4XOTA

Tailspike protein mutant e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xotA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xotA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xotA02
4Z05A 1KTWA 1KCDA 1CZFA 3B4NA 2BSPA 5C1EA 1K5CA 1O8MA 4XR6A 3VSTA 1O8DA 4OZYA 4OJLA 4C2LA 4YEJA 2X3HA 3VMWA 4XKVA 1O8JA 1WMRA 2VJIA 3GQ9A 4W8TA 1QCXA 2ODLA 1HG8A 1JTAA 1QJVA 2O0VA 4YZAA 4XOTA 4XLFA 4XQFA 2O17A 3GQAA 4OJ6A 1OGMX 2QY1A 2QX3A 3GQ8A 3ZPPA 3B8YA 4XMYA 2NSPA 3WWGA 2EWEA 4W8RA 4OJPA 2X85A 1IDKA 4AVZA 1O8IA 1OGOX 3UW0A 4URRA 3EQOA 4YELA 1PXZA 4Z03A 1PE9A 3SUCA 4EW9A 4W8QA 1H80A 3T9GA 1IDJA 2NTBA 3GQ7A 1O8KA 1IB4A 4XNFA 1NHCA 3LMWA 4XN0A 4XLAA 3JURA 4XN3A 2NTQA 3VSUA 4YZXA 4XLCA 2UVEA 2X6XA 1PLUA 2NT9A 3FY3A 1DBOA 1IA5A 2VJJA 2Z8GA 4OZZA 2INUA 3EQNA 1BN8A 2O1DA 1O8GA 4U49A 4YZ0A 1JRGA 4XLEA 1XG2A 2O0WA 4XL9A 2PYGA 1O8EA 2UVFA 4W8SA 4XKWA 4Z06A 3B90A 1O8FA 2NZMA 1AIRA 3ZSCA 2NSTA 2NT6A 1EE6A 2NTPA 2QXZA 1RMGA 4XOPA 1OOCA 3KRGA 4OJ5A 4PMHA 3VSVA 2IQ7A 4MXNA 1O8HA 4I84A 1RWRA 1BHEA 1RU4A 5AMVA 4NK6A 4XM3A 2O04A 4OJOA 3GRHA 1X0CA 5C1CA 4MR0A 4U4BA 4HWVA 2VBEA 2VBKA 4XLHA 1O8LA 2X6YA 1OFMA 2PYHA 1VBLA 4XONA 2X6WA 1DBGA 4NK8A 1GQ8A 1KCCA 1OFLA 1O88A 2INVA 2VBMA 3VMVA 2PECA 4YZQA 4XORA
chains in the Genus database with same CATH superfamily
2IS1A 3UKGA 3HGYA 2GOMA 2EV0A 4Z4YA 3NAWA 1TW2A 1FNNA 4KYWA 1ZR2A 1XSVA 2W7NA 3GFIA 3Q9VA 2K5CA 2ZNYA 4IHSA 4M2LA 2J8IA 2MGQA 1GV5A 1N77A 3PSSA 1I3QJ 1TQMA 4BHBA 3BWGA 3RIRA 2QWWA 1G7SA 3GMEA 2DDBA 2O0YA 2LREA 4B4CA 3A02A 3B02A 1KQ5A 4OJ6A 3BH6B 1B9NA 1TWAJ 3BJOA 3LL7A 5HDNA 1AIPA 3ASTA 1XD7A 3AG3H 5ILSA 2R7TA 2NNNA 2R93J 2AQFA 5K5OA 4X7FA 3B8YA 4HQMA 5HODA 4BY1J 2GQQA 3NE5B 2BHYA 1EKEA 4TMXA 3DCFA 4ZV4A 4NB5A 2X85A 3S1MJ 5BMZA 1B1BA 1NK2P 4UZUA 1S5LC 2BV6A 3ULQB 4DIQA 1K9MD 3LA7A 2L02A 1EJ9A 1GLNA 4ESBA 3QPHA 3EQOA 1K83J 1X58A 2ZZEA 2RC6A 4ZCLA 3K4LA 4Z4ZA 3R4KA 2Y75A 5IT9Z 1I3AA 3RKQA 1D1CA 1PVEA 4Z4UA 3F9KA 3HRSA 3ELKA 1QO0D 3CW2A 3S1RJ 1FRNA 1F4KA 3FHZA 2B0RA 1IRXA 1BI3A 4K2EA 1S9HA 1MKMA 1A8PA 1IB4A 3BCFA 1G3SA 5H20A 2I8DA 4WK8F 4LG0A 2BGIA 4Z4SA 5TRDA 3F8NA 3RYRA 1EH6A 3BC8A 2DCEA 2OTLI 1QU3A 1H8EA 2C4UA 3AVVA 3VSUA 3GTPJ 4D1QA 4M3DA 4ANJA 5J4YA 1EWYA 1TLHB 3L00A 5L3EA 1X4PA 2ZZGA 2LOOA 2D9RA 3OS2A 2NT9A 2B0LA 2HOEA 2V7UA 4RJLA 3TOBA 1VQ6I 1T6XA 1RI7A 2UZKA 2Q6LA 4AWXB 4TV7A 2M0CA 3OWTA 1U9NA 1XG2A 3JQQA 1TL8A 4MEXF 2FF4A 1RIOH 3EYIA 4HX7A 4WWVA 2DI3A 4BDYA 5E17F 3DBLB 1VZ0A 3LFUA 3LA3A 1ZRFA 3GTKJ 3DTKA 4EH1A 4IL6C 1H89C 1EP2B 4ACAA 3PNVA 1GAWA 2DTZA 3BCDA 4PZJA 2OK7A 1G3YA 3OJXA 3W5HA 4YFXF 2ZJQF 1K4ZA 4LC0A 2WC2A 2QZAA 4P3YA 5L3DA 4Q4ZF 5HLTA 1BI2A 3EETA 1YOVB 3H35A 2GREA 3LNNA 2CV0A 1VQKI 2DJIA 3HRUA 3ZC3A 1XTAA 2P5KA 1HW1A 1J5YA 4YFOA 2FD5A 4XLHA 3BROA 2HZTA 1IGNA 3G1LA 4RM0A 2PIAA 4BJ6C 3HUGA 3FDYA 5TISC 2LZJA 1LFUP 2D3NA 1YX2A 4TSFA 4H0EA 4IOCF 3ZQLA 2F6CA 3BR6A 3A35A 5D5UB 1R5ID 2DBBA 2DLLA 2KJBA 1D8KA 1LDKB 3ZMZA 4MTDA 2VJ4A 2L9RA 1YS7A 3BQYA 4EMSA 1USTA 5DD4A 1E0EA 1VHEA 2GJPA 1WI3A 3P5JA 1FSEA 3MZYA 3OL4A 1W0JA 2M4GA 5CPRB 4FX4A 1TC3C 2ZL7A 2BY1A 2E35A 5LGNA 1WDTA 3S8PA 4XSXF 3JRDA 1OGIA 2XAFA 3AG2H 5JLWA 1BPLA 2DDAA 3HOUJ 2NOGA 4AC9A 1J2XA 4L9NA 3A3GA 2C4TA 1MW7A 4XKBA 1X4OA 3U6KA 3K70C 1O3RA 2QY1A 3LMMA 1LEAA 2KDZA 1A31A 2E2JJ 2DOEA 4LFUA 1RUOA 4DBQA 5EG0B 3CCQB 2K27A 2WA0A 2PMDA 5CVIA 2QQAA 2R9VA 5HZBA 1BN5A 1Q7YD 2HYJA 3VO1A 3PSZA 5DM7F 1L1IA 3KX2A 2DQRA 4AIKA 2WAFA 3FBNB 3HOZJ 2L7KA 2BM0A 2O9LA 3L2VA 5LGTA 5TV2A 3S2WA 4YELA 1GJRA 1KU2A 1FDRA 3KLOA 4H4KC 2NVXJ 4A3LJ 1E3HA 3HBLA 2M7BA 2X0LA 2IGMA 2XB5A 4W8QA 3BR1A 5BS6A 4BUPA 1HKSA 4OMZA 4O5VA 5FFXA 3Q3AA 1LUJB 1WOSA 4DZJA 4HPQA 3O3KA 5DUIA 3WGIA 3M07A 4X1EA 2IT0A 1HC8A 1JJ2B 3L09A 5GADJ 1JUPA 3E5UA 3CP8A 3G1MA 1SD6A 2NTQA 3ZMUA 4DK0A 2FU4A 2X6OA 4X05A 3T53B 1QUEA 3VNVA 3PSFA 1YIJB 2QTZA 3KCCA 1YS6A 4MFDA 2YU9J 2L9NA 1EH8A 1W4MA 4F55A 5GAGJ 4XLPF 4DQLA 4F7DA 2OTJB 2INUA 2Z8GA 1QA2A 3ONYA 2E7XA 4L9VA 1IC8A 3WBJA 4EJWA 3GTQJ 1PDNC 3DPLC 2PYGA 2VQLA 3FISA 3CMEB 3CD6B 2ZO4A 5LEJA 2OC6A 3TOAA 2FNAA 1KJZA 5CQGA 2NT6A 2P6SA 3CLOA 3VPRA 3OYKA 2LSOA 3TP3A 4HNTA 2VFMA 1QZZA 2WJYA 2JIZA 2ME6A 3GZ5A 4XBFA 1M1KD 4LLGF 1R00A 3J7AY 1R4MB 4HDVA 1X1DA 1WU8A 3KL9A 2PMUA 4JX4A 4P3IA 3AVTA 2IQ7A 3I53A 5DS9A 4P96A 1OCOH 4F91B 2FX0A 1E1RA 3SDBA 2DPUA 3L2QA 1RU4A 1V5FA 2XVCA 2XASA 4E7KA 1QGZA 2O04A 2DK8A 5FO0A 4Y17A 1X0CA 4KICA 2MC4A 4M9XA 5M3MJ 4MR0A 3O6BB 2D5VA 2ZBUA 5BQTA 1WORA 4CYCB 1YLOA 3ASRA 3JCUC 3COAC 1H0MA 1VBLA 1W0UA 1T33A 1FOWA 3LQRA 4E4HA 1W7PD 1W7PB 2EFOA 2XAGA 4ZDOA 4DJAA 1D3YA 2PECA 4X6AJ 3C2GA 2F2EA 2WAEA 3ISPA 3GVKA 1VQ5B 4Y33A 1Y8QB 1K5CA 2HVRA 4XR6A 5IYQA 4Q47A 2L4MA 2HVSA 2VONA 1BM9A 1LEBA 2FMYA 1FBUA 2F48A 3FXLA 3CCVI 3IRQA 3QFCA 1TW3A 5HS7A 2ELKA 1GXQA 2HS5A 2KL4A 3O8HA 4MHGA 2GLOA 1HCRA 3FPPA 1G4DA 3WG9A 3OFNA 3F6VA 4D9JA 2RQPA 1TP4A 1QNTA 2P5LC 3OSGA 1JTAA 5LMZA 5DYMA 5J3OA 1WKMA 5J1RA 3SJMA 2ESNA 3HRTA 2OCEA 2MYSA 5AONA 3DU1X 2D1VA 5IYCJ 2L5QA 2CQNA 2K4BA 3EUHA 4A12A 1J9ZA 3CJNA 1FP1D 1R6RA 2QLZA 5FLXK 5FLVA 4LK1F 3VB2A 4IRGA 2MD0A 5E6TA 3I9V2 2BW3B 2DIEA 3GSIA 2H09A 4RGUA 2O3FA 2JMWA 4Z4TA 1DQUA 2Y69H 1WPCA 3MVPA 4KIGA 2PFBA 4R8HA 4RBOA 3KYDB 4M53A 2R92J 2ZC2A 4D0PA 4G7ZF 3AAFA 4BKXA 2JRTA 3CLQA 2MLKA 3BZ6A 1WTHD 3OEEA 4FQGA 1HF0A 4P55A 2Y0SA 1B8IB 2M34A 3BY2A 2K9LA 2XGEA 4NQWB 4BJ5C 3CC7I 1UHMA 2D74A 2R6HA 1T0FA 1U78A 2XC1A 3T9GA 3W2WA 3DEEA 3R61A 5JR3A 2GQFA 2XNCA 4KFCA 4MGRA 1UG2A 1UD2A 2JSCA 1ZM2A 1X2MA 2IXSA 5E3MA 1E64A 3U6BA 2ZXJA 3BCBA 4IHVA 1ZH5A 4XLCA 3Q5FA 3HKZA 4GYGA 1Y6IA 2XF7A 4KKTA 2VPRA 3EQLF 3K4BA 4KDPA 4OPVA 4DNRB 4BEHB 1QRCA 1V5VA 3M1EA 2JA6J 4PAAA 3R0AA 2E1MC 3SZTA 3WNCA 3W2VA 4XL9A 4ZYDA 1O8EA 3VOEA 4U0VA 1O8FA 2JQ7A 4S05A 2DTRA 3G6EI 1LDDA 4CO8A 1YFHA 3BG6A 2LFBA 5AIQA 3LSPA 3GTOJ 2NTPA 2DK5A 4RGXA 3RYPA 4IHYA 2LVSA 1BJKA 4IHTA 1C0WA 1WQ2A 5KAFC 4IEJA 4ZTJA 4P5OA 1S8NA 5HLGA 1VNDA 2EINH 1LKXA 1MBJA 2OQRA 5F0CA 1A5JA 3H92A 1MNEA 2AHOA 3AK5A 2PMHA 1UD4A 1R5NA 4P26A 1IG7A 2GXGA 3GW2A 4HV6A 3CCLI 3L2CA 2HTSA 1PUFB 1OYYA 1I7PA 3P7NA 1BIBA 4U7DA 1K4TA 4WZLA 1ETYA 1MBFA 2DQLA 2XF6A 3LSTA 5FROA 2CUZA 3CMAB 3GCMA 1U5TC 3S32A 2WZPP 4I0AA 3ZQCA 2BGCA 5DCMB 1DBGA 1Z67A 5J1UA 4B8XA 5M5WJ 2BV3A 2IRFG 3MCAA 2INVA 3P9KA 3PUBA 3OYJA 1S72I 4G1BA 2CQXA 2OJED 3OOPA 1O3TA 2CNDA 2YX4A 3IUOA 1QA3A 2F1MA 1BJAA 3LJYA 3NB2A 1Z7LA 4OU0A 1FBQA 2HQNA 1T98A 4HLYA 3S16J 4P1WA 4GFBA 4Q5SF 1SM4A 1YQAA 4XKVA 4RGRA 3DKYA 1T08B 5J3LA 2JRMA 2HKOA 2Z33A 1RESA 1MNDA 1WMRA 1ETVA 2ECBA 2Y0SN 4UHTA 5DDGA 2K9NA 1IDYA 2D2WA 1YIOA 1W5TA 3ONUA 3RPQA 4ZZDA 4HX4A 3PSIA 2ZMEC 2A5YB 2V7TA 5FKMA 3NARA 4C3JJ 4RB2C 3OYLA 1VQNI 3QOPA 3LFKA 3VMFA 1ULYA 2DOFA 2VKHA 2R5YA 4CH7A 3Q39A 2YR2A 3E5QA 2VT2A 3CCMI 1UD8A 4JRAC 2KZVA 2HPMA 2NAZA 5C4XJ 4LBVA 2BYVE 3CP2A 3S3MA 1MZBA 3W6KB 4BY7J 3ZMTA 2GXAA 4RPBA 5J47A 1Z91A 4YEIA 4A3KJ 2DMTA 1P4XA 5BNGA 4XRMA 3DP7A 4AD9A 4NC7A 3DXJF 1UAAA 3FK6A 5K7HA 4J0QA 3KP2A 2NOJB 1OKRA 3E3VA 4IX7A 1YX3A 4P9SA 1FJLA 2K9MA 4UV8A 3WTZA 2P3MA 4TMVA 3J7YJ 4NQWA 5CVJA 4BHPA 5ICCA 3F8FA 3ZZTA 2M5WA 3HPGA 2UVEA 5IYBJ 3S2DJ 3OV8A 2TRTA 3KP5A 1J9IA 4D5CA 2DU9A 3DU5A 1Y0YA 3W2GA 5AN9A 1ZGWA 3CCJB 4C9YA 1VLYA 3O8GA 4G5GA 2CGPA 3I3LA 3CCUB 1S0UA 4LLNA 2DYSH 3BDDA 1TQPA 2V1XA 2JUGA 3E6BA 1N07A 3W3CA 3LSIA 4CCKA 3E6CC 1PJRA 1LVKA 3AG1H 1EFRA 4ZDPA 3HOWJ 3OZWA 1FNMA 2ZZQA 2OA4A 4X0CA 5FA6A 1V54H 1HA8A 3FPKA 2E60A 4MNUA 2DOGA 2VBZA 2MH2A 2M4KA 5FKLA 4ENJA 4MXNA 3H5NA 4R1HA 3AVUA 1K7AA 3D5RC 1I50J 2DFEA 4OMYA 5JLVC 2V7FA 4CUGA 1IJEA 3A4CA 3EUAA 5B5EC 3OKXA 2VBEA 1N25A 4U0YA 2E1BA 2VFQA 2MLGA 4B3XA 5H2FC 1QH0A 4G94A 1OFMA 2PYHA 2BE5F 3RPUA 5DM6F 1I6HJ 2OBSA 4II2A 2W7ZA 1O88A 3M1CA 2QMUA 3JR9A 4G7OF 2KT0A 3QFRA 4TKOB 5GPCA 2XKPA 5F04A 4JMQA 3TP0A 1CZFA 1GO2A 5EG0A 3X2QH 2OD5A 3HOXJ 3J7AO 3VSTA 4BJTA 3L1PA 3CCSB 5IP6A 1P4AA 4A5NA 4NNJA 1OR7A 2B7CA 4KT5C 4LBYA 1D1BA 2EIXA 3J80K 3QODA 4J19A 4CXFA 2X3HA 3BY6A 1APLC 3CCEB 2QGGA 3RZDJ 3TDZC 3CDLA 3KZIC 5EDNA 4XOTA 2EIMH 4IOAF 1VQMI 3KEOA 2O6GE 2BM1A 4ZJZA 4RD6A 4RCYA 4CYDA 2KPMA 4DW6A 2E19A 1XGSA 2XAQA 3CPWB 1Z9CA 2L2OA 5IYWA 1T8IA 4HSTA 1F60A 1OB0A 5F4JA 1QUFA 1MBGA 1BQEA 3BH7B 1R7JA 1IXCA 4E70A 1KZLA 1EV7A 2DA2A 2BM7A 2QKLB 2ZZFA 4LBWA 2DMNA 2PMZN 1XCVA 2BXYA 3WGHA 3PA2A 1QA1A 2ZKZA 3SZGA 1BIAA 4XRSG 4RCZA 1VQ8B 5J6XA 1XMXA 4Q7JB 2DFIA 3I0TA 3RCOA 3LOCA 2W6IA 3WNDA 3J7ZI 1ZYRF 4EM0B 1QHHD 4HEA2 1LLZA 4UVCA 3MKLA 4UXNA 2A6EF 4A3EJ 5FRMA 1NJID 5A2QK 2DY1A 3A3BA 2CQ7A 2YUSA 3E6MA 1KYWA 3ZMSA 3OYMA 3CCEI 1Y8RB 2VE8A 2VI6A 3CD6I 1E3XA 2WZNA 5IP7J 5TY0A 1IDJA 1QQIA 2F5VA 2FNPA 2K3FA 2VC0A 4JX6A 1W1WE 4GDFA 3OYEA 3OSFA 1WH5A 1E3OC 3LMWA 1YRNB 1ZG1A 1IRZA 4RAYA 1FX7A 5IT3A 2CU7A 3JRBA 1KQ0A 1YLFA 1TT5B 2L7ZA 4FETA 4ZZLA 2RGVA 1YIJI 3QU6A 2CO5A 3H3VK 3GTMJ 1RETA 2QF7A 2XUBA 4RAFA 2VNHA 1Z3XA 2A6HF 2ACJA 2HQ5A 5A88A 1IXRC 2Z1DA 1YJNB 2CYYA 2MA3A 1NB9A 2OBRA 5ILVA 3ZMVA 4Y9RA 4XKWA 1MMGA 3HZJA 3TO9A 3MZHA 1QVUA 1U3EM 3OYDA 1LFPA 3IWFA 1O3QA 2RC4A 2P6TA 2VL8A 1D5YA 1DDGA 1DGRM 4N4OB 5HDGA 2WTEA 1J75A 3MWMA 1ZELA 2L54A 2BN4A 4G6DA 2B5OA 3KEWA 3ASQA 2X1EA 3MCZA 5DV5A 4UVAA 2RAEA 1F5TA 2XOKA 2XROA 1O8HA 1I18A 1BR1A 1BHEA 4C3IJ 2EJRA 4NK6A 3ZQFA 4BXFA 1DP3A 2JUCA 1MBKA 3HOVJ 1WJFA 2WBMA 2L7FP 2PJPA 3OL3A 3NQOA 4PCQA 1U2RA 3T0YA 4FXUA 3SFZA 1E3ZA 3OYNA 3G05A 1Z05A 2LF8A 1OFDA 3BTJA 2CBXA 3S3OA 2M8GX 2NVTJ 1IF1A 1SKYB 4IZZA 3FMSA 2R7VA 4CDGA 5TR9A 1LM1A 2DA1A 2BM4A 1ONVA 2CSOA 2DA6A 5BPDA 2XPUA 2ADUA 2PX9A 4G6TB 3B4NA 1YE9A 2JPCA 4Z6YA 3GTJJ 2Q6OA 1WH7A 5D6EA 2CFXA 3E1YE 2W48A 4OP7A 1O8DA 3DWLE 2V9KA 3ZCOA 2HU9A 2O5RA 2CQKA 4X7DA 1RC9A 2LG4A 3C2BA 2VLAA 3ZBTA 2P0WA 1QZEA 4UZEA 2J5PA 4LJZF 1LDJA 2OAZA 3U2RA 5F1RA 4YZAA 3WTUC 2CMPA 3TEDA 2HPIA 3OS1A 2K85A 3JRAA 1U9OA 1BBYA 1B2RA 1MJ9A 4RAZA 5DSZA 2VNKA 1SVLA 1VQKB 1ENHA 2VFNA 3GQ8A 1ZARA 4BPRA 2JSPA 1OJLA 4C43A 3TQNA 1E79A 3VO2A 3HG9A 1BOBA 2P5VA 4M4SA 4C0SA 2V1DA 3ROUA 1ZGJA 1WPKA 3LSKA 2Q2EA 2CV2A 3P9CA 1IJFA 3LYCA 4B47A 3BG5A 1K8AD 2GK7A 1BI0A 2R7ZJ 1JKPC 1MMDA 4PGGA 4A0ZA 2AXLA 4L5EA 3N97A 1K6OA 1W36C 2F4NA 3CRZA 2KMUA 2KIFA 3ZGKA 1F9NA 1Q1VA 2HOAA 4NBSA 2GAUA 1LE8A 1IUFA 3TW6A 1JT0A 2E2HJ 1DG1G 1EP1B 3I59B 6PAXA 1OCPA 3DBHB 2QBYA 1SAUA 2NTBA 1OCCH 3IH2A 2C77A 1XDSA 4UUVA 1NHCA 1Y1WJ 3OE7A 3FXOA 1Z77A 4XN0A 3SEQA 5IYDJ 1H9GA 1BLIA 4DQKA 1FMWA 2QSFX 1EZGA 1HDPA 4EGZA 1R5HA 1XPXA 1WSRA 4P2NA 3AVXA 2AXTC 2XGCA 3A0HC 1W87A 1RR7A 4EVIA 3F3XA 1JRGA 1TYUA 1G6NA 2HXOA 4O6JA 5A8AA 1JB9A 2UVFA 4UUTA 3VYSB 3PM1A 2WADA 3H5AA 3ZQ7A 3QWLA 2JWTA 4BAYA 5CVUA 2L4AA 2MD5A 3IKVA 2M30A 3GLXA 5FO1A 1AHDP 2IW5A 1AOYA 3QYBA 3I56I 3ISXA 4DK1A 2GK6A 2KRFA 2ME0A 1S29A 3BQJA 2P8TA 3TO7A 4XICA 4QFMA 2DERA 3W6JB 3S15J 2V5IA 3JTGA 1Y0UA 1IRGA 2DW4A 2KJCA 1SFKA 3O2PE 3M9AA 1OLTA 2OBPA 5K1YA 5FLMJ 2VC1A 3G4SI 5CDFA 5AMVA 2VBYA 1IW7F 3T8RA 1FYMA 3GF2A 4W97A 2EWNA 3OJWA 4ZYGA 5LHGA 1JUMA 3KZYA 1K78A 2Q6KA 2XEXA 3ZIAA 4U4BA 1GR1A 3F0CA 4A6DA 4A93J 3FKSA 3JQPA 4TMTA 2ICWG 2W4SA 2EV5A 5HOOA 4UV9A 3JSPA 1UFMA 4AM3A 1QVFB 2ZFWA 2BZTA 1O7FA 2VFPA 1UELB 4JQFA 1YJ9B 3Q0VA 4X06A 2IGKA 3HOTA 1VQLI 2LY1A 2GXBA 3S1NJ 1F43A 4PJJA 3V4GA 3H0DA 4FK8A 1JA0A 2XRNA 3I59A 2B7EA 5FJ8J 4KNYA 2V7WA 2IPQX 3M8FA 3RJPA 4OPWA 2G7UA 4N9IA 2DA5A 4AVPA 2RKHA 3OR1C 1ZM3A 3ZPNA 4PDKA 3F8MA 4RGSA 1QRBA 2QE7A 3WE3A 1HG8A 1JGGA 1ZM9A 4HRIA 2VASA 1VI0A 2V7VA 5JLXA 2PBIA 2V31A 2BXZA 3SQVA 2VT3A 4A3GJ 3VDXA 1UHWA 2QX3A 1PJ6A 3V7AA 3ZBUA 3GUDA 1MDMA 2XTWA 2F4MB 1IAWA 1V0EA 2WYRA 3QQAA 2KFDA 2ZMEB 4OJPA 4PJLA 4HV5A 1T38A 3RQIA 3U2QA 1T6SA 5FIUA 4AVZA 4HAMA 4FASD 1TQIA 2E71A 1EH7A 2VKDA 5E1WA 5EJCA 3SEJA 2KP6A 5CYVA 4YAWA 2E1NA 3WTXC 4PFOA 4TT3A 1MJAA 3KEYA 2VBSA 1U5TA 3CQZJ 5D4RA 4WQMA 1BX1A 2A5WA 1PUFA 1KU3A 3KIOA 4YIRX 5BSXA 5DEQA 4AIDA 1KK3A 1A35A 3CCVB 3B8HA 3IP4B 2Q1ZB 4YC5A 3RY8A 4YAOA 1N75A 4HBLA 1DU6A 1E17A 1XG1A 4YDTA 1DU0A 4HLXA 3SXYA 4KH3A 4QUZA 3K6GA 1U5TB 2BSAA 4CCNA 2EFNA 3IH3A 4CHUA 2DOAA 5HDKA 4CYCA 4RD0A 1CLWA 1IN6A 4FISA 5EZHA 3KEQA 4U87A 4IKFA 1STZA 1UD6A 3ZQIA 4A2UA 1H8AC 1ZGAA 1K78B 2FA5A 1T0FC 1TZLA 2XDVA 2XIGA 2ZFUA 4ZC3A 3ZOBA 2PJRB 4M0LA 3DFGA 4W8SA 1O4XA 5IK2A 3VR6A 3K2ZA 2XRLA 5GAEJ 1WP6A 1MDMB 1HA3A 2XNDA 3ZSCA 2NS8A 5DNSA 2E1OA 4KIFA 3SFIA 5K5RA 2VE9A 1IO2A 3HSFA 1PYVA 4L5JA 4C2TA 3E7LA 1OPCA 1FMVA 4IF4A 1EXMA 2FEZA 2Y31A 3W2IA 2XGJA 3H36A 3OYCA 1VJSA 2EZIA 1VQ7B 3BR3A 3VODA 1PJ5A 1B9MA 1KQ9A 2OZUA 5E3LA 5F4MA 1P4MA 5J35A 1O8MA 1RWRA 3GXOA 1MJBA 2IS6A 2ELHA 1UMKA 4KKUA 3JRIA 2ELJA 2E1MB 3HHGA 5DCFA 1GT0C 1J59A 1T39A 3FIWA 1VQLB 1YJ9I 1HSTA 5J8FA 1K73D 2HQRA 4CZZA 1CF7B 3V7RA 3HTUA 1OHHA 1T6ZA 1Q86D 5L3GA 1IV6A 1UJ8A 1FY7A 2WAQA 2DT7B 1COWA 1IZ1A 2RC5A 1JTYA 3IKTA 2EB7A 2QTLA 5E1ZB 2MH9A 2DN0A 3IH4A 3U9GA 3J80Z 2GBYA 2IA2A 3S93A 3BPXA 4EJTA 2V4DA 1E1QA 3ZZ0A 1ON1A 2C6YA 3BCAA 3WU0A 2FOWA 4X07A 5E20A 2N8GA 5H6RA 1K79A 3CCRB 3A8IA 3I56B 1KTVA 1QQ1A 2ODLA 2QUFA 3OAAA 2Q2EB 3KYLA 2ISZA 1JGSA 4DYRA 4XRFA 4XQFA 2O17A 2L9VA 3HJEA 4S04A 1U8RA 2F5DA 2EZLA 2FBHA 4Y3OA 3QSYA 2Z9OA 1QGAA 1XS9A 2NSPA 5EGOA 3V7SA 3CCQI 3ZP5A 3SQNA 1W35A 1FNCA 4WXCA 2ZTNA 4PC7A 1R4NB 4Y4RA 1MSFC 4ZTFA 4M73A 5CVVA 3F22A 4BEHA 2ZJRF 2IJLA 2E36A 3OYAA 4ZYAA 2G7HA 2WY8Q 4ZH4F 2HOTA 1WSUA 3M8EA 3TO6A 3VYRB 2BVNA 4EJOA 4PUSA 2EFGA 2JA8J 1HSJA 1WRJA 4L9JA 2G0EA 3JW4A 3PIOF 2D3LA 2OUMA 1NRKA 1EFCA 1X1CA 2LMDA 3ABKH 4HNUA 5K7ZA 3NRVA 1NDHA 3MEXA 4A6EA 4RM3A 2JT1A 1O7LA 3ABLH 1TBXA 3AVYA 4D7NA 4PC2A 3BZCA 3DU6A 2JA5J 3H94A 1DBOA 2V1NA 1HKQA 4RM2A 5FKNA 4JOMA 1SFOJ 1LB2A 2R7FA 3U21A 5D5VB 1FT9A 2HNHA 2NNYA 3GTLJ 3BC9A 1Z21A 1G7TA 1HLVA 4XLEA 2YWEA 1J7KA 2KIMA 1X3UA 4JP0A 4TMWA 1ZG5A 3ABUA 2HEOA 5EYRA 3TBIA 3HM5A 2LBFB 3NEUA 5FFZA 4RB3C 3WTVC 2HCJB 2RQQA 1WWXA 3K10A 3EDPA 3KLNA 5D8LB 5GV7A 1V5EA 4I7HA 1RMGA 1ZAOA 2H6CA 3DKWA 4EQQA 4NC8A 2A05A 2AHQA 4A3BJ 2K9SA 2V79A 4Y7NJ 2O8KA 2XAJA 4RPDA 3VSVA 1JJ6C 4MYUA 3B6CA 2OU2A 3IC7A 4I6ZA 4B3FX 1BR2A 1B4AA 3S1QJ 1JKOC 2VBWA 1OFCX 3GRHA 3LA2A 4Y13A 2MC3A 1O57A 2P7CB 2HKXA 2K7LA 3MKWB 3K4NA 3LO8A 2XHKA 5E79C 2X6YA 2W57A 4RS8A 4E7SA 1OYWA 2NV4A 3QFSA 1QA6A 1OFLA 2QZ8A 2W85A 4G7HF 2K02A 4XORA 4QIWN 3MD2A 1B6AA 1Y39A 3Q3SA 2DA3A 4M1KA 3CJRB 4BDZA 3OS0A 5K7FA 1TVCA 2FBKA 2HZDA 4P9UA 2GJRA 4RDUA 2VZLA 1REPC 4C30A 1DPUA 3GBGA 1BJZA 2CJJA 3JREA 1X19A 3OYHA 1E63A 4E7HA 1V5GA 3TW7A 5KNLA 5J8CA 4L5IA 4XD7A 4YFKF 2B7BA 2E5ZA 4G1VA 3M7GA 4N3NA 4WCGA 2M3AA 2XPVA 1RZ4A 2JA2A 1WFXA 2R5YB 3M3YJ 1E62A 1FNDA 2Q0OA 1QHGA 2QQ9A 4KIBA 2VNJA 2PE3A 2EWEA 1E2XA 1R58A 2QM3A 4R71A 3BLYA 3DKXA 3H1CA 3G73A 1XSDA 3JU4A 1WCMJ 1D0YA 4X7CA 2F3LA 3VYUB 2JJ7A 3WTTC 1L3LA 3EPZA 3CB4A 4KISA 2JJ2A 4QHYA 4PSXA 3WNBA 1PP8F 1F36A 3CC4I 3SUCA 2OF7A 2AO9A 3OP1A 3WY9A 2XC7A 3FHNA 1FTZA 1BW5A 2LR8A 3WTWC 2G9WA 2XGXA 1N0UA 3SLNA 3QP6A 2OV7A 5GV8A 3BTCA 2VFOA 1NG6A 4PABA 1ETWA 4HF2A 3K4MA 2HMAA 2DMUA 4DBRA 2DXIA 1J09A 4OINF 3JRFA 4LD5A 2QSHX 3WYAA 3M8JA 1FIPA 2WB1N 2QQ8A 1I6XA 1R5BA 2CUEA 1IV8A 1KGSA 1S7OA 4OOVA 1EP3B 3HPHA 2CW8A 3A0BC 3R60A 5B3SH 2FQ4A 2YSRA 4I99C 5F64A 5HS9A 3C7JA 2CWEA 2IA1A 2VJJA 5ILUA 1TSPA 4CCMA 2EZHA 3OZVA 5KHDA 3HSRA 5JVTA 3EQNA 5D4SA 3QAHA 2FSWA 4YZ0A 2ZJ2A 1H85A 1F1ZA 1WJBA 2EFPA 1IB0A 1NB0A 5IYNA 3LSGA 4NDLA 2X53S 2HYGD 3PUNA 4A0YA 3S2HJ 2X1CA 1QX4A 4N4NB 5GTHC 1Y1VJ 4I2OA 1QGYA 5A89A 1V0FA 2DMPA 2LTPA 2NSTA 4QSHA 5F1JA 3DPUA 4KT6A 3ML3A 3SYTA 2VUMJ 4BQNA 1UG0A 4B3GA 1MGTA 2TCTA 1OCTC 1JTXA 3SKBA 1QVTA 3OW7A 4PMHA 3TKYA 1A6IA 4UB6C 1D5VA 1HW2A 1O3SA 2MG4A 3PO3J 2XNJA 1QBJA 1E3PA 1RRJA 1SFXA 3CCSI 3R6KA 5IPAA 2HWVA 5FNZA 1Z0XA 1GDTA 2CUFA 2H94A 5EGOB 4PGOA 4Z2YA 4XM3A 3PENA 1JXSA 1ZM4A 3PVDA 3WE2A 4AC0A 5IYRA 4B3AA 2X4HA 2IEKA 4RDLA 2VBKA 3HGGA 1ETKA 2W82A 2WAQN 3ZQGA 3UR3C 2ZXHA 1I1GA 2C78A 1WI9A 1MBHA 4O3MA 2BM6A 3KYCB 3ASNH 2RDPA 2DYIA 1OB2A 2QENA 2DCUA 1KCCA 3K4CA 4AUXA 5F08A 2IAIA 4IRIA 4XKCA 3CESA 3K1PA 2ETHA 2KIUA 4CCOA 4BU2A 1ORKA 2O61A 3J81k 5JHUA 2EA2A 3BT9A 3ZN1A 2B9SA 1KK0A 5LLQA 1HDDC 4TN1A 1T56A 2H6BA 2VXDA 3UNGC 2FX3A 3GFMA 3JTHA 4V2GA 3D26A 2NS7A 1HW5A 2VJIA 4IHWA 2EBIA 4W8TA 1TLLA 3ZQHA 4FE4A 1W34A 1NHAA 3HB9A 3D0SA 2GA2A 1TYWA 5D8KB 4XLFA 3WHBA 3K70D 5EEHA 2LP0A 2R3SA 1XCBA 3MN2A 3CO6C 2L01A 2P81A 5FL7A 2BW3A 1Q82D 3KPHA 1VTNC 1R22A 2COBA 2M0MA 4I98B 1LQ1A 3ZPPA 3CMYA 2VN2A 5H59A 3CCJI 3GFLA 2Z5UA 4W8RA 1YTYA 3OR2C 2UWMA 2HXIA 2OYNA 4A0XA 3VSKA 1W5SA 2W00A 4YFNF 1OQYA 1OCZH 2C5BA 2IP2A 3UW0A 3K0LA 2X9DA 1KZHA 2EFQA 1PXZA 4GRIA 3I4PA 2X0KA 4QVAA 2W84A 3N90A 5IOZA 5TJJA 3CXCB 3CCYA 5AIPA 3JAMK 3K7AJ 2RVCA 2V9VA 1MIJA 1JNYA 3NWSA 2ZITA 1TNSA 3RKWA 2NVQJ 3QPSA 3G4SB 3E97A 4XNFA 1YO5C 3TL4X 3JURA 1I8DA 3K69A 2E1CA 4YZXA 4UUSA 1D8JA 3H5RA 1LNWA 2X6XA 4J01A 3ECHA 2E2IJ 3CCMB 1QFYA 3FY3A 2JN6A 1IA5A 1ACIA 1MNMC 1OMIA 3F8BA 5ICFA 4QV2A 3V8JA 3V8LA 1O8GA 1VQPB 3D5SC 3FKIJ 1ERDA 1VQNB 4C3HJ 3ZXSA 5GP9A 5C4JJ 2I5UA 4AYBN 2HYFA 2DO7A 3E20A 3WQZA 2R7RA 2L9SA 4IXAA 3J81K 5B1AH 4OWRB 1FOKA 3FZVA 2B63J 2QXZA 2FMLA 5EMNA 2KVOA 1JT6A 3AGQA 1I39A 3GZ6A 2AS5F 4MTEA 1W2BB 2COMA 1S7AA 4FN5A 4Z4WA 2ZXWH 3FBIB 2VPLA 3QRFF 2O6WA 3FXJA 4I84A 2EQRA 2IS2A 3ZUGA 5F27A 5CLSA 3F23A 2LKXA 1N78A 2BY0A 1S72B 3BJAA 1MMNA 2O7OA 1BW6A 2UV1A 2VKEA 4HNVA 5FB2A 3SHFA 3QPTA 3OY9A 1BC7C 2QDXA 1V3FA 1TTTA 1O8LA 3W5VA 4EATA 4I09A 2Z6BD 1WOPA 4DYCA 3K1NA 2X3UA 1IN7A 4X0GA 3ZPLA 1FYLA 1RQRA 3P26A 4AIJA 2A68F 1A36A 4M3BA 1MMAA 4M6XA 1TUIA 2HDWA 2BMWA 3SLDA 1KTWA 5IP9J 5C1EA 3WU1B 3TH0A 1P2FA 1W5CC 1JHFA 5D5WB 1PUEE 4WXHA 4QVJA 2JVHA 2Z2SB 2VKVA 2X51A 3ZQQA 5IOYA 3VMWA 2ZNZA 3H3UA 2E7WA 2CC2A 1KD1D 1WVRA 1Z6TA 2YWFA 1W7PA 1D2EA 2A61A 1KYZA 4NBQA 4ZYHA 2QA4I 1UD5A 3H9GA 1MD0A 1MH4A 4RLQA 4IJAA 4EGYA 1FSHA 5E1XA 1KA8A 5JBQA 5LD2C 3LSRA 4FT8A 4Y15A 3FJOA 4UB8C 4RAGA 4XMYA 3HYIA 2JTVA 4BQQA 1SAXA 1WZ2A 4UZFA 3LQ6A 4F92B 2HOSA 2QN6A 2F43A 3G2BA 4GGGA 3TMOA 1R9TJ 2QSGX 5KCMA 3CTAA 1A04A 3LWFA 3HDDA 2WPDA 2YWGA 4NHJA 1PE9A 2MFZA 5B66C 2R5ZB 1ZN2A 3PA1A 1H80A 1NH3A 2XF5A 4ZGQB 2GIVA 3FXQA 3KP7A 4U0WA 1TNTA 4M71A 3HOYJ 2E34A 2VOOA 2QYUA 1TYXA 5FKKA 4H9GA 4Y9UA 3LSHA 1H88C 1P92A 1VHOA 3FM5A 2NRAC 3HHHA 3HTSB 4XLAA 3A2KA 2M45A 1N05A 3H09A 2WR8A 1VQ4I 3W2HA 2EZKA 3HUGB 4IPAA 1R49A 4HYEA 4PJNA 3FMQA 4ZDLA 1G8XA 4M9ZA 2VBTA 4D7MA 1W36D 1LJ9A 5IY5H 5HS8A 3HOSA 3ESWB 2PG4A 3ONQA 5M5YJ 3OYIA 2LF7A 2MABA 3LQQA 4Z06A 3H9JA 1W0TA 1S3JA 4P6YA 4AF7A 3ZN0A 3T5XA 1YJNI 1CNFA 2V7QA 2M8EA 3OW2B 5ED4A 4EM2A 5K5QA 1EE6A 1Z1DA 2ZXIA 5L3BA 2CH0A 3FXKA 4WX9A 4L0YB 1FLIA 5E18F 3GZNB 3ASOH 3ABTA 4KMFA 1M90D 2IVMA 3BR5A 5F0FA 1U2WA 3AGPA 4FWTA 3CZ6A 2PLYA 3BG7A 2KDOA 2VXZA 3B82A 2BVMA 2NYXA 1UCRA 4DOZA 4G7XA 5GAHJ 3QYFA 4YIIA 2GJKA 3A8KA 4LIUA 2LH9A 5FD5A 4L18B 1D1AA 4OIRF 2P7VB 1DGWY 1IHMA 1XQBA 4B44A 2RNGA 3GX4X 2XAUA 3LSJA 3IAM2 4D5FA 5HLHA 1DUXC 5FRNA 3BY1A 4OAZA 2LD5A 1HBXG 1DARA 3RSNA 4FTHA 1BC8C 3SZPA 1KK1A 2H1KA 4NK8A 1IN4A 3VMVA 3WG7H 1YITI 3V42A 1VQ8I 4P9FA 5FD6A 5JVGF 3OIOA 3HXLA 3A01B 3GVJA 1G2HA 4GCVA 1SC7A 4LB6B 4BNCA 1XE1A 5DN6A 4C2LA 2ZL6A 3DF8A 2CUJA 2WY7Q 4A3CJ 3B78A 1Z6RA 3FX3A 3HEFA 3SY2A 4RMNA 1O8JA 3I54A 2V1UA 5E8GA 1VQMB 2ZCWA 1BI1A 1SD5A 3DEWA 5BSYA 1UZCA 4CCJA 1JJ8C 2EK5A 5H6QA 4F52A 3G71I 2R0QC 2A6TA 3DBRB 3CMEI 3GYHX 2WJVA 1OGMX 3L2WA 2HQAA 1OFEA 4GO1A 3PQJA 3RQ4A 5GTIC 2V6CA 4MFEA 4E7LA 4RD4A 4LBZA 4E7ZA 4LMYA 2V7XA 2OTJI 2Y9ZA 3QOEA 5E8IA 2BGJA 2GWRA 2VJ5A 1SVMA 1XC5A 2ZBVA 5H5JA 3FK7A 1D0ZA 5IYPA 4PK4A 2IOUG 2OPTA 1CF7A 4P1VA 4EW9A 2KIQA 2FRHA 2FUG2 2CRGA 4L9TA 1HQCA 2DT5A 3E5XA 1P6RA 2EPFA 3IWZA 1GVJA 3LSMA 4JBAA 3RIQA 1MSEC 4MQVA 4IQJA 3CDHA 3GEZA 2YUHA 2UUZA 3A1YA 1UMQA 4U7BA 1B72A 2DA7A 4RA2A 5EEGA 2DMQA 2LC2A 4BXXJ 5L3FA 4ENNA 2NPFA 4P25A 1ZRCA 2NVYJ 2R7UA 2V26A 1G7CA 1OCRH 3KP6A 1QZYA 4OZZA 2ZL5A 1BOAA 1T5EA 3P9IA 2FVGA 3V76A 2O1DA 1TWCJ 1YRNA 3S14J 2E1RA 1Z3YA 3F8CA 3SJZA 1Q9SA 2O0WA 1F20A 2XGDA 4KUMA 3Q0WA 3D5LA 4Z1MA 2NZMA 1MH3A 4UAJA 1WJEA 2CW7A 2JK3A 4P6VF 3RDIA 3MQ0A 3CCUI 1V4RA 1YI2I 3T51B 1WGXA 2ID3A 5FKOA 3PETA 4QTRA 4BE2A 3MKZA 4UVBA 5ERIA 1N8RD 4KMUX 2HTJA 1RKWA 4IVNA 1POGA 3OOCA 1EFUA 3WU2C 3J81Z 2RN7A 3IV5A 1H8HA 2DJNA 2NS0A 4XSZF 1FX0A 2K86A 2HDNB 3ERMA 5LHIA 5J4VA 3JSOA 3QU3A 2DODA 3IAS2 3MZ8A 1ITYA 3C2HA 4M3EA 2PLFA 4CSWA 2HR3A 5DUKA 3BPVA 2R7OA 3FXUA 4GYIA 2A07F 4OIPF 5THXA 3FM3A 1AA7A 3DTIA 2F1LA 4AYBA 2VOPA 1B59A 4ESFA 1T6YA 3BR0A 1ZUNB 2QYOA 2A3SA 2LKPA 4Z4RA 5HKKA 2QA4B 2DAOA 1P7IA 2X6WA 5LRRA 4E6KG 5IT9K 1USSA 5BOXA 4RD2A 2CV1A 4Y52J 3BR2A 4KA4A 3D1NI 3JQRA 4UY8I 4AIHA 2ESHA 2IA0A 3BG3A 4LG0B 4IRHA 1G7RA 4OIOF 2M9HA 1U8BA 4WZTA 1ZHFA 4HF0A 2BSPA 1BX0A 1KCDA 1HVXA 3BQZA 1XSXA 3CUOA 4MEYF 4OZYA 1XGMA 4BXUA 1FC3A 4L0ZB 3I55B 4P12A 3RZOJ 4QPOA 2WSSA 4X8IA 1XMAA 5HVQC 3A03A 3K4KA 1JKRC 3W6VA 2LNBA 1QFJA 1X3ZB 2O0VA 3AVWA 2CF4A 1Y0NA 2HI3A 2YU3A 4LK0F 2OCCH 1JUSA 5CKTA 4G7WA 3MFKA 3WTYC 1CQXA 2PQ8A 4YAFA 1QG0A 4LIVA 3GVAA 3AL0C 3Q6RA 2HGCA 4M3GA 5D6FA 2F5EA 1IDZA 3ECOA 1ZTRA 2EH3A 5LFAA 3DLAA 1VQ6B 2R4GA 1LFBA 4EJUA 1Y56A 3M4OJ 1RNLA 1RQPA 3VEPA 3AG4H 3HRMA 4QPQA 3S3NA 2OTLB 3W2FA 4HZFA 1IUYA 4Z03A 2LY2A 3CMAI 2E5NA 1ZR4A 5EF6A 3CUQB 2Q8KA 1OISA 3WHCA 3I55I 3CF5F 2H27A 2W6JA 3CCLB 2PEXA 3FF5A 3SEZA 3ML6A 2QCOA 5HNFA 1I27A 1R1UA 4ROXA 3ABMH 2KISA 3SYJA 5DCMA 3LNQA 1IJWC 4ZCMA 4PC1A 2A69F 2LRDA 3IL2A 4LLLA 2J5OA 4M3FA 4LB5A 3T1BA 4U49A 2XT2A 4AU7A 1D0XA 1K28D 2BOLA 5JMCB 4HW0A 3DV8A 2VODA 3G6EB 3CF2A 4ENKA 2STWA 1K8FA 4A5MA 4E0FA 2KRCA 2R7DA 4A3JJ 2ZJPF 1AIRA 3U1DA 1X1BA 4OM9A 1FP2A 2CFOA 3E1SA 4AF6A 2VQHA 3G3ZA 1B8IA 4IO9F 3VWBA 4BQOA 1EA0A 1YX5A 2W24A 2HDCA 2K4JA 4I02A 3KRGA 2VYQA 4PC6A 3L7WA 1ETOA 4PJMA 3QE2A 2ZB9A 1ODDA 3NAUA 1FWZA 2F4IA 4YG2F 3SZEA 3HSEA 5LHHA 1YYVA 2M2EA 3GTGJ 1N08A 1YI2B 3JRHA 1GUUA 2QBYB 1NK3P 4EV0A 2CK3A 5HLIA 1Y0RA 2KZGA 3L2UA 1R5OA 1OR7C 1LE8B 3CC7B 3CDIA 1K4SA 3WTSC 4RD3A 1YHQB 3PJRA 5FGMA 2KHMA 2R7WA 5LRSA 2PN6A 2EV6A 1R36A 4FCYA 2XV4S 2VBUA 2YPRA 3Q9SA 3OZUA 1V55H 3DTEA 1AKHA 3GQBA 3MAJA 2YS9A 3PL8A 3BTIA 5J1YA 1LPQA 1HXDA 2EA4A 2J7KA 2OZ6A 4ZGNB 2WB1A 2WV0A 4NUBA 1RPWA 3GIRA 3CUQC 4JK1X 1QPMA 3F6OA 1ZREA 1KQ8A 3K9TA 1PJ7A 1X1PA 3JAMZ 4HF1A 4YEJA 3TGNA 4X7EA 2DETA 1SFUA 1VQ9B 2YX7A 1MBEA 1BL0A 2CQQA 3HC7A 1QJVA 2JPBA 3ES9A 1XFOA 2IBDA 3E6DA 4ETSA 5M5XJ 3GQAA 4PC3A 2GIZA 4N3GA 4A3FJ 3QFTA 1ZQ3P 2FOKA 1WHUA 1KQSB 5ICEA 5LGUA 1IN8A 5J40A 3WWGA 3GVLA 1SD7A 2H8RA 2QQBA 4OIQF 1VQ5I 1IDKA 3KZZA 1TWHJ 4QWQA 4EJVA 5F0HA 4XRSA 1HKTA 3W2EA 4MIMA 3W5UA 2C5HA 3KFWX 1OGOX 3N6ZA 2DFHA 3G71B 3MMYB 2Z16A 4MLOA 5JHFA 2ZBKA 4F3QA 5L3CA 2EIKH 3BNWA 1ZK8A 1Q81D 4WF2A 4RLFA 2KKOA 4DQ2A 3P27A 9ANTA 4WZKA 5C3EJ 3K4JA 4A3DJ 3LVBA 3OIPA 5F6FA 1KONA 4OOSA 1VQOB 3PFYA 1KC8D 3W2AA 3K2AA 3GQ7A 4YALA 1R23A 3FKJA 4WXDA 4BGDA 5M3FJ 3CPXA 5KW9A 2HLDA 2X8KA 1T95A 3JRCA 1WSVA 3CUQA 4XN3A 4BH9A 2L3DA 4IQ4A 2CW5A 4DGWB 3G1OA 3GO5A 1R1VA 3HAGA 1FPQA 1I5ZA 3V8KA 2LK2A 3VSLA 2XSDC 3KETA 3OEHA 2BF4A 3WGGA 1YITB 2OBTA 4RDKA 2XT4A 4YIFA 4G8XA 1FTTA 4ZYEA 2Y0MA 1EFTA 4NC6A 5JI6A 4M72A 1TTYA 3BP8A 1SVOA 4M9SA 2RV8A 4BBRJ 1VLOA 4B48A 5E3NA 1EA3A 1QVGB 2P4WA 4RD1A 4QLCU 3S17J 4FHTA 2PI0A 1XGOA 2XB0X 5DTDA 4HIZA 3KE2A 2F5CA 4WZEA 4CZCA 3CC4B 3OYFA 4CICA 1LLWA 5A2QZ 1AWCA 1OYIA 1IXSB 2JVGA 1S7EA 3I64A 2D45A 1JE8A 2I10A 3EUKL 1SKQA 2XZOA 1FIAA 4N0BA 2DA4A 3L9FA 1U6GA 3H9QA 4BQAA 3VNUA 2VBXA 2H8WA 5FLXZ 2STTA 4V19K 1GHCA 2BX6A 1IN5A 4R79A 4YCQA 2HFHA 1SANA 3HL2A 4JYKA 1XMKA 2BPOA 3OOUA 5D5XB 2XTYA 3ZRGA 3I4NJ 2ZTGA 2BY2A 4F7ZA 1G3WA 3I4MJ 4ZCIA 1RR8C 5DD8A 2Y48A 3GWZA 2J8KA 1SD4A 1WJDA 1P7JA 1TWGJ 3ASSA 5HXBA 1QRYA 4ASUA 3EYYA 3DLLF 4YXWA 4HG2A 1S4MA 3R6JA 1ZKGA 5KVRA 2RNJA 4B09A 3SJPA 2UXXA 3QPLA 3C1DA 3WXMA 1E43A 4I01A 4FX0A 3ASPA 4Z05A 2VBVA 1VQ4B 4RLZA 2NXNB 3SDGA 4M6YA 4MQ9F 2LYCA 2CRVA 4UNOA 3QYEA 4K1XA 2Y30A 2V6EA 4P22A 4U9UA 3WBKA 3B73A 5LEKA 2F4OB 2WWYA 1YW8A 4IW3B 3K1MA 2FJ1A 1VFCA 3FXMA 3ZZUA 3GQ9A 4S0HB 2JN9A 4HX8A 2TDXA 2GPJA 2M1BA 1N0VC 2EFWA 3QP5A 3PIPF 3CC2I 2OK8A 2IGNA 2WV1A 1T2KA 4MO7A 4M74A 3AKZA 2VQGA 3A1PA 2FE3A 3C18A 3RKXA 4C2MJ 1H42A 4HE6A 1YJWB 4RB1A 5B6IA 4XK4A 4DNCA 2JDIA 1M1EB 1R1TA 3A01A 4KKSA 4NCNA 1UHSA 1P4WA 1WJCA 2D1HA 4II3A 1NBMA 1AMOA 2QEXI 4ENMA 4KJZA 2K3PA 2OQGA 5BPIA 1SFEA 3R0JA 3BZKA 4E7JA 4URRA 2LLKA 1OB5A 3PNYA 4V02C 2BM5A 1XDUA 2ECCA 1XB4A 2VB6A 1RUNA 1MRZA 2X48A 4HOBA 1OGJA 3JX8A 1VF9A 2M7AA 4KITB 2LY9A 3IHUA 1XGNA 1GAQA 4A69C 1ELOA 2XKOA 3JRGA 1GV2A 3BJ6A 1N06A 1QFZA 4HDUA 4CQJA 5KAIC 4A3IJ 4J00A 1FBSA 1NTCA 2Y9YA 2XZLA 5L46A 4ACBA 1DPRA 4G9YA 3BH4A 2JZYA 3N05A 2VIXA 4W1UA 4PGHA 2JJ1A 1YG2A 4IHXA 3T8TA 3A8JA 2EILH 3RPUD 1ETXA 1P9QC 2QGUA 2VNIA 3LQEA 2K40A 5FO5A 3P4GA 1PLUA 1FYKA 2QEXB 4G6QA 4MYTA 3E0JB 3DEUA 1KMHA 2BY3A 1ON2A 1H9TA 2LBFA 1X1AA 4KN7X 2KRHA 1YJWI 2BEOA 2CS3A 1RKTA 1KU9A 3F21A 4HSRA 3REOA 4OOIA 2FBIA 1YW7A 3OYGA 5TGTA 5F4OA 4N9HA 4B1RA 1ZRDA 3CC2B 3FMRA 4V2FA 4ABZA 1BMFA 1ZLJA 4M6VA 1ZG3A 4Q48A 4XOPA 5EZGA 1CQTA 1XX5A 3MMPA 1OOCA 4OJ5A 2JA7J 4LITA 4LGWA 5KSWB 3F72A 3ZMDA 2PMZA 1SMYF 4OAYA 1J0RA 2KLOA 2Y2ZA 3BTLA 1W0KA 4HE5A 2M87A 2K9QA 3PFIA 3PUFA 2R5ZA 4HQEA 2HDDA 1CGPA 2AQEA 2YWHA 4HWVA 3DPTA 1GVDA 1NG7A 4B43A 2DT6A 1VQPI 1VF7A 1L0OC 2EIJH 2XZPA 4EEFG 3I1FA 1DP7P 2GZWA 4KN4X 2DYRH 4PJ0C 3CCRI 1HZEA 3RKYA 5C44J 3V7CA 1I1SA 4YZQA 3LAPA 3KP3A 2FQ3A 1PKVA 3PO2J 1JKQC 1MMSA 3PUMA 1UB9A 5CJ9A 4Y7CA 2QKMB 4JX5A 2NVUB 4OJLA 5CVRA 5E3OA 5B1BH 3GLLA 3CMMA 1HOMA 1CNEA 2CG4A 1XN7A 2GM4A 3H9NA 4B4DA 1FOXA 4PSWA 3LAJA 1QCXA 1JHHA 1TWFJ 2CW0F 5ICGA 1FOYA 2L0KA 1ZLKA 3ZR8X 1SMTA 1GVHA 3MHPA 1TT0A 1GXPA 1KU7A 4Z4VA 2DPDA 2O03A 2XPWA 1D8TA 1R5GA 4GXOA 1X3WB 2V9PA 2MBFA 3CJTB 3RI4A 1A6QA 4WWCA 3BG9A 3U1KA 4OPOA 3B6AA 4DZPA 1Q1HA 1KRHA 2ZSIB 2ID6A 1VQ7I 4XLNF 1AU7A 4G12A 5HZAA 2MW8A 5HNHA 1BA5A 1O8IA 1UD3A 2R7QA 4BBSJ 1WJ5A 2MSYA 4I0BA 2VQCA 3CO7C 2O8XA 1W9XA 2I1LA 2LDUA 2W25A 1B23P 2QVOA 3GFJA 3CJQB 4UUSB 3DQVC 3FWEA 4BE0A 2ZSHB 1K61A 3RTRA 4BHCA 4CA0A 3ERED 3C3WA 4ITVA 5CQEA 5EEAA 1FRQA 3L2RA 1VQOI 2UXNA 4G6IA 2XTXA 3Q38A 1QGPA 4ON0A 1O8KA 4BYYA 1PP7U 1DABA 3AFHA 4DYQA 1AKHB 1S6LA 4A3MJ 1U0JA 2HVQA 5LBQA 4YAUA 3OPOA 1DDIA 2M5SA 3FXRA 4LG3A 1HF2A 1Z7UA 2W1OA 3MKYB 2R7SA 1FEXA 3BOQA 3H0GJ 4RB0A 1BN8A 3EUHC 3R6SA 1R71A 1MABA 1JI8A 2G0YA 3WODF 4C2UA 1WJAA 4TMZA 3I71A 3N4MA 3PQKA 2ZMEA 4PFPA 4ASNA 4CGZA 2ISYA 3OMYA 3Q0UA 2XAHA 5JFRA 3B90A 4E7IA 1FNBA 2F5FA 3OYBA 2PJRA 2RREA 4RDJA 4OOXA 1QPIA 4I76A 4GQNA 3AL0B 3HIFA 3NWTA 4LOCA 3H3ZA 2H1LA 3IRRA 4YRVA 2XSJC 4CCLA 1IRFA 1VQ9I 4EM1A 2BVLA 2IGOA 1G3TA 5GPAA 2C2WA 4YHBA 2GOXB 2BHZA 3T56B 3VYTB 1TYVA 4BL0B 4F93B 2LKSA 4ESJA 3HKZN 1XB2A 2DEUA 3PNTA 4HA8A 1KK2A 1LVAA 2L7MP 1BR4A 1EF4A 3Q6QA 1X2NA 4OJOA 2FXAA 4FE7A 2DFFA 4BS9A 3DDYA 2X1DA 1ETQA 1YW9A 4BACA 4BE1A 1D1NA 5C1CA 3I58A 1FZPB 3VFZA 5KK1A 3I5UA 4XIDA 2Q6IA 1WXRA 1YHQI 4OPSA 3OIQA 2V4JC 2BBYA 4DNTB 2GA1A 5DS0A 4U88A 4XONA 4L8JA 1SEUA 2IS4A 2KQRA 3KP4A 1WOOA 1GQ8A 1K6YA 2Z3YA 1B72B 1DDNA 3TDUC 1JA1A 2VBMA 1G59A 2Z99A 2R7XA
chains in the Genus database with same CATH topology
2IS1A 4JMQA 1CZFA 2BSPA 1KCDA 2GOMA 3CJRB 1HVXA 4BJTA 4BDZA 3OS0A 3VSTA 4NNJA 2HZDA 2W7NA 4OZYA 2GJRA 2K5CA 1D1BA 2WSSA 4QPOA 2X3HA 3QODA 4C30A 3GBGA 5HVQC 1N77A 1X19A 3K4KA 3OYHA 4E7HA 1V5GA 2O0VA 5KNLA 4XOTA 4XD7A 4ZJZA 2LREA 2KPMA 2E5ZA 5CKTA 4G7WA 4OJ6A 2M3AA 3LL7A 2L2OA 2JA2A 4HSTA 1WFXA 1OB0A 2R7TA 4LIVA 3AL0C 1QHGA 2AQFA 3B8YA 1KZLA 2QKLB 2ZZFA 3NE5B 5LFAA 3DLAA 2EWEA 2R4GA 2X85A 3BLYA 3DKXA 3JU4A 3SZGA 1D0YA 1Y56A 3VYUB 4DIQA 3RCOA 1GLNA 4QPQA 2W6IA 3EQOA 2ZZEA 3EPZA 3S3NA 4KISA 3K4LA 2JJ2A 1QHHD 4HEA2 4PSXA 5FRMA 4Z03A 3SUCA 2LY2A 1D1CA 3A3BA 2E5NA 3OYMA 2XC7A 3FHNA 3F9KA 1E3XA 1IDJA 1IRXA 2OV7A 2F5VA 1NG6A 1S9HA 2W6JA 3K4MA 3BCFA 4DBRA 3OYEA 2I8DA 1IB4A 1J09A 3SEZA 5HNFA 3LMWA 3M8JA 1QU3A 3BC8A 2DCEA 1H8EA 3VSUA 4D1QA 4ANJA 1X4PA 2ZZGA 3HPHA 2LOOA 2CW8A 4FETA 3OS2A 2DXIA 2NT9A 2VJJA 2LRDA 4CCMA 1Z3XA 5KHDA 3EQNA 4U49A 4YZ0A 4AU7A 1D0XA 1K28D 2BOLA 1WJBA 2Z1DA 3OWTA 1XG2A 3LSGA 3CF2A 2X53S 4E0FA 2KRCA 4XKWA 2X1CA 4N4NB 4BDYA 1MMGA 1AIRA 1VZ0A 1X1BA 3LFUA 2CFOA 3E1SA 1V0FA 3DTKA 2NSTA 2VQHA 3OYDA 3DPUA 1LFPA 4KT6A 2VL8A 3SYTA 3PNVA 1UG0A 4BQNA 1DGRM 4N4OB 4BQOA 1YX5A 3VWBA 4B3GA 3BCDA 3KRGA 3OW7A 4PMHA 1ZELA 4PJMA 3KEWA 2F4IA 2X1EA 2XOKA 5HLTA 1O8HA 1I18A 1BR1A 1BHEA 3H35A 4NK6A 4BXFA 4XM3A 3LNNA 1DP3A 2CV0A 2DJIA 1WJFA 2WBMA 2CK3A 3OL3A 3L2UA 2VBKA 1OR7C 2W82A 4XLHA 3UR3C 1E3ZA 2ZXHA 3OYNA 4FXUA 3G05A 3PJRA 2R7WA 2KHMA 4BJ6C 3S3OA 3FDYA 1SKYB 1KCCA 4IZZA 2LZJA 2R7VA 3K4CA 2D3NA 4TSFA 3DTEA 3GQBA 4XKCA 3CESA 2F6CA 3A35A 1LDKB 3PL8A 2VJ4A 4CCOA 3B4NA 4G6TB 1YE9A 4UZUA 1O8MA 2WB1A 4NUBA 4BU2A 1E0EA 1O8DA 3DWLE 2V9KA 3ZCOA 2GJPA 3OL4A 2HU9A 2O5RA 1W0JA 2M4GA 5CPRB 4YEJA 2VXDA 2LG4A 3UNGC 2VLAA 2P0WA 2VJIA 3S8PA 4W8TA 3HC7A 1BPLA 1QJVA 4YZAA 2CMPA 3A3GA 2HPIA 4XLFA 3OS1A 3K70D 3GQAA 1MW7A 4XKBA 1X4OA 3K70C 5FL7A 2BW3A 2QY1A 3LMMA 3GQ8A 2M0MA 3ZPPA 2JSPA 4DBQA 1E79A 3WWGA 3HG9A 4W8RA 2WA0A 3GVLA 1IDKA 1BOBA 2R9VA 3OR2C 2UWMA 2CV2A 3LSKA 3VSKA 3KX2A 2W00A 4B47A 2WAFA 3FBNB 2GK7A 1OGOX 3UW0A 2L7KA 3MMYB 2Z16A 4MLOA 5JHFA 1MMDA 4F3QA 3L2VA 4YELA 1W36C 1PXZA 4H4KC 2KMUA 4GRIA 4RLFA 3ZGKA 2M7BA 2IGMA 3K4JA 4W8QA 3OIPA 4BUPA 1KONA 3PFYA 3W2AA 1SAUA 2NTBA 3NWSA 3FKJA 4HPQA 4BGDA 3GQ7A 2HLDA 2X8KA 4XNFA 1NHCA 1T95A 3OE7A 4XN0A 3CP8A 3SEQA 3TL4X 4XN3A 1BLIA 2NTQA 3JURA 1I8DA 1FMWA 4IQ4A 3T53B 4DGWB 3HAGA 4DK0A 4YZXA 3PSFA 3H5RA 3VSLA 2X6XA 4J01A 3OEHA 3FY3A 1IA5A 2L9NA 4F55A 2Z8GA 2INUA 1O8GA 3D5SC 1JRGA 4B48A 3DPLC 1ERDA 2PYGA 1EA3A 3ZXSA 2UVFA 3VYSB 2VQLA 2WADA 3H5AA 3WQZA 2OC6A 2R7RA 2L9SA 4HIZA 5CQGA 2NT6A 4CZCA 3OYFA 4OWRB 4DK1A 3OYKA 3QYBA 4HNTA 2GK6A 2QXZA 2JVGA 2WJYA 2JIZA 2KVOA 3EUKL 2XZOA 3J7AY 1X1DA 2IQ7A 3H9QA 3FBIB 4F91B 2VPLA 1E1RA 3SDBA 4I84A 3L2QA 1SFKA 4R79A 1RU4A 1OLTA 1V5FA 2IS2A 5CDFA 5AMVA 3HL2A 2O04A 4E7KA 3OOUA 1N78A 1X0CA 2MC4A 1MMNA 3ZRGA 3ZIAA 2ZTGA 4MR0A 4U4BA 2UV1A 3OY9A 3FKSA 1O8LA 1WJDA 2W4SA 4EATA 5HOOA 2Z6BD 1VBLA 4ASUA 4X0GA 4E4HA 4YXWA 1UELB 4HG2A 4JQFA 4ZDOA 2IGKA 4DJAA 3HOTA 2LY1A 1MMAA 4PJJA 2PECA 3C2GA 2HDWA 2WAEA 1E43A 4Z05A 3H0DA 1KTWA 3GVKA 5C1EA 4Y33A 1K5CA 2HVRA 4XR6A 2LYCA 3QYEA 2V6EA 2HVSA 4P22A 2JVHA 2Z2SB 2X51A 3ZQQA 2KL4A 3FPPA 3VMWA 3OR1C 3ZPNA 3GQ9A 3OFNA 4D9JA 2QE7A 1UD5A 1HG8A 1JTAA 3H9GA 2VASA 4HRIA 4RLQA 2V31A 2IGNA 2MYSA 3AKZA 3VDXA 2VQGA 2QX3A 2L5QA 5LD2C 1R6RA 2MD0A 4XMYA 2JDIA 1V0EA 3I9V2 2BW3B 4KKSA 4OJPA 1WJCA 4II3A 4PJLA 4BQQA 1NBMA 2DIEA 4KJZA 2K3PA 4AVZA 1DQUA 4FASD 4F92B 1WPCA 2VKDA 2F43A 3G2BA 2KP6A 4E7JA 4URRA 3TMOA 3PNYA 4PFOA 4TT3A 5KCMA 2VB6A 3KEYA 2M7AA 4KITB 1WTHD 2WPDA 3OEEA 1PE9A 2MFZA 2Y0SA 2K9LA 4NQWB 4BJ5C 2A5WA 1H80A 2XF5A 3T9GA 3W2WA 3DEEA 4J00A 2XZLA 3IP4B 2Q1ZB 1N75A 3LSHA 1UD2A 3BH4A 3N05A 2VIXA 2IXSA 4XLAA 3A2KA 2JJ1A 3BCBA 3HUGB 3K6GA 3RPUD 4XLCA 4PJNA 3HKZA 1P9QC 1Y6IA 4ZDLA 2DOAA 2XF7A 4CCNA 1G8XA 4KKTA 1PLUA 3K4BA 4DNRB 3E0JB 4U87A 4BEHB 4IKFA 1KMHA 1UD6A 1W36D 3HOSA 2XDVA 1T0FC 1TZLA 1X1AA 2E1MC 2ZFUA 2LBFA 4ZC3A 2PJRB 2KRHA 3ONQA 3W2VA 3OYIA 2CS3A 4XL9A 2MABA 1O8EA 4W8SA 4HSRA 5IK2A 4Z06A 3H9JA 3OYGA 5TGTA 1WP6A 3VR6A 1O8FA 2V7QA 2XNDA 3ZSCA 3BG6A 1EE6A 2NTPA 2ZXIA 2CH0A 1BMFA 1PYVA 4C2TA 4XOPA 1FMVA 1OOCA 4OJ5A 2XGJA 1VJSA 3OYCA 4LITA 3CZ6A 4ZTJA 3BG7A 2KDOA 2VXZA 4P5OA 2BVMA 4G7XA 4DOZA 1LKXA 2PMZA 3QYFA 4OAYA 1MNEA 2GJKA 1RWRA 4LIUA 2LH9A 2IS6A 2KLOA 1UD4A 4KKUA 2ELJA 2E1MB 1W0KA 1D1AA 1DGWY 4HWVA 2AQEA 4B44A 1NG7A 2RNGA 2XAUA 3DPTA 3IAM2 2XF6A 5FROA 4B43A 4OAZA 2CUZA 5FRNA 1OHHA 2DT6A 1VF7A 3RSNA 3S32A 2XZPA 2WZPP 1COWA 2WAQA 1DBGA 2DT7B 4NK8A 2INVA 1HZEA 3PUBA 3OYJA 3VMVA 3V42A 4YZQA 3IUOA 3HXLA 1PKVA 3S93A 3GVJA 2F1MA 1Z7LA 2V4DA 1E1QA 3BCAA 5DN6A 2QKMB 4OJLA 4C2LA 2CUJA 2WY7Q 4P1WA 4XKVA 3DKYA 4RMNA 3CMMA 4TKOB 1O8JA 1WMRA 1MNDA 4PSWA 1QCXA 2ODLA 3OAAA 3ZR8X 2Q2EB 3KYLA 4CCJA 4XQFA 2O17A 1TT0A 3PSIA 4F52A 2A6TA 2WJVA 3OYLA 1OGMX 3L2WA 2HQAA 4Y3OA 3RQ4A 4E7LA 2VKHA 2NSPA 4E7ZA 4CH7A 2ZSIB 1UD8A 2ZTNA 3QOEA 2KZVA 5HNHA 1O8IA 4Y4RA 2HPMA 4ZTFA 2VJ5A 2R7QA 1UD3A 1WJ5A 3CP2A 4BEHA 2VQCA 3S3MA 3OYAA 1D0ZA 1W9XA 4ZYAA 2WY8Q 4PK4A 3VYRB 3CJQB 4EW9A 4PUSA 3DQVC 4BE0A 2FUG2 2ZSHB 3RTRA 4CA0A 4ITVA 4NC7A 5CQEA 3L2RA 1UAAA 2D3LA 3LSMA 2OUMA 4G6IA 1NRKA 1O8KA 1X1CA 2NOJB 4HNUA 4IX7A 1YX3A 4IQJA 2K9MA 2UUZA 3AFHA 3A1YA 4U7BA 1U0JA 2HVQA 2LC2A 3HPGA 4RM3A 3OPOA 2UVEA 2M5SA 2R7UA 3DU6A 2V26A 4LG3A 3H94A 1DBOA 2V1NA 4RM2A 3DU5A 2W1OA 3MKYB 4JOMA 2R7SA 4OZZA 3U21A 1BN8A 3EUHC 1MABA 2HNHA 4C9YA 1JI8A 1T5EA 1VLYA 2O1DA 4C2UA 1Z21A 1WJAA 3BC9A 1Z3YA 3I3LA 4XLEA 2O0WA 4PFPA 3OMYA 3D5LA 4Z1MA 3B90A 2NZMA 4E7IA 3TBIA 2JUGA 3OYBA 1WJEA 2CW7A 2RREA 2LBFB 2PJRA 3T51B 4GQNA 3W3CA 3LSIA 3NWTA 2RQQA 3K10A 4CCKA 3AL0B 1PJRA 4YRVA 1V5EA 1LVKA 2XSJC 4CCLA 3MKZA 4BE2A 4ZDPA 1EFRA 1RMGA 2ZZQA 2BVLA 2IGOA 4NC8A 3OOCA 2GOXB 3T56B 3VYTB 4BL0B 4F93B 1H8HA 3VSVA 1HA8A 1FX0A 2E60A 3PNTA 4B3FX 2M4KA 4MXNA 1BR4A 1BR2A 3H5NA 3IAS2 3C2HA 3D5RC 4CSWA 4OJOA 4BS9A 3DDYA 2R7OA 3GRHA 2V7FA 2X1DA 1AA7A 3DTIA 4CUGA 3A4CA 4AYBA 4BACA 3EUAA 3MKWB 4BE1A 2VBEA 3K4NA 5C1CA 2E1BA 4B3XA 3OIQA 2V4JC 2X6YA 4DNTB 1OFMA 5HKKA 2PYHA 4XONA 4E6KG 2X6WA 2IS4A 4L8JA 4E7SA 2KQRA 2CV1A 1GQ8A 4II2A 1K6YA 1OFLA 1O88A 3M1CA 2VBMA 4XORA 1G59A 3MD2A 2R7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z05 A;  1KTW A;  1KCD A;  1CZF A;  3B4N A;  2BSP A;  5C1E A;  1K5C A;  1O8M A;  4XR6 A;  3VST A;  1O8D A;  4OZY A;  4OJL A;  4C2L A;  4YEJ A;  2X3H A;  3VMW A;  4XKV A;  1O8J A;  1WMR A;  2VJI A;  3GQ9 A;  4W8T A;  1QCX A;  2ODL A;  1HG8 A;  1JTA A;  1QJV A;  2O0V A;  4YZA A;  4XOT A;  4XLF A;  4XQF A;  2O17 A;  3GQA A;  4OJ6 A;  1OGM X;  2QY1 A;  2QX3 A;  3GQ8 A;  3ZPP A;  3B8Y A;  4XMY A;  2NSP A;  3WWG A;  2EWE A;  4W8R A;  4OJP A;  2X85 A;  1IDK A;  4AVZ A;  1O8I A;  1OGO X;  3UW0 A;  4URR A;  3EQO A;  4YEL A;  1PXZ A;  4Z03 A;  1PE9 A;  3SUC A;  4EW9 A;  4W8Q A;  1H80 A;  3T9G A;  1IDJ A;  2NTB A;  3GQ7 A;  1O8K A;  1IB4 A;  4XNF A;  1NHC A;  3LMW A;  4XN0 A;  4XLA A;  3JUR A;  4XN3 A;  2NTQ A;  3VSU A;  4YZX A;  4XLC A;  2UVE A;  2X6X A;  1PLU A;  2NT9 A;  3FY3 A;  1DBO A;  1IA5 A;  2VJJ A;  2Z8G A;  4OZZ A;  2INU A;  3EQN A;  1BN8 A;  2O1D A;  1O8G A;  4U49 A;  4YZ0 A;  1JRG A;  4XLE A;  1XG2 A;  2O0W A;  4XL9 A;  2PYG A;  1O8E A;  2UVF A;  4W8S A;  4XKW A;  4Z06 A;  3B90 A;  1O8F A;  2NZM A;  1AIR A;  3ZSC A;  2NST A;  2NT6 A;  1EE6 A;  2NTP A;  2QXZ A;  1RMG A;  4XOP A;  1OOC A;  3KRG A;  4OJ5 A;  4PMH A;  3VSV A;  2IQ7 A;  4MXN A;  1O8H A;  4I84 A;  1RWR A;  1BHE A;  1RU4 A;  5AMV A;  4NK6 A;  4XM3 A;  2O04 A;  4OJO A;  3GRH A;  1X0C A;  5C1C A;  4MR0 A;  4U4B A;  4HWV A;  2VBE A;  2VBK A;  4XLH A;  1O8L A;  2X6Y A;  1OFM A;  2PYH A;  1VBL A;  4XON A;  2X6W A;  1DBG A;  4NK8 A;  1GQ8 A;  1KCC A;  1OFL A;  1O88 A;  2INV A;  2VBM A;  3VMV A;  2PEC A;  4YZQ A;  4XOR A; 
#chains in the Genus database with same CATH topology
 2IS1 A;  3UKG A;  3HGY A;  2GOM A;  2EV0 A;  4Z4Y A;  3NAW A;  1TW2 A;  1FNN A;  4KYW A;  1ZR2 A;  1XSV A;  2W7N A;  3GFI A;  3Q9V A;  2K5C A;  2ZNY A;  4IHS A;  4M2L A;  2J8I A;  2MGQ A;  1GV5 A;  1N77 A;  3PSS A;  1I3Q J;  1TQM A;  4BHB A;  3BWG A;  3RIR A;  2QWW A;  1G7S A;  3GME A;  2DDB A;  2O0Y A;  2LRE A;  4B4C A;  3A02 A;  3B02 A;  1KQ5 A;  4OJ6 A;  3BH6 B;  1B9N A;  1TWA J;  3BJO A;  3LL7 A;  5HDN A;  1AIP A;  3AST A;  1XD7 A;  3AG3 H;  5ILS A;  2R7T A;  2NNN A;  2R93 J;  2AQF A;  5K5O A;  4X7F A;  3B8Y A;  4HQM A;  5HOD A;  4BY1 J;  2GQQ A;  3NE5 B;  2BHY A;  1EKE A;  4TMX A;  3DCF A;  4ZV4 A;  4NB5 A;  2X85 A;  3S1M J;  5BMZ A;  1B1B A;  1NK2 P;  4UZU A;  1S5L C;  2BV6 A;  3ULQ B;  4DIQ A;  1K9M D;  3LA7 A;  2L02 A;  1EJ9 A;  1GLN A;  4ESB A;  3QPH A;  3EQO A;  1K83 J;  1X58 A;  2ZZE A;  2RC6 A;  4ZCL A;  3K4L A;  4Z4Z A;  3R4K A;  2Y75 A;  5IT9 Z;  1I3A A;  3RKQ A;  1D1C A;  1PVE A;  4Z4U A;  3F9K A;  3HRS A;  3ELK A;  1QO0 D;  3CW2 A;  3S1R J;  1FRN A;  1F4K A;  3FHZ A;  2B0R A;  1IRX A;  1BI3 A;  4K2E A;  1S9H A;  1MKM A;  1A8P A;  1IB4 A;  3BCF A;  1G3S A;  5H20 A;  2I8D A;  4WK8 F;  4LG0 A;  2BGI A;  4Z4S A;  5TRD A;  3F8N A;  3RYR A;  1EH6 A;  3BC8 A;  2DCE A;  2OTL I;  1QU3 A;  1H8E A;  2C4U A;  3AVV A;  3VSU A;  3GTP J;  4D1Q A;  4M3D A;  4ANJ A;  5J4Y A;  1EWY A;  1TLH B;  3L00 A;  5L3E A;  1X4P A;  2ZZG A;  2LOO A;  2D9R A;  3OS2 A;  2NT9 A;  2B0L A;  2HOE A;  2V7U A;  4RJL A;  3TOB A;  1VQ6 I;  1T6X A;  1RI7 A;  2UZK A;  2Q6L A;  4AWX B;  4TV7 A;  2M0C A;  3OWT A;  1U9N A;  1XG2 A;  3JQQ A;  1TL8 A;  4MEX F;  2FF4 A;  1RIO H;  3EYI A;  4HX7 A;  4WWV A;  2DI3 A;  4BDY A;  5E17 F;  3DBL B;  1VZ0 A;  3LFU A;  3LA3 A;  1ZRF A;  3GTK J;  3DTK A;  4EH1 A;  4IL6 C;  1H89 C;  1EP2 B;  4ACA A;  3PNV A;  1GAW A;  2DTZ A;  3BCD A;  4PZJ A;  2OK7 A;  1G3Y A;  3OJX A;  3W5H A;  4YFX F;  2ZJQ F;  1K4Z A;  4LC0 A;  2WC2 A;  2QZA A;  4P3Y A;  5L3D A;  4Q4Z F;  5HLT A;  1BI2 A;  3EET A;  1YOV B;  3H35 A;  2GRE A;  3LNN A;  2CV0 A;  1VQK I;  2DJI A;  3HRU A;  3ZC3 A;  1XTA A;  2P5K A;  1HW1 A;  1J5Y A;  4YFO A;  2FD5 A;  4XLH A;  3BRO A;  2HZT A;  1IGN A;  3G1L A;  4RM0 A;  2PIA A;  4BJ6 C;  3HUG A;  3FDY A;  5TIS C;  2LZJ A;  1LFU P;  2D3N A;  1YX2 A;  4TSF A;  4H0E A;  4IOC F;  3ZQL A;  2F6C A;  3BR6 A;  3A35 A;  5D5U B;  1R5I D;  2DBB A;  2DLL A;  2KJB A;  1D8K A;  1LDK B;  3ZMZ A;  4MTD A;  2VJ4 A;  2L9R A;  1YS7 A;  3BQY A;  4EMS A;  1UST A;  5DD4 A;  1E0E A;  1VHE A;  2GJP A;  1WI3 A;  3P5J A;  1FSE A;  3MZY A;  3OL4 A;  1W0J A;  2M4G A;  5CPR B;  4FX4 A;  1TC3 C;  2ZL7 A;  2BY1 A;  2E35 A;  5LGN A;  1WDT A;  3S8P A;  4XSX F;  3JRD A;  1OGI A;  2XAF A;  3AG2 H;  5JLW A;  1BPL A;  2DDA A;  3HOU J;  2NOG A;  4AC9 A;  1J2X A;  4L9N A;  3A3G A;  2C4T A;  1MW7 A;  4XKB A;  1X4O A;  3U6K A;  3K70 C;  1O3R A;  2QY1 A;  3LMM A;  1LEA A;  2KDZ A;  1A31 A;  2E2J J;  2DOE A;  4LFU A;  1RUO A;  4DBQ A;  5EG0 B;  3CCQ B;  2K27 A;  2WA0 A;  2PMD A;  5CVI A;  2QQA A;  2R9V A;  5HZB A;  1BN5 A;  1Q7Y D;  2HYJ A;  3VO1 A;  3PSZ A;  5DM7 F;  1L1I A;  3KX2 A;  2DQR A;  4AIK A;  2WAF A;  3FBN B;  3HOZ J;  2L7K A;  2BM0 A;  2O9L A;  3L2V A;  5LGT A;  5TV2 A;  3S2W A;  4YEL A;  1GJR A;  1KU2 A;  1FDR A;  3KLO A;  4H4K C;  2NVX J;  4A3L J;  1E3H A;  3HBL A;  2M7B A;  2X0L A;  2IGM A;  2XB5 A;  4W8Q A;  3BR1 A;  5BS6 A;  4BUP A;  1HKS A;  4OMZ A;  4O5V A;  5FFX A;  3Q3A A;  1LUJ B;  1WOS A;  4DZJ A;  4HPQ A;  3O3K A;  5DUI A;  3WGI A;  3M07 A;  4X1E A;  2IT0 A;  1HC8 A;  1JJ2 B;  3L09 A;  5GAD J;  1JUP A;  3E5U A;  3CP8 A;  3G1M A;  1SD6 A;  2NTQ A;  3ZMU A;  4DK0 A;  2FU4 A;  2X6O A;  4X05 A;  3T53 B;  1QUE A;  3VNV A;  3PSF A;  1YIJ B;  2QTZ A;  3KCC A;  1YS6 A;  4MFD A;  2YU9 J;  2L9N A;  1EH8 A;  1W4M A;  4F55 A;  5GAG J;  4XLP F;  4DQL A;  4F7D A;  2OTJ B;  2INU A;  2Z8G A;  1QA2 A;  3ONY A;  2E7X A;  4L9V A;  1IC8 A;  3WBJ A;  4EJW A;  3GTQ J;  1PDN C;  3DPL C;  2PYG A;  2VQL A;  3FIS A;  3CME B;  3CD6 B;  2ZO4 A;  5LEJ A;  2OC6 A;  3TOA A;  2FNA A;  1KJZ A;  5CQG A;  2NT6 A;  2P6S A;  3CLO A;  3VPR A;  3OYK A;  2LSO A;  3TP3 A;  4HNT A;  2VFM A;  1QZZ A;  2WJY A;  2JIZ A;  2ME6 A;  3GZ5 A;  4XBF A;  1M1K D;  4LLG F;  1R00 A;  3J7A Y;  1R4M B;  4HDV A;  1X1D A;  1WU8 A;  3KL9 A;  2PMU A;  4JX4 A;  4P3I A;  3AVT A;  2IQ7 A;  3I53 A;  5DS9 A;  4P96 A;  1OCO H;  4F91 B;  2FX0 A;  1E1R A;  3SDB A;  2DPU A;  3L2Q A;  1RU4 A;  1V5F A;  2XVC A;  2XAS A;  4E7K A;  1QGZ A;  2O04 A;  2DK8 A;  5FO0 A;  4Y17 A;  1X0C A;  4KIC A;  2MC4 A;  4M9X A;  5M3M J;  4MR0 A;  3O6B B;  2D5V A;  2ZBU A;  5BQT A;  1WOR A;  4CYC B;  1YLO A;  3ASR A;  3JCU C;  3COA C;  1H0M A;  1VBL A;  1W0U A;  1T33 A;  1FOW A;  3LQR A;  4E4H A;  1W7P D;  1W7P B;  2EFO A;  2XAG A;  4ZDO A;  4DJA A;  1D3Y A;  2PEC A;  4X6A J;  3C2G A;  2F2E A;  2WAE A;  3ISP A;  3GVK A;  1VQ5 B;  4Y33 A;  1Y8Q B;  1K5C A;  2HVR A;  4XR6 A;  5IYQ A;  4Q47 A;  2L4M A;  2HVS A;  2VON A;  1BM9 A;  1LEB A;  2FMY A;  1FBU A;  2F48 A;  3FXL A;  3CCV I;  3IRQ A;  3QFC A;  1TW3 A;  5HS7 A;  2ELK A;  1GXQ A;  2HS5 A;  2KL4 A;  3O8H A;  4MHG A;  2GLO A;  1HCR A;  3FPP A;  1G4D A;  3WG9 A;  3OFN A;  3F6V A;  4D9J A;  2RQP A;  1TP4 A;  1QNT A;  2P5L C;  3OSG A;  1JTA A;  5LMZ A;  5DYM A;  5J3O A;  1WKM A;  5J1R A;  3SJM A;  2ESN A;  3HRT A;  2OCE A;  2MYS A;  5AON A;  3DU1 X;  2D1V A;  5IYC J;  2L5Q A;  2CQN A;  2K4B A;  3EUH A;  4A12 A;  1J9Z A;  3CJN A;  1FP1 D;  1R6R A;  2QLZ A;  5FLX K;  5FLV A;  4LK1 F;  3VB2 A;  4IRG A;  2MD0 A;  5E6T A;  3I9V 2;  2BW3 B;  2DIE A;  3GSI A;  2H09 A;  4RGU A;  2O3F A;  2JMW A;  4Z4T A;  1DQU A;  2Y69 H;  1WPC A;  3MVP A;  4KIG A;  2PFB A;  4R8H A;  4RBO A;  3KYD B;  4M53 A;  2R92 J;  2ZC2 A;  4D0P A;  4G7Z F;  3AAF A;  4BKX A;  2JRT A;  3CLQ A;  2MLK A;  3BZ6 A;  1WTH D;  3OEE A;  4FQG A;  1HF0 A;  4P55 A;  2Y0S A;  1B8I B;  2M34 A;  3BY2 A;  2K9L A;  2XGE A;  4NQW B;  4BJ5 C;  3CC7 I;  1UHM A;  2D74 A;  2R6H A;  1T0F A;  1U78 A;  2XC1 A;  3T9G A;  3W2W A;  3DEE A;  3R61 A;  5JR3 A;  2GQF A;  2XNC A;  4KFC A;  4MGR A;  1UG2 A;  1UD2 A;  2JSC A;  1ZM2 A;  1X2M A;  2IXS A;  5E3M A;  1E64 A;  3U6B A;  2ZXJ A;  3BCB A;  4IHV A;  1ZH5 A;  4XLC A;  3Q5F A;  3HKZ A;  4GYG A;  1Y6I A;  2XF7 A;  4KKT A;  2VPR A;  3EQL F;  3K4B A;  4KDP A;  4OPV A;  4DNR B;  4BEH B;  1QRC A;  1V5V A;  3M1E A;  2JA6 J;  4PAA A;  3R0A A;  2E1M C;  3SZT A;  3WNC A;  3W2V A;  4XL9 A;  4ZYD A;  1O8E A;  3VOE A;  4U0V A;  1O8F A;  2JQ7 A;  4S05 A;  2DTR A;  3G6E I;  1LDD A;  4CO8 A;  1YFH A;  3BG6 A;  2LFB A;  5AIQ A;  3LSP A;  3GTO J;  2NTP A;  2DK5 A;  4RGX A;  3RYP A;  4IHY A;  2LVS A;  1BJK A;  4IHT A;  1C0W A;  1WQ2 A;  5KAF C;  4IEJ A;  4ZTJ A;  4P5O A;  1S8N A;  5HLG A;  1VND A;  2EIN H;  1LKX A;  1MBJ A;  2OQR A;  5F0C A;  1A5J A;  3H92 A;  1MNE A;  2AHO A;  3AK5 A;  2PMH A;  1UD4 A;  1R5N A;  4P26 A;  1IG7 A;  2GXG A;  3GW2 A;  4HV6 A;  3CCL I;  3L2C A;  2HTS A;  1PUF B;  1OYY A;  1I7P A;  3P7N A;  1BIB A;  4U7D A;  1K4T A;  4WZL A;  1ETY A;  1MBF A;  2DQL A;  2XF6 A;  3LST A;  5FRO A;  2CUZ A;  3CMA B;  3GCM A;  1U5T C;  3S32 A;  2WZP P;  4I0A A;  3ZQC A;  2BGC A;  5DCM B;  1DBG A;  1Z67 A;  5J1U A;  4B8X A;  5M5W J;  2BV3 A;  2IRF G;  3MCA A;  2INV A;  3P9K A;  3PUB A;  3OYJ A;  1S72 I;  4G1B A;  2CQX A;  2OJE D;  3OOP A;  1O3T A;  2CND A;  2YX4 A;  3IUO A;  1QA3 A;  2F1M A;  1BJA A;  3LJY A;  3NB2 A;  1Z7L A;  4OU0 A;  1FBQ A;  2HQN A;  1T98 A;  4HLY A;  3S16 J;  4P1W A;  4GFB A;  4Q5S F;  1SM4 A;  1YQA A;  4XKV A;  4RGR A;  3DKY A;  1T08 B;  5J3L A;  2JRM A;  2HKO A;  2Z33 A;  1RES A;  1MND A;  1WMR A;  1ETV A;  2ECB A;  2Y0S N;  4UHT A;  5DDG A;  2K9N A;  1IDY A;  2D2W A;  1YIO A;  1W5T A;  3ONU A;  3RPQ A;  4ZZD A;  4HX4 A;  3PSI A;  2ZME C;  2A5Y B;  2V7T A;  5FKM A;  3NAR A;  4C3J J;  4RB2 C;  3OYL A;  1VQN I;  3QOP A;  3LFK A;  3VMF A;  1ULY A;  2DOF A;  2VKH A;  2R5Y A;  4CH7 A;  3Q39 A;  2YR2 A;  3E5Q A;  2VT2 A;  3CCM I;  1UD8 A;  4JRA C;  2KZV A;  2HPM A;  2NAZ A;  5C4X J;  4LBV A;  2BYV E;  3CP2 A;  3S3M A;  1MZB A;  3W6K B;  4BY7 J;  3ZMT A;  2GXA A;  4RPB A;  5J47 A;  1Z91 A;  4YEI A;  4A3K J;  2DMT A;  1P4X A;  5BNG A;  4XRM A;  3DP7 A;  4AD9 A;  4NC7 A;  3DXJ F;  1UAA A;  3FK6 A;  5K7H A;  4J0Q A;  3KP2 A;  2NOJ B;  1OKR A;  3E3V A;  4IX7 A;  1YX3 A;  4P9S A;  1FJL A;  2K9M A;  4UV8 A;  3WTZ A;  2P3M A;  4TMV A;  3J7Y J;  4NQW A;  5CVJ A;  4BHP A;  5ICC A;  3F8F A;  3ZZT A;  2M5W A;  3HPG A;  2UVE A;  5IYB J;  3S2D J;  3OV8 A;  2TRT A;  3KP5 A;  1J9I A;  4D5C A;  2DU9 A;  3DU5 A;  1Y0Y A;  3W2G A;  5AN9 A;  1ZGW A;  3CCJ B;  4C9Y A;  1VLY A;  3O8G A;  4G5G A;  2CGP A;  3I3L A;  3CCU B;  1S0U A;  4LLN A;  2DYS H;  3BDD A;  1TQP A;  2V1X A;  2JUG A;  3E6B A;  1N07 A;  3W3C A;  3LSI A;  4CCK A;  3E6C C;  1PJR A;  1LVK A;  3AG1 H;  1EFR A;  4ZDP A;  3HOW J;  3OZW A;  1FNM A;  2ZZQ A;  2OA4 A;  4X0C A;  5FA6 A;  1V54 H;  1HA8 A;  3FPK A;  2E60 A;  4MNU A;  2DOG A;  2VBZ A;  2MH2 A;  2M4K A;  5FKL A;  4ENJ A;  4MXN A;  3H5N A;  4R1H A;  3AVU A;  1K7A A;  3D5R C;  1I50 J;  2DFE A;  4OMY A;  5JLV C;  2V7F A;  4CUG A;  1IJE A;  3A4C A;  3EUA A;  5B5E C;  3OKX A;  2VBE A;  1N25 A;  4U0Y A;  2E1B A;  2VFQ A;  2MLG A;  4B3X A;  5H2F C;  1QH0 A;  4G94 A;  1OFM A;  2PYH A;  2BE5 F;  3RPU A;  5DM6 F;  1I6H J;  2OBS A;  4II2 A;  2W7Z A;  1O88 A;  3M1C A;  2QMU A;  3JR9 A;  4G7O F;  2KT0 A;  3QFR A;  4TKO B;  5GPC A;  2XKP A;  5F04 A;  4JMQ A;  3TP0 A;  1CZF A;  1GO2 A;  5EG0 A;  3X2Q H;  2OD5 A;  3HOX J;  3J7A O;  3VST A;  4BJT A;  3L1P A;  3CCS B;  5IP6 A;  1P4A A;  4A5N A;  4NNJ A;  1OR7 A;  2B7C A;  4KT5 C;  4LBY A;  1D1B A;  2EIX A;  3J80 K;  3QOD A;  4J19 A;  4CXF A;  2X3H A;  3BY6 A;  1APL C;  3CCE B;  2QGG A;  3RZD J;  3TDZ C;  3CDL A;  3KZI C;  5EDN A;  4XOT A;  2EIM H;  4IOA F;  1VQM I;  3KEO A;  2O6G E;  2BM1 A;  4ZJZ A;  4RD6 A;  4RCY A;  4CYD A;  2KPM A;  4DW6 A;  2E19 A;  1XGS A;  2XAQ A;  3CPW B;  1Z9C A;  2L2O A;  5IYW A;  1T8I A;  4HST A;  1F60 A;  1OB0 A;  5F4J A;  1QUF A;  1MBG A;  1BQE A;  3BH7 B;  1R7J A;  1IXC A;  4E70 A;  1KZL A;  1EV7 A;  2DA2 A;  2BM7 A;  2QKL B;  2ZZF A;  4LBW A;  2DMN A;  2PMZ N;  1XCV A;  2BXY A;  3WGH A;  3PA2 A;  1QA1 A;  2ZKZ A;  3SZG A;  1BIA A;  4XRS G;  4RCZ A;  1VQ8 B;  5J6X A;  1XMX A;  4Q7J B;  2DFI A;  3I0T A;  3RCO A;  3LOC A;  2W6I A;  3WND A;  3J7Z I;  1ZYR F;  4EM0 B;  1QHH D;  4HEA 2;  1LLZ A;  4UVC A;  3MKL A;  4UXN A;  2A6E F;  4A3E J;  5FRM A;  1NJI D;  5A2Q K;  2DY1 A;  3A3B A;  2CQ7 A;  2YUS A;  3E6M A;  1KYW A;  3ZMS A;  3OYM A;  3CCE I;  1Y8R B;  2VE8 A;  2VI6 A;  3CD6 I;  1E3X A;  2WZN A;  5IP7 J;  5TY0 A;  1IDJ A;  1QQI A;  2F5V A;  2FNP A;  2K3F A;  2VC0 A;  4JX6 A;  1W1W E;  4GDF A;  3OYE A;  3OSF A;  1WH5 A;  1E3O C;  3LMW A;  1YRN B;  1ZG1 A;  1IRZ A;  4RAY A;  1FX7 A;  5IT3 A;  2CU7 A;  3JRB A;  1KQ0 A;  1YLF A;  1TT5 B;  2L7Z A;  4FET A;  4ZZL A;  2RGV A;  1YIJ I;  3QU6 A;  2CO5 A;  3H3V K;  3GTM J;  1RET A;  2QF7 A;  2XUB A;  4RAF A;  2VNH A;  1Z3X A;  2A6H F;  2ACJ A;  2HQ5 A;  5A88 A;  1IXR C;  2Z1D A;  1YJN B;  2CYY A;  2MA3 A;  1NB9 A;  2OBR A;  5ILV A;  3ZMV A;  4Y9R A;  4XKW A;  1MMG A;  3HZJ A;  3TO9 A;  3MZH A;  1QVU A;  1U3E M;  3OYD A;  1LFP A;  3IWF A;  1O3Q A;  2RC4 A;  2P6T A;  2VL8 A;  1D5Y A;  1DDG A;  1DGR M;  4N4O B;  5HDG A;  2WTE A;  1J75 A;  3MWM A;  1ZEL A;  2L54 A;  2BN4 A;  4G6D A;  2B5O A;  3KEW A;  3ASQ A;  2X1E A;  3MCZ A;  5DV5 A;  4UVA A;  2RAE A;  1F5T A;  2XOK A;  2XRO A;  1O8H A;  1I18 A;  1BR1 A;  1BHE A;  4C3I J;  2EJR A;  4NK6 A;  3ZQF A;  4BXF A;  1DP3 A;  2JUC A;  1MBK A;  3HOV J;  1WJF A;  2WBM A;  2L7F P;  2PJP A;  3OL3 A;  3NQO A;  4PCQ A;  1U2R A;  3T0Y A;  4FXU A;  3SFZ A;  1E3Z A;  3OYN A;  3G05 A;  1Z05 A;  2LF8 A;  1OFD A;  3BTJ A;  2CBX A;  3S3O A;  2M8G X;  2NVT J;  1IF1 A;  1SKY B;  4IZZ A;  3FMS A;  2R7V A;  4CDG A;  5TR9 A;  1LM1 A;  2DA1 A;  2BM4 A;  1ONV A;  2CSO A;  2DA6 A;  5BPD A;  2XPU A;  2ADU A;  2PX9 A;  4G6T B;  3B4N A;  1YE9 A;  2JPC A;  4Z6Y A;  3GTJ J;  2Q6O A;  1WH7 A;  5D6E A;  2CFX A;  3E1Y E;  2W48 A;  4OP7 A;  1O8D A;  3DWL E;  2V9K A;  3ZCO A;  2HU9 A;  2O5R A;  2CQK A;  4X7D A;  1RC9 A;  2LG4 A;  3C2B A;  2VLA A;  3ZBT A;  2P0W A;  1QZE A;  4UZE A;  2J5P A;  4LJZ F;  1LDJ A;  2OAZ A;  3U2R A;  5F1R A;  4YZA A;  3WTU C;  2CMP A;  3TED A;  2HPI A;  3OS1 A;  2K85 A;  3JRA A;  1U9O A;  1BBY A;  1B2R A;  1MJ9 A;  4RAZ A;  5DSZ A;  2VNK A;  1SVL A;  1VQK B;  1ENH A;  2VFN A;  3GQ8 A;  1ZAR A;  4BPR A;  2JSP A;  1OJL A;  4C43 A;  3TQN A;  1E79 A;  3VO2 A;  3HG9 A;  1BOB A;  2P5V A;  4M4S A;  4C0S A;  2V1D A;  3ROU A;  1ZGJ A;  1WPK A;  3LSK A;  2Q2E A;  2CV2 A;  3P9C A;  1IJF A;  3LYC A;  4B47 A;  3BG5 A;  1K8A D;  2GK7 A;  1BI0 A;  2R7Z J;  1JKP C;  1MMD A;  4PGG A;  4A0Z A;  2AXL A;  4L5E A;  3N97 A;  1K6O A;  1W36 C;  2F4N A;  3CRZ A;  2KMU A;  2KIF A;  3ZGK A;  1F9N A;  1Q1V A;  2HOA A;  4NBS A;  2GAU A;  1LE8 A;  1IUF A;  3TW6 A;  1JT0 A;  2E2H J;  1DG1 G;  1EP1 B;  3I59 B;  6PAX A;  1OCP A;  3DBH B;  2QBY A;  1SAU A;  2NTB A;  1OCC H;  3IH2 A;  2C77 A;  1XDS A;  4UUV A;  1NHC A;  1Y1W J;  3OE7 A;  3FXO A;  1Z77 A;  4XN0 A;  3SEQ A;  5IYD J;  1H9G A;  1BLI A;  4DQK A;  1FMW A;  2QSF X;  1EZG A;  1HDP A;  4EGZ A;  1R5H A;  1XPX A;  1WSR A;  4P2N A;  3AVX A;  2AXT C;  2XGC A;  3A0H C;  1W87 A;  1RR7 A;  4EVI A;  3F3X A;  1JRG A;  1TYU A;  1G6N A;  2HXO A;  4O6J A;  5A8A A;  1JB9 A;  2UVF A;  4UUT A;  3VYS B;  3PM1 A;  2WAD A;  3H5A A;  3ZQ7 A;  3QWL A;  2JWT A;  4BAY A;  5CVU A;  2L4A A;  2MD5 A;  3IKV A;  2M30 A;  3GLX A;  5FO1 A;  1AHD P;  2IW5 A;  1AOY A;  3QYB A;  3I56 I;  3ISX A;  4DK1 A;  2GK6 A;  2KRF A;  2ME0 A;  1S29 A;  3BQJ A;  2P8T A;  3TO7 A;  4XIC A;  4QFM A;  2DER A;  3W6J B;  3S15 J;  2V5I A;  3JTG A;  1Y0U A;  1IRG A;  2DW4 A;  2KJC A;  1SFK A;  3O2P E;  3M9A A;  1OLT A;  2OBP A;  5K1Y A;  5FLM J;  2VC1 A;  3G4S I;  5CDF A;  5AMV A;  2VBY A;  1IW7 F;  3T8R A;  1FYM A;  3GF2 A;  4W97 A;  2EWN A;  3OJW A;  4ZYG A;  5LHG A;  1JUM A;  3KZY A;  1K78 A;  2Q6K A;  2XEX A;  3ZIA A;  4U4B A;  1GR1 A;  3F0C A;  4A6D A;  4A93 J;  3FKS A;  3JQP A;  4TMT A;  2ICW G;  2W4S A;  2EV5 A;  5HOO A;  4UV9 A;  3JSP A;  1UFM A;  4AM3 A;  1QVF B;  2ZFW A;  2BZT A;  1O7F A;  2VFP A;  1UEL B;  4JQF A;  1YJ9 B;  3Q0V A;  4X06 A;  2IGK A;  3HOT A;  1VQL I;  2LY1 A;  2GXB A;  3S1N J;  1F43 A;  4PJJ A;  3V4G A;  3H0D A;  4FK8 A;  1JA0 A;  2XRN A;  3I59 A;  2B7E A;  5FJ8 J;  4KNY A;  2V7W A;  2IPQ X;  3M8F A;  3RJP A;  4OPW A;  2G7U A;  4N9I A;  2DA5 A;  4AVP A;  2RKH A;  3OR1 C;  1ZM3 A;  3ZPN A;  4PDK A;  3F8M A;  4RGS A;  1QRB A;  2QE7 A;  3WE3 A;  1HG8 A;  1JGG A;  1ZM9 A;  4HRI A;  2VAS A;  1VI0 A;  2V7V A;  5JLX A;  2PBI A;  2V31 A;  2BXZ A;  3SQV A;  2VT3 A;  4A3G J;  3VDX A;  1UHW A;  2QX3 A;  1PJ6 A;  3V7A A;  3ZBU A;  3GUD A;  1MDM A;  2XTW A;  2F4M B;  1IAW A;  1V0E A;  2WYR A;  3QQA A;  2KFD A;  2ZME B;  4OJP A;  4PJL A;  4HV5 A;  1T38 A;  3RQI A;  3U2Q A;  1T6S A;  5FIU A;  4AVZ A;  4HAM A;  4FAS D;  1TQI A;  2E71 A;  1EH7 A;  2VKD A;  5E1W A;  5EJC A;  3SEJ A;  2KP6 A;  5CYV A;  4YAW A;  2E1N A;  3WTX C;  4PFO A;  4TT3 A;  1MJA A;  3KEY A;  2VBS A;  1U5T A;  3CQZ J;  5D4R A;  4WQM A;  1BX1 A;  2A5W A;  1PUF A;  1KU3 A;  3KIO A;  4YIR X;  5BSX A;  5DEQ A;  4AID A;  1KK3 A;  1A35 A;  3CCV B;  3B8H A;  3IP4 B;  2Q1Z B;  4YC5 A;  3RY8 A;  4YAO A;  1N75 A;  4HBL A;  1DU6 A;  1E17 A;  1XG1 A;  4YDT A;  1DU0 A;  4HLX A;  3SXY A;  4KH3 A;  4QUZ A;  3K6G A;  1U5T B;  2BSA A;  4CCN A;  2EFN A;  3IH3 A;  4CHU A;  2DOA A;  5HDK A;  4CYC A;  4RD0 A;  1CLW A;  1IN6 A;  4FIS A;  5EZH A;  3KEQ A;  4U87 A;  4IKF A;  1STZ A;  1UD6 A;  3ZQI A;  4A2U A;  1H8A C;  1ZGA A;  1K78 B;  2FA5 A;  1T0F C;  1TZL A;  2XDV A;  2XIG A;  2ZFU A;  4ZC3 A;  3ZOB A;  2PJR B;  4M0L A;  3DFG A;  4W8S A;  1O4X A;  5IK2 A;  3VR6 A;  3K2Z A;  2XRL A;  5GAE J;  1WP6 A;  1MDM B;  1HA3 A;  2XND A;  3ZSC A;  2NS8 A;  5DNS A;  2E1O A;  4KIF A;  3SFI A;  5K5R A;  2VE9 A;  1IO2 A;  3HSF A;  1PYV A;  4L5J A;  4C2T A;  3E7L A;  1OPC A;  1FMV A;  4IF4 A;  1EXM A;  2FEZ A;  2Y31 A;  3W2I A;  2XGJ A;  3H36 A;  3OYC A;  1VJS A;  2EZI A;  1VQ7 B;  3BR3 A;  3VOD A;  1PJ5 A;  1B9M A;  1KQ9 A;  2OZU A;  5E3L A;  5F4M A;  1P4M A;  5J35 A;  1O8M A;  1RWR A;  3GXO A;  1MJB A;  2IS6 A;  2ELH A;  1UMK A;  4KKU A;  3JRI A;  2ELJ A;  2E1M B;  3HHG A;  5DCF A;  1GT0 C;  1J59 A;  1T39 A;  3FIW A;  1VQL B;  1YJ9 I;  1HST A;  5J8F A;  1K73 D;  2HQR A;  4CZZ A;  1CF7 B;  3V7R A;  3HTU A;  1OHH A;  1T6Z A;  1Q86 D;  5L3G A;  1IV6 A;  1UJ8 A;  1FY7 A;  2WAQ A;  2DT7 B;  1COW A;  1IZ1 A;  2RC5 A;  1JTY A;  3IKT A;  2EB7 A;  2QTL A;  5E1Z B;  2MH9 A;  2DN0 A;  3IH4 A;  3U9G A;  3J80 Z;  2GBY A;  2IA2 A;  3S93 A;  3BPX A;  4EJT A;  2V4D A;  1E1Q A;  3ZZ0 A;  1ON1 A;  2C6Y A;  3BCA A;  3WU0 A;  2FOW A;  4X07 A;  5E20 A;  2N8G A;  5H6R A;  1K79 A;  3CCR B;  3A8I A;  3I56 B;  1KTV A;  1QQ1 A;  2ODL A;  2QUF A;  3OAA A;  2Q2E B;  3KYL A;  2ISZ A;  1JGS A;  4DYR A;  4XRF A;  4XQF A;  2O17 A;  2L9V A;  3HJE A;  4S04 A;  1U8R A;  2F5D A;  2EZL A;  2FBH A;  4Y3O A;  3QSY A;  2Z9O A;  1QGA A;  1XS9 A;  2NSP A;  5EGO A;  3V7S A;  3CCQ I;  3ZP5 A;  3SQN A;  1W35 A;  1FNC A;  4WXC A;  2ZTN A;  4PC7 A;  1R4N B;  4Y4R A;  1MSF C;  4ZTF A;  4M73 A;  5CVV A;  3F22 A;  4BEH A;  2ZJR F;  2IJL A;  2E36 A;  3OYA A;  4ZYA A;  2G7H A;  2WY8 Q;  4ZH4 F;  2HOT A;  1WSU A;  3M8E A;  3TO6 A;  3VYR B;  2BVN A;  4EJO A;  4PUS A;  2EFG A;  2JA8 J;  1HSJ A;  1WRJ A;  4L9J A;  2G0E A;  3JW4 A;  3PIO F;  2D3L A;  2OUM A;  1NRK A;  1EFC A;  1X1C A;  2LMD A;  3ABK H;  4HNU A;  5K7Z A;  3NRV A;  1NDH A;  3MEX A;  4A6E A;  4RM3 A;  2JT1 A;  1O7L A;  3ABL H;  1TBX A;  3AVY A;  4D7N A;  4PC2 A;  3BZC A;  3DU6 A;  2JA5 J;  3H94 A;  1DBO A;  2V1N A;  1HKQ A;  4RM2 A;  5FKN A;  4JOM A;  1SFO J;  1LB2 A;  2R7F A;  3U21 A;  5D5V B;  1FT9 A;  2HNH A;  2NNY A;  3GTL J;  3BC9 A;  1Z21 A;  1G7T A;  1HLV A;  4XLE A;  2YWE A;  1J7K A;  2KIM A;  1X3U A;  4JP0 A;  4TMW A;  1ZG5 A;  3ABU A;  2HEO A;  5EYR A;  3TBI A;  3HM5 A;  2LBF B;  3NEU A;  5FFZ A;  4RB3 C;  3WTV C;  2HCJ B;  2RQQ A;  1WWX A;  3K10 A;  3EDP A;  3KLN A;  5D8L B;  5GV7 A;  1V5E A;  4I7H A;  1RMG A;  1ZAO A;  2H6C A;  3DKW A;  4EQQ A;  4NC8 A;  2A05 A;  2AHQ A;  4A3B J;  2K9S A;  2V79 A;  4Y7N J;  2O8K A;  2XAJ A;  4RPD A;  3VSV A;  1JJ6 C;  4MYU A;  3B6C A;  2OU2 A;  3IC7 A;  4I6Z A;  4B3F X;  1BR2 A;  1B4A A;  3S1Q J;  1JKO C;  2VBW A;  1OFC X;  3GRH A;  3LA2 A;  4Y13 A;  2MC3 A;  1O57 A;  2P7C B;  2HKX A;  2K7L A;  3MKW B;  3K4N A;  3LO8 A;  2XHK A;  5E79 C;  2X6Y A;  2W57 A;  4RS8 A;  4E7S A;  1OYW A;  2NV4 A;  3QFS A;  1QA6 A;  1OFL A;  2QZ8 A;  2W85 A;  4G7H F;  2K02 A;  4XOR A;  4QIW N;  3MD2 A;  1B6A A;  1Y39 A;  3Q3S A;  2DA3 A;  4M1K A;  3CJR B;  4BDZ A;  3OS0 A;  5K7F A;  1TVC A;  2FBK A;  2HZD A;  4P9U A;  2GJR A;  4RDU A;  2VZL A;  1REP C;  4C30 A;  1DPU A;  3GBG A;  1BJZ A;  2CJJ A;  3JRE A;  1X19 A;  3OYH A;  1E63 A;  4E7H A;  1V5G A;  3TW7 A;  5KNL A;  5J8C A;  4L5I A;  4XD7 A;  4YFK F;  2B7B A;  2E5Z A;  4G1V A;  3M7G A;  4N3N A;  4WCG A;  2M3A A;  2XPV A;  1RZ4 A;  2JA2 A;  1WFX A;  2R5Y B;  3M3Y J;  1E62 A;  1FND A;  2Q0O A;  1QHG A;  2QQ9 A;  4KIB A;  2VNJ A;  2PE3 A;  2EWE A;  1E2X A;  1R58 A;  2QM3 A;  4R71 A;  3BLY A;  3DKX A;  3H1C A;  3G73 A;  1XSD A;  3JU4 A;  1WCM J;  1D0Y A;  4X7C A;  2F3L A;  3VYU B;  2JJ7 A;  3WTT C;  1L3L A;  3EPZ A;  3CB4 A;  4KIS A;  2JJ2 A;  4QHY A;  4PSX A;  3WNB A;  1PP8 F;  1F36 A;  3CC4 I;  3SUC A;  2OF7 A;  2AO9 A;  3OP1 A;  3WY9 A;  2XC7 A;  3FHN A;  1FTZ A;  1BW5 A;  2LR8 A;  3WTW C;  2G9W A;  2XGX A;  1N0U A;  3SLN A;  3QP6 A;  2OV7 A;  5GV8 A;  3BTC A;  2VFO A;  1NG6 A;  4PAB A;  1ETW A;  4HF2 A;  3K4M A;  2HMA A;  2DMU A;  4DBR A;  2DXI A;  1J09 A;  4OIN F;  3JRF A;  4LD5 A;  2QSH X;  3WYA A;  3M8J A;  1FIP A;  2WB1 N;  2QQ8 A;  1I6X A;  1R5B A;  2CUE A;  1IV8 A;  1KGS A;  1S7O A;  4OOV A;  1EP3 B;  3HPH A;  2CW8 A;  3A0B C;  3R60 A;  5B3S H;  2FQ4 A;  2YSR A;  4I99 C;  5F64 A;  5HS9 A;  3C7J A;  2CWE A;  2IA1 A;  2VJJ A;  5ILU A;  1TSP A;  4CCM A;  2EZH A;  3OZV A;  5KHD A;  3HSR A;  5JVT A;  3EQN A;  5D4S A;  3QAH A;  2FSW A;  4YZ0 A;  2ZJ2 A;  1H85 A;  1F1Z A;  1WJB A;  2EFP A;  1IB0 A;  1NB0 A;  5IYN A;  3LSG A;  4NDL A;  2X53 S;  2HYG D;  3PUN A;  4A0Y A;  3S2H J;  2X1C A;  1QX4 A;  4N4N B;  5GTH C;  1Y1V J;  4I2O A;  1QGY A;  5A89 A;  1V0F A;  2DMP A;  2LTP A;  2NST A;  4QSH A;  5F1J A;  3DPU A;  4KT6 A;  3ML3 A;  3SYT A;  2VUM J;  4BQN A;  1UG0 A;  4B3G A;  1MGT A;  2TCT A;  1OCT C;  1JTX A;  3SKB A;  1QVT A;  3OW7 A;  4PMH A;  3TKY A;  1A6I A;  4UB6 C;  1D5V A;  1HW2 A;  1O3S A;  2MG4 A;  3PO3 J;  2XNJ A;  1QBJ A;  1E3P A;  1RRJ A;  1SFX A;  3CCS I;  3R6K A;  5IPA A;  2HWV A;  5FNZ A;  1Z0X A;  1GDT A;  2CUF A;  2H94 A;  5EGO B;  4PGO A;  4Z2Y A;  4XM3 A;  3PEN A;  1JXS A;  1ZM4 A;  3PVD A;  3WE2 A;  4AC0 A;  5IYR A;  4B3A A;  2X4H A;  2IEK A;  4RDL A;  2VBK A;  3HGG A;  1ETK A;  2W82 A;  2WAQ N;  3ZQG A;  3UR3 C;  2ZXH A;  1I1G A;  2C78 A;  1WI9 A;  1MBH A;  4O3M A;  2BM6 A;  3KYC B;  3ASN H;  2RDP A;  2DYI A;  1OB2 A;  2QEN A;  2DCU A;  1KCC A;  3K4C A;  4AUX A;  5F08 A;  2IAI A;  4IRI A;  4XKC A;  3CES A;  3K1P A;  2ETH A;  2KIU A;  4CCO A;  4BU2 A;  1ORK A;  2O61 A;  3J81 k;  5JHU A;  2EA2 A;  3BT9 A;  3ZN1 A;  2B9S A;  1KK0 A;  5LLQ A;  1HDD C;  4TN1 A;  1T56 A;  2H6B A;  2VXD A;  3UNG C;  2FX3 A;  3GFM A;  3JTH A;  4V2G A;  3D26 A;  2NS7 A;  1HW5 A;  2VJI A;  4IHW A;  2EBI A;  4W8T A;  1TLL A;  3ZQH A;  4FE4 A;  1W34 A;  1NHA A;  3HB9 A;  3D0S A;  2GA2 A;  1TYW A;  5D8K B;  4XLF A;  3WHB A;  3K70 D;  5EEH A;  2LP0 A;  2R3S A;  1XCB A;  3MN2 A;  3CO6 C;  2L01 A;  2P81 A;  5FL7 A;  2BW3 A;  1Q82 D;  3KPH A;  1VTN C;  1R22 A;  2COB A;  2M0M A;  4I98 B;  1LQ1 A;  3ZPP A;  3CMY A;  2VN2 A;  5H59 A;  3CCJ I;  3GFL A;  2Z5U A;  4W8R A;  1YTY A;  3OR2 C;  2UWM A;  2HXI A;  2OYN A;  4A0X A;  3VSK A;  1W5S A;  2W00 A;  4YFN F;  1OQY A;  1OCZ H;  2C5B A;  2IP2 A;  3UW0 A;  3K0L A;  2X9D A;  1KZH A;  2EFQ A;  1PXZ A;  4GRI A;  3I4P A;  2X0K A;  4QVA A;  2W84 A;  3N90 A;  5IOZ A;  5TJJ A;  3CXC B;  3CCY A;  5AIP A;  3JAM K;  3K7A J;  2RVC A;  2V9V A;  1MIJ A;  1JNY A;  3NWS A;  2ZIT A;  1TNS A;  3RKW A;  2NVQ J;  3QPS A;  3G4S B;  3E97 A;  4XNF A;  1YO5 C;  3TL4 X;  3JUR A;  1I8D A;  3K69 A;  2E1C A;  4YZX A;  4UUS A;  1D8J A;  3H5R A;  1LNW A;  2X6X A;  4J01 A;  3ECH A;  2E2I J;  3CCM B;  1QFY A;  3FY3 A;  2JN6 A;  1IA5 A;  1ACI A;  1MNM C;  1OMI A;  3F8B A;  5ICF A;  4QV2 A;  3V8J A;  3V8L A;  1O8G A;  1VQP B;  3D5S C;  3FKI J;  1ERD A;  1VQN B;  4C3H J;  3ZXS A;  5GP9 A;  5C4J J;  2I5U A;  4AYB N;  2HYF A;  2DO7 A;  3E20 A;  3WQZ A;  2R7R A;  2L9S A;  4IXA A;  3J81 K;  5B1A H;  4OWR B;  1FOK A;  3FZV A;  2B63 J;  2QXZ A;  2FML A;  5EMN A;  2KVO A;  1JT6 A;  3AGQ A;  1I39 A;  3GZ6 A;  2AS5 F;  4MTE A;  1W2B B;  2COM A;  1S7A A;  4FN5 A;  4Z4W A;  2ZXW H;  3FBI B;  2VPL A;  3QRF F;  2O6W A;  3FXJ A;  4I84 A;  2EQR A;  2IS2 A;  3ZUG A;  5F27 A;  5CLS A;  3F23 A;  2LKX A;  1N78 A;  2BY0 A;  1S72 B;  3BJA A;  1MMN A;  2O7O A;  1BW6 A;  2UV1 A;  2VKE A;  4HNV A;  5FB2 A;  3SHF A;  3QPT A;  3OY9 A;  1BC7 C;  2QDX A;  1V3F A;  1TTT A;  1O8L A;  3W5V A;  4EAT A;  4I09 A;  2Z6B D;  1WOP A;  4DYC A;  3K1N A;  2X3U A;  1IN7 A;  4X0G A;  3ZPL A;  1FYL A;  1RQR A;  3P26 A;  4AIJ A;  2A68 F;  1A36 A;  4M3B A;  1MMA A;  4M6X A;  1TUI A;  2HDW A;  2BMW A;  3SLD A;  1KTW A;  5IP9 J;  5C1E A;  3WU1 B;  3TH0 A;  1P2F A;  1W5C C;  1JHF A;  5D5W B;  1PUE E;  4WXH A;  4QVJ A;  2JVH A;  2Z2S B;  2VKV A;  2X51 A;  3ZQQ A;  5IOY A;  3VMW A;  2ZNZ A;  3H3U A;  2E7W A;  2CC2 A;  1KD1 D;  1WVR A;  1Z6T A;  2YWF A;  1W7P A;  1D2E A;  2A61 A;  1KYZ A;  4NBQ A;  4ZYH A;  2QA4 I;  1UD5 A;  3H9G A;  1MD0 A;  1MH4 A;  4RLQ A;  4IJA A;  4EGY A;  1FSH A;  5E1X A;  1KA8 A;  5JBQ A;  5LD2 C;  3LSR A;  4FT8 A;  4Y15 A;  3FJO A;  4UB8 C;  4RAG A;  4XMY A;  3HYI A;  2JTV A;  4BQQ A;  1SAX A;  1WZ2 A;  4UZF A;  3LQ6 A;  4F92 B;  2HOS A;  2QN6 A;  2F43 A;  3G2B A;  4GGG A;  3TMO A;  1R9T J;  2QSG X;  5KCM A;  3CTA A;  1A04 A;  3LWF A;  3HDD A;  2WPD A;  2YWG A;  4NHJ A;  1PE9 A;  2MFZ A;  5B66 C;  2R5Z B;  1ZN2 A;  3PA1 A;  1H80 A;  1NH3 A;  2XF5 A;  4ZGQ B;  2GIV A;  3FXQ A;  3KP7 A;  4U0W A;  1TNT A;  4M71 A;  3HOY J;  2E34 A;  2VOO A;  2QYU A;  1TYX A;  5FKK A;  4H9G A;  4Y9U A;  3LSH A;  1H88 C;  1P92 A;  1VHO A;  3FM5 A;  2NRA C;  3HHH A;  3HTS B;  4XLA A;  3A2K A;  2M45 A;  1N05 A;  3H09 A;  2WR8 A;  1VQ4 I;  3W2H A;  2EZK A;  3HUG B;  4IPA A;  1R49 A;  4HYE A;  4PJN A;  3FMQ A;  4ZDL A;  1G8X A;  4M9Z A;  2VBT A;  4D7M A;  1W36 D;  1LJ9 A;  5IY5 H;  5HS8 A;  3HOS A;  3ESW B;  2PG4 A;  3ONQ A;  5M5Y J;  3OYI A;  2LF7 A;  2MAB A;  3LQQ A;  4Z06 A;  3H9J A;  1W0T A;  1S3J A;  4P6Y A;  4AF7 A;  3ZN0 A;  3T5X A;  1YJN I;  1CNF A;  2V7Q A;  2M8E A;  3OW2 B;  5ED4 A;  4EM2 A;  5K5Q A;  1EE6 A;  1Z1D A;  2ZXI A;  5L3B A;  2CH0 A;  3FXK A;  4WX9 A;  4L0Y B;  1FLI A;  5E18 F;  3GZN B;  3ASO H;  3ABT A;  4KMF A;  1M90 D;  2IVM A;  3BR5 A;  5F0F A;  1U2W A;  3AGP A;  4FWT A;  3CZ6 A;  2PLY A;  3BG7 A;  2KDO A;  2VXZ A;  3B82 A;  2BVM A;  2NYX A;  1UCR A;  4DOZ A;  4G7X A;  5GAH J;  3QYF A;  4YII A;  2GJK A;  3A8K A;  4LIU A;  2LH9 A;  5FD5 A;  4L18 B;  1D1A A;  4OIR F;  2P7V B;  1DGW Y;  1IHM A;  1XQB A;  4B44 A;  2RNG A;  3GX4 X;  2XAU A;  3LSJ A;  3IAM 2;  4D5F A;  5HLH A;  1DUX C;  5FRN A;  3BY1 A;  4OAZ A;  2LD5 A;  1HBX G;  1DAR A;  3RSN A;  4FTH A;  1BC8 C;  3SZP A;  1KK1 A;  2H1K A;  4NK8 A;  1IN4 A;  3VMV A;  3WG7 H;  1YIT I;  3V42 A;  1VQ8 I;  4P9F A;  5FD6 A;  5JVG F;  3OIO A;  3HXL A;  3A01 B;  3GVJ A;  1G2H A;  4GCV A;  1SC7 A;  4LB6 B;  4BNC A;  1XE1 A;  5DN6 A;  4C2L A;  2ZL6 A;  3DF8 A;  2CUJ A;  2WY7 Q;  4A3C J;  3B78 A;  1Z6R A;  3FX3 A;  3HEF A;  3SY2 A;  4RMN A;  1O8J A;  3I54 A;  2V1U A;  5E8G A;  1VQM B;  2ZCW A;  1BI1 A;  1SD5 A;  3DEW A;  5BSY A;  1UZC A;  4CCJ A;  1JJ8 C;  2EK5 A;  5H6Q A;  4F52 A;  3G71 I;  2R0Q C;  2A6T A;  3DBR B;  3CME I;  3GYH X;  2WJV A;  1OGM X;  3L2W A;  2HQA A;  1OFE A;  4GO1 A;  3PQJ A;  3RQ4 A;  5GTI C;  2V6C A;  4MFE A;  4E7L A;  4RD4 A;  4LBZ A;  4E7Z A;  4LMY A;  2V7X A;  2OTJ I;  2Y9Z A;  3QOE A;  5E8I A;  2BGJ A;  2GWR A;  2VJ5 A;  1SVM A;  1XC5 A;  2ZBV A;  5H5J A;  3FK7 A;  1D0Z A;  5IYP A;  4PK4 A;  2IOU G;  2OPT A;  1CF7 A;  4P1V A;  4EW9 A;  2KIQ A;  2FRH A;  2FUG 2;  2CRG A;  4L9T A;  1HQC A;  2DT5 A;  3E5X A;  1P6R A;  2EPF A;  3IWZ A;  1GVJ A;  3LSM A;  4JBA A;  3RIQ A;  1MSE C;  4MQV A;  4IQJ A;  3CDH A;  3GEZ A;  2YUH A;  2UUZ A;  3A1Y A;  1UMQ A;  4U7B A;  1B72 A;  2DA7 A;  4RA2 A;  5EEG A;  2DMQ A;  2LC2 A;  4BXX J;  5L3F A;  4ENN A;  2NPF A;  4P25 A;  1ZRC A;  2NVY J;  2R7U A;  2V26 A;  1G7C A;  1OCR H;  3KP6 A;  1QZY A;  4OZZ A;  2ZL5 A;  1BOA A;  1T5E A;  3P9I A;  2FVG A;  3V76 A;  2O1D A;  1TWC J;  1YRN A;  3S14 J;  2E1R A;  1Z3Y A;  3F8C A;  3SJZ A;  1Q9S A;  2O0W A;  1F20 A;  2XGD A;  4KUM A;  3Q0W A;  3D5L A;  4Z1M A;  2NZM A;  1MH3 A;  4UAJ A;  1WJE A;  2CW7 A;  2JK3 A;  4P6V F;  3RDI A;  3MQ0 A;  3CCU I;  1V4R A;  1YI2 I;  3T51 B;  1WGX A;  2ID3 A;  5FKO A;  3PET A;  4QTR A;  4BE2 A;  3MKZ A;  4UVB A;  5ERI A;  1N8R D;  4KMU X;  2HTJ A;  1RKW A;  4IVN A;  1POG A;  3OOC A;  1EFU A;  3WU2 C;  3J81 Z;  2RN7 A;  3IV5 A;  1H8H A;  2DJN A;  2NS0 A;  4XSZ F;  1FX0 A;  2K86 A;  2HDN B;  3ERM A;  5LHI A;  5J4V A;  3JSO A;  3QU3 A;  2DOD A;  3IAS 2;  3MZ8 A;  1ITY A;  3C2H A;  4M3E A;  2PLF A;  4CSW A;  2HR3 A;  5DUK A;  3BPV A;  2R7O A;  3FXU A;  4GYI A;  2A07 F;  4OIP F;  5THX A;  3FM3 A;  1AA7 A;  3DTI A;  2F1L A;  4AYB A;  2VOP A;  1B59 A;  4ESF A;  1T6Y A;  3BR0 A;  1ZUN B;  2QYO A;  2A3S A;  2LKP A;  4Z4R A;  5HKK A;  2QA4 B;  2DAO A;  1P7I A;  2X6W A;  5LRR A;  4E6K G;  5IT9 K;  1USS A;  5BOX A;  4RD2 A;  2CV1 A;  4Y52 J;  3BR2 A;  4KA4 A;  3D1N I;  3JQR A;  4UY8 I;  4AIH A;  2ESH A;  2IA0 A;  3BG3 A;  4LG0 B;  4IRH A;  1G7R A;  4OIO F;  2M9H A;  1U8B A;  4WZT A;  1ZHF A;  4HF0 A;  2BSP A;  1BX0 A;  1KCD A;  1HVX A;  3BQZ A;  1XSX A;  3CUO A;  4MEY F;  4OZY A;  1XGM A;  4BXU A;  1FC3 A;  4L0Z B;  3I55 B;  4P12 A;  3RZO J;  4QPO A;  2WSS A;  4X8I A;  1XMA A;  5HVQ C;  3A03 A;  3K4K A;  1JKR C;  3W6V A;  2LNB A;  1QFJ A;  1X3Z B;  2O0V A;  3AVW A;  2CF4 A;  1Y0N A;  2HI3 A;  2YU3 A;  4LK0 F;  2OCC H;  1JUS A;  5CKT A;  4G7W A;  3MFK A;  3WTY C;  1CQX A;  2PQ8 A;  4YAF A;  1QG0 A;  4LIV A;  3GVA A;  3AL0 C;  3Q6R A;  2HGC A;  4M3G A;  5D6F A;  2F5E A;  1IDZ A;  3ECO A;  1ZTR A;  2EH3 A;  5LFA A;  3DLA A;  1VQ6 B;  2R4G A;  1LFB A;  4EJU A;  1Y56 A;  3M4O J;  1RNL A;  1RQP A;  3VEP A;  3AG4 H;  3HRM A;  4QPQ A;  3S3N A;  2OTL B;  3W2F A;  4HZF A;  1IUY A;  4Z03 A;  2LY2 A;  3CMA I;  2E5N A;  1ZR4 A;  5EF6 A;  3CUQ B;  2Q8K A;  1OIS A;  3WHC A;  3I55 I;  3CF5 F;  2H27 A;  2W6J A;  3CCL B;  2PEX A;  3FF5 A;  3SEZ A;  3ML6 A;  2QCO A;  5HNF A;  1I27 A;  1R1U A;  4ROX A;  3ABM H;  2KIS A;  3SYJ A;  5DCM A;  3LNQ A;  1IJW C;  4ZCM A;  4PC1 A;  2A69 F;  2LRD A;  3IL2 A;  4LLL A;  2J5O A;  4M3F A;  4LB5 A;  3T1B A;  4U49 A;  2XT2 A;  4AU7 A;  1D0X A;  1K28 D;  2BOL A;  5JMC B;  4HW0 A;  3DV8 A;  2VOD A;  3G6E B;  3CF2 A;  4ENK A;  2STW A;  1K8F A;  4A5M A;  4E0F A;  2KRC A;  2R7D A;  4A3J J;  2ZJP F;  1AIR A;  3U1D A;  1X1B A;  4OM9 A;  1FP2 A;  2CFO A;  3E1S A;  4AF6 A;  2VQH A;  3G3Z A;  1B8I A;  4IO9 F;  3VWB A;  4BQO A;  1EA0 A;  1YX5 A;  2W24 A;  2HDC A;  2K4J A;  4I02 A;  3KRG A;  2VYQ A;  4PC6 A;  3L7W A;  1ETO A;  4PJM A;  3QE2 A;  2ZB9 A;  1ODD A;  3NAU A;  1FWZ A;  2F4I A;  4YG2 F;  3SZE A;  3HSE A;  5LHH A;  1YYV A;  2M2E A;  3GTG J;  1N08 A;  1YI2 B;  3JRH A;  1GUU A;  2QBY B;  1NK3 P;  4EV0 A;  2CK3 A;  5HLI A;  1Y0R A;  2KZG A;  3L2U A;  1R5O A;  1OR7 C;  1LE8 B;  3CC7 B;  3CDI A;  1K4S A;  3WTS C;  4RD3 A;  1YHQ B;  3PJR A;  5FGM A;  2KHM A;  2R7W A;  5LRS A;  2PN6 A;  2EV6 A;  1R36 A;  4FCY A;  2XV4 S;  2VBU A;  2YPR A;  3Q9S A;  3OZU A;  1V55 H;  3DTE A;  1AKH A;  3GQB A;  3MAJ A;  2YS9 A;  3PL8 A;  3BTI A;  5J1Y A;  1LPQ A;  1HXD A;  2EA4 A;  2J7K A;  2OZ6 A;  4ZGN B;  2WB1 A;  2WV0 A;  4NUB A;  1RPW A;  3GIR A;  3CUQ C;  4JK1 X;  1QPM A;  3F6O A;  1ZRE A;  1KQ8 A;  3K9T A;  1PJ7 A;  1X1P A;  3JAM Z;  4HF1 A;  4YEJ A;  3TGN A;  4X7E A;  2DET A;  1SFU A;  1VQ9 B;  2YX7 A;  1MBE A;  1BL0 A;  2CQQ A;  3HC7 A;  1QJV A;  2JPB A;  3ES9 A;  1XFO A;  2IBD A;  3E6D A;  4ETS A;  5M5X J;  3GQA A;  4PC3 A;  2GIZ A;  4N3G A;  4A3F J;  3QFT A;  1ZQ3 P;  2FOK A;  1WHU A;  1KQS B;  5ICE A;  5LGU A;  1IN8 A;  5J40 A;  3WWG A;  3GVL A;  1SD7 A;  2H8R A;  2QQB A;  4OIQ F;  1VQ5 I;  1IDK A;  3KZZ A;  1TWH J;  4QWQ A;  4EJV A;  5F0H A;  4XRS A;  1HKT A;  3W2E A;  4MIM A;  3W5U A;  2C5H A;  3KFW X;  1OGO X;  3N6Z A;  2DFH A;  3G71 B;  3MMY B;  2Z16 A;  4MLO A;  5JHF A;  2ZBK A;  4F3Q A;  5L3C A;  2EIK H;  3BNW A;  1ZK8 A;  1Q81 D;  4WF2 A;  4RLF A;  2KKO A;  4DQ2 A;  3P27 A;  9ANT A;  4WZK A;  5C3E J;  3K4J A;  4A3D J;  3LVB A;  3OIP A;  5F6F A;  1KON A;  4OOS A;  1VQO B;  3PFY A;  1KC8 D;  3W2A A;  3K2A A;  3GQ7 A;  4YAL A;  1R23 A;  3FKJ A;  4WXD A;  4BGD A;  5M3F J;  3CPX A;  5KW9 A;  2HLD A;  2X8K A;  1T95 A;  3JRC A;  1WSV A;  3CUQ A;  4XN3 A;  4BH9 A;  2L3D A;  4IQ4 A;  2CW5 A;  4DGW B;  3G1O A;  3GO5 A;  1R1V A;  3HAG A;  1FPQ A;  1I5Z A;  3V8K A;  2LK2 A;  3VSL A;  2XSD C;  3KET A;  3OEH A;  2BF4 A;  3WGG A;  1YIT B;  2OBT A;  4RDK A;  2XT4 A;  4YIF A;  4G8X A;  1FTT A;  4ZYE A;  2Y0M A;  1EFT A;  4NC6 A;  5JI6 A;  4M72 A;  1TTY A;  3BP8 A;  1SVO A;  4M9S A;  2RV8 A;  4BBR J;  1VLO A;  4B48 A;  5E3N A;  1EA3 A;  1QVG B;  2P4W A;  4RD1 A;  4QLC U;  3S17 J;  4FHT A;  2PI0 A;  1XGO A;  2XB0 X;  5DTD A;  4HIZ A;  3KE2 A;  2F5C A;  4WZE A;  4CZC A;  3CC4 B;  3OYF A;  4CIC A;  1LLW A;  5A2Q Z;  1AWC A;  1OYI A;  1IXS B;  2JVG A;  1S7E A;  3I64 A;  2D45 A;  1JE8 A;  2I10 A;  3EUK L;  1SKQ A;  2XZO A;  1FIA A;  4N0B A;  2DA4 A;  3L9F A;  1U6G A;  3H9Q A;  4BQA A;  3VNU A;  2VBX A;  2H8W A;  5FLX Z;  2STT A;  4V19 K;  1GHC A;  2BX6 A;  1IN5 A;  4R79 A;  4YCQ A;  2HFH A;  1SAN A;  3HL2 A;  4JYK A;  1XMK A;  2BPO A;  3OOU A;  5D5X B;  2XTY A;  3ZRG A;  3I4N J;  2ZTG A;  2BY2 A;  4F7Z A;  1G3W A;  3I4M J;  4ZCI A;  1RR8 C;  5DD8 A;  2Y48 A;  3GWZ A;  2J8K A;  1SD4 A;  1WJD A;  1P7J A;  1TWG J;  3ASS A;  5HXB A;  1QRY A;  4ASU A;  3EYY A;  3DLL F;  4YXW A;  4HG2 A;  1S4M A;  3R6J A;  1ZKG A;  5KVR A;  2RNJ A;  4B09 A;  3SJP A;  2UXX A;  3QPL A;  3C1D A;  3WXM A;  1E43 A;  4I01 A;  4FX0 A;  3ASP A;  4Z05 A;  2VBV A;  1VQ4 B;  4RLZ A;  2NXN B;  3SDG A;  4M6Y A;  4MQ9 F;  2LYC A;  2CRV A;  4UNO A;  3QYE A;  4K1X A;  2Y30 A;  2V6E A;  4P22 A;  4U9U A;  3WBK A;  3B73 A;  5LEK A;  2F4O B;  2WWY A;  1YW8 A;  4IW3 B;  3K1M A;  2FJ1 A;  1VFC A;  3FXM A;  3ZZU A;  3GQ9 A;  4S0H B;  2JN9 A;  4HX8 A;  2TDX A;  2GPJ A;  2M1B A;  1N0V C;  2EFW A;  3QP5 A;  3PIP F;  3CC2 I;  2OK8 A;  2IGN A;  2WV1 A;  1T2K A;  4MO7 A;  4M74 A;  3AKZ A;  2VQG A;  3A1P A;  2FE3 A;  3C18 A;  3RKX A;  4C2M J;  1H42 A;  4HE6 A;  1YJW B;  4RB1 A;  5B6I A;  4XK4 A;  4DNC A;  2JDI A;  1M1E B;  1R1T A;  3A01 A;  4KKS A;  4NCN A;  1UHS A;  1P4W A;  1WJC A;  2D1H A;  4II3 A;  1NBM A;  1AMO A;  2QEX I;  4ENM A;  4KJZ A;  2K3P A;  2OQG A;  5BPI A;  1SFE A;  3R0J A;  3BZK A;  4E7J A;  4URR A;  2LLK A;  1OB5 A;  3PNY A;  4V02 C;  2BM5 A;  1XDU A;  2ECC A;  1XB4 A;  2VB6 A;  1RUN A;  1MRZ A;  2X48 A;  4HOB A;  1OGJ A;  3JX8 A;  1VF9 A;  2M7A A;  4KIT B;  2LY9 A;  3IHU A;  1XGN A;  1GAQ A;  4A69 C;  1ELO A;  2XKO A;  3JRG A;  1GV2 A;  3BJ6 A;  1N06 A;  1QFZ A;  4HDU A;  4CQJ A;  5KAI C;  4A3I J;  4J00 A;  1FBS A;  1NTC A;  2Y9Y A;  2XZL A;  5L46 A;  4ACB A;  1DPR A;  4G9Y A;  3BH4 A;  2JZY A;  3N05 A;  2VIX A;  4W1U A;  4PGH A;  2JJ1 A;  1YG2 A;  4IHX A;  3T8T A;  3A8J A;  2EIL H;  3RPU D;  1ETX A;  1P9Q C;  2QGU A;  2VNI A;  3LQE A;  2K40 A;  5FO5 A;  3P4G A;  1PLU A;  1FYK A;  2QEX B;  4G6Q A;  4MYT A;  3E0J B;  3DEU A;  1KMH A;  2BY3 A;  1ON2 A;  1H9T A;  2LBF A;  1X1A A;  4KN7 X;  2KRH A;  1YJW I;  2BEO A;  2CS3 A;  1RKT A;  1KU9 A;  3F21 A;  4HSR A;  3REO A;  4OOI A;  2FBI A;  1YW7 A;  3OYG A;  5TGT A;  5F4O A;  4N9H A;  4B1R A;  1ZRD A;  3CC2 B;  3FMR A;  4V2F A;  4ABZ A;  1BMF A;  1ZLJ A;  4M6V A;  1ZG3 A;  4Q48 A;  4XOP A;  5EZG A;  1CQT A;  1XX5 A;  3MMP A;  1OOC A;  4OJ5 A;  2JA7 J;  4LIT A;  4LGW A;  5KSW B;  3F72 A;  3ZMD A;  2PMZ A;  1SMY F;  4OAY A;  1J0R A;  2KLO A;  2Y2Z A;  3BTL A;  1W0K A;  4HE5 A;  2M87 A;  2K9Q A;  3PFI A;  3PUF A;  2R5Z A;  4HQE A;  2HDD A;  1CGP A;  2AQE A;  2YWH A;  4HWV A;  3DPT A;  1GVD A;  1NG7 A;  4B43 A;  2DT6 A;  1VQP I;  1VF7 A;  1L0O C;  2EIJ H;  2XZP A;  4EEF G;  3I1F A;  1DP7 P;  2GZW A;  4KN4 X;  2DYR H;  4PJ0 C;  3CCR I;  1HZE A;  3RKY A;  5C44 J;  3V7C A;  1I1S A;  4YZQ A;  3LAP A;  3KP3 A;  2FQ3 A;  1PKV A;  3PO2 J;  1JKQ C;  1MMS A;  3PUM A;  1UB9 A;  5CJ9 A;  4Y7C A;  2QKM B;  4JX5 A;  2NVU B;  4OJL A;  5CVR A;  5E3O A;  5B1B H;  3GLL A;  3CMM A;  1HOM A;  1CNE A;  2CG4 A;  1XN7 A;  2GM4 A;  3H9N A;  4B4D A;  1FOX A;  4PSW A;  3LAJ A;  1QCX A;  1JHH A;  1TWF J;  2CW0 F;  5ICG A;  1FOY A;  2L0K A;  1ZLK A;  3ZR8 X;  1SMT A;  1GVH A;  3MHP A;  1TT0 A;  1GXP A;  1KU7 A;  4Z4V A;  2DPD A;  2O03 A;  2XPW A;  1D8T A;  1R5G A;  4GXO A;  1X3W B;  2V9P A;  2MBF A;  3CJT B;  3RI4 A;  1A6Q A;  4WWC A;  3BG9 A;  3U1K A;  4OPO A;  3B6A A;  4DZP A;  1Q1H A;  1KRH A;  2ZSI B;  2ID6 A;  1VQ7 I;  4XLN F;  1AU7 A;  4G12 A;  5HZA A;  2MW8 A;  5HNH A;  1BA5 A;  1O8I A;  1UD3 A;  2R7Q A;  4BBS J;  1WJ5 A;  2MSY A;  4I0B A;  2VQC A;  3CO7 C;  2O8X A;  1W9X A;  2I1L A;  2LDU A;  2W25 A;  1B23 P;  2QVO A;  3GFJ A;  3CJQ B;  4UUS B;  3DQV C;  3FWE A;  4BE0 A;  2ZSH B;  1K61 A;  3RTR A;  4BHC A;  4CA0 A;  3ERE D;  3C3W A;  4ITV A;  5CQE A;  5EEA A;  1FRQ A;  3L2R A;  1VQO I;  2UXN A;  4G6I A;  2XTX A;  3Q38 A;  1QGP A;  4ON0 A;  1O8K A;  4BYY A;  1PP7 U;  1DAB A;  3AFH A;  4DYQ A;  1AKH B;  1S6L A;  4A3M J;  1U0J A;  2HVQ A;  5LBQ A;  4YAU A;  3OPO A;  1DDI A;  2M5S A;  3FXR A;  4LG3 A;  1HF2 A;  1Z7U A;  2W1O A;  3MKY B;  2R7S A;  1FEX A;  3BOQ A;  3H0G J;  4RB0 A;  1BN8 A;  3EUH C;  3R6S A;  1R71 A;  1MAB A;  1JI8 A;  2G0Y A;  3WOD F;  4C2U A;  1WJA A;  4TMZ A;  3I71 A;  3N4M A;  3PQK A;  2ZME A;  4PFP A;  4ASN A;  4CGZ A;  2ISY A;  3OMY A;  3Q0U A;  2XAH A;  5JFR A;  3B90 A;  4E7I A;  1FNB A;  2F5F A;  3OYB A;  2PJR A;  2RRE A;  4RDJ A;  4OOX A;  1QPI A;  4I76 A;  4GQN A;  3AL0 B;  3HIF A;  3NWT A;  4LOC A;  3H3Z A;  2H1L A;  3IRR A;  4YRV A;  2XSJ C;  4CCL A;  1IRF A;  1VQ9 I;  4EM1 A;  2BVL A;  2IGO A;  1G3T A;  5GPA A;  2C2W A;  4YHB A;  2GOX B;  2BHZ A;  3T56 B;  3VYT B;  1TYV A;  4BL0 B;  4F93 B;  2LKS A;  4ESJ A;  3HKZ N;  1XB2 A;  2DEU A;  3PNT A;  4HA8 A;  1KK2 A;  1LVA A;  2L7M P;  1BR4 A;  1EF4 A;  3Q6Q A;  1X2N A;  4OJO A;  2FXA A;  4FE7 A;  2DFF A;  4BS9 A;  3DDY A;  2X1D A;  1ETQ A;  1YW9 A;  4BAC A;  4BE1 A;  1D1N A;  5C1C A;  3I58 A;  1FZP B;  3VFZ A;  5KK1 A;  3I5U A;  4XID A;  2Q6I A;  1WXR A;  1YHQ I;  4OPS A;  3OIQ A;  2V4J C;  2BBY A;  4DNT B;  2GA1 A;  5DS0 A;  4U88 A;  4XON A;  4L8J A;  1SEU A;  2IS4 A;  2KQR A;  3KP4 A;  1WOO A;  1GQ8 A;  1K6Y A;  2Z3Y A;  1B72 B;  1DDN A;  3TDU C;  1JA1 A;  2VBM A;  1G59 A;  2Z99 A;  2R7X A; 
#chains in the Genus database with same CATH homology
 2IS1 A;  4JMQ A;  1CZF A;  2BSP A;  1KCD A;  2GOM A;  3CJR B;  1HVX A;  4BJT A;  4BDZ A;  3OS0 A;  3VST A;  4NNJ A;  2HZD A;  2W7N A;  4OZY A;  2GJR A;  2K5C A;  1D1B A;  2WSS A;  4QPO A;  2X3H A;  3QOD A;  4C30 A;  3GBG A;  5HVQ C;  1N77 A;  1X19 A;  3K4K A;  3OYH A;  4E7H A;  1V5G A;  2O0V A;  5KNL A;  4XOT A;  4XD7 A;  4ZJZ A;  2LRE A;  2KPM A;  2E5Z A;  5CKT A;  4G7W A;  4OJ6 A;  2M3A A;  3LL7 A;  2L2O A;  2JA2 A;  4HST A;  1WFX A;  1OB0 A;  2R7T A;  4LIV A;  3AL0 C;  1QHG A;  2AQF A;  3B8Y A;  1KZL A;  2QKL B;  2ZZF A;  3NE5 B;  5LFA A;  3DLA A;  2EWE A;  2R4G A;  2X85 A;  3BLY A;  3DKX A;  3JU4 A;  3SZG A;  1D0Y A;  1Y56 A;  3VYU B;  4DIQ A;  3RCO A;  1GLN A;  4QPQ A;  2W6I A;  3EQO A;  2ZZE A;  3EPZ A;  3S3N A;  4KIS A;  3K4L A;  2JJ2 A;  1QHH D;  4HEA 2;  4PSX A;  5FRM A;  4Z03 A;  3SUC A;  2LY2 A;  1D1C A;  3A3B A;  2E5N A;  3OYM A;  2XC7 A;  3FHN A;  3F9K A;  1E3X A;  1IDJ A;  1IRX A;  2OV7 A;  2F5V A;  1NG6 A;  1S9H A;  2W6J A;  3K4M A;  3BCF A;  4DBR A;  3OYE A;  2I8D A;  1IB4 A;  1J09 A;  3SEZ A;  5HNF A;  3LMW A;  3M8J A;  1QU3 A;  3BC8 A;  2DCE A;  1H8E A;  3VSU A;  4D1Q A;  4ANJ A;  1X4P A;  2ZZG A;  3HPH A;  2LOO A;  2CW8 A;  4FET A;  3OS2 A;  2DXI A;  2NT9 A;  2VJJ A;  2LRD A;  4CCM A;  1Z3X A;  5KHD A;  3EQN A;  4U49 A;  4YZ0 A;  4AU7 A;  1D0X A;  1K28 D;  2BOL A;  1WJB A;  2Z1D A;  3OWT A;  1XG2 A;  3LSG A;  3CF2 A;  2X53 S;  4E0F A;  2KRC A;  4XKW A;  2X1C A;  4N4N B;  4BDY A;  1MMG A;  1AIR A;  1VZ0 A;  1X1B A;  3LFU A;  2CFO A;  3E1S A;  1V0F A;  3DTK A;  2NST A;  2VQH A;  3OYD A;  3DPU A;  1LFP A;  4KT6 A;  2VL8 A;  3SYT A;  3PNV A;  1UG0 A;  4BQN A;  1DGR M;  4N4O B;  4BQO A;  1YX5 A;  3VWB A;  4B3G A;  3BCD A;  3KRG A;  3OW7 A;  4PMH A;  1ZEL A;  4PJM A;  3KEW A;  2F4I A;  2X1E A;  2XOK A;  5HLT A;  1O8H A;  1I18 A;  1BR1 A;  1BHE A;  3H35 A;  4NK6 A;  4BXF A;  4XM3 A;  3LNN A;  1DP3 A;  2CV0 A;  2DJI A;  1WJF A;  2WBM A;  2CK3 A;  3OL3 A;  3L2U A;  2VBK A;  1OR7 C;  2W82 A;  4XLH A;  3UR3 C;  1E3Z A;  2ZXH A;  3OYN A;  4FXU A;  3G05 A;  3PJR A;  2R7W A;  2KHM A;  4BJ6 C;  3S3O A;  3FDY A;  1SKY B;  1KCC A;  4IZZ A;  2LZJ A;  2R7V A;  3K4C A;  2D3N A;  4TSF A;  3DTE A;  3GQB A;  4XKC A;  3CES A;  2F6C A;  3A35 A;  1LDK B;  3PL8 A;  2VJ4 A;  4CCO A;  3B4N A;  4G6T B;  1YE9 A;  4UZU A;  1O8M A;  2WB1 A;  4NUB A;  4BU2 A;  1E0E A;  1O8D A;  3DWL E;  2V9K A;  3ZCO A;  2GJP A;  3OL4 A;  2HU9 A;  2O5R A;  1W0J A;  2M4G A;  5CPR B;  4YEJ A;  2VXD A;  2LG4 A;  3UNG C;  2VLA A;  2P0W A;  2VJI A;  3S8P A;  4W8T A;  3HC7 A;  1BPL A;  1QJV A;  4YZA A;  2CMP A;  3A3G A;  2HPI A;  4XLF A;  3OS1 A;  3K70 D;  3GQA A;  1MW7 A;  4XKB A;  1X4O A;  3K70 C;  5FL7 A;  2BW3 A;  2QY1 A;  3LMM A;  3GQ8 A;  2M0M A;  3ZPP A;  2JSP A;  4DBQ A;  1E79 A;  3WWG A;  3HG9 A;  4W8R A;  2WA0 A;  3GVL A;  1IDK A;  1BOB A;  2R9V A;  3OR2 C;  2UWM A;  2CV2 A;  3LSK A;  3VSK A;  3KX2 A;  2W00 A;  4B47 A;  2WAF A;  3FBN B;  2GK7 A;  1OGO X;  3UW0 A;  2L7K A;  3MMY B;  2Z16 A;  4MLO A;  5JHF A;  1MMD A;  4F3Q A;  3L2V A;  4YEL A;  1W36 C;  1PXZ A;  4H4K C;  2KMU A;  4GRI A;  4RLF A;  3ZGK A;  2M7B A;  2IGM A;  3K4J A;  4W8Q A;  3OIP A;  4BUP A;  1KON A;  3PFY A;  3W2A A;  1SAU A;  2NTB A;  3NWS A;  3FKJ A;  4HPQ A;  4BGD A;  3GQ7 A;  2HLD A;  2X8K A;  4XNF A;  1NHC A;  1T95 A;  3OE7 A;  4XN0 A;  3CP8 A;  3SEQ A;  3TL4 X;  4XN3 A;  1BLI A;  2NTQ A;  3JUR A;  1I8D A;  1FMW A;  4IQ4 A;  3T53 B;  4DGW B;  3HAG A;  4DK0 A;  4YZX A;  3PSF A;  3H5R A;  3VSL A;  2X6X A;  4J01 A;  3OEH A;  3FY3 A;  1IA5 A;  2L9N A;  4F55 A;  2Z8G A;  2INU A;  1O8G A;  3D5S C;  1JRG A;  4B48 A;  3DPL C;  1ERD A;  2PYG A;  1EA3 A;  3ZXS A;  2UVF A;  3VYS B;  2VQL A;  2WAD A;  3H5A A;  3WQZ A;  2OC6 A;  2R7R A;  2L9S A;  4HIZ A;  5CQG A;  2NT6 A;  4CZC A;  3OYF A;  4OWR B;  4DK1 A;  3OYK A;  3QYB A;  4HNT A;  2GK6 A;  2QXZ A;  2JVG A;  2WJY A;  2JIZ A;  2KVO A;  3EUK L;  2XZO A;  3J7A Y;  1X1D A;  2IQ7 A;  3H9Q A;  3FBI B;  4F91 B;  2VPL A;  1E1R A;  3SDB A;  4I84 A;  3L2Q A;  1SFK A;  4R79 A;  1RU4 A;  1OLT A;  1V5F A;  2IS2 A;  5CDF A;  5AMV A;  3HL2 A;  2O04 A;  4E7K A;  3OOU A;  1N78 A;  1X0C A;  2MC4 A;  1MMN A;  3ZRG A;  3ZIA A;  2ZTG A;  4MR0 A;  4U4B A;  2UV1 A;  3OY9 A;  3FKS A;  1O8L A;  1WJD A;  2W4S A;  4EAT A;  5HOO A;  2Z6B D;  1VBL A;  4ASU A;  4X0G A;  4E4H A;  4YXW A;  1UEL B;  4HG2 A;  4JQF A;  4ZDO A;  2IGK A;  4DJA A;  3HOT A;  2LY1 A;  1MMA A;  4PJJ A;  2PEC A;  3C2G A;  2HDW A;  2WAE A;  1E43 A;  4Z05 A;  3H0D A;  1KTW A;  3GVK A;  5C1E A;  4Y33 A;  1K5C A;  2HVR A;  4XR6 A;  2LYC A;  3QYE A;  2V6E A;  2HVS A;  4P22 A;  2JVH A;  2Z2S B;  2X51 A;  3ZQQ A;  2KL4 A;  3FPP A;  3VMW A;  3OR1 C;  3ZPN A;  3GQ9 A;  3OFN A;  4D9J A;  2QE7 A;  1UD5 A;  1HG8 A;  1JTA A;  3H9G A;  2VAS A;  4HRI A;  4RLQ A;  2V31 A;  2IGN A;  2MYS A;  3AKZ A;  3VDX A;  2VQG A;  2QX3 A;  2L5Q A;  5LD2 C;  1R6R A;  2MD0 A;  4XMY A;  2JDI A;  1V0E A;  3I9V 2;  2BW3 B;  4KKS A;  4OJP A;  1WJC A;  4II3 A;  4PJL A;  4BQQ A;  1NBM A;  2DIE A;  4KJZ A;  2K3P A;  4AVZ A;  1DQU A;  4FAS D;  4F92 B;  1WPC A;  2VKD A;  2F43 A;  3G2B A;  2KP6 A;  4E7J A;  4URR A;  3TMO A;  3PNY A;  4PFO A;  4TT3 A;  5KCM A;  2VB6 A;  3KEY A;  2M7A A;  4KIT B;  1WTH D;  2WPD A;  3OEE A;  1PE9 A;  2MFZ A;  2Y0S A;  2K9L A;  4NQW B;  4BJ5 C;  2A5W A;  1H80 A;  2XF5 A;  3T9G A;  3W2W A;  3DEE A;  4J00 A;  2XZL A;  3IP4 B;  2Q1Z B;  1N75 A;  3LSH A;  1UD2 A;  3BH4 A;  3N05 A;  2VIX A;  2IXS A;  4XLA A;  3A2K A;  2JJ1 A;  3BCB A;  3HUG B;  3K6G A;  3RPU D;  4XLC A;  4PJN A;  3HKZ A;  1P9Q C;  1Y6I A;  4ZDL A;  2DOA A;  2XF7 A;  4CCN A;  1G8X A;  4KKT A;  1PLU A;  3K4B A;  4DNR B;  3E0J B;  4U87 A;  4BEH B;  4IKF A;  1KMH A;  1UD6 A;  1W36 D;  3HOS A;  2XDV A;  1T0F C;  1TZL A;  1X1A A;  2E1M C;  2ZFU A;  2LBF A;  4ZC3 A;  2PJR B;  2KRH A;  3ONQ A;  3W2V A;  3OYI A;  2CS3 A;  4XL9 A;  2MAB A;  1O8E A;  4W8S A;  4HSR A;  5IK2 A;  4Z06 A;  3H9J A;  3OYG A;  5TGT A;  1WP6 A;  3VR6 A;  1O8F A;  2V7Q A;  2XND A;  3ZSC A;  3BG6 A;  1EE6 A;  2NTP A;  2ZXI A;  2CH0 A;  1BMF A;  1PYV A;  4C2T A;  4XOP A;  1FMV A;  1OOC A;  4OJ5 A;  2XGJ A;  1VJS A;  3OYC A;  4LIT A;  3CZ6 A;  4ZTJ A;  3BG7 A;  2KDO A;  2VXZ A;  4P5O A;  2BVM A;  4G7X A;  4DOZ A;  1LKX A;  2PMZ A;  3QYF A;  4OAY A;  1MNE A;  2GJK A;  1RWR A;  4LIU A;  2LH9 A;  2IS6 A;  2KLO A;  1UD4 A;  4KKU A;  2ELJ A;  2E1M B;  1W0K A;  1D1A A;  1DGW Y;  4HWV A;  2AQE A;  4B44 A;  1NG7 A;  2RNG A;  2XAU A;  3DPT A;  3IAM 2;  2XF6 A;  5FRO A;  4B43 A;  4OAZ A;  2CUZ A;  5FRN A;  1OHH A;  2DT6 A;  1VF7 A;  3RSN A;  3S32 A;  2XZP A;  2WZP P;  1COW A;  2WAQ A;  1DBG A;  2DT7 B;  4NK8 A;  2INV A;  1HZE A;  3PUB A;  3OYJ A;  3VMV A;  3V42 A;  4YZQ A;  3IUO A;  3HXL A;  1PKV A;  3S93 A;  3GVJ A;  2F1M A;  1Z7L A;  2V4D A;  1E1Q A;  3BCA A;  5DN6 A;  2QKM B;  4OJL A;  4C2L A;  2CUJ A;  2WY7 Q;  4P1W A;  4XKV A;  3DKY A;  4RMN A;  3CMM A;  4TKO B;  1O8J A;  1WMR A;  1MND A;  4PSW A;  1QCX A;  2ODL A;  3OAA A;  3ZR8 X;  2Q2E B;  3KYL A;  4CCJ A;  4XQF A;  2O17 A;  1TT0 A;  3PSI A;  4F52 A;  2A6T A;  2WJV A;  3OYL A;  1OGM X;  3L2W A;  2HQA A;  4Y3O A;  3RQ4 A;  4E7L A;  2VKH A;  2NSP A;  4E7Z A;  4CH7 A;  2ZSI B;  1UD8 A;  2ZTN A;  3QOE A;  2KZV A;  5HNH A;  1O8I A;  4Y4R A;  2HPM A;  4ZTF A;  2VJ5 A;  2R7Q A;  1UD3 A;  1WJ5 A;  3CP2 A;  4BEH A;  2VQC A;  3S3M A;  3OYA A;  1D0Z A;  1W9X A;  4ZYA A;  2WY8 Q;  4PK4 A;  3VYR B;  3CJQ B;  4EW9 A;  4PUS A;  3DQV C;  4BE0 A;  2FUG 2;  2ZSH B;  3RTR A;  4CA0 A;  4ITV A;  4NC7 A;  5CQE A;  3L2R A;  1UAA A;  2D3L A;  3LSM A;  2OUM A;  4G6I A;  1NRK A;  1O8K A;  1X1C A;  2NOJ B;  4HNU A;  4IX7 A;  1YX3 A;  4IQJ A;  2K9M A;  2UUZ A;  3AFH A;  3A1Y A;  4U7B A;  1U0J A;  2HVQ A;  2LC2 A;  3HPG A;  4RM3 A;  3OPO A;  2UVE A;  2M5S A;  2R7U A;  3DU6 A;  2V26 A;  4LG3 A;  3H94 A;  1DBO A;  2V1N A;  4RM2 A;  3DU5 A;  2W1O A;  3MKY B;  4JOM A;  2R7S A;  4OZZ A;  3U21 A;  1BN8 A;  3EUH C;  1MAB A;  2HNH A;  4C9Y A;  1JI8 A;  1T5E A;  1VLY A;  2O1D A;  4C2U A;  1Z21 A;  1WJA A;  3BC9 A;  1Z3Y A;  3I3L A;  4XLE A;  2O0W A;  4PFP A;  3OMY A;  3D5L A;  4Z1M A;  3B90 A;  2NZM A;  4E7I A;  3TBI A;  2JUG A;  3OYB A;  1WJE A;  2CW7 A;  2RRE A;  2LBF B;  2PJR A;  3T51 B;  4GQN A;  3W3C A;  3LSI A;  3NWT A;  2RQQ A;  3K10 A;  4CCK A;  3AL0 B;  1PJR A;  4YRV A;  1V5E A;  1LVK A;  2XSJ C;  4CCL A;  3MKZ A;  4BE2 A;  4ZDP A;  1EFR A;  1RMG A;  2ZZQ A;  2BVL A;  2IGO A;  4NC8 A;  3OOC A;  2GOX B;  3T56 B;  3VYT B;  4BL0 B;  4F93 B;  1H8H A;  3VSV A;  1HA8 A;  1FX0 A;  2E60 A;  3PNT A;  4B3F X;  2M4K A;  4MXN A;  1BR4 A;  1BR2 A;  3H5N A;  3IAS 2;  3C2H A;  3D5R C;  4CSW A;  4OJO A;  4BS9 A;  3DDY A;  2R7O A;  3GRH A;  2V7F A;  2X1D A;  1AA7 A;  3DTI A;  4CUG A;  3A4C A;  4AYB A;  4BAC A;  3EUA A;  3MKW B;  4BE1 A;  2VBE A;  3K4N A;  5C1C A;  2E1B A;  4B3X A;  3OIQ A;  2V4J C;  2X6Y A;  4DNT B;  1OFM A;  5HKK A;  2PYH A;  4XON A;  4E6K G;  2X6W A;  2IS4 A;  4L8J A;  4E7S A;  2KQR A;  2CV1 A;  1GQ8 A;  4II2 A;  1K6Y A;  1OFL A;  1O88 A;  3M1C A;  2VBM A;  4XOR A;  1G59 A;  3MD2 A;  2R7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...