4XOTA

Tailspike protein mutant e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xotA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xotA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xotA02
4XOTA 1O8MA 1O8LA 2X6WA 1OGMX 2NTPA 2O0VA 2PYGA 4YZXA 4Z03A 2VBMA 1OGOX 2NT9A 4Z06A 2QXZA 2EWEA 1KCCA 4XLEA 4XQFA 1O8IA 1DBOA 4XLAA 2X6XA 3JURA 4XN0A 2UVEA 4XN3A 4MXNA 4W8TA 1IB4A 1QJVA 4XKWA 1O8JA 1RU4A 3EQNA 1PE9A 1X0CA 2QY1A 3ZPPA 1WMRA 3B8YA 3VSUA 3GQ8A 2NSPA 2X3HA 3EQOA 1OFLA 3LMWA 4EW9A 3WWGA 4YZQA 1VBLA 4YEJA 1DBGA 4YZAA 3GQ7A 3VMVA 3SUCA 2IQ7A 1O8FA 1HG8A 2UVFA 5C1EA 1JRGA 2ODLA 2O1DA 4OJLA 4OJ5A 2NSTA 2INUA 2NTBA 1O8HA 2NZMA 3GRHA 3GQ9A 4U49A 1OOCA 2BSPA 3VSTA 4XONA 1O8DA 2NT6A 4MR0A 4XLFA 1O8EA 1PXZA 1CZFA 4XLHA 2PYHA 4W8QA 2O0WA 4NK6A 3GQAA 1PLUA 4W8RA 2O04A 4XL9A 2PECA 3KRGA 1BHEA 4XNFA 4URRA 2O17A 1NHCA 3VSVA 2X6YA 1KTWA 4OJ6A 2NTQA 1QCXA 2VJJA 4XLCA 4HWVA 4XM3A 1BN8A 1KCDA 3VMWA 2VJIA 4OJOA 1XG2A 4YELA 1O8KA 4OZYA 4XORA 4C2LA 1K5CA 3T9GA 5AMVA 3B90A 1AIRA 3B4NA 4NK8A 2Z8GA 4OJPA 4PMHA 3ZSCA 5C1CA 1H80A 4I84A 2VBEA 4YZ0A 1O88A 4XMYA 4U4BA 1RMGA 1EE6A 2QX3A 4OZZA 1IA5A 3FY3A 1OFMA 4XR6A 4Z05A 2X85A 1IDKA 2INVA 2VBKA 1IDJA 1JTAA 4W8SA 1RWRA 3UW0A 4XOPA 4AVZA 4XKVA 1O8GA 1GQ8A
chains in the Genus database with same CATH superfamily
2BYVE 1OMIA 4QWQA 3TO6A 4CYDA 1O8MA 1K8AD 5B1BH 2FEZA 1Y8QB 3LSKA 3GQBA 5D8KB 1SD7A 1O3TA 3KP2A 3QYFA 3AVVA 1KCCA 4J01A 1QFZA 1ZM2A 1XE1A 4XQFA 2HVQA 2DETA 4DQLA 4B4CA 1YO5C 4BDZA 4MYUA 2R7TA 4X7EA 4EGYA 3V4GA 3P5JA 2BF4A 2TDXA 1F43A 1Z6RA 3CPWB 3OYNA 2ESNA 3I5UA 4QHYA 2M87A 3Q6QA 2L9VA 1WSVA 4BACA 1I6XA 4XRFA 2WY8Q 2V4DA 4CYCA 1IXCA 2P5LC 3JRCA 3MEXA 1K78A 2WA0A 1BM9A 4EW9A 4F93B 4OPWA 5DCFA 1BI2A 3IC7A 2CUEA 3LQRA 3WBJA 3DU6A 1I1GA 2P5VA 1CQXA 1HG8A 5IYPA 2JZYA 3FXQA 3PM1A 2M4KA 2ODLA 1V54H 1ZAOA 5F1RA 1UD8A 2NZMA 1BJAA 2L4MA 1W5SA 1VI0A 2QZAA 2O8XA 4BDYA 5EEAA 4BJ6C 1N06A 2RQQA 2XSJC 2NT6A 4MR0A 3K4KA 3HOVJ 4TMZA 4XLHA 3GTLJ 4R79A 1BIAA 3LA2A 5L3DA 1IN4A 3ASRA 4PJLA 5D5XB 4XL9A 4A0YA 4TMWA 4HBLA 2ZBUA 3IKVA 4P6YA 2Q2EA 1PVEA 3GYHX 2C6YA 5C4JJ 2VFQA 4ESJA 2NS0A 2A5YB 1FEXA 2GREA 2VYQA 2V7QA 5J8FA 4RS8A 3OYKA 4MYTA 4Y3OA 1EH8A 3K1MA 1T2KA 1DDNA 1JT0A 4ZDOA 1KTWA 1QA3A 3PL8A 3RTRA 4RA2A 3OS0A 2BGCA 1NG6A 3R61A 4A3JJ 1E62A 1KQ0A 2E1MB 3P9IA 5L3BA 4PC6A 1T39A 4HWVA 2E60A 1FY7A 2ME6A 1ETVA 1KCDA 2YUSA 3PSFA 3ZRGA 2R92J 1KA8A 1IO2A 1RKWA 4IPAA 3V7SA 3ZIAA 1Z3YA 4KICA 2Z9OA 1ON1A 2B7BA 2PIAA 3CCLI 4Q7JB 4BXXJ 4L5EA 1GUUA 2LFBA 3MKWB 1X2NA 2VBEA 4HX4A 2D45A 3FZVA 3C2GA 3M1EA 4O3MA 2BGJA 4Z4YA 5ED4A 2W1OA 3OAAA 1V55H 2P6TA 1P9QC 3MMYB 1V4RA 1SD5A 4U88A 3MAJA 4DW6A 2RDPA 2X1EA 2KHMA 3G05A 3AGQA 4Z05A 3KP7A 3M7GA 4AC0A 4F52A 2Q6OA 1IDKA 3CC7I 2E5ZA 2HYGD 4JX6A 1TNTA 2CK3A 5HS9A 4E70A 3CP8A 4MFEA 4F91B 1R4NB 4S04A 3E0JB 3TL4X 3OE7A 1F9NA 4YZXA 3ZGKA 4M3DA 1OR7C 2RC6A 4Z06A 2H94A 2VE9A 4IO9F 2OK8A 2QQAA 2V7FA 3SEZA 2XAQA 1KZLA 1H0MA 4Q4ZF 2DA4A 1DBOA 2CW0F 5B1AH 1HBXG 2JJ7A 4HIZA 5LRRA 3OYJA 4P3IA 1T95A 1XGNA 4W8TA 2F2EA 1BR2A 1D8JA 2PFBA 4MQVA 2VQHA 1VF9A 3LA3A 3HSRA 4XKCA 2FOWA 3BTJA 3R0AA 2L02A 4CO8A 1SFUA 2WPDA 3CF2A 2ZBVA 3F72A 3VMFA 4IHSA 3SKBA 1J2XA 3TEDA 2KJCA 4YEJA 3KYLA 5K7ZA 2YS9A 4YFOA 1MBEA 1O3QA 3A3BA 2CG4A 4MNUA 3VMVA 3Q6RA 3OL4A 5J35A 4Y52J 5FO0A 5C44J 2NVXJ 5FLXK 2Z2SB 2UV1A 1QBJA 4A5NA 5JBQA 4OJ5A 1W1WE 2GA1A 4Q48A 4AF6A 4Z4WA 2JRTA 2ZSHB 2V7WA 1G6NA 3E5QA 1FBSA 1OOCA 3CMYA 4BAYA 2A6HF 2R7QA 5LEKA 5JHUA 1BA5A 4A3LJ 1S0UA 1H9GA 1MMGA 4E0FA 2BW3B 5GAHJ 4RGSA 2H6BA 4D5CA 4E7SA 1NG7A 1OYYA 5IYRA 4HEA2 3AG1H 1Z7UA 4OMZA 2CRVA 3K2ZA 3GQAA 2OZUA 1K78B 1MH4A 2VKHA 4Y9UA 5FL7A 1LDJA 3K6GA 4LD5A 3RQIA 2PECA 2DYSH 3K10A 3OOUA 1MKMA 4BGDA 3LMMA 2XAFA 3BQJA 2NVQJ 2JMWA 1Z3XA 3ASNH 4Y17A 3KCCA 3CC4B 3S16J 3A8KA 3AVXA 1IN5A 3BY6A 1FNBA 3U6KA 3HEFA 2L2OA 4B1RA 5GTIC 2CWEA 5IP6A 4LFUA 2NTQA 4RM2A 4A93J 5CLSA 4EJOA 3KP6A 1WHUA 2FVGA 2FNPA 1FX7A 2QYOA 2XF7A 4I7HA 4P1WA 1O4XA 1IC8A 2DMTA 5EF6A 5CYVA 1UD5A 1T98A 4P22A 3GTKJ 1E1QA 1R4MB 3GMEA 4M72A 2JRMA 3WG7H 2O3FA 2HVSA 4P12A 3CUQC 2CU7A 5HOOA 2V1DA 2UXXA 3OJXA 3WYAA 2F5VA 4X0GA 3G3ZA 4G7HF 4GGGA 2Q6KA 2A07F 2QGGA 2F5CA 3BTCA 4Y7NJ 3PUMA 4MEXF 2ZMEA 2MBFA 3CXCB 2ZMEB 2DY1A 4W1UA 4FASD 2K9SA 4BY7J 4P9SA 4M3GA 2VE8A 2R7ZJ 2XAHA 3SJPA 4HW0A 3OOCA 4YC5A 5LMZA 2EBIA 1M1KD 2GJKA 3QFCA 4W8SA 3E97A 3WTYC 4ZCLA 1UAAA 2YU3A 1QGYA 3GVJA 2COBA 3L9FA 2X6WA 2NTPA 2L7FP 4A6DA 1GVHA 3K4MA 3HOTA 3GWZA 3K4CA 4G7OF 1EF4A 1D8KA 3TW6A 3HTUA 2WB1N 1NK3P 4J0QA 2IPQX 2VBXA 1JKRC 1ZQ3P 4HA8A 5E6TA 3ZZUA 4NUBA 5E17F 3CC7B 1GXQA 3ASQA 3CCUB 4LIVA 1I3AA 2CC2A 3L1PA 3ONQA 1YW7A 3EUKL 4XN0A 1UJ8A 1Z05A 1SFXA 4GCVA 2LZJA 3ASPA 5KAIC 3KETA 5TRDA 2DCUA 2HOEA 2DFIA 2PMHA 1ZR4A 2F4MB 1S4MA 1BW6A 1A5JA 1CNEA 2VBTA 5DSZA 3EQNA 2WWYA 3PIPF 2Z1DA 4RPBA 3ZC3A 1W7PD 1QUFA 2CS3A 4P5OA 1ETKA 2EH3A 2K3PA 3HL2A 2LF8A 5J8CA 1LDDA 4QTRA 3D26A 5F0FA 3GCMA 2Y75A 2COMA 1T6ZA 4OPSA 4FT8A 2LH9A 2HDDA 1LVAA 2UWMA 3H9NA 2IVMA 4LBVA 4HG2A 4CH7A 5HLHA 4Z4ZA 4DK1A 4FETA 1K28D 3V76A 3L09A 1R6RA 4YIIA 4HF1A 4YHBA 1SVMA 4GYGA 2VXZA 3Q0WA 1PDNC 2RQPA 5EG0B 3RKWA 2W7ZA 5JR3A 3SQVA 2GPJA 5IOZA 1HCRA 1JHFA 4OMYA 2WBMA 1O8EA 4P26A 1S3JA 2NXNB 3TOBA 1WDTA 2C5BA 2OUMA 2DFHA 1N8RD 1SM4A 2ZXWH 2P4WA 3B73A 2DJIA 4A3FJ 3QRFF 1UFMA 1YFHA 1QGZA 4DNRB 3H0GJ 2R4GA 1K83J 3VODA 2K9QA 2B7CA 1B6AA 1VQOB 3RKQA 4OINF 2K02A 3BZ6A 3HHGA 4K2EA 4KN7X 4XNFA 5LEJA 2GXBA 4RDLA 3OKXA 5FKKA 5ICGA 3U6BA 2X1CA 2BN4A 2O9LA 4E7ZA 4XSZF 1BQEA 2X6YA 1GVDA 1USTA 3GXOA 3IH3A 3BCFA 1FYKA 2OBPA 1Q86D 1D1AA 3OYIA 1YX5A 1WOPA 3CCMB 2C4TA 4L0YB 3J7YJ 4LIUA 4P6VF 4A12A 2P8TA 3JSOA 5FRMA 3KP5A 3SFZA 1I7PA 1V3FA 2QN6A 2F5EA 3SFIA 4CCNA 2HEOA 1VQPB 1EV7A 3IHUA 3G2BA 4M3FA 4PMHA 2MA3A 4MLOA 2XF5A 1ZH5A 3REOA 4YZ0A 4E7LA 2GK7A 5KSWB 1LFPA 4YEIA 1X3UA 1OLTA 5J1RA 1ERDA 3EQLF 2X3UA 1OKRA 4BJTA 1IDYA 2O5RA 4RCYA 3W3CA 3CMAI 4N3NA 5CVUA 1WH7A 1R1UA 4LBWA 3ELKA 2JPBA 4BE1A 3CD6B 1G7TA 1UZCA 5A2QZ 3H0DA 1TWAJ 3RZOJ 3K2AA 3ZMVA 2A5WA 2VXDA 5K5QA 3NE5B 2OTJB 3LFKA 3GZ5A 2O0VA 2VN2A 4B4DA 2W48A 2EA2A 5JVGF 2F3LA 3PETA 1F36A 3CP2A 3R60A 5EZHA 2LMDA 3OYAA 2GLOA 2CO5A 3LJYA 2L54A 3A0HC 5FLMJ 1FYLA 1VQ4I 1O8IA 2VC0A 4KUMA 1VLYA 5IYNA 3CPXA 3GTOJ 2CF4A 1K8FA 5M5XJ 3N90A 4IXAA 4IW3B 4LLLA 4HE6A 1TNSA 3FM3A 4UVAA 4CCMA 1R5OA 3OEEA 3CCSI 3F8FA 4BQQA 3CD6I 3E1SA 5JFRA 1BR1A 3TBIA 1MZBA 1IDZA 2X6OA 3HAGA 4DNTB 4I98B 2X8KA 2RGVA 4R8HA 4JP0A 4KDPA 1ZUNB 2JUGA 4FN5A 5CVRA 3WWGA 1YS7A 3KZIC 1CF7A 3I9V2 2HYJA 4LMYA 2O03A 3GEZA 2A69F 2X53S 2IQ7A 1JUPA 5B5EC 2JA7J 1PJ7A 5CVIA 2EFQA 2IBDA 4AIDA 3JX8A 1XTAA 1ZG5A 3BROA 4TSFA 4DIQA 2DA1A 2WAQA 2M2EA 1UHWA 3F8BA 3LSMA 4N0BA 1SAUA 1S7EA 1Y1VJ 3U2RA 3JRAA 5J1YA 1PP7U 4N9HA 2YR2A 2LKPA 2G9WA 4RAYA 1ETWA 4I02A 1WXRA 3HRSA 3JTHA 1B72B 2H6CA 3SHFA 5KCMA 1QRBA 1PLUA 3LQ6A 5HLTA 5BPDA 4YAFA 2YUHA 1W7PA 3E7LA 2BVMA 1XN7A 4X7CA 2VBZA 4ZCMA 1IRGA 4EV0A 1P4WA 1Z7LA 3GUDA 2XSDC 5IK2A 2JSCA 3G1OA 1SD4A 1MMNA 4ENKA 1VQ9I 4M2LA 1YIOA 2FBKA 4JX4A 2MYSA 2BY3A 4MQ9F 3G73A 1W4MA 4X7FA 2DOEA 1ETQA 2GOMA 2DTRA 4WXDA 2IW5A 3M9AA 3W2HA 2OTLB 1OCTC 1FWZA 1SKQA 4XLCA 3JTGA 2XTWA 2MSYA 2QQ9A 2STTA 1XSXA 3DBRB 1N08A 3SZTA 2WYRA 2DQLA 1I8DA 1W87A 1WCMJ 4AC9A 2RV8A 1T56A 3I58A 3CJNA 2E71A 1KQ9A 4IHVA 1D5VA 1FTTA 2XOKA 2BX6A 4A0ZA 3P7NA 2DI3A 2DN0A 2OTJI 3O6BB 1UMQA 5BNGA 4BXUA 3QODA 2Q0OA 4BY1J 1G3WA 3AVYA 1LE8B 5J6XA 2PJRB 2ZXJA 3CTAA 2DQRA 1RUOA 4XMYA 5L3CA 1SMTA 3JSPA 3KEQA 3CQZJ 1ZGJA 3S3MA 2ZL6A 3GTGJ 3JR9A 1Z67A 4I09A 2DJNA 2M34A 2R3SA 2GJRA 1X1DA 2V7UA 3IUOA 4U0VA 5C4XJ 1B1BA 3G1LA 4V19K 1VNDA 1WRJA 3MKLA 1QG0A 1BJKA 3H35A 4XKVA 4MHGA 2QQ8A 2IGMA 2DOGA 5GV7A 1WPKA 2HU9A 1W7PB 3DPUA 4WX9A 1O3SA 3E6DA 4C3JJ 2BGIA 1J09A 2OCEA 3QSYA 2PI0A 3BC8A 2LVSA 4EGZA 2E34A 3P26A 4BBSJ 4QFMA 4D7MA 3RKXA 1HOMA 4WZTA 1R7JA 2VJ5A 4PFOA 5BMZA 1QZZA 1VF7A 4YIFA 1U9NA 3UR3C 1JKQC 3J7AY 3K4NA 5L46A 3QAHA 1JNYA 2MH2A 2EZHA 2KRCA 2EZKA 4I76A 2QF7A 4LG3A 3WHBA 4BH9A 4P9FA 1X4PA 2OYNA 4BNCA 3BG3A 4XRMA 2IEKA 4B8XA 2LY1A 3BJ6A 1QPIA 3FXOA 3OOPA 3V8JA 2PJPA 3A8IA 2JK3A 3BH7B 2X0LA 2OF7A 4RGUA 3W6KB 2P7VB 3RDIA 4A3DJ 1UD6A 3BH4A 4YAUA 3VNVA 1X19A 3MKZA 4CZZA 4WQMA 3RCOA 4I99C 4IVNA 2MD0A 3CCQB 2VIXA 1PP8F 1W34A 3MD2A 1ODDA 1OR7A 3B82A 1S6LA 3ZQQA 2ZL5A 2ISZA 1VQ5B 5C1EA 5CVJA 4A0XA 3LQEA 1LLWA 2QYUA 2OCCH 2NSTA 3G4SB 1PUFA 5DM7F 1PUFB 3WY9A 1YJNI 1JE8A 1XCVA 4Z4SA 3L2UA 4U7BA 1ZRDA 3QWLA 2B5OA 4W8QA 1HSJA 2L7MP 2PMZA 2EIXA 4CDGA 3T56B 2QLZA 3GFMA 1QA6A 1ITYA 3ZQIA 3LVBA 2A05A 2HI3A 2LF7A 2ZXIA 1LE8A 3GZNB 4Y33A 3C1DA 3QFTA 3DDYA 3BPXA 3CDHA 1YHQI 3JQPA 4IHWA 1WPCA 4TMVA 3I3LA 3T51B 1T38A 3L2QA 2XNDA 1MDMB 3PQJA 1J7KA 1IHMA 3CCJB 3I64A 1FOWA 2LYCA 1KU9A 1E1RA 1FNNA 4M74A 3RI4A 2ZC2A 1JA0A 2XZPA 3L7WA 2DAOA 4G6DA 4PJ0C 2HCJB 3FM5A 3S3OA 4IHTA 1RESA 2HZDA 2KLOA 2XVCA 2V1XA 2V1NA 4FE4A 1P7JA 5H6QA 4FISA 3L2VA 1G2HA 3K1PA 1IAWA 5C3EJ 5DTDA 1OFCX 3HG9A 3EUAA 3J80Z 3S1RJ 3Q0VA 3A2KA 1I18A 1B8IB 5A88A 3MVPA 4HF0A 2F4IA 5FO5A 3OYDA 1GJRA 1D1NA 2E2IJ 1I6HJ 3FMRA 1TTTA 4AWXB 3PJRA 4U4BA 3LAJA 1KRHA 3X2QH 1E3OC 2LK2A 4QSHA 1RR7A 1SC7A 2DIEA 1JTXA 3Q39A 1B23P 2MLKA 2OK7A 3S8PA 1T0FC 2VBVA 1TWFJ 1FP2A 1RWRA 4XOPA 3OPOA 1B9NA 2QCOA 1F4KA 3PA1A 3FXLA 2EFNA 3ZQHA 4YIRX 1QVFB 3NRVA 1NBMA 1BOBA 1ZN2A 2BOLA 2MW8A 3M8FA 1FZPB 4Q5SF 2OBRA 1K4ZA 3QYEA 4TN1A 3BTIA 2R7WA 3VEPA 4E7JA 2M3AA 1MH3A 4OIOF 2QTZA 2HR3A 3R6SA 1VQ8I 1VQ7B 3I54A 1ETXA 2VBYA 1V0FA 4F92B 2K5CA 4ENJA 4XKBA 4DZPA 2MH9A 3CCEB 2LG4A 3AKZA 2I1LA 5CVVA 3HBLA 2AQEA 4IZZA 1O8JA 3E20A 4KIFA 1PE9A 2QY1A 4X06A 3LYCA 1YJ9B 3BJAA 5J3OA 3ERMA 3KIOA 1VLOA 3VSUA 4PC1A 2NSPA 2X3HA 2EPFA 3OSGA 3EQOA 1FOXA 3RYPA 4D0PA 3FDYA 2V5IA 2CMPA 5DS9A 2FBHA 5DCMA 2Y30A 1R5ID 3SQNA 1T6YA 3HIFA 3PSSA 1LEAA 2O61A 4KIBA 3BG9A 3T8TA 5FLVA 3QFRA 4BHBA 1SEUA 1H8HA 4OJLA 3GBGA 1OB2A 3EPZA 1BIBA 2PMDA 1O8HA 3UKGA 2QGUA 5D6EA 5E3NA 3GRHA 3B6AA 4Q47A 4GFBA 5IYCJ 2HDCA 1MMDA 2BSPA 2NVYJ 1YYVA 3ERED 2L01A 1TWGJ 1ZARA 4O5VA 3FXUA 1XCBA 4KYWA 3HSEA 3HSFA 2O7OA 5EEGA 3OIQA 2BY2A 2DDBA 4G7WA 2H27A 2VT2A 2DA7A 5E3LA 1IW7F 4AVPA 1RQRA 3R4KA 3QPTA 2DK8A 3LQQA 2E2HJ 2E36A 1WOSA 1RUNA 1Q81D 5HVQC 3OR2C 4I0AA 1FSEA 4BBRJ 5M5WJ 2FMYA 3HJEA 3VO1A 3AK5A 2VKEA 3K9TA 1VJSA 2W82A 4KKTA 3R0JA 2XRLA 4RMNA 4DBQA 4G8XA 2ZKZA 1QCXA 3OIPA 1SD6A 4HZFA 4X1EA 2EWNA 4CA0A 3ZQ7A 1ACIA 2PMUA 4XM3A 2P81A 2F5DA 3WTWC 3BY1A 5KHDA 3PNYA 2EFGA 1R1VA 3JAMK 1A8PA 1IRXA 4IL6C 4UZFA 2QUFA 4UY8I 5CPRB 2RAEA 3A01A 4L5IA 1B2RA 2NS8A 3HB9A 1WJBA 1E3ZA 2JDIA 2LREA 5A2QK 1N05A 2Z8GA 1OISA 1BL0A 1H42A 2O6GE 2FQ4A 1XC5A 3ZMDA 2HDNB 1VQ4B 1YIJB 4Z4TA 1O88A 4TT3A 2WSSA 1GVJA 3CB4A 1V0EA 3BG7A 5E3MA 3ONYA 2VFMA 3RPUD 4QUZA 3ABLH 2QX3A 1KONA 2XDVA 3Q38A 1TWHJ 1QVGB 5KW9A 1A35A 3GF2A 4IQJA 2ZNZA 3KFWX 4CXFA 1KMHA 1USSA 1MNEA 4Z4UA 2VFOA 1AA7A 3RQ4A 1EWYA 3GZ6A 2ZBKA 4PGOA 3JRBA 3ISXA 4P96A 1ZG1A 3VFZA 3FXMA 2ICWG 4KA4A 4Z4VA 3TH0A 3F3XA 3WE2A 2QZ8A 3PNTA 4UUSA 4RLQA 1DU0A 3HOZJ 1OB5A 1Y0NA 1IJFA 4N4OB 1PUEE 2VFPA 2YX7A 1AMOA 2VASA 1K79A 2E1NA 1IRFA 3JW4A 1TYXA 1MMAA 1WI9A 1YJNB 1C0WA 4M6VA 4RB3C 2JVGA 4LB5A 3Q9SA 3FPKA 1XD7A 2OAZA 1SMYF 2LBFA 3C18A 3G6EB 4XN3A 5HDNA 1Y56A 4ZGQB 4BL0B 3RY8A 5FFZA 1ON2A 1E43A 2DMNA 3J80K 1V5VA 2RREA 2E35A 1U78A 3M8EA 2OQRA 2CV1A 2CQ7A 2DDAA 3B8YA 4PJNA 5GPAA 2XHKA 4I6ZA 5BS6A 1F60A 3ZBTA 2A3SA 2BM5A 4Y7CA 2HPIA 1IJWC 1EA0A 2G7HA 3H9GA 4Y15A 2QVOA 1PJRA 2ZJPF 3J7ZI 1TYWA 1A6QA 2M4GA 4E6KG 1FT9A 3ISPA 1KGSA 5DS0A 4GRIA 2DEUA 3PSZA 5DD8A 2VT3A 5HLIA 2YWGA 5FKLA 1KK2A 4YZAA 2TRTA 4JQFA 1XB4A 2FA5A 2QEXI 3IH4A 1TWCJ 3I1FA 1FMVA 1KZHA 3COAC 5ICEA 1JRGA 1WU8A 1ZM9A 3CJQB 2O1DA 1VQNB 2E7XA 1HA8A 2W6IA 2C5HA 2FD5A 1W36D 1COWA 2LRDA 2L5QA 2PN6A 3K70D 4EQQA 1O8DA 1OHHA 5B66C 5JHFA 4LB6B 1PXZA 2A61A 2NV4A 1I50J 3FXRA 5B6IA 1FNMA 2XGCA 5KK1A 2LC2A 1TW3A 1L0OC 3ZMTA 2CW7A 1R9TJ 1OCPA 4YG2F 2GZWA 3NARA 3P9CA 3RKYA 3ZPLA 2HLDA 1Y6IA 3KRGA 3HOWJ 4ESBA 2ZJRF 2ZSIB 2PJRA 2VJ4A 3LSPA 4V2FA 3CW2A 1BHEA 4FCYA 4ASUA 1W35A 4PGHA 1PJ5A 1IZ1A 1NHCA 2Q6IA 2KISA 2XPVA 3QE2A 4YXWA 2DXIA 4ZCIA 1DPRA 3I55I 4HLYA 3A03A 1T0FA 4Y9RA 3BZCA 2EV5A 1UHSA 3DKXA 4OJOA 4EM2A 3P9KA 1OFEA 3WU0A 2G7UA 4OP7A 3FWEA 1IG7A 2M0MA 2IXSA 2XPWA 3BQZA 5E1WA 1APLC 2HOSA 1UB9A 1F20A 5BPIA 3LSTA 2VBUA 4H4KC 2FX0A 5FKMA 3TDUC 4OJPA 5DD4A 3ZCOA 1H80A 1JJ8C 3CUOA 2BVNA 3GSIA 4FWTA 1JHHA 3O8GA 1DG1G 2BHZA 1HQCA 2GOXB 1OCOH 5E8IA 1TP4A 1TT5B 3O3KA 4D1QA 1EE6A 4AF7A 1GXPA 2XEXA 4C9YA 4E4HA 2R5YB 4GYIA 5BQTA 5EGOA 1XPXA 4BYYA 1WJAA 3LAPA 3ZP5A 4A3BJ 1U3EM 1S72B 4LJZF 1OQYA 2XB5A 5E3OA 5EDNA 5E1ZB 3SYTA 1HF2A 3J81Z 1IDJA 3W5VA 4AVZA 4OPOA 4MEYF 4RDKA 4QVJA 3G71I 4XOTA 5FKNA 4IHYA 2W57A 3S1NJ 1OGMX 4GXOA 1G3YA 2JT1A 2L9NA 2CJJA 2B0LA 2XKPA 3BJOA 3K1NA 3OIOA 4CHUA 2YWHA 3W2EA 2ZB9A 2FF4A 5DUKA 1MIJA 1SVOA 2IT0A 2R6HA 1YITB 2DMQA 5BOXA 1AHDP 3QOPA 1R22A 3E6MA 3HRTA 4HSRA 1EKEA 3J81K 3FBNB 2CUFA 1U9OA 1D0ZA 2UVEA 2HQRA 3BG5A 3LNQA 3Q3AA 5IP7J 3JQQA 1E2XA 3BR5A 1UD3A 1QJVA 1T33A 1W0UA 3DEEA 2BVLA 3MQ0A 4XKWA 4ENMA 3K69A 2V7TA 3ECHA 2VKVA 2LSOA 3E5XA 4Z1MA 4C43A 1TUIA 3GQ8A 3FKJA 3CCQI 2W00A 3N97A 3T53B 3B78A 3ABMH 3WBKA 1UHMA 1OFLA 2D3NA 1MBKA 1QA2A 4XSXF 1ZRCA 2LKSA 3KX2A 1FOYA 2XPUA 2V6EA 1ENHA 4IJAA 1WJCA 2D5VA 4IKFA 4WWVA 2Y2ZA 5ICCA 3HGGA 1YITI 3ZQGA 1VQLB 2DPDA 4DQ2A 1Z91A 2Q6LA 4PCQA 3SZEA 4OOXA 4P2NA 1TW2A 3S15J 3BWGA 4QV2A 2Y48A 1OYIA 2NRAC 3PO3J 4JYKA 5H2FC 1Y1WJ 2HVRA 2BM6A 5F27A 4OWRB 4P25A 3IP4B 2BBYA 2HPMA 2OD5A 3SDBA 5FD5A 2VZLA 3DTEA 3IV5A 1KYWA 3PIOF 2K3FA 1RZ4A 4ON0A 1ZREA 2DYIA 2V31A 4KKSA 4NK6A 1YJWI 3SEQA 1DABA 2IGNA 1BC8C 1QUEA 3K4LA 3ML6A 4YRVA 1E3PA 5H59A 3D0SA 4CSWA 3I4PA 1WSRA 2XTXA 1Q1HA 4DZJA 3DU5A 3KYCB 3ZBUA 5F1JA 3MKYB 4EEFG 3TW7A 4XRSA 3CO7C 3S14J 3B02A 4M73A 2UZKA 3JRDA 3LA7A 2V1UA 1XX5A 3WTSC 2R5YA 3FMQA 4L0ZB 3UNGC 1FNDA 2PLFA 3LWFA 2CUZA 4KNYA 2DERA 2AXTC 1QZYA 1ETOA 4QPQA 3S1QJ 4L5JA 4RJLA 4F3QA 4NDLA 4HE5A 2FE3A 3G71B 3CCUI 2GA2A 1TL8A 4AYBA 1S9HA 2CNDA 5J4YA 2G0EA 2MGQA 3E3VA 1QHHD 1ZELA 3VWBA 2K40A 1SFOJ 5FJ8J 1QA1A 2DTZA 2EA4A 1LM1A 1KQ5A 3W5HA 3MWMA 2W84A 3HM5A 3HRMA 2AHQA 4Y13A 4WZLA 2J8KA 3UW0A 3NWTA 3RZDJ 1BPLA 1EFUA 4C2UA 2OBTA 1FRNA 1QVUA 2FRHA 4R71A 5CQEA 3S2HJ 2DT6A 1QGAA 4M53A 3GX4X 5TISC 4NC8A 2M5SA 2ZZFA 2MC4A 3W2WA 4B3AA 2K27A 2LY2A 2ZZQA 5BSXA 3BR0A 3LL7A 3VYSB 1CGPA 2FMLA 4Y4RA 4ACAA 4YALA 1Z77A 5F6FA 1FOKA 2JJ1A 4HPQA 1J59A 3SLNA 4G7XA 4CCKA 3CCVB 3KYDB 3BCDA 3FHNA 4B3GA 4TKOB 4EVIA 1ZGWA 4ZYAA 1S7OA 2PBIA 3H3UA 4U7DA 2MLGA 3TDZC 2X1DA 2HTJA 1X3ZB 4IHXA 1GAWA 3BY2A 4LLGF 3KL9A 5EJCA 4ETSA 1G7CA 4CYCB 4S05A 3LMWA 1R5HA 1DDIA 1OJLA 5BSYA 2AHOA 5H20A 2CH0A 1EP1B 1NRKA 2M30A 3OYLA 4ZH4F 5M3FJ 1MRZA 1R36A 1RR8C 3ABUA 3QOEA 3WNBA 2UVFA 4EJTA 1D2EA 4PAAA 3QPSA 3ZOBA 1YW9A 4AUXA 3IL2A 2V9KA 2BV3A 5EYRA 3QU6A 1A6IA 4U0WA 4NBQA 3ZN0A 1HDDC 1G3SA 1N25A 2GK6A 5FO1A 5TR9A 2HYFA 3HRUA 2HZTA 3S32A 4YFXF 3K4JA 4PGGA 5GPCA 2LD5A 1CZFA 2EINH 3RSNA 4B47A 3DPLC 2IP2A 3DU1X 2ID3A 4G94A 2KIMA 4A3KJ 4ESFA 2JPCA 3ROUA 4ABZA 4L8JA 3LSJA 5B3SH 1Z21A 2DCEA 2KDOA 4V2GA 5HS8A 4BEHA 1AKHB 1VQ6I 1V5GA 2HKOA 1IB0A 2WJYA 4IRIA 3E6CC 4BPRA 1UG0A 2H8WA 3U2QA 4I0BA 4PC2A 2M8GX 5THXA 5FRNA 5IT9K 3WQZA 1JUSA 1G7RA 5DN6A 2JN6A 4MO7A 2RVCA 1SAXA 2NVUB 2V4JC 3CJTB 2J8IA 3BG6A 4WXHA 1AU7A 4MTDA 4KFCA 4KH3A 1OGJA 5IT3A 4M0LA 4OM9A 2E5NA 1NB9A 1RQPA 3CCJI 4FK8A 3MMPA 4C2TA 1E3XA 4CGZA 3V8KA 5AMVA 4XICA 4YCQA 1IN7A 2H1LA 4PSWA 1S7AA 4CQJA 2VFNA 1T6SA 1TTYA 1QO0D 2RN7A 3E6BA 3PA2A 1VQ6B 3OP1A 1X1BA 2EB7A 3CC2I 4II3A 3OY9A 1Y8RB 3AG2H 3H3ZA 5E79C 4X6AJ 3KPHA 5KNLA 2GM4A 1BI0A 2DMUA 2MFZA 2J5OA 2Q1ZB 5TJJA 2M7BA 5JVTA 4OZZA 5IPAA 3BDDA 3HKZN 4BS9A 4A3CJ 1OFMA 4OIRF 2X85A 2BXZA 2EV0A 2NS7A 3M3YJ 2EIJH 2XC7A 1Q82D 2GXAA 2M7AA 1LFBA 1ZTRA 2I8DA 4QLCU 1ZLKA 2VQGA 4AIKA 2Y31A 1YRNA 3A3GA 3LSRA 4M1KA 1XFOA 2NAZA 1IV6A 4RAFA 5FLXZ 2E1CA 2IGOA 2HS5A 2X51A 3A1PA 4II2A 3G6EI 1LDKB 4HQMA 1LLZA 3VO2A 2FJ1A 3RPQA 1RC9A 2RC5A 2MD5A 4XLEA 1EP3B 4ZYHA 2EWEA 4FXUA 3JRGA 1OGIA 5DYMA 5J4VA 1KU7A 3F6VA 4CZCA 1P4XA 1BOAA 3W2VA 4RB0A 4DYQA 2NYXA 1L3LA 5LRSA 1AOYA 2CQXA 2BPOA 4RGXA 3H94A 1NB0A 2AXLA 4LBYA 3DXJF 3WODF 5D8LB 4RCZA 3IWZA 1XQBA 4XLPF 1QU3A 4FX4A 2STWA 2OJED 4HYEA 3TO7A 3S2DJ 4A2UA 1YLOA 3ABTA 2V26A 3L2WA 3IKTA 4DOZA 3OYFA 3ZN1A 4R1HA 3M4OJ 3Q9VA 4JMQA 1MBFA 4M4SA 3ZMZA 2W4SA 4BQOA 1YW8A 1E17A 3NQOA 3ML3A 1FDRA 1MW7A 1Q7YD 2ZCWA 2EIMH 1XMKA 2LTPA 4M3EA 2D74A 4ROXA 3SYJA 1KU3A 4EJVA 1P2FA 2KP6A 5FA6A 4YDTA 5ILUA 5JLVC 3VNUA 4IRHA 1WTHD 4ZV4A 1U5TB 5K7FA 2BM7A 4XONA 3OYCA 4XLFA 2CBXA 2LR8A 3ULQB 1BC7C 4PFPA 4JRAC 1LQ1A 1MSFC 1DP3A 4EJWA 3B8HA 1IV8A 3F9KA 3FMSA 1MJ9A 2HFHA 1VQ5I 1XGMA 2VLAA 4PJJA 4P1VA 2XAUA 2RNGA 2JUCA 3DTKA 4C3IJ 5M3MJ 4KISA 3CUQA 3Q3SA 2KIFA 4C30A 3DEWA 1HSTA 2A6EF 1B4AA 2Z5UA 1JGSA 4CICA 2P0WA 3BCBA 2HOAA 4EM1A 5D5UB 2EQRA 2PMZN 1B9MA 1XMAA 3QQAA 1IRZA 5LHGA 1AIPA 2JN9A 5HNFA 3BZKA 3I59B 5F64A 4UUVA 2XAJA 1U8BA 1LFUP 3H09A 3WGHA 2XUBA 4D5FA 4OIQF 2BY0A 1W9XA 2ZZEA 3SEJA 3D5LA 5IT9Z 1T08B 5D6FA 4OZYA 3BT9A 4P9UA 4U0YA 3CCVI 1WOOA 3H1CA 1BR4A 2EK5A 2X4HA 1RETA 3F8MA 2AO9A 1Y39A 3CC4I 4EATA 3F0CA 5D5VB 2XGJA 5C1CA 4F55A 4WWCA 3NWSA 4NNJA 4HDUA 2FU4A 3FX3A 5LHIA 4UUTA 2O8KA 5E20A 3WHCA 4QVAA 1HDPA 1LEBA 1BI3A 4RD6A 4CCLA 1TSPA 4M3BA 1UCRA 4ENNA 2VI6A 4Z4RA 1FBQA 1FMWA 4U87A 1IA5A 5EMNA 3OZVA 2HNHA 4AYBN 1QH0A 1WKMA 3K70C 2CFXA 5GV8A 1TQMA 5TGTA 5HS7A 4DBRA 2QKMB 4Z2YA 1X1AA 2HXIA 3DV8A 4PUSA 3M8JA 2EFPA 2L7KA 3PFIA 3W6JB 3IRRA 5IYQA 2L0KA 3MZHA 2F4OB 3ASOH 4A3MJ 3AVUA 4CCJA 2RC4A 3ZQFA 2QA4I 2IJLA 4ZYEA 4HSTA 1U2RA 3E1YE 4RLFA 4ANJA 2W6JA 2ZTGA 1ZK8A 3GW2A 3OR1C 2YWFA 3IAS2 1H89C 4RAZA 1YLFA 1GHCA 2OQGA 3LSGA 5HLGA 4MXNA 3A4CA 2KIQA 3FJOA 3LOCA 5FFXA 2N8GA 4RM0A 2GQQA 1I5ZA 3I59A 5HDGA 2LP0A 1BW5A 2VC1A 1ZLJA 1ZYRF 1E0EA 1EFRA 1QQIA 1S72I 4ACBA 4BJ5C 2P5KA 2WTEA 4EMSA 2DT5A 4F7ZA 2XAGA 1VZ0A 2VNKA 1QPMA 3AGPA 2M8EA 5D4RA 5LBQA 3HTSB 2JTVA 2VPRA 2YX4A 3F8CA 1U6GA 4MIMA 1X4OA 3VOEA 5L3GA 3SZPA 4C3HJ 1DBGA 4UAJA 2VQLA 2CQNA 4OU0A 4BE0A 2IS4A 2HDWA 3O2PE 1W5CC 5LD2C 2ACJA 2QA4B 2FBIA 4JK1X 3SUCA 5JMCB 3KP4A 1STZA 3FF5A 4RPDA 1O8FA 3F6OA 1IUYA 2JIZA 4WCGA 5F0HA 4UVCA 1KQ8A 2KQRA 1VQMI 3OZWA 3OZUA 4GQNA 4JX5A 1B59A 3F8NA 4HNVA 4RDJA 2QEXB 2V9PA 3ECOA 4A69C 2E1MC 2WC2A 4DNCA 1Z9CA 1FIPA 1TC3C 4KIGA 1QHGA 3L2RA 5JLXA 1WSUA 4HDVA 1NH3A 4PJMA 1ZR2A 1BX0A 5ICFA 3SY2A 2DW4A 4RB1A 2NNNA 2A68F 1QQ1A 3MFKA 1LNWA 1E64A 3ZXSA 2CYYA 4FQGA 1UD4A 3EYYA 3K4BA 4ZJZA 1WI3A 4LK1F 3I56B 5GAGJ 3ZMSA 3PO2J 3PUFA 2E1OA 3DBLB 3E5UA 2Y69H 1X1PA 1MABA 3PQKA 5LGUA 3DLLF 3S2WA 1PKVA 2M45A 3OW7A 1Q9SA 2OA4A 3LNNA 2XZOA 3VSLA 4TMXA 1S8NA 3H3VK 1K61A 1MJBA 3AVTA 3Q0UA 1WORA 2LY9A 3WGIA 2B63J 2QTLA 1OCZH 2ECCA 2HGCA 2VJIA 2XNJA 2LDUA 3GVKA 4IOAF 1P6RA 3GFJA 1K7AA 5D5WB 4YELA 2DA2A 2X48A 3ZPNA 5E1XA 1A36A 1UELB 4BXFA 2QSHX 4B43A 4L9VA 1P4MA 2CW5A 4C2LA 2FSWA 4PC3A 1JKOC 2ETHA 4B09A 5CDFA 2ELHA 4LG0A 2P6SA 3H92A 3FHZA 1D8TA 3ZZ0A 1FLIA 2IA1A 2BXYA 2Y0MA 2XC1A 3IWFA 3WGGA 3GTQJ 4FHTA 1R1TA 1EP2B 1EH6A 1GV5A 3TOAA 4B48A 1Q1VA 1RMGA 1HLVA 1ETYA 2K4BA 2KL4A 3HOXJ 3CRZA 4X05A 2HKXA 4ZYGA 1X58A 1YG2A 1WQ2A 2NNYA 1VQOI 1J0RA 2INVA 3VYUB 3F23A 3WTVC 3CF5F 4CCOA 2ZFUA 1VQPI 1JI8A 2XKOA 4NHJA 4FE7A 1O8LA 2LOOA 2NOGA 3VPRA 2R5ZA 4L9NA 4B44A 1GDTA 2W85A 5GP9A 4AIJA 3W2GA 2AQFA 2CRGA 2NT9A 4DGWB 5J40A 1D3YA 4LC0A 2FOKA 1QFJA 4ZGNB 3P4GA 4NCNA 3KEOA 2KRFA 1P4AA 2DOFA 5J47A 3DWLE 3IRQA 4B3XA 3SLDA 2UXNA 2HQ5A 4CUGA 3VMWA 2F6CA 3PSIA 4UZEA 2F1MA 2HWVA 1BI1A 1T5EA 4AD9A 1AWCA 5D4SA 2OPTA 2CSOA 1LVKA 5K5OA 3AL0C 3H36A 1WZ2A 3C3WA 3QYBA 4D9JA 4M71A 4TV7A 2KRHA 3HC7A 1NHAA 3BQYA 3JRFA 3ZZTA 3NAWA 4YZQA 2XTYA 1UD2A 4BEHB 1AKHA 3D5SC 2Q2EB 4MGRA 3AG4H 3JQRA 3TP3A 2PEXA 3GQ7A 2R93J 3A02A 4YFKF 1MMSA 2NPFA 3AFHA 3HXLA 3N05A 5FGMA 3JAMZ 3FPPA 2EFWA 3CDLA 4KT6A 4HNTA 3KE2A 4LLNA 4WF2A 4YAWA 3GVLA 2NTBA 3KP3A 2B9SA 2K85A 4H0EA 3TP0A 1TBXA 2Z6BD 5L3FA 3C2BA 2P7CB 2W7NA 3KZYA 4FX0A 4A3IJ 1H88C 2DYRH 5IYWA 1VQLI 3V42A 2BW3A 1K9MD 5HXBA 1TQIA 3VDXA 1KTVA 1RKTA 5IYBJ 1B72A 4RD2A 1Z6TA 3OYBA 2IA0A 4ZDPA 3V7CA 2R7OA 1R5GA 2EZLA 1ONVA 4G12A 4BQAA 1DP7P 2V7VA 2CQKA 4G1BA 1N77A 3S17J 9ANTA 1FSHA 1J9ZA 3VSVA 2VOOA 2IS2A 2ECBA 4X7DA 2Q8KA 4PDKA 3SJMA 1RNLA 3B6CA 2VJJA 1D5YA 5JI6A 1VQKB 5DV5A 1HXDA 2BZTA 3BR1A 2KPMA 3GLXA 2DK5A 1VQNI 5GTHC 1HKSA 3HGYA 2Y9YA 1K5CA 1D1BA 1X2MA 3QP6A 2BHYA 1CF7B 3B90A 2BEOA 2XGDA 4XIDA 3BR2A 2R7RA 2MG4A 2A6TA 1QNTA 1X3WB 4WZEA 3ZSCA 2F48A 2UUZA 2ZJQF 2R7DA 2BM4A 2Y0SA 1FNCA 5L3EA 2E2JJ 1IXSB 2MC3A 2WR8A 3CLOA 3V7RA 5DEQA 3PUBA 1M90D 3MHPA 5HDKA 3WXMA 1OCRH 1SFKA 2CW8A 2EILH 3K7AJ 4QIWN 4EH1A 1KD1D 3HZJA 4KMFA 3BNWA 2FXAA 3MZYA 2V79A 3OS2A 2QXZA 1IXRC 3AL0B 3PNVA 1LJ9A 3Q5FA 5AIPA 2BMWA 1VQ9B 2VBKA 3GFLA 1ULYA 4UVBA 1JUMA 1VHEA 1JTAA 2XIGA 2H1KA 1GQ8A 4RD0A 1JKPC 1GV2A 1YX3A 2KDZA 2M0CA 3G1MA 4IQ4A 4A3GJ 4Z03A 3GVAA 4LG0B 1OGOX 4BHCA 1MD0A 5IY5H 4L9JA 1NTCA 3TKYA 1DQUA 1B8IA 3PVDA 2K9NA 3WU2C 1TVCA 1ZM3A 1RI7A 2D3LA 2JA2A 2QM3A 3WTZA 1BX1A 1GR1A 2X6XA 2XNCA 3CLQA 4G6IA 2QQBA 2LBFB 3LSHA 3GTJJ 1W36C 1MDMA 1S29A 3QPHA 1I1SA 2GQFA 3ZR8X 3T0YA 4JOMA 3F21A 1KJZA 2ZTNA 2K4JA 3LSIA 2DA3A 3BC9A 4XD7A 1RU4A 1X0CA 3ZPPA 2E7WA 4HX7A 1DUXC 2XGEA 1K4SA 3H5RA 2JA5J 1JXSA 2GIVA 4ZC3A 3CCEI 1YE9A 2R5ZB 2ZMEC 5AIQA 1F5TA 5E8GA 1IUFA 5FKOA 2HXOA 4DJAA 1ZKGA 1IN8A 2YPRA 2Z16A 2PE3A 3H5AA 4LITA 3OYEA 5ERIA 3CUQB 4ZZLA 4BE2A 4MFDA 2ZZGA 5ILSA 2E19A 1F1ZA 3ASSA 5CQGA 2CFOA 5DNSA 4O6JA 5M5YJ 3CCRB 3SDGA 3H5NA 1ZG3A 1SKYB 1HW1A 2WAFA 2E1RA 4KKUA 3VSTA 3S1MJ 2C78A 2XT2A 3ZUGA 1N75A 1EFCA 2QENA 2QMUA 2GXGA 3PFYA 4Z6YA 1WJDA 2O0WA 1K4TA 2M1BA 5DDGA 4WK8F 2Z99A 3JRIA 3KEWA 2O04A 1HW5A 1R5NA 3ZQLA 5GADJ 1R49A 3OW2B 1UG2A 3A1YA 2OTLI 3O8HA 1MGTA 3HUGB 1YTYA 1A04A 3V7AA 3KLNA 1HKQA 3A8JA 1CLWA 1RRJA 4X8IA 3BTLA 3GLLA 4NQWB 1VTNC 4G7ZF 1HZEA 4RD4A 2HQNA 1QRYA 5HZBA 3C2HA 1XSVA 4HRIA 1W0JA 1XG1A 1DGRM 2BE5F 2ELJA 3VYTB 4WZKA 3ONUA 5TY0A 4OOVA 1BLIA 4RLZA 4HV5A 1O8KA 2VBWA 1LPQA 3G4SI 3HHHA 4G6QA 2VNIA 3T9GA 1CNFA 2GIZA 3AG3H 2NVTJ 3M1CA 1KQSB 1MNDA 2JSPA 1WJEA 4UV8A 4WXCA 3W2AA 2ZL7A 4I84A 3F22A 3T1BA 1NK2P 2IAIA 3RIQA 2L9SA 2VBSA 2C77A 1MBHA 1MBJA 3TO9A 1FBUA 1TQPA 1U0JA 2DFEA 1BN5A 4AIHA 4KMUX 4EM0B 1BMFA 2F1LA 4XR6A 2QSFX 5HKKA 1KYZA 3IH2A 3CESA 2B0RA 3FK6A 2BM0A 1O3RA 2W24A 1FIAA 4BUPA 5FNZA 4F7DA 4LOCA 1K73D 1O8GA 3N6ZA 1L1IA 3H9QA 1V5EA 3DEUA 1H85A 1U2WA 4I01A 2QBYB 4RBOA 5FROA 2PYGA 1N0UA 2K9MA 3VSKA 3VR6A 2VBMA 3DFGA 4PK4A 1Y0YA 2XROA 2KZGA 3BLYA 3CDIA 4YAOA 2R7XA 5FB2A 1N0VC 4ASNA 4UHTA 3S3NA 1OFDA 2O6WA 2TCTA 4XLAA 5KAFC 3WE3A 1P92A 5HODA 1ORKA 3MCZA 1N78A 2KFDA 2QSGX 3PENA 4M6YA 4UV9A 2XT4A 1X1CA 1MNMC 3S93A 2Z3YA 3OFNA 1PJ6A 2XB0X 1WJFA 2IOUG 2QKLB 1V5FA 2D1HA 2ZJ2A 4B3FX 1H9TA 2CQQA 3J81k 3GIRA 5KVRA 2G0YA 3OS1A 4M6XA 1JTYA 4RGRA 2YSRA 3ZMUA 4G9YA 3OYMA 2FNAA 2YWEA 5F4JA 2HMAA 4QPOA 5A89A 1VQKI 3QU3A 2KJBA 1G7SA 3P27A 5F4MA 3T8RA 1IGNA 3H9JA 4DYRA 1W5TA 4NQWA 4E7KA 3DF8A 1TYUA 3DTIA 4I2OA 4IRGA 4OOSA 1YQAA 2GAUA 1P7IA 5HZAA 5TV2A 1SVLA 3FXKA 3DQVC 3JCUC 4KT5C 4ZDLA 3SJZA 5JLWA 4PC7A 2J5PA 3U1DA 1XSDA 4TMTA 3RIRA 3CCMI 5J3LA 2O0YA 2OU2A 3M07A 4IF4A 1YI2I 4RB2C 1KK3A 2K7LA 6PAXA 1OB0A 1FP1D 3ESWB 4E7IA 1YOVB 2R7SA 3ES9A 3OYHA 1FPQA 2DOAA 4ZYDA 3W6VA 3DBHB 4URRA 3BP8A 1A31A 3JRHA 1O7FA 1H8AC 1JGGA 2ZNYA 4YFNF 2L9RA 4ZTJA 1DGWY 1XGSA 2EFOA 2YU9J 2ADUA 2Y0SN 4HNUA 3ABKH 4M9SA 3WTTC 2E1BA 3R6JA 3FK7A 3OMYA 3I4MJ 4J19A 1BN8A 3I71A 2IS1A 1U5TC 3IAM2 3HOYJ 4EJUA 2DT7B 2KZVA 1XG2A 2HQAA 3TQNA 1QRCA 1LKXA 2RKHA 4XORA 5F08A 1XDUA 1G3TA 4A6EA 3A01B 4P3YA 5AN9A 1GLNA 5DCMB 2VPLA 4NK8A 2JQ7A 2JJ2A 1JT6A 1SANA 1HC8A 3CO6C 2V6CA 2LNBA 1K6OA 4KJZA 1REPC 3SXYA 2ZITA 4XK4A 3U1KA 3HUGA 2R7UA 1XDSA 3OJWA 4XLNF 1I27A 2ID6A 2R7FA 2R0QC 1W0TA 1R71A 3PUNA 4OIPF 3HOSA 2DLLA 3BH6B 3HPGA 3QPLA 2OV7A 5A8AA 3FY3A 5IOYA 4OAYA 3CMEI 2EV6A 5K7HA 3VYRB 3EUHA 1I3QJ 3RJPA 1HA3A 2RNJA 4PSXA 2XASA 3WG9A 2XGXA 1TT0A 3ASTA 3CCRI 2L3DA 2CV0A 2XRNA 5K1YA 5DM6F 1WVRA 2K86A 1H8EA 4UNOA 1W2BB 2KVOA 4JBAA 3C7JA 2FQ3A 3DP7A 1KK0A 2BY1A 2DO7A 1FJLA 1IF1A 3D1NI 3WNCA 2C2WA 3T5XA 1HVXA 4KN4X 2IA2A 1FYMA 2PX9A 5EGOB 2R9VA 1GO2A 1ZHFA 4NBSA 5F0CA 2FUG2 1OPCA 1WFXA 1YIJI 3TGNA 2DPUA 3W2IA 2F4NA 5LHHA 4G1VA 2XV4S 2F43A 5K5RA 1KC8D 3CJRB 2QDXA 1OCCH 3QP5A 2VNHA 2QBYA 3CMAB 4HLXA 2ME0A 3A35A 3GO5A 3A0BC 2WAQN 2Y9ZA 1POGA 3AAFA 1T6XA 1R5BA 2DMPA 2R7VA 2JA8J 1XB2A 2WZPP 5CKTA 1VHOA 1DU6A 3WU1B 3DPTA 1RPWA 2J7KA 2OBSA 2INUA 3CCYA 2VL8A 3MN2A 1JB9A 4HQEA 1O7LA 2WB1A 3BCAA 4U49A 3RPUA 4BHPA 5LGTA 1TLLA 2V7XA 1MJAA 1TYVA 5LFAA 4S0HB 4AU7A 2PYHA 4K1XA 1QVTA 3NEUA 1QX4A 5FIUA 4DQKA 4UXNA 3KEYA 4UUSB 1G8XA 3AVWA 4W8RA 3KLOA 4A5MA 2H09A 4MTEA 2VUMJ 2WV0A 2GBYA 1E3HA 3CCSB 3CC2B 5CJ9A 5AONA 3GFIA 2WV1A 1W0KA 3EDPA 1TZLA 5DUIA 3HOUJ 2VONA 3CCLB 4DYCA 1HF0A 4G5GA 2ZO4A 1Y0UA 3VB2A 4PABA 1EJ9A 4E7HA 2CV2A 4PZJA 4DK0A 2IS6A 2WZNA 1TLHB 2XZLA 3V8LA 1FC3A 4BU2A 4C0SA 3CMMA 3BR6A 3EUHC 3RYRA 1E79A 2WJVA 1DPUA 2JA6J 1K6YA 2M5WA 2I10A 4UZUA 1JJ6C 4OOIA 2DFFA 5IP9J 2AS5F 2EIKH 3TMOA 3B4NA 1MBGA 1WH5A 1Z1DA 3U21A 5F4OA 1WJ5A 5H6RA 1LB2A 1WGXA 4HAMA 5J1UA 4OPVA 2IGKA 3DLAA 4GO1A 4N9IA 2KT0A 4NC6A 4XRSG 4LBZA 2VQCA 1I39A 5GAEJ 2HOTA 2C4UA 3I55B 1ZGAA 4FTHA 4XBFA 1QFYA 2FX3A 1R00A 2KMUA 4BQNA 3HDDA 5EEHA 5E18F 1YX2A 4A3EJ 1U8RA 4ZZDA 3K0LA 4H9GA 4RD1A 3LFUA 1UMKA 1NDHA 1J75A 3HYIA 3MCAA 2QWWA 4V02C 1YRNB 3I53A 1QGPA 3EETA 1XGOA 1VQMB 4IEJA 1IN6A 3U9GA 1S5LC 2ESHA 3KZZA 1G59A 3DKWA 1J9IA 1PYVA 2WADA 4L9TA 4X0CA 1CQTA 1SFEA 1G4DA 4HF2A 1GAQA 3OEHA 3I0TA 2NOJB 4ITVA 4ZTFA 1KK1A 3W2FA 4M9ZA 5LGNA 1DDGA 1EXMA 2F5FA 1RIOH 2QE7A 4G6TB 1EH7A 4KITB 2VOPA 3JURA 2W25A 2LKXA 2OZ6A 3FKSA 4L18B 2DA5A 3BR3A 2IRFG 2BSAA 1IB4A 2CUJA 3DKYA 4BKXA 2PLYA 3NAUA 3OL3A 2P3MA 1VQ8B 1LUJB 2GJPA 2ZFWA 3LO8A 1WMRA 4N3GA 1EZGA 4NC7A 2DA6A 2VB6A 2EZIA 1EFTA 2X0KA 4U9UA 2ELKA 1D0YA 4N4NB 2JVHA 4RDUA 1VBLA 3OWTA 2K9LA 4D7NA 3SZGA 2MABA 2OC6A 4OAZA 3OYGA 4RD3A 2DODA 1JJ2B 4IOCF 3JREA 1WWXA 2DU9A 1WP6A 1BBYA 1KU2A 4C2MJ 2PQ8A 2CGPA 4AM3A 4LK0F 3BPVA 2BV6A 3FBIB 4GDFA 3FKIJ 3GQ9A 1YHQB 3FIWA 1FX0A 3OV8A 1U5TA 2PG4A 5HNHA 5FD6A 1J5YA 1M1EB 5F04A 3WTUC 3OSFA 3W5UA 1QZEA 1YJ9I 4RM3A 1XMXA 1Z0XA 3L00A 5ILVA 5EZGA 3WTXC 2D9RA 3EYIA 1HW2A 4RAGA 4W97A 1O57A 1D0XA 2I5UA 2WY7Q 2D1VA 3DCFA 3HKZA 4NB5A 3QFSA 2HTSA 3CMEB 3FXJA 1BJZA 1VFCA 2Z33A 3J7AO 3BOQA 3D5RC 1D1CA 2O17A 2KKOA 1IJEA 1ZM4A 2BM1A 4OJ6A 1OYWA 2VKDA 1R23A 4HX8A 5EG0A 3GTPJ 1YJWB 5IYDJ 2LLKA 2L7ZA 3L2CA 3CZ6A 2WAEA 4HV6A 4J00A 1ZRFA 5H5JA 1T8IA 4IX7A 3FISA 2D2WA 3ZQCA 2H8RA 1YI2B 1GT0C 2KIUA 2ISYA 2EJRA 2JWTA 1N07A 4M9XA 2B7EA 2DBBA 3JU4A 2XF6A 1AIRA 1YS6A 2VNJA 4X07A 1FTZA 2V9VA 1XS9A 3NB2A 1JA1A 4UB8C 2GWRA 5LLQA 1FRQA 4UB6C 2VODA 4LGWA 3GTMJ 4P55A 1NJID 3R6KA 2L4AA 1ELOA 1MSEC 1Y0RA 3I4NJ 3HPHA 1EA3A 1HKTA 4HOBA 1VQ7I 1E63A 3I56I 2ZXHA 1DARA 3WNDA 2X9DA 3MZ8A 1R58A 3N4MA 2M9HA
chains in the Genus database with same CATH topology
4C2UA 2IGMA 1O8MA 2HU9A 3DPUA 5CQEA 2DT6A 1YX3A 1J09A 4IQ4A 3BC8A 3LSKA 4Z03A 3GQBA 4NC8A 1OGOX 2M5SA 2ZZFA 2MC4A 3W2WA 2LY2A 3QYFA 2ZZQA 1KCCA 1DQUA 2VJ5A 3LL7A 4PFOA 3VYSB 4J01A 2D3LA 2JA2A 4Y4RA 4XQFA 2HVQA 1VF7A 2X6XA 2JJ1A 4HPQA 3UR3C 4BDZA 3J7AY 3K4NA 3LSHA 2LBFB 4CCKA 2R7TA 4G6IA 4G7XA 1W36C 2KRCA 4LG3A 3FHNA 3BCDA 4B3GA 4TKOB 4ZYAA 3ZR8X 4JOMA 1RU4A 1X4PA 2ZTNA 3LSIA 3BC9A 4XD7A 1X0CA 3OYNA 3ZPPA 2X1DA 3H5RA 2LY1A 4ZC3A 4BACA 1YE9A 2WY8Q 2V4DA 3BH4A 1UD6A 3LMWA 4EW9A 2WA0A 4F93B 1X19A 4DJAA 3MKZA 3RCOA 2CH0A 1NRKA 2MD0A 3OYLA 2Z16A 2VIXA 3H5AA 4LITA 3DU6A 3MD2A 3OYEA 3QOEA 4BE2A 2ZZGA 3ZQQA 1HG8A 2UVFA 5C1EA 5CQGA 2CFOA 2M4KA 2ODLA 2NSTA 1UD8A 2NZMA 3H5NA 2V9KA 1SKYB 2WAFA 4KKUA 4BDYA 2GK6A 4BJ6C 3VSTA 2RQQA 2XSJC 3L2UA 4U7BA 2NT6A 1N75A 4MR0A 3K4KA 3S32A 3K4JA 1CZFA 4XLHA 3PFYA 4R79A 3RSNA 1WJDA 4B47A 2O0WA 4W8QA 3DPLC 2PMZA 3T56B 4PJLA 4L8JA 3KEWA 2O04A 4XL9A 1Z21A 2DCEA 2KDOA 4BEHA 2ZXIA 1V5GA 2WJYA 3A1YA 4Y33A 3DDYA 3T51B 1UG0A 3HUGB 1WPCA 3I3LA 2V7QA 3L2QA 3OYKA 2XNDA 5FRNA 3WQZA 4Y3OA 1KTWA 4NQWB 4ZDOA 1HZEA 5DN6A 2LYCA 3PL8A 3RTRA 1E1RA 3C2HA 3OS0A 1NG6A 4HRIA 1W0JA 2E1MB 2V4JC 1DGRM 3BG6A 4HWVA 2E60A 1KCDA 2ELJA 2XZPA 3VYTB 3PSFA 2E5NA 3ZRGA 1BLIA 3S3OA 1O8KA 3ZIAA 4C2TA 2HZDA 1Z3YA 2KLOA 1E3XA 5AMVA 2V1NA 3L2VA 3T9GA 4PSWA 3M1CA 1MNDA 2JSPA 3HG9A 1WJEA 3W2AA 3EUAA 3A2KA 4I84A 3MKWB 1I18A 2VBEA 1X1BA 2F4IA 4II3A 3OYDA 3C2GA 3OY9A 2L9SA 2W1OA 5KNLA 3PJRA 3OAAA 4U4BA 2MFZA 2Q1ZB 1P9QC 1U0JA 2M7BA 3MMYB 4OZZA 4BS9A 1OFMA 1BMFA 2X1EA 2KHMA 4XR6A 3G05A 4Z05A 2DIEA 5HKKA 2X85A 3CESA 4F52A 1IDKA 2XC7A 2E5ZA 1T0FC 3S8PA 2M7AA 2I8DA 1RWRA 4XOPA 4BUPA 2VQGA 3OPOA 2CK3A 3A3GA 1O8GA 3H9QA 1V5EA 3CP8A 4F91B 5FROA 2IGOA 2PYGA 2K9MA 2X51A 3E0JB 3TL4X 3VSKA 1BOBA 2BOLA 4II2A 1NBMA 1LDKB 3ZGKA 1OR7C 3OE7A 3VR6A 4PK4A 2VBMA 4Z06A 3QYEA 3BLYA 2R7WA 2EWEA 4XLEA 2V7FA 3SEZA 2R7XA 4E7JA 1KZLA 2M3AA 4FXUA 3S3NA 1DBOA 4XLAA 4CZCA 3W2VA 1V0FA 4HIZA 4F92B 2K5CA 4XKBA 3OYJA 1N78A 1T95A 4W8TA 2LG4A 3AKZA 1BR2A 2AQEA 4IZZA 3H94A 1O8JA 1X1CA 1PE9A 2QY1A 3S93A 3OFNA 1WJFA 2VQHA 2QKLB 1V5FA 3VSUA 1QU3A 4B3FX 2NSPA 4XKCA 2X3HA 3EQOA 3OS1A 2WPDA 3CF2A 3FDYA 2V26A 3L2WA 2CMPA 4DOZA 3OYFA 3OYMA 4YEJA 3KYLA 4JMQA 2W4SA 4BQOA 4QPOA 3A3BA 1MW7A 3VMVA 3OL4A 2Z2SB 2UV1A 1H8HA 3H9JA 3GBGA 4OJ5A 3EPZA 4OJLA 2KP6A 1O8HA 2ZSHB 4E7KA 3GRHA 3DTIA 1OOCA 1WTHD 1MMDA 2BSPA 2R7QA 4XONA 1MMGA 4E0FA 2BW3B 4E7SA 3OYCA 4XLFA 1NG7A 4HEA2 3OIQA 4ZDLA 3DQVC 4G7WA 3GQAA 4PFPA 1DP3A 2VKHA 5FL7A 3F9KA 3K6GA 2PECA 2VLAA 4PJJA 3K10A 3OOUA 4BGDA 3LMMA 2XAUA 1OB0A 5HVQC 2RNGA 3DTKA 3OR2C 4E7IA 3OYHA 2R7SA 2DOAA 1Z3XA 4KISA 4C30A 4URRA 1VJSA 2W82A 4KKTA 2L2OA 2P0WA 3BCBA 4ZTJA 4RMNA 2NTQA 4DBQA 1DGWY 4RM2A 1QCXA 3OIPA 5HNFA 4HNUA 2E1BA 4CA0A 3OMYA 4XM3A 1BN8A 2IS1A 3VMWA 4P1WA 3IAM2 3PNYA 2XF7A 5KHDA 1W9XA 2ZZEA 3D5LA 2DT7B 2KZVA 1UD5A 2HQAA 1XG2A 1IRXA 1LKXA 4OZYA 4XORA 5CPRB 2JDIA 1GLNA 1E1QA 4P22A 1WJBA 1BR4A 2VPLA 1E3ZA 4NK8A 2LREA 2HVSA 2JJ2A 2Z8GA 4EATA 5HOOA 2XGJA 5C1CA 2F5VA 4F55A 3NWSA 4KJZA 4X0GA 4NNJA 1O88A 4TT3A 2R7UA 2WSSA 1V0EA 3BG7A 3RPUD 4CCLA 3HOSA 2QX3A 1KONA 2XDVA 3HPGA 2OV7A 4U87A 1FMWA 4FASD 1IA5A 3FY3A 4IQJA 2HNHA 3K70C 1KMHA 1MNEA 5TGTA 1AA7A 4OAYA 2QKMB 4DBRA 3OOCA 1X1AA 3RQ4A 3VYRB 4PUSA 3M8JA 2GJKA 4W8SA 2L7KA 4PSXA 1UAAA 3GVJA 2X6WA 2NTPA 3PNTA 1TT0A 4RLQA 3K4MA 3HOTA 4N4OB 3K4CA 2CV0A 4CCJA 2VASA 1H8EA 1MMAA 2QXZA 4XKVA 4HSTA 2KVOA 4NUBA 4RLFA 4ANJA 2W6JA 2JVGA 3OR1C 2ZTGA 4LIVA 3IAS2 3ONQA 2LBFA 3EUKL 4XN0A 3LSGA 2LZJA 4XN3A 1Y56A 1HVXA 3A4CA 4MXNA 4BL0B 2R9VA 1E43A 2RREA 3EQNA 2FUG2 1WFXA 2CV1A 2Z1DA 1E0EA 3B8YA 1EFRA 4PJNA 4BJ5C 2F43A 2CS3A 3CJRB 4P5OA 1VZ0A 2K3PA 2HPIA 3HL2A 3H9GA 1PJRA 3A35A 2M4GA 4E6KG 4GRIA 1X4OA 1DBGA 4YZAA 2VQLA 2LH9A 4BE0A 2IS4A 2R7VA 2HDWA 2UWMA 4JQFA 5LD2C 2WZPP 5CKTA 4HG2A 4CH7A 3SUCA 1O8FA 1FMVA 4DK1A 4FETA 1K28D 3DPTA 2JIZA 1JRGA 1R6RA 2KQRA 2O1DA 3CJQB 1HA8A 2VXZA 2INUA 2W6IA 2VL8A 4GQNA 2WB1A 1W36D 3BCAA 1COWA 4U49A 2LRDA 2L5QA 3K70D 5LFAA 1O8DA 2E1MC 1OHHA 2WBMA 5JHFA 1QHGA 4AU7A 3L2RA 1O8EA 1PXZA 2PYHA 4PJMA 3KEYA 1G8XA 2OUMA 2LC2A 4W8RA 2CW7A 2DJIA 3ZXSA 2HLDA 4DNRB 1UD4A 1Y6IA 2R4GA 3KRGA 3K4BA 4ZJZA 2ZSIB 2PJRA 1W0KA 2VJ4A 1BHEA 4XNFA 1TZLA 4ASUA 2X1CA 1MABA 4E7ZA 1NHCA 1PKVA 2X6YA 3OW7A 4YXWA 2CV2A 4E7HA 3VSLA 2DXIA 3LNNA 2IS6A 4DK0A 2XZOA 2XZLA 3BCFA 4BU2A 3CMMA 1D1AA 3OYIA 3EUHC 1YX5A 1E79A 3DKXA 2WJVA 2VJIA 4OJOA 1K6YA 3GVKA 4UZUA 4YELA 3ZPNA 4LIUA 5FRMA 1UELB 4BXFA 4C2LA 4B43A 4YZXA 2M0MA 2IXSA 3TMOA 5CDFA 3B4NA 3U21A 1WJ5A 4CCNA 4H4KC 3G2BA 4OJPA 2IGKA 3DLAA 4MLOA 4PMHA 2XF5A 1H80A 3ZCOA 4YZ0A 4E7LA 2GK7A 2VQCA 1LFPA 1OLTA 1ERDA 2GOXB 4B48A 4BJTA 4D1QA 2O5RA 1RMGA 1EE6A 3W3CA 2KMUA 2KL4A 4BQNA 4C9YA 4E4HA 4BE1A 1WJAA 3LFUA 2INVA 3VYUB 3SYTA 3H0DA 1IDJA 4CCOA 2ZFUA 1JI8A 4AVZA 2A5WA 2VXDA 3NE5B 4XOTA 1O8LA 2LOOA 1OGMX 2O0VA 4B44A 2L9NA 1G59A 2AQFA 3CP2A 1PYVA 2WADA 2NT9A 4DGWB 3OYAA 3OEHA 4ITVA 2NOJB 4ZTFA 1O8IA 1VLYA 2QE7A 4G6TB 4HSRA 4KITB 3FBNB 3JURA 1D0ZA 3DWLE 3FKSA 2UVEA 4B3XA 1IB4A 1UD3A 1QJVA 2CUJA 3DKYA 3DEEA 2BVLA 3OL3A 4XKWA 4CUGA 3OEEA 4CCMA 2F6CA 3PSIA 2GJPA 2F1MA 4BQQA 1T5EA 4Z1MA 1WMRA 3E1SA 1BR1A 4NC7A 3TBIA 3FKJA 1LVKA 2W00A 3AL0C 2VB6A 3HAGA 4DNTB 3GQ8A 3QYBA 2X8KA 3T53B 4D9JA 2JUGA 1OFLA 2D3NA 2KRHA 3HC7A 3WWGA 1D0YA 4N4NB 4YZQA 2JVHA 3KX2A 1UD2A 3I9V2 4BEHB 2V6EA 3D5SC 3OWTA 2K9LA 2Q2EB 1VBLA 1WJCA 3SZGA 4IKFA 2MABA 2OC6A 4OAZA 3OYGA 3GQ7A 3AFHA 3HXLA 3N05A 2X53S 3FPPA 2IQ7A 4HNTA 4KT6A 1WP6A 3GVLA 2NTBA 4TSFA 4DIQA 2WAQA 3LSMA 1SAUA 3FBIB 2HVRA 3GQ9A 2Z6BD 4OWRB 2W7NA 1FX0A 3IP4B 2HPMA 3V42A 2BW3A 3SDBA 5HNHA 3DTEA 3VDXA 4RM3A 5KCMA 2V31A 4KKSA 4NK6A 3OYBA 3SEQA 4ZDPA 2IGNA 1PLUA 5HLTA 2BVMA 3K4LA 2R7OA 4YRVA 1D0XA 2WY7Q 1Z7LA 4CSWA 5IK2A 3HKZA 3DU5A 1MMNA 3MKYB 1N77A 2MYSA 3D5RC 1D1CA 2O17A 3VSVA 4OJ6A 2GOMA 2VKDA 2IS2A 3UNGC 2VJJA 3CZ6A 2WAEA 4XLCA 2CUZA 4J00A 4IX7A 2KPMA 1I8DA 1K5CA 4QPQA 1D1BA 2XF6A 3JU4A 1AIRA 3B90A 2XOKA 4F3QA 2R7RA 2A6TA 3ZSCA 2UUZA 4AYBA 1S9HA 3QODA 2Y0SA 2PJRB 1QHHD 1ZELA 4XMYA 3VWBA 3PUBA 1SFKA 2CW8A 3S3MA 3OS2A 3HPHA 3AL0B 1EA3A 2GJRA 3PNVA 1X1DA 2ZXHA 3IUOA 2VBKA 1JTAA 3UW0A 3H35A 3NWTA 1GQ8A 1BPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XOT A;  1O8M A;  1O8L A;  2X6W A;  1OGM X;  2NTP A;  2O0V A;  2PYG A;  4YZX A;  4Z03 A;  2VBM A;  1OGO X;  2NT9 A;  4Z06 A;  2QXZ A;  2EWE A;  1KCC A;  4XLE A;  4XQF A;  1O8I A;  1DBO A;  4XLA A;  2X6X A;  3JUR A;  4XN0 A;  2UVE A;  4XN3 A;  4MXN A;  4W8T A;  1IB4 A;  1QJV A;  4XKW A;  1O8J A;  1RU4 A;  3EQN A;  1PE9 A;  1X0C A;  2QY1 A;  3ZPP A;  1WMR A;  3B8Y A;  3VSU A;  3GQ8 A;  2NSP A;  2X3H A;  3EQO A;  1OFL A;  3LMW A;  4EW9 A;  3WWG A;  4YZQ A;  1VBL A;  4YEJ A;  1DBG A;  4YZA A;  3GQ7 A;  3VMV A;  3SUC A;  2IQ7 A;  1O8F A;  1HG8 A;  2UVF A;  5C1E A;  1JRG A;  2ODL A;  2O1D A;  4OJL A;  4OJ5 A;  2NST A;  2INU A;  2NTB A;  1O8H A;  2NZM A;  3GRH A;  3GQ9 A;  4U49 A;  1OOC A;  2BSP A;  3VST A;  4XON A;  1O8D A;  2NT6 A;  4MR0 A;  4XLF A;  1O8E A;  1PXZ A;  1CZF A;  4XLH A;  2PYH A;  4W8Q A;  2O0W A;  4NK6 A;  3GQA A;  1PLU A;  4W8R A;  2O04 A;  4XL9 A;  2PEC A;  3KRG A;  1BHE A;  4XNF A;  4URR A;  2O17 A;  1NHC A;  3VSV A;  2X6Y A;  1KTW A;  4OJ6 A;  2NTQ A;  1QCX A;  2VJJ A;  4XLC A;  4HWV A;  4XM3 A;  1BN8 A;  1KCD A;  3VMW A;  2VJI A;  4OJO A;  1XG2 A;  4YEL A;  1O8K A;  4OZY A;  4XOR A;  4C2L A;  1K5C A;  3T9G A;  5AMV A;  3B90 A;  1AIR A;  3B4N A;  4NK8 A;  2Z8G A;  4OJP A;  4PMH A;  3ZSC A;  5C1C A;  1H80 A;  4I84 A;  2VBE A;  4YZ0 A;  1O88 A;  4XMY A;  4U4B A;  1RMG A;  1EE6 A;  2QX3 A;  4OZZ A;  1IA5 A;  3FY3 A;  1OFM A;  4XR6 A;  4Z05 A;  2X85 A;  1IDK A;  2INV A;  2VBK A;  1IDJ A;  1JTA A;  4W8S A;  1RWR A;  3UW0 A;  4XOP A;  4AVZ A;  4XKV A;  1O8G A;  1GQ8 A; 
#chains in the Genus database with same CATH topology
 2BYV E;  1OMI A;  4QWQ A;  3TO6 A;  4CYD A;  1O8M A;  1K8A D;  5B1B H;  2FEZ A;  1Y8Q B;  3LSK A;  3GQB A;  5D8K B;  1SD7 A;  1O3T A;  3KP2 A;  3QYF A;  3AVV A;  1KCC A;  4J01 A;  1QFZ A;  1ZM2 A;  1XE1 A;  4XQF A;  2HVQ A;  2DET A;  4DQL A;  4B4C A;  1YO5 C;  4BDZ A;  4MYU A;  2R7T A;  4X7E A;  4EGY A;  3V4G A;  3P5J A;  2BF4 A;  2TDX A;  1F43 A;  1Z6R A;  3CPW B;  3OYN A;  2ESN A;  3I5U A;  4QHY A;  2M87 A;  3Q6Q A;  2L9V A;  1WSV A;  4BAC A;  1I6X A;  4XRF A;  2WY8 Q;  2V4D A;  4CYC A;  1IXC A;  2P5L C;  3JRC A;  3MEX A;  1K78 A;  2WA0 A;  1BM9 A;  4EW9 A;  4F93 B;  4OPW A;  5DCF A;  1BI2 A;  3IC7 A;  2CUE A;  3LQR A;  3WBJ A;  3DU6 A;  1I1G A;  2P5V A;  1CQX A;  1HG8 A;  5IYP A;  2JZY A;  3FXQ A;  3PM1 A;  2M4K A;  2ODL A;  1V54 H;  1ZAO A;  5F1R A;  1UD8 A;  2NZM A;  1BJA A;  2L4M A;  1W5S A;  1VI0 A;  2QZA A;  2O8X A;  4BDY A;  5EEA A;  4BJ6 C;  1N06 A;  2RQQ A;  2XSJ C;  2NT6 A;  4MR0 A;  3K4K A;  3HOV J;  4TMZ A;  4XLH A;  3GTL J;  4R79 A;  1BIA A;  3LA2 A;  5L3D A;  1IN4 A;  3ASR A;  4PJL A;  5D5X B;  4XL9 A;  4A0Y A;  4TMW A;  4HBL A;  2ZBU A;  3IKV A;  4P6Y A;  2Q2E A;  1PVE A;  3GYH X;  2C6Y A;  5C4J J;  2VFQ A;  4ESJ A;  2NS0 A;  2A5Y B;  1FEX A;  2GRE A;  2VYQ A;  2V7Q A;  5J8F A;  4RS8 A;  3OYK A;  4MYT A;  4Y3O A;  1EH8 A;  3K1M A;  1T2K A;  1DDN A;  1JT0 A;  4ZDO A;  1KTW A;  1QA3 A;  3PL8 A;  3RTR A;  4RA2 A;  3OS0 A;  2BGC A;  1NG6 A;  3R61 A;  4A3J J;  1E62 A;  1KQ0 A;  2E1M B;  3P9I A;  5L3B A;  4PC6 A;  1T39 A;  4HWV A;  2E60 A;  1FY7 A;  2ME6 A;  1ETV A;  1KCD A;  2YUS A;  3PSF A;  3ZRG A;  2R92 J;  1KA8 A;  1IO2 A;  1RKW A;  4IPA A;  3V7S A;  3ZIA A;  1Z3Y A;  4KIC A;  2Z9O A;  1ON1 A;  2B7B A;  2PIA A;  3CCL I;  4Q7J B;  4BXX J;  4L5E A;  1GUU A;  2LFB A;  3MKW B;  1X2N A;  2VBE A;  4HX4 A;  2D45 A;  3FZV A;  3C2G A;  3M1E A;  4O3M A;  2BGJ A;  4Z4Y A;  5ED4 A;  2W1O A;  3OAA A;  1V55 H;  2P6T A;  1P9Q C;  3MMY B;  1V4R A;  1SD5 A;  4U88 A;  3MAJ A;  4DW6 A;  2RDP A;  2X1E A;  2KHM A;  3G05 A;  3AGQ A;  4Z05 A;  3KP7 A;  3M7G A;  4AC0 A;  4F52 A;  2Q6O A;  1IDK A;  3CC7 I;  2E5Z A;  2HYG D;  4JX6 A;  1TNT A;  2CK3 A;  5HS9 A;  4E70 A;  3CP8 A;  4MFE A;  4F91 B;  1R4N B;  4S04 A;  3E0J B;  3TL4 X;  3OE7 A;  1F9N A;  4YZX A;  3ZGK A;  4M3D A;  1OR7 C;  2RC6 A;  4Z06 A;  2H94 A;  2VE9 A;  4IO9 F;  2OK8 A;  2QQA A;  2V7F A;  3SEZ A;  2XAQ A;  1KZL A;  1H0M A;  4Q4Z F;  2DA4 A;  1DBO A;  2CW0 F;  5B1A H;  1HBX G;  2JJ7 A;  4HIZ A;  5LRR A;  3OYJ A;  4P3I A;  1T95 A;  1XGN A;  4W8T A;  2F2E A;  1BR2 A;  1D8J A;  2PFB A;  4MQV A;  2VQH A;  1VF9 A;  3LA3 A;  3HSR A;  4XKC A;  2FOW A;  3BTJ A;  3R0A A;  2L02 A;  4CO8 A;  1SFU A;  2WPD A;  3CF2 A;  2ZBV A;  3F72 A;  3VMF A;  4IHS A;  3SKB A;  1J2X A;  3TED A;  2KJC A;  4YEJ A;  3KYL A;  5K7Z A;  2YS9 A;  4YFO A;  1MBE A;  1O3Q A;  3A3B A;  2CG4 A;  4MNU A;  3VMV A;  3Q6R A;  3OL4 A;  5J35 A;  4Y52 J;  5FO0 A;  5C44 J;  2NVX J;  5FLX K;  2Z2S B;  2UV1 A;  1QBJ A;  4A5N A;  5JBQ A;  4OJ5 A;  1W1W E;  2GA1 A;  4Q48 A;  4AF6 A;  4Z4W A;  2JRT A;  2ZSH B;  2V7W A;  1G6N A;  3E5Q A;  1FBS A;  1OOC A;  3CMY A;  4BAY A;  2A6H F;  2R7Q A;  5LEK A;  5JHU A;  1BA5 A;  4A3L J;  1S0U A;  1H9G A;  1MMG A;  4E0F A;  2BW3 B;  5GAH J;  4RGS A;  2H6B A;  4D5C A;  4E7S A;  1NG7 A;  1OYY A;  5IYR A;  4HEA 2;  3AG1 H;  1Z7U A;  4OMZ A;  2CRV A;  3K2Z A;  3GQA A;  2OZU A;  1K78 B;  1MH4 A;  2VKH A;  4Y9U A;  5FL7 A;  1LDJ A;  3K6G A;  4LD5 A;  3RQI A;  2PEC A;  2DYS H;  3K10 A;  3OOU A;  1MKM A;  4BGD A;  3LMM A;  2XAF A;  3BQJ A;  2NVQ J;  2JMW A;  1Z3X A;  3ASN H;  4Y17 A;  3KCC A;  3CC4 B;  3S16 J;  3A8K A;  3AVX A;  1IN5 A;  3BY6 A;  1FNB A;  3U6K A;  3HEF A;  2L2O A;  4B1R A;  5GTI C;  2CWE A;  5IP6 A;  4LFU A;  2NTQ A;  4RM2 A;  4A93 J;  5CLS A;  4EJO A;  3KP6 A;  1WHU A;  2FVG A;  2FNP A;  1FX7 A;  2QYO A;  2XF7 A;  4I7H A;  4P1W A;  1O4X A;  1IC8 A;  2DMT A;  5EF6 A;  5CYV A;  1UD5 A;  1T98 A;  4P22 A;  3GTK J;  1E1Q A;  1R4M B;  3GME A;  4M72 A;  2JRM A;  3WG7 H;  2O3F A;  2HVS A;  4P12 A;  3CUQ C;  2CU7 A;  5HOO A;  2V1D A;  2UXX A;  3OJX A;  3WYA A;  2F5V A;  4X0G A;  3G3Z A;  4G7H F;  4GGG A;  2Q6K A;  2A07 F;  2QGG A;  2F5C A;  3BTC A;  4Y7N J;  3PUM A;  4MEX F;  2ZME A;  2MBF A;  3CXC B;  2ZME B;  2DY1 A;  4W1U A;  4FAS D;  2K9S A;  4BY7 J;  4P9S A;  4M3G A;  2VE8 A;  2R7Z J;  2XAH A;  3SJP A;  4HW0 A;  3OOC A;  4YC5 A;  5LMZ A;  2EBI A;  1M1K D;  2GJK A;  3QFC A;  4W8S A;  3E97 A;  3WTY C;  4ZCL A;  1UAA A;  2YU3 A;  1QGY A;  3GVJ A;  2COB A;  3L9F A;  2X6W A;  2NTP A;  2L7F P;  4A6D A;  1GVH A;  3K4M A;  3HOT A;  3GWZ A;  3K4C A;  4G7O F;  1EF4 A;  1D8K A;  3TW6 A;  3HTU A;  2WB1 N;  1NK3 P;  4J0Q A;  2IPQ X;  2VBX A;  1JKR C;  1ZQ3 P;  4HA8 A;  5E6T A;  3ZZU A;  4NUB A;  5E17 F;  3CC7 B;  1GXQ A;  3ASQ A;  3CCU B;  4LIV A;  1I3A A;  2CC2 A;  3L1P A;  3ONQ A;  1YW7 A;  3EUK L;  4XN0 A;  1UJ8 A;  1Z05 A;  1SFX A;  4GCV A;  2LZJ A;  3ASP A;  5KAI C;  3KET A;  5TRD A;  2DCU A;  2HOE A;  2DFI A;  2PMH A;  1ZR4 A;  2F4M B;  1S4M A;  1BW6 A;  1A5J A;  1CNE A;  2VBT A;  5DSZ A;  3EQN A;  2WWY A;  3PIP F;  2Z1D A;  4RPB A;  3ZC3 A;  1W7P D;  1QUF A;  2CS3 A;  4P5O A;  1ETK A;  2EH3 A;  2K3P A;  3HL2 A;  2LF8 A;  5J8C A;  1LDD A;  4QTR A;  3D26 A;  5F0F A;  3GCM A;  2Y75 A;  2COM A;  1T6Z A;  4OPS A;  4FT8 A;  2LH9 A;  2HDD A;  1LVA A;  2UWM A;  3H9N A;  2IVM A;  4LBV A;  4HG2 A;  4CH7 A;  5HLH A;  4Z4Z A;  4DK1 A;  4FET A;  1K28 D;  3V76 A;  3L09 A;  1R6R A;  4YII A;  4HF1 A;  4YHB A;  1SVM A;  4GYG A;  2VXZ A;  3Q0W A;  1PDN C;  2RQP A;  5EG0 B;  3RKW A;  2W7Z A;  5JR3 A;  3SQV A;  2GPJ A;  5IOZ A;  1HCR A;  1JHF A;  4OMY A;  2WBM A;  1O8E A;  4P26 A;  1S3J A;  2NXN B;  3TOB A;  1WDT A;  2C5B A;  2OUM A;  2DFH A;  1N8R D;  1SM4 A;  2ZXW H;  2P4W A;  3B73 A;  2DJI A;  4A3F J;  3QRF F;  1UFM A;  1YFH A;  1QGZ A;  4DNR B;  3H0G J;  2R4G A;  1K83 J;  3VOD A;  2K9Q A;  2B7C A;  1B6A A;  1VQO B;  3RKQ A;  4OIN F;  2K02 A;  3BZ6 A;  3HHG A;  4K2E A;  4KN7 X;  4XNF A;  5LEJ A;  2GXB A;  4RDL A;  3OKX A;  5FKK A;  5ICG A;  3U6B A;  2X1C A;  2BN4 A;  2O9L A;  4E7Z A;  4XSZ F;  1BQE A;  2X6Y A;  1GVD A;  1UST A;  3GXO A;  3IH3 A;  3BCF A;  1FYK A;  2OBP A;  1Q86 D;  1D1A A;  3OYI A;  1YX5 A;  1WOP A;  3CCM B;  2C4T A;  4L0Y B;  3J7Y J;  4LIU A;  4P6V F;  4A12 A;  2P8T A;  3JSO A;  5FRM A;  3KP5 A;  3SFZ A;  1I7P A;  1V3F A;  2QN6 A;  2F5E A;  3SFI A;  4CCN A;  2HEO A;  1VQP B;  1EV7 A;  3IHU A;  3G2B A;  4M3F A;  4PMH A;  2MA3 A;  4MLO A;  2XF5 A;  1ZH5 A;  3REO A;  4YZ0 A;  4E7L A;  2GK7 A;  5KSW B;  1LFP A;  4YEI A;  1X3U A;  1OLT A;  5J1R A;  1ERD A;  3EQL F;  2X3U A;  1OKR A;  4BJT A;  1IDY A;  2O5R A;  4RCY A;  3W3C A;  3CMA I;  4N3N A;  5CVU A;  1WH7 A;  1R1U A;  4LBW A;  3ELK A;  2JPB A;  4BE1 A;  3CD6 B;  1G7T A;  1UZC A;  5A2Q Z;  3H0D A;  1TWA J;  3RZO J;  3K2A A;  3ZMV A;  2A5W A;  2VXD A;  5K5Q A;  3NE5 B;  2OTJ B;  3LFK A;  3GZ5 A;  2O0V A;  2VN2 A;  4B4D A;  2W48 A;  2EA2 A;  5JVG F;  2F3L A;  3PET A;  1F36 A;  3CP2 A;  3R60 A;  5EZH A;  2LMD A;  3OYA A;  2GLO A;  2CO5 A;  3LJY A;  2L54 A;  3A0H C;  5FLM J;  1FYL A;  1VQ4 I;  1O8I A;  2VC0 A;  4KUM A;  1VLY A;  5IYN A;  3CPX A;  3GTO J;  2CF4 A;  1K8F A;  5M5X J;  3N90 A;  4IXA A;  4IW3 B;  4LLL A;  4HE6 A;  1TNS A;  3FM3 A;  4UVA A;  4CCM A;  1R5O A;  3OEE A;  3CCS I;  3F8F A;  4BQQ A;  3CD6 I;  3E1S A;  5JFR A;  1BR1 A;  3TBI A;  1MZB A;  1IDZ A;  2X6O A;  3HAG A;  4DNT B;  4I98 B;  2X8K A;  2RGV A;  4R8H A;  4JP0 A;  4KDP A;  1ZUN B;  2JUG A;  4FN5 A;  5CVR A;  3WWG A;  1YS7 A;  3KZI C;  1CF7 A;  3I9V 2;  2HYJ A;  4LMY A;  2O03 A;  3GEZ A;  2A69 F;  2X53 S;  2IQ7 A;  1JUP A;  5B5E C;  2JA7 J;  1PJ7 A;  5CVI A;  2EFQ A;  2IBD A;  4AID A;  3JX8 A;  1XTA A;  1ZG5 A;  3BRO A;  4TSF A;  4DIQ A;  2DA1 A;  2WAQ A;  2M2E A;  1UHW A;  3F8B A;  3LSM A;  4N0B A;  1SAU A;  1S7E A;  1Y1V J;  3U2R A;  3JRA A;  5J1Y A;  1PP7 U;  4N9H A;  2YR2 A;  2LKP A;  2G9W A;  4RAY A;  1ETW A;  4I02 A;  1WXR A;  3HRS A;  3JTH A;  1B72 B;  2H6C A;  3SHF A;  5KCM A;  1QRB A;  1PLU A;  3LQ6 A;  5HLT A;  5BPD A;  4YAF A;  2YUH A;  1W7P A;  3E7L A;  2BVM A;  1XN7 A;  4X7C A;  2VBZ A;  4ZCM A;  1IRG A;  4EV0 A;  1P4W A;  1Z7L A;  3GUD A;  2XSD C;  5IK2 A;  2JSC A;  3G1O A;  1SD4 A;  1MMN A;  4ENK A;  1VQ9 I;  4M2L A;  1YIO A;  2FBK A;  4JX4 A;  2MYS A;  2BY3 A;  4MQ9 F;  3G73 A;  1W4M A;  4X7F A;  2DOE A;  1ETQ A;  2GOM A;  2DTR A;  4WXD A;  2IW5 A;  3M9A A;  3W2H A;  2OTL B;  1OCT C;  1FWZ A;  1SKQ A;  4XLC A;  3JTG A;  2XTW A;  2MSY A;  2QQ9 A;  2STT A;  1XSX A;  3DBR B;  1N08 A;  3SZT A;  2WYR A;  2DQL A;  1I8D A;  1W87 A;  1WCM J;  4AC9 A;  2RV8 A;  1T56 A;  3I58 A;  3CJN A;  2E71 A;  1KQ9 A;  4IHV A;  1D5V A;  1FTT A;  2XOK A;  2BX6 A;  4A0Z A;  3P7N A;  2DI3 A;  2DN0 A;  2OTJ I;  3O6B B;  1UMQ A;  5BNG A;  4BXU A;  3QOD A;  2Q0O A;  4BY1 J;  1G3W A;  3AVY A;  1LE8 B;  5J6X A;  2PJR B;  2ZXJ A;  3CTA A;  2DQR A;  1RUO A;  4XMY A;  5L3C A;  1SMT A;  3JSP A;  3KEQ A;  3CQZ J;  1ZGJ A;  3S3M A;  2ZL6 A;  3GTG J;  3JR9 A;  1Z67 A;  4I09 A;  2DJN A;  2M34 A;  2R3S A;  2GJR A;  1X1D A;  2V7U A;  3IUO A;  4U0V A;  5C4X J;  1B1B A;  3G1L A;  4V19 K;  1VND A;  1WRJ A;  3MKL A;  1QG0 A;  1BJK A;  3H35 A;  4XKV A;  4MHG A;  2QQ8 A;  2IGM A;  2DOG A;  5GV7 A;  1WPK A;  2HU9 A;  1W7P B;  3DPU A;  4WX9 A;  1O3S A;  3E6D A;  4C3J J;  2BGI A;  1J09 A;  2OCE A;  3QSY A;  2PI0 A;  3BC8 A;  2LVS A;  4EGZ A;  2E34 A;  3P26 A;  4BBS J;  4QFM A;  4D7M A;  3RKX A;  1HOM A;  4WZT A;  1R7J A;  2VJ5 A;  4PFO A;  5BMZ A;  1QZZ A;  1VF7 A;  4YIF A;  1U9N A;  3UR3 C;  1JKQ C;  3J7A Y;  3K4N A;  5L46 A;  3QAH A;  1JNY A;  2MH2 A;  2EZH A;  2KRC A;  2EZK A;  4I76 A;  2QF7 A;  4LG3 A;  3WHB A;  4BH9 A;  4P9F A;  1X4P A;  2OYN A;  4BNC A;  3BG3 A;  4XRM A;  2IEK A;  4B8X A;  2LY1 A;  3BJ6 A;  1QPI A;  3FXO A;  3OOP A;  3V8J A;  2PJP A;  3A8I A;  2JK3 A;  3BH7 B;  2X0L A;  2OF7 A;  4RGU A;  3W6K B;  2P7V B;  3RDI A;  4A3D J;  1UD6 A;  3BH4 A;  4YAU A;  3VNV A;  1X19 A;  3MKZ A;  4CZZ A;  4WQM A;  3RCO A;  4I99 C;  4IVN A;  2MD0 A;  3CCQ B;  2VIX A;  1PP8 F;  1W34 A;  3MD2 A;  1ODD A;  1OR7 A;  3B82 A;  1S6L A;  3ZQQ A;  2ZL5 A;  2ISZ A;  1VQ5 B;  5C1E A;  5CVJ A;  4A0X A;  3LQE A;  1LLW A;  2QYU A;  2OCC H;  2NST A;  3G4S B;  1PUF A;  5DM7 F;  1PUF B;  3WY9 A;  1YJN I;  1JE8 A;  1XCV A;  4Z4S A;  3L2U A;  4U7B A;  1ZRD A;  3QWL A;  2B5O A;  4W8Q A;  1HSJ A;  2L7M P;  2PMZ A;  2EIX A;  4CDG A;  3T56 B;  2QLZ A;  3GFM A;  1QA6 A;  1ITY A;  3ZQI A;  3LVB A;  2A05 A;  2HI3 A;  2LF7 A;  2ZXI A;  1LE8 A;  3GZN B;  4Y33 A;  3C1D A;  3QFT A;  3DDY A;  3BPX A;  3CDH A;  1YHQ I;  3JQP A;  4IHW A;  1WPC A;  4TMV A;  3I3L A;  3T51 B;  1T38 A;  3L2Q A;  2XND A;  1MDM B;  3PQJ A;  1J7K A;  1IHM A;  3CCJ B;  3I64 A;  1FOW A;  2LYC A;  1KU9 A;  1E1R A;  1FNN A;  4M74 A;  3RI4 A;  2ZC2 A;  1JA0 A;  2XZP A;  3L7W A;  2DAO A;  4G6D A;  4PJ0 C;  2HCJ B;  3FM5 A;  3S3O A;  4IHT A;  1RES A;  2HZD A;  2KLO A;  2XVC A;  2V1X A;  2V1N A;  4FE4 A;  1P7J A;  5H6Q A;  4FIS A;  3L2V A;  1G2H A;  3K1P A;  1IAW A;  5C3E J;  5DTD A;  1OFC X;  3HG9 A;  3EUA A;  3J80 Z;  3S1R J;  3Q0V A;  3A2K A;  1I18 A;  1B8I B;  5A88 A;  3MVP A;  4HF0 A;  2F4I A;  5FO5 A;  3OYD A;  1GJR A;  1D1N A;  2E2I J;  1I6H J;  3FMR A;  1TTT A;  4AWX B;  3PJR A;  4U4B A;  3LAJ A;  1KRH A;  3X2Q H;  1E3O C;  2LK2 A;  4QSH A;  1RR7 A;  1SC7 A;  2DIE A;  1JTX A;  3Q39 A;  1B23 P;  2MLK A;  2OK7 A;  3S8P A;  1T0F C;  2VBV A;  1TWF J;  1FP2 A;  1RWR A;  4XOP A;  3OPO A;  1B9N A;  2QCO A;  1F4K A;  3PA1 A;  3FXL A;  2EFN A;  3ZQH A;  4YIR X;  1QVF B;  3NRV A;  1NBM A;  1BOB A;  1ZN2 A;  2BOL A;  2MW8 A;  3M8F A;  1FZP B;  4Q5S F;  2OBR A;  1K4Z A;  3QYE A;  4TN1 A;  3BTI A;  2R7W A;  3VEP A;  4E7J A;  2M3A A;  1MH3 A;  4OIO F;  2QTZ A;  2HR3 A;  3R6S A;  1VQ8 I;  1VQ7 B;  3I54 A;  1ETX A;  2VBY A;  1V0F A;  4F92 B;  2K5C A;  4ENJ A;  4XKB A;  4DZP A;  2MH9 A;  3CCE B;  2LG4 A;  3AKZ A;  2I1L A;  5CVV A;  3HBL A;  2AQE A;  4IZZ A;  1O8J A;  3E20 A;  4KIF A;  1PE9 A;  2QY1 A;  4X06 A;  3LYC A;  1YJ9 B;  3BJA A;  5J3O A;  3ERM A;  3KIO A;  1VLO A;  3VSU A;  4PC1 A;  2NSP A;  2X3H A;  2EPF A;  3OSG A;  3EQO A;  1FOX A;  3RYP A;  4D0P A;  3FDY A;  2V5I A;  2CMP A;  5DS9 A;  2FBH A;  5DCM A;  2Y30 A;  1R5I D;  3SQN A;  1T6Y A;  3HIF A;  3PSS A;  1LEA A;  2O61 A;  4KIB A;  3BG9 A;  3T8T A;  5FLV A;  3QFR A;  4BHB A;  1SEU A;  1H8H A;  4OJL A;  3GBG A;  1OB2 A;  3EPZ A;  1BIB A;  2PMD A;  1O8H A;  3UKG A;  2QGU A;  5D6E A;  5E3N A;  3GRH A;  3B6A A;  4Q47 A;  4GFB A;  5IYC J;  2HDC A;  1MMD A;  2BSP A;  2NVY J;  1YYV A;  3ERE D;  2L01 A;  1TWG J;  1ZAR A;  4O5V A;  3FXU A;  1XCB A;  4KYW A;  3HSE A;  3HSF A;  2O7O A;  5EEG A;  3OIQ A;  2BY2 A;  2DDB A;  4G7W A;  2H27 A;  2VT2 A;  2DA7 A;  5E3L A;  1IW7 F;  4AVP A;  1RQR A;  3R4K A;  3QPT A;  2DK8 A;  3LQQ A;  2E2H J;  2E36 A;  1WOS A;  1RUN A;  1Q81 D;  5HVQ C;  3OR2 C;  4I0A A;  1FSE A;  4BBR J;  5M5W J;  2FMY A;  3HJE A;  3VO1 A;  3AK5 A;  2VKE A;  3K9T A;  1VJS A;  2W82 A;  4KKT A;  3R0J A;  2XRL A;  4RMN A;  4DBQ A;  4G8X A;  2ZKZ A;  1QCX A;  3OIP A;  1SD6 A;  4HZF A;  4X1E A;  2EWN A;  4CA0 A;  3ZQ7 A;  1ACI A;  2PMU A;  4XM3 A;  2P81 A;  2F5D A;  3WTW C;  3BY1 A;  5KHD A;  3PNY A;  2EFG A;  1R1V A;  3JAM K;  1A8P A;  1IRX A;  4IL6 C;  4UZF A;  2QUF A;  4UY8 I;  5CPR B;  2RAE A;  3A01 A;  4L5I A;  1B2R A;  2NS8 A;  3HB9 A;  1WJB A;  1E3Z A;  2JDI A;  2LRE A;  5A2Q K;  1N05 A;  2Z8G A;  1OIS A;  1BL0 A;  1H42 A;  2O6G E;  2FQ4 A;  1XC5 A;  3ZMD A;  2HDN B;  1VQ4 B;  1YIJ B;  4Z4T A;  1O88 A;  4TT3 A;  2WSS A;  1GVJ A;  3CB4 A;  1V0E A;  3BG7 A;  5E3M A;  3ONY A;  2VFM A;  3RPU D;  4QUZ A;  3ABL H;  2QX3 A;  1KON A;  2XDV A;  3Q38 A;  1TWH J;  1QVG B;  5KW9 A;  1A35 A;  3GF2 A;  4IQJ A;  2ZNZ A;  3KFW X;  4CXF A;  1KMH A;  1USS A;  1MNE A;  4Z4U A;  2VFO A;  1AA7 A;  3RQ4 A;  1EWY A;  3GZ6 A;  2ZBK A;  4PGO A;  3JRB A;  3ISX A;  4P96 A;  1ZG1 A;  3VFZ A;  3FXM A;  2ICW G;  4KA4 A;  4Z4V A;  3TH0 A;  3F3X A;  3WE2 A;  2QZ8 A;  3PNT A;  4UUS A;  4RLQ A;  1DU0 A;  3HOZ J;  1OB5 A;  1Y0N A;  1IJF A;  4N4O B;  1PUE E;  2VFP A;  2YX7 A;  1AMO A;  2VAS A;  1K79 A;  2E1N A;  1IRF A;  3JW4 A;  1TYX A;  1MMA A;  1WI9 A;  1YJN B;  1C0W A;  4M6V A;  4RB3 C;  2JVG A;  4LB5 A;  3Q9S A;  3FPK A;  1XD7 A;  2OAZ A;  1SMY F;  2LBF A;  3C18 A;  3G6E B;  4XN3 A;  5HDN A;  1Y56 A;  4ZGQ B;  4BL0 B;  3RY8 A;  5FFZ A;  1ON2 A;  1E43 A;  2DMN A;  3J80 K;  1V5V A;  2RRE A;  2E35 A;  1U78 A;  3M8E A;  2OQR A;  2CV1 A;  2CQ7 A;  2DDA A;  3B8Y A;  4PJN A;  5GPA A;  2XHK A;  4I6Z A;  5BS6 A;  1F60 A;  3ZBT A;  2A3S A;  2BM5 A;  4Y7C A;  2HPI A;  1IJW C;  1EA0 A;  2G7H A;  3H9G A;  4Y15 A;  2QVO A;  1PJR A;  2ZJP F;  3J7Z I;  1TYW A;  1A6Q A;  2M4G A;  4E6K G;  1FT9 A;  3ISP A;  1KGS A;  5DS0 A;  4GRI A;  2DEU A;  3PSZ A;  5DD8 A;  2VT3 A;  5HLI A;  2YWG A;  5FKL A;  1KK2 A;  4YZA A;  2TRT A;  4JQF A;  1XB4 A;  2FA5 A;  2QEX I;  3IH4 A;  1TWC J;  3I1F A;  1FMV A;  1KZH A;  3COA C;  5ICE A;  1JRG A;  1WU8 A;  1ZM9 A;  3CJQ B;  2O1D A;  1VQN B;  2E7X A;  1HA8 A;  2W6I A;  2C5H A;  2FD5 A;  1W36 D;  1COW A;  2LRD A;  2L5Q A;  2PN6 A;  3K70 D;  4EQQ A;  1O8D A;  1OHH A;  5B66 C;  5JHF A;  4LB6 B;  1PXZ A;  2A61 A;  2NV4 A;  1I50 J;  3FXR A;  5B6I A;  1FNM A;  2XGC A;  5KK1 A;  2LC2 A;  1TW3 A;  1L0O C;  3ZMT A;  2CW7 A;  1R9T J;  1OCP A;  4YG2 F;  2GZW A;  3NAR A;  3P9C A;  3RKY A;  3ZPL A;  2HLD A;  1Y6I A;  3KRG A;  3HOW J;  4ESB A;  2ZJR F;  2ZSI B;  2PJR A;  2VJ4 A;  3LSP A;  4V2F A;  3CW2 A;  1BHE A;  4FCY A;  4ASU A;  1W35 A;  4PGH A;  1PJ5 A;  1IZ1 A;  1NHC A;  2Q6I A;  2KIS A;  2XPV A;  3QE2 A;  4YXW A;  2DXI A;  4ZCI A;  1DPR A;  3I55 I;  4HLY A;  3A03 A;  1T0F A;  4Y9R A;  3BZC A;  2EV5 A;  1UHS A;  3DKX A;  4OJO A;  4EM2 A;  3P9K A;  1OFE A;  3WU0 A;  2G7U A;  4OP7 A;  3FWE A;  1IG7 A;  2M0M A;  2IXS A;  2XPW A;  3BQZ A;  5E1W A;  1APL C;  2HOS A;  1UB9 A;  1F20 A;  5BPI A;  3LST A;  2VBU A;  4H4K C;  2FX0 A;  5FKM A;  3TDU C;  4OJP A;  5DD4 A;  3ZCO A;  1H80 A;  1JJ8 C;  3CUO A;  2BVN A;  3GSI A;  4FWT A;  1JHH A;  3O8G A;  1DG1 G;  2BHZ A;  1HQC A;  2GOX B;  1OCO H;  5E8I A;  1TP4 A;  1TT5 B;  3O3K A;  4D1Q A;  1EE6 A;  4AF7 A;  1GXP A;  2XEX A;  4C9Y A;  4E4H A;  2R5Y B;  4GYI A;  5BQT A;  5EGO A;  1XPX A;  4BYY A;  1WJA A;  3LAP A;  3ZP5 A;  4A3B J;  1U3E M;  1S72 B;  4LJZ F;  1OQY A;  2XB5 A;  5E3O A;  5EDN A;  5E1Z B;  3SYT A;  1HF2 A;  3J81 Z;  1IDJ A;  3W5V A;  4AVZ A;  4OPO A;  4MEY F;  4RDK A;  4QVJ A;  3G71 I;  4XOT A;  5FKN A;  4IHY A;  2W57 A;  3S1N J;  1OGM X;  4GXO A;  1G3Y A;  2JT1 A;  2L9N A;  2CJJ A;  2B0L A;  2XKP A;  3BJO A;  3K1N A;  3OIO A;  4CHU A;  2YWH A;  3W2E A;  2ZB9 A;  2FF4 A;  5DUK A;  1MIJ A;  1SVO A;  2IT0 A;  2R6H A;  1YIT B;  2DMQ A;  5BOX A;  1AHD P;  3QOP A;  1R22 A;  3E6M A;  3HRT A;  4HSR A;  1EKE A;  3J81 K;  3FBN B;  2CUF A;  1U9O A;  1D0Z A;  2UVE A;  2HQR A;  3BG5 A;  3LNQ A;  3Q3A A;  5IP7 J;  3JQQ A;  1E2X A;  3BR5 A;  1UD3 A;  1QJV A;  1T33 A;  1W0U A;  3DEE A;  2BVL A;  3MQ0 A;  4XKW A;  4ENM A;  3K69 A;  2V7T A;  3ECH A;  2VKV A;  2LSO A;  3E5X A;  4Z1M A;  4C43 A;  1TUI A;  3GQ8 A;  3FKJ A;  3CCQ I;  2W00 A;  3N97 A;  3T53 B;  3B78 A;  3ABM H;  3WBK A;  1UHM A;  1OFL A;  2D3N A;  1MBK A;  1QA2 A;  4XSX F;  1ZRC A;  2LKS A;  3KX2 A;  1FOY A;  2XPU A;  2V6E A;  1ENH A;  4IJA A;  1WJC A;  2D5V A;  4IKF A;  4WWV A;  2Y2Z A;  5ICC A;  3HGG A;  1YIT I;  3ZQG A;  1VQL B;  2DPD A;  4DQ2 A;  1Z91 A;  2Q6L A;  4PCQ A;  3SZE A;  4OOX A;  4P2N A;  1TW2 A;  3S15 J;  3BWG A;  4QV2 A;  2Y48 A;  1OYI A;  2NRA C;  3PO3 J;  4JYK A;  5H2F C;  1Y1W J;  2HVR A;  2BM6 A;  5F27 A;  4OWR B;  4P25 A;  3IP4 B;  2BBY A;  2HPM A;  2OD5 A;  3SDB A;  5FD5 A;  2VZL A;  3DTE A;  3IV5 A;  1KYW A;  3PIO F;  2K3F A;  1RZ4 A;  4ON0 A;  1ZRE A;  2DYI A;  2V31 A;  4KKS A;  4NK6 A;  1YJW I;  3SEQ A;  1DAB A;  2IGN A;  1BC8 C;  1QUE A;  3K4L A;  3ML6 A;  4YRV A;  1E3P A;  5H59 A;  3D0S A;  4CSW A;  3I4P A;  1WSR A;  2XTX A;  1Q1H A;  4DZJ A;  3DU5 A;  3KYC B;  3ZBU A;  5F1J A;  3MKY B;  4EEF G;  3TW7 A;  4XRS A;  3CO7 C;  3S14 J;  3B02 A;  4M73 A;  2UZK A;  3JRD A;  3LA7 A;  2V1U A;  1XX5 A;  3WTS C;  2R5Y A;  3FMQ A;  4L0Z B;  3UNG C;  1FND A;  2PLF A;  3LWF A;  2CUZ A;  4KNY A;  2DER A;  2AXT C;  1QZY A;  1ETO A;  4QPQ A;  3S1Q J;  4L5J A;  4RJL A;  4F3Q A;  4NDL A;  4HE5 A;  2FE3 A;  3G71 B;  3CCU I;  2GA2 A;  1TL8 A;  4AYB A;  1S9H A;  2CND A;  5J4Y A;  2G0E A;  2MGQ A;  3E3V A;  1QHH D;  1ZEL A;  3VWB A;  2K40 A;  1SFO J;  5FJ8 J;  1QA1 A;  2DTZ A;  2EA4 A;  1LM1 A;  1KQ5 A;  3W5H A;  3MWM A;  2W84 A;  3HM5 A;  3HRM A;  2AHQ A;  4Y13 A;  4WZL A;  2J8K A;  3UW0 A;  3NWT A;  3RZD J;  1BPL A;  1EFU A;  4C2U A;  2OBT A;  1FRN A;  1QVU A;  2FRH A;  4R71 A;  5CQE A;  3S2H J;  2DT6 A;  1QGA A;  4M53 A;  3GX4 X;  5TIS C;  4NC8 A;  2M5S A;  2ZZF A;  2MC4 A;  3W2W A;  4B3A A;  2K27 A;  2LY2 A;  2ZZQ A;  5BSX A;  3BR0 A;  3LL7 A;  3VYS B;  1CGP A;  2FML A;  4Y4R A;  4ACA A;  4YAL A;  1Z77 A;  5F6F A;  1FOK A;  2JJ1 A;  4HPQ A;  1J59 A;  3SLN A;  4G7X A;  4CCK A;  3CCV B;  3KYD B;  3BCD A;  3FHN A;  4B3G A;  4TKO B;  4EVI A;  1ZGW A;  4ZYA A;  1S7O A;  2PBI A;  3H3U A;  4U7D A;  2MLG A;  3TDZ C;  2X1D A;  2HTJ A;  1X3Z B;  4IHX A;  1GAW A;  3BY2 A;  4LLG F;  3KL9 A;  5EJC A;  4ETS A;  1G7C A;  4CYC B;  4S05 A;  3LMW A;  1R5H A;  1DDI A;  1OJL A;  5BSY A;  2AHO A;  5H20 A;  2CH0 A;  1EP1 B;  1NRK A;  2M30 A;  3OYL A;  4ZH4 F;  5M3F J;  1MRZ A;  1R36 A;  1RR8 C;  3ABU A;  3QOE A;  3WNB A;  2UVF A;  4EJT A;  1D2E A;  4PAA A;  3QPS A;  3ZOB A;  1YW9 A;  4AUX A;  3IL2 A;  2V9K A;  2BV3 A;  5EYR A;  3QU6 A;  1A6I A;  4U0W A;  4NBQ A;  3ZN0 A;  1HDD C;  1G3S A;  1N25 A;  2GK6 A;  5FO1 A;  5TR9 A;  2HYF A;  3HRU A;  2HZT A;  3S32 A;  4YFX F;  3K4J A;  4PGG A;  5GPC A;  2LD5 A;  1CZF A;  2EIN H;  3RSN A;  4B47 A;  3DPL C;  2IP2 A;  3DU1 X;  2ID3 A;  4G94 A;  2KIM A;  4A3K J;  4ESF A;  2JPC A;  3ROU A;  4ABZ A;  4L8J A;  3LSJ A;  5B3S H;  1Z21 A;  2DCE A;  2KDO A;  4V2G A;  5HS8 A;  4BEH A;  1AKH B;  1VQ6 I;  1V5G A;  2HKO A;  1IB0 A;  2WJY A;  4IRI A;  3E6C C;  4BPR A;  1UG0 A;  2H8W A;  3U2Q A;  4I0B A;  4PC2 A;  2M8G X;  5THX A;  5FRN A;  5IT9 K;  3WQZ A;  1JUS A;  1G7R A;  5DN6 A;  2JN6 A;  4MO7 A;  2RVC A;  1SAX A;  2NVU B;  2V4J C;  3CJT B;  2J8I A;  3BG6 A;  4WXH A;  1AU7 A;  4MTD A;  4KFC A;  4KH3 A;  1OGJ A;  5IT3 A;  4M0L A;  4OM9 A;  2E5N A;  1NB9 A;  1RQP A;  3CCJ I;  4FK8 A;  3MMP A;  4C2T A;  1E3X A;  4CGZ A;  3V8K A;  5AMV A;  4XIC A;  4YCQ A;  1IN7 A;  2H1L A;  4PSW A;  1S7A A;  4CQJ A;  2VFN A;  1T6S A;  1TTY A;  1QO0 D;  2RN7 A;  3E6B A;  3PA2 A;  1VQ6 B;  3OP1 A;  1X1B A;  2EB7 A;  3CC2 I;  4II3 A;  3OY9 A;  1Y8R B;  3AG2 H;  3H3Z A;  5E79 C;  4X6A J;  3KPH A;  5KNL A;  2GM4 A;  1BI0 A;  2DMU A;  2MFZ A;  2J5O A;  2Q1Z B;  5TJJ A;  2M7B A;  5JVT A;  4OZZ A;  5IPA A;  3BDD A;  3HKZ N;  4BS9 A;  4A3C J;  1OFM A;  4OIR F;  2X85 A;  2BXZ A;  2EV0 A;  2NS7 A;  3M3Y J;  2EIJ H;  2XC7 A;  1Q82 D;  2GXA A;  2M7A A;  1LFB A;  1ZTR A;  2I8D A;  4QLC U;  1ZLK A;  2VQG A;  4AIK A;  2Y31 A;  1YRN A;  3A3G A;  3LSR A;  4M1K A;  1XFO A;  2NAZ A;  1IV6 A;  4RAF A;  5FLX Z;  2E1C A;  2IGO A;  2HS5 A;  2X51 A;  3A1P A;  4II2 A;  3G6E I;  1LDK B;  4HQM A;  1LLZ A;  3VO2 A;  2FJ1 A;  3RPQ A;  1RC9 A;  2RC5 A;  2MD5 A;  4XLE A;  1EP3 B;  4ZYH A;  2EWE A;  4FXU A;  3JRG A;  1OGI A;  5DYM A;  5J4V A;  1KU7 A;  3F6V A;  4CZC A;  1P4X A;  1BOA A;  3W2V A;  4RB0 A;  4DYQ A;  2NYX A;  1L3L A;  5LRS A;  1AOY A;  2CQX A;  2BPO A;  4RGX A;  3H94 A;  1NB0 A;  2AXL A;  4LBY A;  3DXJ F;  3WOD F;  5D8L B;  4RCZ A;  3IWZ A;  1XQB A;  4XLP F;  1QU3 A;  4FX4 A;  2STW A;  2OJE D;  4HYE A;  3TO7 A;  3S2D J;  4A2U A;  1YLO A;  3ABT A;  2V26 A;  3L2W A;  3IKT A;  4DOZ A;  3OYF A;  3ZN1 A;  4R1H A;  3M4O J;  3Q9V A;  4JMQ A;  1MBF A;  4M4S A;  3ZMZ A;  2W4S A;  4BQO A;  1YW8 A;  1E17 A;  3NQO A;  3ML3 A;  1FDR A;  1MW7 A;  1Q7Y D;  2ZCW A;  2EIM H;  1XMK A;  2LTP A;  4M3E A;  2D74 A;  4ROX A;  3SYJ A;  1KU3 A;  4EJV A;  1P2F A;  2KP6 A;  5FA6 A;  4YDT A;  5ILU A;  5JLV C;  3VNU A;  4IRH A;  1WTH D;  4ZV4 A;  1U5T B;  5K7F A;  2BM7 A;  4XON A;  3OYC A;  4XLF A;  2CBX A;  2LR8 A;  3ULQ B;  1BC7 C;  4PFP A;  4JRA C;  1LQ1 A;  1MSF C;  1DP3 A;  4EJW A;  3B8H A;  1IV8 A;  3F9K A;  3FMS A;  1MJ9 A;  2HFH A;  1VQ5 I;  1XGM A;  2VLA A;  4PJJ A;  4P1V A;  2XAU A;  2RNG A;  2JUC A;  3DTK A;  4C3I J;  5M3M J;  4KIS A;  3CUQ A;  3Q3S A;  2KIF A;  4C30 A;  3DEW A;  1HST A;  2A6E F;  1B4A A;  2Z5U A;  1JGS A;  4CIC A;  2P0W A;  3BCB A;  2HOA A;  4EM1 A;  5D5U B;  2EQR A;  2PMZ N;  1B9M A;  1XMA A;  3QQA A;  1IRZ A;  5LHG A;  1AIP A;  2JN9 A;  5HNF A;  3BZK A;  3I59 B;  5F64 A;  4UUV A;  2XAJ A;  1U8B A;  1LFU P;  3H09 A;  3WGH A;  2XUB A;  4D5F A;  4OIQ F;  2BY0 A;  1W9X A;  2ZZE A;  3SEJ A;  3D5L A;  5IT9 Z;  1T08 B;  5D6F A;  4OZY A;  3BT9 A;  4P9U A;  4U0Y A;  3CCV I;  1WOO A;  3H1C A;  1BR4 A;  2EK5 A;  2X4H A;  1RET A;  3F8M A;  2AO9 A;  1Y39 A;  3CC4 I;  4EAT A;  3F0C A;  5D5V B;  2XGJ A;  5C1C A;  4F55 A;  4WWC A;  3NWS A;  4NNJ A;  4HDU A;  2FU4 A;  3FX3 A;  5LHI A;  4UUT A;  2O8K A;  5E20 A;  3WHC A;  4QVA A;  1HDP A;  1LEB A;  1BI3 A;  4RD6 A;  4CCL A;  1TSP A;  4M3B A;  1UCR A;  4ENN A;  2VI6 A;  4Z4R A;  1FBQ A;  1FMW A;  4U87 A;  1IA5 A;  5EMN A;  3OZV A;  2HNH A;  4AYB N;  1QH0 A;  1WKM A;  3K70 C;  2CFX A;  5GV8 A;  1TQM A;  5TGT A;  5HS7 A;  4DBR A;  2QKM B;  4Z2Y A;  1X1A A;  2HXI A;  3DV8 A;  4PUS A;  3M8J A;  2EFP A;  2L7K A;  3PFI A;  3W6J B;  3IRR A;  5IYQ A;  2L0K A;  3MZH A;  2F4O B;  3ASO H;  4A3M J;  3AVU A;  4CCJ A;  2RC4 A;  3ZQF A;  2QA4 I;  2IJL A;  4ZYE A;  4HST A;  1U2R A;  3E1Y E;  4RLF A;  4ANJ A;  2W6J A;  2ZTG A;  1ZK8 A;  3GW2 A;  3OR1 C;  2YWF A;  3IAS 2;  1H89 C;  4RAZ A;  1YLF A;  1GHC A;  2OQG A;  3LSG A;  5HLG A;  4MXN A;  3A4C A;  2KIQ A;  3FJO A;  3LOC A;  5FFX A;  2N8G A;  4RM0 A;  2GQQ A;  1I5Z A;  3I59 A;  5HDG A;  2LP0 A;  1BW5 A;  2VC1 A;  1ZLJ A;  1ZYR F;  1E0E A;  1EFR A;  1QQI A;  1S72 I;  4ACB A;  4BJ5 C;  2P5K A;  2WTE A;  4EMS A;  2DT5 A;  4F7Z A;  2XAG A;  1VZ0 A;  2VNK A;  1QPM A;  3AGP A;  2M8E A;  5D4R A;  5LBQ A;  3HTS B;  2JTV A;  2VPR A;  2YX4 A;  3F8C A;  1U6G A;  4MIM A;  1X4O A;  3VOE A;  5L3G A;  3SZP A;  4C3H J;  1DBG A;  4UAJ A;  2VQL A;  2CQN A;  4OU0 A;  4BE0 A;  2IS4 A;  2HDW A;  3O2P E;  1W5C C;  5LD2 C;  2ACJ A;  2QA4 B;  2FBI A;  4JK1 X;  3SUC A;  5JMC B;  3KP4 A;  1STZ A;  3FF5 A;  4RPD A;  1O8F A;  3F6O A;  1IUY A;  2JIZ A;  4WCG A;  5F0H A;  4UVC A;  1KQ8 A;  2KQR A;  1VQM I;  3OZW A;  3OZU A;  4GQN A;  4JX5 A;  1B59 A;  3F8N A;  4HNV A;  4RDJ A;  2QEX B;  2V9P A;  3ECO A;  4A69 C;  2E1M C;  2WC2 A;  4DNC A;  1Z9C A;  1FIP A;  1TC3 C;  4KIG A;  1QHG A;  3L2R A;  5JLX A;  1WSU A;  4HDV A;  1NH3 A;  4PJM A;  1ZR2 A;  1BX0 A;  5ICF A;  3SY2 A;  2DW4 A;  4RB1 A;  2NNN A;  2A68 F;  1QQ1 A;  3MFK A;  1LNW A;  1E64 A;  3ZXS A;  2CYY A;  4FQG A;  1UD4 A;  3EYY A;  3K4B A;  4ZJZ A;  1WI3 A;  4LK1 F;  3I56 B;  5GAG J;  3ZMS A;  3PO2 J;  3PUF A;  2E1O A;  3DBL B;  3E5U A;  2Y69 H;  1X1P A;  1MAB A;  3PQK A;  5LGU A;  3DLL F;  3S2W A;  1PKV A;  2M45 A;  3OW7 A;  1Q9S A;  2OA4 A;  3LNN A;  2XZO A;  3VSL A;  4TMX A;  1S8N A;  3H3V K;  1K61 A;  1MJB A;  3AVT A;  3Q0U A;  1WOR A;  2LY9 A;  3WGI A;  2B63 J;  2QTL A;  1OCZ H;  2ECC A;  2HGC A;  2VJI A;  2XNJ A;  2LDU A;  3GVK A;  4IOA F;  1P6R A;  3GFJ A;  1K7A A;  5D5W B;  4YEL A;  2DA2 A;  2X48 A;  3ZPN A;  5E1X A;  1A36 A;  1UEL B;  4BXF A;  2QSH X;  4B43 A;  4L9V A;  1P4M A;  2CW5 A;  4C2L A;  2FSW A;  4PC3 A;  1JKO C;  2ETH A;  4B09 A;  5CDF A;  2ELH A;  4LG0 A;  2P6S A;  3H92 A;  3FHZ A;  1D8T A;  3ZZ0 A;  1FLI A;  2IA1 A;  2BXY A;  2Y0M A;  2XC1 A;  3IWF A;  3WGG A;  3GTQ J;  4FHT A;  1R1T A;  1EP2 B;  1EH6 A;  1GV5 A;  3TOA A;  4B48 A;  1Q1V A;  1RMG A;  1HLV A;  1ETY A;  2K4B A;  2KL4 A;  3HOX J;  3CRZ A;  4X05 A;  2HKX A;  4ZYG A;  1X58 A;  1YG2 A;  1WQ2 A;  2NNY A;  1VQO I;  1J0R A;  2INV A;  3VYU B;  3F23 A;  3WTV C;  3CF5 F;  4CCO A;  2ZFU A;  1VQP I;  1JI8 A;  2XKO A;  4NHJ A;  4FE7 A;  1O8L A;  2LOO A;  2NOG A;  3VPR A;  2R5Z A;  4L9N A;  4B44 A;  1GDT A;  2W85 A;  5GP9 A;  4AIJ A;  3W2G A;  2AQF A;  2CRG A;  2NT9 A;  4DGW B;  5J40 A;  1D3Y A;  4LC0 A;  2FOK A;  1QFJ A;  4ZGN B;  3P4G A;  4NCN A;  3KEO A;  2KRF A;  1P4A A;  2DOF A;  5J47 A;  3DWL E;  3IRQ A;  4B3X A;  3SLD A;  2UXN A;  2HQ5 A;  4CUG A;  3VMW A;  2F6C A;  3PSI A;  4UZE A;  2F1M A;  2HWV A;  1BI1 A;  1T5E A;  4AD9 A;  1AWC A;  5D4S A;  2OPT A;  2CSO A;  1LVK A;  5K5O A;  3AL0 C;  3H36 A;  1WZ2 A;  3C3W A;  3QYB A;  4D9J A;  4M71 A;  4TV7 A;  2KRH A;  3HC7 A;  1NHA A;  3BQY A;  3JRF A;  3ZZT A;  3NAW A;  4YZQ A;  2XTY A;  1UD2 A;  4BEH B;  1AKH A;  3D5S C;  2Q2E B;  4MGR A;  3AG4 H;  3JQR A;  3TP3 A;  2PEX A;  3GQ7 A;  2R93 J;  3A02 A;  4YFK F;  1MMS A;  2NPF A;  3AFH A;  3HXL A;  3N05 A;  5FGM A;  3JAM Z;  3FPP A;  2EFW A;  3CDL A;  4KT6 A;  4HNT A;  3KE2 A;  4LLN A;  4WF2 A;  4YAW A;  3GVL A;  2NTB A;  3KP3 A;  2B9S A;  2K85 A;  4H0E A;  3TP0 A;  1TBX A;  2Z6B D;  5L3F A;  3C2B A;  2P7C B;  2W7N A;  3KZY A;  4FX0 A;  4A3I J;  1H88 C;  2DYR H;  5IYW A;  1VQL I;  3V42 A;  2BW3 A;  1K9M D;  5HXB A;  1TQI A;  3VDX A;  1KTV A;  1RKT A;  5IYB J;  1B72 A;  4RD2 A;  1Z6T A;  3OYB A;  2IA0 A;  4ZDP A;  3V7C A;  2R7O A;  1R5G A;  2EZL A;  1ONV A;  4G12 A;  4BQA A;  1DP7 P;  2V7V A;  2CQK A;  4G1B A;  1N77 A;  3S17 J;  9ANT A;  1FSH A;  1J9Z A;  3VSV A;  2VOO A;  2IS2 A;  2ECB A;  4X7D A;  2Q8K A;  4PDK A;  3SJM A;  1RNL A;  3B6C A;  2VJJ A;  1D5Y A;  5JI6 A;  1VQK B;  5DV5 A;  1HXD A;  2BZT A;  3BR1 A;  2KPM A;  3GLX A;  2DK5 A;  1VQN I;  5GTH C;  1HKS A;  3HGY A;  2Y9Y A;  1K5C A;  1D1B A;  1X2M A;  3QP6 A;  2BHY A;  1CF7 B;  3B90 A;  2BEO A;  2XGD A;  4XID A;  3BR2 A;  2R7R A;  2MG4 A;  2A6T A;  1QNT A;  1X3W B;  4WZE A;  3ZSC A;  2F48 A;  2UUZ A;  2ZJQ F;  2R7D A;  2BM4 A;  2Y0S A;  1FNC A;  5L3E A;  2E2J J;  1IXS B;  2MC3 A;  2WR8 A;  3CLO A;  3V7R A;  5DEQ A;  3PUB A;  1M90 D;  3MHP A;  5HDK A;  3WXM A;  1OCR H;  1SFK A;  2CW8 A;  2EIL H;  3K7A J;  4QIW N;  4EH1 A;  1KD1 D;  3HZJ A;  4KMF A;  3BNW A;  2FXA A;  3MZY A;  2V79 A;  3OS2 A;  2QXZ A;  1IXR C;  3AL0 B;  3PNV A;  1LJ9 A;  3Q5F A;  5AIP A;  2BMW A;  1VQ9 B;  2VBK A;  3GFL A;  1ULY A;  4UVB A;  1JUM A;  1VHE A;  1JTA A;  2XIG A;  2H1K A;  1GQ8 A;  4RD0 A;  1JKP C;  1GV2 A;  1YX3 A;  2KDZ A;  2M0C A;  3G1M A;  4IQ4 A;  4A3G J;  4Z03 A;  3GVA A;  4LG0 B;  1OGO X;  4BHC A;  1MD0 A;  5IY5 H;  4L9J A;  1NTC A;  3TKY A;  1DQU A;  1B8I A;  3PVD A;  2K9N A;  3WU2 C;  1TVC A;  1ZM3 A;  1RI7 A;  2D3L A;  2JA2 A;  2QM3 A;  3WTZ A;  1BX1 A;  1GR1 A;  2X6X A;  2XNC A;  3CLQ A;  4G6I A;  2QQB A;  2LBF B;  3LSH A;  3GTJ J;  1W36 C;  1MDM A;  1S29 A;  3QPH A;  1I1S A;  2GQF A;  3ZR8 X;  3T0Y A;  4JOM A;  3F21 A;  1KJZ A;  2ZTN A;  2K4J A;  3LSI A;  2DA3 A;  3BC9 A;  4XD7 A;  1RU4 A;  1X0C A;  3ZPP A;  2E7W A;  4HX7 A;  1DUX C;  2XGE A;  1K4S A;  3H5R A;  2JA5 J;  1JXS A;  2GIV A;  4ZC3 A;  3CCE I;  1YE9 A;  2R5Z B;  2ZME C;  5AIQ A;  1F5T A;  5E8G A;  1IUF A;  5FKO A;  2HXO A;  4DJA A;  1ZKG A;  1IN8 A;  2YPR A;  2Z16 A;  2PE3 A;  3H5A A;  4LIT A;  3OYE A;  5ERI A;  3CUQ B;  4ZZL A;  4BE2 A;  4MFD A;  2ZZG A;  5ILS A;  2E19 A;  1F1Z A;  3ASS A;  5CQG A;  2CFO A;  5DNS A;  4O6J A;  5M5Y J;  3CCR B;  3SDG A;  3H5N A;  1ZG3 A;  1SKY B;  1HW1 A;  2WAF A;  2E1R A;  4KKU A;  3VST A;  3S1M J;  2C78 A;  2XT2 A;  3ZUG A;  1N75 A;  1EFC A;  2QEN A;  2QMU A;  2GXG A;  3PFY A;  4Z6Y A;  1WJD A;  2O0W A;  1K4T A;  2M1B A;  5DDG A;  4WK8 F;  2Z99 A;  3JRI A;  3KEW A;  2O04 A;  1HW5 A;  1R5N A;  3ZQL A;  5GAD J;  1R49 A;  3OW2 B;  1UG2 A;  3A1Y A;  2OTL I;  3O8H A;  1MGT A;  3HUG B;  1YTY A;  1A04 A;  3V7A A;  3KLN A;  1HKQ A;  3A8J A;  1CLW A;  1RRJ A;  4X8I A;  3BTL A;  3GLL A;  4NQW B;  1VTN C;  4G7Z F;  1HZE A;  4RD4 A;  2HQN A;  1QRY A;  5HZB A;  3C2H A;  1XSV A;  4HRI A;  1W0J A;  1XG1 A;  1DGR M;  2BE5 F;  2ELJ A;  3VYT B;  4WZK A;  3ONU A;  5TY0 A;  4OOV A;  1BLI A;  4RLZ A;  4HV5 A;  1O8K A;  2VBW A;  1LPQ A;  3G4S I;  3HHH A;  4G6Q A;  2VNI A;  3T9G A;  1CNF A;  2GIZ A;  3AG3 H;  2NVT J;  3M1C A;  1KQS B;  1MND A;  2JSP A;  1WJE A;  4UV8 A;  4WXC A;  3W2A A;  2ZL7 A;  4I84 A;  3F22 A;  3T1B A;  1NK2 P;  2IAI A;  3RIQ A;  2L9S A;  2VBS A;  2C77 A;  1MBH A;  1MBJ A;  3TO9 A;  1FBU A;  1TQP A;  1U0J A;  2DFE A;  1BN5 A;  4AIH A;  4KMU X;  4EM0 B;  1BMF A;  2F1L A;  4XR6 A;  2QSF X;  5HKK A;  1KYZ A;  3IH2 A;  3CES A;  2B0R A;  3FK6 A;  2BM0 A;  1O3R A;  2W24 A;  1FIA A;  4BUP A;  5FNZ A;  4F7D A;  4LOC A;  1K73 D;  1O8G A;  3N6Z A;  1L1I A;  3H9Q A;  1V5E A;  3DEU A;  1H85 A;  1U2W A;  4I01 A;  2QBY B;  4RBO A;  5FRO A;  2PYG A;  1N0U A;  2K9M A;  3VSK A;  3VR6 A;  2VBM A;  3DFG A;  4PK4 A;  1Y0Y A;  2XRO A;  2KZG A;  3BLY A;  3CDI A;  4YAO A;  2R7X A;  5FB2 A;  1N0V C;  4ASN A;  4UHT A;  3S3N A;  1OFD A;  2O6W A;  2TCT A;  4XLA A;  5KAF C;  3WE3 A;  1P92 A;  5HOD A;  1ORK A;  3MCZ A;  1N78 A;  2KFD A;  2QSG X;  3PEN A;  4M6Y A;  4UV9 A;  2XT4 A;  1X1C A;  1MNM C;  3S93 A;  2Z3Y A;  3OFN A;  1PJ6 A;  2XB0 X;  1WJF A;  2IOU G;  2QKL B;  1V5F A;  2D1H A;  2ZJ2 A;  4B3F X;  1H9T A;  2CQQ A;  3J81 k;  3GIR A;  5KVR A;  2G0Y A;  3OS1 A;  4M6X A;  1JTY A;  4RGR A;  2YSR A;  3ZMU A;  4G9Y A;  3OYM A;  2FNA A;  2YWE A;  5F4J A;  2HMA A;  4QPO A;  5A89 A;  1VQK I;  3QU3 A;  2KJB A;  1G7S A;  3P27 A;  5F4M A;  3T8R A;  1IGN A;  3H9J A;  4DYR A;  1W5T A;  4NQW A;  4E7K A;  3DF8 A;  1TYU A;  3DTI A;  4I2O A;  4IRG A;  4OOS A;  1YQA A;  2GAU A;  1P7I A;  5HZA A;  5TV2 A;  1SVL A;  3FXK A;  3DQV C;  3JCU C;  4KT5 C;  4ZDL A;  3SJZ A;  5JLW A;  4PC7 A;  2J5P A;  3U1D A;  1XSD A;  4TMT A;  3RIR A;  3CCM I;  5J3L A;  2O0Y A;  2OU2 A;  3M07 A;  4IF4 A;  1YI2 I;  4RB2 C;  1KK3 A;  2K7L A;  6PAX A;  1OB0 A;  1FP1 D;  3ESW B;  4E7I A;  1YOV B;  2R7S A;  3ES9 A;  3OYH A;  1FPQ A;  2DOA A;  4ZYD A;  3W6V A;  3DBH B;  4URR A;  3BP8 A;  1A31 A;  3JRH A;  1O7F A;  1H8A C;  1JGG A;  2ZNY A;  4YFN F;  2L9R A;  4ZTJ A;  1DGW Y;  1XGS A;  2EFO A;  2YU9 J;  2ADU A;  2Y0S N;  4HNU A;  3ABK H;  4M9S A;  3WTT C;  2E1B A;  3R6J A;  3FK7 A;  3OMY A;  3I4M J;  4J19 A;  1BN8 A;  3I71 A;  2IS1 A;  1U5T C;  3IAM 2;  3HOY J;  4EJU A;  2DT7 B;  2KZV A;  1XG2 A;  2HQA A;  3TQN A;  1QRC A;  1LKX A;  2RKH A;  4XOR A;  5F08 A;  1XDU A;  1G3T A;  4A6E A;  3A01 B;  4P3Y A;  5AN9 A;  1GLN A;  5DCM B;  2VPL A;  4NK8 A;  2JQ7 A;  2JJ2 A;  1JT6 A;  1SAN A;  1HC8 A;  3CO6 C;  2V6C A;  2LNB A;  1K6O A;  4KJZ A;  1REP C;  3SXY A;  2ZIT A;  4XK4 A;  3U1K A;  3HUG A;  2R7U A;  1XDS A;  3OJW A;  4XLN F;  1I27 A;  2ID6 A;  2R7F A;  2R0Q C;  1W0T A;  1R71 A;  3PUN A;  4OIP F;  3HOS A;  2DLL A;  3BH6 B;  3HPG A;  3QPL A;  2OV7 A;  5A8A A;  3FY3 A;  5IOY A;  4OAY A;  3CME I;  2EV6 A;  5K7H A;  3VYR B;  3EUH A;  1I3Q J;  3RJP A;  1HA3 A;  2RNJ A;  4PSX A;  2XAS A;  3WG9 A;  2XGX A;  1TT0 A;  3AST A;  3CCR I;  2L3D A;  2CV0 A;  2XRN A;  5K1Y A;  5DM6 F;  1WVR A;  2K86 A;  1H8E A;  4UNO A;  1W2B B;  2KVO A;  4JBA A;  3C7J A;  2FQ3 A;  3DP7 A;  1KK0 A;  2BY1 A;  2DO7 A;  1FJL A;  1IF1 A;  3D1N I;  3WNC A;  2C2W A;  3T5X A;  1HVX A;  4KN4 X;  2IA2 A;  1FYM A;  2PX9 A;  5EGO B;  2R9V A;  1GO2 A;  1ZHF A;  4NBS A;  5F0C A;  2FUG 2;  1OPC A;  1WFX A;  1YIJ I;  3TGN A;  2DPU A;  3W2I A;  2F4N A;  5LHH A;  4G1V A;  2XV4 S;  2F43 A;  5K5R A;  1KC8 D;  3CJR B;  2QDX A;  1OCC H;  3QP5 A;  2VNH A;  2QBY A;  3CMA B;  4HLX A;  2ME0 A;  3A35 A;  3GO5 A;  3A0B C;  2WAQ N;  2Y9Z A;  1POG A;  3AAF A;  1T6X A;  1R5B A;  2DMP A;  2R7V A;  2JA8 J;  1XB2 A;  2WZP P;  5CKT A;  1VHO A;  1DU6 A;  3WU1 B;  3DPT A;  1RPW A;  2J7K A;  2OBS A;  2INU A;  3CCY A;  2VL8 A;  3MN2 A;  1JB9 A;  4HQE A;  1O7L A;  2WB1 A;  3BCA A;  4U49 A;  3RPU A;  4BHP A;  5LGT A;  1TLL A;  2V7X A;  1MJA A;  1TYV A;  5LFA A;  4S0H B;  4AU7 A;  2PYH A;  4K1X A;  1QVT A;  3NEU A;  1QX4 A;  5FIU A;  4DQK A;  4UXN A;  3KEY A;  4UUS B;  1G8X A;  3AVW A;  4W8R A;  3KLO A;  4A5M A;  2H09 A;  4MTE A;  2VUM J;  2WV0 A;  2GBY A;  1E3H A;  3CCS B;  3CC2 B;  5CJ9 A;  5AON A;  3GFI A;  2WV1 A;  1W0K A;  3EDP A;  1TZL A;  5DUI A;  3HOU J;  2VON A;  3CCL B;  4DYC A;  1HF0 A;  4G5G A;  2ZO4 A;  1Y0U A;  3VB2 A;  4PAB A;  1EJ9 A;  4E7H A;  2CV2 A;  4PZJ A;  4DK0 A;  2IS6 A;  2WZN A;  1TLH B;  2XZL A;  3V8L A;  1FC3 A;  4BU2 A;  4C0S A;  3CMM A;  3BR6 A;  3EUH C;  3RYR A;  1E79 A;  2WJV A;  1DPU A;  2JA6 J;  1K6Y A;  2M5W A;  2I10 A;  4UZU A;  1JJ6 C;  4OOI A;  2DFF A;  5IP9 J;  2AS5 F;  2EIK H;  3TMO A;  3B4N A;  1MBG A;  1WH5 A;  1Z1D A;  3U21 A;  5F4O A;  1WJ5 A;  5H6R A;  1LB2 A;  1WGX A;  4HAM A;  5J1U A;  4OPV A;  2IGK A;  3DLA A;  4GO1 A;  4N9I A;  2KT0 A;  4NC6 A;  4XRS G;  4LBZ A;  2VQC A;  1I39 A;  5GAE J;  2HOT A;  2C4U A;  3I55 B;  1ZGA A;  4FTH A;  4XBF A;  1QFY A;  2FX3 A;  1R00 A;  2KMU A;  4BQN A;  3HDD A;  5EEH A;  5E18 F;  1YX2 A;  4A3E J;  1U8R A;  4ZZD A;  3K0L A;  4H9G A;  4RD1 A;  3LFU A;  1UMK A;  1NDH A;  1J75 A;  3HYI A;  3MCA A;  2QWW A;  4V02 C;  1YRN B;  3I53 A;  1QGP A;  3EET A;  1XGO A;  1VQM B;  4IEJ A;  1IN6 A;  3U9G A;  1S5L C;  2ESH A;  3KZZ A;  1G59 A;  3DKW A;  1J9I A;  1PYV A;  2WAD A;  4L9T A;  4X0C A;  1CQT A;  1SFE A;  1G4D A;  4HF2 A;  1GAQ A;  3OEH A;  3I0T A;  2NOJ B;  4ITV A;  4ZTF A;  1KK1 A;  3W2F A;  4M9Z A;  5LGN A;  1DDG A;  1EXM A;  2F5F A;  1RIO H;  2QE7 A;  4G6T B;  1EH7 A;  4KIT B;  2VOP A;  3JUR A;  2W25 A;  2LKX A;  2OZ6 A;  3FKS A;  4L18 B;  2DA5 A;  3BR3 A;  2IRF G;  2BSA A;  1IB4 A;  2CUJ A;  3DKY A;  4BKX A;  2PLY A;  3NAU A;  3OL3 A;  2P3M A;  1VQ8 B;  1LUJ B;  2GJP A;  2ZFW A;  3LO8 A;  1WMR A;  4N3G A;  1EZG A;  4NC7 A;  2DA6 A;  2VB6 A;  2EZI A;  1EFT A;  2X0K A;  4U9U A;  2ELK A;  1D0Y A;  4N4N B;  2JVH A;  4RDU A;  1VBL A;  3OWT A;  2K9L A;  4D7N A;  3SZG A;  2MAB A;  2OC6 A;  4OAZ A;  3OYG A;  4RD3 A;  2DOD A;  1JJ2 B;  4IOC F;  3JRE A;  1WWX A;  2DU9 A;  1WP6 A;  1BBY A;  1KU2 A;  4C2M J;  2PQ8 A;  2CGP A;  4AM3 A;  4LK0 F;  3BPV A;  2BV6 A;  3FBI B;  4GDF A;  3FKI J;  3GQ9 A;  1YHQ B;  3FIW A;  1FX0 A;  3OV8 A;  1U5T A;  2PG4 A;  5HNH A;  5FD6 A;  1J5Y A;  1M1E B;  5F04 A;  3WTU C;  3OSF A;  3W5U A;  1QZE A;  1YJ9 I;  4RM3 A;  1XMX A;  1Z0X A;  3L00 A;  5ILV A;  5EZG A;  3WTX C;  2D9R A;  3EYI A;  1HW2 A;  4RAG A;  4W97 A;  1O57 A;  1D0X A;  2I5U A;  2WY7 Q;  2D1V A;  3DCF A;  3HKZ A;  4NB5 A;  3QFS A;  2HTS A;  3CME B;  3FXJ A;  1BJZ A;  1VFC A;  2Z33 A;  3J7A O;  3BOQ A;  3D5R C;  1D1C A;  2O17 A;  2KKO A;  1IJE A;  1ZM4 A;  2BM1 A;  4OJ6 A;  1OYW A;  2VKD A;  1R23 A;  4HX8 A;  5EG0 A;  3GTP J;  1YJW B;  5IYD J;  2LLK A;  2L7Z A;  3L2C A;  3CZ6 A;  2WAE A;  4HV6 A;  4J00 A;  1ZRF A;  5H5J A;  1T8I A;  4IX7 A;  3FIS A;  2D2W A;  3ZQC A;  2H8R A;  1YI2 B;  1GT0 C;  2KIU A;  2ISY A;  2EJR A;  2JWT A;  1N07 A;  4M9X A;  2B7E A;  2DBB A;  3JU4 A;  2XF6 A;  1AIR A;  1YS6 A;  2VNJ A;  4X07 A;  1FTZ A;  2V9V A;  1XS9 A;  3NB2 A;  1JA1 A;  4UB8 C;  2GWR A;  5LLQ A;  1FRQ A;  4UB6 C;  2VOD A;  4LGW A;  3GTM J;  4P55 A;  1NJI D;  3R6K A;  2L4A A;  1ELO A;  1MSE C;  1Y0R A;  3I4N J;  3HPH A;  1EA3 A;  1HKT A;  4HOB A;  1VQ7 I;  1E63 A;  3I56 I;  2ZXH A;  1DAR A;  3WND A;  2X9D A;  3MZ8 A;  1R58 A;  3N4M A;  2M9H A; 
#chains in the Genus database with same CATH homology
 4C2U A;  2IGM A;  1O8M A;  2HU9 A;  3DPU A;  5CQE A;  2DT6 A;  1YX3 A;  1J09 A;  4IQ4 A;  3BC8 A;  3LSK A;  4Z03 A;  3GQB A;  4NC8 A;  1OGO X;  2M5S A;  2ZZF A;  2MC4 A;  3W2W A;  2LY2 A;  3QYF A;  2ZZQ A;  1KCC A;  1DQU A;  2VJ5 A;  3LL7 A;  4PFO A;  3VYS B;  4J01 A;  2D3L A;  2JA2 A;  4Y4R A;  4XQF A;  2HVQ A;  1VF7 A;  2X6X A;  2JJ1 A;  4HPQ A;  3UR3 C;  4BDZ A;  3J7A Y;  3K4N A;  3LSH A;  2LBF B;  4CCK A;  2R7T A;  4G6I A;  4G7X A;  1W36 C;  2KRC A;  4LG3 A;  3FHN A;  3BCD A;  4B3G A;  4TKO B;  4ZYA A;  3ZR8 X;  4JOM A;  1RU4 A;  1X4P A;  2ZTN A;  3LSI A;  3BC9 A;  4XD7 A;  1X0C A;  3OYN A;  3ZPP A;  2X1D A;  3H5R A;  2LY1 A;  4ZC3 A;  4BAC A;  1YE9 A;  2WY8 Q;  2V4D A;  3BH4 A;  1UD6 A;  3LMW A;  4EW9 A;  2WA0 A;  4F93 B;  1X19 A;  4DJA A;  3MKZ A;  3RCO A;  2CH0 A;  1NRK A;  2MD0 A;  3OYL A;  2Z16 A;  2VIX A;  3H5A A;  4LIT A;  3DU6 A;  3MD2 A;  3OYE A;  3QOE A;  4BE2 A;  2ZZG A;  3ZQQ A;  1HG8 A;  2UVF A;  5C1E A;  5CQG A;  2CFO A;  2M4K A;  2ODL A;  2NST A;  1UD8 A;  2NZM A;  3H5N A;  2V9K A;  1SKY B;  2WAF A;  4KKU A;  4BDY A;  2GK6 A;  4BJ6 C;  3VST A;  2RQQ A;  2XSJ C;  3L2U A;  4U7B A;  2NT6 A;  1N75 A;  4MR0 A;  3K4K A;  3S32 A;  3K4J A;  1CZF A;  4XLH A;  3PFY A;  4R79 A;  3RSN A;  1WJD A;  4B47 A;  2O0W A;  4W8Q A;  3DPL C;  2PMZ A;  3T56 B;  4PJL A;  4L8J A;  3KEW A;  2O04 A;  4XL9 A;  1Z21 A;  2DCE A;  2KDO A;  4BEH A;  2ZXI A;  1V5G A;  2WJY A;  3A1Y A;  4Y33 A;  3DDY A;  3T51 B;  1UG0 A;  3HUG B;  1WPC A;  3I3L A;  2V7Q A;  3L2Q A;  3OYK A;  2XND A;  5FRN A;  3WQZ A;  4Y3O A;  1KTW A;  4NQW B;  4ZDO A;  1HZE A;  5DN6 A;  2LYC A;  3PL8 A;  3RTR A;  1E1R A;  3C2H A;  3OS0 A;  1NG6 A;  4HRI A;  1W0J A;  2E1M B;  2V4J C;  1DGR M;  3BG6 A;  4HWV A;  2E60 A;  1KCD A;  2ELJ A;  2XZP A;  3VYT B;  3PSF A;  2E5N A;  3ZRG A;  1BLI A;  3S3O A;  1O8K A;  3ZIA A;  4C2T A;  2HZD A;  1Z3Y A;  2KLO A;  1E3X A;  5AMV A;  2V1N A;  3L2V A;  3T9G A;  4PSW A;  3M1C A;  1MND A;  2JSP A;  3HG9 A;  1WJE A;  3W2A A;  3EUA A;  3A2K A;  4I84 A;  3MKW B;  1I18 A;  2VBE A;  1X1B A;  2F4I A;  4II3 A;  3OYD A;  3C2G A;  3OY9 A;  2L9S A;  2W1O A;  5KNL A;  3PJR A;  3OAA A;  4U4B A;  2MFZ A;  2Q1Z B;  1P9Q C;  1U0J A;  2M7B A;  3MMY B;  4OZZ A;  4BS9 A;  1OFM A;  1BMF A;  2X1E A;  2KHM A;  4XR6 A;  3G05 A;  4Z05 A;  2DIE A;  5HKK A;  2X85 A;  3CES A;  4F52 A;  1IDK A;  2XC7 A;  2E5Z A;  1T0F C;  3S8P A;  2M7A A;  2I8D A;  1RWR A;  4XOP A;  4BUP A;  2VQG A;  3OPO A;  2CK3 A;  3A3G A;  1O8G A;  3H9Q A;  1V5E A;  3CP8 A;  4F91 B;  5FRO A;  2IGO A;  2PYG A;  2K9M A;  2X51 A;  3E0J B;  3TL4 X;  3VSK A;  1BOB A;  2BOL A;  4II2 A;  1NBM A;  1LDK B;  3ZGK A;  1OR7 C;  3OE7 A;  3VR6 A;  4PK4 A;  2VBM A;  4Z06 A;  3QYE A;  3BLY A;  2R7W A;  2EWE A;  4XLE A;  2V7F A;  3SEZ A;  2R7X A;  4E7J A;  1KZL A;  2M3A A;  4FXU A;  3S3N A;  1DBO A;  4XLA A;  4CZC A;  3W2V A;  1V0F A;  4HIZ A;  4F92 B;  2K5C A;  4XKB A;  3OYJ A;  1N78 A;  1T95 A;  4W8T A;  2LG4 A;  3AKZ A;  1BR2 A;  2AQE A;  4IZZ A;  3H94 A;  1O8J A;  1X1C A;  1PE9 A;  2QY1 A;  3S93 A;  3OFN A;  1WJF A;  2VQH A;  2QKL B;  1V5F A;  3VSU A;  1QU3 A;  4B3F X;  2NSP A;  4XKC A;  2X3H A;  3EQO A;  3OS1 A;  2WPD A;  3CF2 A;  3FDY A;  2V26 A;  3L2W A;  2CMP A;  4DOZ A;  3OYF A;  3OYM A;  4YEJ A;  3KYL A;  4JMQ A;  2W4S A;  4BQO A;  4QPO A;  3A3B A;  1MW7 A;  3VMV A;  3OL4 A;  2Z2S B;  2UV1 A;  1H8H A;  3H9J A;  3GBG A;  4OJ5 A;  3EPZ A;  4OJL A;  2KP6 A;  1O8H A;  2ZSH B;  4E7K A;  3GRH A;  3DTI A;  1OOC A;  1WTH D;  1MMD A;  2BSP A;  2R7Q A;  4XON A;  1MMG A;  4E0F A;  2BW3 B;  4E7S A;  3OYC A;  4XLF A;  1NG7 A;  4HEA 2;  3OIQ A;  4ZDL A;  3DQV C;  4G7W A;  3GQA A;  4PFP A;  1DP3 A;  2VKH A;  5FL7 A;  3F9K A;  3K6G A;  2PEC A;  2VLA A;  4PJJ A;  3K10 A;  3OOU A;  4BGD A;  3LMM A;  2XAU A;  1OB0 A;  5HVQ C;  2RNG A;  3DTK A;  3OR2 C;  4E7I A;  3OYH A;  2R7S A;  2DOA A;  1Z3X A;  4KIS A;  4C30 A;  4URR A;  1VJS A;  2W82 A;  4KKT A;  2L2O A;  2P0W A;  3BCB A;  4ZTJ A;  4RMN A;  2NTQ A;  4DBQ A;  1DGW Y;  4RM2 A;  1QCX A;  3OIP A;  5HNF A;  4HNU A;  2E1B A;  4CA0 A;  3OMY A;  4XM3 A;  1BN8 A;  2IS1 A;  3VMW A;  4P1W A;  3IAM 2;  3PNY A;  2XF7 A;  5KHD A;  1W9X A;  2ZZE A;  3D5L A;  2DT7 B;  2KZV A;  1UD5 A;  2HQA A;  1XG2 A;  1IRX A;  1LKX A;  4OZY A;  4XOR A;  5CPR B;  2JDI A;  1GLN A;  1E1Q A;  4P22 A;  1WJB A;  1BR4 A;  2VPL A;  1E3Z A;  4NK8 A;  2LRE A;  2HVS A;  2JJ2 A;  2Z8G A;  4EAT A;  5HOO A;  2XGJ A;  5C1C A;  2F5V A;  4F55 A;  3NWS A;  4KJZ A;  4X0G A;  4NNJ A;  1O88 A;  4TT3 A;  2R7U A;  2WSS A;  1V0E A;  3BG7 A;  3RPU D;  4CCL A;  3HOS A;  2QX3 A;  1KON A;  2XDV A;  3HPG A;  2OV7 A;  4U87 A;  1FMW A;  4FAS D;  1IA5 A;  3FY3 A;  4IQJ A;  2HNH A;  3K70 C;  1KMH A;  1MNE A;  5TGT A;  1AA7 A;  4OAY A;  2QKM B;  4DBR A;  3OOC A;  1X1A A;  3RQ4 A;  3VYR B;  4PUS A;  3M8J A;  2GJK A;  4W8S A;  2L7K A;  4PSX A;  1UAA A;  3GVJ A;  2X6W A;  2NTP A;  3PNT A;  1TT0 A;  4RLQ A;  3K4M A;  3HOT A;  4N4O B;  3K4C A;  2CV0 A;  4CCJ A;  2VAS A;  1H8E A;  1MMA A;  2QXZ A;  4XKV A;  4HST A;  2KVO A;  4NUB A;  4RLF A;  4ANJ A;  2W6J A;  2JVG A;  3OR1 C;  2ZTG A;  4LIV A;  3IAS 2;  3ONQ A;  2LBF A;  3EUK L;  4XN0 A;  3LSG A;  2LZJ A;  4XN3 A;  1Y56 A;  1HVX A;  3A4C A;  4MXN A;  4BL0 B;  2R9V A;  1E43 A;  2RRE A;  3EQN A;  2FUG 2;  1WFX A;  2CV1 A;  2Z1D A;  1E0E A;  3B8Y A;  1EFR A;  4PJN A;  4BJ5 C;  2F43 A;  2CS3 A;  3CJR B;  4P5O A;  1VZ0 A;  2K3P A;  2HPI A;  3HL2 A;  3H9G A;  1PJR A;  3A35 A;  2M4G A;  4E6K G;  4GRI A;  1X4O A;  1DBG A;  4YZA A;  2VQL A;  2LH9 A;  4BE0 A;  2IS4 A;  2R7V A;  2HDW A;  2UWM A;  4JQF A;  5LD2 C;  2WZP P;  5CKT A;  4HG2 A;  4CH7 A;  3SUC A;  1O8F A;  1FMV A;  4DK1 A;  4FET A;  1K28 D;  3DPT A;  2JIZ A;  1JRG A;  1R6R A;  2KQR A;  2O1D A;  3CJQ B;  1HA8 A;  2VXZ A;  2INU A;  2W6I A;  2VL8 A;  4GQN A;  2WB1 A;  1W36 D;  3BCA A;  1COW A;  4U49 A;  2LRD A;  2L5Q A;  3K70 D;  5LFA A;  1O8D A;  2E1M C;  1OHH A;  2WBM A;  5JHF A;  1QHG A;  4AU7 A;  3L2R A;  1O8E A;  1PXZ A;  2PYH A;  4PJM A;  3KEY A;  1G8X A;  2OUM A;  2LC2 A;  4W8R A;  2CW7 A;  2DJI A;  3ZXS A;  2HLD A;  4DNR B;  1UD4 A;  1Y6I A;  2R4G A;  3KRG A;  3K4B A;  4ZJZ A;  2ZSI B;  2PJR A;  1W0K A;  2VJ4 A;  1BHE A;  4XNF A;  1TZL A;  4ASU A;  2X1C A;  1MAB A;  4E7Z A;  1NHC A;  1PKV A;  2X6Y A;  3OW7 A;  4YXW A;  2CV2 A;  4E7H A;  3VSL A;  2DXI A;  3LNN A;  2IS6 A;  4DK0 A;  2XZO A;  2XZL A;  3BCF A;  4BU2 A;  3CMM A;  1D1A A;  3OYI A;  3EUH C;  1YX5 A;  1E79 A;  3DKX A;  2WJV A;  2VJI A;  4OJO A;  1K6Y A;  3GVK A;  4UZU A;  4YEL A;  3ZPN A;  4LIU A;  5FRM A;  1UEL B;  4BXF A;  4C2L A;  4B43 A;  4YZX A;  2M0M A;  2IXS A;  3TMO A;  5CDF A;  3B4N A;  3U21 A;  1WJ5 A;  4CCN A;  4H4K C;  3G2B A;  4OJP A;  2IGK A;  3DLA A;  4MLO A;  4PMH A;  2XF5 A;  1H80 A;  3ZCO A;  4YZ0 A;  4E7L A;  2GK7 A;  2VQC A;  1LFP A;  1OLT A;  1ERD A;  2GOX B;  4B48 A;  4BJT A;  4D1Q A;  2O5R A;  1RMG A;  1EE6 A;  3W3C A;  2KMU A;  2KL4 A;  4BQN A;  4C9Y A;  4E4H A;  4BE1 A;  1WJA A;  3LFU A;  2INV A;  3VYU B;  3SYT A;  3H0D A;  1IDJ A;  4CCO A;  2ZFU A;  1JI8 A;  4AVZ A;  2A5W A;  2VXD A;  3NE5 B;  4XOT A;  1O8L A;  2LOO A;  1OGM X;  2O0V A;  4B44 A;  2L9N A;  1G59 A;  2AQF A;  3CP2 A;  1PYV A;  2WAD A;  2NT9 A;  4DGW B;  3OYA A;  3OEH A;  4ITV A;  2NOJ B;  4ZTF A;  1O8I A;  1VLY A;  2QE7 A;  4G6T B;  4HSR A;  4KIT B;  3FBN B;  3JUR A;  1D0Z A;  3DWL E;  3FKS A;  2UVE A;  4B3X A;  1IB4 A;  1UD3 A;  1QJV A;  2CUJ A;  3DKY A;  3DEE A;  2BVL A;  3OL3 A;  4XKW A;  4CUG A;  3OEE A;  4CCM A;  2F6C A;  3PSI A;  2GJP A;  2F1M A;  4BQQ A;  1T5E A;  4Z1M A;  1WMR A;  3E1S A;  1BR1 A;  4NC7 A;  3TBI A;  3FKJ A;  1LVK A;  2W00 A;  3AL0 C;  2VB6 A;  3HAG A;  4DNT B;  3GQ8 A;  3QYB A;  2X8K A;  3T53 B;  4D9J A;  2JUG A;  1OFL A;  2D3N A;  2KRH A;  3HC7 A;  3WWG A;  1D0Y A;  4N4N B;  4YZQ A;  2JVH A;  3KX2 A;  1UD2 A;  3I9V 2;  4BEH B;  2V6E A;  3D5S C;  3OWT A;  2K9L A;  2Q2E B;  1VBL A;  1WJC A;  3SZG A;  4IKF A;  2MAB A;  2OC6 A;  4OAZ A;  3OYG A;  3GQ7 A;  3AFH A;  3HXL A;  3N05 A;  2X53 S;  3FPP A;  2IQ7 A;  4HNT A;  4KT6 A;  1WP6 A;  3GVL A;  2NTB A;  4TSF A;  4DIQ A;  2WAQ A;  3LSM A;  1SAU A;  3FBI B;  2HVR A;  3GQ9 A;  2Z6B D;  4OWR B;  2W7N A;  1FX0 A;  3IP4 B;  2HPM A;  3V42 A;  2BW3 A;  3SDB A;  5HNH A;  3DTE A;  3VDX A;  4RM3 A;  5KCM A;  2V31 A;  4KKS A;  4NK6 A;  3OYB A;  3SEQ A;  4ZDP A;  2IGN A;  1PLU A;  5HLT A;  2BVM A;  3K4L A;  2R7O A;  4YRV A;  1D0X A;  2WY7 Q;  1Z7L A;  4CSW A;  5IK2 A;  3HKZ A;  3DU5 A;  1MMN A;  3MKY B;  1N77 A;  2MYS A;  3D5R C;  1D1C A;  2O17 A;  3VSV A;  4OJ6 A;  2GOM A;  2VKD A;  2IS2 A;  3UNG C;  2VJJ A;  3CZ6 A;  2WAE A;  4XLC A;  2CUZ A;  4J00 A;  4IX7 A;  2KPM A;  1I8D A;  1K5C A;  4QPQ A;  1D1B A;  2XF6 A;  3JU4 A;  1AIR A;  3B90 A;  2XOK A;  4F3Q A;  2R7R A;  2A6T A;  3ZSC A;  2UUZ A;  4AYB A;  1S9H A;  3QOD A;  2Y0S A;  2PJR B;  1QHH D;  1ZEL A;  4XMY A;  3VWB A;  3PUB A;  1SFK A;  2CW8 A;  3S3M A;  3OS2 A;  3HPH A;  3AL0 B;  1EA3 A;  2GJR A;  3PNV A;  1X1D A;  2ZXH A;  3IUO A;  2VBK A;  1JTA A;  3UW0 A;  3H35 A;  3NWT A;  1GQ8 A;  1BPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...