2NTPA

Crystal structure of pectin methylesterase in complex with hexasaccharide vi
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
342
structure length
342
Chain Sequence
b'ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 125
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2ntpA00
3LMWA 1O8EA 2PYGA 1PXZA 4W8RA 1JTAA 1O8FA 4W8QA 3EQOA 4XKVA 1CZFA 4YEJA 1OFMA 4EW9A 2UVFA 4YZQA 2VJIA 2O17A 1OGOX 1BN8A 2EWEA 3EQNA 1O8IA 2X6XA 1O8HA 2X6YA 2QX3A 1WMRA 1H80A 1IDJA 2VBEA 4XNFA 4XN3A 2UVEA 1OOCA 1AIRA 4W8SA 3ZSCA 2O0WA 1BHEA 1PLUA 1VBLA 2QY1A 4YZXA 4Z05A 1XG2A 4I84A 2VBMA 2X85A 4PMHA 4XR6A 1O8GA 1QCXA 3SUCA 2O1DA 1RU4A 4NK8A 4XOPA 2BSPA 1O8KA 4Z03A 2NSTA 2NZMA 3GQ9A 4YELA 3KRGA 1QJVA 2NTQA 3VMWA 4U49A 1IA5A 4OJPA 2PECA 3GRHA 1O88A 2INUA 1GQ8A 3VMVA 3GQ7A 4W8TA 2NTBA 4OZYA 1RMGA 1EE6A 4XOTA 4U4BA 4OJLA 2NSPA 3VSVA 3JURA 1O8JA 1NHCA 1RWRA 3B4NA 3GQAA 2PYHA 4OJOA 1OFLA 4MXNA 3T9GA 1O8DA 4XLEA 4YZAA 4XL9A 2O0VA 4MR0A 4XLCA 3ZPPA 5C1EA 5C1CA 1JRGA 1DBGA 3GQ8A 3B90A 1O8LA 1KTWA 3WWGA 1PE9A 1IDKA 4XONA 3VSTA 4OJ6A 1K5CA 2X3HA 1IB4A 4OZZA 4XMYA 4XKWA 4XM3A 2QXZA 4URRA 4XLHA 1HG8A 1X0CA 2NTPA 2NT9A 2ODLA 1DBOA 1KCCA 4YZ0A 3B8YA 2Z8GA 3VSUA 4NK6A 2NT6A 2IQ7A 1O8MA 2X6WA 4HWVA 4XLAA 4C2LA 1OGMX 4XQFA 2INVA 3UW0A 4XN0A 4XORA 5AMVA 3FY3A 4XLFA 2O04A 1KCDA 4OJ5A 4Z06A 2VBKA 4AVZA 2VJJA
chains in the Genus database with same CATH superfamily
3LMWA 1O8EA 2PYGA 1PXZA 4W8RA 4YEIA 1JTAA 1O8FA 4W8QA 3EQOA 4XKVA 1CZFA 4YEJA 1OFMA 4EW9A 2UVFA 2BX6A 4YZQA 1TYWA 4V02C 1TYUA 2VJIA 3NAWA 2O17A 1OGOX 1BN8A 2EWEA 3EQNA 1LM1A 1O8IA 2X6XA 1O8HA 2X6YA 3SZEA 2QX3A 1WMRA 1H80A 1IDJA 2VBEA 4XNFA 5JMCB 3NB2A 2UVEA 4XN3A 1OOCA 1AIRA 4JRAC 1KQ5A 1OFEA 4W8SA 3ZSCA 2VFOA 4YCQA 2O0WA 3TH0A 1BHEA 1PLUA 1VBLA 2QY1A 1QRCA 4OPWA 4YZXA 3AK5A 4Z05A 1XG2A 4I84A 2VBMA 2G0YA 2X85A 3PSZA 4PMHA 4XR6A 5JLVC 3BH7B 1TYVA 1O8GA 1QCXA 3SUCA 2O1DA 2XTWA 1RU4A 4NK8A 4XOPA 4YC5A 2BSPA 4KH3A 1O8KA 2VFMA 3BH6B 4Z03A 2NSTA 2NZMA 2QZAA 3LJYA 3GQ9A 4YELA 3KRGA 1QJVA 2NTQA 1QRBA 4U49A 3SQVA 3VMWA 1IA5A 2F3LA 4OJPA 4YFOA 2PECA 3GRHA 1O88A 2INUA 1GQ8A 3VMVA 3GQ7A 4W8TA 2NTBA 4OZYA 2XT2A 5DNSA 3P4GA 1OFDA 1RMGA 1EE6A 2XC1A 4U4BA 4OJLA 4XOTA 2NSPA 2W7ZA 2J8KA 2VFPA 3VSVA 4OM9A 3JURA 1O8JA 3H09A 1NHCA 1RWRA 3B4NA 3GQAA 1EZGA 1CLWA 3N90A 2PYHA 1L1IA 4OJOA 1OFLA 4MXNA 3T9GA 3SYJA 1O8DA 4XLEA 4YZAA 4XL9A 2O0VA 4MR0A 4XLCA 2VFNA 3ZPPA 3LYCA 5C1EA 2BM6A 5C1CA 2YUHA 3N6ZA 3SY2A 1JRGA 1DBGA 3GQ8A 3B90A 1O8LA 1KTWA 2BM7A 1K4ZA 3JX8A 3WWGA 3RIQA 1WXRA 1EA0A 1PE9A 1IDKA 2XT4A 3PSSA 4XONA 3VSTA 1QA2A 4OJ6A 1K5CA 2X3HA 1IB4A 1DABA 1LLWA 2XTXA 4OZZA 2J8IA 1QQ1A 4XMYA 4XKWA 4XM3A 3ML3A 2QXZA 1TYXA 2QYUA 4URRA 4XLHA 1HG8A 1X0CA 2NTPA 1QA1A 2NT9A 2ODLA 2XTYA 1DBOA 1KCCA 1K8FA 4YZ0A 2BM4A 2VFQA 3B8YA 2O6WA 2Z8GA 3VSUA 1HF2A 4NK6A 1LLZA 2BM5A 2NT6A 2IQ7A 2IOUG 3PETA 1O8MA 2X6WA 4HWVA 4XLAA 4C2LA 1OGMX 3DU1X 4XQFA 2INVA 3UW0A 4XN0A 4XORA 1QA3A 5AMVA 3FY3A 1TSPA 4XLFA 4YDTA 2O04A 1KCDA 2V5IA 4OJ5A 4Z06A 2VBKA 2B0RA 4AVZA 2VJJA
chains in the Genus database with same CATH topology
3LMWA 1O8EA 2PYGA 1PXZA 4W8RA 1JTAA 1O8FA 4W8QA 3EQOA 4XKVA 1CZFA 4YEJA 1OFMA 4EW9A 2UVFA 4YZQA 2VJIA 2O17A 1OGOX 1BN8A 2EWEA 3EQNA 1O8IA 2X6XA 1O8HA 2X6YA 2QX3A 1WMRA 1H80A 1IDJA 2VBEA 4XNFA 4XN3A 2UVEA 1OOCA 1AIRA 4W8SA 3ZSCA 2O0WA 1BHEA 1PLUA 1VBLA 2QY1A 4YZXA 4Z05A 1XG2A 4I84A 2VBMA 2X85A 4PMHA 4XR6A 1O8GA 1QCXA 3SUCA 2O1DA 1RU4A 4NK8A 4XOPA 2BSPA 1O8KA 4Z03A 2NSTA 2NZMA 3GQ9A 4YELA 3KRGA 1QJVA 2NTQA 3VMWA 4U49A 1IA5A 4OJPA 2PECA 3GRHA 1O88A 2INUA 1GQ8A 3VMVA 3GQ7A 4W8TA 2NTBA 4OZYA 1RMGA 1EE6A 4XOTA 4U4BA 4OJLA 2NSPA 3VSVA 3JURA 1O8JA 1NHCA 1RWRA 3B4NA 3GQAA 2PYHA 4OJOA 1OFLA 4MXNA 3T9GA 1O8DA 4XLEA 4YZAA 4XL9A 2O0VA 4MR0A 4XLCA 3ZPPA 5C1EA 5C1CA 1JRGA 1DBGA 3GQ8A 3B90A 1O8LA 1KTWA 3WWGA 1PE9A 1IDKA 4XONA 3VSTA 4OJ6A 1K5CA 2X3HA 1IB4A 4OZZA 4XMYA 4XKWA 4XM3A 2QXZA 4URRA 4XLHA 1HG8A 1X0CA 2NTPA 2NT9A 2ODLA 1DBOA 1KCCA 4YZ0A 3B8YA 2Z8GA 3VSUA 4NK6A 2NT6A 2IQ7A 1O8MA 2X6WA 4HWVA 4XLAA 4C2LA 1OGMX 4XQFA 2INVA 3UW0A 4XN0A 4XORA 5AMVA 3FY3A 4XLFA 2O04A 1KCDA 4OJ5A 4Z06A 2VBKA 4AVZA 2VJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LMW A;  1O8E A;  2PYG A;  1PXZ A;  4W8R A;  1JTA A;  1O8F A;  4W8Q A;  3EQO A;  4XKV A;  1CZF A;  4YEJ A;  1OFM A;  4EW9 A;  2UVF A;  4YZQ A;  2VJI A;  2O17 A;  1OGO X;  1BN8 A;  2EWE A;  3EQN A;  1O8I A;  2X6X A;  1O8H A;  2X6Y A;  2QX3 A;  1WMR A;  1H80 A;  1IDJ A;  2VBE A;  4XNF A;  4XN3 A;  2UVE A;  1OOC A;  1AIR A;  4W8S A;  3ZSC A;  2O0W A;  1BHE A;  1PLU A;  1VBL A;  2QY1 A;  4YZX A;  4Z05 A;  1XG2 A;  4I84 A;  2VBM A;  2X85 A;  4PMH A;  4XR6 A;  1O8G A;  1QCX A;  3SUC A;  2O1D A;  1RU4 A;  4NK8 A;  4XOP A;  2BSP A;  1O8K A;  4Z03 A;  2NST A;  2NZM A;  3GQ9 A;  4YEL A;  3KRG A;  1QJV A;  2NTQ A;  3VMW A;  4U49 A;  1IA5 A;  4OJP A;  2PEC A;  3GRH A;  1O88 A;  2INU A;  1GQ8 A;  3VMV A;  3GQ7 A;  4W8T A;  2NTB A;  4OZY A;  1RMG A;  1EE6 A;  4XOT A;  4U4B A;  4OJL A;  2NSP A;  3VSV A;  3JUR A;  1O8J A;  1NHC A;  1RWR A;  3B4N A;  3GQA A;  2PYH A;  4OJO A;  1OFL A;  4MXN A;  3T9G A;  1O8D A;  4XLE A;  4YZA A;  4XL9 A;  2O0V A;  4MR0 A;  4XLC A;  3ZPP A;  5C1E A;  5C1C A;  1JRG A;  1DBG A;  3GQ8 A;  3B90 A;  1O8L A;  1KTW A;  3WWG A;  1PE9 A;  1IDK A;  4XON A;  3VST A;  4OJ6 A;  1K5C A;  2X3H A;  1IB4 A;  4OZZ A;  4XMY A;  4XKW A;  4XM3 A;  2QXZ A;  4URR A;  4XLH A;  1HG8 A;  1X0C A;  2NTP A;  2NT9 A;  2ODL A;  1DBO A;  1KCC A;  4YZ0 A;  3B8Y A;  2Z8G A;  3VSU A;  4NK6 A;  2NT6 A;  2IQ7 A;  1O8M A;  2X6W A;  4HWV A;  4XLA A;  4C2L A;  1OGM X;  4XQF A;  2INV A;  3UW0 A;  4XN0 A;  4XOR A;  5AMV A;  3FY3 A;  4XLF A;  2O04 A;  1KCD A;  4OJ5 A;  4Z06 A;  2VBK A;  4AVZ A;  2VJJ A; 
#chains in the Genus database with same CATH topology
 3LMW A;  1O8E A;  2PYG A;  1PXZ A;  4W8R A;  4YEI A;  1JTA A;  1O8F A;  4W8Q A;  3EQO A;  4XKV A;  1CZF A;  4YEJ A;  1OFM A;  4EW9 A;  2UVF A;  2BX6 A;  4YZQ A;  1TYW A;  4V02 C;  1TYU A;  2VJI A;  3NAW A;  2O17 A;  1OGO X;  1BN8 A;  2EWE A;  3EQN A;  1LM1 A;  1O8I A;  2X6X A;  1O8H A;  2X6Y A;  3SZE A;  2QX3 A;  1WMR A;  1H80 A;  1IDJ A;  2VBE A;  4XNF A;  5JMC B;  3NB2 A;  2UVE A;  4XN3 A;  1OOC A;  1AIR A;  4JRA C;  1KQ5 A;  1OFE A;  4W8S A;  3ZSC A;  2VFO A;  4YCQ A;  2O0W A;  3TH0 A;  1BHE A;  1PLU A;  1VBL A;  2QY1 A;  1QRC A;  4OPW A;  4YZX A;  3AK5 A;  4Z05 A;  1XG2 A;  4I84 A;  2VBM A;  2G0Y A;  2X85 A;  3PSZ A;  4PMH A;  4XR6 A;  5JLV C;  3BH7 B;  1TYV A;  1O8G A;  1QCX A;  3SUC A;  2O1D A;  2XTW A;  1RU4 A;  4NK8 A;  4XOP A;  4YC5 A;  2BSP A;  4KH3 A;  1O8K A;  2VFM A;  3BH6 B;  4Z03 A;  2NST A;  2NZM A;  2QZA A;  3LJY A;  3GQ9 A;  4YEL A;  3KRG A;  1QJV A;  2NTQ A;  1QRB A;  4U49 A;  3SQV A;  3VMW A;  1IA5 A;  2F3L A;  4OJP A;  4YFO A;  2PEC A;  3GRH A;  1O88 A;  2INU A;  1GQ8 A;  3VMV A;  3GQ7 A;  4W8T A;  2NTB A;  4OZY A;  2XT2 A;  5DNS A;  3P4G A;  1OFD A;  1RMG A;  1EE6 A;  2XC1 A;  4U4B A;  4OJL A;  4XOT A;  2NSP A;  2W7Z A;  2J8K A;  2VFP A;  3VSV A;  4OM9 A;  3JUR A;  1O8J A;  3H09 A;  1NHC A;  1RWR A;  3B4N A;  3GQA A;  1EZG A;  1CLW A;  3N90 A;  2PYH A;  1L1I A;  4OJO A;  1OFL A;  4MXN A;  3T9G A;  3SYJ A;  1O8D A;  4XLE A;  4YZA A;  4XL9 A;  2O0V A;  4MR0 A;  4XLC A;  2VFN A;  3ZPP A;  3LYC A;  5C1E A;  2BM6 A;  5C1C A;  2YUH A;  3N6Z A;  3SY2 A;  1JRG A;  1DBG A;  3GQ8 A;  3B90 A;  1O8L A;  1KTW A;  2BM7 A;  1K4Z A;  3JX8 A;  3WWG A;  3RIQ A;  1WXR A;  1EA0 A;  1PE9 A;  1IDK A;  2XT4 A;  3PSS A;  4XON A;  3VST A;  1QA2 A;  4OJ6 A;  1K5C A;  2X3H A;  1IB4 A;  1DAB A;  1LLW A;  2XTX A;  4OZZ A;  2J8I A;  1QQ1 A;  4XMY A;  4XKW A;  4XM3 A;  3ML3 A;  2QXZ A;  1TYX A;  2QYU A;  4URR A;  4XLH A;  1HG8 A;  1X0C A;  2NTP A;  1QA1 A;  2NT9 A;  2ODL A;  2XTY A;  1DBO A;  1KCC A;  1K8F A;  4YZ0 A;  2BM4 A;  2VFQ A;  3B8Y A;  2O6W A;  2Z8G A;  3VSU A;  1HF2 A;  4NK6 A;  1LLZ A;  2BM5 A;  2NT6 A;  2IQ7 A;  2IOU G;  3PET A;  1O8M A;  2X6W A;  4HWV A;  4XLA A;  4C2L A;  1OGM X;  3DU1 X;  4XQF A;  2INV A;  3UW0 A;  4XN0 A;  4XOR A;  1QA3 A;  5AMV A;  3FY3 A;  1TSP A;  4XLF A;  4YDT A;  2O04 A;  1KCD A;  2V5I A;  4OJ5 A;  4Z06 A;  2VBK A;  2B0R A;  4AVZ A;  2VJJ A; 
#chains in the Genus database with same CATH homology
 3LMW A;  1O8E A;  2PYG A;  1PXZ A;  4W8R A;  1JTA A;  1O8F A;  4W8Q A;  3EQO A;  4XKV A;  1CZF A;  4YEJ A;  1OFM A;  4EW9 A;  2UVF A;  4YZQ A;  2VJI A;  2O17 A;  1OGO X;  1BN8 A;  2EWE A;  3EQN A;  1O8I A;  2X6X A;  1O8H A;  2X6Y A;  2QX3 A;  1WMR A;  1H80 A;  1IDJ A;  2VBE A;  4XNF A;  4XN3 A;  2UVE A;  1OOC A;  1AIR A;  4W8S A;  3ZSC A;  2O0W A;  1BHE A;  1PLU A;  1VBL A;  2QY1 A;  4YZX A;  4Z05 A;  1XG2 A;  4I84 A;  2VBM A;  2X85 A;  4PMH A;  4XR6 A;  1O8G A;  1QCX A;  3SUC A;  2O1D A;  1RU4 A;  4NK8 A;  4XOP A;  2BSP A;  1O8K A;  4Z03 A;  2NST A;  2NZM A;  3GQ9 A;  4YEL A;  3KRG A;  1QJV A;  2NTQ A;  3VMW A;  4U49 A;  1IA5 A;  4OJP A;  2PEC A;  3GRH A;  1O88 A;  2INU A;  1GQ8 A;  3VMV A;  3GQ7 A;  4W8T A;  2NTB A;  4OZY A;  1RMG A;  1EE6 A;  4XOT A;  4U4B A;  4OJL A;  2NSP A;  3VSV A;  3JUR A;  1O8J A;  1NHC A;  1RWR A;  3B4N A;  3GQA A;  2PYH A;  4OJO A;  1OFL A;  4MXN A;  3T9G A;  1O8D A;  4XLE A;  4YZA A;  4XL9 A;  2O0V A;  4MR0 A;  4XLC A;  3ZPP A;  5C1E A;  5C1C A;  1JRG A;  1DBG A;  3GQ8 A;  3B90 A;  1O8L A;  1KTW A;  3WWG A;  1PE9 A;  1IDK A;  4XON A;  3VST A;  4OJ6 A;  1K5C A;  2X3H A;  1IB4 A;  4OZZ A;  4XMY A;  4XKW A;  4XM3 A;  2QXZ A;  4URR A;  4XLH A;  1HG8 A;  1X0C A;  2NTP A;  2NT9 A;  2ODL A;  1DBO A;  1KCC A;  4YZ0 A;  3B8Y A;  2Z8G A;  3VSU A;  4NK6 A;  2NT6 A;  2IQ7 A;  1O8M A;  2X6W A;  4HWV A;  4XLA A;  4C2L A;  1OGM X;  4XQF A;  2INV A;  3UW0 A;  4XN0 A;  4XOR A;  5AMV A;  3FY3 A;  4XLF A;  2O04 A;  1KCD A;  4OJ5 A;  4Z06 A;  2VBK A;  4AVZ A;  2VJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...