2NTPA

Crystal structure of pectin methylesterase in complex with hexasaccharide vi
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 125
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2ntpA00
1QJVA 2NTBA 4MR0A 4XOPA 1KCCA 1OFLA 1HG8A 3B8YA 1NHCA 1X0CA 2O1DA 5AMVA 4I84A 1DBOA 2X6YA 2EWEA 3ZSCA 1IB4A 2IQ7A 2VJIA 2VBEA 2X85A 3JURA 4XLHA 2BSPA 2INUA 4EW9A 1OGOX 4Z06A 2QXZA 3B90A 3EQOA 4XLAA 3SUCA 4OJ5A 5C1CA 1OOCA 2NT9A 4XKVA 2O17A 2PECA 1O8DA 3EQNA 4XM3A 1RU4A 1EE6A 2NTPA 1O8LA 1VBLA 3B4NA 1CZFA 3KRGA 3LMWA 4HWVA 4XNFA 1O8EA 4C2LA 1KTWA 3UW0A 4Z03A 1O8KA 2NSTA 3VMWA 4U49A 2PYHA 2UVEA 4OZZA 4XL9A 2NT6A 3VSUA 2Z8GA 4W8RA 4XMYA 1IDKA 1O88A 2VBKA 4XLCA 4PMHA 2VJJA 2PYGA 4OJLA 4XKWA 1RMGA 3GRHA 4XN3A 3FY3A 5C1EA 2QY1A 4XN0A 2NZMA 1KCDA 4U4BA 1WMRA 1XG2A 4XR6A 2NSPA 3VSVA 3WWGA 1O8GA 1AIRA 4YZAA 4YZXA 4YZ0A 2VBMA 3GQ9A 2NTQA 1DBGA 4YEJA 4YELA 4OZYA 1RWRA 4Z05A 4XLFA 1GQ8A 2X6WA 1IDJA 4XONA 4OJ6A 2X3HA 1OFMA 3GQ8A 2O0VA 2X6XA 3ZPPA 2ODLA 1O8IA 3GQ7A 1PLUA 1JTAA 1IA5A 1O8HA 4OJPA 1QCXA 4XQFA 1PXZA 1O8FA 1BN8A 4OJOA 4XORA 4YZQA 2QX3A 4AVZA 4W8TA 3VMVA 1K5CA 4W8QA 3VSTA 1OGMX 4NK8A 2INVA 4MXNA 1O8MA 4NK6A 1BHEA 1JRGA 3GQAA 4XOTA 3T9GA 1H80A 1O8JA 4URRA 1PE9A 2O04A 4W8SA 2UVFA 2O0WA 4XLEA
chains in the Genus database with same CATH superfamily
3NB2A 1QJVA 2NTBA 4MR0A 2XC1A 4XOPA 2J8KA 1KCCA 1OFLA 1HG8A 2IOUG 3B8YA 1NHCA 1X0CA 2O1DA 5AMVA 4I84A 1DBOA 2X6YA 2EWEA 3RIQA 3ZSCA 1IB4A 2IQ7A 2VJIA 2VBEA 2X85A 1QQ1A 3JURA 4XLHA 2BSPA 4YFOA 3PSZA 2INUA 4EW9A 1OGOX 4Z06A 1LLZA 2QXZA 3B90A 3EQOA 4OPWA 4XLAA 2BM4A 4OJ5A 3SUCA 1QA1A 5C1CA 3H09A 2V5IA 1OOCA 1LM1A 3PSSA 2NT9A 4XKVA 2O17A 1EA0A 2PECA 1O8DA 3EQNA 3NAWA 1RU4A 4XM3A 1EE6A 2NTPA 1O8LA 1VBLA 3B4NA 1CZFA 3KRGA 3LMWA 4HWVA 4XNFA 3SZEA 1O8EA 5JMCB 1QA2A 4C2LA 1EZGA 1TYUA 1KTWA 3LJYA 2O6WA 3UW0A 4Z03A 3N90A 3BH7B 2VFMA 1O8KA 2NSTA 3VMWA 1QRBA 4U49A 2PYHA 2UVEA 4OZZA 4XL9A 2NT6A 3VSUA 1OFDA 2Z8GA 4W8RA 4XMYA 1OFEA 1IDKA 1O88A 2VBKA 3SQVA 4XLCA 4PMHA 2YUHA 2QYUA 2G0YA 2PYGA 2VJJA 4OJLA 4XKWA 3SYJA 1RMGA 2XT2A 3GRHA 4XN3A 3FY3A 4KH3A 5C1EA 2QY1A 1KQ5A 2NZMA 4XN0A 1KCDA 4U4BA 1WMRA 1XG2A 4XR6A 2NSPA 2XTXA 3SY2A 3N6ZA 1LLWA 3VSVA 1O8GA 3WWGA 1AIRA 4JRAC 2VFQA 4YZAA 4YZXA 4YZ0A 2VBMA 3GQ9A 2NTQA 2BX6A 2F3LA 3BH6B 1DBGA 3ML3A 4YEJA 4YCQA 4YELA 4OZYA 4V02C 2VFPA 1RWRA 2VFOA 4Z05A 2XTYA 3AK5A 4XLFA 1TYVA 1GQ8A 2W7ZA 2X6WA 2J8IA 1HF2A 1IDJA 4XONA 4OJ6A 2X3HA 1OFMA 3GQ8A 4OM9A 2O0VA 2X6XA 3ZPPA 2BM6A 2ODLA 1O8IA 3GQ7A 1PLUA 1JTAA 3JX8A 1IA5A 3TH0A 1O8HA 2QZAA 4OJPA 1QCXA 4XQFA 1PXZA 1QRCA 1DABA 1O8FA 2BM5A 1BN8A 4OJOA 4XORA 4YZQA 2QX3A 4AVZA 4W8TA 3VMVA 1K5CA 4W8QA 2BM7A 3P4GA 1L1IA 1WXRA 1CLWA 4YDTA 2VFNA 3VSTA 3LYCA 1TSPA 1OGMX 4NK8A 2B0RA 2INVA 4MXNA 5DNSA 5JLVC 2UVFA 1QA3A 1TYXA 1O8MA 4YC5A 3DU1X 2XTWA 4NK6A 1BHEA 1JRGA 3GQAA 4XOTA 1K8FA 3T9GA 1H80A 1TYWA 1O8JA 4URRA 1PE9A 2O04A 4W8SA 2XT4A 4YEIA 1K4ZA 2O0WA 3PETA 4XLEA
chains in the Genus database with same CATH topology
1QJVA 2NTBA 4MR0A 4XOPA 1KCCA 1OFLA 1HG8A 3B8YA 1NHCA 1X0CA 2O1DA 5AMVA 4I84A 1DBOA 2X6YA 2EWEA 3ZSCA 1IB4A 2IQ7A 2VJIA 2VBEA 2X85A 3JURA 4XLHA 2BSPA 2INUA 4EW9A 1OGOX 4Z06A 2QXZA 3B90A 3EQOA 4XLAA 3SUCA 4OJ5A 5C1CA 1OOCA 2NT9A 4XKVA 2O17A 2PECA 1O8DA 3EQNA 4XM3A 1RU4A 1EE6A 2NTPA 1O8LA 1VBLA 3B4NA 1CZFA 3KRGA 3LMWA 4HWVA 4XNFA 1O8EA 4C2LA 1KTWA 3UW0A 4Z03A 1O8KA 2NSTA 3VMWA 4U49A 2PYHA 2UVEA 4OZZA 4XL9A 2NT6A 3VSUA 2Z8GA 4W8RA 4XMYA 1IDKA 1O88A 2VBKA 4XLCA 4PMHA 2VJJA 2PYGA 4OJLA 4XKWA 1RMGA 3GRHA 4XN3A 3FY3A 5C1EA 2QY1A 4XN0A 2NZMA 1KCDA 4U4BA 1WMRA 1XG2A 4XR6A 2NSPA 3VSVA 3WWGA 1O8GA 1AIRA 4YZAA 4YZXA 4YZ0A 2VBMA 3GQ9A 2NTQA 1DBGA 4YEJA 4YELA 4OZYA 1RWRA 4Z05A 4XLFA 1GQ8A 2X6WA 1IDJA 4XONA 4OJ6A 2X3HA 1OFMA 3GQ8A 2O0VA 2X6XA 3ZPPA 2ODLA 1O8IA 3GQ7A 1PLUA 1JTAA 1IA5A 1O8HA 4OJPA 1QCXA 4XQFA 1PXZA 1O8FA 1BN8A 4OJOA 4XORA 4YZQA 2QX3A 4AVZA 4W8TA 3VMVA 1K5CA 4W8QA 3VSTA 1OGMX 4NK8A 2INVA 4MXNA 1O8MA 4NK6A 1BHEA 1JRGA 3GQAA 4XOTA 3T9GA 1H80A 1O8JA 4URRA 1PE9A 2O04A 4W8SA 2UVFA 2O0WA 4XLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJV A;  2NTB A;  4MR0 A;  4XOP A;  1KCC A;  1OFL A;  1HG8 A;  3B8Y A;  1NHC A;  1X0C A;  2O1D A;  5AMV A;  4I84 A;  1DBO A;  2X6Y A;  2EWE A;  3ZSC A;  1IB4 A;  2IQ7 A;  2VJI A;  2VBE A;  2X85 A;  3JUR A;  4XLH A;  2BSP A;  2INU A;  4EW9 A;  1OGO X;  4Z06 A;  2QXZ A;  3B90 A;  3EQO A;  4XLA A;  3SUC A;  4OJ5 A;  5C1C A;  1OOC A;  2NT9 A;  4XKV A;  2O17 A;  2PEC A;  1O8D A;  3EQN A;  4XM3 A;  1RU4 A;  1EE6 A;  2NTP A;  1O8L A;  1VBL A;  3B4N A;  1CZF A;  3KRG A;  3LMW A;  4HWV A;  4XNF A;  1O8E A;  4C2L A;  1KTW A;  3UW0 A;  4Z03 A;  1O8K A;  2NST A;  3VMW A;  4U49 A;  2PYH A;  2UVE A;  4OZZ A;  4XL9 A;  2NT6 A;  3VSU A;  2Z8G A;  4W8R A;  4XMY A;  1IDK A;  1O88 A;  2VBK A;  4XLC A;  4PMH A;  2VJJ A;  2PYG A;  4OJL A;  4XKW A;  1RMG A;  3GRH A;  4XN3 A;  3FY3 A;  5C1E A;  2QY1 A;  4XN0 A;  2NZM A;  1KCD A;  4U4B A;  1WMR A;  1XG2 A;  4XR6 A;  2NSP A;  3VSV A;  3WWG A;  1O8G A;  1AIR A;  4YZA A;  4YZX A;  4YZ0 A;  2VBM A;  3GQ9 A;  2NTQ A;  1DBG A;  4YEJ A;  4YEL A;  4OZY A;  1RWR A;  4Z05 A;  4XLF A;  1GQ8 A;  2X6W A;  1IDJ A;  4XON A;  4OJ6 A;  2X3H A;  1OFM A;  3GQ8 A;  2O0V A;  2X6X A;  3ZPP A;  2ODL A;  1O8I A;  3GQ7 A;  1PLU A;  1JTA A;  1IA5 A;  1O8H A;  4OJP A;  1QCX A;  4XQF A;  1PXZ A;  1O8F A;  1BN8 A;  4OJO A;  4XOR A;  4YZQ A;  2QX3 A;  4AVZ A;  4W8T A;  3VMV A;  1K5C A;  4W8Q A;  3VST A;  1OGM X;  4NK8 A;  2INV A;  4MXN A;  1O8M A;  4NK6 A;  1BHE A;  1JRG A;  3GQA A;  4XOT A;  3T9G A;  1H80 A;  1O8J A;  4URR A;  1PE9 A;  2O04 A;  4W8S A;  2UVF A;  2O0W A;  4XLE A; 
#chains in the Genus database with same CATH topology
 3NB2 A;  1QJV A;  2NTB A;  4MR0 A;  2XC1 A;  4XOP A;  2J8K A;  1KCC A;  1OFL A;  1HG8 A;  2IOU G;  3B8Y A;  1NHC A;  1X0C A;  2O1D A;  5AMV A;  4I84 A;  1DBO A;  2X6Y A;  2EWE A;  3RIQ A;  3ZSC A;  1IB4 A;  2IQ7 A;  2VJI A;  2VBE A;  2X85 A;  1QQ1 A;  3JUR A;  4XLH A;  2BSP A;  4YFO A;  3PSZ A;  2INU A;  4EW9 A;  1OGO X;  4Z06 A;  1LLZ A;  2QXZ A;  3B90 A;  3EQO A;  4OPW A;  4XLA A;  2BM4 A;  4OJ5 A;  3SUC A;  1QA1 A;  5C1C A;  3H09 A;  2V5I A;  1OOC A;  1LM1 A;  3PSS A;  2NT9 A;  4XKV A;  2O17 A;  1EA0 A;  2PEC A;  1O8D A;  3EQN A;  3NAW A;  1RU4 A;  4XM3 A;  1EE6 A;  2NTP A;  1O8L A;  1VBL A;  3B4N A;  1CZF A;  3KRG A;  3LMW A;  4HWV A;  4XNF A;  3SZE A;  1O8E A;  5JMC B;  1QA2 A;  4C2L A;  1EZG A;  1TYU A;  1KTW A;  3LJY A;  2O6W A;  3UW0 A;  4Z03 A;  3N90 A;  3BH7 B;  2VFM A;  1O8K A;  2NST A;  3VMW A;  1QRB A;  4U49 A;  2PYH A;  2UVE A;  4OZZ A;  4XL9 A;  2NT6 A;  3VSU A;  1OFD A;  2Z8G A;  4W8R A;  4XMY A;  1OFE A;  1IDK A;  1O88 A;  2VBK A;  3SQV A;  4XLC A;  4PMH A;  2YUH A;  2QYU A;  2G0Y A;  2PYG A;  2VJJ A;  4OJL A;  4XKW A;  3SYJ A;  1RMG A;  2XT2 A;  3GRH A;  4XN3 A;  3FY3 A;  4KH3 A;  5C1E A;  2QY1 A;  1KQ5 A;  2NZM A;  4XN0 A;  1KCD A;  4U4B A;  1WMR A;  1XG2 A;  4XR6 A;  2NSP A;  2XTX A;  3SY2 A;  3N6Z A;  1LLW A;  3VSV A;  1O8G A;  3WWG A;  1AIR A;  4JRA C;  2VFQ A;  4YZA A;  4YZX A;  4YZ0 A;  2VBM A;  3GQ9 A;  2NTQ A;  2BX6 A;  2F3L A;  3BH6 B;  1DBG A;  3ML3 A;  4YEJ A;  4YCQ A;  4YEL A;  4OZY A;  4V02 C;  2VFP A;  1RWR A;  2VFO A;  4Z05 A;  2XTY A;  3AK5 A;  4XLF A;  1TYV A;  1GQ8 A;  2W7Z A;  2X6W A;  2J8I A;  1HF2 A;  1IDJ A;  4XON A;  4OJ6 A;  2X3H A;  1OFM A;  3GQ8 A;  4OM9 A;  2O0V A;  2X6X A;  3ZPP A;  2BM6 A;  2ODL A;  1O8I A;  3GQ7 A;  1PLU A;  1JTA A;  3JX8 A;  1IA5 A;  3TH0 A;  1O8H A;  2QZA A;  4OJP A;  1QCX A;  4XQF A;  1PXZ A;  1QRC A;  1DAB A;  1O8F A;  2BM5 A;  1BN8 A;  4OJO A;  4XOR A;  4YZQ A;  2QX3 A;  4AVZ A;  4W8T A;  3VMV A;  1K5C A;  4W8Q A;  2BM7 A;  3P4G A;  1L1I A;  1WXR A;  1CLW A;  4YDT A;  2VFN A;  3VST A;  3LYC A;  1TSP A;  1OGM X;  4NK8 A;  2B0R A;  2INV A;  4MXN A;  5DNS A;  5JLV C;  2UVF A;  1QA3 A;  1TYX A;  1O8M A;  4YC5 A;  3DU1 X;  2XTW A;  4NK6 A;  1BHE A;  1JRG A;  3GQA A;  4XOT A;  1K8F A;  3T9G A;  1H80 A;  1TYW A;  1O8J A;  4URR A;  1PE9 A;  2O04 A;  4W8S A;  2XT4 A;  4YEI A;  1K4Z A;  2O0W A;  3PET A;  4XLE A; 
#chains in the Genus database with same CATH homology
 1QJV A;  2NTB A;  4MR0 A;  4XOP A;  1KCC A;  1OFL A;  1HG8 A;  3B8Y A;  1NHC A;  1X0C A;  2O1D A;  5AMV A;  4I84 A;  1DBO A;  2X6Y A;  2EWE A;  3ZSC A;  1IB4 A;  2IQ7 A;  2VJI A;  2VBE A;  2X85 A;  3JUR A;  4XLH A;  2BSP A;  2INU A;  4EW9 A;  1OGO X;  4Z06 A;  2QXZ A;  3B90 A;  3EQO A;  4XLA A;  3SUC A;  4OJ5 A;  5C1C A;  1OOC A;  2NT9 A;  4XKV A;  2O17 A;  2PEC A;  1O8D A;  3EQN A;  4XM3 A;  1RU4 A;  1EE6 A;  2NTP A;  1O8L A;  1VBL A;  3B4N A;  1CZF A;  3KRG A;  3LMW A;  4HWV A;  4XNF A;  1O8E A;  4C2L A;  1KTW A;  3UW0 A;  4Z03 A;  1O8K A;  2NST A;  3VMW A;  4U49 A;  2PYH A;  2UVE A;  4OZZ A;  4XL9 A;  2NT6 A;  3VSU A;  2Z8G A;  4W8R A;  4XMY A;  1IDK A;  1O88 A;  2VBK A;  4XLC A;  4PMH A;  2VJJ A;  2PYG A;  4OJL A;  4XKW A;  1RMG A;  3GRH A;  4XN3 A;  3FY3 A;  5C1E A;  2QY1 A;  4XN0 A;  2NZM A;  1KCD A;  4U4B A;  1WMR A;  1XG2 A;  4XR6 A;  2NSP A;  3VSV A;  3WWG A;  1O8G A;  1AIR A;  4YZA A;  4YZX A;  4YZ0 A;  2VBM A;  3GQ9 A;  2NTQ A;  1DBG A;  4YEJ A;  4YEL A;  4OZY A;  1RWR A;  4Z05 A;  4XLF A;  1GQ8 A;  2X6W A;  1IDJ A;  4XON A;  4OJ6 A;  2X3H A;  1OFM A;  3GQ8 A;  2O0V A;  2X6X A;  3ZPP A;  2ODL A;  1O8I A;  3GQ7 A;  1PLU A;  1JTA A;  1IA5 A;  1O8H A;  4OJP A;  1QCX A;  4XQF A;  1PXZ A;  1O8F A;  1BN8 A;  4OJO A;  4XOR A;  4YZQ A;  2QX3 A;  4AVZ A;  4W8T A;  3VMV A;  1K5C A;  4W8Q A;  3VST A;  1OGM X;  4NK8 A;  2INV A;  4MXN A;  1O8M A;  4NK6 A;  1BHE A;  1JRG A;  3GQA A;  4XOT A;  3T9G A;  1H80 A;  1O8J A;  4URR A;  1PE9 A;  2O04 A;  4W8S A;  2UVF A;  2O0W A;  4XLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...