4XOTA

Tailspike protein mutant e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
b'QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xotA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xotA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xotA02
1QCXA 3GQ8A 1O8HA 3VMVA 1PLUA 1WMRA 2NZMA 4NK6A 3EQNA 2INUA 1O8FA 2PYGA 2QY1A 2X6XA 3VSVA 4YZXA 1OGOX 1X0CA 2NTQA 1JTAA 4XOPA 4XQFA 1QJVA 1JRGA 4OZZA 3VSUA 1O88A 1IDJA 1PXZA 4W8QA 4OJPA 4YEJA 5C1CA 2PECA 3GRHA 1O8JA 2NTBA 3SUCA 1IB4A 4XNFA 2QX3A 3ZPPA 1O8KA 1GQ8A 1RWRA 1PE9A 3KRGA 4HWVA 4XKVA 2NT9A 1O8MA 4I84A 1OOCA 4U49A 1CZFA 1XG2A 1OGMX 2UVFA 1KCCA 4XOTA 3GQ9A 4XN0A 4XM3A 4XN3A 4XONA 4XR6A 2IQ7A 4XLAA 1O8DA 1BHEA 1O8LA 2Z8GA 3FY3A 2VJIA 4XKWA 4MXNA 4XLFA 4W8TA 4NK8A 3ZSCA 4XLEA 1OFMA 2NT6A 3VSTA 1DBGA 3WWGA 1KCDA 4W8RA 4OJLA 1O8EA 1K5CA 4OZYA 3JURA 1RMGA 2NSPA 2NSTA 3T9GA 1IA5A 2O0VA 1O8IA 1VBLA 2VBMA 3GQAA 4U4BA 2INVA 4YZQA 4YZ0A 4MR0A 2O17A 1RU4A 3UW0A 1OFLA 2UVEA 2O04A 4XLHA 2EWEA 1AIRA 2BSPA 4Z06A 2O1DA 3LMWA 1KTWA 2VJJA 4EW9A 4OJOA 4AVZA 3GQ7A 2X6WA 3EQOA 4C2LA 4XORA 4OJ5A 4XMYA 3B4NA 4YZAA 4PMHA 3B90A 2ODLA 2X85A 1NHCA 1HG8A 2PYHA 3B8YA 2VBEA 4Z05A 2O0WA 1BN8A 4XL9A 2QXZA 4OJ6A 1EE6A 4YELA 4URRA 5AMVA 2NTPA 1O8GA 4W8SA 1DBOA 3VMWA 4Z03A 5C1EA 4XLCA 1IDKA 2X3HA 1H80A 2VBKA 2X6YA
chains in the Genus database with same CATH superfamily
3IKVA 1B72B 1JUMA 5HLHA 4BQAA 3CF2A 4IHYA 3S93A 4HBLA 4G6DA 4JQFA 1DP7P 3RIRA 2V7FA 3OZUA 2W82A 4OOVA 5J47A 1TT0A 2OD5A 3JQPA 1Q82D 2K9SA 5CQGA 1VZ0A 3HSFA 2GM4A 4I02A 2HVSA 2P5LC 2YR2A 3PM1A 4J0QA 4HNUA 3ZR8X 2F5DA 2OTLI 2AXLA 3OR1C 1FPQA 1WQ2A 1YI2I 1CNEA 3GVLA 2FSWA 4M9XA 4QSHA 1N78A 4EMSA 2PLYA 3KP4A 2W84A 4QHYA 1V54H 2DCEA 3F3XA 1MJAA 4KN4X 1YW7A 4Y9UA 4XNFA 3ELKA 2WY7Q 3F8NA 1KK1A 5F4MA 1QPMA 3CLOA 4X7DA 4NHJA 2ZITA 4ZJZA 4IOCF 2X51A 2YWEA 2M30A 3KCCA 2K9QA 4BBSJ 1Y8QB 3TO9A 1WRJA 3CUQC 4YFXF 1GXQA 1T98A 3SFIA 1FX7A 4TKOB 5BPIA 4RAGA 1Q1VA 1ZREA 2B7EA 4WXCA 5JHUA 3DPUA 2Z9OA 2BVNA 3FIWA 4DNRB 4LG0A 2RNGA 4BEHA 5D5VB 1UMKA 3BG3A 3OYLA 3DDYA 2W57A 1NRKA 2A61A 4XLFA 4BE1A 4X0CA 4U7DA 1WGXA 3TO6A 3WTXC 1N25A 3RPUA 4L5EA 3PA1A 1MRZA 3TW7A 2CGPA 3Q9SA 3TOBA 2DY1A 2M45A 1O3SA 1NG7A 2P7VB 3HUGB 4A5NA 4AUXA 3JU4A 4C2UA 1TWGJ 1W7PB 2R93J 1SFXA 2NVQJ 2IVMA 2EIKH 4M0LA 2CRVA 4L9NA 1OR7C 4FASD 1YITB 4FTHA 3R61A 2V5IA 1GDTA 2BM0A 4RDUA 2IBDA 2ME6A 4HDVA 1HCRA 3G2BA 4YHBA 2UVEA 1BM9A 5E8IA 4M6XA 3SJZA 1NK3P 1AIRA 4FX0A 3AFHA 3GX4X 1XS9A 1BLIA 1L0OC 2W00A 2PN6A 5DSZA 2IGOA 2K7LA 4ZYDA 3FKJA 1LPQA 3K4JA 3HOZJ 1U5TC 1BI3A 3G3ZA 2EZLA 4PDKA 3MFKA 3ONYA 2L54A 1PJ7A 1TNSA 2ZMEB 1YFHA 1FNDA 3OE7A 2WWYA 4M9ZA 1W9XA 3QE2A 2WY8Q 1FRQA 2DK8A 3FF5A 4HPQA 2CJJA 2VBSA 2VI6A 1LE8A 2KDZA 2GOMA 3DQVC 4HV5A 1FX0A 3G05A 4EJTA 4M73A 1RC9A 4BY1J 2O0WA 4B3GA 3RKYA 1MBJA 5LRRA 3K70C 2DODA 1P4WA 3BJ6A 2VFPA 4XKBA 1S9HA 3O2PE 2CSOA 1LVAA 2XC7A 3RKQA 3W2HA 5L46A 3BH7B 3AKZA 4ITVA 3PSZA 3MD2A 1BIBA 3KE2A 5DCMB 1WTHD 1XMKA 3DKYA 5HDGA 3KIOA 4BE0A 4NBSA 2E1NA 4UVBA 1UJ8A 3D0SA 1DDNA 1QCXA 4BY7J 1D3YA 2DOEA 3OKXA 4D7NA 2A6TA 1WMRA 2CG4A 1R71A 2VKVA 3T5XA 1VQ5I 4BXFA 2C5BA 4L18B 5IY5H 2QTLA 1QRCA 3LSRA 5E3MA 4K1XA 2G7UA 4A3JJ 3ZQGA 4TSFA 4X07A 1JGGA 1IN8A 3GFJA 1I6HJ 3V4GA 1LLWA 2GWRA 1BJKA 1JB9A 5FKLA 2O3FA 2EFPA 2RC4A 5GV8A 1HSJA 3BG6A 1Y8RB 3TGNA 1QG0A 3K69A 2GBYA 3DBHB 2LMDA 2FBIA 3UKGA 1X1PA 1NDHA 3CXCB 2LOOA 3CJQB 4UB8C 2ZKZA 1PP8F 3SZPA 4BYYA 2EH3A 2E7WA 2STWA 3AG4H 1ZH5A 3ZMDA 1O8MA 4BDZA 2X1DA 1REPC 1CZFA 2MW8A 2DW4A 3HAGA 4AC0A 5GPCA 1HLVA 4ZGQB 4G9YA 4KT6A 3FX3A 3PUFA 2VJ5A 4Q4ZF 4XRSG 1YJNB 2IQ7A 4RDJA 5KW9A 2Z8GA 1M90D 4PAAA 5ICEA 1GVJA 2ELHA 3RTRA 3D5RC 3W2AA 1F43A 5J1YA 2Q0OA 2W85A 3HHHA 2DYIA 1MBKA 3BY6A 4LD5A 1WKMA 2WJVA 2ME0A 2C2WA 3JURA 4UUVA 2ZL6A 1WXRA 2E71A 3MKZA 5F0CA 2IA2A 2L0KA 5TR9A 2H6BA 2Y0SA 4KITB 3CMYA 4RM2A 4S05A 4MQ9F 2A6HF 4YZQA 2Y2ZA 3BTJA 1U2WA 2XSJC 4R8HA 1QHHD 4GGGA 3ONUA 3ZZTA 3UW0A 2XAQA 3LYCA 1USSA 3WHBA 3E20A 1WDTA 2EWEA 4P9FA 2FXAA 2ZZEA 3U9GA 3HOWJ 3IKTA 5EMNA 3ECOA 1P4AA 2FBHA 4OIOF 4MEYF 1DP3A 3D5LA 5HOOA 4ZYHA 1K28D 4F92B 4ZYEA 2IRFG 3ML3A 1V5FA 2ZMEC 3MCZA 3NWSA 5CVVA 2FNPA 5D5UB 4AVZA 1B2RA 1OHHA 2JN6A 2LBFB 1UHWA 3LO8A 4RD0A 1QA1A 2CWEA 1B72A 2DK5A 2F6CA 3EYYA 3CF5F 4E7LA 3ZQHA 3I9V2 3SEJA 1X2MA 1MH3A 2DPDA 2VBEA 1BI0A 2R5YA 2H8RA 3ROUA 2GA2A 2VPLA 1IJWC 2R7WA 3PJRA 4GCVA 1VQ9I 1UHMA 2M1BA 5AMVA 3PNVA 3FXKA 4N4NB 4W8SA 3DFGA 4I76A 3BCBA 3BCAA 3VSLA 1W35A 3GZ5A 3LFKA 3A0HC 3MVPA 4NC7A 4WK8F 4YIIA 2F5VA 4H0EA 1G7TA 1QVGB 1KGSA 1GVDA 2Y31A 1R4MB 2AO9A 2CQNA 2G7HA 2ZJPF 4RAZA 3F8CA 4PJNA 1RZ4A 1ACIA 5J4YA 2G9WA 1Z91A 2Z3YA 4OIPF 1W0KA 5J3LA 3A0BC 3COAC 1CGPA 1FOYA 2AQEA 3A8IA 2EA4A 1W36C 1O4XA 1KZLA 2R7SA 1NB0A 3IWZA 5DN6A 3G4SI 2GLOA 4A69C 2GQFA 1IHMA 1HXDA 1XG1A 3R0JA 4U0WA 4I09A 1PP7U 3K2ZA 1UD4A 1MKMA 1JT0A 3ZMTA 1VQOI 4YEJA 4IXAA 2CQ7A 3KP7A 1UZCA 2A6EF 2V7UA 3BTCA 4P6YA 3H92A 3OZVA 3GFLA 3ZMSA 3HEFA 4YG2F 2VBXA 1FRNA 1TYWA 4CXFA 2YX4A 3IWFA 3KLOA 3SHFA 4DZPA 1RWRA 4HWVA 1TYXA 1EH7A 2FNAA 1K4ZA 1J59A 2BF4A 5FKMA 1RUNA 3CDLA 5FRMA 2J7KA 3NQOA 3HTUA 4B43A 5DS9A 4FX4A 3NWTA 1S29A 2L7ZA 4KISA 3M8JA 4RGXA 4HLYA 5IYWA 2QTZA 4Z4VA 4V19K 4UVAA 5ERIA 2HVRA 1LVKA 1NTCA 3IHUA 2M4KA 3HG9A 4XKWA 2OC6A 3BH6B 3G71B 3ZUGA 2EBIA 4PSXA 1YX2A 3ERED 5B6IA 1I18A 2XGJA 4KNYA 5E3LA 2EA2A 1ODDA 4W8RA 4CZZA 2TDXA 3BZKA 5LGUA 2QENA 3OWTA 4B4DA 3IH3A 3F6VA 3CMEI 3T51B 5K1YA 5EG0A 1TL8A 1MDMA 2O0VA 4IW3B 5BPDA 5FLXK 2MLGA 2VBYA 3KYDB 4PFOA 2QSGX 3KLNA 2BMWA 3CMAB 3GMEA 1OFLA 3OS2A 4JRAC 4MIMA 4V02C 2VJ4A 1WI3A 4UY8I 2L9RA 1VQ4I 4RAFA 4O3MA 2BGIA 1EFUA 3GZNB 4F55A 5F0FA 3ZRGA 2VFNA 3EPZA 4HE6A 2O1DA 2EIMH 1KTWA 4RB0A 2V6EA 1I39A 2ZJ2A 4ACBA 4EW9A 2X6WA 1W5CC 1TLLA 2X3UA 1VTNC 1C0WA 4ZTJA 5HXBA 1KTVA 2JSPA 1OCOH 1JT6A 2CF4A 4GXOA 3BY1A 5FA6A 4ASNA 4M53A 4YDTA 1QZEA 1QGPA 1X3WB 2C6YA 3EQLF 1KQ8A 4AU7A 1B23P 3OZWA 3W5UA 4Z4YA 5DM6F 4XRFA 1IV6A 4Q5SF 1D8TA 2VFQA 3RYRA 1ENHA 4CZCA 2EPFA 4Z2YA 4MYUA 3ZZUA 2BX6A 3J81K 3AVWA 1VQPI 5B5EC 1U8BA 1W5SA 4P9UA 3W6VA 1WOSA 4WZEA 5JLVC 1Y0UA 1O8HA 3LWFA 2GXAA 2R9VA 1FWZA 1IJFA 1EA0A 4ASUA 5C44J 3RQIA 1OFCX 4KH3A 1PJ6A 3F72A 4CQJA 2DTZA 3PO3J 4P5OA 4D0PA 3GF2A 2QLZA 4R1HA 3P7NA 3MEXA 2CFOA 3FBNB 4PGHA 1ZHFA 4AIDA 3V76A 2BHYA 1B9MA 1ZTRA 3CPXA 2WB1A 3DKWA 3HOUJ 4RDLA 4OU0A 3DBLB 4Q47A 4RCYA 2HGCA 4IOAF 3OY9A 2YS9A 1Z9CA 2KMUA 1O8KA 2E19A 5F27A 4IHWA 2QYOA 1QFJA 5CVIA 4I7HA 3CCUB 4YFOA 2WA0A 4A3MJ 2QQAA 3HYIA 4FETA 3GTJJ 3OAAA 4PABA 3DTIA 4WZTA 2F5FA 2N8GA 5FB2A 2EIJH 3TL4X 2R7XA 3PUNA 2IGNA 1FDRA 4H9GA 5IP6A 1VQMI 2IGMA 5JFRA 3K4KA 1FIAA 3CCMI 1WI9A 3OIQA 5EEHA 1R4NB 2EK5A 1TQPA 1LDDA 1BIAA 4ZCIA 5CLSA 3GCMA 2BM7A 4XRSA 3CO7C 3I56B 5GV7A 4PC3A 3WWGA 1FIPA 5D8KB 2BGJA 4DK0A 2HTSA 1SVMA 4B3XA 4Z6YA 3PSFA 1EP3B 3BQZA 5DS0A 3U2QA 1MBFA 2XKOA 4PUSA 4ENKA 1Z0XA 4RB1A 4AIKA 4M4SA 3WNCA 3AVUA 3AVXA 1YW9A 2GXGA 2KDOA 1FMWA 1T39A 2HOTA 3RDIA 2ESNA 1QGZA 1VBLA 2VXZA 4U4BA 1MZBA 1B4AA 1X4OA 2E35A 2OPTA 2Q6IA 3QRFF 2M2EA 3GTKJ 1FYKA 3EYIA 3AL0B 1BI2A 1NB9A 4A5MA 3BH4A 2HYJA 3WTWC 2LZJA 2KT0A 4QV2A 2VBTA 1O7LA 2E1OA 1D2EA 2W25A 3H9NA 3QAHA 3S3MA 1WU8A 1BR1A 3TDUC 3OEEA 1WH7A 1K6YA 2VBZA 2L9VA 1DU6A 2DIEA 2Q6KA 3FHNA 4F3QA 2JRMA 3S3OA 3CDHA 3WE2A 1MMNA 4GO1A 4GRIA 3CCLB 4I99C 3H5AA 1JKOC 1IRFA 2DA7A 1EFCA 2QVOA 1SFEA 3MAJA 4M6YA 1XDUA 2HWVA 4X7CA 2CRGA 2Z2SB 3DV8A 5FGMA 4B8XA 2OU2A 2NVUB 5F1JA 3BR0A 3KL9A 2ZXHA 1YIJB 3J7AY 2QKMB 3L00A 1TVCA 4JX4A 2HQAA 2RDPA 5L3EA 4DBQA 3X2QH 1VF9A 2F4OB 4LIUA 2QE7A 2M34A 1IN4A 5H6RA 4XLCA 6PAXA 4A6DA 2KZGA 3AG2H 5CVUA 4BQOA 3AGQA 3MCAA 3B02A 4RD4A 3N6ZA 4FE4A 1OYWA 4OOSA 1QVUA 2O6WA 2YUSA 3J7YJ 4BNCA 2YWFA 3CC4I 2X8KA 1WOOA 1FLIA 2IS2A 4BDYA 1FNBA 2PLFA 2JUCA 3ZBTA 3Q5FA 3OOPA 3NB2A 3NE5B 1KYWA 1VHEA 4KT5C 2DFIA 4II3A 1VQ8I 3QPSA 4RGUA 2ELJA 5FKOA 5CKTA 3HB9A 2LDUA 4M1KA 2FQ3A 2OAZA 2YU9J 3L1PA 1P2FA 1WFXA 3GLXA 2COMA 2Y9ZA 3GRHA 1YRNA 2D5VA 1E0EA 2LYCA 2QQ8A 4PJ0C 2NTBA 3ZQQA 2XOKA 1ZG5A 3LA3A 2Q2EB 2V7XA 2X48A 2P5KA 2IS1A 1YO5C 3HOTA 2GJPA 3OJXA 2XT4A 1OFDA 2NPFA 1IJEA 5FFXA 4X8IA 2BEOA 1SAXA 1R00A 2HTJA 3HDDA 4B3FX 4ZZDA 1XSXA 2YU3A 3R4KA 2C4TA 3CW2A 1W2BB 2DETA 2J8IA 5CJ9A 1K78B 1Z3YA 1E3HA 1U2RA 2EZKA 1YHQB 3Q39A 1Z6TA 2F4NA 3WNBA 5IYDJ 1IDYA 1P6RA 3NAUA 3JAMK 2ZL7A 3OOCA 1YIOA 1O57A 2XDVA 3H09A 3J7ZI 5D6FA 4S04A 4Y15A 3G73A 2V4DA 1IG7A 2DN0A 2P6TA 3B78A 3BTLA 1TWFJ 2F5EA 2RQQA 5C4JJ 5DDGA 4BPRA 3VSTA 1KCDA 1R5ID 4ZTFA 3WG7H 2WZPP 1D0ZA 1BC8C 4ZDPA 4UZFA 2G0YA 5A2QZ 2PMDA 1F9NA 5FL7A 1XCBA 1ZGJA 3W2FA 1IA5A 4RJLA 2OQRA 2YUHA 5F0HA 2DOFA 3EUAA 2LY2A 5DEQA 2NV4A 2FQ4A 1PJ5A 3AL0C 2XEXA 5JLWA 3MQ0A 4OAYA 3S1RJ 1R5NA 2VNKA 3H0GJ 4IHTA 5M3MJ 1XGMA 2V1NA 3I64A 4GYGA 3ASTA 2MYSA 2O0YA 2HCJB 3JRBA 1MBEA 2Q1ZB 5F64A 1NBMA 2ZZQA 1R49A 2HYGD 3N05A 1R1TA 4C3IJ 1H8HA 4EM2A 1UD3A 5M5WJ 2P6SA 2H1LA 4ESBA 3EQOA 2QA4B 1XD7A 3BG9A 2BBYA 3CC2I 3T56B 3CUOA 3GUDA 2E36A 3FXRA 4G7XA 3BDDA 4TN1A 4AC9A 3QQAA 3ASOH 3DU1X 1J09A 3JRCA 3K70D 2VOPA 1J75A 2CV0A 4L0ZB 1IC8A 1B8IB 1P7JA 4XKCA 3OYBA 4II2A 4TMWA 3DLLF 2F48A 2V9KA 2JUGA 3SQNA 4AD9A 3I59B 1O8GA 1Y6IA 4I2OA 5HLTA 2DYRH 3EUKL 1GAWA 3BQJA 2UXXA 5LGTA 3OS1A 1I27A 5FD6A 1E64A 2X0KA 3GZ6A 1ZGAA 3SLNA 1H80A 3PL8A 4BHCA 2XAJA 4DGWB 3IV5A 4E7JA 1E3PA 2E1MB 3DTKA 1CF7B 4P22A 2X1EA 4P96A 3A02A 5LRSA 3OOUA 4XLNF 3P5JA 2INUA 2UUZA 2PYGA 2ZCWA 1AU7A 2BM5A 3LAPA 2QY1A 3CCQB 4PJLA 5HVQC 1OJLA 2LLKA 3HGGA 1XGSA 3U1KA 3H9GA 4E4HA 3T8RA 4YCQA 4MLOA 5E17F 4FWTA 3I5UA 1YJ9I 1HC8A 1FC3A 3HJEA 2K3FA 2PMZA 2JA6J 2HXOA 2L4AA 3FK7A 1K61A 2BV3A 2PECA 1KC8D 1WCMJ 3KYCB 4AIHA 2BM6A 3WG9A 1VQKB 3DXJF 3MN2A 3CCJB 4KIBA 4DQLA 2QX3A 2RGVA 3MWMA 1Y0NA 3OJWA 2Z5UA 2EINH 2G0EA 5BOXA 1U9NA 3VYSB 2MD0A 4DK1A 4CYCB 1ETWA 3LA2A 1PDNC 3PUMA 5FKKA 3BCDA 5J3OA 2ZJRF 3QFTA 2DCUA 1A36A 1MNDA 1A35A 1WJCA 4PJJA 2BN4A 4OP7A 1WJDA 1RESA 2PMZN 5L3DA 4HF2A 3WXMA 2DEUA 3GQ9A 4XM3A 4IVNA 4G7HF 1HDPA 5GAHJ 1R22A 3HPHA 4YIFA 3B6CA 3GTPJ 3SYTA 3OW2B 4CGZA 1KU2A 2HZDA 1I1GA 2LP0A 5FO5A 4BE2A 2GK7A 2NS8A 2HI3A 1W7PD 2BVMA 1VQ6B 4K2EA 1BX0A 2V4JC 2BXZA 2QWWA 2R7UA 4A3LJ 2VNIA 4P9SA 1R1VA 2BV6A 1MSEC 1T5EA 4UZEA 4EATA 1QUFA 3VFZA 4B3AA 2NSTA 3H35A 2R7DA 1QZZA 3LFUA 2GIVA 5IP7J 1O8IA 3I4PA 3LSTA 1YLOA 3A3GA 2DU9A 4NQWA 5EZHA 2K02A 5BMZA 1GVHA 1OCTC 3QFCA 2DMTA 3SZEA 2BY2A 2LK2A 2VKDA 1ZRDA 4IX7A 1ZLKA 2VOOA 2BY1A 3IRRA 3QFRA 3E7LA 2DMQA 2E1BA 3MKLA 2XNCA 1FNCA 3HC7A 3JSPA 1FBQA 5FLXZ 4HQEA 1JKRC 4RD6A 4M3EA 1S0UA 3CC7B 3V7SA 1ZQ3P 2MC3A 3H36A 4RA2A 5GAEJ 5FLVA 1QVTA 1POGA 3FK6A 3QU6A 4F52A 1W1WE 4A2UA 3AAFA 4EGZA 1G2HA 1CNFA 2ZFUA 4Z4TA 3PSSA 1UD8A 3GVAA 2HR3A 3F22A 4Y13A 1EV7A 5GAGJ 2L2OA 3FDYA 5LLQA 5LHIA 1R9TJ 1IAWA 2PJRB 3A2KA 2XTWA 5K7FA 4V2FA 2R5ZB 1NK2P 4FQGA 2ZSIB 3WGHA 1A6QA 2IXSA 2JK3A 3HM5A 4UUSA 1XFOA 1U9OA 1O3RA 1XQBA 2VNHA 1OKRA 1XX5A 2RREA 3HSEA 3SXYA 4BS9A 4Z03A 3V7CA 4BHPA 3GEZA 2E1MC 1SFKA 2EQRA 3W2EA 4I0AA 4OMZA 4OPOA 3QPHA 4KIGA 2VASA 3VNVA 2YPRA 3OYNA 3D1NI 1A04A 1T6SA 1HKQA 2X9DA 1D5YA 4XD7A 2WAQA 3CCVB 2GA1A 3I55B 1W36D 4E7KA 3CCSI 3OSGA 3M8EA 3BOQA 3SJPA 1HZEA 3J81Z 1IO2A 1AOYA 3QOEA 2JPCA 3PIPF 4ZYAA 1XDSA 2I8DA 2IPQX 3TMOA 2M0MA 3KZYA 2NOJB 3RIQA 4OZZA 4FN5A 5A8AA 3VODA 1N75A 1T6YA 3H9JA 1T6ZA 4RM0A 1WJAA 3JRIA 2ZC2A 1WP6A 1CLWA 5C1CA 1W4MA 1BN5A 1Z67A 3I53A 4PZJA 1QA3A 2O03A 3QPLA 4DQ2A 4WZLA 4ANJA 1KA8A 1DG1G 4X0GA 4XKVA 1TP4A 3HPGA 1UG2A 2DOAA 3F9KA 1RR8C 1AMOA 3KZIC 3HOSA 4U49A 1UD6A 1UCRA 3PA2A 2UVFA 1BW6A 2JMWA 2M7BA 4IRHA 5ICFA 4ZH4F 1UD5A 4XN0A 5F6FA 2PE3A 3A01B 1FP2A 3ZP5A 1D1AA 1H88C 3CUQA 4UZUA 1KK3A 4NCNA 1QH0A 1TW3A 2JPBA 5DNSA 3PNYA 5EJCA 5J1RA 4PC1A 4EGYA 1WWXA 4DJAA 4P55A 4HDUA 5HKKA 1MBGA 1QPIA 2BM4A 2CQKA 2QCOA 3QWLA 1VQNI 2DJNA 3M1EA 5JHFA 3M1CA 1PUFB 2O5RA 1TNTA 3G6EB 4Y52J 1BR4A 2IS6A 1HQCA 2ZBUA 2LKSA 3HBLA 4KJZA 4U87A 2CW8A 3BZCA 2ICWG 2QMUA 2D74A 3WYAA 1G59A 3FHZA 4OM9A 1Z1DA 3HRTA 4YIRX 1OR7A 3I59A 1VQLI 1COWA 2HQRA 3QFSA 1TUIA 1VJSA 3LMWA 1D8KA 2LFBA 4A93J 5GTIC 1PKVA 4DQKA 4HA8A 5EYRA 1OPCA 4OJOA 2VLAA 4IPAA 4DBRA 1HA8A 3FKSA 4J19A 2QBYA 1RQPA 2QEXB 2WR8A 3K9TA 2D1VA 3ABKH 1EP1B 2BW3B 1NH3A 3E6MA 1NHCA 1U5TA 1XSVA 2MA3A 4QTRA 1OB0A 2PX9A 2JT1A 2CW5A 2IP2A 3K4BA 2MG4A 3DU5A 2K9LA 1P4XA 3ZQFA 1W0JA 4NC6A 5E20A 2DBBA 4BQNA 2ZFWA 2DFFA 3D26A 4FISA 4LGWA 5F08A 3K6GA 5TY0A 4E0FA 4ZDOA 2WYRA 4ZYGA 4IKFA 5HDNA 1E3OC 1OB2A 2KL4A 3WE3A 2WAFA 3E6CC 2XAUA 1I50J 2VQGA 3P4GA 2Y0SN 2NZMA 2A5WA 4Q7JB 4KMUX 3HGYA 1EJ9A 1I8DA 4G7ZF 3S3NA 1OCRH 5AIPA 4DYCA 3H94A 3Q0WA 2O8XA 5AIQA 2ZXJA 2ISYA 2P4WA 2X6XA 1YJWI 1KRHA 3BR3A 2GPJA 1S72I 1WPCA 5J35A 2BGCA 1MJ9A 1X3ZB 2Q8KA 2Q6OA 3OPOA 2MLKA 1JTAA 3LOCA 1QJVA 1H8AC 2VZLA 2AHQA 2DT5A 5B1BH 1LEAA 1MGTA 2CU7A 2CUEA 3IRQA 3SJMA 4BH9A 4TMVA 3ZC3A 1SFOJ 4P3IA 2V7WA 1HSTA 4KDPA 1ETQA 1VQ7I 2KISA 4DNCA 3BR2A 1P9QC 2FOWA 4ZZLA 1K4TA 5M5YJ 3GFIA 3T8TA 5BSYA 1S7AA 4WF2A 2QZAA 4LLNA 4N9HA 5JVTA 3OYIA 1M1EB 2WV0A 1JGSA 1I6XA 3LSGA 2WZNA 5IT3A 1FYMA 1GJRA 1SD4A 2MABA 2QSFX 1SAUA 3FXJA 3FPKA 1V4RA 2CO5A 1G6NA 4EJOA 1BHEA 3JRGA 2VJIA 2HVQA 3VYTB 3ZSCA 3OYFA 3P9CA 5E1XA 2PBIA 1UAAA 3H3VK 1GLNA 4QVJA 3W2VA 1FBSA 2KZVA 1KZHA 4XSZF 2VYQA 1MSFC 3ASQA 3DPTA 2DA2A 4LLLA 2OF7A 4ETSA 5CVJA 5F04A 2XGEA 2DA6A 1T08B 3HUGA 1J2XA 4QVAA 5B66C 2GJRA 4RPDA 1V5VA 1W7PA 1KK0A 2EILH 2INVA 1X3UA 3R0AA 3G1MA 4PC2A 4P1WA 3WHCA 2D9RA 3T1BA 5F4OA 2OTJB 4FE7A 2TCTA 5KHDA 2O04A 4C3HJ 2V7QA 3GTOJ 2JA8J 3CDIA 3KP2A 1FNMA 4L8JA 2X0LA 2A68F 2R7TA 1TW2A 3KFWX 3E5QA 4XRMA 1RPWA 3N90A 2JSCA 2D1HA 1T56A 3WTSC 2JDIA 1CQXA 4X05A 3MHPA 3ABUA 2KRCA 4MNUA 3WTTC 2KKOA 3GW2A 1SEUA 4OJ5A 3B4NA 2AQFA 4ESFA 2ZMEA 3TKYA 3MZHA 1EP2B 1EXMA 2ZZGA 1YX5A 1V55H 1QX4A 5IYPA 3ZPNA 2UZKA 3CCEB 1K8AD 3CC7I 2ELKA 3D5SC 4LMYA 2Y9YA 1YS7A 2L5QA 4CCMA 4D7MA 3C18A 4L9TA 4UV8A 2LH9A 1OCPA 3KZZA 4NB5A 3VDXA 1GAQA 1Q7YD 2QYUA 2F4MB 5AONA 3CCRB 2M0CA 1OGJA 2K40A 3H0DA 1VI0A 3JRHA 4FXUA 1ETKA 1FP1D 1YITI 1ON1A 1Z05A 3OYMA 1IDKA 5BS6A 2H27A 1ZRCA 5HODA 3V8JA 5FO0A 4M2LA 2A07F 5DCMA 4HEA2 2BHZA 1BPLA 1JUPA 5BNGA 3A8KA 3C7JA 1I3QJ 2DAOA 2VBUA 1MJBA 4OPVA 5K5QA 2M8GX 4PCQA 1T6XA 3G1LA 3LSKA 4C3JJ 1XE1A 3VOEA 3ZQCA 3CMMA 2OQGA 4YAUA 3F8MA 2ACJA 3V7AA 3ZCOA 1YQAA 3EETA 1DPRA 2V9VA 1X2NA 1JKQC 2B7CA 1IDJA 5LHGA 3U1DA 3Q0UA 5ILUA 1QA6A 3OYGA 2QN6A 4QIWN 5GTHC 1H8EA 1IB4A 1K8FA 2R7RA 2VIXA 3ZOBA 1YTYA 4MHGA 1AKHB 5TV2A 1BC7C 3W5VA 3HHGA 1AIPA 2JVHA 1HBXG 3BY2A 5FO1A 3JRFA 1PE9A 2L4MA 2NNYA 3SFZA 1XG2A 1BOAA 3KEQA 4RS8A 2ECCA 3K1MA 2IA1A 3HOYJ 5C3EJ 2CFXA 2YX7A 2KRHA 2X6OA 3JCUC 5HLGA 1O8DA 1ZGWA 5BSXA 1T0FC 1XN7A 4NK8A 1Z21A 4PC7A 4XLEA 4JK1X 3PUBA 1B6AA 2FMYA 3ESWB 4EJVA 4YRVA 1QUEA 3GBGA 2CNDA 1GT0C 3KEYA 4G94A 4P1VA 3CQZJ 5C4XJ 5E1ZB 3S2DJ 1S4MA 5EGOB 1APLC 4C2TA 4Y17A 1QFZA 5E3OA 1R6RA 3HSRA 3M7GA 2QGGA 3FISA 4UXNA 3ABTA 3AVVA 3SQVA 4JBAA 2OV7A 3FMQA 2VB6A 3I1FA 2XTXA 3ONQA 3RYPA 1RUOA 1VLYA 2R7FA 1QQIA 4TT3A 3Q3SA 2VBVA 2O17A 1RR7A 1X19A 4F93B 2WB1N 2BPOA 1JJ6C 3H3ZA 2O6GE 1WZ2A 1R5HA 4HG2A 3SDBA 3IAS2 5IP9J 1IRGA 3M4OJ 3RPQA 4P25A 4G7WA 2DXIA 2DA1A 2HOEA 4A3IJ 1EF4A 1XTAA 2XNJA 3LAJA 1DABA 2KHMA 2XV4S 3S14J 1YJNI 1BQEA 1RETA 3CB4A 4RLQA 3Q6QA 3GO5A 2FD5A 2Y0MA 1I3AA 3E5UA 3OR2C 4XMYA 1S8NA 1Y1WJ 2V1XA 2K86A 2LBFA 4YZAA 3ZIAA 1KONA 2OTLB 1WVRA 2GZWA 2PYHA 4EQQA 1DDGA 1YI2B 1B1BA 2XTYA 4WXDA 2L9SA 1O7FA 5M3FJ 5LD2C 1F5TA 2XF7A 1EA3A 3J7AO 1E79A 2X4HA 5EEAA 2AXTC 3FKIJ 4AF6A 2IGKA 4KYWA 2LNBA 4CDGA 5FLMJ 1AWCA 4TMXA 4S0HB 1JJ8C 3CLQA 2JJ2A 3OIOA 3PIOF 1IDZA 3B8HA 2XVCA 3OYKA 1E1QA 3HL2A 4Z4SA 5KCMA 2ZSHB 4KFCA 5E18F 4YALA 1JE8A 5CQEA 2ETHA 3OYJA 2P8TA 1FJLA 1BA5A 5D4RA 2VODA 2WAEA 2H1KA 1SVLA 5KAFC 3PO2J 4NNJA 4HE5A 3KP3A 5GP9A 5HNFA 1FYLA 2VQLA 3GVJA 2PFBA 4YFKF 4BXXJ 3A1PA 1M1KD 4EH1A 2DA3A 2A3SA 3PNTA 4B44A 5L3FA 1G4DA 2QDXA 3BC9A 4ZCLA 1JRGA 3OL3A 1Y56A 2OUMA 1IW7F 5HS8A 4UV9A 1P4MA 5E6TA 2OBRA 3ZN0A 3A8JA 1QVFB 2Z33A 1W0UA 1KU9A 2C77A 2BZTA 2XZLA 1E1RA 2E1CA 4DOZA 5ILSA 3E1SA 1Y39A 5M5XJ 1MMAA 1MD0A 4RB3C 1ETYA 3SEZA 5DTDA 4U9UA 5J1UA 1GV5A 3PFIA 1R5GA 2XUBA 1ZUNB 1RRJA 3CCYA 4YAFA 5LEJA 4RBOA 3ZQ7A 5H5JA 4LG0B 1U0JA 3HKZA 2M7AA 5CPRB 4BEHB 2GXBA 1MH4A 2FX3A 3JR9A 4BJ6C 1BOBA 5J8FA 1Y0YA 4KKSA 1Z7UA 4XONA 4XR6A 4XBFA 1X58A 2GAUA 3ABLH 2XPWA 3DKXA 3NAWA 4HX7A 4Z4ZA 1EFTA 1HVXA 3S1MJ 2JA2A 1YW8A 1UHSA 1TZLA 3K2AA 4ENNA 4ON0A 4XIDA 3TEDA 5D8LB 2QSHX 4UNOA 1XMXA 3FJOA 4E6KG 2HDCA 3J81k 1O8EA 3LSMA 1XSDA 2FJ1A 2QKLB 2XAFA 1RKTA 3OP1A 4KUMA 3ASSA 5LFAA 1DPUA 3AVYA 3EUHC 4CO8A 4IRGA 1RMGA 1Q1HA 3T9GA 2F4IA 4BU2A 1KU7A 2QQ9A 4AVPA 4LB5A 3RJPA 1EH6A 3K0LA 2W6JA 2XB5A 4MR0A 3P9KA 2C4UA 2D2WA 1IZ1A 2OJED 2NS0A 1VF7A 2HFHA 2OCEA 1ULYA 3CTAA 1BI1A 3BG5A 4LOCA 1DU0A 1SKYB 2DJIA 3DBRB 1HW1A 3E97A 5FNZA 5JI6A 2OA4A 3M9AA 1VQ5B 2VN2A 3OYAA 2VJJA 3M3YJ 2ZNYA 4OMYA 1LFPA 2Z16A 1JUSA 4AWXB 1BW5A 1LE8B 4RD3A 2JA5J 3HRUA 3ISXA 3I58A 4CH7A 1N0UA 2ZL5A 3BR6A 3MKYB 3CESA 3G71I 3QP5A 4N3GA 3LQRA 1RNLA 1FY7A 2HNHA 4E7SA 1KK2A 3BC8A 3RKXA 1FT9A 1JTYA 2DDAA 4XK4A 1MBHA 2STTA 2OK7A 3OW7A 5DCFA 2ZO4A 3LJYA 4YELA 4ZDLA 1X1BA 4ENMA 4KMFA 3QPTA 3TP3A 1W0TA 1FZPB 5DD4A 3A35A 1W34A 4F7DA 3VYUB 4Y7NJ 2ZZFA 1JTXA 3VMFA 2X3HA 3CMAI 3WNDA 1LQ1A 2LF8A 1GV2A 1QO0D 2GQQA 4P12A 4WWCA 1ZR2A 2V7VA 2NS7A 2Z6BD 4PK4A 3L2UA 2VE9A 2DQRA 1Z77A 3LSJA 2JWTA 3ZMZA 1JI8A 3I4MJ 2LRDA 1WH5A 2LG4A 3DLAA 3QOPA 1WORA 2I5UA 4W97A 1G8XA 2R3SA 4U7BA 3JX8A 2NTQA 4XQFA 3ASPA 2R0QC 3VSUA 3PQKA 5TJJA 1Q86D 1IRZA 4A6EA 2M5SA 2Y30A 1W5TA 4RD2A 4EVIA 4A12A 3PVDA 1F36A 2IEKA 1K83J 4YAOA 1OMIA 4PGGA 4C9YA 5KK1A 4WQMA 3CO6C 4MQVA 4L5JA 4M3BA 5FRNA 2NT9A 2DMUA 4I84A 1UD2A 3WBKA 3S8PA 4HLXA 1ZM4A 4A3CJ 5HZAA 4XOTA 2HEOA 2GIZA 2XSDC 1ONVA 2W7NA 1IXSB 5HNHA 4JP0A 2R7OA 5JBQA 4XLAA 3P27A 1DGWY 2E2JJ 2B7BA 2FEZA 3Q38A 4C2MJ 4DYQA 2WSSA 4Z1MA 3KP6A 1OLTA 2EV6A 2MFZA 4TV7A 3W2WA 4MXNA 1B9NA 5EF6A 1EWYA 1OYYA 2NRAC 1T2KA 2P81A 2V6CA 2RC5A 1I5ZA 2NT6A 4UAJA 2L7KA 4CHUA 2H94A 3GTQJ 4CCOA 2ZBVA 2O61A 1VQ9B 2XKPA 3QODA 4BJ5C 4G12A 1MMGA 4I01A 2LY1A 4MEXF 3JQRA 3O3KA 1BMFA 3GXOA 1BJZA 1E2XA 1YOVB 5D4SA 5L3GA 2VT3A 5GPAA 1Z6RA 1N77A 4IHVA 2HZTA 1DUXC 2XT2A 4YZ0A 2LF7A 3QU3A 2D3NA 1USTA 2YSRA 4GYIA 2AS5F 2MH9A 2XAHA 3CJRB 3CCUI 4HZFA 3HTSB 1Y1VJ 2QF7A 3VB2A 2PQ8A 2H09A 3VYRB 1ERDA 2RKHA 2LKPA 1LLZA 2WV1A 1QRYA 2CW7A 1IXRC 3S32A 2UWMA 5H59A 3GQ7A 4PFPA 2BE5F 3BWGA 3OYEA 3BLYA 2H8WA 4ENJA 2E34A 5KAIC 1RI7A 3G4SB 4BXUA 4B4CA 3AK5A 1QFYA 4PMHA 2XGXA 2L3DA 2X85A 3I56I 2R5YB 2CC2A 3K4LA 3C2GA 1LFBA 5IOZA 2VC1A 1VQOB 1RIOH 3Q6RA 4RDKA 3U6KA 3LA7A 1XMAA 2CMPA 3PSIA 4BGDA 1JNYA 1N0VC 3IL2A 1A5JA 1I1SA 3L2CA 2NVTJ 2WTEA 2FOKA 3CJTB 4EM1A 4PSWA 4EJUA 2L7FP 2XHKA 2V31A 2VQHA 4B47A 4XICA 2Z1DA 2VQCA 1IB0A 1IXCA 3H5RA 4G6TB 4IL6C 1TSPA 5F1RA 2A05A 2PG4A 5HLIA 3GQ8A 2M8EA 2I1LA 2C78A 1UB9A 3BG7A 4M6VA 4NK6A 4YC5A 3KX2A 3KP5A 3E0JB 4HSRA 4D9JA 1A6IA 1TTTA 5ICCA 4C0SA 1K7AA 3GYHX 4RGSA 4ZC3A 5HZBA 3ZPLA 2IOUG 5E3NA 2ZXIA 1JJ2B 4YZXA 2VUMJ 2Q6LA 2B0RA 1OGOX 2O8KA 4B09A 3JSOA 2XRNA 3MZ8A 2LKXA 4G5GA 1P7IA 3CCLI 1WHUA 4GDFA 2V79A 2KVOA 1LFUP 1FMVA 1LJ9A 3CMEB 2WJYA 1NJID 3K4MA 3QP6A 1K9MD 3A1YA 1YIJI 3CP8A 2K85A 3ULQB 3RCOA 2FBKA 2EFWA 4Y9RA 1SM4A 5THXA 2VFMA 2R92J 1FOWA 4NC8A 4ZGNB 5IT9K 1GQ8A 4HQMA 2JIZA 3UNGC 1V0FA 1N06A 2Q2EA 4RMNA 3DCFA 5CDFA 1VQ4B 2KRFA 1AA7A 1IGNA 1V3FA 2B9SA 1SD5A 3SLDA 1OCZH 2HYFA 3O6BB 4G6QA 5D6EA 2P7CB 3I0TA 5E79C 1TLHB 2Y69H 1WPKA 4BUPA 2GK6A 4JMQA 2VKEA 3ZMUA 1K78A 3VO2A 1ZYRF 2BVLA 2HOAA 1ETOA 4XN3A 1GHCA 1OGIA 2IS4A 1T33A 2DDBA 2DYSH 3C3WA 4FHTA 1O8LA 3U2RA 3ZGKA 4OIQF 5FJ8J 2KP6A 3E1YE 1ZM9A 3R60A 3ZQIA 2HQNA 2WAQN 5LBQA 2KJBA 1ZG1A 3OL4A 1FBUA 4G1BA 4QUZA 4HSTA 2DT6A 3F8FA 1K5CA 4LJZF 3BR1A 2V9PA 5EG0B 1MDMB 4IZZA 3WQZA 2IAIA 2OBPA 4QPQA 1ZM2A 3DWLE 3WTYC 2XZOA 5TISC 1QA2A 1E62A 1X1AA 2MD5A 1MMDA 3HIFA 4LB6B 3VR6A 1VQPB 3WTZA 1RU4A 3GVKA 1G7CA 2XGCA 4CCKA 4ZCMA 1J5YA 3N4MA 4Y7CA 1IV8A 2HOSA 3VEPA 2CK3A 2PEXA 3KEOA 1YHQI 4OAZA 4G7OF 4Y33A 4LK0F 3JTGA 4DZJA 2WPDA 2F3LA 2Y48A 1X1DA 4KIFA 1Q81D 4JYKA 3RQ4A 1UMQA 4M3GA 2VXDA 1XB2A 1SMTA 3B90A 4BAYA 2ODLA 3IUOA 2ZJQF 3HZJA 2CUJA 3K1NA 4IF4A 2XROA 3RI4A 1QU3A 4QFMA 4I6ZA 4Z4WA 5ED4A 1BL0A 2BM1A 4R71A 4UVCA 4OINF 1S5LC 2NYXA 2YWGA 1BN8A 3V7RA 4R79A 2E60A 4XL9A 1FEXA 3W6KB 3N97A 1HKTA 2FVGA 2BY0A 5DUKA 1ZARA 3DF8A 3PFYA 1B8IA 1FOKA 1R5BA 3SY2A 1IN5A 3CP2A 4PGOA 4QWQA 2RNJA 3L2QA 1XB4A 1DBOA 3NEUA 4E7ZA 5KSWB 4TMTA 3K4CA 5C1EA 2JVGA 1SVOA 1K6OA 3S2HJ 1JA1A 3AVTA 4WCGA 3I71A 1TTYA 2NVXJ 2OBSA 4JX5A 3ERMA 2KQRA 3EQNA 1VQMB 1CF7A 4N3NA 1WJFA 1O8FA 1F20A 3CCMB 1SC7A 2HDWA 1OB5A 3OFNA 1Z7LA 2JA7J 3SEQA 2IT0A 5EZGA 2J5PA 2JRTA 3WU2C 2V26A 2QA4I 1U6GA 3S2WA 5A2QK 4ACAA 2MSYA 5IOYA 3T0YA 3TBIA 4HYEA 5D5XB 5A88A 3G1OA 2D3LA 1OCCH 1PXZA 2NOGA 2RN7A 3AG3H 5FKNA 2K5CA 3S17J 1V5EA 2YWHA 1EKEA 3ZN1A 1HF2A 2KIUA 2XAGA 4BACA 2R7VA 2NVYJ 4BQQA 4O6JA 2L02A 2DMNA 4BHBA 2JZYA 1VNDA 2DQLA 2XB0X 2LC2A 1KQ5A 4A3DJ 1UG0A 3GFMA 4CICA 5J8CA 2JJ7A 5HS9A 5J6XA 3VWBA 4CYCA 4JOMA 1KCCA 1UFMA 4E7IA 3W6JB 2CQXA 1LNWA 2VBWA 4MGRA 4OOXA 3TW6A 1OFEA 1E3ZA 3ES9A 2O9LA 3WU0A 3HRMA 5B3SH 2L7MP 3CCQI 4L5IA 3FY3A 2RQPA 2ZBKA 1S3JA 1D1BA 3QYEA 5TRDA 1H9TA 1G3YA 2P3MA 3DEWA 4X7FA 3CD6B 1WSRA 3VSKA 3J80K 1A8PA 2WADA 1T8IA 2V1UA 5FROA 3L7WA 1OQYA 3FM3A 4B1RA 2E7XA 3A3BA 4LITA 4C2LA 4M71A 1WJEA 1YE9A 2HPIA 2M3AA 2H6CA 1HF0A 2VT2A 1E17A 2FRHA 2UXNA 4CCNA 5K7HA 2EFNA 4A3EJ 2NSPA 5DUIA 1T38A 1I7PA 3BJAA 3UR3C 2QZ8A 1VQKI 1TWHJ 3MMYB 3CCJI 3LL7A 2HPMA 1SKQA 1V0EA 2VNJA 3CJNA 3HXLA 2DLLA 3F8BA 4B48A 2RC6A 4RD1A 1QQ1A 4MFEA 2LREA 3A03A 3SDGA 4XLHA 1D1NA 1QNTA 2MGQA 2DA5A 3DPLC 3C2HA 3FXOA 1WOPA 2VE8A 3CC4B 2E5NA 4C43A 3REOA 1JA0A 1KMHA 1ZELA 5K5OA 1KQ9A 1Z3XA 4NUBA 3BQYA 1AHDP 3Q9VA 4RAYA 4G1VA 5JMCB 4XORA 1RQRA 3RY8A 2J8KA 5E8GA 1QGYA 1VQ8B 3FXMA 2QQBA 2K9NA 3SZGA 3JAMZ 4OPSA 1H0MA 3JTHA 1K4SA 1VQ6I 3GLLA 3IH2A 4IEJA 1FNNA 1V5GA 2FU4A 3WODF 4LBYA 5JR3A 2PJRA 3DEUA 2XIGA 4KN7X 3V8LA 2R5ZA 2HDDA 4DIQA 3FXLA 3KYLA 2CS3A 1J7KA 3IH4A 5KNLA 1HDDC 2JTVA 2PMUA 1ZRFA 3GTMJ 2DTRA 1S7EA 4LG3A 4BJTA 2JJ1A 2VBKA 1ZG3A 1ELOA 3L09A 5LHHA 5GADJ 1U78A 2L9NA 4RB2C 4M74A 3W5HA 1PLUA 3MZYA 3IC7A 2CUZA 1TT5B 2Y75A 4EM0B 2BXYA 3DU6A 1D0XA 4HIZA 2BY3A 3OYCA 3R6SA 4MFDA 4HF0A 2FMLA 1QRBA 4AM3A 3W3CA 3T53B 1X0CA 1E3XA 4Z4RA 3OMYA 4XOPA 2RAEA 3ML6A 3QSYA 1UELB 3F6OA 3FXQA 3H1CA 1SANA 3ZQLA 1NHAA 3LNNA 1PVEA 1JKPC 1ITYA 3ISPA 2ZB9A 2EFQA 3L9FA 1S6LA 1IN7A 4N4OB 1YRNB 2DI3A 1ZAOA 2XF5A 4UB6C 4EEFG 4ESJA 4GQNA 4ABZA 4X06A 3WBJA 1O8JA 2K3PA 2CV1A 3I3LA 4A3BJ 2LVSA 4RLZA 4DNTB 3JW4A 2L01A 3ZPPA 3WU1B 4V2GA 5CYVA 1G3TA 2ZNZA 2NNNA 1FTTA 1E43A 1X4PA 3BROA 3O8HA 1N08A 4BKXA 2B5OA 4QPOA 3BTIA 1MW7A 1GUUA 4LC0A 3CCVI 4XSXF 2K4BA 3TP0A 1MIJA 3I55I 4HF1A 3A01A 2OYNA 3F0CA 2V1DA 4PJMA 2FUG2 5IYBJ 5H2FC 5D5WB 1XGNA 4P3YA 4IHXA 3CC2B 1TYUA 4W8TA 2W1OA 4M3FA 4RCZA 4N0BA 4OJLA 2K4JA 5IPAA 1BBYA 1J9ZA 3MMPA 4HNVA 2I10A 3GTLJ 3KPHA 2DFEA 4HX4A 3TH0A 1ETXA 2E5ZA 1RKWA 1PUFA 4W1UA 4EJWA 4Q48A 3WGGA 3H9QA 2HKOA 4IQJA 1LDJA 1WJ5A 2O7OA 3GWZA 1W87A 1U3EM 3FMRA 1O3QA 4OWRB 3R6JA 3B73A 3GQBA 1R23A 4J01A 5DYMA 5H20A 1XCVA 4Z06A 3DTEA 2HU9A 3WTUC 5DM7F 1ZLJA 5AN9A 2XZPA 4RLFA 1EH8A 2EZIA 3E3VA 5IYQA 1R7JA 1QZYA 4L9VA 5ICGA 4HAMA 3TQNA 3KETA 4KKUA 3Q3AA 4P26A 3E6BA 3U6BA 3CPWB 2DT7B 3QYFA 1YJ9B 1XPXA 2KPMA 4LBVA 2LTPA 3FMSA 2A69F 2B0LA 2BW3A 3V8KA 4BL0B 2M87A 4I98B 4A3FJ 1O3TA 1QBJA 3BCFA 4Z05A 3S1QJ 3SZTA 5BQTA 4LFUA 1PJRA 4LLGF 4OJ6A 1EE6A 2XASA 1D8JA 4URRA 2X53S 3G6EI 2ZXWH 3RZOJ 1JXSA 4D1QA 1E63A 2OK8A 2HLDA 4RPBA 3H5NA 5HS7A 4CA0A 3JRDA 1SD7A 2VPRA 3K10A 5HDKA 2EIXA 2XNDA 4HOBA 2HXIA 2IA0A 4YEIA 1H89C 1F4KA 2KIMA 2MBFA 1B59A 1TQMA 4DYRA 3BNWA 2F43A 2F1LA 1TWAJ 3EDPA 5EDNA 3P26A 3PQJA 4DW6A 3FWEA 2B63J 2CUFA 4MYTA 4WZKA 1H9GA 1QHGA 3RKWA 4LIVA 1SFUA 1MABA 3PETA 2J5OA 2OZ6A 1G7RA 5IYCJ 3ZBUA 3VNUA 3FPPA 2EV0A 2XGDA 2EB7A 1BR2A 4CYDA 2QEXI 2VC0A 1R1UA 1CQTA 1HOMA 4LBWA 1L1IA 3K7AJ 3LMMA 2CV2A 4L0YB 3VO1A 2PMHA 4A3GJ 3TOAA 2R7QA 4MO7A 3LSHA 1STZA 1IUFA 3B6AA 2NAZA 4OJPA 4P6VF 3BR5A 2GREA 3L2RA 3R6KA 2W48A 3S16J 2DFHA 1R5OA 1R36A 3TDZC 2EJRA 3SUCA 2PIAA 3OV8A 4U0VA 1K73D 4Y4RA 4CUGA 2ADUA 1D0YA 1KD1D 2XPVA 2K27A 2KLOA 3KRGA 1KU3A 3P9IA 1DARA 1NG6A 3I4NJ 3NARA 2RV8A 4YXWA 2ZTGA 2FX0A 3ASNH 1OOCA 1KQ0A 1TBXA 2CQQA 2LSOA 3BPVA 4CCJA 4KKTA 3RPUD 1ON2A 1VFCA 1N05A 5IYNA 2HDNB 4YFNF 2UV1A 2EWNA 4G8XA 5IT9Z 2R6HA 3KEWA 3C2BA 5DD8A 2R4GA 3MKWB 2VKHA 1D1CA 2ECBA 2NXNB 4JX6A 1MNMC 1D5VA 1N07A 3B82A 1OFMA 3FM5A 1DBGA 2OCCH 5JLXA 1DGRM 4WX9A 1SD6A 2EV5A 1T0FA 4J00A 5FD5A 4M3DA 1ZKGA 3CD6I 3H3UA 3M07A 1YX3A 2WC2A 2W4SA 2LR8A 3BT9A 2F1MA 2JN9A 2FA5A 4HV6A 4A3KJ 1IUYA 1J9IA 4NQWB 4HX8A 4FT8A 3W2GA 4NDLA 2BSAA 2GOXB 1X1CA 2EZHA 4FK8A 1ORKA 1EZGA 1Y0RA 2DA4A 4F91B 3BPXA 3OIPA 4KICA 4M9SA 3LSPA 3JREA 2E2HJ 1FSHA 2BSPA 4TMZA 2FF4A 1FTZA 4P2NA 3HOXJ 3JRAA 4A0ZA 3DP7A 1WSVA 2EFOA 2QUFA 1ETVA 3V42A 2FE3A 1F60A 2A5YB 3CCSB 1TYVA 2HQ5A 2M4GA 4CCLA 5FIUA 4ROXA 4AYBA 3HRSA 2ID3A 1TWCJ 4U0YA 4M72A 1JHFA 1HW5A 3HKZN 4XLPF 2ISZA 3LQEA 2COBA 3LSIA 4WXHA 4D5FA 2PI0A 1FSEA 1HA3A 2WBMA 1HG8A 3B8YA 4FCYA 3WGIA 3I54A 2GJKA 5L3CA 4UUSB 4EV0A 4MTDA 1YLFA 3FBIB 5F4JA 3RSNA 1ZK8A 4HW0A 2ESHA 3E6DA 4IJAA 5H6QA 2NTPA 3RZDJ 2LD5A 3VMWA 4AYBN 2KIFA 2ZTNA 4OPWA 1HKSA 1YYVA 2F2EA 3BP8A 2X6YA 4KA4A 3BJOA 2R7ZJ 2OTJI 1P92A 1H42A 2CYYA 4YAWA 1MMSA 2VFOA 2RVCA 3CZ6A 3VMVA 2TRTA 2XF6A 3U21A 3DEEA 1XC5A 2P0WA 5E1WA 3C1DA 3ZXSA 5ILVA 3ASRA 2HMAA 2BOLA 3FXUA 2Z99A 3VSVA 5CVRA 3LVBA 2EFGA 2M9HA 5LEKA 3L2WA 3GTGJ 2C5HA 3GIRA 2KJCA 3BZ6A 5LMZA 1VQNB 1O88A 4PC6A 3CCEI 1K79A 4F7ZA 3OEHA 1ZN2A 4W8QA 1ZR4A 2XRLA 4E7HA 3LQ6A 2CBXA 1XGOA 3HOVJ 2BYVE 1R58A 2E2IJ 3F23A 3S1NJ 1DDIA 2D45A 5K7ZA 3CCRI 1PYVA 2DOGA 2OBTA 1ZM3A 1VLOA 4Y3OA 1AKHA 3QYBA 1IRXA 4LK1F 2VL8A 4CSWA 1VQLB 2LY9A 4LBZA 4L9JA 1U8RA 3K4NA 1OGMX 5KVRA 1WJBA 1LKXA 3CUQB 4RGRA 9ANTA 4OZYA 3K1PA 1L3LA 1GO2A 4UUTA 2X1CA 2XC1A 1QGAA 3Q0VA 1HW2A 3ZZ0A 3AG1H 3W2IA 4IO9F 4OIRF 3AGPA 4X6AJ 2CH0A 5B1AH 1SMYF 4BBRJ 2OZUA 2KFDA 3CRZA 1G3SA 2DPUA 2HS5A 4I0BA 3VPRA 2W7ZA 1JHHA 2HKXA 4OOIA 2K9MA 5IYRA 1N8RD 3OSFA 2DO7A 4E70A 3JQQA 2QM3A 1LUJB 2IJLA 5EGOA 2KIQA 2DERA 1A31A 3IAM2 3SKBA 1GR1A 4A0YA 5JVGF 1IF1A 1GXPA 4GFBA 4G6IA 2VBMA 4RM3A 1LB2A 4NBQA 3GQAA 5K5RA 4WWVA 3J80Z 1F1ZA 3OS0A 1IN6A 2QGUA 3EUHA 3OYDA 5DV5A 4A0XA 4D5CA 3SYJA 4MTEA 4UHTA 3WTVC 3WY9A 4ZV4A 1VHOA 1KQSB 2VONA 1H85A 3IP4B 1PUEE 2E1RA 1S7OA 5FFZA 4X7EA 1FOXA 2JQ7A 5IK2A 3E5XA 3LQQA 1YJWB 2QBYB 2CW0F 2MC4A 3LNQA 1S72B 2P5VA 4H4KC 1G3WA 3ZMVA 4U88A 2V7TA 1TQIA 4IRIA 3PENA 2IW5A 2MH2A 2W24A 4O5VA 1U5TB 4AIJA 2ID6A 4IHSA 3S15J 4N9IA 2DMPA 4HNTA 5TGTA 1LEBA 1MNEA 1OISA 1Q9SA 1BJAA 2AHOA 2F5CA 5L3BA 3OYHA 1KJZA 3TO7A 1LM1A 2PJPA 1J0RA 5J40A 3FZVA 4HRIA 4C30A 3NRVA 1TC3C 1VQ7B 1YS6A 2XPUA 1OYIA 4IQ4A 4QLCU 1BX1A 3F21A 4Z4UA 2QXZA 3L2VA 3M8FA 3A4CA 1KYZA 1WSUA 5LGNA 3ABMH 3ECHA 5EEGA 1LDKB 2M5WA 1T95A 2W6IA 3O8GA 1EFRA 3GSIA 4AF7A 1G7SA 1YG2A 5J4VA 1DQUA 5A89A 4X1EA
chains in the Genus database with same CATH topology
3CF2A 3S93A 4HEA2 2KQRA 4JQFA 3EQNA 2X8KA 1WJFA 1BPLA 1O8FA 2IS2A 2V7FA 4BDYA 2W82A 2HDWA 1TT0A 3OFNA 1Z7LA 5CQGA 3NE5B 3SEQA 1VZ0A 2V26A 2HVSA 3LSKA 3CMMA 4HNUA 4II3A 3TBIA 3ZR8X 3OR1C 3ZCOA 2ELJA 5CKTA 2D3LA 1IDJA 1PXZA 3GVLA 1N78A 2K5CA 1V5EA 1WFXA 3GRHA 4BACA 3OYGA 2R7VA 4BQQA 2DCEA 1E0EA 1H8EA 2LYCA 2NTBA 1IB4A 4XNFA 3ZQQA 2VIXA 2WY7Q 2R7RA 2XOKA 2Q2EB 2JVHA 2IS1A 3HOTA 2GJPA 4ZJZA 2LC2A 1PE9A 2X51A 4B3FX 1UG0A 4TKOB 1XG2A 3VWBA 1Z3YA 4JOMA 1KCCA 4E7IA 3DPUA 4DNRB 2RNGA 4BEHA 1E3ZA 2KRHA 4NK6A 1O8DA 3OOCA 3OYLA 3DDYA 2XDVA 1NRKA 3FY3A 1T0FC 4XLFA 1D1BA 3QYEA 4BE1A 4NK8A 1Z21A 2V4DA 4XLEA 4YRVA 3PUBA 3VSKA 3GBGA 2RQQA 3VSTA 2WADA 3KEYA 1KCDA 5FROA 4ZTFA 4C2TA 1D0ZA 2WZPP 4ZDPA 4LITA 3A3BA 1NG7A 1R6RA 1WJEA 1YE9A 3HUGB 3JU4A 4OZYA 2HPIA 2M3AA 2OV7A 4C2UA 5FL7A 2VB6A 2NSPA 1IA5A 4CCNA 3ONQA 3EUAA 3UR3C 2LY2A 1VLYA 1OR7C 3MMYB 4FASD 3LL7A 2HPMA 3AL0C 1V0EA 4TT3A 2O17A 1X19A 4OAYA 3HXLA 4F93B 4B48A 2UVEA 3G2BA 2LREA 4HG2A 3SDBA 4XLHA 3IAS2 2V1NA 4G7WA 3DPLC 3C2HA 2MYSA 2DXIA 1AIRA 3AFHA 1BLIA 2E5NA 2Q1ZB 2W00A 1NBMA 1KMHA 2ZZQA 2IGOA 1ZELA 2KHMA 3FKJA 3N05A 1Z3XA 3K4JA 4NUBA 1H8HA 1UD3A 4RLQA 3EQOA 3OE7A 3OR2C 4XORA 4XMYA 1W9XA 2WY8Q 4YZAA 2LBFA 3T56B 4HPQA 1KONA 3ZIAA 4G7XA 2GOMA 3DQVC 3SZGA 1FX0A 2PYHA 1J09A 3K70D 3G05A 2L9SA 1V5GA 5LD2C 2CV0A 2O0WA 2XF7A 4B3GA 1EA3A 1E79A 3K70C 4XKCA 2PJRA 3OYBA 4II2A 2IGKA 2V9KA 2JUGA 4XKBA 1O8GA 1Y6IA 1S9HA 4DIQA 5HLTA 2JJ2A 2XC7A 3KYLA 2CS3A 3EUKL 3AKZA 4ITVA 5KNLA 3OYKA 3OS1A 3HL2A 1E1QA 3MD2A 4LG3A 5KCMA 4BJTA 2JJ1A 2ZSHB 1H80A 3PL8A 2VBKA 1WTHD 4DGWB 3DKYA 4BE0A 4E7JA 3DTKA 2E1MB 2L9NA 4P22A 1QCXA 1PLUA 2X1EA 1WMRA 2A6TA 3OOUA 5CQEA 3OYJA 2INUA 2CUZA 2UUZA 2PYGA 2WAEA 4BXFA 4NNJA 2QY1A 4PJLA 3DU6A 5HNFA 1D0XA 2VQLA 3GVJA 5HVQC 4HIZA 3OYCA 4E4HA 3H9GA 4TSFA 3W3CA 3T53B 1X0CA 1E3XA 3OMYA 4MLOA 4XOPA 3PNTA 4B44A 1JRGA 3BC9A 1UELB 3OL3A 1Y56A 2OUMA 3LNNA 2PMZA 4N4OB 2PECA 2XF5A 4GQNA 3BG6A 1O8JA 2K3PA 2CV1A 3I3LA 4DNTB 1E1RA 2XZLA 2QX3A 4DOZA 3ZPPA 3E1SA 2LOOA 1MMAA 3CJQB 3SEZA 3VYSB 1E43A 1X4PA 2MD0A 4DK1A 1O8MA 3BCDA 4BDZA 2X1DA 1CZFA 4QPOA 3HAGA 1MNDA 1U0JA 1WJCA 1MW7A 2M7AA 1WJDA 3HKZA 4PJJA 5CPRB 4BEHB 3GQ9A 4XM3A 1BOBA 4KT6A 4BJ6C 2VJ5A 4KKSA 4XONA 4XR6A 2IQ7A 3DKXA 3HPHA 2Z8GA 1HVXA 4PJMA 2FUG2 3SYTA 4W8TA 2JA2A 1TZLA 2HZDA 2GK7A 2W1OA 3RTRA 3D5RC 4BE2A 3W2AA 2BVMA 2WJVA 2V4JC 4E6KG 4OJLA 1O8EA 3LSMA 2R7UA 2QKLB 3JURA 5LFAA 1T5EA 3MKZA 3EUHC 4EATA 1RMGA 2NSTA 3T9GA 2F4IA 2Y0SA 2E5ZA 3H35A 4RM2A 4BU2A 4KITB 3LFUA 1O8IA 3A3GA 4YZQA 3H9QA 2W6JA 4MR0A 4IQJA 2XSJC 1WJ5A 1QHHD 3UW0A 1VF7A 1SKYB 2VKDA 4IX7A 4OWRB 2DJIA 2EWEA 2ZZEA 3GQBA 4J01A 2E1BA 1DP3A 4Z06A 1K28D 3D5LA 5HOOA 3DTEA 4F92B 2HU9A 3HC7A 1V5FA 2VJJA 3NWSA 3OYAA 2XZPA 4RLFA 4AVZA 1LFPA 2Z16A 1OHHA 2LBFB 4C2LA 2Z6BD 4KKUA 2F6CA 4F52A 4E7LA 2ZFUA 4CH7A 2DT7B 3MKYB 3CESA 3I9V2 3QYFA 1UD8A 2KPMA 2HNHA 2BW3A 4BL0B 4E7SA 2L2OA 3FDYA 3BC8A 2PJRB 3BCFA 2VBEA 4Z05A 3A2KA 2VPLA 2R7WA 3PJRA 3OW7A 1PJRA 2ZSIB 2IXSA 4OJ6A 1EE6A 4YELA 4URRA 4ZDLA 1X1BA 3PNVA 2X53S 5AMVA 4N4NB 4W8SA 4D1QA 2RREA 3BCBA 2HLDA 3BCAA 4BS9A 4Z03A 3VSLA 3H5NA 3A35A 2E1MC 4NC7A 3VYUB 1SFKA 3K10A 4CA0A 2XNDA 2ZZFA 2F5VA 2X3HA 2VASA 3OYNA 2F43A 4PJNA 4XD7A 2WAQA 4PK4A 3L2UA 1W36D 4E7KA 1QHGA 4LIVA 1W0KA 1JI8A 1MABA 1HZEA 2LG4A 2AQEA 2LRDA 3DLAA 3QOEA 1W36C 1KZLA 1G8XA 4ZYAA 2R7SA 3FPPA 1BR2A 4U7BA 2I8DA 3TMOA 5DN6A 2NTQA 2M0MA 2NOJB 3LMMA 4XQFA 2CV2A 4OZZA 1N75A 3VSUA 2R7QA 3H9JA 1UD4A 3LSHA 1WJAA 2M5SA 1WP6A 4OJPA 4YEJA 5C1CA 3L2RA 3SUCA 4ANJA 4C9YA 4Y4RA 4CUGA 1D0YA 1RWRA 4X0GA 2KLOA 3KRGA 4HWVA 4XKVA 1NG6A 3HPGA 5FRNA 3F9KA 2DOAA 2NT9A 5FRMA 4YXWA 2ZTGA 1UD2A 3HOSA 1OOCA 4I84A 3S8PA 1UD6A 4U49A 4B43A 4CCJA 2M7BA 3NWTA 3RPUD 4KISA 1UD5A 4KKTA 2UVFA 3M8JA 4XOTA 4XN0A 2W7NA 1D1AA 5HNHA 2UV1A 2R7OA 4UZUA 2HVRA 4XLAA 1LVKA 1DGWY 3KEWA 4Z1MA 2WSSA 2M4KA 3HG9A 4XKWA 1OLTA 2R4GA 2MFZA 2OC6A 3PNYA 2VKHA 3W2WA 1D1CA 3MKWB 4MXNA 1OFMA 4PSXA 4DJAA 2L7KA 1I18A 1DBGA 2XGJA 5HKKA 1DGRM 2NT6A 4CCOA 4W8RA 4J00A 3OWTA 5JHFA 3QODA 4BJ5C 3M1CA 1MMGA 1YX3A 2LY1A 3T51B 2W4SA 2F1MA 2O5RA 1BMFA 1BR4A 2IS6A 2O0VA 4NQWB 4KJZA 4U87A 4PFOA 2CW8A 1N77A 4YZ0A 2GOXB 1X1CA 2D3NA 1OFLA 3CJRB 3OS2A 4F91B 2VJ4A 3OIPA 1G59A 2BSPA 4F55A 1COWA 3ZRGA 3VYRB 1ERDA 1VJSA 3EPZA 2O1DA 3LMWA 3V42A 3S32A 2CW7A 2UWMA 1PKVA 1KTWA 2V6EA 4EW9A 4OJOA 2VLAA 2M4GA 4CCLA 4PFPA 3GQ7A 2X6WA 4DBRA 3OYEA 3BLYA 1HA8A 3FKSA 4AYBA 4ZTJA 2JSPA 4PMHA 2BW3B 2X85A 3LSIA 1NHCA 1HG8A 3K4LA 2WBMA 3C2GA 3B8YA 1OB0A 2GJKA 3PSIA 4AU7A 2CMPA 3K4BA 3FBIB 3DU5A 2K9LA 4BGDA 1W0JA 3RSNA 4BQNA 2NTPA 4E0FA 4PSWA 3K6GA 3VMWA 2ZTNA 4ZDOA 4CZCA 2VQHA 2V31A 4B47A 4IKFA 2VQCA 2KL4A 2Z1DA 2WAFA 2X6YA 3H5RA 2XAUA 4G6TB 2VQGA 3GQ8A 1O8HA 3CZ6A 3VMVA 2R9VA 2XF6A 3BG7A 3U21A 3DEEA 2NZMA 2A5WA 2P0WA 3KX2A 3ZXSA 4D9JA 3E0JB 4HSRA 1I8DA 3S3NA 3H94A 4ASUA 2BOLA 4ZC3A 2X6XA 3VSVA 4P5OA 1WPCA 2ZXIA 4YZXA 3OPOA 3L2WA 1OGOX 2CFOA 3FBNB 1JTAA 1QJVA 1O88A 2KVOA 3OEHA 1FMVA 4W8QA 2WB1A 4E7HA 2WJYA 3K4MA 3A1YA 3CP8A 3RCOA 3OY9A 1P9QC 4NC8A 2KMUA 1PYVA 1GQ8A 2JIZA 1O8KA 3UNGC 4Y3OA 3QYBA 1IRXA 1V0FA 4RMNA 3OYIA 5CDFA 2WA0A 2VL8A 1AA7A 4CSWA 4FETA 3OAAA 3LSGA 3K4NA 1OGMX 3DTIA 1WJBA 1LKXA 4JMQA 3TL4X 2MABA 4BUPA 2IGNA 2R7XA 2GK6A 1SAUA 2BVLA 4XN3A 2IGMA 2X1CA 3K4KA 2IS4A 1BHEA 3OIQA 1O8LA 3ZGKA 2VJIA 2HVQA 3VYTB 3ZSCA 3OYFA 2KP6A 1UAAA 2CH0A 1GLNA 3W2VA 3WWGA 3OL4A 2KZVA 4DK0A 4B3XA 4HSTA 2DT6A 1K5CA 3PSFA 2K9MA 3DPTA 4PUSA 4IZZA 3WQZA 3IAM2 4QPQA 3DWLE 4G6IA 2GJRA 2KDOA 1FMWA 2XZOA 1VBLA 4RM3A 2VBMA 3GQAA 2VXZA 4U4BA 2INVA 1X4OA 1X1AA 4P1WA 1MMDA 3OS0A 3VR6A 1RU4A 3GVKA 5KHDA 3OYDA 3AL0B 2O04A 4CCKA 2V7QA 4L8JA 3BH4A 2LZJA 2R7TA 2CK3A 5IK2A 3IP4B 4OAZA 2JDIA 3S3MA 4Y33A 1BR1A 3OEEA 2MC4A 2WPDA 1K6YA 4H4KC 2KRCA 1X1DA 3RQ4A 2DIEA 3FHNA 4OJ5A 4F3QA 2AQFA 3S3OA 2VXDA 3B4NA 4HNTA 1MMNA 4GRIA 5TGTA 1MNEA 2ZZGA 2ODLA 3IUOA 3B90A 1QU3A 2CUJA 1YX5A 3H5AA 3OYHA 3ZPNA 4HRIA 3D5SC 4C30A 2Z2SB 1BN8A 2L5QA 4CCMA 4R79A 2ZXHA 2E60A 4IQ4A 4XL9A 2LH9A 3J7AY 2QKMB 3VDXA 3L2VA 2QXZA 3PFYA 2HQAA 3A4CA 3CP2A 4DBQA 1DBOA 3L2QA 4E7ZA 3H0DA 4LIUA 2QE7A 4FXUA 1LDKB 3K4CA 5C1EA 1T95A 4XLCA 2JVGA 3OYMA 1EFRA 2W6IA 1IDKA 4BQOA 1DQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCX A;  3GQ8 A;  1O8H A;  3VMV A;  1PLU A;  1WMR A;  2NZM A;  4NK6 A;  3EQN A;  2INU A;  1O8F A;  2PYG A;  2QY1 A;  2X6X A;  3VSV A;  4YZX A;  1OGO X;  1X0C A;  2NTQ A;  1JTA A;  4XOP A;  4XQF A;  1QJV A;  1JRG A;  4OZZ A;  3VSU A;  1O88 A;  1IDJ A;  1PXZ A;  4W8Q A;  4OJP A;  4YEJ A;  5C1C A;  2PEC A;  3GRH A;  1O8J A;  2NTB A;  3SUC A;  1IB4 A;  4XNF A;  2QX3 A;  3ZPP A;  1O8K A;  1GQ8 A;  1RWR A;  1PE9 A;  3KRG A;  4HWV A;  4XKV A;  2NT9 A;  1O8M A;  4I84 A;  1OOC A;  4U49 A;  1CZF A;  1XG2 A;  1OGM X;  2UVF A;  1KCC A;  4XOT A;  3GQ9 A;  4XN0 A;  4XM3 A;  4XN3 A;  4XON A;  4XR6 A;  2IQ7 A;  4XLA A;  1O8D A;  1BHE A;  1O8L A;  2Z8G A;  3FY3 A;  2VJI A;  4XKW A;  4MXN A;  4XLF A;  4W8T A;  4NK8 A;  3ZSC A;  4XLE A;  1OFM A;  2NT6 A;  3VST A;  1DBG A;  3WWG A;  1KCD A;  4W8R A;  4OJL A;  1O8E A;  1K5C A;  4OZY A;  3JUR A;  1RMG A;  2NSP A;  2NST A;  3T9G A;  1IA5 A;  2O0V A;  1O8I A;  1VBL A;  2VBM A;  3GQA A;  4U4B A;  2INV A;  4YZQ A;  4YZ0 A;  4MR0 A;  2O17 A;  1RU4 A;  3UW0 A;  1OFL A;  2UVE A;  2O04 A;  4XLH A;  2EWE A;  1AIR A;  2BSP A;  4Z06 A;  2O1D A;  3LMW A;  1KTW A;  2VJJ A;  4EW9 A;  4OJO A;  4AVZ A;  3GQ7 A;  2X6W A;  3EQO A;  4C2L A;  4XOR A;  4OJ5 A;  4XMY A;  3B4N A;  4YZA A;  4PMH A;  3B90 A;  2ODL A;  2X85 A;  1NHC A;  1HG8 A;  2PYH A;  3B8Y A;  2VBE A;  4Z05 A;  2O0W A;  1BN8 A;  4XL9 A;  2QXZ A;  4OJ6 A;  1EE6 A;  4YEL A;  4URR A;  5AMV A;  2NTP A;  1O8G A;  4W8S A;  1DBO A;  3VMW A;  4Z03 A;  5C1E A;  4XLC A;  1IDK A;  2X3H A;  1H80 A;  2VBK A;  2X6Y A; 
#chains in the Genus database with same CATH topology
 3IKV A;  1B72 B;  1JUM A;  5HLH A;  4BQA A;  3CF2 A;  4IHY A;  3S93 A;  4HBL A;  4G6D A;  4JQF A;  1DP7 P;  3RIR A;  2V7F A;  3OZU A;  2W82 A;  4OOV A;  5J47 A;  1TT0 A;  2OD5 A;  3JQP A;  1Q82 D;  2K9S A;  5CQG A;  1VZ0 A;  3HSF A;  2GM4 A;  4I02 A;  2HVS A;  2P5L C;  2YR2 A;  3PM1 A;  4J0Q A;  4HNU A;  3ZR8 X;  2F5D A;  2OTL I;  2AXL A;  3OR1 C;  1FPQ A;  1WQ2 A;  1YI2 I;  1CNE A;  3GVL A;  2FSW A;  4M9X A;  4QSH A;  1N78 A;  4EMS A;  2PLY A;  3KP4 A;  2W84 A;  4QHY A;  1V54 H;  2DCE A;  3F3X A;  1MJA A;  4KN4 X;  1YW7 A;  4Y9U A;  4XNF A;  3ELK A;  2WY7 Q;  3F8N A;  1KK1 A;  5F4M A;  1QPM A;  3CLO A;  4X7D A;  4NHJ A;  2ZIT A;  4ZJZ A;  4IOC F;  2X51 A;  2YWE A;  2M30 A;  3KCC A;  2K9Q A;  4BBS J;  1Y8Q B;  3TO9 A;  1WRJ A;  3CUQ C;  4YFX F;  1GXQ A;  1T98 A;  3SFI A;  1FX7 A;  4TKO B;  5BPI A;  4RAG A;  1Q1V A;  1ZRE A;  2B7E A;  4WXC A;  5JHU A;  3DPU A;  2Z9O A;  2BVN A;  3FIW A;  4DNR B;  4LG0 A;  2RNG A;  4BEH A;  5D5V B;  1UMK A;  3BG3 A;  3OYL A;  3DDY A;  2W57 A;  1NRK A;  2A61 A;  4XLF A;  4BE1 A;  4X0C A;  4U7D A;  1WGX A;  3TO6 A;  3WTX C;  1N25 A;  3RPU A;  4L5E A;  3PA1 A;  1MRZ A;  3TW7 A;  2CGP A;  3Q9S A;  3TOB A;  2DY1 A;  2M45 A;  1O3S A;  1NG7 A;  2P7V B;  3HUG B;  4A5N A;  4AUX A;  3JU4 A;  4C2U A;  1TWG J;  1W7P B;  2R93 J;  1SFX A;  2NVQ J;  2IVM A;  2EIK H;  4M0L A;  2CRV A;  4L9N A;  1OR7 C;  4FAS D;  1YIT B;  4FTH A;  3R61 A;  2V5I A;  1GDT A;  2BM0 A;  4RDU A;  2IBD A;  2ME6 A;  4HDV A;  1HCR A;  3G2B A;  4YHB A;  2UVE A;  1BM9 A;  5E8I A;  4M6X A;  3SJZ A;  1NK3 P;  1AIR A;  4FX0 A;  3AFH A;  3GX4 X;  1XS9 A;  1BLI A;  1L0O C;  2W00 A;  2PN6 A;  5DSZ A;  2IGO A;  2K7L A;  4ZYD A;  3FKJ A;  1LPQ A;  3K4J A;  3HOZ J;  1U5T C;  1BI3 A;  3G3Z A;  2EZL A;  4PDK A;  3MFK A;  3ONY A;  2L54 A;  1PJ7 A;  1TNS A;  2ZME B;  1YFH A;  1FND A;  3OE7 A;  2WWY A;  4M9Z A;  1W9X A;  3QE2 A;  2WY8 Q;  1FRQ A;  2DK8 A;  3FF5 A;  4HPQ A;  2CJJ A;  2VBS A;  2VI6 A;  1LE8 A;  2KDZ A;  2GOM A;  3DQV C;  4HV5 A;  1FX0 A;  3G05 A;  4EJT A;  4M73 A;  1RC9 A;  4BY1 J;  2O0W A;  4B3G A;  3RKY A;  1MBJ A;  5LRR A;  3K70 C;  2DOD A;  1P4W A;  3BJ6 A;  2VFP A;  4XKB A;  1S9H A;  3O2P E;  2CSO A;  1LVA A;  2XC7 A;  3RKQ A;  3W2H A;  5L46 A;  3BH7 B;  3AKZ A;  4ITV A;  3PSZ A;  3MD2 A;  1BIB A;  3KE2 A;  5DCM B;  1WTH D;  1XMK A;  3DKY A;  5HDG A;  3KIO A;  4BE0 A;  4NBS A;  2E1N A;  4UVB A;  1UJ8 A;  3D0S A;  1DDN A;  1QCX A;  4BY7 J;  1D3Y A;  2DOE A;  3OKX A;  4D7N A;  2A6T A;  1WMR A;  2CG4 A;  1R71 A;  2VKV A;  3T5X A;  1VQ5 I;  4BXF A;  2C5B A;  4L18 B;  5IY5 H;  2QTL A;  1QRC A;  3LSR A;  5E3M A;  4K1X A;  2G7U A;  4A3J J;  3ZQG A;  4TSF A;  4X07 A;  1JGG A;  1IN8 A;  3GFJ A;  1I6H J;  3V4G A;  1LLW A;  2GWR A;  1BJK A;  1JB9 A;  5FKL A;  2O3F A;  2EFP A;  2RC4 A;  5GV8 A;  1HSJ A;  3BG6 A;  1Y8R B;  3TGN A;  1QG0 A;  3K69 A;  2GBY A;  3DBH B;  2LMD A;  2FBI A;  3UKG A;  1X1P A;  1NDH A;  3CXC B;  2LOO A;  3CJQ B;  4UB8 C;  2ZKZ A;  1PP8 F;  3SZP A;  4BYY A;  2EH3 A;  2E7W A;  2STW A;  3AG4 H;  1ZH5 A;  3ZMD A;  1O8M A;  4BDZ A;  2X1D A;  1REP C;  1CZF A;  2MW8 A;  2DW4 A;  3HAG A;  4AC0 A;  5GPC A;  1HLV A;  4ZGQ B;  4G9Y A;  4KT6 A;  3FX3 A;  3PUF A;  2VJ5 A;  4Q4Z F;  4XRS G;  1YJN B;  2IQ7 A;  4RDJ A;  5KW9 A;  2Z8G A;  1M90 D;  4PAA A;  5ICE A;  1GVJ A;  2ELH A;  3RTR A;  3D5R C;  3W2A A;  1F43 A;  5J1Y A;  2Q0O A;  2W85 A;  3HHH A;  2DYI A;  1MBK A;  3BY6 A;  4LD5 A;  1WKM A;  2WJV A;  2ME0 A;  2C2W A;  3JUR A;  4UUV A;  2ZL6 A;  1WXR A;  2E71 A;  3MKZ A;  5F0C A;  2IA2 A;  2L0K A;  5TR9 A;  2H6B A;  2Y0S A;  4KIT B;  3CMY A;  4RM2 A;  4S05 A;  4MQ9 F;  2A6H F;  4YZQ A;  2Y2Z A;  3BTJ A;  1U2W A;  2XSJ C;  4R8H A;  1QHH D;  4GGG A;  3ONU A;  3ZZT A;  3UW0 A;  2XAQ A;  3LYC A;  1USS A;  3WHB A;  3E20 A;  1WDT A;  2EWE A;  4P9F A;  2FXA A;  2ZZE A;  3U9G A;  3HOW J;  3IKT A;  5EMN A;  3ECO A;  1P4A A;  2FBH A;  4OIO F;  4MEY F;  1DP3 A;  3D5L A;  5HOO A;  4ZYH A;  1K28 D;  4F92 B;  4ZYE A;  2IRF G;  3ML3 A;  1V5F A;  2ZME C;  3MCZ A;  3NWS A;  5CVV A;  2FNP A;  5D5U B;  4AVZ A;  1B2R A;  1OHH A;  2JN6 A;  2LBF B;  1UHW A;  3LO8 A;  4RD0 A;  1QA1 A;  2CWE A;  1B72 A;  2DK5 A;  2F6C A;  3EYY A;  3CF5 F;  4E7L A;  3ZQH A;  3I9V 2;  3SEJ A;  1X2M A;  1MH3 A;  2DPD A;  2VBE A;  1BI0 A;  2R5Y A;  2H8R A;  3ROU A;  2GA2 A;  2VPL A;  1IJW C;  2R7W A;  3PJR A;  4GCV A;  1VQ9 I;  1UHM A;  2M1B A;  5AMV A;  3PNV A;  3FXK A;  4N4N B;  4W8S A;  3DFG A;  4I76 A;  3BCB A;  3BCA A;  3VSL A;  1W35 A;  3GZ5 A;  3LFK A;  3A0H C;  3MVP A;  4NC7 A;  4WK8 F;  4YII A;  2F5V A;  4H0E A;  1G7T A;  1QVG B;  1KGS A;  1GVD A;  2Y31 A;  1R4M B;  2AO9 A;  2CQN A;  2G7H A;  2ZJP F;  4RAZ A;  3F8C A;  4PJN A;  1RZ4 A;  1ACI A;  5J4Y A;  2G9W A;  1Z91 A;  2Z3Y A;  4OIP F;  1W0K A;  5J3L A;  3A0B C;  3COA C;  1CGP A;  1FOY A;  2AQE A;  3A8I A;  2EA4 A;  1W36 C;  1O4X A;  1KZL A;  2R7S A;  1NB0 A;  3IWZ A;  5DN6 A;  3G4S I;  2GLO A;  4A69 C;  2GQF A;  1IHM A;  1HXD A;  1XG1 A;  3R0J A;  4U0W A;  4I09 A;  1PP7 U;  3K2Z A;  1UD4 A;  1MKM A;  1JT0 A;  3ZMT A;  1VQO I;  4YEJ A;  4IXA A;  2CQ7 A;  3KP7 A;  1UZC A;  2A6E F;  2V7U A;  3BTC A;  4P6Y A;  3H92 A;  3OZV A;  3GFL A;  3ZMS A;  3HEF A;  4YG2 F;  2VBX A;  1FRN A;  1TYW A;  4CXF A;  2YX4 A;  3IWF A;  3KLO A;  3SHF A;  4DZP A;  1RWR A;  4HWV A;  1TYX A;  1EH7 A;  2FNA A;  1K4Z A;  1J59 A;  2BF4 A;  5FKM A;  1RUN A;  3CDL A;  5FRM A;  2J7K A;  3NQO A;  3HTU A;  4B43 A;  5DS9 A;  4FX4 A;  3NWT A;  1S29 A;  2L7Z A;  4KIS A;  3M8J A;  4RGX A;  4HLY A;  5IYW A;  2QTZ A;  4Z4V A;  4V19 K;  4UVA A;  5ERI A;  2HVR A;  1LVK A;  1NTC A;  3IHU A;  2M4K A;  3HG9 A;  4XKW A;  2OC6 A;  3BH6 B;  3G71 B;  3ZUG A;  2EBI A;  4PSX A;  1YX2 A;  3ERE D;  5B6I A;  1I18 A;  2XGJ A;  4KNY A;  5E3L A;  2EA2 A;  1ODD A;  4W8R A;  4CZZ A;  2TDX A;  3BZK A;  5LGU A;  2QEN A;  3OWT A;  4B4D A;  3IH3 A;  3F6V A;  3CME I;  3T51 B;  5K1Y A;  5EG0 A;  1TL8 A;  1MDM A;  2O0V A;  4IW3 B;  5BPD A;  5FLX K;  2MLG A;  2VBY A;  3KYD B;  4PFO A;  2QSG X;  3KLN A;  2BMW A;  3CMA B;  3GME A;  1OFL A;  3OS2 A;  4JRA C;  4MIM A;  4V02 C;  2VJ4 A;  1WI3 A;  4UY8 I;  2L9R A;  1VQ4 I;  4RAF A;  4O3M A;  2BGI A;  1EFU A;  3GZN B;  4F55 A;  5F0F A;  3ZRG A;  2VFN A;  3EPZ A;  4HE6 A;  2O1D A;  2EIM H;  1KTW A;  4RB0 A;  2V6E A;  1I39 A;  2ZJ2 A;  4ACB A;  4EW9 A;  2X6W A;  1W5C C;  1TLL A;  2X3U A;  1VTN C;  1C0W A;  4ZTJ A;  5HXB A;  1KTV A;  2JSP A;  1OCO H;  1JT6 A;  2CF4 A;  4GXO A;  3BY1 A;  5FA6 A;  4ASN A;  4M53 A;  4YDT A;  1QZE A;  1QGP A;  1X3W B;  2C6Y A;  3EQL F;  1KQ8 A;  4AU7 A;  1B23 P;  3OZW A;  3W5U A;  4Z4Y A;  5DM6 F;  4XRF A;  1IV6 A;  4Q5S F;  1D8T A;  2VFQ A;  3RYR A;  1ENH A;  4CZC A;  2EPF A;  4Z2Y A;  4MYU A;  3ZZU A;  2BX6 A;  3J81 K;  3AVW A;  1VQP I;  5B5E C;  1U8B A;  1W5S A;  4P9U A;  3W6V A;  1WOS A;  4WZE A;  5JLV C;  1Y0U A;  1O8H A;  3LWF A;  2GXA A;  2R9V A;  1FWZ A;  1IJF A;  1EA0 A;  4ASU A;  5C44 J;  3RQI A;  1OFC X;  4KH3 A;  1PJ6 A;  3F72 A;  4CQJ A;  2DTZ A;  3PO3 J;  4P5O A;  4D0P A;  3GF2 A;  2QLZ A;  4R1H A;  3P7N A;  3MEX A;  2CFO A;  3FBN B;  4PGH A;  1ZHF A;  4AID A;  3V76 A;  2BHY A;  1B9M A;  1ZTR A;  3CPX A;  2WB1 A;  3DKW A;  3HOU J;  4RDL A;  4OU0 A;  3DBL B;  4Q47 A;  4RCY A;  2HGC A;  4IOA F;  3OY9 A;  2YS9 A;  1Z9C A;  2KMU A;  1O8K A;  2E19 A;  5F27 A;  4IHW A;  2QYO A;  1QFJ A;  5CVI A;  4I7H A;  3CCU B;  4YFO A;  2WA0 A;  4A3M J;  2QQA A;  3HYI A;  4FET A;  3GTJ J;  3OAA A;  4PAB A;  3DTI A;  4WZT A;  2F5F A;  2N8G A;  5FB2 A;  2EIJ H;  3TL4 X;  2R7X A;  3PUN A;  2IGN A;  1FDR A;  4H9G A;  5IP6 A;  1VQM I;  2IGM A;  5JFR A;  3K4K A;  1FIA A;  3CCM I;  1WI9 A;  3OIQ A;  5EEH A;  1R4N B;  2EK5 A;  1TQP A;  1LDD A;  1BIA A;  4ZCI A;  5CLS A;  3GCM A;  2BM7 A;  4XRS A;  3CO7 C;  3I56 B;  5GV7 A;  4PC3 A;  3WWG A;  1FIP A;  5D8K B;  2BGJ A;  4DK0 A;  2HTS A;  1SVM A;  4B3X A;  4Z6Y A;  3PSF A;  1EP3 B;  3BQZ A;  5DS0 A;  3U2Q A;  1MBF A;  2XKO A;  4PUS A;  4ENK A;  1Z0X A;  4RB1 A;  4AIK A;  4M4S A;  3WNC A;  3AVU A;  3AVX A;  1YW9 A;  2GXG A;  2KDO A;  1FMW A;  1T39 A;  2HOT A;  3RDI A;  2ESN A;  1QGZ A;  1VBL A;  2VXZ A;  4U4B A;  1MZB A;  1B4A A;  1X4O A;  2E35 A;  2OPT A;  2Q6I A;  3QRF F;  2M2E A;  3GTK J;  1FYK A;  3EYI A;  3AL0 B;  1BI2 A;  1NB9 A;  4A5M A;  3BH4 A;  2HYJ A;  3WTW C;  2LZJ A;  2KT0 A;  4QV2 A;  2VBT A;  1O7L A;  2E1O A;  1D2E A;  2W25 A;  3H9N A;  3QAH A;  3S3M A;  1WU8 A;  1BR1 A;  3TDU C;  3OEE A;  1WH7 A;  1K6Y A;  2VBZ A;  2L9V A;  1DU6 A;  2DIE A;  2Q6K A;  3FHN A;  4F3Q A;  2JRM A;  3S3O A;  3CDH A;  3WE2 A;  1MMN A;  4GO1 A;  4GRI A;  3CCL B;  4I99 C;  3H5A A;  1JKO C;  1IRF A;  2DA7 A;  1EFC A;  2QVO A;  1SFE A;  3MAJ A;  4M6Y A;  1XDU A;  2HWV A;  4X7C A;  2CRG A;  2Z2S B;  3DV8 A;  5FGM A;  4B8X A;  2OU2 A;  2NVU B;  5F1J A;  3BR0 A;  3KL9 A;  2ZXH A;  1YIJ B;  3J7A Y;  2QKM B;  3L00 A;  1TVC A;  4JX4 A;  2HQA A;  2RDP A;  5L3E A;  4DBQ A;  3X2Q H;  1VF9 A;  2F4O B;  4LIU A;  2QE7 A;  2M34 A;  1IN4 A;  5H6R A;  4XLC A;  6PAX A;  4A6D A;  2KZG A;  3AG2 H;  5CVU A;  4BQO A;  3AGQ A;  3MCA A;  3B02 A;  4RD4 A;  3N6Z A;  4FE4 A;  1OYW A;  4OOS A;  1QVU A;  2O6W A;  2YUS A;  3J7Y J;  4BNC A;  2YWF A;  3CC4 I;  2X8K A;  1WOO A;  1FLI A;  2IS2 A;  4BDY A;  1FNB A;  2PLF A;  2JUC A;  3ZBT A;  3Q5F A;  3OOP A;  3NB2 A;  3NE5 B;  1KYW A;  1VHE A;  4KT5 C;  2DFI A;  4II3 A;  1VQ8 I;  3QPS A;  4RGU A;  2ELJ A;  5FKO A;  5CKT A;  3HB9 A;  2LDU A;  4M1K A;  2FQ3 A;  2OAZ A;  2YU9 J;  3L1P A;  1P2F A;  1WFX A;  3GLX A;  2COM A;  2Y9Z A;  3GRH A;  1YRN A;  2D5V A;  1E0E A;  2LYC A;  2QQ8 A;  4PJ0 C;  2NTB A;  3ZQQ A;  2XOK A;  1ZG5 A;  3LA3 A;  2Q2E B;  2V7X A;  2X48 A;  2P5K A;  2IS1 A;  1YO5 C;  3HOT A;  2GJP A;  3OJX A;  2XT4 A;  1OFD A;  2NPF A;  1IJE A;  5FFX A;  4X8I A;  2BEO A;  1SAX A;  1R00 A;  2HTJ A;  3HDD A;  4B3F X;  4ZZD A;  1XSX A;  2YU3 A;  3R4K A;  2C4T A;  3CW2 A;  1W2B B;  2DET A;  2J8I A;  5CJ9 A;  1K78 B;  1Z3Y A;  1E3H A;  1U2R A;  2EZK A;  1YHQ B;  3Q39 A;  1Z6T A;  2F4N A;  3WNB A;  5IYD J;  1IDY A;  1P6R A;  3NAU A;  3JAM K;  2ZL7 A;  3OOC A;  1YIO A;  1O57 A;  2XDV A;  3H09 A;  3J7Z I;  5D6F A;  4S04 A;  4Y15 A;  3G73 A;  2V4D A;  1IG7 A;  2DN0 A;  2P6T A;  3B78 A;  3BTL A;  1TWF J;  2F5E A;  2RQQ A;  5C4J J;  5DDG A;  4BPR A;  3VST A;  1KCD A;  1R5I D;  4ZTF A;  3WG7 H;  2WZP P;  1D0Z A;  1BC8 C;  4ZDP A;  4UZF A;  2G0Y A;  5A2Q Z;  2PMD A;  1F9N A;  5FL7 A;  1XCB A;  1ZGJ A;  3W2F A;  1IA5 A;  4RJL A;  2OQR A;  2YUH A;  5F0H A;  2DOF A;  3EUA A;  2LY2 A;  5DEQ A;  2NV4 A;  2FQ4 A;  1PJ5 A;  3AL0 C;  2XEX A;  5JLW A;  3MQ0 A;  4OAY A;  3S1R J;  1R5N A;  2VNK A;  3H0G J;  4IHT A;  5M3M J;  1XGM A;  2V1N A;  3I64 A;  4GYG A;  3AST A;  2MYS A;  2O0Y A;  2HCJ B;  3JRB A;  1MBE A;  2Q1Z B;  5F64 A;  1NBM A;  2ZZQ A;  1R49 A;  2HYG D;  3N05 A;  1R1T A;  4C3I J;  1H8H A;  4EM2 A;  1UD3 A;  5M5W J;  2P6S A;  2H1L A;  4ESB A;  3EQO A;  2QA4 B;  1XD7 A;  3BG9 A;  2BBY A;  3CC2 I;  3T56 B;  3CUO A;  3GUD A;  2E36 A;  3FXR A;  4G7X A;  3BDD A;  4TN1 A;  4AC9 A;  3QQA A;  3ASO H;  3DU1 X;  1J09 A;  3JRC A;  3K70 D;  2VOP A;  1J75 A;  2CV0 A;  4L0Z B;  1IC8 A;  1B8I B;  1P7J A;  4XKC A;  3OYB A;  4II2 A;  4TMW A;  3DLL F;  2F48 A;  2V9K A;  2JUG A;  3SQN A;  4AD9 A;  3I59 B;  1O8G A;  1Y6I A;  4I2O A;  5HLT A;  2DYR H;  3EUK L;  1GAW A;  3BQJ A;  2UXX A;  5LGT A;  3OS1 A;  1I27 A;  5FD6 A;  1E64 A;  2X0K A;  3GZ6 A;  1ZGA A;  3SLN A;  1H80 A;  3PL8 A;  4BHC A;  2XAJ A;  4DGW B;  3IV5 A;  4E7J A;  1E3P A;  2E1M B;  3DTK A;  1CF7 B;  4P22 A;  2X1E A;  4P96 A;  3A02 A;  5LRS A;  3OOU A;  4XLN F;  3P5J A;  2INU A;  2UUZ A;  2PYG A;  2ZCW A;  1AU7 A;  2BM5 A;  3LAP A;  2QY1 A;  3CCQ B;  4PJL A;  5HVQ C;  1OJL A;  2LLK A;  3HGG A;  1XGS A;  3U1K A;  3H9G A;  4E4H A;  3T8R A;  4YCQ A;  4MLO A;  5E17 F;  4FWT A;  3I5U A;  1YJ9 I;  1HC8 A;  1FC3 A;  3HJE A;  2K3F A;  2PMZ A;  2JA6 J;  2HXO A;  2L4A A;  3FK7 A;  1K61 A;  2BV3 A;  2PEC A;  1KC8 D;  1WCM J;  3KYC B;  4AIH A;  2BM6 A;  3WG9 A;  1VQK B;  3DXJ F;  3MN2 A;  3CCJ B;  4KIB A;  4DQL A;  2QX3 A;  2RGV A;  3MWM A;  1Y0N A;  3OJW A;  2Z5U A;  2EIN H;  2G0E A;  5BOX A;  1U9N A;  3VYS B;  2MD0 A;  4DK1 A;  4CYC B;  1ETW A;  3LA2 A;  1PDN C;  3PUM A;  5FKK A;  3BCD A;  5J3O A;  2ZJR F;  3QFT A;  2DCU A;  1A36 A;  1MND A;  1A35 A;  1WJC A;  4PJJ A;  2BN4 A;  4OP7 A;  1WJD A;  1RES A;  2PMZ N;  5L3D A;  4HF2 A;  3WXM A;  2DEU A;  3GQ9 A;  4XM3 A;  4IVN A;  4G7H F;  1HDP A;  5GAH J;  1R22 A;  3HPH A;  4YIF A;  3B6C A;  3GTP J;  3SYT A;  3OW2 B;  4CGZ A;  1KU2 A;  2HZD A;  1I1G A;  2LP0 A;  5FO5 A;  4BE2 A;  2GK7 A;  2NS8 A;  2HI3 A;  1W7P D;  2BVM A;  1VQ6 B;  4K2E A;  1BX0 A;  2V4J C;  2BXZ A;  2QWW A;  2R7U A;  4A3L J;  2VNI A;  4P9S A;  1R1V A;  2BV6 A;  1MSE C;  1T5E A;  4UZE A;  4EAT A;  1QUF A;  3VFZ A;  4B3A A;  2NST A;  3H35 A;  2R7D A;  1QZZ A;  3LFU A;  2GIV A;  5IP7 J;  1O8I A;  3I4P A;  3LST A;  1YLO A;  3A3G A;  2DU9 A;  4NQW A;  5EZH A;  2K02 A;  5BMZ A;  1GVH A;  1OCT C;  3QFC A;  2DMT A;  3SZE A;  2BY2 A;  2LK2 A;  2VKD A;  1ZRD A;  4IX7 A;  1ZLK A;  2VOO A;  2BY1 A;  3IRR A;  3QFR A;  3E7L A;  2DMQ A;  2E1B A;  3MKL A;  2XNC A;  1FNC A;  3HC7 A;  3JSP A;  1FBQ A;  5FLX Z;  4HQE A;  1JKR C;  4RD6 A;  4M3E A;  1S0U A;  3CC7 B;  3V7S A;  1ZQ3 P;  2MC3 A;  3H36 A;  4RA2 A;  5GAE J;  5FLV A;  1QVT A;  1POG A;  3FK6 A;  3QU6 A;  4F52 A;  1W1W E;  4A2U A;  3AAF A;  4EGZ A;  1G2H A;  1CNF A;  2ZFU A;  4Z4T A;  3PSS A;  1UD8 A;  3GVA A;  2HR3 A;  3F22 A;  4Y13 A;  1EV7 A;  5GAG J;  2L2O A;  3FDY A;  5LLQ A;  5LHI A;  1R9T J;  1IAW A;  2PJR B;  3A2K A;  2XTW A;  5K7F A;  4V2F A;  2R5Z B;  1NK2 P;  4FQG A;  2ZSI B;  3WGH A;  1A6Q A;  2IXS A;  2JK3 A;  3HM5 A;  4UUS A;  1XFO A;  1U9O A;  1O3R A;  1XQB A;  2VNH A;  1OKR A;  1XX5 A;  2RRE A;  3HSE A;  3SXY A;  4BS9 A;  4Z03 A;  3V7C A;  4BHP A;  3GEZ A;  2E1M C;  1SFK A;  2EQR A;  3W2E A;  4I0A A;  4OMZ A;  4OPO A;  3QPH A;  4KIG A;  2VAS A;  3VNV A;  2YPR A;  3OYN A;  3D1N I;  1A04 A;  1T6S A;  1HKQ A;  2X9D A;  1D5Y A;  4XD7 A;  2WAQ A;  3CCV B;  2GA1 A;  3I55 B;  1W36 D;  4E7K A;  3CCS I;  3OSG A;  3M8E A;  3BOQ A;  3SJP A;  1HZE A;  3J81 Z;  1IO2 A;  1AOY A;  3QOE A;  2JPC A;  3PIP F;  4ZYA A;  1XDS A;  2I8D A;  2IPQ X;  3TMO A;  2M0M A;  3KZY A;  2NOJ B;  3RIQ A;  4OZZ A;  4FN5 A;  5A8A A;  3VOD A;  1N75 A;  1T6Y A;  3H9J A;  1T6Z A;  4RM0 A;  1WJA A;  3JRI A;  2ZC2 A;  1WP6 A;  1CLW A;  5C1C A;  1W4M A;  1BN5 A;  1Z67 A;  3I53 A;  4PZJ A;  1QA3 A;  2O03 A;  3QPL A;  4DQ2 A;  4WZL A;  4ANJ A;  1KA8 A;  1DG1 G;  4X0G A;  4XKV A;  1TP4 A;  3HPG A;  1UG2 A;  2DOA A;  3F9K A;  1RR8 C;  1AMO A;  3KZI C;  3HOS A;  4U49 A;  1UD6 A;  1UCR A;  3PA2 A;  2UVF A;  1BW6 A;  2JMW A;  2M7B A;  4IRH A;  5ICF A;  4ZH4 F;  1UD5 A;  4XN0 A;  5F6F A;  2PE3 A;  3A01 B;  1FP2 A;  3ZP5 A;  1D1A A;  1H88 C;  3CUQ A;  4UZU A;  1KK3 A;  4NCN A;  1QH0 A;  1TW3 A;  2JPB A;  5DNS A;  3PNY A;  5EJC A;  5J1R A;  4PC1 A;  4EGY A;  1WWX A;  4DJA A;  4P55 A;  4HDU A;  5HKK A;  1MBG A;  1QPI A;  2BM4 A;  2CQK A;  2QCO A;  3QWL A;  1VQN I;  2DJN A;  3M1E A;  5JHF A;  3M1C A;  1PUF B;  2O5R A;  1TNT A;  3G6E B;  4Y52 J;  1BR4 A;  2IS6 A;  1HQC A;  2ZBU A;  2LKS A;  3HBL A;  4KJZ A;  4U87 A;  2CW8 A;  3BZC A;  2ICW G;  2QMU A;  2D74 A;  3WYA A;  1G59 A;  3FHZ A;  4OM9 A;  1Z1D A;  3HRT A;  4YIR X;  1OR7 A;  3I59 A;  1VQL I;  1COW A;  2HQR A;  3QFS A;  1TUI A;  1VJS A;  3LMW A;  1D8K A;  2LFB A;  4A93 J;  5GTI C;  1PKV A;  4DQK A;  4HA8 A;  5EYR A;  1OPC A;  4OJO A;  2VLA A;  4IPA A;  4DBR A;  1HA8 A;  3FKS A;  4J19 A;  2QBY A;  1RQP A;  2QEX B;  2WR8 A;  3K9T A;  2D1V A;  3ABK H;  1EP1 B;  2BW3 B;  1NH3 A;  3E6M A;  1NHC A;  1U5T A;  1XSV A;  2MA3 A;  4QTR A;  1OB0 A;  2PX9 A;  2JT1 A;  2CW5 A;  2IP2 A;  3K4B A;  2MG4 A;  3DU5 A;  2K9L A;  1P4X A;  3ZQF A;  1W0J A;  4NC6 A;  5E20 A;  2DBB A;  4BQN A;  2ZFW A;  2DFF A;  3D26 A;  4FIS A;  4LGW A;  5F08 A;  3K6G A;  5TY0 A;  4E0F A;  4ZDO A;  2WYR A;  4ZYG A;  4IKF A;  5HDN A;  1E3O C;  1OB2 A;  2KL4 A;  3WE3 A;  2WAF A;  3E6C C;  2XAU A;  1I50 J;  2VQG A;  3P4G A;  2Y0S N;  2NZM A;  2A5W A;  4Q7J B;  4KMU X;  3HGY A;  1EJ9 A;  1I8D A;  4G7Z F;  3S3N A;  1OCR H;  5AIP A;  4DYC A;  3H94 A;  3Q0W A;  2O8X A;  5AIQ A;  2ZXJ A;  2ISY A;  2P4W A;  2X6X A;  1YJW I;  1KRH A;  3BR3 A;  2GPJ A;  1S72 I;  1WPC A;  5J35 A;  2BGC A;  1MJ9 A;  1X3Z B;  2Q8K A;  2Q6O A;  3OPO A;  2MLK A;  1JTA A;  3LOC A;  1QJV A;  1H8A C;  2VZL A;  2AHQ A;  2DT5 A;  5B1B H;  1LEA A;  1MGT A;  2CU7 A;  2CUE A;  3IRQ A;  3SJM A;  4BH9 A;  4TMV A;  3ZC3 A;  1SFO J;  4P3I A;  2V7W A;  1HST A;  4KDP A;  1ETQ A;  1VQ7 I;  2KIS A;  4DNC A;  3BR2 A;  1P9Q C;  2FOW A;  4ZZL A;  1K4T A;  5M5Y J;  3GFI A;  3T8T A;  5BSY A;  1S7A A;  4WF2 A;  2QZA A;  4LLN A;  4N9H A;  5JVT A;  3OYI A;  1M1E B;  2WV0 A;  1JGS A;  1I6X A;  3LSG A;  2WZN A;  5IT3 A;  1FYM A;  1GJR A;  1SD4 A;  2MAB A;  2QSF X;  1SAU A;  3FXJ A;  3FPK A;  1V4R A;  2CO5 A;  1G6N A;  4EJO A;  1BHE A;  3JRG A;  2VJI A;  2HVQ A;  3VYT B;  3ZSC A;  3OYF A;  3P9C A;  5E1X A;  2PBI A;  1UAA A;  3H3V K;  1GLN A;  4QVJ A;  3W2V A;  1FBS A;  2KZV A;  1KZH A;  4XSZ F;  2VYQ A;  1MSF C;  3ASQ A;  3DPT A;  2DA2 A;  4LLL A;  2OF7 A;  4ETS A;  5CVJ A;  5F04 A;  2XGE A;  2DA6 A;  1T08 B;  3HUG A;  1J2X A;  4QVA A;  5B66 C;  2GJR A;  4RPD A;  1V5V A;  1W7P A;  1KK0 A;  2EIL H;  2INV A;  1X3U A;  3R0A A;  3G1M A;  4PC2 A;  4P1W A;  3WHC A;  2D9R A;  3T1B A;  5F4O A;  2OTJ B;  4FE7 A;  2TCT A;  5KHD A;  2O04 A;  4C3H J;  2V7Q A;  3GTO J;  2JA8 J;  3CDI A;  3KP2 A;  1FNM A;  4L8J A;  2X0L A;  2A68 F;  2R7T A;  1TW2 A;  3KFW X;  3E5Q A;  4XRM A;  1RPW A;  3N90 A;  2JSC A;  2D1H A;  1T56 A;  3WTS C;  2JDI A;  1CQX A;  4X05 A;  3MHP A;  3ABU A;  2KRC A;  4MNU A;  3WTT C;  2KKO A;  3GW2 A;  1SEU A;  4OJ5 A;  3B4N A;  2AQF A;  4ESF A;  2ZME A;  3TKY A;  3MZH A;  1EP2 B;  1EXM A;  2ZZG A;  1YX5 A;  1V55 H;  1QX4 A;  5IYP A;  3ZPN A;  2UZK A;  3CCE B;  1K8A D;  3CC7 I;  2ELK A;  3D5S C;  4LMY A;  2Y9Y A;  1YS7 A;  2L5Q A;  4CCM A;  4D7M A;  3C18 A;  4L9T A;  4UV8 A;  2LH9 A;  1OCP A;  3KZZ A;  4NB5 A;  3VDX A;  1GAQ A;  1Q7Y D;  2QYU A;  2F4M B;  5AON A;  3CCR B;  2M0C A;  1OGJ A;  2K40 A;  3H0D A;  1VI0 A;  3JRH A;  4FXU A;  1ETK A;  1FP1 D;  1YIT I;  1ON1 A;  1Z05 A;  3OYM A;  1IDK A;  5BS6 A;  2H27 A;  1ZRC A;  5HOD A;  3V8J A;  5FO0 A;  4M2L A;  2A07 F;  5DCM A;  4HEA 2;  2BHZ A;  1BPL A;  1JUP A;  5BNG A;  3A8K A;  3C7J A;  1I3Q J;  2DAO A;  2VBU A;  1MJB A;  4OPV A;  5K5Q A;  2M8G X;  4PCQ A;  1T6X A;  3G1L A;  3LSK A;  4C3J J;  1XE1 A;  3VOE A;  3ZQC A;  3CMM A;  2OQG A;  4YAU A;  3F8M A;  2ACJ A;  3V7A A;  3ZCO A;  1YQA A;  3EET A;  1DPR A;  2V9V A;  1X2N A;  1JKQ C;  2B7C A;  1IDJ A;  5LHG A;  3U1D A;  3Q0U A;  5ILU A;  1QA6 A;  3OYG A;  2QN6 A;  4QIW N;  5GTH C;  1H8E A;  1IB4 A;  1K8F A;  2R7R A;  2VIX A;  3ZOB A;  1YTY A;  4MHG A;  1AKH B;  5TV2 A;  1BC7 C;  3W5V A;  3HHG A;  1AIP A;  2JVH A;  1HBX G;  3BY2 A;  5FO1 A;  3JRF A;  1PE9 A;  2L4M A;  2NNY A;  3SFZ A;  1XG2 A;  1BOA A;  3KEQ A;  4RS8 A;  2ECC A;  3K1M A;  2IA1 A;  3HOY J;  5C3E J;  2CFX A;  2YX7 A;  2KRH A;  2X6O A;  3JCU C;  5HLG A;  1O8D A;  1ZGW A;  5BSX A;  1T0F C;  1XN7 A;  4NK8 A;  1Z21 A;  4PC7 A;  4XLE A;  4JK1 X;  3PUB A;  1B6A A;  2FMY A;  3ESW B;  4EJV A;  4YRV A;  1QUE A;  3GBG A;  2CND A;  1GT0 C;  3KEY A;  4G94 A;  4P1V A;  3CQZ J;  5C4X J;  5E1Z B;  3S2D J;  1S4M A;  5EGO B;  1APL C;  4C2T A;  4Y17 A;  1QFZ A;  5E3O A;  1R6R A;  3HSR A;  3M7G A;  2QGG A;  3FIS A;  4UXN A;  3ABT A;  3AVV A;  3SQV A;  4JBA A;  2OV7 A;  3FMQ A;  2VB6 A;  3I1F A;  2XTX A;  3ONQ A;  3RYP A;  1RUO A;  1VLY A;  2R7F A;  1QQI A;  4TT3 A;  3Q3S A;  2VBV A;  2O17 A;  1RR7 A;  1X19 A;  4F93 B;  2WB1 N;  2BPO A;  1JJ6 C;  3H3Z A;  2O6G E;  1WZ2 A;  1R5H A;  4HG2 A;  3SDB A;  3IAS 2;  5IP9 J;  1IRG A;  3M4O J;  3RPQ A;  4P25 A;  4G7W A;  2DXI A;  2DA1 A;  2HOE A;  4A3I J;  1EF4 A;  1XTA A;  2XNJ A;  3LAJ A;  1DAB A;  2KHM A;  2XV4 S;  3S14 J;  1YJN I;  1BQE A;  1RET A;  3CB4 A;  4RLQ A;  3Q6Q A;  3GO5 A;  2FD5 A;  2Y0M A;  1I3A A;  3E5U A;  3OR2 C;  4XMY A;  1S8N A;  1Y1W J;  2V1X A;  2K86 A;  2LBF A;  4YZA A;  3ZIA A;  1KON A;  2OTL B;  1WVR A;  2GZW A;  2PYH A;  4EQQ A;  1DDG A;  1YI2 B;  1B1B A;  2XTY A;  4WXD A;  2L9S A;  1O7F A;  5M3F J;  5LD2 C;  1F5T A;  2XF7 A;  1EA3 A;  3J7A O;  1E79 A;  2X4H A;  5EEA A;  2AXT C;  3FKI J;  4AF6 A;  2IGK A;  4KYW A;  2LNB A;  4CDG A;  5FLM J;  1AWC A;  4TMX A;  4S0H B;  1JJ8 C;  3CLQ A;  2JJ2 A;  3OIO A;  3PIO F;  1IDZ A;  3B8H A;  2XVC A;  3OYK A;  1E1Q A;  3HL2 A;  4Z4S A;  5KCM A;  2ZSH B;  4KFC A;  5E18 F;  4YAL A;  1JE8 A;  5CQE A;  2ETH A;  3OYJ A;  2P8T A;  1FJL A;  1BA5 A;  5D4R A;  2VOD A;  2WAE A;  2H1K A;  1SVL A;  5KAF C;  3PO2 J;  4NNJ A;  4HE5 A;  3KP3 A;  5GP9 A;  5HNF A;  1FYL A;  2VQL A;  3GVJ A;  2PFB A;  4YFK F;  4BXX J;  3A1P A;  1M1K D;  4EH1 A;  2DA3 A;  2A3S A;  3PNT A;  4B44 A;  5L3F A;  1G4D A;  2QDX A;  3BC9 A;  4ZCL A;  1JRG A;  3OL3 A;  1Y56 A;  2OUM A;  1IW7 F;  5HS8 A;  4UV9 A;  1P4M A;  5E6T A;  2OBR A;  3ZN0 A;  3A8J A;  1QVF B;  2Z33 A;  1W0U A;  1KU9 A;  2C77 A;  2BZT A;  2XZL A;  1E1R A;  2E1C A;  4DOZ A;  5ILS A;  3E1S A;  1Y39 A;  5M5X J;  1MMA A;  1MD0 A;  4RB3 C;  1ETY A;  3SEZ A;  5DTD A;  4U9U A;  5J1U A;  1GV5 A;  3PFI A;  1R5G A;  2XUB A;  1ZUN B;  1RRJ A;  3CCY A;  4YAF A;  5LEJ A;  4RBO A;  3ZQ7 A;  5H5J A;  4LG0 B;  1U0J A;  3HKZ A;  2M7A A;  5CPR B;  4BEH B;  2GXB A;  1MH4 A;  2FX3 A;  3JR9 A;  4BJ6 C;  1BOB A;  5J8F A;  1Y0Y A;  4KKS A;  1Z7U A;  4XON A;  4XR6 A;  4XBF A;  1X58 A;  2GAU A;  3ABL H;  2XPW A;  3DKX A;  3NAW A;  4HX7 A;  4Z4Z A;  1EFT A;  1HVX A;  3S1M J;  2JA2 A;  1YW8 A;  1UHS A;  1TZL A;  3K2A A;  4ENN A;  4ON0 A;  4XID A;  3TED A;  5D8L B;  2QSH X;  4UNO A;  1XMX A;  3FJO A;  4E6K G;  2HDC A;  3J81 k;  1O8E A;  3LSM A;  1XSD A;  2FJ1 A;  2QKL B;  2XAF A;  1RKT A;  3OP1 A;  4KUM A;  3ASS A;  5LFA A;  1DPU A;  3AVY A;  3EUH C;  4CO8 A;  4IRG A;  1RMG A;  1Q1H A;  3T9G A;  2F4I A;  4BU2 A;  1KU7 A;  2QQ9 A;  4AVP A;  4LB5 A;  3RJP A;  1EH6 A;  3K0L A;  2W6J A;  2XB5 A;  4MR0 A;  3P9K A;  2C4U A;  2D2W A;  1IZ1 A;  2OJE D;  2NS0 A;  1VF7 A;  2HFH A;  2OCE A;  1ULY A;  3CTA A;  1BI1 A;  3BG5 A;  4LOC A;  1DU0 A;  1SKY B;  2DJI A;  3DBR B;  1HW1 A;  3E97 A;  5FNZ A;  5JI6 A;  2OA4 A;  3M9A A;  1VQ5 B;  2VN2 A;  3OYA A;  2VJJ A;  3M3Y J;  2ZNY A;  4OMY A;  1LFP A;  2Z16 A;  1JUS A;  4AWX B;  1BW5 A;  1LE8 B;  4RD3 A;  2JA5 J;  3HRU A;  3ISX A;  3I58 A;  4CH7 A;  1N0U A;  2ZL5 A;  3BR6 A;  3MKY B;  3CES A;  3G71 I;  3QP5 A;  4N3G A;  3LQR A;  1RNL A;  1FY7 A;  2HNH A;  4E7S A;  1KK2 A;  3BC8 A;  3RKX A;  1FT9 A;  1JTY A;  2DDA A;  4XK4 A;  1MBH A;  2STT A;  2OK7 A;  3OW7 A;  5DCF A;  2ZO4 A;  3LJY A;  4YEL A;  4ZDL A;  1X1B A;  4ENM A;  4KMF A;  3QPT A;  3TP3 A;  1W0T A;  1FZP B;  5DD4 A;  3A35 A;  1W34 A;  4F7D A;  3VYU B;  4Y7N J;  2ZZF A;  1JTX A;  3VMF A;  2X3H A;  3CMA I;  3WND A;  1LQ1 A;  2LF8 A;  1GV2 A;  1QO0 D;  2GQQ A;  4P12 A;  4WWC A;  1ZR2 A;  2V7V A;  2NS7 A;  2Z6B D;  4PK4 A;  3L2U A;  2VE9 A;  2DQR A;  1Z77 A;  3LSJ A;  2JWT A;  3ZMZ A;  1JI8 A;  3I4M J;  2LRD A;  1WH5 A;  2LG4 A;  3DLA A;  3QOP A;  1WOR A;  2I5U A;  4W97 A;  1G8X A;  2R3S A;  4U7B A;  3JX8 A;  2NTQ A;  4XQF A;  3ASP A;  2R0Q C;  3VSU A;  3PQK A;  5TJJ A;  1Q86 D;  1IRZ A;  4A6E A;  2M5S A;  2Y30 A;  1W5T A;  4RD2 A;  4EVI A;  4A12 A;  3PVD A;  1F36 A;  2IEK A;  1K83 J;  4YAO A;  1OMI A;  4PGG A;  4C9Y A;  5KK1 A;  4WQM A;  3CO6 C;  4MQV A;  4L5J A;  4M3B A;  5FRN A;  2NT9 A;  2DMU A;  4I84 A;  1UD2 A;  3WBK A;  3S8P A;  4HLX A;  1ZM4 A;  4A3C J;  5HZA A;  4XOT A;  2HEO A;  2GIZ A;  2XSD C;  1ONV A;  2W7N A;  1IXS B;  5HNH A;  4JP0 A;  2R7O A;  5JBQ A;  4XLA A;  3P27 A;  1DGW Y;  2E2J J;  2B7B A;  2FEZ A;  3Q38 A;  4C2M J;  4DYQ A;  2WSS A;  4Z1M A;  3KP6 A;  1OLT A;  2EV6 A;  2MFZ A;  4TV7 A;  3W2W A;  4MXN A;  1B9N A;  5EF6 A;  1EWY A;  1OYY A;  2NRA C;  1T2K A;  2P81 A;  2V6C A;  2RC5 A;  1I5Z A;  2NT6 A;  4UAJ A;  2L7K A;  4CHU A;  2H94 A;  3GTQ J;  4CCO A;  2ZBV A;  2O61 A;  1VQ9 B;  2XKP A;  3QOD A;  4BJ5 C;  4G12 A;  1MMG A;  4I01 A;  2LY1 A;  4MEX F;  3JQR A;  3O3K A;  1BMF A;  3GXO A;  1BJZ A;  1E2X A;  1YOV B;  5D4S A;  5L3G A;  2VT3 A;  5GPA A;  1Z6R A;  1N77 A;  4IHV A;  2HZT A;  1DUX C;  2XT2 A;  4YZ0 A;  2LF7 A;  3QU3 A;  2D3N A;  1UST A;  2YSR A;  4GYI A;  2AS5 F;  2MH9 A;  2XAH A;  3CJR B;  3CCU I;  4HZF A;  3HTS B;  1Y1V J;  2QF7 A;  3VB2 A;  2PQ8 A;  2H09 A;  3VYR B;  1ERD A;  2RKH A;  2LKP A;  1LLZ A;  2WV1 A;  1QRY A;  2CW7 A;  1IXR C;  3S32 A;  2UWM A;  5H59 A;  3GQ7 A;  4PFP A;  2BE5 F;  3BWG A;  3OYE A;  3BLY A;  2H8W A;  4ENJ A;  2E34 A;  5KAI C;  1RI7 A;  3G4S B;  4BXU A;  4B4C A;  3AK5 A;  1QFY A;  4PMH A;  2XGX A;  2L3D A;  2X85 A;  3I56 I;  2R5Y B;  2CC2 A;  3K4L A;  3C2G A;  1LFB A;  5IOZ A;  2VC1 A;  1VQO B;  1RIO H;  3Q6R A;  4RDK A;  3U6K A;  3LA7 A;  1XMA A;  2CMP A;  3PSI A;  4BGD A;  1JNY A;  1N0V C;  3IL2 A;  1A5J A;  1I1S A;  3L2C A;  2NVT J;  2WTE A;  2FOK A;  3CJT B;  4EM1 A;  4PSW A;  4EJU A;  2L7F P;  2XHK A;  2V31 A;  2VQH A;  4B47 A;  4XIC A;  2Z1D A;  2VQC A;  1IB0 A;  1IXC A;  3H5R A;  4G6T B;  4IL6 C;  1TSP A;  5F1R A;  2A05 A;  2PG4 A;  5HLI A;  3GQ8 A;  2M8E A;  2I1L A;  2C78 A;  1UB9 A;  3BG7 A;  4M6V A;  4NK6 A;  4YC5 A;  3KX2 A;  3KP5 A;  3E0J B;  4HSR A;  4D9J A;  1A6I A;  1TTT A;  5ICC A;  4C0S A;  1K7A A;  3GYH X;  4RGS A;  4ZC3 A;  5HZB A;  3ZPL A;  2IOU G;  5E3N A;  2ZXI A;  1JJ2 B;  4YZX A;  2VUM J;  2Q6L A;  2B0R A;  1OGO X;  2O8K A;  4B09 A;  3JSO A;  2XRN A;  3MZ8 A;  2LKX A;  4G5G A;  1P7I A;  3CCL I;  1WHU A;  4GDF A;  2V79 A;  2KVO A;  1LFU P;  1FMV A;  1LJ9 A;  3CME B;  2WJY A;  1NJI D;  3K4M A;  3QP6 A;  1K9M D;  3A1Y A;  1YIJ I;  3CP8 A;  2K85 A;  3ULQ B;  3RCO A;  2FBK A;  2EFW A;  4Y9R A;  1SM4 A;  5THX A;  2VFM A;  2R92 J;  1FOW A;  4NC8 A;  4ZGN B;  5IT9 K;  1GQ8 A;  4HQM A;  2JIZ A;  3UNG C;  1V0F A;  1N06 A;  2Q2E A;  4RMN A;  3DCF A;  5CDF A;  1VQ4 B;  2KRF A;  1AA7 A;  1IGN A;  1V3F A;  2B9S A;  1SD5 A;  3SLD A;  1OCZ H;  2HYF A;  3O6B B;  4G6Q A;  5D6E A;  2P7C B;  3I0T A;  5E79 C;  1TLH B;  2Y69 H;  1WPK A;  4BUP A;  2GK6 A;  4JMQ A;  2VKE A;  3ZMU A;  1K78 A;  3VO2 A;  1ZYR F;  2BVL A;  2HOA A;  1ETO A;  4XN3 A;  1GHC A;  1OGI A;  2IS4 A;  1T33 A;  2DDB A;  2DYS H;  3C3W A;  4FHT A;  1O8L A;  3U2R A;  3ZGK A;  4OIQ F;  5FJ8 J;  2KP6 A;  3E1Y E;  1ZM9 A;  3R60 A;  3ZQI A;  2HQN A;  2WAQ N;  5LBQ A;  2KJB A;  1ZG1 A;  3OL4 A;  1FBU A;  4G1B A;  4QUZ A;  4HST A;  2DT6 A;  3F8F A;  1K5C A;  4LJZ F;  3BR1 A;  2V9P A;  5EG0 B;  1MDM B;  4IZZ A;  3WQZ A;  2IAI A;  2OBP A;  4QPQ A;  1ZM2 A;  3DWL E;  3WTY C;  2XZO A;  5TIS C;  1QA2 A;  1E62 A;  1X1A A;  2MD5 A;  1MMD A;  3HIF A;  4LB6 B;  3VR6 A;  1VQP B;  3WTZ A;  1RU4 A;  3GVK A;  1G7C A;  2XGC A;  4CCK A;  4ZCM A;  1J5Y A;  3N4M A;  4Y7C A;  1IV8 A;  2HOS A;  3VEP A;  2CK3 A;  2PEX A;  3KEO A;  1YHQ I;  4OAZ A;  4G7O F;  4Y33 A;  4LK0 F;  3JTG A;  4DZJ A;  2WPD A;  2F3L A;  2Y48 A;  1X1D A;  4KIF A;  1Q81 D;  4JYK A;  3RQ4 A;  1UMQ A;  4M3G A;  2VXD A;  1XB2 A;  1SMT A;  3B90 A;  4BAY A;  2ODL A;  3IUO A;  2ZJQ F;  3HZJ A;  2CUJ A;  3K1N A;  4IF4 A;  2XRO A;  3RI4 A;  1QU3 A;  4QFM A;  4I6Z A;  4Z4W A;  5ED4 A;  1BL0 A;  2BM1 A;  4R71 A;  4UVC A;  4OIN F;  1S5L C;  2NYX A;  2YWG A;  1BN8 A;  3V7R A;  4R79 A;  2E60 A;  4XL9 A;  1FEX A;  3W6K B;  3N97 A;  1HKT A;  2FVG A;  2BY0 A;  5DUK A;  1ZAR A;  3DF8 A;  3PFY A;  1B8I A;  1FOK A;  1R5B A;  3SY2 A;  1IN5 A;  3CP2 A;  4PGO A;  4QWQ A;  2RNJ A;  3L2Q A;  1XB4 A;  1DBO A;  3NEU A;  4E7Z A;  5KSW B;  4TMT A;  3K4C A;  5C1E A;  2JVG A;  1SVO A;  1K6O A;  3S2H J;  1JA1 A;  3AVT A;  4WCG A;  3I71 A;  1TTY A;  2NVX J;  2OBS A;  4JX5 A;  3ERM A;  2KQR A;  3EQN A;  1VQM B;  1CF7 A;  4N3N A;  1WJF A;  1O8F A;  1F20 A;  3CCM B;  1SC7 A;  2HDW A;  1OB5 A;  3OFN A;  1Z7L A;  2JA7 J;  3SEQ A;  2IT0 A;  5EZG A;  2J5P A;  2JRT A;  3WU2 C;  2V26 A;  2QA4 I;  1U6G A;  3S2W A;  5A2Q K;  4ACA A;  2MSY A;  5IOY A;  3T0Y A;  3TBI A;  4HYE A;  5D5X B;  5A88 A;  3G1O A;  2D3L A;  1OCC H;  1PXZ A;  2NOG A;  2RN7 A;  3AG3 H;  5FKN A;  2K5C A;  3S17 J;  1V5E A;  2YWH A;  1EKE A;  3ZN1 A;  1HF2 A;  2KIU A;  2XAG A;  4BAC A;  2R7V A;  2NVY J;  4BQQ A;  4O6J A;  2L02 A;  2DMN A;  4BHB A;  2JZY A;  1VND A;  2DQL A;  2XB0 X;  2LC2 A;  1KQ5 A;  4A3D J;  1UG0 A;  3GFM A;  4CIC A;  5J8C A;  2JJ7 A;  5HS9 A;  5J6X A;  3VWB A;  4CYC A;  4JOM A;  1KCC A;  1UFM A;  4E7I A;  3W6J B;  2CQX A;  1LNW A;  2VBW A;  4MGR A;  4OOX A;  3TW6 A;  1OFE A;  1E3Z A;  3ES9 A;  2O9L A;  3WU0 A;  3HRM A;  5B3S H;  2L7M P;  3CCQ I;  4L5I A;  3FY3 A;  2RQP A;  2ZBK A;  1S3J A;  1D1B A;  3QYE A;  5TRD A;  1H9T A;  1G3Y A;  2P3M A;  3DEW A;  4X7F A;  3CD6 B;  1WSR A;  3VSK A;  3J80 K;  1A8P A;  2WAD A;  1T8I A;  2V1U A;  5FRO A;  3L7W A;  1OQY A;  3FM3 A;  4B1R A;  2E7X A;  3A3B A;  4LIT A;  4C2L A;  4M71 A;  1WJE A;  1YE9 A;  2HPI A;  2M3A A;  2H6C A;  1HF0 A;  2VT2 A;  1E17 A;  2FRH A;  2UXN A;  4CCN A;  5K7H A;  2EFN A;  4A3E J;  2NSP A;  5DUI A;  1T38 A;  1I7P A;  3BJA A;  3UR3 C;  2QZ8 A;  1VQK I;  1TWH J;  3MMY B;  3CCJ I;  3LL7 A;  2HPM A;  1SKQ A;  1V0E A;  2VNJ A;  3CJN A;  3HXL A;  2DLL A;  3F8B A;  4B48 A;  2RC6 A;  4RD1 A;  1QQ1 A;  4MFE A;  2LRE A;  3A03 A;  3SDG A;  4XLH A;  1D1N A;  1QNT A;  2MGQ A;  2DA5 A;  3DPL C;  3C2H A;  3FXO A;  1WOP A;  2VE8 A;  3CC4 B;  2E5N A;  4C43 A;  3REO A;  1JA0 A;  1KMH A;  1ZEL A;  5K5O A;  1KQ9 A;  1Z3X A;  4NUB A;  3BQY A;  1AHD P;  3Q9V A;  4RAY A;  4G1V A;  5JMC B;  4XOR A;  1RQR A;  3RY8 A;  2J8K A;  5E8G A;  1QGY A;  1VQ8 B;  3FXM A;  2QQB A;  2K9N A;  3SZG A;  3JAM Z;  4OPS A;  1H0M A;  3JTH A;  1K4S A;  1VQ6 I;  3GLL A;  3IH2 A;  4IEJ A;  1FNN A;  1V5G A;  2FU4 A;  3WOD F;  4LBY A;  5JR3 A;  2PJR A;  3DEU A;  2XIG A;  4KN7 X;  3V8L A;  2R5Z A;  2HDD A;  4DIQ A;  3FXL A;  3KYL A;  2CS3 A;  1J7K A;  3IH4 A;  5KNL A;  1HDD C;  2JTV A;  2PMU A;  1ZRF A;  3GTM J;  2DTR A;  1S7E A;  4LG3 A;  4BJT A;  2JJ1 A;  2VBK A;  1ZG3 A;  1ELO A;  3L09 A;  5LHH A;  5GAD J;  1U78 A;  2L9N A;  4RB2 C;  4M74 A;  3W5H A;  1PLU A;  3MZY A;  3IC7 A;  2CUZ A;  1TT5 B;  2Y75 A;  4EM0 B;  2BXY A;  3DU6 A;  1D0X A;  4HIZ A;  2BY3 A;  3OYC A;  3R6S A;  4MFD A;  4HF0 A;  2FML A;  1QRB A;  4AM3 A;  3W3C A;  3T53 B;  1X0C A;  1E3X A;  4Z4R A;  3OMY A;  4XOP A;  2RAE A;  3ML6 A;  3QSY A;  1UEL B;  3F6O A;  3FXQ A;  3H1C A;  1SAN A;  3ZQL A;  1NHA A;  3LNN A;  1PVE A;  1JKP C;  1ITY A;  3ISP A;  2ZB9 A;  2EFQ A;  3L9F A;  1S6L A;  1IN7 A;  4N4O B;  1YRN B;  2DI3 A;  1ZAO A;  2XF5 A;  4UB6 C;  4EEF G;  4ESJ A;  4GQN A;  4ABZ A;  4X06 A;  3WBJ A;  1O8J A;  2K3P A;  2CV1 A;  3I3L A;  4A3B J;  2LVS A;  4RLZ A;  4DNT B;  3JW4 A;  2L01 A;  3ZPP A;  3WU1 B;  4V2G A;  5CYV A;  1G3T A;  2ZNZ A;  2NNN A;  1FTT A;  1E43 A;  1X4P A;  3BRO A;  3O8H A;  1N08 A;  4BKX A;  2B5O A;  4QPO A;  3BTI A;  1MW7 A;  1GUU A;  4LC0 A;  3CCV I;  4XSX F;  2K4B A;  3TP0 A;  1MIJ A;  3I55 I;  4HF1 A;  3A01 A;  2OYN A;  3F0C A;  2V1D A;  4PJM A;  2FUG 2;  5IYB J;  5H2F C;  5D5W B;  1XGN A;  4P3Y A;  4IHX A;  3CC2 B;  1TYU A;  4W8T A;  2W1O A;  4M3F A;  4RCZ A;  4N0B A;  4OJL A;  2K4J A;  5IPA A;  1BBY A;  1J9Z A;  3MMP A;  4HNV A;  2I10 A;  3GTL J;  3KPH A;  2DFE A;  4HX4 A;  3TH0 A;  1ETX A;  2E5Z A;  1RKW A;  1PUF A;  4W1U A;  4EJW A;  4Q48 A;  3WGG A;  3H9Q A;  2HKO A;  4IQJ A;  1LDJ A;  1WJ5 A;  2O7O A;  3GWZ A;  1W87 A;  1U3E M;  3FMR A;  1O3Q A;  4OWR B;  3R6J A;  3B73 A;  3GQB A;  1R23 A;  4J01 A;  5DYM A;  5H20 A;  1XCV A;  4Z06 A;  3DTE A;  2HU9 A;  3WTU C;  5DM7 F;  1ZLJ A;  5AN9 A;  2XZP A;  4RLF A;  1EH8 A;  2EZI A;  3E3V A;  5IYQ A;  1R7J A;  1QZY A;  4L9V A;  5ICG A;  4HAM A;  3TQN A;  3KET A;  4KKU A;  3Q3A A;  4P26 A;  3E6B A;  3U6B A;  3CPW B;  2DT7 B;  3QYF A;  1YJ9 B;  1XPX A;  2KPM A;  4LBV A;  2LTP A;  3FMS A;  2A69 F;  2B0L A;  2BW3 A;  3V8K A;  4BL0 B;  2M87 A;  4I98 B;  4A3F J;  1O3T A;  1QBJ A;  3BCF A;  4Z05 A;  3S1Q J;  3SZT A;  5BQT A;  4LFU A;  1PJR A;  4LLG F;  4OJ6 A;  1EE6 A;  2XAS A;  1D8J A;  4URR A;  2X53 S;  3G6E I;  2ZXW H;  3RZO J;  1JXS A;  4D1Q A;  1E63 A;  2OK8 A;  2HLD A;  4RPB A;  3H5N A;  5HS7 A;  4CA0 A;  3JRD A;  1SD7 A;  2VPR A;  3K10 A;  5HDK A;  2EIX A;  2XND A;  4HOB A;  2HXI A;  2IA0 A;  4YEI A;  1H89 C;  1F4K A;  2KIM A;  2MBF A;  1B59 A;  1TQM A;  4DYR A;  3BNW A;  2F43 A;  2F1L A;  1TWA J;  3EDP A;  5EDN A;  3P26 A;  3PQJ A;  4DW6 A;  3FWE A;  2B63 J;  2CUF A;  4MYT A;  4WZK A;  1H9G A;  1QHG A;  3RKW A;  4LIV A;  1SFU A;  1MAB A;  3PET A;  2J5O A;  2OZ6 A;  1G7R A;  5IYC J;  3ZBU A;  3VNU A;  3FPP A;  2EV0 A;  2XGD A;  2EB7 A;  1BR2 A;  4CYD A;  2QEX I;  2VC0 A;  1R1U A;  1CQT A;  1HOM A;  4LBW A;  1L1I A;  3K7A J;  3LMM A;  2CV2 A;  4L0Y B;  3VO1 A;  2PMH A;  4A3G J;  3TOA A;  2R7Q A;  4MO7 A;  3LSH A;  1STZ A;  1IUF A;  3B6A A;  2NAZ A;  4OJP A;  4P6V F;  3BR5 A;  2GRE A;  3L2R A;  3R6K A;  2W48 A;  3S16 J;  2DFH A;  1R5O A;  1R36 A;  3TDZ C;  2EJR A;  3SUC A;  2PIA A;  3OV8 A;  4U0V A;  1K73 D;  4Y4R A;  4CUG A;  2ADU A;  1D0Y A;  1KD1 D;  2XPV A;  2K27 A;  2KLO A;  3KRG A;  1KU3 A;  3P9I A;  1DAR A;  1NG6 A;  3I4N J;  3NAR A;  2RV8 A;  4YXW A;  2ZTG A;  2FX0 A;  3ASN H;  1OOC A;  1KQ0 A;  1TBX A;  2CQQ A;  2LSO A;  3BPV A;  4CCJ A;  4KKT A;  3RPU D;  1ON2 A;  1VFC A;  1N05 A;  5IYN A;  2HDN B;  4YFN F;  2UV1 A;  2EWN A;  4G8X A;  5IT9 Z;  2R6H A;  3KEW A;  3C2B A;  5DD8 A;  2R4G A;  3MKW B;  2VKH A;  1D1C A;  2ECB A;  2NXN B;  4JX6 A;  1MNM C;  1D5V A;  1N07 A;  3B82 A;  1OFM A;  3FM5 A;  1DBG A;  2OCC H;  5JLX A;  1DGR M;  4WX9 A;  1SD6 A;  2EV5 A;  1T0F A;  4J00 A;  5FD5 A;  4M3D A;  1ZKG A;  3CD6 I;  3H3U A;  3M07 A;  1YX3 A;  2WC2 A;  2W4S A;  2LR8 A;  3BT9 A;  2F1M A;  2JN9 A;  2FA5 A;  4HV6 A;  4A3K J;  1IUY A;  1J9I A;  4NQW B;  4HX8 A;  4FT8 A;  3W2G A;  4NDL A;  2BSA A;  2GOX B;  1X1C A;  2EZH A;  4FK8 A;  1ORK A;  1EZG A;  1Y0R A;  2DA4 A;  4F91 B;  3BPX A;  3OIP A;  4KIC A;  4M9S A;  3LSP A;  3JRE A;  2E2H J;  1FSH A;  2BSP A;  4TMZ A;  2FF4 A;  1FTZ A;  4P2N A;  3HOX J;  3JRA A;  4A0Z A;  3DP7 A;  1WSV A;  2EFO A;  2QUF A;  1ETV A;  3V42 A;  2FE3 A;  1F60 A;  2A5Y B;  3CCS B;  1TYV A;  2HQ5 A;  2M4G A;  4CCL A;  5FIU A;  4ROX A;  4AYB A;  3HRS A;  2ID3 A;  1TWC J;  4U0Y A;  4M72 A;  1JHF A;  1HW5 A;  3HKZ N;  4XLP F;  2ISZ A;  3LQE A;  2COB A;  3LSI A;  4WXH A;  4D5F A;  2PI0 A;  1FSE A;  1HA3 A;  2WBM A;  1HG8 A;  3B8Y A;  4FCY A;  3WGI A;  3I54 A;  2GJK A;  5L3C A;  4UUS B;  4EV0 A;  4MTD A;  1YLF A;  3FBI B;  5F4J A;  3RSN A;  1ZK8 A;  4HW0 A;  2ESH A;  3E6D A;  4IJA A;  5H6Q A;  2NTP A;  3RZD J;  2LD5 A;  3VMW A;  4AYB N;  2KIF A;  2ZTN A;  4OPW A;  1HKS A;  1YYV A;  2F2E A;  3BP8 A;  2X6Y A;  4KA4 A;  3BJO A;  2R7Z J;  2OTJ I;  1P92 A;  1H42 A;  2CYY A;  4YAW A;  1MMS A;  2VFO A;  2RVC A;  3CZ6 A;  3VMV A;  2TRT A;  2XF6 A;  3U21 A;  3DEE A;  1XC5 A;  2P0W A;  5E1W A;  3C1D A;  3ZXS A;  5ILV A;  3ASR A;  2HMA A;  2BOL A;  3FXU A;  2Z99 A;  3VSV A;  5CVR A;  3LVB A;  2EFG A;  2M9H A;  5LEK A;  3L2W A;  3GTG J;  2C5H A;  3GIR A;  2KJC A;  3BZ6 A;  5LMZ A;  1VQN B;  1O88 A;  4PC6 A;  3CCE I;  1K79 A;  4F7Z A;  3OEH A;  1ZN2 A;  4W8Q A;  1ZR4 A;  2XRL A;  4E7H A;  3LQ6 A;  2CBX A;  1XGO A;  3HOV J;  2BYV E;  1R58 A;  2E2I J;  3F23 A;  3S1N J;  1DDI A;  2D45 A;  5K7Z A;  3CCR I;  1PYV A;  2DOG A;  2OBT A;  1ZM3 A;  1VLO A;  4Y3O A;  1AKH A;  3QYB A;  1IRX A;  4LK1 F;  2VL8 A;  4CSW A;  1VQL B;  2LY9 A;  4LBZ A;  4L9J A;  1U8R A;  3K4N A;  1OGM X;  5KVR A;  1WJB A;  1LKX A;  3CUQ B;  4RGR A;  9ANT A;  4OZY A;  3K1P A;  1L3L A;  1GO2 A;  4UUT A;  2X1C A;  2XC1 A;  1QGA A;  3Q0V A;  1HW2 A;  3ZZ0 A;  3AG1 H;  3W2I A;  4IO9 F;  4OIR F;  3AGP A;  4X6A J;  2CH0 A;  5B1A H;  1SMY F;  4BBR J;  2OZU A;  2KFD A;  3CRZ A;  1G3S A;  2DPU A;  2HS5 A;  4I0B A;  3VPR A;  2W7Z A;  1JHH A;  2HKX A;  4OOI A;  2K9M A;  5IYR A;  1N8R D;  3OSF A;  2DO7 A;  4E70 A;  3JQQ A;  2QM3 A;  1LUJ B;  2IJL A;  5EGO A;  2KIQ A;  2DER A;  1A31 A;  3IAM 2;  3SKB A;  1GR1 A;  4A0Y A;  5JVG F;  1IF1 A;  1GXP A;  4GFB A;  4G6I A;  2VBM A;  4RM3 A;  1LB2 A;  4NBQ A;  3GQA A;  5K5R A;  4WWV A;  3J80 Z;  1F1Z A;  3OS0 A;  1IN6 A;  2QGU A;  3EUH A;  3OYD A;  5DV5 A;  4A0X A;  4D5C A;  3SYJ A;  4MTE A;  4UHT A;  3WTV C;  3WY9 A;  4ZV4 A;  1VHO A;  1KQS B;  2VON A;  1H85 A;  3IP4 B;  1PUE E;  2E1R A;  1S7O A;  5FFZ A;  4X7E A;  1FOX A;  2JQ7 A;  5IK2 A;  3E5X A;  3LQQ A;  1YJW B;  2QBY B;  2CW0 F;  2MC4 A;  3LNQ A;  1S72 B;  2P5V A;  4H4K C;  1G3W A;  3ZMV A;  4U88 A;  2V7T A;  1TQI A;  4IRI A;  3PEN A;  2IW5 A;  2MH2 A;  2W24 A;  4O5V A;  1U5T B;  4AIJ A;  2ID6 A;  4IHS A;  3S15 J;  4N9I A;  2DMP A;  4HNT A;  5TGT A;  1LEB A;  1MNE A;  1OIS A;  1Q9S A;  1BJA A;  2AHO A;  2F5C A;  5L3B A;  3OYH A;  1KJZ A;  3TO7 A;  1LM1 A;  2PJP A;  1J0R A;  5J40 A;  3FZV A;  4HRI A;  4C30 A;  3NRV A;  1TC3 C;  1VQ7 B;  1YS6 A;  2XPU A;  1OYI A;  4IQ4 A;  4QLC U;  1BX1 A;  3F21 A;  4Z4U A;  2QXZ A;  3L2V A;  3M8F A;  3A4C A;  1KYZ A;  1WSU A;  5LGN A;  3ABM H;  3ECH A;  5EEG A;  1LDK B;  2M5W A;  1T95 A;  2W6I A;  3O8G A;  1EFR A;  3GSI A;  4AF7 A;  1G7S A;  1YG2 A;  5J4V A;  1DQU A;  5A89 A;  4X1E A; 
#chains in the Genus database with same CATH homology
 3CF2 A;  3S93 A;  4HEA 2;  2KQR A;  4JQF A;  3EQN A;  2X8K A;  1WJF A;  1BPL A;  1O8F A;  2IS2 A;  2V7F A;  4BDY A;  2W82 A;  2HDW A;  1TT0 A;  3OFN A;  1Z7L A;  5CQG A;  3NE5 B;  3SEQ A;  1VZ0 A;  2V26 A;  2HVS A;  3LSK A;  3CMM A;  4HNU A;  4II3 A;  3TBI A;  3ZR8 X;  3OR1 C;  3ZCO A;  2ELJ A;  5CKT A;  2D3L A;  1IDJ A;  1PXZ A;  3GVL A;  1N78 A;  2K5C A;  1V5E A;  1WFX A;  3GRH A;  4BAC A;  3OYG A;  2R7V A;  4BQQ A;  2DCE A;  1E0E A;  1H8E A;  2LYC A;  2NTB A;  1IB4 A;  4XNF A;  3ZQQ A;  2VIX A;  2WY7 Q;  2R7R A;  2XOK A;  2Q2E B;  2JVH A;  2IS1 A;  3HOT A;  2GJP A;  4ZJZ A;  2LC2 A;  1PE9 A;  2X51 A;  4B3F X;  1UG0 A;  4TKO B;  1XG2 A;  3VWB A;  1Z3Y A;  4JOM A;  1KCC A;  4E7I A;  3DPU A;  4DNR B;  2RNG A;  4BEH A;  1E3Z A;  2KRH A;  4NK6 A;  1O8D A;  3OOC A;  3OYL A;  3DDY A;  2XDV A;  1NRK A;  3FY3 A;  1T0F C;  4XLF A;  1D1B A;  3QYE A;  4BE1 A;  4NK8 A;  1Z21 A;  2V4D A;  4XLE A;  4YRV A;  3PUB A;  3VSK A;  3GBG A;  2RQQ A;  3VST A;  2WAD A;  3KEY A;  1KCD A;  5FRO A;  4ZTF A;  4C2T A;  1D0Z A;  2WZP P;  4ZDP A;  4LIT A;  3A3B A;  1NG7 A;  1R6R A;  1WJE A;  1YE9 A;  3HUG B;  3JU4 A;  4OZY A;  2HPI A;  2M3A A;  2OV7 A;  4C2U A;  5FL7 A;  2VB6 A;  2NSP A;  1IA5 A;  4CCN A;  3ONQ A;  3EUA A;  3UR3 C;  2LY2 A;  1VLY A;  1OR7 C;  3MMY B;  4FAS D;  3LL7 A;  2HPM A;  3AL0 C;  1V0E A;  4TT3 A;  2O17 A;  1X19 A;  4OAY A;  3HXL A;  4F93 B;  4B48 A;  2UVE A;  3G2B A;  2LRE A;  4HG2 A;  3SDB A;  4XLH A;  3IAS 2;  2V1N A;  4G7W A;  3DPL C;  3C2H A;  2MYS A;  2DXI A;  1AIR A;  3AFH A;  1BLI A;  2E5N A;  2Q1Z B;  2W00 A;  1NBM A;  1KMH A;  2ZZQ A;  2IGO A;  1ZEL A;  2KHM A;  3FKJ A;  3N05 A;  1Z3X A;  3K4J A;  4NUB A;  1H8H A;  1UD3 A;  4RLQ A;  3EQO A;  3OE7 A;  3OR2 C;  4XOR A;  4XMY A;  1W9X A;  2WY8 Q;  4YZA A;  2LBF A;  3T56 B;  4HPQ A;  1KON A;  3ZIA A;  4G7X A;  2GOM A;  3DQV C;  3SZG A;  1FX0 A;  2PYH A;  1J09 A;  3K70 D;  3G05 A;  2L9S A;  1V5G A;  5LD2 C;  2CV0 A;  2O0W A;  2XF7 A;  4B3G A;  1EA3 A;  1E79 A;  3K70 C;  4XKC A;  2PJR A;  3OYB A;  4II2 A;  2IGK A;  2V9K A;  2JUG A;  4XKB A;  1O8G A;  1Y6I A;  1S9H A;  4DIQ A;  5HLT A;  2JJ2 A;  2XC7 A;  3KYL A;  2CS3 A;  3EUK L;  3AKZ A;  4ITV A;  5KNL A;  3OYK A;  3OS1 A;  3HL2 A;  1E1Q A;  3MD2 A;  4LG3 A;  5KCM A;  4BJT A;  2JJ1 A;  2ZSH B;  1H80 A;  3PL8 A;  2VBK A;  1WTH D;  4DGW B;  3DKY A;  4BE0 A;  4E7J A;  3DTK A;  2E1M B;  2L9N A;  4P22 A;  1QCX A;  1PLU A;  2X1E A;  1WMR A;  2A6T A;  3OOU A;  5CQE A;  3OYJ A;  2INU A;  2CUZ A;  2UUZ A;  2PYG A;  2WAE A;  4BXF A;  4NNJ A;  2QY1 A;  4PJL A;  3DU6 A;  5HNF A;  1D0X A;  2VQL A;  3GVJ A;  5HVQ C;  4HIZ A;  3OYC A;  4E4H A;  3H9G A;  4TSF A;  3W3C A;  3T53 B;  1X0C A;  1E3X A;  3OMY A;  4MLO A;  4XOP A;  3PNT A;  4B44 A;  1JRG A;  3BC9 A;  1UEL B;  3OL3 A;  1Y56 A;  2OUM A;  3LNN A;  2PMZ A;  4N4O B;  2PEC A;  2XF5 A;  4GQN A;  3BG6 A;  1O8J A;  2K3P A;  2CV1 A;  3I3L A;  4DNT B;  1E1R A;  2XZL A;  2QX3 A;  4DOZ A;  3ZPP A;  3E1S A;  2LOO A;  1MMA A;  3CJQ B;  3SEZ A;  3VYS B;  1E43 A;  1X4P A;  2MD0 A;  4DK1 A;  1O8M A;  3BCD A;  4BDZ A;  2X1D A;  1CZF A;  4QPO A;  3HAG A;  1MND A;  1U0J A;  1WJC A;  1MW7 A;  2M7A A;  1WJD A;  3HKZ A;  4PJJ A;  5CPR B;  4BEH B;  3GQ9 A;  4XM3 A;  1BOB A;  4KT6 A;  4BJ6 C;  2VJ5 A;  4KKS A;  4XON A;  4XR6 A;  2IQ7 A;  3DKX A;  3HPH A;  2Z8G A;  1HVX A;  4PJM A;  2FUG 2;  3SYT A;  4W8T A;  2JA2 A;  1TZL A;  2HZD A;  2GK7 A;  2W1O A;  3RTR A;  3D5R C;  4BE2 A;  3W2A A;  2BVM A;  2WJV A;  2V4J C;  4E6K G;  4OJL A;  1O8E A;  3LSM A;  2R7U A;  2QKL B;  3JUR A;  5LFA A;  1T5E A;  3MKZ A;  3EUH C;  4EAT A;  1RMG A;  2NST A;  3T9G A;  2F4I A;  2Y0S A;  2E5Z A;  3H35 A;  4RM2 A;  4BU2 A;  4KIT B;  3LFU A;  1O8I A;  3A3G A;  4YZQ A;  3H9Q A;  2W6J A;  4MR0 A;  4IQJ A;  2XSJ C;  1WJ5 A;  1QHH D;  3UW0 A;  1VF7 A;  1SKY B;  2VKD A;  4IX7 A;  4OWR B;  2DJI A;  2EWE A;  2ZZE A;  3GQB A;  4J01 A;  2E1B A;  1DP3 A;  4Z06 A;  1K28 D;  3D5L A;  5HOO A;  3DTE A;  4F92 B;  2HU9 A;  3HC7 A;  1V5F A;  2VJJ A;  3NWS A;  3OYA A;  2XZP A;  4RLF A;  4AVZ A;  1LFP A;  2Z16 A;  1OHH A;  2LBF B;  4C2L A;  2Z6B D;  4KKU A;  2F6C A;  4F52 A;  4E7L A;  2ZFU A;  4CH7 A;  2DT7 B;  3MKY B;  3CES A;  3I9V 2;  3QYF A;  1UD8 A;  2KPM A;  2HNH A;  2BW3 A;  4BL0 B;  4E7S A;  2L2O A;  3FDY A;  3BC8 A;  2PJR B;  3BCF A;  2VBE A;  4Z05 A;  3A2K A;  2VPL A;  2R7W A;  3PJR A;  3OW7 A;  1PJR A;  2ZSI B;  2IXS A;  4OJ6 A;  1EE6 A;  4YEL A;  4URR A;  4ZDL A;  1X1B A;  3PNV A;  2X53 S;  5AMV A;  4N4N B;  4W8S A;  4D1Q A;  2RRE A;  3BCB A;  2HLD A;  3BCA A;  4BS9 A;  4Z03 A;  3VSL A;  3H5N A;  3A35 A;  2E1M C;  4NC7 A;  3VYU B;  1SFK A;  3K10 A;  4CA0 A;  2XND A;  2ZZF A;  2F5V A;  2X3H A;  2VAS A;  3OYN A;  2F43 A;  4PJN A;  4XD7 A;  2WAQ A;  4PK4 A;  3L2U A;  1W36 D;  4E7K A;  1QHG A;  4LIV A;  1W0K A;  1JI8 A;  1MAB A;  1HZE A;  2LG4 A;  2AQE A;  2LRD A;  3DLA A;  3QOE A;  1W36 C;  1KZL A;  1G8X A;  4ZYA A;  2R7S A;  3FPP A;  1BR2 A;  4U7B A;  2I8D A;  3TMO A;  5DN6 A;  2NTQ A;  2M0M A;  2NOJ B;  3LMM A;  4XQF A;  2CV2 A;  4OZZ A;  1N75 A;  3VSU A;  2R7Q A;  3H9J A;  1UD4 A;  3LSH A;  1WJA A;  2M5S A;  1WP6 A;  4OJP A;  4YEJ A;  5C1C A;  3L2R A;  3SUC A;  4ANJ A;  4C9Y A;  4Y4R A;  4CUG A;  1D0Y A;  1RWR A;  4X0G A;  2KLO A;  3KRG A;  4HWV A;  4XKV A;  1NG6 A;  3HPG A;  5FRN A;  3F9K A;  2DOA A;  2NT9 A;  5FRM A;  4YXW A;  2ZTG A;  1UD2 A;  3HOS A;  1OOC A;  4I84 A;  3S8P A;  1UD6 A;  4U49 A;  4B43 A;  4CCJ A;  2M7B A;  3NWT A;  3RPU D;  4KIS A;  1UD5 A;  4KKT A;  2UVF A;  3M8J A;  4XOT A;  4XN0 A;  2W7N A;  1D1A A;  5HNH A;  2UV1 A;  2R7O A;  4UZU A;  2HVR A;  4XLA A;  1LVK A;  1DGW Y;  3KEW A;  4Z1M A;  2WSS A;  2M4K A;  3HG9 A;  4XKW A;  1OLT A;  2R4G A;  2MFZ A;  2OC6 A;  3PNY A;  2VKH A;  3W2W A;  1D1C A;  3MKW B;  4MXN A;  1OFM A;  4PSX A;  4DJA A;  2L7K A;  1I18 A;  1DBG A;  2XGJ A;  5HKK A;  1DGR M;  2NT6 A;  4CCO A;  4W8R A;  4J00 A;  3OWT A;  5JHF A;  3QOD A;  4BJ5 C;  3M1C A;  1MMG A;  1YX3 A;  2LY1 A;  3T51 B;  2W4S A;  2F1M A;  2O5R A;  1BMF A;  1BR4 A;  2IS6 A;  2O0V A;  4NQW B;  4KJZ A;  4U87 A;  4PFO A;  2CW8 A;  1N77 A;  4YZ0 A;  2GOX B;  1X1C A;  2D3N A;  1OFL A;  3CJR B;  3OS2 A;  4F91 B;  2VJ4 A;  3OIP A;  1G59 A;  2BSP A;  4F55 A;  1COW A;  3ZRG A;  3VYR B;  1ERD A;  1VJS A;  3EPZ A;  2O1D A;  3LMW A;  3V42 A;  3S32 A;  2CW7 A;  2UWM A;  1PKV A;  1KTW A;  2V6E A;  4EW9 A;  4OJO A;  2VLA A;  2M4G A;  4CCL A;  4PFP A;  3GQ7 A;  2X6W A;  4DBR A;  3OYE A;  3BLY A;  1HA8 A;  3FKS A;  4AYB A;  4ZTJ A;  2JSP A;  4PMH A;  2BW3 B;  2X85 A;  3LSI A;  1NHC A;  1HG8 A;  3K4L A;  2WBM A;  3C2G A;  3B8Y A;  1OB0 A;  2GJK A;  3PSI A;  4AU7 A;  2CMP A;  3K4B A;  3FBI B;  3DU5 A;  2K9L A;  4BGD A;  1W0J A;  3RSN A;  4BQN A;  2NTP A;  4E0F A;  4PSW A;  3K6G A;  3VMW A;  2ZTN A;  4ZDO A;  4CZC A;  2VQH A;  2V31 A;  4B47 A;  4IKF A;  2VQC A;  2KL4 A;  2Z1D A;  2WAF A;  2X6Y A;  3H5R A;  2XAU A;  4G6T B;  2VQG A;  3GQ8 A;  1O8H A;  3CZ6 A;  3VMV A;  2R9V A;  2XF6 A;  3BG7 A;  3U21 A;  3DEE A;  2NZM A;  2A5W A;  2P0W A;  3KX2 A;  3ZXS A;  4D9J A;  3E0J B;  4HSR A;  1I8D A;  3S3N A;  3H94 A;  4ASU A;  2BOL A;  4ZC3 A;  2X6X A;  3VSV A;  4P5O A;  1WPC A;  2ZXI A;  4YZX A;  3OPO A;  3L2W A;  1OGO X;  2CFO A;  3FBN B;  1JTA A;  1QJV A;  1O88 A;  2KVO A;  3OEH A;  1FMV A;  4W8Q A;  2WB1 A;  4E7H A;  2WJY A;  3K4M A;  3A1Y A;  3CP8 A;  3RCO A;  3OY9 A;  1P9Q C;  4NC8 A;  2KMU A;  1PYV A;  1GQ8 A;  2JIZ A;  1O8K A;  3UNG C;  4Y3O A;  3QYB A;  1IRX A;  1V0F A;  4RMN A;  3OYI A;  5CDF A;  2WA0 A;  2VL8 A;  1AA7 A;  4CSW A;  4FET A;  3OAA A;  3LSG A;  3K4N A;  1OGM X;  3DTI A;  1WJB A;  1LKX A;  4JMQ A;  3TL4 X;  2MAB A;  4BUP A;  2IGN A;  2R7X A;  2GK6 A;  1SAU A;  2BVL A;  4XN3 A;  2IGM A;  2X1C A;  3K4K A;  2IS4 A;  1BHE A;  3OIQ A;  1O8L A;  3ZGK A;  2VJI A;  2HVQ A;  3VYT B;  3ZSC A;  3OYF A;  2KP6 A;  1UAA A;  2CH0 A;  1GLN A;  3W2V A;  3WWG A;  3OL4 A;  2KZV A;  4DK0 A;  4B3X A;  4HST A;  2DT6 A;  1K5C A;  3PSF A;  2K9M A;  3DPT A;  4PUS A;  4IZZ A;  3WQZ A;  3IAM 2;  4QPQ A;  3DWL E;  4G6I A;  2GJR A;  2KDO A;  1FMW A;  2XZO A;  1VBL A;  4RM3 A;  2VBM A;  3GQA A;  2VXZ A;  4U4B A;  2INV A;  1X4O A;  1X1A A;  4P1W A;  1MMD A;  3OS0 A;  3VR6 A;  1RU4 A;  3GVK A;  5KHD A;  3OYD A;  3AL0 B;  2O04 A;  4CCK A;  2V7Q A;  4L8J A;  3BH4 A;  2LZJ A;  2R7T A;  2CK3 A;  5IK2 A;  3IP4 B;  4OAZ A;  2JDI A;  3S3M A;  4Y33 A;  1BR1 A;  3OEE A;  2MC4 A;  2WPD A;  1K6Y A;  4H4K C;  2KRC A;  1X1D A;  3RQ4 A;  2DIE A;  3FHN A;  4OJ5 A;  4F3Q A;  2AQF A;  3S3O A;  2VXD A;  3B4N A;  4HNT A;  1MMN A;  4GRI A;  5TGT A;  1MNE A;  2ZZG A;  2ODL A;  3IUO A;  3B90 A;  1QU3 A;  2CUJ A;  1YX5 A;  3H5A A;  3OYH A;  3ZPN A;  4HRI A;  3D5S C;  4C30 A;  2Z2S B;  1BN8 A;  2L5Q A;  4CCM A;  4R79 A;  2ZXH A;  2E60 A;  4IQ4 A;  4XL9 A;  2LH9 A;  3J7A Y;  2QKM B;  3VDX A;  3L2V A;  2QXZ A;  3PFY A;  2HQA A;  3A4C A;  3CP2 A;  4DBQ A;  1DBO A;  3L2Q A;  4E7Z A;  3H0D A;  4LIU A;  2QE7 A;  4FXU A;  1LDK B;  3K4C A;  5C1E A;  1T95 A;  4XLC A;  2JVG A;  3OYM A;  1EFR A;  2W6I A;  1IDK A;  4BQO A;  1DQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...