2NTPA

Crystal structure of pectin methylesterase in complex with hexasaccharide vi
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords Pectinesterase A
total genus 125
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2ntpA00
4C2LA 2NSTA 1OGMX 1O8GA 1QCXA 4XN0A 3GQ8A 1QJVA 1X0CA 4U4BA 3ZSCA 1PXZA 1CZFA 1AIRA 2EWEA 1O8HA 2X3HA 1WMRA 5AMVA 2INVA 2NT9A 1PE9A 4AVZA 4YZQA 1RWRA 1DBOA 1O8FA 2VJIA 4W8QA 1XG2A 3JURA 4Z05A 1EE6A 4XL9A 4YZXA 1IA5A 1OOCA 5C1EA 1IDJA 4XLEA 4YEJA 4I84A 1VBLA 2O0WA 1KCCA 3VSVA 2X85A 2X6YA 4OJPA 1K5CA 2O1DA 4XORA 1O8LA 4URRA 4XLHA 2NT6A 2VBMA 2O04A 2NZMA 3EQOA 3GQ7A 1O8EA 3GQ9A 3B4NA 3FY3A 4YELA 1O8MA 1O88A 4OZYA 2PECA 5C1CA 4Z03A 4MXNA 2VBEA 4XKVA 1OFLA 3SUCA 1O8KA 3WWGA 4OJLA 3EQNA 3ZPPA 4XNFA 4XQFA 1KTWA 1O8IA 2X6WA 2O0VA 2PYHA 3VSTA 4NK6A 2BSPA 2Z8GA 2ODLA 4HWVA 1RU4A 4XOTA 4XLAA 3LMWA 1JRGA 1BHEA 1GQ8A 4XLFA 3T9GA 3UW0A 1RMGA 4Z06A 2QX3A 1OGOX 2IQ7A 4XN3A 4XONA 1NHCA 1PLUA 2NTPA 2UVEA 1OFMA 4W8SA 4EW9A 3B90A 4W8RA 3GRHA 1IDKA 4XMYA 4XLCA 3VMWA 2NTQA 2PYGA 4OJOA 4YZAA 4MR0A 1IB4A 2VBKA 2INUA 3B8YA 3GQAA 1O8DA 4XR6A 3VMVA 1DBGA 4XKWA 4OJ6A 2O17A 2X6XA 3VSUA 2NSPA 2UVFA 4OJ5A 4XOPA 1H80A 3KRGA 2VJJA 4XM3A 1BN8A 2NTBA 2QXZA 2QY1A 1KCDA 4OZZA 4PMHA 4NK8A 1O8JA 4W8TA 1JTAA 4YZ0A 1HG8A 4U49A
chains in the Genus database with same CATH superfamily
4C2LA 3RIQA 2NSTA 2VFPA 1OGMX 1O8GA 1QCXA 1LLWA 4XN0A 2B0RA 3BH6B 3AK5A 3JX8A 3GQ8A 4OM9A 1QJVA 1X0CA 3PSZA 4U4BA 3ZSCA 1QA3A 1PXZA 1CZFA 3NAWA 4V02C 1AIRA 2EWEA 1O8HA 1TSPA 1WMRA 2X3HA 2XT4A 3BH7B 2W7ZA 5AMVA 2INVA 4YDTA 2NT9A 4OPWA 1PE9A 4AVZA 4YZQA 1QRCA 1RWRA 1DBOA 1K8FA 1O8FA 2VJIA 1XG2A 3JURA 2J8KA 4W8QA 4Z05A 1EE6A 4XL9A 2XTXA 4YZXA 2XC1A 1IA5A 1OOCA 5C1EA 1IDJA 1TYUA 2BM6A 4XLEA 4YEJA 3PETA 4I84A 3N90A 1VBLA 2O0WA 2VFQA 1KCCA 3NB2A 1QRBA 3VSVA 2J8IA 2X85A 2X6YA 4OJPA 1K5CA 2O1DA 4XORA 1O8LA 2BX6A 4URRA 4XLHA 1OFEA 2O6WA 2NT6A 2VBMA 2O04A 1L1IA 4YEIA 2NZMA 3EQOA 3N6ZA 3P4GA 3GQ7A 1O8EA 3GQ9A 3B4NA 2VFMA 1HF2A 2BM4A 3FY3A 4YELA 3SQVA 1O8MA 1O88A 4OZYA 2PECA 3PSSA 5DNSA 5C1CA 1EA0A 3SY2A 4Z03A 4MXNA 1CLWA 2VBEA 4XKVA 4JRAC 1KQ5A 1OFLA 3SUCA 1O8KA 3SYJA 3WWGA 4OJLA 3EQNA 3ZPPA 1QQ1A 2IOUG 4XNFA 4XQFA 1OFDA 1KTWA 1O8IA 2X6WA 2O0VA 2PYHA 3VSTA 4NK6A 2BSPA 2Z8GA 1DABA 2ODLA 2BM7A 1RU4A 4HWVA 4XLAA 4XOTA 3LMWA 1WXRA 1EZGA 3DU1X 1JRGA 1BHEA 1GQ8A 2BM5A 4XLFA 3T9GA 3UW0A 1RMGA 4Z06A 2QX3A 1OGOX 2IQ7A 4XN3A 4XONA 2G0YA 1NHCA 1PLUA 2NTPA 3ML3A 2UVEA 1OFMA 2VFNA 4W8SA 5JMCB 3H09A 4EW9A 3B90A 1QA2A 4KH3A 1K4ZA 3LJYA 3GRHA 4W8RA 1IDKA 1TYWA 4XMYA 4YCQA 3TH0A 4XLCA 3VMWA 5JLVC 2XT2A 2NTQA 2PYGA 1LM1A 1TYVA 2VFOA 4MR0A 4OJOA 2XTYA 2VBKA 4YZAA 1IB4A 2INUA 3B8YA 3GQAA 1O8DA 2QYUA 4XR6A 3VMVA 3LYCA 1DBGA 4XKWA 4OJ6A 2O17A 1LLZA 2X6XA 2V5IA 3VSUA 1QA1A 2F3LA 2NSPA 2UVFA 4OJ5A 4XOPA 4YFOA 1H80A 2QZAA 4YC5A 3SZEA 3KRGA 2VJJA 4XM3A 1BN8A 2NTBA 2QXZA 2QY1A 1KCDA 4OZZA 4PMHA 4NK8A 1O8JA 2XTWA 4W8TA 1JTAA 4YZ0A 2YUHA 1TYXA 1HG8A 4U49A
chains in the Genus database with same CATH topology
4C2LA 2NSTA 1OGMX 1O8GA 1QCXA 4XN0A 3GQ8A 1QJVA 1X0CA 4U4BA 3ZSCA 1PXZA 1CZFA 1AIRA 2EWEA 1O8HA 2X3HA 1WMRA 5AMVA 2INVA 2NT9A 1PE9A 4AVZA 4YZQA 1RWRA 1DBOA 1O8FA 2VJIA 4W8QA 1XG2A 3JURA 4Z05A 1EE6A 4XL9A 4YZXA 1IA5A 1OOCA 5C1EA 1IDJA 4XLEA 4YEJA 4I84A 1VBLA 2O0WA 1KCCA 3VSVA 2X85A 2X6YA 4OJPA 1K5CA 2O1DA 4XORA 1O8LA 4URRA 4XLHA 2NT6A 2VBMA 2O04A 2NZMA 3EQOA 3GQ7A 1O8EA 3GQ9A 3B4NA 3FY3A 4YELA 1O8MA 1O88A 4OZYA 2PECA 5C1CA 4Z03A 4MXNA 2VBEA 4XKVA 1OFLA 3SUCA 1O8KA 3WWGA 4OJLA 3EQNA 3ZPPA 4XNFA 4XQFA 1KTWA 1O8IA 2X6WA 2O0VA 2PYHA 3VSTA 4NK6A 2BSPA 2Z8GA 2ODLA 4HWVA 1RU4A 4XOTA 4XLAA 3LMWA 1JRGA 1BHEA 1GQ8A 4XLFA 3T9GA 3UW0A 1RMGA 4Z06A 2QX3A 1OGOX 2IQ7A 4XN3A 4XONA 1NHCA 1PLUA 2NTPA 2UVEA 1OFMA 4W8SA 4EW9A 3B90A 4W8RA 3GRHA 1IDKA 4XMYA 4XLCA 3VMWA 2NTQA 2PYGA 4OJOA 4YZAA 4MR0A 1IB4A 2VBKA 2INUA 3B8YA 3GQAA 1O8DA 4XR6A 3VMVA 1DBGA 4XKWA 4OJ6A 2O17A 2X6XA 3VSUA 2NSPA 2UVFA 4OJ5A 4XOPA 1H80A 3KRGA 2VJJA 4XM3A 1BN8A 2NTBA 2QXZA 2QY1A 1KCDA 4OZZA 4PMHA 4NK8A 1O8JA 4W8TA 1JTAA 4YZ0A 1HG8A 4U49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2L A;  2NST A;  1OGM X;  1O8G A;  1QCX A;  4XN0 A;  3GQ8 A;  1QJV A;  1X0C A;  4U4B A;  3ZSC A;  1PXZ A;  1CZF A;  1AIR A;  2EWE A;  1O8H A;  2X3H A;  1WMR A;  5AMV A;  2INV A;  2NT9 A;  1PE9 A;  4AVZ A;  4YZQ A;  1RWR A;  1DBO A;  1O8F A;  2VJI A;  4W8Q A;  1XG2 A;  3JUR A;  4Z05 A;  1EE6 A;  4XL9 A;  4YZX A;  1IA5 A;  1OOC A;  5C1E A;  1IDJ A;  4XLE A;  4YEJ A;  4I84 A;  1VBL A;  2O0W A;  1KCC A;  3VSV A;  2X85 A;  2X6Y A;  4OJP A;  1K5C A;  2O1D A;  4XOR A;  1O8L A;  4URR A;  4XLH A;  2NT6 A;  2VBM A;  2O04 A;  2NZM A;  3EQO A;  3GQ7 A;  1O8E A;  3GQ9 A;  3B4N A;  3FY3 A;  4YEL A;  1O8M A;  1O88 A;  4OZY A;  2PEC A;  5C1C A;  4Z03 A;  4MXN A;  2VBE A;  4XKV A;  1OFL A;  3SUC A;  1O8K A;  3WWG A;  4OJL A;  3EQN A;  3ZPP A;  4XNF A;  4XQF A;  1KTW A;  1O8I A;  2X6W A;  2O0V A;  2PYH A;  3VST A;  4NK6 A;  2BSP A;  2Z8G A;  2ODL A;  4HWV A;  1RU4 A;  4XOT A;  4XLA A;  3LMW A;  1JRG A;  1BHE A;  1GQ8 A;  4XLF A;  3T9G A;  3UW0 A;  1RMG A;  4Z06 A;  2QX3 A;  1OGO X;  2IQ7 A;  4XN3 A;  4XON A;  1NHC A;  1PLU A;  2NTP A;  2UVE A;  1OFM A;  4W8S A;  4EW9 A;  3B90 A;  4W8R A;  3GRH A;  1IDK A;  4XMY A;  4XLC A;  3VMW A;  2NTQ A;  2PYG A;  4OJO A;  4YZA A;  4MR0 A;  1IB4 A;  2VBK A;  2INU A;  3B8Y A;  3GQA A;  1O8D A;  4XR6 A;  3VMV A;  1DBG A;  4XKW A;  4OJ6 A;  2O17 A;  2X6X A;  3VSU A;  2NSP A;  2UVF A;  4OJ5 A;  4XOP A;  1H80 A;  3KRG A;  2VJJ A;  4XM3 A;  1BN8 A;  2NTB A;  2QXZ A;  2QY1 A;  1KCD A;  4OZZ A;  4PMH A;  4NK8 A;  1O8J A;  4W8T A;  1JTA A;  4YZ0 A;  1HG8 A;  4U49 A; 
#chains in the Genus database with same CATH topology
 4C2L A;  3RIQ A;  2NST A;  2VFP A;  1OGM X;  1O8G A;  1QCX A;  1LLW A;  4XN0 A;  2B0R A;  3BH6 B;  3AK5 A;  3JX8 A;  3GQ8 A;  4OM9 A;  1QJV A;  1X0C A;  3PSZ A;  4U4B A;  3ZSC A;  1QA3 A;  1PXZ A;  1CZF A;  3NAW A;  4V02 C;  1AIR A;  2EWE A;  1O8H A;  1TSP A;  1WMR A;  2X3H A;  2XT4 A;  3BH7 B;  2W7Z A;  5AMV A;  2INV A;  4YDT A;  2NT9 A;  4OPW A;  1PE9 A;  4AVZ A;  4YZQ A;  1QRC A;  1RWR A;  1DBO A;  1K8F A;  1O8F A;  2VJI A;  1XG2 A;  3JUR A;  2J8K A;  4W8Q A;  4Z05 A;  1EE6 A;  4XL9 A;  2XTX A;  4YZX A;  2XC1 A;  1IA5 A;  1OOC A;  5C1E A;  1IDJ A;  1TYU A;  2BM6 A;  4XLE A;  4YEJ A;  3PET A;  4I84 A;  3N90 A;  1VBL A;  2O0W A;  2VFQ A;  1KCC A;  3NB2 A;  1QRB A;  3VSV A;  2J8I A;  2X85 A;  2X6Y A;  4OJP A;  1K5C A;  2O1D A;  4XOR A;  1O8L A;  2BX6 A;  4URR A;  4XLH A;  1OFE A;  2O6W A;  2NT6 A;  2VBM A;  2O04 A;  1L1I A;  4YEI A;  2NZM A;  3EQO A;  3N6Z A;  3P4G A;  3GQ7 A;  1O8E A;  3GQ9 A;  3B4N A;  2VFM A;  1HF2 A;  2BM4 A;  3FY3 A;  4YEL A;  3SQV A;  1O8M A;  1O88 A;  4OZY A;  2PEC A;  3PSS A;  5DNS A;  5C1C A;  1EA0 A;  3SY2 A;  4Z03 A;  4MXN A;  1CLW A;  2VBE A;  4XKV A;  4JRA C;  1KQ5 A;  1OFL A;  3SUC A;  1O8K A;  3SYJ A;  3WWG A;  4OJL A;  3EQN A;  3ZPP A;  1QQ1 A;  2IOU G;  4XNF A;  4XQF A;  1OFD A;  1KTW A;  1O8I A;  2X6W A;  2O0V A;  2PYH A;  3VST A;  4NK6 A;  2BSP A;  2Z8G A;  1DAB A;  2ODL A;  2BM7 A;  1RU4 A;  4HWV A;  4XLA A;  4XOT A;  3LMW A;  1WXR A;  1EZG A;  3DU1 X;  1JRG A;  1BHE A;  1GQ8 A;  2BM5 A;  4XLF A;  3T9G A;  3UW0 A;  1RMG A;  4Z06 A;  2QX3 A;  1OGO X;  2IQ7 A;  4XN3 A;  4XON A;  2G0Y A;  1NHC A;  1PLU A;  2NTP A;  3ML3 A;  2UVE A;  1OFM A;  2VFN A;  4W8S A;  5JMC B;  3H09 A;  4EW9 A;  3B90 A;  1QA2 A;  4KH3 A;  1K4Z A;  3LJY A;  3GRH A;  4W8R A;  1IDK A;  1TYW A;  4XMY A;  4YCQ A;  3TH0 A;  4XLC A;  3VMW A;  5JLV C;  2XT2 A;  2NTQ A;  2PYG A;  1LM1 A;  1TYV A;  2VFO A;  4MR0 A;  4OJO A;  2XTY A;  2VBK A;  4YZA A;  1IB4 A;  2INU A;  3B8Y A;  3GQA A;  1O8D A;  2QYU A;  4XR6 A;  3VMV A;  3LYC A;  1DBG A;  4XKW A;  4OJ6 A;  2O17 A;  1LLZ A;  2X6X A;  2V5I A;  3VSU A;  1QA1 A;  2F3L A;  2NSP A;  2UVF A;  4OJ5 A;  4XOP A;  4YFO A;  1H80 A;  2QZA A;  4YC5 A;  3SZE A;  3KRG A;  2VJJ A;  4XM3 A;  1BN8 A;  2NTB A;  2QXZ A;  2QY1 A;  1KCD A;  4OZZ A;  4PMH A;  4NK8 A;  1O8J A;  2XTW A;  4W8T A;  1JTA A;  4YZ0 A;  2YUH A;  1TYX A;  1HG8 A;  4U49 A; 
#chains in the Genus database with same CATH homology
 4C2L A;  2NST A;  1OGM X;  1O8G A;  1QCX A;  4XN0 A;  3GQ8 A;  1QJV A;  1X0C A;  4U4B A;  3ZSC A;  1PXZ A;  1CZF A;  1AIR A;  2EWE A;  1O8H A;  2X3H A;  1WMR A;  5AMV A;  2INV A;  2NT9 A;  1PE9 A;  4AVZ A;  4YZQ A;  1RWR A;  1DBO A;  1O8F A;  2VJI A;  4W8Q A;  1XG2 A;  3JUR A;  4Z05 A;  1EE6 A;  4XL9 A;  4YZX A;  1IA5 A;  1OOC A;  5C1E A;  1IDJ A;  4XLE A;  4YEJ A;  4I84 A;  1VBL A;  2O0W A;  1KCC A;  3VSV A;  2X85 A;  2X6Y A;  4OJP A;  1K5C A;  2O1D A;  4XOR A;  1O8L A;  4URR A;  4XLH A;  2NT6 A;  2VBM A;  2O04 A;  2NZM A;  3EQO A;  3GQ7 A;  1O8E A;  3GQ9 A;  3B4N A;  3FY3 A;  4YEL A;  1O8M A;  1O88 A;  4OZY A;  2PEC A;  5C1C A;  4Z03 A;  4MXN A;  2VBE A;  4XKV A;  1OFL A;  3SUC A;  1O8K A;  3WWG A;  4OJL A;  3EQN A;  3ZPP A;  4XNF A;  4XQF A;  1KTW A;  1O8I A;  2X6W A;  2O0V A;  2PYH A;  3VST A;  4NK6 A;  2BSP A;  2Z8G A;  2ODL A;  4HWV A;  1RU4 A;  4XOT A;  4XLA A;  3LMW A;  1JRG A;  1BHE A;  1GQ8 A;  4XLF A;  3T9G A;  3UW0 A;  1RMG A;  4Z06 A;  2QX3 A;  1OGO X;  2IQ7 A;  4XN3 A;  4XON A;  1NHC A;  1PLU A;  2NTP A;  2UVE A;  1OFM A;  4W8S A;  4EW9 A;  3B90 A;  4W8R A;  3GRH A;  1IDK A;  4XMY A;  4XLC A;  3VMW A;  2NTQ A;  2PYG A;  4OJO A;  4YZA A;  4MR0 A;  1IB4 A;  2VBK A;  2INU A;  3B8Y A;  3GQA A;  1O8D A;  4XR6 A;  3VMV A;  1DBG A;  4XKW A;  4OJ6 A;  2O17 A;  2X6X A;  3VSU A;  2NSP A;  2UVF A;  4OJ5 A;  4XOP A;  1H80 A;  3KRG A;  2VJJ A;  4XM3 A;  1BN8 A;  2NTB A;  2QXZ A;  2QY1 A;  1KCD A;  4OZZ A;  4PMH A;  4NK8 A;  1O8J A;  4W8T A;  1JTA A;  4YZ0 A;  1HG8 A;  4U49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...