2NTPA

Crystal structure of pectin methylesterase in complex with hexasaccharide vi
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords Pectinesterase A
total genus 125
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2ntpA00
3VSVA 4EW9A 4XLCA 2EWEA 3VSUA 4PMHA 2IQ7A 2O1DA 4OZYA 2VBMA 1O8DA 1VBLA 4OZZA 1PXZA 3FY3A 4XLEA 4XLHA 2QY1A 2X3HA 2NSPA 2NTBA 3GQ7A 1QJVA 2VBEA 4Z06A 4MXNA 4W8TA 3GRHA 4XN3A 1RU4A 1RMGA 2X6YA 3JURA 4XNFA 1O8HA 4W8SA 1O88A 1WMRA 3ZSCA 4YZ0A 4YELA 5C1CA 1OFMA 1O8MA 2X6WA 1IB4A 1RWRA 2NTPA 3EQOA 2BSPA 4XLFA 1IDJA 4XOTA 4YZXA 1OFLA 2ODLA 1KTWA 4HWVA 3UW0A 1AIRA 4XKVA 4U4BA 4Z03A 4OJ5A 3T9GA 1CZFA 4XKWA 1BHEA 3ZPPA 2VJIA 4XORA 2X85A 4XLAA 1JRGA 1OGMX 4C2LA 1NHCA 1DBOA 1O8IA 3EQNA 2NT6A 1PLUA 1OOCA 1IA5A 1XG2A 3GQAA 3SUCA 3B4NA 1X0CA 3WWGA 4XQFA 5AMVA 3VSTA 2O04A 1PE9A 4XR6A 2X6XA 2NT9A 2INVA 1HG8A 2O17A 4OJLA 4W8QA 1KCCA 1O8JA 4XMYA 1KCDA 4NK8A 1O8LA 4U49A 1EE6A 4XONA 4YEJA 1H80A 1GQ8A 2NTQA 4I84A 2UVEA 3GQ8A 4XOPA 1OGOX 3VMWA 2UVFA 1JTAA 4NK6A 4OJ6A 2QX3A 4YZAA 1IDKA 4OJPA 2PECA 3KRGA 1BN8A 2NSTA 3GQ9A 2VBKA 1O8EA 4URRA 4OJOA 1DBGA 2Z8GA 3B90A 2O0VA 3LMWA 4Z05A 1O8FA 1O8GA 3B8YA 4YZQA 2QXZA 3VMVA 4XM3A 4XL9A 2PYHA 1QCXA 2VJJA 4W8RA 5C1EA 2INUA 1O8KA 2NZMA 2O0WA 4MR0A 4AVZA 1K5CA 4XN0A 2PYGA
chains in the Genus database with same CATH superfamily
3VSVA 1EZGA 4EW9A 4XLCA 2EWEA 3VSUA 4PMHA 2IQ7A 2O1DA 2VFMA 4OZYA 2VBMA 3PSSA 1O8DA 1VBLA 1EA0A 4OZZA 1LLZA 1PXZA 3ML3A 3FY3A 4XLEA 3BH7B 4XLHA 2QY1A 2X3HA 2B0RA 2NSPA 2NTBA 3DU1X 3GQ7A 1QJVA 2VBEA 4Z06A 4MXNA 4W8TA 1TYVA 3GRHA 3SZEA 4XN3A 1RU4A 4YDTA 1RMGA 2X6YA 3AK5A 4YFOA 2J8KA 3JURA 4XNFA 1O8HA 4W8SA 5JLVC 1L1IA 1O88A 1WMRA 3ZSCA 3NAWA 4YZ0A 4YELA 2XC1A 5C1CA 1OFMA 1O8MA 2X6WA 2XTYA 1IB4A 1LLWA 1RWRA 2NTPA 1QRBA 2BSPA 3EQOA 4XLFA 1IDJA 4V02C 3SYJA 4XOTA 4YZXA 4YEIA 1OFLA 2BM4A 1KTWA 2ODLA 4HWVA 4OPWA 2BM7A 3UW0A 1AIRA 4XKVA 1K4ZA 2XT2A 4U4BA 4Z03A 1QA3A 4OJ5A 3T9GA 1CZFA 4XKWA 1BHEA 3ZPPA 2VJIA 4XORA 2X85A 4XLAA 2YUHA 3TH0A 2BM5A 1OFDA 1WXRA 1JRGA 3P4GA 3PETA 1OGMX 4C2LA 2XT4A 1NHCA 1DBOA 1O8IA 3EQNA 2NT6A 4KH3A 1CLWA 3H09A 1PLUA 5DNSA 1OOCA 1TSPA 2QZAA 1IA5A 1XG2A 3GQAA 2W7ZA 3SUCA 3B4NA 1X0CA 2BM6A 3JX8A 4OM9A 3WWGA 4XQFA 2O6WA 5JMCB 2IOUG 5AMVA 3SY2A 2O04A 3VSTA 1PE9A 2V5IA 4XR6A 2X6XA 2VFQA 2NT9A 3LJYA 2INVA 1HG8A 2O17A 4OJLA 4W8QA 3LYCA 2F3LA 1O8JA 4XMYA 1KCCA 1KCDA 4NK8A 1O8LA 4U49A 1EE6A 1KQ5A 4XONA 1H80A 4YEJA 1QQ1A 3RIQA 3SQVA 1DABA 3N90A 3PSZA 1GQ8A 4YCQA 1QA1A 2NTQA 3BH6B 4I84A 2UVEA 3GQ8A 1LM1A 4XOPA 2QYUA 1OGOX 3VMWA 2UVFA 1JTAA 2VFPA 4NK6A 2J8IA 4OJ6A 2QX3A 4YZAA 1IDKA 4YC5A 1TYUA 4OJPA 2PECA 3KRGA 1BN8A 2NSTA 3GQ9A 1QRCA 1HF2A 1O8EA 2VBKA 4OJOA 4URRA 1DBGA 2BX6A 2G0YA 2Z8GA 2O0VA 3B90A 3LMWA 3N6ZA 4Z05A 3NB2A 1O8FA 1O8GA 3B8YA 1OFEA 2VFOA 4YZQA 1K8FA 2QXZA 3VMVA 4XM3A 4XL9A 1QA2A 2PYHA 1QCXA 2VJJA 4W8RA 5C1EA 2XTXA 2INUA 1O8KA 2NZMA 1TYWA 2VFNA 2O0WA 1TYXA 4MR0A 4AVZA 4JRAC 1K5CA 4XN0A 2PYGA 2XTWA
chains in the Genus database with same CATH topology
3VSVA 4EW9A 4XLCA 2EWEA 3VSUA 4PMHA 2IQ7A 2O1DA 4OZYA 2VBMA 1O8DA 1VBLA 4OZZA 1PXZA 3FY3A 4XLEA 4XLHA 2QY1A 2X3HA 2NSPA 2NTBA 3GQ7A 1QJVA 2VBEA 4Z06A 4MXNA 4W8TA 3GRHA 4XN3A 1RU4A 1RMGA 2X6YA 3JURA 4XNFA 1O8HA 4W8SA 1O88A 1WMRA 3ZSCA 4YZ0A 4YELA 5C1CA 1OFMA 1O8MA 2X6WA 1IB4A 1RWRA 2NTPA 3EQOA 2BSPA 4XLFA 1IDJA 4XOTA 4YZXA 1OFLA 2ODLA 1KTWA 4HWVA 3UW0A 1AIRA 4XKVA 4U4BA 4Z03A 4OJ5A 3T9GA 1CZFA 4XKWA 1BHEA 3ZPPA 2VJIA 4XORA 2X85A 4XLAA 1JRGA 1OGMX 4C2LA 1NHCA 1DBOA 1O8IA 3EQNA 2NT6A 1PLUA 1OOCA 1IA5A 1XG2A 3GQAA 3SUCA 3B4NA 1X0CA 3WWGA 4XQFA 5AMVA 3VSTA 2O04A 1PE9A 4XR6A 2X6XA 2NT9A 2INVA 1HG8A 2O17A 4OJLA 4W8QA 1KCCA 1O8JA 4XMYA 1KCDA 4NK8A 1O8LA 4U49A 1EE6A 4XONA 4YEJA 1H80A 1GQ8A 2NTQA 4I84A 2UVEA 3GQ8A 4XOPA 1OGOX 3VMWA 2UVFA 1JTAA 4NK6A 4OJ6A 2QX3A 4YZAA 1IDKA 4OJPA 2PECA 3KRGA 1BN8A 2NSTA 3GQ9A 2VBKA 1O8EA 4URRA 4OJOA 1DBGA 2Z8GA 3B90A 2O0VA 3LMWA 4Z05A 1O8FA 1O8GA 3B8YA 4YZQA 2QXZA 3VMVA 4XM3A 4XL9A 2PYHA 1QCXA 2VJJA 4W8RA 5C1EA 2INUA 1O8KA 2NZMA 2O0WA 4MR0A 4AVZA 1K5CA 4XN0A 2PYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSV A;  4EW9 A;  4XLC A;  2EWE A;  3VSU A;  4PMH A;  2IQ7 A;  2O1D A;  4OZY A;  2VBM A;  1O8D A;  1VBL A;  4OZZ A;  1PXZ A;  3FY3 A;  4XLE A;  4XLH A;  2QY1 A;  2X3H A;  2NSP A;  2NTB A;  3GQ7 A;  1QJV A;  2VBE A;  4Z06 A;  4MXN A;  4W8T A;  3GRH A;  4XN3 A;  1RU4 A;  1RMG A;  2X6Y A;  3JUR A;  4XNF A;  1O8H A;  4W8S A;  1O88 A;  1WMR A;  3ZSC A;  4YZ0 A;  4YEL A;  5C1C A;  1OFM A;  1O8M A;  2X6W A;  1IB4 A;  1RWR A;  2NTP A;  3EQO A;  2BSP A;  4XLF A;  1IDJ A;  4XOT A;  4YZX A;  1OFL A;  2ODL A;  1KTW A;  4HWV A;  3UW0 A;  1AIR A;  4XKV A;  4U4B A;  4Z03 A;  4OJ5 A;  3T9G A;  1CZF A;  4XKW A;  1BHE A;  3ZPP A;  2VJI A;  4XOR A;  2X85 A;  4XLA A;  1JRG A;  1OGM X;  4C2L A;  1NHC A;  1DBO A;  1O8I A;  3EQN A;  2NT6 A;  1PLU A;  1OOC A;  1IA5 A;  1XG2 A;  3GQA A;  3SUC A;  3B4N A;  1X0C A;  3WWG A;  4XQF A;  5AMV A;  3VST A;  2O04 A;  1PE9 A;  4XR6 A;  2X6X A;  2NT9 A;  2INV A;  1HG8 A;  2O17 A;  4OJL A;  4W8Q A;  1KCC A;  1O8J A;  4XMY A;  1KCD A;  4NK8 A;  1O8L A;  4U49 A;  1EE6 A;  4XON A;  4YEJ A;  1H80 A;  1GQ8 A;  2NTQ A;  4I84 A;  2UVE A;  3GQ8 A;  4XOP A;  1OGO X;  3VMW A;  2UVF A;  1JTA A;  4NK6 A;  4OJ6 A;  2QX3 A;  4YZA A;  1IDK A;  4OJP A;  2PEC A;  3KRG A;  1BN8 A;  2NST A;  3GQ9 A;  2VBK A;  1O8E A;  4URR A;  4OJO A;  1DBG A;  2Z8G A;  3B90 A;  2O0V A;  3LMW A;  4Z05 A;  1O8F A;  1O8G A;  3B8Y A;  4YZQ A;  2QXZ A;  3VMV A;  4XM3 A;  4XL9 A;  2PYH A;  1QCX A;  2VJJ A;  4W8R A;  5C1E A;  2INU A;  1O8K A;  2NZM A;  2O0W A;  4MR0 A;  4AVZ A;  1K5C A;  4XN0 A;  2PYG A; 
#chains in the Genus database with same CATH topology
 3VSV A;  1EZG A;  4EW9 A;  4XLC A;  2EWE A;  3VSU A;  4PMH A;  2IQ7 A;  2O1D A;  2VFM A;  4OZY A;  2VBM A;  3PSS A;  1O8D A;  1VBL A;  1EA0 A;  4OZZ A;  1LLZ A;  1PXZ A;  3ML3 A;  3FY3 A;  4XLE A;  3BH7 B;  4XLH A;  2QY1 A;  2X3H A;  2B0R A;  2NSP A;  2NTB A;  3DU1 X;  3GQ7 A;  1QJV A;  2VBE A;  4Z06 A;  4MXN A;  4W8T A;  1TYV A;  3GRH A;  3SZE A;  4XN3 A;  1RU4 A;  4YDT A;  1RMG A;  2X6Y A;  3AK5 A;  4YFO A;  2J8K A;  3JUR A;  4XNF A;  1O8H A;  4W8S A;  5JLV C;  1L1I A;  1O88 A;  1WMR A;  3ZSC A;  3NAW A;  4YZ0 A;  4YEL A;  2XC1 A;  5C1C A;  1OFM A;  1O8M A;  2X6W A;  2XTY A;  1IB4 A;  1LLW A;  1RWR A;  2NTP A;  1QRB A;  2BSP A;  3EQO A;  4XLF A;  1IDJ A;  4V02 C;  3SYJ A;  4XOT A;  4YZX A;  4YEI A;  1OFL A;  2BM4 A;  1KTW A;  2ODL A;  4HWV A;  4OPW A;  2BM7 A;  3UW0 A;  1AIR A;  4XKV A;  1K4Z A;  2XT2 A;  4U4B A;  4Z03 A;  1QA3 A;  4OJ5 A;  3T9G A;  1CZF A;  4XKW A;  1BHE A;  3ZPP A;  2VJI A;  4XOR A;  2X85 A;  4XLA A;  2YUH A;  3TH0 A;  2BM5 A;  1OFD A;  1WXR A;  1JRG A;  3P4G A;  3PET A;  1OGM X;  4C2L A;  2XT4 A;  1NHC A;  1DBO A;  1O8I A;  3EQN A;  2NT6 A;  4KH3 A;  1CLW A;  3H09 A;  1PLU A;  5DNS A;  1OOC A;  1TSP A;  2QZA A;  1IA5 A;  1XG2 A;  3GQA A;  2W7Z A;  3SUC A;  3B4N A;  1X0C A;  2BM6 A;  3JX8 A;  4OM9 A;  3WWG A;  4XQF A;  2O6W A;  5JMC B;  2IOU G;  5AMV A;  3SY2 A;  2O04 A;  3VST A;  1PE9 A;  2V5I A;  4XR6 A;  2X6X A;  2VFQ A;  2NT9 A;  3LJY A;  2INV A;  1HG8 A;  2O17 A;  4OJL A;  4W8Q A;  3LYC A;  2F3L A;  1O8J A;  4XMY A;  1KCC A;  1KCD A;  4NK8 A;  1O8L A;  4U49 A;  1EE6 A;  1KQ5 A;  4XON A;  1H80 A;  4YEJ A;  1QQ1 A;  3RIQ A;  3SQV A;  1DAB A;  3N90 A;  3PSZ A;  1GQ8 A;  4YCQ A;  1QA1 A;  2NTQ A;  3BH6 B;  4I84 A;  2UVE A;  3GQ8 A;  1LM1 A;  4XOP A;  2QYU A;  1OGO X;  3VMW A;  2UVF A;  1JTA A;  2VFP A;  4NK6 A;  2J8I A;  4OJ6 A;  2QX3 A;  4YZA A;  1IDK A;  4YC5 A;  1TYU A;  4OJP A;  2PEC A;  3KRG A;  1BN8 A;  2NST A;  3GQ9 A;  1QRC A;  1HF2 A;  1O8E A;  2VBK A;  4OJO A;  4URR A;  1DBG A;  2BX6 A;  2G0Y A;  2Z8G A;  2O0V A;  3B90 A;  3LMW A;  3N6Z A;  4Z05 A;  3NB2 A;  1O8F A;  1O8G A;  3B8Y A;  1OFE A;  2VFO A;  4YZQ A;  1K8F A;  2QXZ A;  3VMV A;  4XM3 A;  4XL9 A;  1QA2 A;  2PYH A;  1QCX A;  2VJJ A;  4W8R A;  5C1E A;  2XTX A;  2INU A;  1O8K A;  2NZM A;  1TYW A;  2VFN A;  2O0W A;  1TYX A;  4MR0 A;  4AVZ A;  4JRA C;  1K5C A;  4XN0 A;  2PYG A;  2XTW A; 
#chains in the Genus database with same CATH homology
 3VSV A;  4EW9 A;  4XLC A;  2EWE A;  3VSU A;  4PMH A;  2IQ7 A;  2O1D A;  4OZY A;  2VBM A;  1O8D A;  1VBL A;  4OZZ A;  1PXZ A;  3FY3 A;  4XLE A;  4XLH A;  2QY1 A;  2X3H A;  2NSP A;  2NTB A;  3GQ7 A;  1QJV A;  2VBE A;  4Z06 A;  4MXN A;  4W8T A;  3GRH A;  4XN3 A;  1RU4 A;  1RMG A;  2X6Y A;  3JUR A;  4XNF A;  1O8H A;  4W8S A;  1O88 A;  1WMR A;  3ZSC A;  4YZ0 A;  4YEL A;  5C1C A;  1OFM A;  1O8M A;  2X6W A;  1IB4 A;  1RWR A;  2NTP A;  3EQO A;  2BSP A;  4XLF A;  1IDJ A;  4XOT A;  4YZX A;  1OFL A;  2ODL A;  1KTW A;  4HWV A;  3UW0 A;  1AIR A;  4XKV A;  4U4B A;  4Z03 A;  4OJ5 A;  3T9G A;  1CZF A;  4XKW A;  1BHE A;  3ZPP A;  2VJI A;  4XOR A;  2X85 A;  4XLA A;  1JRG A;  1OGM X;  4C2L A;  1NHC A;  1DBO A;  1O8I A;  3EQN A;  2NT6 A;  1PLU A;  1OOC A;  1IA5 A;  1XG2 A;  3GQA A;  3SUC A;  3B4N A;  1X0C A;  3WWG A;  4XQF A;  5AMV A;  3VST A;  2O04 A;  1PE9 A;  4XR6 A;  2X6X A;  2NT9 A;  2INV A;  1HG8 A;  2O17 A;  4OJL A;  4W8Q A;  1KCC A;  1O8J A;  4XMY A;  1KCD A;  4NK8 A;  1O8L A;  4U49 A;  1EE6 A;  4XON A;  4YEJ A;  1H80 A;  1GQ8 A;  2NTQ A;  4I84 A;  2UVE A;  3GQ8 A;  4XOP A;  1OGO X;  3VMW A;  2UVF A;  1JTA A;  4NK6 A;  4OJ6 A;  2QX3 A;  4YZA A;  1IDK A;  4OJP A;  2PEC A;  3KRG A;  1BN8 A;  2NST A;  3GQ9 A;  2VBK A;  1O8E A;  4URR A;  4OJO A;  1DBG A;  2Z8G A;  3B90 A;  2O0V A;  3LMW A;  4Z05 A;  1O8F A;  1O8G A;  3B8Y A;  4YZQ A;  2QXZ A;  3VMV A;  4XM3 A;  4XL9 A;  2PYH A;  1QCX A;  2VJJ A;  4W8R A;  5C1E A;  2INU A;  1O8K A;  2NZM A;  2O0W A;  4MR0 A;  4AVZ A;  1K5C A;  4XN0 A;  2PYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...