QX3 A;  3EQN A;  4XOP A;  3ZSC A;  1OFL A;  2QXZ A;  4YZQ A;  3GRH A;  4XN3 A;  2VBM A;  4YEJ A;  3KRG A;  1DBG A;  5AMV A;  2X6Y A;  2EWE A;  1OGM X;  4OZY A;  3B8Y A;  2BSP A;  2X6W A;  4XOT A;  1IDK A;  2VBK A;  3EQO A;  3GQ8 A;  4YZ0 A;  4MXN A;  1BN8 A;  4OZZ A;  4XR6 A;  2VBE A;  3ZPP A;  4URR A;  3GQ9 A;  4W8Q A;  4YZX A;  4OJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...