4XOTA

Tailspike protein mutant e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xotA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xotA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xotA02
2NT9A 1JRGA 3VMVA 4XL9A 2NTQA 4PMHA 4Z05A 3VMWA 3EQOA 2IQ7A 4XKVA 4XMYA 4XLCA 1AIRA 4YZAA 2ODLA 1KTWA 1O8GA 1EE6A 1OGOX 2VJIA 4XR6A 4XOPA 1O88A 2NTPA 2PECA 3GQ8A 4OZZA 1O8FA 3GRHA 4YEJA 4YZQA 5AMVA 1KCCA 1OGMX 3VSUA 4XQFA 1RU4A 2UVEA 1CZFA 1IB4A 3VSTA 2X6WA 2EWEA 1OFMA 4C2LA 5C1EA 1DBGA 1GQ8A 1IDJA 4U49A 1RWRA 1BHEA 2BSPA 2QY1A 2NSPA 4Z03A 3VSVA 4YELA 4MXNA 2NTBA 2VBKA 1BN8A 1X0CA 3SUCA 4XLAA 2VJJA 3ZPPA 4XLFA 1OFLA 2NZMA 2O17A 1IDKA 1O8DA 1WMRA 4NK6A 1O8LA 4XONA 4XKWA 2O1DA 1H80A 3ZSCA 4YZ0A 2X3HA 3GQ9A 3WWGA 4XN0A 1XG2A 3JURA 4W8RA 5C1CA 4OZYA 4OJ5A 4URRA 1NHCA 4HWVA 4OJLA 4Z06A 2QXZA 4OJOA 1PXZA 4XM3A 2PYGA 1O8JA 1O8EA 2Z8GA 3B4NA 1PE9A 4EW9A 4W8SA 1JTAA 2VBMA 4YZXA 2INVA 1HG8A 4XOTA 4AVZA 3LMWA 2O0WA 3KRGA 2INUA 4OJ6A 3FY3A 2NSTA 1QCXA 4MR0A 1DBOA 4XN3A 4XLHA 2O0VA 2O04A 1O8KA 2UVFA 1PLUA 2X6XA 4I84A 1O8MA 1IA5A 1KCDA 1QJVA 4NK8A 1RMGA 1O8IA 4W8QA 1K5CA 4U4BA 1OOCA 1O8HA 4XNFA 2NT6A 4XLEA 2PYHA 2VBEA 3GQAA 3EQNA 3T9GA 2X85A 3UW0A 4W8TA 3B8YA 4XORA 3GQ7A 4OJPA 3B90A 2X6YA 2QX3A 1VBLA
chains in the Genus database with same CATH superfamily
1ACIA 3K7AJ 5F08A 2E7XA 5CPRB 3GLXA 3CUQC 4PGHA 1B6AA 3K1NA 2ECCA 4X07A 3RY8A 1UG0A 4BU2A 1DDNA 2AQFA 2GM4A 5F04A 4B3XA 3ZQCA 1VQKI 2ZBUA 1IC8A 4HX4A 5AONA 3COAC 2RKHA 4HA8A 2W25A 5FKLA 4QTRA 1HDPA 2FD5A 1FRQA 1T56A 1W7PA 1D1AA 1OKRA 1FOYA 5BPIA 4F52A 2FOKA 2EFOA 3D5RC 5E3OA 3E6CC 2IT0A 2X6WA 1Z67A 2EWEA 2IOUG 1E3XA 1ELOA 1OFMA 3KCCA 1BM9A 1C0WA 4MYUA 3OW2B 3FXMA 4MEYF 3CCRI 1DBGA 1K9MD 1SANA 1ETVA 4IEJA 2JJ2A 2JUGA 1J9IA 1IDJA 1MMDA 3VWBA 2ISZA 3FXRA 5M5WJ 2Q8KA 3LJYA 3CUOA 2RC4A 4DQ2A 1WH5A 1NG6A 1R5ID 1FOXA 2LDUA 1A36A 2RDPA 4MTEA 3PSFA 4M3EA 2RAEA 2HQRA 3BG5A 3HSEA 4NDLA 9ANTA 2E1MC 2PJRB 4D5CA 3VEPA 2BW3A 4CYCB 3CD6B 2W85A 2FVGA 2FBIA 2LBFB 2A5WA 3BTJA 1RRJA 2BYVE 2DFEA 2W57A 2V79A 3IUOA 1XSDA 1H80A 3U21A 2COBA 2KRCA 1B72A 5DN6A 1JB9A 2ZSIB 4QV2A 2BEOA 1HCRA 3VFZA 4M6XA 3JR9A 1Q1HA 2L7MP 3V7SA 3TKYA 1NTCA 2KLOA 2XIGA 3R6SA 4ENNA 2X3UA 2W7NA 3MCAA 3KZYA 4E0FA 1K4SA 4EATA 3FHZA 3CC7I 3LWFA 3U1KA 2O8XA 2GXGA 1SC7A 1QGYA 2JK3A 1VQPB 4PC3A 5E20A 2E1BA 4PJLA 3HRTA 4OOIA 3R4KA 1G4DA 2P5LC 3K4BA 3ZQ7A 3G71I 4F7DA 2QYUA 2BGCA 1BX1A 2K4BA 4BE0A 1TYWA 2JRMA 2R5ZA 4M9XA 3D0SA 3FY3A 3K4CA 5HDNA 1L0OC 4ENKA 1FSHA 4KIFA 2V5IA 3PJRA 4A3EJ 1TQMA 3SDBA 3PNVA 5EGOA 5CQGA 3BR1A 1Y0NA 2XTYA 2R7QA 3BPVA 1U2WA 3PQJA 3VO2A 3BR0A 4LLLA 1I1SA 1QGAA 2DCUA 3U6BA 2L9RA 3QU6A 2H6BA 1T6ZA 4GYGA 1D2EA 2Z1DA 1K5CA 2LBFA 5F1JA 5M3MJ 1Y1WJ 1IDZA 4YC5A 3JTHA 2IA2A 1WTHD 1YS7A 2BZTA 3MMPA 1O8HA 3F22A 1SD6A 1YYVA 2H8WA 2IGMA 2L4MA 4M74A 4I6ZA 2G0YA 4M6VA 5JLVC 2DYSH 1YX3A 2F4OB 2DJNA 4QSHA 3KEQA 1IUFA 1QNTA 3WE3A 2XOKA 2V1DA 3F9KA 5B5EC 2OTLI 2X6YA 3SYTA 3JW4A 2XKOA 1QFJA 1X1DA 2OBPA 3QYBA 4UV8A 5IYNA 2OTJB 1JUSA 3TOBA 4ZCIA 4UAJA 1OCTC 3E6MA 2ZNZA 1SMTA 4KDPA 5LRSA 3AGQA 1BR1A 1WJFA 4KUMA 3Q5FA 1D8JA 1E2XA 4Z4VA 4YXWA 5DS9A 3AG2H 3OYGA 2NV4A 1KTWA 1ZRDA 2Q6LA 2X8KA 4LBVA 3TO9A 4ASNA 2XZPA 3W2HA 5D5UB 3OFNA 3TDZC 1VI0A 1H9GA 1XPXA 1HLVA 2QBYA 3NRVA 4CGZA 2JUCA 3ZPNA 1WH7A 3RPUD 3ZZTA 1ZYRF 2ZITA 3SEZA 4EJTA 3LSIA 3ZMTA 2W4SA 1BC7C 5CKTA 1UAAA 3I55I 2P4WA 2CH0A 1GQ8A 2BPOA 2FNAA 3DKWA 4GRIA 5ICEA 2QY1A 1ON1A 1ZM3A 1R1VA 1OB5A 1W36D 4OAZA 4RDUA 3ZQLA 4UXNA 3N97A 1BN8A 1QVFB 2XRLA 2QSGX 1R1TA 1ZGJA 1V5EA 1FYMA 2HCJB 3ASSA 2EIKH 2HVRA 4EJVA 2EFWA 1KU9A 2BY2A 4NNJA 5ICFA 3ERED 2CUEA 4AM3A 3QYEA 4HF2A 4UB8C 3ZSCA 3JSPA 4M4SA 3GTJJ 4DBQA 5IK2A 2V1XA 2GOMA 2CW7A 3FM5A 3ZP5A 5E17F 2YX7A 3H9NA 1HOMA 4Y4RA 1ERDA 1LUJB 1OFEA 4MO7A 5EG0B 3HRMA 1LVKA 3M4OJ 1QHHD 3OZVA 3VOEA 1IRFA 1BW5A 3ZIAA 1TBXA 3HOSA 2EA4A 4P9UA 1F5TA 1ZELA 4A3MJ 1S72I 5DV5A 1UFMA 2JA6J 3OMYA 3SDGA 2DERA 2CS3A 3NQOA 4HLYA 1I8DA 4BE2A 4RCZA 1BC8C 4XOTA 2E19A 3OOPA 2XNJA 1B8IB 1MNMC 1YI2B 1Q86D 2VBWA 3LMWA 4NHJA 1DDIA 4QVJA 4AYBN 1WORA 4N3NA 2WR8A 3LSHA 5BMZA 5D8LB 2F5CA 4QPOA 2LOOA 4B44A 2NAZA 2D3NA 3OYAA 3CB4A 1VQ8B 3W3CA 4UHTA 4CYDA 5DM7F 4Y3OA 3RSNA 1VQPI 3NE5B 2PQ8A 2B0LA 3EUHC 4U9UA 2R0QC 3CCLI 2DFIA 4E7LA 4NK8A 5IT9Z 3F3XA 1O3TA 3ONUA 1O8IA 2NRAC 5J35A 3HYIA 3F8MA 5CLSA 4W8QA 4YFKF 3TO7A 2JJ1A 1YX5A 3K4LA 1OOCA 1QU3A 3C2GA 3CCJI 3A8IA 3LFUA 2VXDA 2PMHA 3T9GA 3OY9A 4A3IJ 3WG9A 2GK6A 1X58A 3E5UA 1AMOA 3GTKJ 3OYIA 2IJLA 4CCJA 1KTVA 3PETA 4Z4TA 3LSJA 4BHPA 3R0AA 1IN4A 3JRHA 5KNLA 2IS2A 1TTYA 3WTTC 1RUOA 4LB5A 1KK1A 4RBOA 1V5GA 3I71A 3JRIA 3VMWA 1TZLA 3PUNA 4KFCA 2DDAA 5FROA 4Y13A 1S4MA 1QA3A 1E3PA 2STWA 4BQNA 1PUFB 4IRIA 1N8RD 3PIPF 4OPSA 5KAIC 2ZMEA 2Z9OA 3OS1A 2PG4A 1UD8A 3OYNA 2HOTA 4XKCA 2XF7A 2ME6A 3TP3A 3IV5A 1O4XA 1JTYA 4IQJA 5DNSA 4EMSA 3DU5A 1O8FA 1E3OC 1SFKA 1GHCA 3A8KA 2XKPA 2OQGA 5BOXA 1KK0A 2ME0A 4FETA 1TLHB 2CV0A 3L2WA 2DOGA 2EZIA 2IP2A 5C4XJ 3H3ZA 3SZEA 1QRCA 3HL2A 1RKTA 4A5MA 3PUBA 1VQ5B 2E7WA 2VFQA 3L2RA 2M5SA 5IYWA 1GXQA 3FXJA 3BG7A 1MD0A 5KCMA 5H5JA 2LVSA 2VBKA 2OYNA 3KE2A 2GIZA 3QPSA 5JHUA 1RR8C 3CC4I 5IT3A 1WSVA 3IWZA 2BHYA 4L5EA 2PLFA 3R6KA 1MGTA 2A5YB 2VOOA 2BVNA 2HDWA 2VKVA 3HHGA 3BQJA 2HOSA 2O17A 4TKOB 3OYLA 2KFDA 4D9JA 2XSJC 2YSRA 5LFAA 1WRJA 2GLOA 1EKEA 1S6LA 1QPIA 2I10A 5HS7A 4WWVA 2HYGD 1ZHFA 4B47A 4M3FA 4N3GA 1XG2A 5ICGA 5IYBJ 4ZZLA 2VYQA 4XSXF 4MTDA 4LG0A 2I5UA 5C1CA 4ZDLA 2XC7A 2Q6KA 2X0KA 5AN9A 4LD5A 4OJLA 2F1LA 1J09A 3DXJF 1OLTA 3L00A 1O3RA 4P22A 1EZGA 2Y75A 1T0FA 3KYLA 4V2GA 3BQZA 2BW3B 1R49A 4FTHA 2KIUA 2QSFX 1GLNA 3ABKH 2IGKA 2J5PA 4PSWA 5B66C 1LPQA 2DW4A 3KYCB 3HDDA 3RKQA 3J7ZI 1DPRA 3PSSA 2RN7A 3OYBA 4MYTA 2V9PA 3SFIA 4IX7A 3CC2I 4KYWA 3Q39A 5L3CA 5B1BH 4RAYA 2BVLA 1G7CA 2VT2A 5DYMA 1K78B 4ESBA 4WWCA 2IXSA 3HXLA 4D5FA 4C3JJ 3AG4H 3PENA 1K8FA 1VQMI 1UB9A 1WPCA 1Z1DA 1APLC 1FPQA 1IA5A 3JSOA 4U87A 1U8RA 1SKQA 1JKPC 1ZR2A 2M9HA 2VIXA 3VNVA 4YG2F 1BJKA 2BGJA 3H5AA 1WHUA 3RYPA 1MZBA 2RREA 4QLCU 2MGQA 2ELHA 3T1BA 4FCYA 2Q6IA 4UY8I 3VSLA 2DN0A 3E0JB 1MBHA 2Y0SA 4RB2C 4B3AA 1T5EA 2VFMA 3S2HJ 1K79A 4Z4SA 3GVAA 2BSAA 3DLAA 2NS7A 3B90A 4IHSA 5FKMA 5F4JA 2PBIA 1X2MA 3PO2J 1ODDA 1KA8A 4Y9RA 2XZLA 1YJWI 1QQ1A 1ZAOA 3OYMA 3IH3A 1F43A 4P1WA 2DODA 4OOVA 1OHHA 4OP7A 4FASD 4LJZF 1U0JA 4C9YA 2L01A 3A0BC 1VQ6I 3L7WA 1S8NA 1D1NA 3F8BA 1P4XA 4A0ZA 2PECA 2KP6A 3GQ8A 4RB3C 4O5VA 1MRZA 5EYRA 4YEJA 4ZDPA 1NK2P 4M3BA 3ASQA 5DDGA 2XNCA 3ISXA 1XD7A 4IOCF 4LLNA 1IB4A 4A69C 4HNVA 5JMCB 1Z3XA 3OPOA 5HS8A 1QPMA 2K9LA 4MHGA 1TNTA 2W00A 4G1VA 2CJJA 2OJED 3LOCA 2NVXJ 2ACJA 4PC6A 1ZUNB 5F4OA 1RWRA 3FX3A 2NSPA 2HR3A 3SLDA 1VQ9I 2LP0A 3FPKA 3FMRA 4MXNA 3VB2A 1KJZA 2KZGA 3F6OA 1SKYB 1X0CA 3BQYA 2E1RA 2GA1A 2WC2A 1J7KA 3UKGA 2IS6A 1HQCA 2YS9A 4ZH4F 4HDVA 1J0RA 4BDZA 4PZJA 4AIKA 3OYCA 1Y0RA 5B1AH 1WI9A 2CRGA 3HZJA 3SQNA 2GQQA 2F4NA 5LHIA 3OOUA 3RKXA 4KKSA 5DSZA 3DBRB 3K1PA 1XN7A 4IVNA 1BR2A 1MDMA 1YIJB 3KP5A 1TLLA 1HW5A 3OL4A 4OPWA 3V7RA 1X19A 2DFFA 5JFRA 3OKXA 5CVJA 5CQEA 2F1MA 2DA3A 1X1PA 4DIQA 3TO6A 2ZZFA 1IZ1A 2W6JA 1WSRA 3BLYA 5E18F 4QPQA 1TT5B 1Y39A 4UV9A 4EW9A 2HDDA 5LMZA 2B7BA 1D8TA 1EFCA 3DTKA 3K9TA 3RIRA 2FOWA 3HGYA 2X51A 2IW5A 3JCUC 2B7EA 4V2FA 5LGUA 2INVA 2YWGA 1JJ2B 1L1IA 2V4JC 2HQAA 4FE7A 2PJRA 4X6AJ 2X53S 3AVXA 1BIBA 4RGUA 4I0BA 3OW7A 4KMUX 4RA2A 5E6TA 1O3QA 2R7OA 3FKIJ 1VQ8I 4PC7A 3J81k 3PA2A 1WJDA 3H94A 3Q0VA 1ZG3A 1VLYA 2FA5A 4HX7A 1GV2A 3CCQI 2JA8J 3OOCA 3R6JA 1YRNB 1O8MA 3W2AA 3E7LA 2KJBA 2M8EA 5IP7J 1QBJA 1QGPA 2LY9A 2QCOA 4X0GA 1ZARA 4JK1X 2WJYA 2O0YA 2VB6A 2XAGA 4MEXF 1SAXA 2ZL5A 2OZ6A 1G3YA 1PKVA 1V5FA 3DLLF 2W6IA 3GTPJ 4G7ZF 3BPXA 5HZBA 3M8FA 2CU7A 1JJ8C 2EIXA 2X85A 1VHOA 3JRDA 3HOVJ 3MAJA 2E1OA 1D0ZA 4BL0B 2K02A 1ZKGA 5FGMA 3GW2A 2H27A 1AA7A 1NDHA 2WY7Q 1LKXA 1WKMA 2QYOA 1E3ZA 3SEJA 1OCZH 2CGPA 4P55A 2CV2A 2BGIA 3K70D 3NARA 4I76A 5GTIC 4PJNA 4YIRX 1BI1A 1GXPA 4OMYA 1WJBA 3RTRA 3MZYA 2VJIA 1G3WA 4UUTA 2G0EA 1F1ZA 4A3KJ 2NTPA 2AO9A 2F48A 1Q82D 1Y0YA 2MA3A 4HOBA 1E63A 4ACAA 2VN2A 3RZDJ 1LE8B 3F23A 2NVQJ 2MLKA 2PI0A 3OIPA 3TBIA 2BX6A 3CCVB 2CW0F 3Q0UA 4NB5A 2G7HA 1D1CA 3AFHA 3TOAA 3G1OA 3CMEB 3ZR8X 2H1KA 4II2A 3GTOJ 2CYYA 3TW6A 2C78A 3AVVA 1T0FC 2HU9A 4PK4A 1GR1A 2BM0A 4NC8A 2BSPA 5HDGA 2Z33A 1TP4A 4A0YA 2VLAA 3VNUA 3VYRB 4EGYA 1J9ZA 3ZC3A 4FX4A 3TMOA 1FIAA 1BIAA 2DA1A 1UHWA 2NS0A 3H36A 4L8JA 3IH2A 2OPTA 4KN4X 3QE2A 5J3OA 4P12A 1F20A 2JSCA 4HEA2 2QENA 1N0UA 3K1MA 3J81Z 5TR9A 1SM4A 4YZ0A 3MCZA 1JXSA 4EEFG 2VPRA 2QBYB 3F8CA 1SVMA 1QZZA 2A05A 2VFNA 1HA3A 4RCYA 3JURA 3F8FA 4LIUA 3K10A 5DCMB 4RD2A 2RQQA 2O6GE 1X4PA 3TH0A 5IYPA 4WX9A 4MFDA 4P9FA 3BTCA 1XDSA 2CFXA 3MMYB 2FQ4A 2ZXWH 1YRNA 2VKEA 4BXFA 2Z8GA 1YW9A 3HEFA 3ASOH 2HGCA 1A31A 2KJCA 2DPUA 2B0RA 2V7TA 2VBMA 2V7UA 1SFOJ 1I7PA 2XT4A 3RKWA 3LSKA 5KHDA 2JQ7A 1KQ0A 1P4WA 1QGZA 5E8GA 4D7NA 1DUXC 3R0JA 4EH1A 3HOZJ 3OZWA 5D6EA 2FNPA 3G1MA 4Y9UA 1I18A 2A68F 3SZGA 1FZPB 1ZLKA 2BF4A 2D9RA 2O04A 1UD5A 5EMNA 2XRNA 2UVFA 2A61A 3O3KA 2M87A 4RLFA 3LSGA 3WTUC 1HKQA 4M3DA 4WQMA 2E1MB 4A2UA 4C2UA 1GVHA 4RGRA 3PO3J 1R00A 4PJ0C 5GADJ 2V7FA 3ECHA 3PIOF 1NG7A 4L0ZB 4ESFA 1JKRC 3GO5A 1DGRM 1BI2A 1P7IA 2XVCA 5CVRA 2HXIA 4DW6A 1MDMB 1XQBA 4PGOA 3E6BA 3GXOA 2VXZA 2V6EA 3I53A 1VQLB 2ZO4A 2LD5A 4ACBA 2ID6A 2EV6A 3S15J 3I4NJ 3WBJA 1KK3A 1TSPA 3CXCB 3FMSA 4KIBA 4XORA 2DMUA 1KQ9A 3ONQA 2ISYA 2ELKA 2LK2A 5D5WB 3DU1X 3HM5A 3K6GA 1EF4A 1O57A 2NT9A 3OIQA 1QHGA 3EPZA 1DGWY 1JGGA 4X7DA 1U9OA 1X3WB 3JREA 3RZOJ 2VNKA 1JNYA 1X1BA 2XGXA 1BN5A 2MC4A 4RD4A 4DZJA 2DA2A 2K85A 1HXDA 3EUKL 4JX5A 5J4YA 2CG4A 4YEIA 4ETSA 5HVQC 1UD3A 2IGNA 3W2IA 1N05A 1M1EB 3W6VA 3JX8A 2HZDA 3HOTA 3T53B 4XQFA 4X7CA 4X7FA 4RD1A 3AAFA 4A3CJ 2V1UA 3Q0WA 5C4JJ 1VF9A 2WAEA 4AIHA 3BR2A 2R5ZB 2C5BA 2X48A 3TP0A 4BUPA 4EM1A 2V1NA 1B72B 4Q48A 4P3YA 1JHFA 1W1WE 2ZL6A 3VSVA 3K4MA 2FMLA 2F5VA 2PMZA 3VSKA 3P27A 4P25A 1JT0A 3WQZA 3V76A 1W34A 2GZWA 4D0PA 4OIOF 5F0CA 1TWCJ 3J81K 2YWFA 1K4ZA 2VASA 3IWFA 4RAZA 3CC7B 1T2KA 1OFLA 2E1CA 5FLXZ 1IDKA 2KIQA 1ONVA 2VC1A 3VYTB 4WXHA 4H9GA 4Y7CA 1WMRA 4XKWA 5EGOB 2YX4A 3BG3A 4U7DA 5JVTA 4XSZF 4IOAF 1WCMJ 4EJWA 3Q9SA 3QYFA 1YLFA 2LKSA 3PFIA 2WB1N 2CUZA 2LRDA 5DD8A 2QSHX 4LBWA 2A6TA 2QQ8A 2UV1A 2EZHA 3ZPLA 2QZAA 4N9IA 3D26A 1XTAA 4URRA 1A35A 1QRYA 3GVLA 4Z06A 4XBFA 3OYJA 5FO1A 4P96A 1G7SA 4FE4A 2EJRA 3CJQB 2BV6A 1Y56A 2PMZN 4HIZA 3FDYA 2HOEA 4HV6A 3WTSC 2ZCWA 4IKFA 4FT8A 4HSTA 3T51B 1YO5C 2DOEA 1IGNA 3DKYA 3W2VA 4X1EA 3NEUA 2ELJA 5BNGA 5B3SH 4HF1A 2V6CA 2M0CA 2WBMA 3I59B 3LA2A 4UVBA 4RM2A 4ZYGA 3IRQA 5E3MA 3I3LA 2XAHA 2O8KA 2CBXA 4Z4ZA 3KRGA 3F21A 1XSXA 3OYEA 4KKTA 2WAFA 2R93J 2VFOA 4TSFA 4NBSA 2NSTA 3LYCA 2MH9A 1IN5A 3E3VA 4R79A 4H0EA 2BBYA 1W9XA 2WPDA 5GPCA 2XV4S 3REOA 2GIVA 1U6GA 4IHXA 2LKPA 1DU0A 2P7VB 4XRSA 1YITB 1QJVA 3VPRA 3QPTA 4OMZA 2EA2A 1WXRA 4A5NA 5JI6A 3GTLJ 2ICWG 1LDDA 1QQIA 2DT7B 1WJ5A 3LA7A 5LHHA 1N07A 2D5VA 2VJ4A 4BJ6C 2R7UA 2KRHA 5HNFA 3LVBA 1AWCA 3Q6RA 2F4IA 2P8TA 2DMPA 3FJOA 3HOXJ 1VZ0A 1HZEA 4PABA 2YUSA 1FT9A 3ZMUA 1XMKA 5J8FA 3UNGC 1OGIA 3MKYB 3ZRGA 4BNCA 3VMVA 2PLYA 1SVLA 2JIZA 2CQKA 5J3LA 2QF7A 2DI3A 1GUUA 2MYSA 2XF5A 4XLCA 4CZZA 2R5YA 3WXMA 1K61A 1G7RA 3HJEA 4HDUA 4RD3A 5LRRA 1WZ2A 2M5WA 1WOOA 3GMEA 3WGHA 2KQRA 4XR6A 1HA8A 4G8XA 2K27A 5CJ9A 1MSFC 4FHTA 1RQRA 4Z4YA 1B9MA 1VQOB 3GEZA 2QQ9A 4TMTA 4XICA 4MQVA 4Z6YA 3OYKA 4X05A 1AKHA 1K7AA 1FOKA 4X7EA 2DT5A 1R36A 3SJMA 5TV2A 4OPVA 1QRBA 4BPRA 1I5ZA 3BDDA 2EZLA 3ZGKA 2OCEA 4WZLA 5K7HA 3CUQB 1ZREA 2LG4A 2EV5A 2A6HF 1EJ9A 1BR4A 1W87A 3IKTA 1ZG5A 2Z99A 3CCRB 4YFOA 2IPQX 3O2PE 2LYCA 1IXCA 1HW1A 2V7VA 2E1NA 3LMMA 5FLXK 1ZLJA 4PSXA 4XLAA 5FFXA 3CCMI 1OPCA 1JUMA 2O0VA 3ZPPA 1Z05A 2YUHA 3ZN0A 3H92A 3FPPA 1I1GA 3HPHA 1HC8A 1P4AA 2MW8A 3PUFA 4ZGNB 1S3JA 2JJ7A 2DA4A 2XHKA 1U8BA 4CHUA 1F60A 1PJ7A 4XONA 3AVTA 1XFOA 1X3UA 1D0XA 1EP2B 2O1DA 1JA1A 1FX7A 1KQSB 2HQ5A 2CWEA 2WV1A 3MKZA 3B02A 3GZ5A 4F93B 3S1NJ 5ILUA 2X3HA 1OCOH 2DK5A 1QZYA 1PDNC 1MMNA 4E7JA 4L9JA 1VQ9B 4G1BA 3RQIA 2R7WA 4W8RA 3HKZN 3HIFA 4P5OA 3TGNA 2OTLB 2HS5A 2QWWA 1U5TA 1LJ9A 1TWHJ 3JQRA 3SZTA 5LBQA 4OJOA 2KVOA 4XM3A 1G6NA 4WZKA 2DO7A 2OTJI 4C3HJ 3BT9A 4Y15A 1UHSA 3KZIC 3MFKA 1W0UA 5LHGA 3S1MJ 2CRVA 4PJJA 1Q1VA 4OIRF 2OBSA 4TN1A 4M3GA 2NXNB 4HLXA 1YG2A 5DEQA 1HF0A 1IN7A 2IGOA 5FKNA 1MMAA 3CTAA 3J80Z 4XN3A 2G9WA 2VZLA 1W7PD 5JLXA 2ZBVA 1PLUA 2ZNYA 1WVRA 3LSMA 4ZC3A 1NHAA 3W2FA 1FLIA 4LMYA 3S3MA 4EM2A 2Z2SB 1IN8A 3HOWJ 1YJNI 3WHCA 3CQZJ 4XLPF 2FX0A 2R9VA 2EWNA 3BR5A 2PX9A 1STZA 1A5JA 1VQKB 2KZVA 5C44J 1XSVA 3DTEA 3X2QH 2GREA 2A69F 4Q47A 1BOAA 4OU0A 4IL6C 3LAPA 2ESNA 3B73A 3FXQA 1U78A 6PAXA 3QU3A 3NWSA 4V19K 2K3PA 2HWVA 2FJ1A 2XGEA 3WTZA 1CQTA 4I2OA 3HOUJ 2FEZA 1DPUA 2LLKA 3PSZA 4M72A 2XEXA 2EK5A 4PFPA 4FISA 1IO2A 1XGMA 2G7UA 3DP7A 1KU2A 1VQ4I 1IJFA 3RPUA 4WK8F 1A6IA 1MJBA 3M1EA 4O6JA 4QIWN 4BEHA 1VQ5I 1OGJA 1T39A 3BH4A 4IPAA 3WBKA 3DKXA 5L3GA 4U0YA 4A3GJ 4I98B 3OEHA 2LH9A 4I7HA 1FX0A 3ES9A 4HG2A 2UWMA 1S7EA 1S9HA 2M1BA 1R5HA 2VKDA 2HDCA 2XB0X 4MNUA 3QP5A 3SXYA 4AVPA 1IW7F 1ETQA 2TCTA 4LK0F 1Z7UA 4RB1A 3GIRA 3BJAA 2NYXA 2DYIA 3RQ4A 3C2BA 1A6QA 2D74A 2DOFA 4F92B 3A0HC 3R61A 3P7NA 4KJZA 2YU9J 5FD6A 2VNHA 2CW8A 4YRVA 2ZBKA 1JKQC 1TWGJ 4C2MJ 1Z21A 5D5XB 4YAOA 4GQNA 4IF4A 1G3TA 3P9KA 3QSYA 3BH6B 2IBDA 2K3FA 3A35A 2NZMA 4E6KG 2O5RA 3GZ6A 3B82A 3KL9A 3LO8A 1O8DA 2EIJH 3ZUGA 3LAJA 4AF6A 1OQYA 2DXIA 1J75A 2P6SA 1S7OA 3L2QA 1LNWA 2EFNA 4PCQA 1BJZA 3OSGA 3W5HA 4XLNF 1CNEA 2RC5A 4OZYA 4LBYA 5FNZA 3GLLA 2E5NA 2L0KA 2CFOA 1ZH5A 4BACA 1UMQA 4IRHA 2QUFA 2MABA 1OR7A 1MMGA 3CLOA 5EDNA 4Z4UA 4E70A 4ZYAA 1XCBA 4QFMA 2X0LA 2COMA 1UD2A 2VKHA 4RGXA 4P9SA 4R71A 2LMDA 3ZQIA 2WAQN 3ML3A 3KP6A 2L2OA 5IT9K 2GJKA 3J80K 3BC9A 5HZAA 4M6YA 4RM0A 2VQHA 4AC0A 1D5YA 4EV0A 2DFHA 1JA0A 3MWMA 5L3DA 1MNDA 4MLOA 1HF2A 2R7SA 1TQPA 4RM3A 2QZ8A 3BZKA 1KU3A 2DMQA 1R23A 2VQGA 2MG4A 1YQAA 1IRGA 3OYFA 3CCEI 3F6VA 2C2WA 2P6TA 3MN2A 1N75A 3E97A 2VQLA 2HKXA 2Q0OA 3KLOA 1K28D 1JGSA 3GWZA 1R6RA 1P92A 2Z6BD 1OR7C 3DBHB 5D4RA 3KP7A 1ETKA 4Q4ZF 5ILSA 2KIMA 1VHEA 1XX5A 2IAIA 3KYDB 4GXOA 1ZN2A 3UW0A 4BJ5C 1RETA 1XCVA 2IVMA 1DABA 2Q6OA 1F9NA 1KQ8A 3ZZUA 3IL2A 2Y0SN 2QX3A 3VSUA 2L54A 2BY3A 4HQMA 4OOXA 1G3SA 1EV7A 3DWLE 4IO9F 1LVAA 1RC9A 4LK1F 2H94A 2R7TA 4S0HB 2M45A 2RGVA 2C4TA 2BM7A 2VBYA 3H9JA 4XD7A 2UUZA 2KDZA 3WU1B 2DJIA 1CGPA 2DA5A 3FMQA 2F5DA 2GK7A 2LF8A 3M7GA 1O8GA 1OGOX 1RR7A 4XOPA 4F7ZA 3O8GA 5CYVA 3K4JA 4ROXA 1MH4A 5DUKA 1W0JA 4TT3A 2KRFA 2GQFA 2ECBA 3DQVC 4HRIA 3Q3SA 5KW9A 5IYDJ 1Z3YA 2CMPA 3K0LA 2R7XA 5E3LA 4YFXF 2DA6A 3ZZ0A 3M1CA 4HNUA 5C1EA 2ZZEA 1YW8A 3I54A 3C18A 1VQ4B 1D8KA 4NUBA 4U49A 1IB0A 4L9TA 4NBQA 2YWHA 5EZGA 2XPUA 3G6EB 3GUDA 2RC6A 1FWZA 1KK2A 4P2NA 2ZFUA 3ZMVA 1V0FA 2VJJA 1FOWA 4ABZA 1FYKA 3U2RA 4E7KA 3AL0B 1FY7A 1Q7YD 5AIQA 4ZZDA 2A07F 3Q6QA 2JRTA 2HDNB 2KL4A 3RYRA 1RESA 5KVRA 3NB2A 1BOBA 4Y17A 1V0EA 2HTSA 3L2UA 1QA6A 2FF4A 4CCLA 1IJWC 1JTXA 2E34A 3ULQB 2GBYA 3AKZA 2VJ5A 2K5CA 2O9LA 5BQTA 3BWGA 2X1CA 2Q2EA 4OINF 5M5YJ 2M2EA 4OPOA 4YAWA 1SD5A 3I59A 3ERMA 2PYGA 1XS9A 2PE3A 1GV5A 2H6CA 3GCMA 1SVOA 4JOMA 3H9GA 1FP2A 1CLWA 2PMUA 4EM0B 1TVCA 4HBLA 5TRDA 2VL8A 1UHMA 1ZM9A 4YIFA 2DA7A 4P26A 2L7ZA 3S32A 1I50J 3KEOA 3OIOA 4YHBA 5F1RA 1KZHA 3KEWA 1J2XA 2BY0A 2QQAA 3BZCA 4YFNF 1PJRA 3AVWA 2J8IA 3OWTA 4I09A 3H0DA 5IOYA 1EP1B 2HQNA 4HW0A 1LB2A 2CO5A 4YALA 3VYUB 3T8RA 2WAQA 5DTDA 4BH9A 2OA4A 3BP8A 2JMWA 3LSTA 1QFZA 2QDXA 2WZNA 3JQQA 3Q3AA 3VMFA 2EB7A 3ZBTA 3ECOA 2BV3A 3RI4A 2XAQA 3QOPA 1LDKB 5FKKA 2CQNA 3ASTA 2Y0MA 3FXLA 2V7QA 3PM1A 2PYHA 5K1YA 3H09A 4R1HA 4U88A 2E2HJ 3OZUA 3SQVA 3V8KA 2F3LA 1U5TC 2EIMH 2P5VA 2HNHA 1S0UA 1V3FA 2BM4A 5J1UA 1QUEA 2VOPA 1XB4A 1N08A 1W5SA 2H09A 2MH2A 4KT6A 1JJ6C 4LG3A 1B9NA 2L02A 2JVHA 3C2HA 5JR3A 1MSEC 3HUGB 4BQQA 3I56I 1G2HA 3J7AY 3ONYA 2CQXA 3ASNH 2KT0A 4HX8A 2C77A 3DV8A 3Q9VA 3SLNA 5EEAA 4ASUA 4B3FX 3B78A 3HSRA 5JLWA 5HS9A 1H85A 1EE6A 5C3EJ 4U0WA 3E5XA 5BPDA 2L9SA 4RLQA 4BBRJ 4LLGF 5AMVA 1E64A 4QHYA 4IXAA 1J59A 3L2CA 3WNCA 2UVEA 4KNYA 3VSTA 2VONA 1TC3C 1XMAA 1AOYA 3MHPA 2W48A 1TYXA 1DARA 2XPVA 4UZUA 3HSFA 2D2WA 1QH0A 2H1LA 1GAQA 1EWYA 3ZN1A 4D1QA 2KIFA 5DM6F 2EV0A 3F72A 2XTWA 1QA1A 1LE8A 1V4RA 5M5XJ 1OB0A 2BM1A 1E62A 1ZQ3P 4PFOA 1AHDP 1G8XA 3S93A 4EJUA 3EETA 4BGDA 2P81A 4CA0A 1ETWA 1DU6A 4X0CA 3ZBUA 5HODA 1BMFA 4W97A 1TL8A 1XB2A 1IN6A 3VR6A 3WTWC 5E79C 3EUAA 4IRGA 1Y8QB 3GX4X 2B5OA 5FLMJ 2MSYA 1R5GA 4B4DA 3I9V2 3CUQA 4RB0A 2OBTA 3M07A 3N6ZA 4PC1A 3S17J 3T56B 3CCUB 1XDUA 1OYYA 3HKZA 3AG1H 5FLVA 5TGTA 2D45A 2B9SA 1HVXA 1KMHA 3W5UA 1QVGB 4I0AA 4N4NB 2ETHA 1DQUA 2GAUA 2HXOA 3L9FA 1LLWA 1VF7A 1YS6A 1XG1A 4HWVA 1FBUA 1XGSA 4J19A 3CCSB 2JA7J 2ZB9A 1PXZA 2M34A 1N77A 2HPMA 3SYJA 5J8CA 2WJVA 1JI8A 3CD6I 2Q1ZB 2XAUA 2HVSA 3CRZA 4LOCA 3KX2A 4W8SA 4HSRA 3BY6A 5EJCA 3PNYA 2MD0A 2QE7A 3K2ZA 2L5QA 3DPTA 1DDGA 2QM3A 3F0CA 4H4KC 4M9SA 4B09A 2YWEA 5DUIA 2K9MA 2ZJ2A 1UJ8A 3TQNA 2INUA 2ADUA 1MBEA 3GSIA 4OJ6A 3P9IA 4FXUA 3L1PA 2JT1A 2GJPA 4BHBA 1DBOA 3D1NI 3RKYA 4BKXA 2P3MA 4C43A 1Z7LA 2JZYA 2QMUA 2VC0A 3PUMA 4LITA 2K9SA 4LGWA 3CMAB 3CCVI 4E4HA 3S3OA 1X1CA 3ZQFA 4CCNA 3G71B 3G4SB 1OMIA 4BS9A 4FX0A 1N78A 5L3EA 2C5HA 3DPLC 2M4GA 3K4NA 5B6IA 1PYVA 4HNTA 4D7MA 1BJAA 3ZCOA 4W1UA 1N25A 1IDYA 4M9ZA 3CP2A 5CDFA 2EFGA 1LM1A 4HQEA 2ZL7A 3RIQA 4OWRB 1ZG1A 1DP7P 2XNDA 3WODF 3QAHA 5D6FA 1XC5A 1JKOC 3NAWA 3WHBA 2M0MA 3DEUA 3CPWB 1P9QC 2XB5A 3HRSA 3WG7H 3BCBA 3I64A 1E43A 4RD0A 4JMQA 4HYEA 1OJLA 3CO6C 5LEKA 3W6KB 1UCRA 2OK8A 3KZZA 1GAWA 1VJSA 1R58A 2UXNA 1KCCA 1VNDA 1M1KD 1N0VC 4ON0A 2N8GA 5AIPA 2J5OA 5BS6A 1TWFJ 2BHZA 2O7OA 2CF4A 2OU2A 5D5VB 1CNFA 4LC0A 4RPBA 3U6KA 5FRMA 5EZHA 4B3GA 1BHEA 2B7CA 1EFUA 4YELA 4DGWB 2VBSA 5F0FA 5DD4A 2NTBA 3WU2C 3SHFA 4L0YB 2X9DA 2VPLA 4I02A 1UMKA 3OL3A 3QPLA 1NK3P 1W0KA 4G7OF 2DBBA 4TMZA 5IYRA 3CP8A 1FSEA 4NK6A 5EEGA 1TWAJ 5FA6A 1TNSA 1R22A 1Z91A 4NCNA 4ENMA 4BDYA 2ZTGA 2XF6A 4NC7A 2YU3A 3WWGA 4JX6A 1VQLI 4RS8A 1IHMA 2JSPA 2LSOA 3QP6A 5K5QA 5H59A 3B6CA 2C6YA 1ZRFA 3BC8A 4LBZA 2BMWA 3DBLB 1RQPA 2M7AA 3J7AO 1FBSA 1LEAA 2EH3A 1R71A 3J7YJ 2STTA 4IHTA 1BI3A 4TV7A 4XK4A 4HPQA 1EFRA 1N06A 4BXXJ 4LB6B 1PE9A 4IHYA 5K7ZA 1B23P 4YAUA 5IYQA 4A12A 1BBYA 2Y30A 5H2FC 4KIGA 1LQ1A 3N4MA 1YITI 4WZEA 1FC3A 2XC1A 2HZTA 2PFBA 2UZKA 1KZLA 3CZ6A 2BM6A 4K1XA 3JRAA 2KPMA 1EH7A 3KETA 5F4MA 1UG2A 2ZJPF 4EQQA 1S5LC 5F6FA 4YCQA 1W4MA 2DQLA 3KLNA 2DMTA 2ZXIA 4Y7NJ 2WV0A 4RDJA 4MIMA 2DOAA 4UZFA 1K8AD 1XGNA 5H6QA 2XUBA 2M3AA 1FYLA 1U3EM 1MBKA 2DQRA 2B63J 4DYCA 1U2RA 1GVJA 2XSDC 1UZCA 1HDDC 1VLOA 1RMGA 3BR3A 3FWEA 2OC6A 3K69A 3M8EA 4PC2A 4G7WA 2LFBA 4XNFA 4XLEA 3W2EA 3GFMA 4LFUA 3QOEA 3LFKA 3EQNA 4NQWA 1SMYF 2Y31A 2VE9A 2K9NA 3S2WA 3CPXA 2CQQA 3WU0A 5HLTA 5IYCJ 2CUFA 4DYRA 4M73A 1KONA 4E7IA 2V7XA 5GTHC 2JA5J 1X3ZB 1FNNA 1GVDA 4WXDA 4E7HA 3JTGA 3VO1A 5HKKA 3CMEI 4IHVA 1O3SA 2MC3A 2P5KA 2Y48A 3MKWB 3Q38A 4L9NA 3IHUA 2DIEA 1AIRA 3CCJB 4TMVA 2ODLA 2BXZA 3P26A 5HDKA 2XROA 3OV8A 1P6RA 4IZZA 1O88A 1OCRH 4ZJZA 2E2IJ 3B6AA 3WTXC 1CF7A 3LNNA 4RLZA 3V7AA 2GA2A 2XAFA 1E79A 3BTIA 2VT3A 3CF2A 3DU6A 4PDKA 4AYBA 1FDRA 3QFSA 3IAS2 1OFDA 2PMDA 1ZR4A 1E0EA 2VODA 3JAMZ 1PP8F 2J8KA 4TMXA 1R5NA 4JRAC 1I3QJ 1SD7A 1JT6A 4YAFA 2VFPA 1I39A 2DTRA 1FRNA 4JX4A 2HI3A 2P0WA 2Z16A 1YIOA 3QFRA 3MQ0A 4Z03A 4UB6C 3GBGA 1T95A 3FK7A 1Z9CA 3CJRB 4KITB 4KISA 2IA0A 4RAGA 1W35A 4BXUA 1WJEA 1FP1D 1BQEA 3GVKA 1P4MA 3OS0A 2ZMEC 2R7VA 1QFYA 5FB2A 3GVJA 4G5GA 2R7DA 1ZRCA 3CCUI 1KQ5A 1O8LA 2K9QA 4ZV4A 1KGSA 5TISC 1ETOA 1WP6A 4Z1MA 3K4KA 1PP7U 2R3SA 5J1RA 1BL0A 4XN0A 2BN4A 1KYZA 3CDLA 3C7JA 3BJ6A 3CC4B 2DU9A 5CVVA 4G94A 3RDIA 1ETYA 5K5RA 4K2EA 3QFCA 1WJCA 4P6YA 2QXZA 1VQ7B 1EH6A 4AD9A 4WCGA 1QA2A 4Z4WA 2HOAA 3ISPA 2E71A 2FBHA 5L3FA 1FMVA 3ZQGA 4BJTA 2NNNA 1NB9A 1SFXA 3KPHA 5JHFA 1D0YA 2YR2A 2AXTC 3I55B 1W36C 4F91B 4A3JJ 1IRZA 3A01B 2GJRA 1YTYA 2I8DA 2I1LA 5E1XA 5KSWB 4BBSJ 4II3A 4DOZA 3S1QJ 1NRKA 2PIAA 4KA4A 2ESHA 2DPDA 2K40A 2KKOA 3JU4A 3RJPA 1I6HJ 1EH8A 1U9NA 1K78A 3ASPA 1BI0A 2O61A 2E35A 4UUSB 1R4NB 3CDIA 4A3BJ 5A8AA 2QTZA 3DF8A 4A3DJ 5E1WA 1REPC 3EQLF 3MVPA 1H88C 1RIOH 2QEXB 3QRFF 3FIWA 1BW6A 1KD1D 2IA1A 3JRGA 2IS4A 3DCFA 2ZJQF 3BG9A 1S7AA 3EDPA 2ZZQA 3R60A 3H1CA 4FQGA 5JVGF 3S3NA 1OFCX 2CW5A 1ULYA 2OF7A 3GFIA 3CCSI 4CYCA 1DG1G 2DT6A 2DY1A 1RNLA 4M1KA 2R6HA 4DNCA 5GV8A 5FKOA 2VQCA 4CH7A 1IUYA 3U2QA 1Y8RB 3OP1A 4UVCA 4CICA 4CO8A 3A2KA 2GPJA 2D1VA 1K6YA 1HKTA 3GFLA 5IPAA 4ZGQB 1D5VA 2RNJA 3DEEA 3GTGJ 1V55H 1LFUP 1QG0A 5IY5H 2HKOA 1KYWA 2F5FA 5E8IA 1BPLA 1R4MB 1HSJA 2W82A 1YJ9B 5ERIA 5TJJA 1YHQB 2R5YB 2HMAA 2E36A 3FHNA 2RNGA 2K4JA 2KHMA 4B1RA 1EP3B 3JAMK 1O7FA 1FBQA 2O6WA 1SEUA 1PUFA 1YW7A 4RAFA 4L18B 5IOZA 2JWTA 1E17A 3FXKA 3VDXA 5LGNA 1IV6A 1ZTRA 3S8PA 4FK8A 1AIPA 3E1SA 4UUSA 3MEXA 1WSUA 2M4KA 3T0YA 5EF6A 2XGJA 3BNWA 3PQKA 3GYHX 2W7ZA 2MFZA 4PJMA 2ZXHA 4ZCLA 1XGOA 4RDLA 2ZKZA 1NB0A 4G9YA 1B59A 2QLZA 3DEWA 1TYUA 2TDXA 3ABUA 2KDOA 1BX0A 3ZMSA 3D5LA 1AU7A 3WGIA 3W2WA 5IP6A 4DYQA 3OJWA 4UNOA 1WPKA 1R5OA 3WYAA 1ENHA 3QFTA 3JRFA 1GO2A 2ZTNA 4J00A 5L3BA 2GWRA 3SKBA 2MLGA 2XTXA 4GFBA 1T38A 3S16J 4R8HA 3OYDA 1WI3A 4ITVA 2WYRA 1W5CC 2LY1A 3I1FA 3SJPA 4OJ5A 4MQ9F 3D5SC 4BAYA 2F6CA 3NAUA 4HV5A 3SEQA 4V02C 4DJAA 1NBMA 1USSA 1OCCH 5ED4A 2XASA 1HSTA 2M7BA 1F4KA 1WOSA 3CJNA 3TDUC 4N9HA 1U5TB 2F4MB 3GF2A 3BOQA 3B4NA 3HUGA 1YFHA 5ILVA 1MMSA 4IQ4A 3I0TA 1T98A 1VQNI 2X1DA 2O3FA 2FXAA 5GV7A 4PUSA 1L3LA 1D3YA 1R7JA 3FKJA 4BQAA 4L5JA 1PVEA 2DCEA 3IKVA 2RQPA 1YE9A 2ZJRF 2GXBA 1FNMA 3HTUA 3E6DA 4CCMA 3GZNB 3KIOA 5K5OA 2X1EA 2Y9ZA 3FISA 3G3ZA 2DMNA 3PSIA 3GFJA 4XLHA 2CV1A 3BROA 1GJRA 2X6XA 4B48A 1OB2A 2H8RA 2CC2A 2V31A 1H0MA 4UZEA 2MBFA 2YPRA 3K2AA 1HBXG 2JN9A 2VNJA 2Y9YA 3T5XA 4G6IA 4A6DA 3HC7A 2OD5A 1V5VA 5D4SA 4ZYEA 4G7XA 2OBRA 5FD5A 3V42A 1Y1VJ 2M30A 1MNEA 1YJNB 3FXOA 3CO7C 3MKLA 1NH3A 1H42A 2A3SA 4C30A 3CESA 4W8TA 4B4CA 1VQOI 5CVIA 3GQ7A 5HLHA 3AGPA 1K83J 3JQPA 3CF5F 1D1BA 4AIJA 1VTNC 2R92J 3A03A 4DK0A 2HPIA 3TL4X 4DK1A 1QVTA 2L9VA 3MZ8A 3VODA 3FK6A 2CK3A 4BE1A 2OAZA 4RGSA 3H5NA 4X06A 2DLLA 2F43A 1H89C 3WNDA 3EQOA 3H0GJ 3TEDA 4WZTA 1K4TA 5LEJA 3W5VA 2HFHA 3ABMH 3LNQA 3CLQA 3OYHA 2QEXI 1T8IA 1MBJA 3BY2A 4J0QA 3DPUA 2NVUB 2LTPA 3CC2B 2XAJA 3G6EI 2LZJA 1LEBA 4KN7X 4ZCMA 4OZZA 3GRHA 1TYVA 4OM9A 1QZEA 2QA4I 4BEHB 4YZQA 2D1HA 3S2DJ 3A3BA 3SFZA 1Z0XA 3DDYA 4OAYA 1HW2A 4AF7A 5GAGJ 3DTIA 3M8JA 3U1DA 5HXBA 5HNHA 1QUFA 1Y0UA 1IAWA 1TW3A 1WOPA 1JHHA 1FTTA 3V7CA 3H5RA 3LSRA 1K6OA 1H8EA 4OOSA 4JP0A 4A6EA 3AG3H 4XKBA 2L7FP 3WGGA 2EQRA 3IRRA 2FRHA 4B43A 4P1VA 3IC7A 1KU7A 3BZ6A 3JRCA 1YJ9I 2QGUA 3BH7B 2MD5A 4ZTFA 5GP9A 3DFGA 1X2NA 1YHQI 1NJID 3QQAA 2QKLB 4ZTJA 3GTMJ 4M71A 3P5JA 3NWTA 1JE8A 2VBXA 1FNBA 1FNDA 1TT0A 2WADA 5BSXA 2EFQA 1EXMA 1M90D 1LFPA 2NS8A 3WTYC 3ROUA 3SJZA 5BSYA 5KK1A 5FFZA 1FMWA 5HLGA 1YIJI 2WB1A 1UD4A 2E5ZA 3QPHA 2PJPA 1GDTA 1J5YA 1IF1A 1PJ6A 1EA0A 3M3YJ 1YOVB 1IG7A 3V8LA 2V9KA 2JTVA 2OUMA 3KP3A 4I01A 3HPGA 3T8TA 3OAAA 1P7JA 4L5IA 4GCVA 4CCOA 1NHCA 4KICA 4HAMA 5LGTA 2EFPA 2NOJB 5KAFC 1ETXA 2L9NA 2LKXA 4UUVA 1BA5A 3E20A 4ZYHA 3KP4A 4O3MA 4I99C 1LDJA 3UR3C 2CSOA 4ZDOA 1MJAA 1WGXA 2X4HA 5DCFA 3FF5A 2TRTA 1JTAA 1IJEA 2CQ7A 2LF7A 2VBUA 2CUJA 4AWXB 4J01A 2R7ZJ 4Y33A 2NVYJ 4U0VA 3EUHA 1Q9SA 4CZCA 4BY1J 2O0WA 1USTA 4JQFA 2GXAA 3G2BA 1W2BB 5FIUA 5FRNA 1T08B 4E7ZA 3WE2A 1HKSA 1SAUA 3LQQA 2A6EF 4LIVA 3W6JB 4G12A 4UVAA 3CMMA 4U7BA 3H35A 2WZPP 2DEUA 4Y52J 3OSFA 5L46A 3AL0C 3ZXSA 4M0LA 2R4GA 2QKMB 2RV8A 2FE3A 4BQOA 4IHWA 1UD6A 2AHQA 2XDVA 4AU7A 1CQXA 1COWA 3ABTA 3KFWX 4G6DA 3H3UA 1Z6RA 2R7FA 2VE8A 5HLIA 3LSPA 1WDTA 2NT6A 3GQAA 2KISA 1W7PB 1B1BA 2ZXJA 3HHHA 3V8JA 4Q5SF 3A1PA 1T6XA 2NOGA 3WNBA 2DDBA 1KC8D 4DZPA 3G73A 2ID3A 1FIPA 2EILH 2LREA 2WA0A 3A01A 1R1UA 3CW2A 1VQMB 1TTTA 2FQ3A 2JVGA 2D3LA 4PAAA 1PUEE 2BVMA 1ZGWA 4IJAA 3HG9A 1GT0C 1Q81D 4XL9A 3M9AA 5GPAA 4KMFA 3BCFA 4A0XA 4PMHA 5IP9J 3OJXA 4YIIA 3AVUA 1MKMA 2WWYA 2VUMJ 2IQ7A 4RJLA 4CDGA 4XKVA 4XMYA 2VNIA 2Y69H 2QTLA 2OQRA 4JBAA 5H6RA 4YZAA 4FWTA 4DQLA 4EGZA 2GOXB 4S05A 1MABA 2OV7A 3KP2A 2HTJA 3QWLA 2IS1A 2XGCA 2Z5UA 1BLIA 1RU4A 1QVUA 1MW7A 3A1YA 3PFYA 2LY2A 3ZMDA 1OYIA 1B2RA 1LLZA 2ZC2A 4C2LA 2R7RA 3CCQB 1P2FA 5H20A 4JYKA 3BJOA 4CUGA 4IW3B 1POGA 1MIJA 3CJTB 1VQ6B 3C3WA 3HGGA 1FNCA 5K7FA 4ANJA 3PA1A 4AC9A 4DNTB 2PN6A 3ESWB 3FBNB 1X1AA 3ASRA 1Z6TA 2FX3A 4F3QA 1I6XA 1CF7B 5F27A 1ZM2A 5F64A 4E7SA 2QA4B 3SUCA 4Q7JB 1WJAA 1AKHB 1XMXA 2BM5A 2WY8Q 2HYJA 2ZSHB 3ML6A 2W1OA 2P7CB 5A88A 2J7KA 2E2JJ 2VI6A 4XRFA 1YX2A 2HEOA 2FUG2 2VBZA 2VBTA 3BCDA 3OE7A 4N4OB 1TUIA 4HE6A 2V26A 4DBRA 3RCOA 1XE1A 3JRBA 3A3GA 2DAOA 3B8HA 5GAHJ 3V4GA 4RD6A 2W24A 1LFBA 3GQ9A 1OCPA 1RPWA 1S29A 1TQIA 2E60A 2L4AA 1YLOA 4TMWA 4C0SA 4CCKA 2V7WA 1IV8A 2RVCA 4NQWB 2BOLA 4ZYDA 4C2TA 3N90A 5A2QZ 1EFTA 5FL7A 4G6TB 4MGRA 3H3VK 1T33A 2QQBA 3I5UA 2K86A 5FO5A 1WQ2A 3EYYA 3CCEB 2LC2A 4ESJA 4HF0A 3OS2A 2OZUA 5ICCA 4WXCA 1H9TA 1SFUA 5E1ZB 3CCLB 3G4SI 2ZZGA 2VBVA 3W2GA 1Y6IA 3BCAA 1HG8A 4AVZA 2JA2A 1WFXA 4WF2A 3K70C 1MJ9A 3ABLH 2FSWA 4KT5C 4CXFA 1RKWA 4NC6A 2V4DA 1SFEA 1VQ7I 5FJ8J 3G05A 3BG6A 3CDHA 4F55A 4CQJA 3AVYA 1WU8A 4XRMA 2WTEA 4BYYA 3I4MJ 1I27A 1R9TJ 1QO0D 4I84A 3HOYJ 4XRSG 3S14J 3N05A 2W84A 3WTVC 2QVOA 2XT2A 1ZGAA 1E1RA 2BXYA 3BTLA 2XGDA 2ZFWA 4GGGA 2DYRH 4P6VF 1T6YA 1ON2A 2DTZA 2IEKA 2VBEA 3H9QA 3A02A 2OCCH 4XIDA 1MH3A 3LQ6A 2AXLA 3IH4A 3B8YA 4OJPA 2K7LA 3WY9A 1IRXA 3FBIB 3OEEA 3P9CA 3MZHA 2HLDA 1SD4A 5J40A 4B8XA 3ZQQA 2L3DA 1JRGA 2NTQA 4OIPF 4G6QA 1FEXA 4Z05A 3F8NA 2Z3YA 2NNYA 3FM3A 3QODA 1OYWA 1RUNA 1H8HA 1OISA 1F36A 2LR8A 3E1YE 1ITYA 5LLQA 3U9GA 2JPCA 2V9VA 3E5QA 2EPFA 2XPWA 3TW7A 2UXXA 3GQBA 2M8GX 4CSWA 5E3NA 3HTSB 2NPFA 4RDKA 3I4PA 1OGMX 1S72B 1E3HA 1G7TA 4BHCA 1CZFA 3OR1C 2QGGA 3O6BB 2EZKA 3CMYA 5J4VA 4PGGA 4LG0B 1E1QA 4C3IJ 2F2EA 1FJLA 4FN5A 4HZFA 2C4UA 4L9VA 4Z4RA 4AIDA 4X8IA 2F5EA 2EINH 2LNBA 2BY1A 4EJOA 3IP4B 4G7HF 2Y2ZA 3ZOBA 3AK5A 1W0TA 4QVAA 4A3FJ 5EG0A 3HAGA 3OR2C 4QUZA 3BY1A 1A8PA 2CNDA 1H8AC 1X4OA 2IRFG 1ZM4A 3CMAI 2PEXA 3BR6A 4XLFA 3A8JA 5FO0A 5D8KB 1Z77A 3LQRA 3LL7A 4GO1A 5J47A 1B8IA 5JBQA 4KKUA 2FU4A 2WSSA 4HE5A 3G1LA 1A04A 1IXSB 3SZPA 3S1RJ 3IAM2 3FZVA 4EVIA 1QX4A 2DETA 5A2QK 3VYSB 1WWXA 4KH3A 4GDFA 3L09A 4MFEA 4A93J 4GYIA 1UELB 3RPQA 1G59A 1TW2A 1V54H 3HBLA 3KEYA 3P4GA 4DNRB 1IXRC 4Z2YA 2JDIA 5A89A 3CCMB 5EEHA 4AUXA 1MBGA 1VFCA 3LA3A 5J1YA 2AS5F 4RPDA 3FXUA 1O8JA 4S04A 1R5BA 1O8EA 1W5TA 2JPBA 2QN6A 3PNTA 5M3FJ 2EBIA 5TY0A 1MBFA 1ORKA 2OK7A 4YZXA 2KMUA 5HOOA 1PJ5A 4BY7J 2FMYA 1EA3A 4RMNA 3GTQJ 1FTZA 4A3LJ 2JN6A 1I3AA 3PL8A 2FBKA 3HB9A 3C1DA 1JUPA 1YI2I 1QCXA 2Q2EB 4MR0A 4YDTA 2HYFA 1O8KA 4DQKA 3HRUA 5F0HA 5CVUA 1RI7A 2HVQA 5GAEJ 3CCYA 2BE5F 2XZOA 1RZ4A 4OIQF 3I58A 3ZMZA 3L2VA 2AQEA 2ZMEB 5LD2C 1VQNB 1KCDA 3I56B 3O8HA 4N0BA 1YJWB 3EYIA 5DCMA 2L7KA 4ENJA 1KRHA 3MD2A 1K73D 4U4BA 5J6XA 5DS0A 2O03A 3A4CA 1O7LA 4M2LA 1DP3A 2AHOA 5THXA 2DK8A 3FKSA 1B4AA 2X6OA 3LQEA 2NVTJ 3SY2A 3ELKA 4P3IA 1ZK8A 1VBLA 4QWQA 4M53A 1T6SA 3ZQHA 3PVDA
chains in the Genus database with same CATH topology
1AA7A 5CPRB 2VQCA 4CH7A 3DWLE 2WY7Q 1LKXA 1E3ZA 1UG0A 4BU2A 3A2KA 2AQFA 2CV2A 1K6YA 3K70D 4B3XA 2R7TA 4PJNA 3H9JA 3DEEA 4XD7A 2UUZA 1WJBA 2DJIA 3RTRA 1BPLA 2GK7A 2W82A 1O8GA 1OGOX 2VJIA 4XOPA 2NTPA 3K4JA 3FHNA 2RNGA 2KHMA 1W0JA 1D1AA 4TT3A 3DQVC 4HRIA 3VSUA 4F52A 1Z3YA 3D5RC 2CMPA 2R7XA 2X6WA 3OIPA 3TBIA 3VDXA 1E3XA 1OFMA 2EWEA 3M1CA 4HNUA 5C1EA 2ZZEA 1D1CA 3AFHA 3S8PA 3ZR8X 1DBGA 1IDJA 3E1SA 4II2A 2JJ2A 2JUGA 4NUBA 2M4KA 1MMDA 3VWBA 4U49A 2XGJA 1T0FC 2HU9A 4PK4A 2BSPA 4NC8A 2MFZA 4PJMA 1NG6A 2ZXHA 2VLAA 3VYRB 2ZFUA 3PSFA 3TMOA 2VJJA 3AL0B 1V0FA 4E7KA 2E1MC 2PJRB 4L8JA 2BW3A 2KDOA 2KL4A 3D5LA 3W2WA 4HEA2 1BOBA 2A5WA 2LBFB 1V0EA 1H80A 3IUOA 3L2UA 3U21A 2KRCA 4CCLA 2ZTNA 5DN6A 4YZ0A 4J00A 2ZSIB 3AKZA 2VJ5A 2K5CA 3OYDA 3JURA 4ITVA 4LIUA 2X1CA 3K10A 2LY1A 2KLOA 4OJ5A 2RQQA 2W7NA 1X4PA 3D5SC 2F6CA 3SEQA 4E0FA 4DJAA 4EATA 1NBMA 2PYGA 2M7BA 3MMYB 4BXFA 2Z8GA 3B4NA 2E1BA 4PJLA 4JOMA 3H9GA 3K4BA 4IQ4A 2X1DA 2VL8A 2VBMA 4PUSA 4BE0A 3FKJA 2DCEA 3S32A 3LSKA 5KHDA 1YE9A 3FY3A 3K4CA 3KEWA 4CCMA 2X1EA 3PSIA 3PJRA 1PJRA 4XLHA 2CV1A 1I18A 3SZGA 3OWTA 2O04A 2O0VA 3SDBA 3PNVA 3H0DA 5CQGA 1UD5A 2UVFA 2X6XA 4RLFA 3LSGA 2R7QA 2E1MB 3VYUB 2WAQA 4B48A 2V31A 4C2UA 4G6IA 2V7FA 3HC7A 1NG7A 1LDKB 2Z1DA 1DGRM 1K5CA 4G7XA 2LBFA 3V42A 1WTHD 2V6EA 1O8HA 2VXZA 1MNEA 2V7QA 2PYHA 2IGMA 1YX3A 4C30A 2XOKA 2HNHA 3CESA 4W8TA 3F9KA 4XORA 3ONQA 3GQ7A 2X6YA 3SYTA 1D1BA 1X1DA 3K6GA 4DK0A 2HPIA 3QYBA 4KT6A 4LG3A 3TL4X 4DK1A 2NT9A 2JVHA 1QHGA 3C2HA 3EPZA 3HUGB 3OIQA 4BQQA 1DGWY 4BE1A 2CK3A 3H5NA 3J7AY 2F43A 3EQOA 1BR1A 1WJFA 4ASUA 4B3FX 3OYHA 1X1BA 2MC4A 4YXWA 3DPUA 3OYGA 1KTWA 3EUKL 1EE6A 2X8KA 2LZJA 2L9SA 4RLQA 4OZZA 5HVQC 2XZPA 1UD3A 2IGNA 3GRHA 3OFNA 4BEHB 4YZQA 5AMVA 2HZDA 3HOTA 3A3BA 4XQFA 3DDYA 3T53B 4OAYA 2UVEA 3ZPNA 3DTIA 3M8JA 3RPUD 3VSTA 5HNHA 3SEZA 3LSIA 2W4SA 3H5RA 4UZUA 5CKTA 2WAEA 1H8EA 1UAAA 2CH0A 4XKBA 1GQ8A 4BUPA 4D1QA 2V1NA 4GRIA 4B43A 1OB0A 2QY1A 3VSVA 3K4MA 2F5VA 2PMZA 4PFOA 3VSKA 4ZTFA 4OAZA 1W36D 1G8XA 3WQZA 2QKLB 3S93A 4ZTJA 4BGDA 4CA0A 1BN8A 3NWTA 1BMFA 1V5EA 1TT0A 2WADA 2VASA 2HVRA 3VR6A 1LFPA 1OFLA 4NNJA 1IDKA 3EUAA 3VYTB 1WMRA 1FMWA 1UD4A 2WB1A 4XKWA 2E5ZA 3QYEA 3I9V2 3ZSCA 3QYFA 3T56B 4DBQA 2CUZA 3HKZA 2GOMA 2CW7A 2LRDA 2V9KA 5TGTA 2OUMA 2A6TA 1HVXA 1KMHA 2UV1A 3HPGA 4N4NB 4Y4RA 1ERDA 1DQUA 3OAAA 1LVKA 1VF7A 1QHHD 3GVLA 4CCOA 4URRA 4HWVA 4Z06A 1NHCA 3OYJA 3ZIAA 2NOJB 2L9NA 3HOSA 1PXZA 1N77A 2HPMA 3CJQB 1ZELA 3UR3C 2WJVA 1Y56A 1JI8A 2Q1ZB 2XAUA 2HVSA 4ZDOA 4HIZA 3FDYA 3KX2A 3OMYA 4HSRA 4W8SA 2QE7A 1JTAA 3PNYA 2MD0A 4HSTA 4IKFA 3T51B 2CUJA 2L5QA 2CS3A 3DKYA 3DPTA 4H4KC 2ELJA 3W2VA 4J01A 4Y33A 1I8DA 2WBMA 2K9MA 4BE2A 4RM2A 4XOTA 4CZCA 3I3LA 3LMWA 2O0WA 3KRGA 2INUA 4JQFA 4OJ6A 4KKTA 3OYEA 2WAFA 4FXUA 3G2BA 4TSFA 2NSTA 5FRNA 3LSHA 2GJPA 1DBOA 4R79A 4E7ZA 4QPOA 1W9XA 2WPDA 2LOOA 4B44A 2D3NA 1SAUA 1Z7LA 3OYAA 4LIVA 4LITA 3W3CA 4Y3OA 3RSNA 3NE5B 3CMMA 4E4HA 3EUHC 4U7BA 3H35A 4E7LA 3S3OA 2WZPP 1X1CA 4CCNA 1QJVA 4NK8A 1O8IA 3AL0C 3ZXSA 4BS9A 2R4GA 2QKMB 4W8QA 4BQOA 2DT7B 1N78A 1WJ5A 1YX5A 2XDVA 3K4LA 4AU7A 1COWA 1UD6A 2JJ1A 2VJ4A 3DPLC 2M4GA 4BJ6C 1OOCA 3K4NA 3C2GA 1QU3A 2R7UA 2KRHA 1PYVA 3LFUA 2VXDA 4HNTA 5HNFA 3ZCOA 2NT6A 3GQAA 3T9GA 3OY9A 2F4IA 2GK6A 2LREA 2WA0A 3CP2A 5CDFA 3OYIA 4CCJA 2JVGA 4OWRB 2D3LA 1VZ0A 1HZEA 2XNDA 2BVMA 5KNLA 3HG9A 2IS2A 3UNGC 3VMVA 3MKYB 4XL9A 3ZRGA 4PMHA 3BCFA 1V5GA 3VMWA 1TZLA 2JIZA 2M0MA 5FROA 2IQ7A 4XKVA 1P9QC 2MYSA 2XF5A 4XMYA 4XLCA 4BQNA 3BCBA 1E43A 4YZAA 3OS1A 1UD8A 3OYNA 4XKCA 2XF7A 2GOXB 4IQJA 2KQRA 4XR6A 1HA8A 2OV7A 1MABA 4JMQA 3DU5A 1O8FA 1VJSA 1SFKA 1KCCA 2IS1A 1BLIA 3OYKA 1RU4A 1MW7A 3A1YA 3PFYA 2LY2A 4C2LA 2R7RA 4FETA 2CV0A 3L2WA 4CUGA 3ZGKA 5FRMA 3HL2A 4B3GA 3PUBA 1RWRA 2LG4A 4ANJA 3L2RA 2M5SA 4DNTB 1BR4A 3BG7A 3FBNB 1BHEA 1X1AA 5KCMA 4YELA 4DGWB 4F3QA 2LYCA 2NTBA 2VBKA 4E7SA 3LMMA 3SUCA 2VPLA 4PSXA 4XLAA 1WJAA 3ZPPA 3OL3A 2WY8Q 2ZSHB 1W0KA 2W1OA 2HDWA 3FPPA 3HPHA 2O17A 4TKOB 3OYLA 3CP8A 3BCDA 3OE7A 2FUG2 4D9JA 4NK6A 4N4OB 4XONA 5IK2A 2V26A 1D0XA 2XSJC 4DBRA 5LFAA 3RCOA 2O1DA 3A3GA 4BDYA 2ZTGA 2XF6A 4NC7A 3MKZA 4F93B 2X3HA 3GQ9A 3WWGA 2E60A 4B47A 1MMNA 4E7JA 2JSPA 1XG2A 2R7WA 4CCKA 4W8RA 5C1CA 4NQWB 4P5OA 4ZDLA 2XC7A 2BOLA 4OJLA 3BC8A 4C2TA 2M7AA 5FL7A 1J09A 4G6TB 1OLTA 4OJOA 2KVOA 4XM3A 4P22A 1EFRA 4HPQA 3KYLA 2LC2A 2BW3B 3OS2A 1PE9A 1GLNA 2IGKA 4PSWA 2ZZGA 3OYBA 4PJJA 1Y6IA 3BCAA 1KZLA 3CZ6A 4IX7A 4AVZA 2JA2A 1HG8A 1WFXA 2KPMA 2BVLA 3K70C 2IGOA 1MMAA 2ZXIA 4XN3A 2V4DA 3G05A 2DOAA 2IXSA 3BG6A 3HXLA 4F55A 1PLUA 2M3AA 3LSMA 4ZC3A 4I84A 1WPCA 3N05A 1IA5A 3S3MA 4U87A 1RMGA 2Z2SB 1E1RA 2OC6A 2VIXA 3H5AA 2R9VA 2RREA 4G7WA 4XNFA 4XLEA 2KZVA 3H9QA 3VSLA 3DTEA 2VBEA 3E0JB 3QOEA 3EQNA 2Y0SA 1T5EA 3B8YA 5HLTA 4OJPA 3NWSA 3DLAA 1IRXA 1KONA 2K3PA 3FBIB 4E7IA 3OEEA 3B90A 2XZLA 2HLDA 3ZQQA 4PFPA 4E7HA 1JRGA 2NTQA 5HKKA 4Z05A 3OYMA 4P1WA 1OHHA 3MKWB 4FASD 3QODA 1U0JA 1H8HA 4C9YA 2DIEA 1AIRA 2ODLA 4BEHA 3BH4A 4IZZA 1O88A 2PECA 3GQ8A 2KP6A 4ZJZA 3LNNA 3DKXA 3GQBA 4CSWA 2LH9A 4YEJA 4ZDPA 3OEHA 1FX0A 1OGMX 4HG2A 2UWMA 1E79A 3CF2A 1S9HA 3DU6A 4AYBA 2VKDA 1CZFA 3IAS2 3OR1C 1E1QA 2ZZQA 1IB4A 1E0EA 1Z3XA 3OPOA 2K9LA 2W00A 3RQ4A 3IP4B 2NSPA 3HAGA 4F92B 2P0WA 2Z16A 3OR2C 4Z03A 4KJZA 3GBGA 1T95A 4MXNA 2CW8A 3CJRB 1X4OA 4YRVA 4KITB 1SKYB 4KISA 1X0CA 1Z21A 1WJEA 4XLFA 4GQNA 2IS6A 3GVKA 3OS0A 2R7VA 3A35A 2NZMA 4E6KG 2O5RA 3GVJA 3LL7A 4BDZA 1O8DA 3OYCA 1O8LA 2WSSA 4KKSA 3OOUA 2DXIA 1WP6A 3IAM2 4Z1MA 3K4KA 1BR2A 3L2QA 3VYSB 3OL4A 4XN0A 1X19A 4OZYA 1UELB 5CQEA 1G59A 3KEYA 2F1MA 4DNRB 2E5NA 2JDIA 2CFOA 2QXZA 1WJCA 4DIQA 4BACA 2ZZFA 2W6JA 2MABA 3BLYA 1MMGA 1O8EA 4QPQA 1O8JA 4ZYAA 4EW9A 1FMVA 1UD2A 4BJTA 2VKHA 3PNTA 3DTKA 5JHFA 1D0YA 2L2OA 2X51A 4YZXA 2KMUA 1W36C 4F91B 5HOOA 2GJRA 2GJKA 3BC9A 2INVA 2V4JC 2HQAA 1EA3A 4RMNA 2PJRA 2VQHA 2X53S 3PL8A 2I8DA 3OW7A 4II3A 4DOZA 2R7OA 1QCXA 2Q2EB 4MR0A 1WJDA 1MNDA 4MLOA 1NRKA 1O8KA 3H94A 2R7SA 4RM3A 1VLYA 3JU4A 2HVQA 2VQGA 2XZOA 3OYFA 3OOCA 1O8MA 3L2VA 2AQEA 1KCDA 5LD2C 3W2AA 1N75A 2VQLA 2L7KA 4X0GA 1K28D 4KKUA 3MD2A 2WJYA 2VB6A 1R6RA 4U4BA 2Z6BD 1OR7C 3A4CA 1PKVA 1V5FA 1DP3A 2W6IA 2IS4A 3FKSA 2X85A 3UW0A 4BJ5C 1D0ZA 4BL0B 3S3NA 2QX3A 1VBLA 2DT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NT9 A;  1JRG A;  3VMV A;  4XL9 A;  2NTQ A;  4PMH A;  4Z05 A;  3VMW A;  3EQO A;  2IQ7 A;  4XKV A;  4XMY A;  4XLC A;  1AIR A;  4YZA A;  2ODL A;  1KTW A;  1O8G A;  1EE6 A;  1OGO X;  2VJI A;  4XR6 A;  4XOP A;  1O88 A;  2NTP A;  2PEC A;  3GQ8 A;  4OZZ A;  1O8F A;  3GRH A;  4YEJ A;  4YZQ A;  5AMV A;  1KCC A;  1OGM X;  3VSU A;  4XQF A;  1RU4 A;  2UVE A;  1CZF A;  1IB4 A;  3VST A;  2X6W A;  2EWE A;  1OFM A;  4C2L A;  5C1E A;  1DBG A;  1GQ8 A;  1IDJ A;  4U49 A;  1RWR A;  1BHE A;  2BSP A;  2QY1 A;  2NSP A;  4Z03 A;  3VSV A;  4YEL A;  4MXN A;  2NTB A;  2VBK A;  1BN8 A;  1X0C A;  3SUC A;  4XLA A;  2VJJ A;  3ZPP A;  4XLF A;  1OFL A;  2NZM A;  2O17 A;  1IDK A;  1O8D A;  1WMR A;  4NK6 A;  1O8L A;  4XON A;  4XKW A;  2O1D A;  1H80 A;  3ZSC A;  4YZ0 A;  2X3H A;  3GQ9 A;  3WWG A;  4XN0 A;  1XG2 A;  3JUR A;  4W8R A;  5C1C A;  4OZY A;  4OJ5 A;  4URR A;  1NHC A;  4HWV A;  4OJL A;  4Z06 A;  2QXZ A;  4OJO A;  1PXZ A;  4XM3 A;  2PYG A;  1O8J A;  1O8E A;  2Z8G A;  3B4N A;  1PE9 A;  4EW9 A;  4W8S A;  1JTA A;  2VBM A;  4YZX A;  2INV A;  1HG8 A;  4XOT A;  4AVZ A;  3LMW A;  2O0W A;  3KRG A;  2INU A;  4OJ6 A;  3FY3 A;  2NST A;  1QCX A;  4MR0 A;  1DBO A;  4XN3 A;  4XLH A;  2O0V A;  2O04 A;  1O8K A;  2UVF A;  1PLU A;  2X6X A;  4I84 A;  1O8M A;  1IA5 A;  1KCD A;  1QJV A;  4NK8 A;  1RMG A;  1O8I A;  4W8Q A;  1K5C A;  4U4B A;  1OOC A;  1O8H A;  4XNF A;  2NT6 A;  4XLE A;  2PYH A;  2VBE A;  3GQA A;  3EQN A;  3T9G A;  2X85 A;  3UW0 A;  4W8T A;  3B8Y A;  4XOR A;  3GQ7 A;  4OJP A;  3B90 A;  2X6Y A;  2QX3 A;  1VBL A; 
#chains in the Genus database with same CATH topology
 1ACI A;  3K7A J;  5F08 A;  2E7X A;  5CPR B;  3GLX A;  3CUQ C;  4PGH A;  1B6A A;  3K1N A;  2ECC A;  4X07 A;  3RY8 A;  1UG0 A;  4BU2 A;  1DDN A;  2AQF A;  2GM4 A;  5F04 A;  4B3X A;  3ZQC A;  1VQK I;  2ZBU A;  1IC8 A;  4HX4 A;  5AON A;  3COA C;  2RKH A;  4HA8 A;  2W25 A;  5FKL A;  4QTR A;  1HDP A;  2FD5 A;  1FRQ A;  1T56 A;  1W7P A;  1D1A A;  1OKR A;  1FOY A;  5BPI A;  4F52 A;  2FOK A;  2EFO A;  3D5R C;  5E3O A;  3E6C C;  2IT0 A;  2X6W A;  1Z67 A;  2EWE A;  2IOU G;  1E3X A;  1ELO A;  1OFM A;  3KCC A;  1BM9 A;  1C0W A;  4MYU A;  3OW2 B;  3FXM A;  4MEY F;  3CCR I;  1DBG A;  1K9M D;  1SAN A;  1ETV A;  4IEJ A;  2JJ2 A;  2JUG A;  1J9I A;  1IDJ A;  1MMD A;  3VWB A;  2ISZ A;  3FXR A;  5M5W J;  2Q8K A;  3LJY A;  3CUO A;  2RC4 A;  4DQ2 A;  1WH5 A;  1NG6 A;  1R5I D;  1FOX A;  2LDU A;  1A36 A;  2RDP A;  4MTE A;  3PSF A;  4M3E A;  2RAE A;  2HQR A;  3BG5 A;  3HSE A;  4NDL A;  9ANT A;  2E1M C;  2PJR B;  4D5C A;  3VEP A;  2BW3 A;  4CYC B;  3CD6 B;  2W85 A;  2FVG A;  2FBI A;  2LBF B;  2A5W A;  3BTJ A;  1RRJ A;  2BYV E;  2DFE A;  2W57 A;  2V79 A;  3IUO A;  1XSD A;  1H80 A;  3U21 A;  2COB A;  2KRC A;  1B72 A;  5DN6 A;  1JB9 A;  2ZSI B;  4QV2 A;  2BEO A;  1HCR A;  3VFZ A;  4M6X A;  3JR9 A;  1Q1H A;  2L7M P;  3V7S A;  3TKY A;  1NTC A;  2KLO A;  2XIG A;  3R6S A;  4ENN A;  2X3U A;  2W7N A;  3MCA A;  3KZY A;  4E0F A;  1K4S A;  4EAT A;  3FHZ A;  3CC7 I;  3LWF A;  3U1K A;  2O8X A;  2GXG A;  1SC7 A;  1QGY A;  2JK3 A;  1VQP B;  4PC3 A;  5E20 A;  2E1B A;  4PJL A;  3HRT A;  4OOI A;  3R4K A;  1G4D A;  2P5L C;  3K4B A;  3ZQ7 A;  3G71 I;  4F7D A;  2QYU A;  2BGC A;  1BX1 A;  2K4B A;  4BE0 A;  1TYW A;  2JRM A;  2R5Z A;  4M9X A;  3D0S A;  3FY3 A;  3K4C A;  5HDN A;  1L0O C;  4ENK A;  1FSH A;  4KIF A;  2V5I A;  3PJR A;  4A3E J;  1TQM A;  3SDB A;  3PNV A;  5EGO A;  5CQG A;  3BR1 A;  1Y0N A;  2XTY A;  2R7Q A;  3BPV A;  1U2W A;  3PQJ A;  3VO2 A;  3BR0 A;  4LLL A;  1I1S A;  1QGA A;  2DCU A;  3U6B A;  2L9R A;  3QU6 A;  2H6B A;  1T6Z A;  4GYG A;  1D2E A;  2Z1D A;  1K5C A;  2LBF A;  5F1J A;  5M3M J;  1Y1W J;  1IDZ A;  4YC5 A;  3JTH A;  2IA2 A;  1WTH D;  1YS7 A;  2BZT A;  3MMP A;  1O8H A;  3F22 A;  1SD6 A;  1YYV A;  2H8W A;  2IGM A;  2L4M A;  4M74 A;  4I6Z A;  2G0Y A;  4M6V A;  5JLV C;  2DYS H;  1YX3 A;  2F4O B;  2DJN A;  4QSH A;  3KEQ A;  1IUF A;  1QNT A;  3WE3 A;  2XOK A;  2V1D A;  3F9K A;  5B5E C;  2OTL I;  2X6Y A;  3SYT A;  3JW4 A;  2XKO A;  1QFJ A;  1X1D A;  2OBP A;  3QYB A;  4UV8 A;  5IYN A;  2OTJ B;  1JUS A;  3TOB A;  4ZCI A;  4UAJ A;  1OCT C;  3E6M A;  2ZNZ A;  1SMT A;  4KDP A;  5LRS A;  3AGQ A;  1BR1 A;  1WJF A;  4KUM A;  3Q5F A;  1D8J A;  1E2X A;  4Z4V A;  4YXW A;  5DS9 A;  3AG2 H;  3OYG A;  2NV4 A;  1KTW A;  1ZRD A;  2Q6L A;  2X8K A;  4LBV A;  3TO9 A;  4ASN A;  2XZP A;  3W2H A;  5D5U B;  3OFN A;  3TDZ C;  1VI0 A;  1H9G A;  1XPX A;  1HLV A;  2QBY A;  3NRV A;  4CGZ A;  2JUC A;  3ZPN A;  1WH7 A;  3RPU D;  3ZZT A;  1ZYR F;  2ZIT A;  3SEZ A;  4EJT A;  3LSI A;  3ZMT A;  2W4S A;  1BC7 C;  5CKT A;  1UAA A;  3I55 I;  2P4W A;  2CH0 A;  1GQ8 A;  2BPO A;  2FNA A;  3DKW A;  4GRI A;  5ICE A;  2QY1 A;  1ON1 A;  1ZM3 A;  1R1V A;  1OB5 A;  1W36 D;  4OAZ A;  4RDU A;  3ZQL A;  4UXN A;  3N97 A;  1BN8 A;  1QVF B;  2XRL A;  2QSG X;  1R1T A;  1ZGJ A;  1V5E A;  1FYM A;  2HCJ B;  3ASS A;  2EIK H;  2HVR A;  4EJV A;  2EFW A;  1KU9 A;  2BY2 A;  4NNJ A;  5ICF A;  3ERE D;  2CUE A;  4AM3 A;  3QYE A;  4HF2 A;  4UB8 C;  3ZSC A;  3JSP A;  4M4S A;  3GTJ J;  4DBQ A;  5IK2 A;  2V1X A;  2GOM A;  2CW7 A;  3FM5 A;  3ZP5 A;  5E17 F;  2YX7 A;  3H9N A;  1HOM A;  4Y4R A;  1ERD A;  1LUJ B;  1OFE A;  4MO7 A;  5EG0 B;  3HRM A;  1LVK A;  3M4O J;  1QHH D;  3OZV A;  3VOE A;  1IRF A;  1BW5 A;  3ZIA A;  1TBX A;  3HOS A;  2EA4 A;  4P9U A;  1F5T A;  1ZEL A;  4A3M J;  1S72 I;  5DV5 A;  1UFM A;  2JA6 J;  3OMY A;  3SDG A;  2DER A;  2CS3 A;  3NQO A;  4HLY A;  1I8D A;  4BE2 A;  4RCZ A;  1BC8 C;  4XOT A;  2E19 A;  3OOP A;  2XNJ A;  1B8I B;  1MNM C;  1YI2 B;  1Q86 D;  2VBW A;  3LMW A;  4NHJ A;  1DDI A;  4QVJ A;  4AYB N;  1WOR A;  4N3N A;  2WR8 A;  3LSH A;  5BMZ A;  5D8L B;  2F5C A;  4QPO A;  2LOO A;  4B44 A;  2NAZ A;  2D3N A;  3OYA A;  3CB4 A;  1VQ8 B;  3W3C A;  4UHT A;  4CYD A;  5DM7 F;  4Y3O A;  3RSN A;  1VQP I;  3NE5 B;  2PQ8 A;  2B0L A;  3EUH C;  4U9U A;  2R0Q C;  3CCL I;  2DFI A;  4E7L A;  4NK8 A;  5IT9 Z;  3F3X A;  1O3T A;  3ONU A;  1O8I A;  2NRA C;  5J35 A;  3HYI A;  3F8M A;  5CLS A;  4W8Q A;  4YFK F;  3TO7 A;  2JJ1 A;  1YX5 A;  3K4L A;  1OOC A;  1QU3 A;  3C2G A;  3CCJ I;  3A8I A;  3LFU A;  2VXD A;  2PMH A;  3T9G A;  3OY9 A;  4A3I J;  3WG9 A;  2GK6 A;  1X58 A;  3E5U A;  1AMO A;  3GTK J;  3OYI A;  2IJL A;  4CCJ A;  1KTV A;  3PET A;  4Z4T A;  3LSJ A;  4BHP A;  3R0A A;  1IN4 A;  3JRH A;  5KNL A;  2IS2 A;  1TTY A;  3WTT C;  1RUO A;  4LB5 A;  1KK1 A;  4RBO A;  1V5G A;  3I71 A;  3JRI A;  3VMW A;  1TZL A;  3PUN A;  4KFC A;  2DDA A;  5FRO A;  4Y13 A;  1S4M A;  1QA3 A;  1E3P A;  2STW A;  4BQN A;  1PUF B;  4IRI A;  1N8R D;  3PIP F;  4OPS A;  5KAI C;  2ZME A;  2Z9O A;  3OS1 A;  2PG4 A;  1UD8 A;  3OYN A;  2HOT A;  4XKC A;  2XF7 A;  2ME6 A;  3TP3 A;  3IV5 A;  1O4X A;  1JTY A;  4IQJ A;  5DNS A;  4EMS A;  3DU5 A;  1O8F A;  1E3O C;  1SFK A;  1GHC A;  3A8K A;  2XKP A;  2OQG A;  5BOX A;  1KK0 A;  2ME0 A;  4FET A;  1TLH B;  2CV0 A;  3L2W A;  2DOG A;  2EZI A;  2IP2 A;  5C4X J;  3H3Z A;  3SZE A;  1QRC A;  3HL2 A;  1RKT A;  4A5M A;  3PUB A;  1VQ5 B;  2E7W A;  2VFQ A;  3L2R A;  2M5S A;  5IYW A;  1GXQ A;  3FXJ A;  3BG7 A;  1MD0 A;  5KCM A;  5H5J A;  2LVS A;  2VBK A;  2OYN A;  3KE2 A;  2GIZ A;  3QPS A;  5JHU A;  1RR8 C;  3CC4 I;  5IT3 A;  1WSV A;  3IWZ A;  2BHY A;  4L5E A;  2PLF A;  3R6K A;  1MGT A;  2A5Y B;  2VOO A;  2BVN A;  2HDW A;  2VKV A;  3HHG A;  3BQJ A;  2HOS A;  2O17 A;  4TKO B;  3OYL A;  2KFD A;  4D9J A;  2XSJ C;  2YSR A;  5LFA A;  1WRJ A;  2GLO A;  1EKE A;  1S6L A;  1QPI A;  2I10 A;  5HS7 A;  4WWV A;  2HYG D;  1ZHF A;  4B47 A;  4M3F A;  4N3G A;  1XG2 A;  5ICG A;  5IYB J;  4ZZL A;  2VYQ A;  4XSX F;  4MTD A;  4LG0 A;  2I5U A;  5C1C A;  4ZDL A;  2XC7 A;  2Q6K A;  2X0K A;  5AN9 A;  4LD5 A;  4OJL A;  2F1L A;  1J09 A;  3DXJ F;  1OLT A;  3L00 A;  1O3R A;  4P22 A;  1EZG A;  2Y75 A;  1T0F A;  3KYL A;  4V2G A;  3BQZ A;  2BW3 B;  1R49 A;  4FTH A;  2KIU A;  2QSF X;  1GLN A;  3ABK H;  2IGK A;  2J5P A;  4PSW A;  5B66 C;  1LPQ A;  2DW4 A;  3KYC B;  3HDD A;  3RKQ A;  3J7Z I;  1DPR A;  3PSS A;  2RN7 A;  3OYB A;  4MYT A;  2V9P A;  3SFI A;  4IX7 A;  3CC2 I;  4KYW A;  3Q39 A;  5L3C A;  5B1B H;  4RAY A;  2BVL A;  1G7C A;  2VT2 A;  5DYM A;  1K78 B;  4ESB A;  4WWC A;  2IXS A;  3HXL A;  4D5F A;  4C3J J;  3AG4 H;  3PEN A;  1K8F A;  1VQM I;  1UB9 A;  1WPC A;  1Z1D A;  1APL C;  1FPQ A;  1IA5 A;  3JSO A;  4U87 A;  1U8R A;  1SKQ A;  1JKP C;  1ZR2 A;  2M9H A;  2VIX A;  3VNV A;  4YG2 F;  1BJK A;  2BGJ A;  3H5A A;  1WHU A;  3RYP A;  1MZB A;  2RRE A;  4QLC U;  2MGQ A;  2ELH A;  3T1B A;  4FCY A;  2Q6I A;  4UY8 I;  3VSL A;  2DN0 A;  3E0J B;  1MBH A;  2Y0S A;  4RB2 C;  4B3A A;  1T5E A;  2VFM A;  3S2H J;  1K79 A;  4Z4S A;  3GVA A;  2BSA A;  3DLA A;  2NS7 A;  3B90 A;  4IHS A;  5FKM A;  5F4J A;  2PBI A;  1X2M A;  3PO2 J;  1ODD A;  1KA8 A;  4Y9R A;  2XZL A;  1YJW I;  1QQ1 A;  1ZAO A;  3OYM A;  3IH3 A;  1F43 A;  4P1W A;  2DOD A;  4OOV A;  1OHH A;  4OP7 A;  4FAS D;  4LJZ F;  1U0J A;  4C9Y A;  2L01 A;  3A0B C;  1VQ6 I;  3L7W A;  1S8N A;  1D1N A;  3F8B A;  1P4X A;  4A0Z A;  2PEC A;  2KP6 A;  3GQ8 A;  4RB3 C;  4O5V A;  1MRZ A;  5EYR A;  4YEJ A;  4ZDP A;  1NK2 P;  4M3B A;  3ASQ A;  5DDG A;  2XNC A;  3ISX A;  1XD7 A;  4IOC F;  4LLN A;  1IB4 A;  4A69 C;  4HNV A;  5JMC B;  1Z3X A;  3OPO A;  5HS8 A;  1QPM A;  2K9L A;  4MHG A;  1TNT A;  2W00 A;  4G1V A;  2CJJ A;  2OJE D;  3LOC A;  2NVX J;  2ACJ A;  4PC6 A;  1ZUN B;  5F4O A;  1RWR A;  3FX3 A;  2NSP A;  2HR3 A;  3SLD A;  1VQ9 I;  2LP0 A;  3FPK A;  3FMR A;  4MXN A;  3VB2 A;  1KJZ A;  2KZG A;  3F6O A;  1SKY B;  1X0C A;  3BQY A;  2E1R A;  2GA1 A;  2WC2 A;  1J7K A;  3UKG A;  2IS6 A;  1HQC A;  2YS9 A;  4ZH4 F;  4HDV A;  1J0R A;  4BDZ A;  4PZJ A;  4AIK A;  3OYC A;  1Y0R A;  5B1A H;  1WI9 A;  2CRG A;  3HZJ A;  3SQN A;  2GQQ A;  2F4N A;  5LHI A;  3OOU A;  3RKX A;  4KKS A;  5DSZ A;  3DBR B;  3K1P A;  1XN7 A;  4IVN A;  1BR2 A;  1MDM A;  1YIJ B;  3KP5 A;  1TLL A;  1HW5 A;  3OL4 A;  4OPW A;  3V7R A;  1X19 A;  2DFF A;  5JFR A;  3OKX A;  5CVJ A;  5CQE A;  2F1M A;  2DA3 A;  1X1P A;  4DIQ A;  3TO6 A;  2ZZF A;  1IZ1 A;  2W6J A;  1WSR A;  3BLY A;  5E18 F;  4QPQ A;  1TT5 B;  1Y39 A;  4UV9 A;  4EW9 A;  2HDD A;  5LMZ A;  2B7B A;  1D8T A;  1EFC A;  3DTK A;  3K9T A;  3RIR A;  2FOW A;  3HGY A;  2X51 A;  2IW5 A;  3JCU C;  2B7E A;  4V2F A;  5LGU A;  2INV A;  2YWG A;  1JJ2 B;  1L1I A;  2V4J C;  2HQA A;  4FE7 A;  2PJR A;  4X6A J;  2X53 S;  3AVX A;  1BIB A;  4RGU A;  4I0B A;  3OW7 A;  4KMU X;  4RA2 A;  5E6T A;  1O3Q A;  2R7O A;  3FKI J;  1VQ8 I;  4PC7 A;  3J81 k;  3PA2 A;  1WJD A;  3H94 A;  3Q0V A;  1ZG3 A;  1VLY A;  2FA5 A;  4HX7 A;  1GV2 A;  3CCQ I;  2JA8 J;  3OOC A;  3R6J A;  1YRN B;  1O8M A;  3W2A A;  3E7L A;  2KJB A;  2M8E A;  5IP7 J;  1QBJ A;  1QGP A;  2LY9 A;  2QCO A;  4X0G A;  1ZAR A;  4JK1 X;  2WJY A;  2O0Y A;  2VB6 A;  2XAG A;  4MEX F;  1SAX A;  2ZL5 A;  2OZ6 A;  1G3Y A;  1PKV A;  1V5F A;  3DLL F;  2W6I A;  3GTP J;  4G7Z F;  3BPX A;  5HZB A;  3M8F A;  2CU7 A;  1JJ8 C;  2EIX A;  2X85 A;  1VHO A;  3JRD A;  3HOV J;  3MAJ A;  2E1O A;  1D0Z A;  4BL0 B;  2K02 A;  1ZKG A;  5FGM A;  3GW2 A;  2H27 A;  1AA7 A;  1NDH A;  2WY7 Q;  1LKX A;  1WKM A;  2QYO A;  1E3Z A;  3SEJ A;  1OCZ H;  2CGP A;  4P55 A;  2CV2 A;  2BGI A;  3K70 D;  3NAR A;  4I76 A;  5GTI C;  4PJN A;  4YIR X;  1BI1 A;  1GXP A;  4OMY A;  1WJB A;  3RTR A;  3MZY A;  2VJI A;  1G3W A;  4UUT A;  2G0E A;  1F1Z A;  4A3K J;  2NTP A;  2AO9 A;  2F48 A;  1Q82 D;  1Y0Y A;  2MA3 A;  4HOB A;  1E63 A;  4ACA A;  2VN2 A;  3RZD J;  1LE8 B;  3F23 A;  2NVQ J;  2MLK A;  2PI0 A;  3OIP A;  3TBI A;  2BX6 A;  3CCV B;  2CW0 F;  3Q0U A;  4NB5 A;  2G7H A;  1D1C A;  3AFH A;  3TOA A;  3G1O A;  3CME B;  3ZR8 X;  2H1K A;  4II2 A;  3GTO J;  2CYY A;  3TW6 A;  2C78 A;  3AVV A;  1T0F C;  2HU9 A;  4PK4 A;  1GR1 A;  2BM0 A;  4NC8 A;  2BSP A;  5HDG A;  2Z33 A;  1TP4 A;  4A0Y A;  2VLA A;  3VNU A;  3VYR B;  4EGY A;  1J9Z A;  3ZC3 A;  4FX4 A;  3TMO A;  1FIA A;  1BIA A;  2DA1 A;  1UHW A;  2NS0 A;  3H36 A;  4L8J A;  3IH2 A;  2OPT A;  4KN4 X;  3QE2 A;  5J3O A;  4P12 A;  1F20 A;  2JSC A;  4HEA 2;  2QEN A;  1N0U A;  3K1M A;  3J81 Z;  5TR9 A;  1SM4 A;  4YZ0 A;  3MCZ A;  1JXS A;  4EEF G;  2VPR A;  2QBY B;  3F8C A;  1SVM A;  1QZZ A;  2A05 A;  2VFN A;  1HA3 A;  4RCY A;  3JUR A;  3F8F A;  4LIU A;  3K10 A;  5DCM B;  4RD2 A;  2RQQ A;  2O6G E;  1X4P A;  3TH0 A;  5IYP A;  4WX9 A;  4MFD A;  4P9F A;  3BTC A;  1XDS A;  2CFX A;  3MMY B;  2FQ4 A;  2ZXW H;  1YRN A;  2VKE A;  4BXF A;  2Z8G A;  1YW9 A;  3HEF A;  3ASO H;  2HGC A;  1A31 A;  2KJC A;  2DPU A;  2B0R A;  2V7T A;  2VBM A;  2V7U A;  1SFO J;  1I7P A;  2XT4 A;  3RKW A;  3LSK A;  5KHD A;  2JQ7 A;  1KQ0 A;  1P4W A;  1QGZ A;  5E8G A;  4D7N A;  1DUX C;  3R0J A;  4EH1 A;  3HOZ J;  3OZW A;  5D6E A;  2FNP A;  3G1M A;  4Y9U A;  1I18 A;  2A68 F;  3SZG A;  1FZP B;  1ZLK A;  2BF4 A;  2D9R A;  2O04 A;  1UD5 A;  5EMN A;  2XRN A;  2UVF A;  2A61 A;  3O3K A;  2M87 A;  4RLF A;  3LSG A;  3WTU C;  1HKQ A;  4M3D A;  4WQM A;  2E1M B;  4A2U A;  4C2U A;  1GVH A;  4RGR A;  3PO3 J;  1R00 A;  4PJ0 C;  5GAD J;  2V7F A;  3ECH A;  3PIO F;  1NG7 A;  4L0Z B;  4ESF A;  1JKR C;  3GO5 A;  1DGR M;  1BI2 A;  1P7I A;  2XVC A;  5CVR A;  2HXI A;  4DW6 A;  1MDM B;  1XQB A;  4PGO A;  3E6B A;  3GXO A;  2VXZ A;  2V6E A;  3I53 A;  1VQL B;  2ZO4 A;  2LD5 A;  4ACB A;  2ID6 A;  2EV6 A;  3S15 J;  3I4N J;  3WBJ A;  1KK3 A;  1TSP A;  3CXC B;  3FMS A;  4KIB A;  4XOR A;  2DMU A;  1KQ9 A;  3ONQ A;  2ISY A;  2ELK A;  2LK2 A;  5D5W B;  3DU1 X;  3HM5 A;  3K6G A;  1EF4 A;  1O57 A;  2NT9 A;  3OIQ A;  1QHG A;  3EPZ A;  1DGW Y;  1JGG A;  4X7D A;  1U9O A;  1X3W B;  3JRE A;  3RZO J;  2VNK A;  1JNY A;  1X1B A;  2XGX A;  1BN5 A;  2MC4 A;  4RD4 A;  4DZJ A;  2DA2 A;  2K85 A;  1HXD A;  3EUK L;  4JX5 A;  5J4Y A;  2CG4 A;  4YEI A;  4ETS A;  5HVQ C;  1UD3 A;  2IGN A;  3W2I A;  1N05 A;  1M1E B;  3W6V A;  3JX8 A;  2HZD A;  3HOT A;  3T53 B;  4XQF A;  4X7C A;  4X7F A;  4RD1 A;  3AAF A;  4A3C J;  2V1U A;  3Q0W A;  5C4J J;  1VF9 A;  2WAE A;  4AIH A;  3BR2 A;  2R5Z B;  2C5B A;  2X48 A;  3TP0 A;  4BUP A;  4EM1 A;  2V1N A;  1B72 B;  4Q48 A;  4P3Y A;  1JHF A;  1W1W E;  2ZL6 A;  3VSV A;  3K4M A;  2FML A;  2F5V A;  2PMZ A;  3VSK A;  3P27 A;  4P25 A;  1JT0 A;  3WQZ A;  3V76 A;  1W34 A;  2GZW A;  4D0P A;  4OIO F;  5F0C A;  1TWC J;  3J81 K;  2YWF A;  1K4Z A;  2VAS A;  3IWF A;  4RAZ A;  3CC7 B;  1T2K A;  1OFL A;  2E1C A;  5FLX Z;  1IDK A;  2KIQ A;  1ONV A;  2VC1 A;  3VYT B;  4WXH A;  4H9G A;  4Y7C A;  1WMR A;  4XKW A;  5EGO B;  2YX4 A;  3BG3 A;  4U7D A;  5JVT A;  4XSZ F;  4IOA F;  1WCM J;  4EJW A;  3Q9S A;  3QYF A;  1YLF A;  2LKS A;  3PFI A;  2WB1 N;  2CUZ A;  2LRD A;  5DD8 A;  2QSH X;  4LBW A;  2A6T A;  2QQ8 A;  2UV1 A;  2EZH A;  3ZPL A;  2QZA A;  4N9I A;  3D26 A;  1XTA A;  4URR A;  1A35 A;  1QRY A;  3GVL A;  4Z06 A;  4XBF A;  3OYJ A;  5FO1 A;  4P96 A;  1G7S A;  4FE4 A;  2EJR A;  3CJQ B;  2BV6 A;  1Y56 A;  2PMZ N;  4HIZ A;  3FDY A;  2HOE A;  4HV6 A;  3WTS C;  2ZCW A;  4IKF A;  4FT8 A;  4HST A;  3T51 B;  1YO5 C;  2DOE A;  1IGN A;  3DKY A;  3W2V A;  4X1E A;  3NEU A;  2ELJ A;  5BNG A;  5B3S H;  4HF1 A;  2V6C A;  2M0C A;  2WBM A;  3I59 B;  3LA2 A;  4UVB A;  4RM2 A;  4ZYG A;  3IRQ A;  5E3M A;  3I3L A;  2XAH A;  2O8K A;  2CBX A;  4Z4Z A;  3KRG A;  3F21 A;  1XSX A;  3OYE A;  4KKT A;  2WAF A;  2R93 J;  2VFO A;  4TSF A;  4NBS A;  2NST A;  3LYC A;  2MH9 A;  1IN5 A;  3E3V A;  4R79 A;  4H0E A;  2BBY A;  1W9X A;  2WPD A;  5GPC A;  2XV4 S;  3REO A;  2GIV A;  1U6G A;  4IHX A;  2LKP A;  1DU0 A;  2P7V B;  4XRS A;  1YIT B;  1QJV A;  3VPR A;  3QPT A;  4OMZ A;  2EA2 A;  1WXR A;  4A5N A;  5JI6 A;  3GTL J;  2ICW G;  1LDD A;  1QQI A;  2DT7 B;  1WJ5 A;  3LA7 A;  5LHH A;  1N07 A;  2D5V A;  2VJ4 A;  4BJ6 C;  2R7U A;  2KRH A;  5HNF A;  3LVB A;  1AWC A;  3Q6R A;  2F4I A;  2P8T A;  2DMP A;  3FJO A;  3HOX J;  1VZ0 A;  1HZE A;  4PAB A;  2YUS A;  1FT9 A;  3ZMU A;  1XMK A;  5J8F A;  3UNG C;  1OGI A;  3MKY B;  3ZRG A;  4BNC A;  3VMV A;  2PLY A;  1SVL A;  2JIZ A;  2CQK A;  5J3L A;  2QF7 A;  2DI3 A;  1GUU A;  2MYS A;  2XF5 A;  4XLC A;  4CZZ A;  2R5Y A;  3WXM A;  1K61 A;  1G7R A;  3HJE A;  4HDU A;  4RD3 A;  5LRR A;  1WZ2 A;  2M5W A;  1WOO A;  3GME A;  3WGH A;  2KQR A;  4XR6 A;  1HA8 A;  4G8X A;  2K27 A;  5CJ9 A;  1MSF C;  4FHT A;  1RQR A;  4Z4Y A;  1B9M A;  1VQO B;  3GEZ A;  2QQ9 A;  4TMT A;  4XIC A;  4MQV A;  4Z6Y A;  3OYK A;  4X05 A;  1AKH A;  1K7A A;  1FOK A;  4X7E A;  2DT5 A;  1R36 A;  3SJM A;  5TV2 A;  4OPV A;  1QRB A;  4BPR A;  1I5Z A;  3BDD A;  2EZL A;  3ZGK A;  2OCE A;  4WZL A;  5K7H A;  3CUQ B;  1ZRE A;  2LG4 A;  2EV5 A;  2A6H F;  1EJ9 A;  1BR4 A;  1W87 A;  3IKT A;  1ZG5 A;  2Z99 A;  3CCR B;  4YFO A;  2IPQ X;  3O2P E;  2LYC A;  1IXC A;  1HW1 A;  2V7V A;  2E1N A;  3LMM A;  5FLX K;  1ZLJ A;  4PSX A;  4XLA A;  5FFX A;  3CCM I;  1OPC A;  1JUM A;  2O0V A;  3ZPP A;  1Z05 A;  2YUH A;  3ZN0 A;  3H92 A;  3FPP A;  1I1G A;  3HPH A;  1HC8 A;  1P4A A;  2MW8 A;  3PUF A;  4ZGN B;  1S3J A;  2JJ7 A;  2DA4 A;  2XHK A;  1U8B A;  4CHU A;  1F60 A;  1PJ7 A;  4XON A;  3AVT A;  1XFO A;  1X3U A;  1D0X A;  1EP2 B;  2O1D A;  1JA1 A;  1FX7 A;  1KQS B;  2HQ5 A;  2CWE A;  2WV1 A;  3MKZ A;  3B02 A;  3GZ5 A;  4F93 B;  3S1N J;  5ILU A;  2X3H A;  1OCO H;  2DK5 A;  1QZY A;  1PDN C;  1MMN A;  4E7J A;  4L9J A;  1VQ9 B;  4G1B A;  3RQI A;  2R7W A;  4W8R A;  3HKZ N;  3HIF A;  4P5O A;  3TGN A;  2OTL B;  2HS5 A;  2QWW A;  1U5T A;  1LJ9 A;  1TWH J;  3JQR A;  3SZT A;  5LBQ A;  4OJO A;  2KVO A;  4XM3 A;  1G6N A;  4WZK A;  2DO7 A;  2OTJ I;  4C3H J;  3BT9 A;  4Y15 A;  1UHS A;  3KZI C;  3MFK A;  1W0U A;  5LHG A;  3S1M J;  2CRV A;  4PJJ A;  1Q1V A;  4OIR F;  2OBS A;  4TN1 A;  4M3G A;  2NXN B;  4HLX A;  1YG2 A;  5DEQ A;  1HF0 A;  1IN7 A;  2IGO A;  5FKN A;  1MMA A;  3CTA A;  3J80 Z;  4XN3 A;  2G9W A;  2VZL A;  1W7P D;  5JLX A;  2ZBV A;  1PLU A;  2ZNY A;  1WVR A;  3LSM A;  4ZC3 A;  1NHA A;  3W2F A;  1FLI A;  4LMY A;  3S3M A;  4EM2 A;  2Z2S B;  1IN8 A;  3HOW J;  1YJN I;  3WHC A;  3CQZ J;  4XLP F;  2FX0 A;  2R9V A;  2EWN A;  3BR5 A;  2PX9 A;  1STZ A;  1A5J A;  1VQK B;  2KZV A;  5C44 J;  1XSV A;  3DTE A;  3X2Q H;  2GRE A;  2A69 F;  4Q47 A;  1BOA A;  4OU0 A;  4IL6 C;  3LAP A;  2ESN A;  3B73 A;  3FXQ A;  1U78 A;  6PAX A;  3QU3 A;  3NWS A;  4V19 K;  2K3P A;  2HWV A;  2FJ1 A;  2XGE A;  3WTZ A;  1CQT A;  4I2O A;  3HOU J;  2FEZ A;  1DPU A;  2LLK A;  3PSZ A;  4M72 A;  2XEX A;  2EK5 A;  4PFP A;  4FIS A;  1IO2 A;  1XGM A;  2G7U A;  3DP7 A;  1KU2 A;  1VQ4 I;  1IJF A;  3RPU A;  4WK8 F;  1A6I A;  1MJB A;  3M1E A;  4O6J A;  4QIW N;  4BEH A;  1VQ5 I;  1OGJ A;  1T39 A;  3BH4 A;  4IPA A;  3WBK A;  3DKX A;  5L3G A;  4U0Y A;  4A3G J;  4I98 B;  3OEH A;  2LH9 A;  4I7H A;  1FX0 A;  3ES9 A;  4HG2 A;  2UWM A;  1S7E A;  1S9H A;  2M1B A;  1R5H A;  2VKD A;  2HDC A;  2XB0 X;  4MNU A;  3QP5 A;  3SXY A;  4AVP A;  1IW7 F;  1ETQ A;  2TCT A;  4LK0 F;  1Z7U A;  4RB1 A;  3GIR A;  3BJA A;  2NYX A;  2DYI A;  3RQ4 A;  3C2B A;  1A6Q A;  2D74 A;  2DOF A;  4F92 B;  3A0H C;  3R61 A;  3P7N A;  4KJZ A;  2YU9 J;  5FD6 A;  2VNH A;  2CW8 A;  4YRV A;  2ZBK A;  1JKQ C;  1TWG J;  4C2M J;  1Z21 A;  5D5X B;  4YAO A;  4GQN A;  4IF4 A;  1G3T A;  3P9K A;  3QSY A;  3BH6 B;  2IBD A;  2K3F A;  3A35 A;  2NZM A;  4E6K G;  2O5R A;  3GZ6 A;  3B82 A;  3KL9 A;  3LO8 A;  1O8D A;  2EIJ H;  3ZUG A;  3LAJ A;  4AF6 A;  1OQY A;  2DXI A;  1J75 A;  2P6S A;  1S7O A;  3L2Q A;  1LNW A;  2EFN A;  4PCQ A;  1BJZ A;  3OSG A;  3W5H A;  4XLN F;  1CNE A;  2RC5 A;  4OZY A;  4LBY A;  5FNZ A;  3GLL A;  2E5N A;  2L0K A;  2CFO A;  1ZH5 A;  4BAC A;  1UMQ A;  4IRH A;  2QUF A;  2MAB A;  1OR7 A;  1MMG A;  3CLO A;  5EDN A;  4Z4U A;  4E70 A;  4ZYA A;  1XCB A;  4QFM A;  2X0L A;  2COM A;  1UD2 A;  2VKH A;  4RGX A;  4P9S A;  4R71 A;  2LMD A;  3ZQI A;  2WAQ N;  3ML3 A;  3KP6 A;  2L2O A;  5IT9 K;  2GJK A;  3J80 K;  3BC9 A;  5HZA A;  4M6Y A;  4RM0 A;  2VQH A;  4AC0 A;  1D5Y A;  4EV0 A;  2DFH A;  1JA0 A;  3MWM A;  5L3D A;  1MND A;  4MLO A;  1HF2 A;  2R7S A;  1TQP A;  4RM3 A;  2QZ8 A;  3BZK A;  1KU3 A;  2DMQ A;  1R23 A;  2VQG A;  2MG4 A;  1YQA A;  1IRG A;  3OYF A;  3CCE I;  3F6V A;  2C2W A;  2P6T A;  3MN2 A;  1N75 A;  3E97 A;  2VQL A;  2HKX A;  2Q0O A;  3KLO A;  1K28 D;  1JGS A;  3GWZ A;  1R6R A;  1P92 A;  2Z6B D;  1OR7 C;  3DBH B;  5D4R A;  3KP7 A;  1ETK A;  4Q4Z F;  5ILS A;  2KIM A;  1VHE A;  1XX5 A;  2IAI A;  3KYD B;  4GXO A;  1ZN2 A;  3UW0 A;  4BJ5 C;  1RET A;  1XCV A;  2IVM A;  1DAB A;  2Q6O A;  1F9N A;  1KQ8 A;  3ZZU A;  3IL2 A;  2Y0S N;  2QX3 A;  3VSU A;  2L54 A;  2BY3 A;  4HQM A;  4OOX A;  1G3S A;  1EV7 A;  3DWL E;  4IO9 F;  1LVA A;  1RC9 A;  4LK1 F;  2H94 A;  2R7T A;  4S0H B;  2M45 A;  2RGV A;  2C4T A;  2BM7 A;  2VBY A;  3H9J A;  4XD7 A;  2UUZ A;  2KDZ A;  3WU1 B;  2DJI A;  1CGP A;  2DA5 A;  3FMQ A;  2F5D A;  2GK7 A;  2LF8 A;  3M7G A;  1O8G A;  1OGO X;  1RR7 A;  4XOP A;  4F7Z A;  3O8G A;  5CYV A;  3K4J A;  4ROX A;  1MH4 A;  5DUK A;  1W0J A;  4TT3 A;  2KRF A;  2GQF A;  2ECB A;  3DQV C;  4HRI A;  3Q3S A;  5KW9 A;  5IYD J;  1Z3Y A;  2CMP A;  3K0L A;  2R7X A;  5E3L A;  4YFX F;  2DA6 A;  3ZZ0 A;  3M1C A;  4HNU A;  5C1E A;  2ZZE A;  1YW8 A;  3I54 A;  3C18 A;  1VQ4 B;  1D8K A;  4NUB A;  4U49 A;  1IB0 A;  4L9T A;  4NBQ A;  2YWH A;  5EZG A;  2XPU A;  3G6E B;  3GUD A;  2RC6 A;  1FWZ A;  1KK2 A;  4P2N A;  2ZFU A;  3ZMV A;  1V0F A;  2VJJ A;  1FOW A;  4ABZ A;  1FYK A;  3U2R A;  4E7K A;  3AL0 B;  1FY7 A;  1Q7Y D;  5AIQ A;  4ZZD A;  2A07 F;  3Q6Q A;  2JRT A;  2HDN B;  2KL4 A;  3RYR A;  1RES A;  5KVR A;  3NB2 A;  1BOB A;  4Y17 A;  1V0E A;  2HTS A;  3L2U A;  1QA6 A;  2FF4 A;  4CCL A;  1IJW C;  1JTX A;  2E34 A;  3ULQ B;  2GBY A;  3AKZ A;  2VJ5 A;  2K5C A;  2O9L A;  5BQT A;  3BWG A;  2X1C A;  2Q2E A;  4OIN F;  5M5Y J;  2M2E A;  4OPO A;  4YAW A;  1SD5 A;  3I59 A;  3ERM A;  2PYG A;  1XS9 A;  2PE3 A;  1GV5 A;  2H6C A;  3GCM A;  1SVO A;  4JOM A;  3H9G A;  1FP2 A;  1CLW A;  2PMU A;  4EM0 B;  1TVC A;  4HBL A;  5TRD A;  2VL8 A;  1UHM A;  1ZM9 A;  4YIF A;  2DA7 A;  4P26 A;  2L7Z A;  3S32 A;  1I50 J;  3KEO A;  3OIO A;  4YHB A;  5F1R A;  1KZH A;  3KEW A;  1J2X A;  2BY0 A;  2QQA A;  3BZC A;  4YFN F;  1PJR A;  3AVW A;  2J8I A;  3OWT A;  4I09 A;  3H0D A;  5IOY A;  1EP1 B;  2HQN A;  4HW0 A;  1LB2 A;  2CO5 A;  4YAL A;  3VYU B;  3T8R A;  2WAQ A;  5DTD A;  4BH9 A;  2OA4 A;  3BP8 A;  2JMW A;  3LST A;  1QFZ A;  2QDX A;  2WZN A;  3JQQ A;  3Q3A A;  3VMF A;  2EB7 A;  3ZBT A;  3ECO A;  2BV3 A;  3RI4 A;  2XAQ A;  3QOP A;  1LDK B;  5FKK A;  2CQN A;  3AST A;  2Y0M A;  3FXL A;  2V7Q A;  3PM1 A;  2PYH A;  5K1Y A;  3H09 A;  4R1H A;  4U88 A;  2E2H J;  3OZU A;  3SQV A;  3V8K A;  2F3L A;  1U5T C;  2EIM H;  2P5V A;  2HNH A;  1S0U A;  1V3F A;  2BM4 A;  5J1U A;  1QUE A;  2VOP A;  1XB4 A;  1N08 A;  1W5S A;  2H09 A;  2MH2 A;  4KT6 A;  1JJ6 C;  4LG3 A;  1B9N A;  2L02 A;  2JVH A;  3C2H A;  5JR3 A;  1MSE C;  3HUG B;  4BQQ A;  3I56 I;  1G2H A;  3J7A Y;  3ONY A;  2CQX A;  3ASN H;  2KT0 A;  4HX8 A;  2C77 A;  3DV8 A;  3Q9V A;  3SLN A;  5EEA A;  4ASU A;  4B3F X;  3B78 A;  3HSR A;  5JLW A;  5HS9 A;  1H85 A;  1EE6 A;  5C3E J;  4U0W A;  3E5X A;  5BPD A;  2L9S A;  4RLQ A;  4BBR J;  4LLG F;  5AMV A;  1E64 A;  4QHY A;  4IXA A;  1J59 A;  3L2C A;  3WNC A;  2UVE A;  4KNY A;  3VST A;  2VON A;  1TC3 C;  1XMA A;  1AOY A;  3MHP A;  2W48 A;  1TYX A;  1DAR A;  2XPV A;  4UZU A;  3HSF A;  2D2W A;  1QH0 A;  2H1L A;  1GAQ A;  1EWY A;  3ZN1 A;  4D1Q A;  2KIF A;  5DM6 F;  2EV0 A;  3F72 A;  2XTW A;  1QA1 A;  1LE8 A;  1V4R A;  5M5X J;  1OB0 A;  2BM1 A;  1E62 A;  1ZQ3 P;  4PFO A;  1AHD P;  1G8X A;  3S93 A;  4EJU A;  3EET A;  4BGD A;  2P81 A;  4CA0 A;  1ETW A;  1DU6 A;  4X0C A;  3ZBU A;  5HOD A;  1BMF A;  4W97 A;  1TL8 A;  1XB2 A;  1IN6 A;  3VR6 A;  3WTW C;  5E79 C;  3EUA A;  4IRG A;  1Y8Q B;  3GX4 X;  2B5O A;  5FLM J;  2MSY A;  1R5G A;  4B4D A;  3I9V 2;  3CUQ A;  4RB0 A;  2OBT A;  3M07 A;  3N6Z A;  4PC1 A;  3S17 J;  3T56 B;  3CCU B;  1XDU A;  1OYY A;  3HKZ A;  3AG1 H;  5FLV A;  5TGT A;  2D45 A;  2B9S A;  1HVX A;  1KMH A;  3W5U A;  1QVG B;  4I0A A;  4N4N B;  2ETH A;  1DQU A;  2GAU A;  2HXO A;  3L9F A;  1LLW A;  1VF7 A;  1YS6 A;  1XG1 A;  4HWV A;  1FBU A;  1XGS A;  4J19 A;  3CCS B;  2JA7 J;  2ZB9 A;  1PXZ A;  2M34 A;  1N77 A;  2HPM A;  3SYJ A;  5J8C A;  2WJV A;  1JI8 A;  3CD6 I;  2Q1Z B;  2XAU A;  2HVS A;  3CRZ A;  4LOC A;  3KX2 A;  4W8S A;  4HSR A;  3BY6 A;  5EJC A;  3PNY A;  2MD0 A;  2QE7 A;  3K2Z A;  2L5Q A;  3DPT A;  1DDG A;  2QM3 A;  3F0C A;  4H4K C;  4M9S A;  4B09 A;  2YWE A;  5DUI A;  2K9M A;  2ZJ2 A;  1UJ8 A;  3TQN A;  2INU A;  2ADU A;  1MBE A;  3GSI A;  4OJ6 A;  3P9I A;  4FXU A;  3L1P A;  2JT1 A;  2GJP A;  4BHB A;  1DBO A;  3D1N I;  3RKY A;  4BKX A;  2P3M A;  4C43 A;  1Z7L A;  2JZY A;  2QMU A;  2VC0 A;  3PUM A;  4LIT A;  2K9S A;  4LGW A;  3CMA B;  3CCV I;  4E4H A;  3S3O A;  1X1C A;  3ZQF A;  4CCN A;  3G71 B;  3G4S B;  1OMI A;  4BS9 A;  4FX0 A;  1N78 A;  5L3E A;  2C5H A;  3DPL C;  2M4G A;  3K4N A;  5B6I A;  1PYV A;  4HNT A;  4D7M A;  1BJA A;  3ZCO A;  4W1U A;  1N25 A;  1IDY A;  4M9Z A;  3CP2 A;  5CDF A;  2EFG A;  1LM1 A;  4HQE A;  2ZL7 A;  3RIQ A;  4OWR B;  1ZG1 A;  1DP7 P;  2XND A;  3WOD F;  3QAH A;  5D6F A;  1XC5 A;  1JKO C;  3NAW A;  3WHB A;  2M0M A;  3DEU A;  3CPW B;  1P9Q C;  2XB5 A;  3HRS A;  3WG7 H;  3BCB A;  3I64 A;  1E43 A;  4RD0 A;  4JMQ A;  4HYE A;  1OJL A;  3CO6 C;  5LEK A;  3W6K B;  1UCR A;  2OK8 A;  3KZZ A;  1GAW A;  1VJS A;  1R58 A;  2UXN A;  1KCC A;  1VND A;  1M1K D;  1N0V C;  4ON0 A;  2N8G A;  5AIP A;  2J5O A;  5BS6 A;  1TWF J;  2BHZ A;  2O7O A;  2CF4 A;  2OU2 A;  5D5V B;  1CNF A;  4LC0 A;  4RPB A;  3U6K A;  5FRM A;  5EZH A;  4B3G A;  1BHE A;  2B7C A;  1EFU A;  4YEL A;  4DGW B;  2VBS A;  5F0F A;  5DD4 A;  2NTB A;  3WU2 C;  3SHF A;  4L0Y B;  2X9D A;  2VPL A;  4I02 A;  1UMK A;  3OL3 A;  3QPL A;  1NK3 P;  1W0K A;  4G7O F;  2DBB A;  4TMZ A;  5IYR A;  3CP8 A;  1FSE A;  4NK6 A;  5EEG A;  1TWA J;  5FA6 A;  1TNS A;  1R22 A;  1Z91 A;  4NCN A;  4ENM A;  4BDY A;  2ZTG A;  2XF6 A;  4NC7 A;  2YU3 A;  3WWG A;  4JX6 A;  1VQL I;  4RS8 A;  1IHM A;  2JSP A;  2LSO A;  3QP6 A;  5K5Q A;  5H59 A;  3B6C A;  2C6Y A;  1ZRF A;  3BC8 A;  4LBZ A;  2BMW A;  3DBL B;  1RQP A;  2M7A A;  3J7A O;  1FBS A;  1LEA A;  2EH3 A;  1R71 A;  3J7Y J;  2STT A;  4IHT A;  1BI3 A;  4TV7 A;  4XK4 A;  4HPQ A;  1EFR A;  1N06 A;  4BXX J;  4LB6 B;  1PE9 A;  4IHY A;  5K7Z A;  1B23 P;  4YAU A;  5IYQ A;  4A12 A;  1BBY A;  2Y30 A;  5H2F C;  4KIG A;  1LQ1 A;  3N4M A;  1YIT I;  4WZE A;  1FC3 A;  2XC1 A;  2HZT A;  2PFB A;  2UZK A;  1KZL A;  3CZ6 A;  2BM6 A;  4K1X A;  3JRA A;  2KPM A;  1EH7 A;  3KET A;  5F4M A;  1UG2 A;  2ZJP F;  4EQQ A;  1S5L C;  5F6F A;  4YCQ A;  1W4M A;  2DQL A;  3KLN A;  2DMT A;  2ZXI A;  4Y7N J;  2WV0 A;  4RDJ A;  4MIM A;  2DOA A;  4UZF A;  1K8A D;  1XGN A;  5H6Q A;  2XUB A;  2M3A A;  1FYL A;  1U3E M;  1MBK A;  2DQR A;  2B63 J;  4DYC A;  1U2R A;  1GVJ A;  2XSD C;  1UZC A;  1HDD C;  1VLO A;  1RMG A;  3BR3 A;  3FWE A;  2OC6 A;  3K69 A;  3M8E A;  4PC2 A;  4G7W A;  2LFB A;  4XNF A;  4XLE A;  3W2E A;  3GFM A;  4LFU A;  3QOE A;  3LFK A;  3EQN A;  4NQW A;  1SMY F;  2Y31 A;  2VE9 A;  2K9N A;  3S2W A;  3CPX A;  2CQQ A;  3WU0 A;  5HLT A;  5IYC J;  2CUF A;  4DYR A;  4M73 A;  1KON A;  4E7I A;  2V7X A;  5GTH C;  2JA5 J;  1X3Z B;  1FNN A;  1GVD A;  4WXD A;  4E7H A;  3JTG A;  3VO1 A;  5HKK A;  3CME I;  4IHV A;  1O3S A;  2MC3 A;  2P5K A;  2Y48 A;  3MKW B;  3Q38 A;  4L9N A;  3IHU A;  2DIE A;  1AIR A;  3CCJ B;  4TMV A;  2ODL A;  2BXZ A;  3P26 A;  5HDK A;  2XRO A;  3OV8 A;  1P6R A;  4IZZ A;  1O88 A;  1OCR H;  4ZJZ A;  2E2I J;  3B6A A;  3WTX C;  1CF7 A;  3LNN A;  4RLZ A;  3V7A A;  2GA2 A;  2XAF A;  1E79 A;  3BTI A;  2VT3 A;  3CF2 A;  3DU6 A;  4PDK A;  4AYB A;  1FDR A;  3QFS A;  3IAS 2;  1OFD A;  2PMD A;  1ZR4 A;  1E0E A;  2VOD A;  3JAM Z;  1PP8 F;  2J8K A;  4TMX A;  1R5N A;  4JRA C;  1I3Q J;  1SD7 A;  1JT6 A;  4YAF A;  2VFP A;  1I39 A;  2DTR A;  1FRN A;  4JX4 A;  2HI3 A;  2P0W A;  2Z16 A;  1YIO A;  3QFR A;  3MQ0 A;  4Z03 A;  4UB6 C;  3GBG A;  1T95 A;  3FK7 A;  1Z9C A;  3CJR B;  4KIT B;  4KIS A;  2IA0 A;  4RAG A;  1W35 A;  4BXU A;  1WJE A;  1FP1 D;  1BQE A;  3GVK A;  1P4M A;  3OS0 A;  2ZME C;  2R7V A;  1QFY A;  5FB2 A;  3GVJ A;  4G5G A;  2R7D A;  1ZRC A;  3CCU I;  1KQ5 A;  1O8L A;  2K9Q A;  4ZV4 A;  1KGS A;  5TIS C;  1ETO A;  1WP6 A;  4Z1M A;  3K4K A;  1PP7 U;  2R3S A;  5J1R A;  1BL0 A;  4XN0 A;  2BN4 A;  1KYZ A;  3CDL A;  3C7J A;  3BJ6 A;  3CC4 B;  2DU9 A;  5CVV A;  4G94 A;  3RDI A;  1ETY A;  5K5R A;  4K2E A;  3QFC A;  1WJC A;  4P6Y A;  2QXZ A;  1VQ7 B;  1EH6 A;  4AD9 A;  4WCG A;  1QA2 A;  4Z4W A;  2HOA A;  3ISP A;  2E71 A;  2FBH A;  5L3F A;  1FMV A;  3ZQG A;  4BJT A;  2NNN A;  1NB9 A;  1SFX A;  3KPH A;  5JHF A;  1D0Y A;  2YR2 A;  2AXT C;  3I55 B;  1W36 C;  4F91 B;  4A3J J;  1IRZ A;  3A01 B;  2GJR A;  1YTY A;  2I8D A;  2I1L A;  5E1X A;  5KSW B;  4BBS J;  4II3 A;  4DOZ A;  3S1Q J;  1NRK A;  2PIA A;  4KA4 A;  2ESH A;  2DPD A;  2K40 A;  2KKO A;  3JU4 A;  3RJP A;  1I6H J;  1EH8 A;  1U9N A;  1K78 A;  3ASP A;  1BI0 A;  2O61 A;  2E35 A;  4UUS B;  1R4N B;  3CDI A;  4A3B J;  5A8A A;  2QTZ A;  3DF8 A;  4A3D J;  5E1W A;  1REP C;  3EQL F;  3MVP A;  1H88 C;  1RIO H;  2QEX B;  3QRF F;  3FIW A;  1BW6 A;  1KD1 D;  2IA1 A;  3JRG A;  2IS4 A;  3DCF A;  2ZJQ F;  3BG9 A;  1S7A A;  3EDP A;  2ZZQ A;  3R60 A;  3H1C A;  4FQG A;  5JVG F;  3S3N A;  1OFC X;  2CW5 A;  1ULY A;  2OF7 A;  3GFI A;  3CCS I;  4CYC A;  1DG1 G;  2DT6 A;  2DY1 A;  1RNL A;  4M1K A;  2R6H A;  4DNC A;  5GV8 A;  5FKO A;  2VQC A;  4CH7 A;  1IUY A;  3U2Q A;  1Y8R B;  3OP1 A;  4UVC A;  4CIC A;  4CO8 A;  3A2K A;  2GPJ A;  2D1V A;  1K6Y A;  1HKT A;  3GFL A;  5IPA A;  4ZGQ B;  1D5V A;  2RNJ A;  3DEE A;  3GTG J;  1V55 H;  1LFU P;  1QG0 A;  5IY5 H;  2HKO A;  1KYW A;  2F5F A;  5E8I A;  1BPL A;  1R4M B;  1HSJ A;  2W82 A;  1YJ9 B;  5ERI A;  5TJJ A;  1YHQ B;  2R5Y B;  2HMA A;  2E36 A;  3FHN A;  2RNG A;  2K4J A;  2KHM A;  4B1R A;  1EP3 B;  3JAM K;  1O7F A;  1FBQ A;  2O6W A;  1SEU A;  1PUF A;  1YW7 A;  4RAF A;  4L18 B;  5IOZ A;  2JWT A;  1E17 A;  3FXK A;  3VDX A;  5LGN A;  1IV6 A;  1ZTR A;  3S8P A;  4FK8 A;  1AIP A;  3E1S A;  4UUS A;  3MEX A;  1WSU A;  2M4K A;  3T0Y A;  5EF6 A;  2XGJ A;  3BNW A;  3PQK A;  3GYH X;  2W7Z A;  2MFZ A;  4PJM A;  2ZXH A;  4ZCL A;  1XGO A;  4RDL A;  2ZKZ A;  1NB0 A;  4G9Y A;  1B59 A;  2QLZ A;  3DEW A;  1TYU A;  2TDX A;  3ABU A;  2KDO A;  1BX0 A;  3ZMS A;  3D5L A;  1AU7 A;  3WGI A;  3W2W A;  5IP6 A;  4DYQ A;  3OJW A;  4UNO A;  1WPK A;  1R5O A;  3WYA A;  1ENH A;  3QFT A;  3JRF A;  1GO2 A;  2ZTN A;  4J00 A;  5L3B A;  2GWR A;  3SKB A;  2MLG A;  2XTX A;  4GFB A;  1T38 A;  3S16 J;  4R8H A;  3OYD A;  1WI3 A;  4ITV A;  2WYR A;  1W5C C;  2LY1 A;  3I1F A;  3SJP A;  4OJ5 A;  4MQ9 F;  3D5S C;  4BAY A;  2F6C A;  3NAU A;  4HV5 A;  3SEQ A;  4V02 C;  4DJA A;  1NBM A;  1USS A;  1OCC H;  5ED4 A;  2XAS A;  1HST A;  2M7B A;  1F4K A;  1WOS A;  3CJN A;  3TDU C;  4N9H A;  1U5T B;  2F4M B;  3GF2 A;  3BOQ A;  3B4N A;  3HUG A;  1YFH A;  5ILV A;  1MMS A;  4IQ4 A;  3I0T A;  1T98 A;  1VQN I;  2X1D A;  2O3F A;  2FXA A;  5GV7 A;  4PUS A;  1L3L A;  1D3Y A;  1R7J A;  3FKJ A;  4BQA A;  4L5J A;  1PVE A;  2DCE A;  3IKV A;  2RQP A;  1YE9 A;  2ZJR F;  2GXB A;  1FNM A;  3HTU A;  3E6D A;  4CCM A;  3GZN B;  3KIO A;  5K5O A;  2X1E A;  2Y9Z A;  3FIS A;  3G3Z A;  2DMN A;  3PSI A;  3GFJ A;  4XLH A;  2CV1 A;  3BRO A;  1GJR A;  2X6X A;  4B48 A;  1OB2 A;  2H8R A;  2CC2 A;  2V31 A;  1H0M A;  4UZE A;  2MBF A;  2YPR A;  3K2A A;  1HBX G;  2JN9 A;  2VNJ A;  2Y9Y A;  3T5X A;  4G6I A;  4A6D A;  3HC7 A;  2OD5 A;  1V5V A;  5D4S A;  4ZYE A;  4G7X A;  2OBR A;  5FD5 A;  3V42 A;  1Y1V J;  2M30 A;  1MNE A;  1YJN B;  3FXO A;  3CO7 C;  3MKL A;  1NH3 A;  1H42 A;  2A3S A;  4C30 A;  3CES A;  4W8T A;  4B4C A;  1VQO I;  5CVI A;  3GQ7 A;  5HLH A;  3AGP A;  1K83 J;  3JQP A;  3CF5 F;  1D1B A;  4AIJ A;  1VTN C;  2R92 J;  3A03 A;  4DK0 A;  2HPI A;  3TL4 X;  4DK1 A;  1QVT A;  2L9V A;  3MZ8 A;  3VOD A;  3FK6 A;  2CK3 A;  4BE1 A;  2OAZ A;  4RGS A;  3H5N A;  4X06 A;  2DLL A;  2F43 A;  1H89 C;  3WND A;  3EQO A;  3H0G J;  3TED A;  4WZT A;  1K4T A;  5LEJ A;  3W5V A;  2HFH A;  3ABM H;  3LNQ A;  3CLQ A;  3OYH A;  2QEX I;  1T8I A;  1MBJ A;  3BY2 A;  4J0Q A;  3DPU A;  2NVU B;  2LTP A;  3CC2 B;  2XAJ A;  3G6E I;  2LZJ A;  1LEB A;  4KN7 X;  4ZCM A;  4OZZ A;  3GRH A;  1TYV A;  4OM9 A;  1QZE A;  2QA4 I;  4BEH B;  4YZQ A;  2D1H A;  3S2D J;  3A3B A;  3SFZ A;  1Z0X A;  3DDY A;  4OAY A;  1HW2 A;  4AF7 A;  5GAG J;  3DTI A;  3M8J A;  3U1D A;  5HXB A;  5HNH A;  1QUF A;  1Y0U A;  1IAW A;  1TW3 A;  1WOP A;  1JHH A;  1FTT A;  3V7C A;  3H5R A;  3LSR A;  1K6O A;  1H8E A;  4OOS A;  4JP0 A;  4A6E A;  3AG3 H;  4XKB A;  2L7F P;  3WGG A;  2EQR A;  3IRR A;  2FRH A;  4B43 A;  4P1V A;  3IC7 A;  1KU7 A;  3BZ6 A;  3JRC A;  1YJ9 I;  2QGU A;  3BH7 B;  2MD5 A;  4ZTF A;  5GP9 A;  3DFG A;  1X2N A;  1YHQ I;  1NJI D;  3QQA A;  2QKL B;  4ZTJ A;  3GTM J;  4M71 A;  3P5J A;  3NWT A;  1JE8 A;  2VBX A;  1FNB A;  1FND A;  1TT0 A;  2WAD A;  5BSX A;  2EFQ A;  1EXM A;  1M90 D;  1LFP A;  2NS8 A;  3WTY C;  3ROU A;  3SJZ A;  5BSY A;  5KK1 A;  5FFZ A;  1FMW A;  5HLG A;  1YIJ I;  2WB1 A;  1UD4 A;  2E5Z A;  3QPH A;  2PJP A;  1GDT A;  1J5Y A;  1IF1 A;  1PJ6 A;  1EA0 A;  3M3Y J;  1YOV B;  1IG7 A;  3V8L A;  2V9K A;  2JTV A;  2OUM A;  3KP3 A;  4I01 A;  3HPG A;  3T8T A;  3OAA A;  1P7J A;  4L5I A;  4GCV A;  4CCO A;  1NHC A;  4KIC A;  4HAM A;  5LGT A;  2EFP A;  2NOJ B;  5KAF C;  1ETX A;  2L9N A;  2LKX A;  4UUV A;  1BA5 A;  3E20 A;  4ZYH A;  3KP4 A;  4O3M A;  4I99 C;  1LDJ A;  3UR3 C;  2CSO A;  4ZDO A;  1MJA A;  1WGX A;  2X4H A;  5DCF A;  3FF5 A;  2TRT A;  1JTA A;  1IJE A;  2CQ7 A;  2LF7 A;  2VBU A;  2CUJ A;  4AWX B;  4J01 A;  2R7Z J;  4Y33 A;  2NVY J;  4U0V A;  3EUH A;  1Q9S A;  4CZC A;  4BY1 J;  2O0W A;  1UST A;  4JQF A;  2GXA A;  3G2B A;  1W2B B;  5FIU A;  5FRN A;  1T08 B;  4E7Z A;  3WE2 A;  1HKS A;  1SAU A;  3LQQ A;  2A6E F;  4LIV A;  3W6J B;  4G12 A;  4UVA A;  3CMM A;  4U7B A;  3H35 A;  2WZP P;  2DEU A;  4Y52 J;  3OSF A;  5L46 A;  3AL0 C;  3ZXS A;  4M0L A;  2R4G A;  2QKM B;  2RV8 A;  2FE3 A;  4BQO A;  4IHW A;  1UD6 A;  2AHQ A;  2XDV A;  4AU7 A;  1CQX A;  1COW A;  3ABT A;  3KFW X;  4G6D A;  3H3U A;  1Z6R A;  2R7F A;  2VE8 A;  5HLI A;  3LSP A;  1WDT A;  2NT6 A;  3GQA A;  2KIS A;  1W7P B;  1B1B A;  2ZXJ A;  3HHH A;  3V8J A;  4Q5S F;  3A1P A;  1T6X A;  2NOG A;  3WNB A;  2DDB A;  1KC8 D;  4DZP A;  3G73 A;  2ID3 A;  1FIP A;  2EIL H;  2LRE A;  2WA0 A;  3A01 A;  1R1U A;  3CW2 A;  1VQM B;  1TTT A;  2FQ3 A;  2JVG A;  2D3L A;  4PAA A;  1PUE E;  2BVM A;  1ZGW A;  4IJA A;  3HG9 A;  1GT0 C;  1Q81 D;  4XL9 A;  3M9A A;  5GPA A;  4KMF A;  3BCF A;  4A0X A;  4PMH A;  5IP9 J;  3OJX A;  4YII A;  3AVU A;  1MKM A;  2WWY A;  2VUM J;  2IQ7 A;  4RJL A;  4CDG A;  4XKV A;  4XMY A;  2VNI A;  2Y69 H;  2QTL A;  2OQR A;  4JBA A;  5H6R A;  4YZA A;  4FWT A;  4DQL A;  4EGZ A;  2GOX B;  4S05 A;  1MAB A;  2OV7 A;  3KP2 A;  2HTJ A;  3QWL A;  2IS1 A;  2XGC A;  2Z5U A;  1BLI A;  1RU4 A;  1QVU A;  1MW7 A;  3A1Y A;  3PFY A;  2LY2 A;  3ZMD A;  1OYI A;  1B2R A;  1LLZ A;  2ZC2 A;  4C2L A;  2R7R A;  3CCQ B;  1P2F A;  5H20 A;  4JYK A;  3BJO A;  4CUG A;  4IW3 B;  1POG A;  1MIJ A;  3CJT B;  1VQ6 B;  3C3W A;  3HGG A;  1FNC A;  5K7F A;  4ANJ A;  3PA1 A;  4AC9 A;  4DNT B;  2PN6 A;  3ESW B;  3FBN B;  1X1A A;  3ASR A;  1Z6T A;  2FX3 A;  4F3Q A;  1I6X A;  1CF7 B;  5F27 A;  1ZM2 A;  5F64 A;  4E7S A;  2QA4 B;  3SUC A;  4Q7J B;  1WJA A;  1AKH B;  1XMX A;  2BM5 A;  2WY8 Q;  2HYJ A;  2ZSH B;  3ML6 A;  2W1O A;  2P7C B;  5A88 A;  2J7K A;  2E2J J;  2VI6 A;  4XRF A;  1YX2 A;  2HEO A;  2FUG 2;  2VBZ A;  2VBT A;  3BCD A;  3OE7 A;  4N4O B;  1TUI A;  4HE6 A;  2V26 A;  4DBR A;  3RCO A;  1XE1 A;  3JRB A;  3A3G A;  2DAO A;  3B8H A;  5GAH J;  3V4G A;  4RD6 A;  2W24 A;  1LFB A;  3GQ9 A;  1OCP A;  1RPW A;  1S29 A;  1TQI A;  2E60 A;  2L4A A;  1YLO A;  4TMW A;  4C0S A;  4CCK A;  2V7W A;  1IV8 A;  2RVC A;  4NQW B;  2BOL A;  4ZYD A;  4C2T A;  3N90 A;  5A2Q Z;  1EFT A;  5FL7 A;  4G6T B;  4MGR A;  3H3V K;  1T33 A;  2QQB A;  3I5U A;  2K86 A;  5FO5 A;  1WQ2 A;  3EYY A;  3CCE B;  2LC2 A;  4ESJ A;  4HF0 A;  3OS2 A;  2OZU A;  5ICC A;  4WXC A;  1H9T A;  1SFU A;  5E1Z B;  3CCL B;  3G4S I;  2ZZG A;  2VBV A;  3W2G A;  1Y6I A;  3BCA A;  1HG8 A;  4AVZ A;  2JA2 A;  1WFX A;  4WF2 A;  3K70 C;  1MJ9 A;  3ABL H;  2FSW A;  4KT5 C;  4CXF A;  1RKW A;  4NC6 A;  2V4D A;  1SFE A;  1VQ7 I;  5FJ8 J;  3G05 A;  3BG6 A;  3CDH A;  4F55 A;  4CQJ A;  3AVY A;  1WU8 A;  4XRM A;  2WTE A;  4BYY A;  3I4M J;  1I27 A;  1R9T J;  1QO0 D;  4I84 A;  3HOY J;  4XRS G;  3S14 J;  3N05 A;  2W84 A;  3WTV C;  2QVO A;  2XT2 A;  1ZGA A;  1E1R A;  2BXY A;  3BTL A;  2XGD A;  2ZFW A;  4GGG A;  2DYR H;  4P6V F;  1T6Y A;  1ON2 A;  2DTZ A;  2IEK A;  2VBE A;  3H9Q A;  3A02 A;  2OCC H;  4XID A;  1MH3 A;  3LQ6 A;  2AXL A;  3IH4 A;  3B8Y A;  4OJP A;  2K7L A;  3WY9 A;  1IRX A;  3FBI B;  3OEE A;  3P9C A;  3MZH A;  2HLD A;  1SD4 A;  5J40 A;  4B8X A;  3ZQQ A;  2L3D A;  1JRG A;  2NTQ A;  4OIP F;  4G6Q A;  1FEX A;  4Z05 A;  3F8N A;  2Z3Y A;  2NNY A;  3FM3 A;  3QOD A;  1OYW A;  1RUN A;  1H8H A;  1OIS A;  1F36 A;  2LR8 A;  3E1Y E;  1ITY A;  5LLQ A;  3U9G A;  2JPC A;  2V9V A;  3E5Q A;  2EPF A;  2XPW A;  3TW7 A;  2UXX A;  3GQB A;  2M8G X;  4CSW A;  5E3N A;  3HTS B;  2NPF A;  4RDK A;  3I4P A;  1OGM X;  1S72 B;  1E3H A;  1G7T A;  4BHC A;  1CZF A;  3OR1 C;  2QGG A;  3O6B B;  2EZK A;  3CMY A;  5J4V A;  4PGG A;  4LG0 B;  1E1Q A;  4C3I J;  2F2E A;  1FJL A;  4FN5 A;  4HZF A;  2C4U A;  4L9V A;  4Z4R A;  4AID A;  4X8I A;  2F5E A;  2EIN H;  2LNB A;  2BY1 A;  4EJO A;  3IP4 B;  4G7H F;  2Y2Z A;  3ZOB A;  3AK5 A;  1W0T A;  4QVA A;  4A3F J;  5EG0 A;  3HAG A;  3OR2 C;  4QUZ A;  3BY1 A;  1A8P A;  2CND A;  1H8A C;  1X4O A;  2IRF G;  1ZM4 A;  3CMA I;  2PEX A;  3BR6 A;  4XLF A;  3A8J A;  5FO0 A;  5D8K B;  1Z77 A;  3LQR A;  3LL7 A;  4GO1 A;  5J47 A;  1B8I A;  5JBQ A;  4KKU A;  2FU4 A;  2WSS A;  4HE5 A;  3G1L A;  1A04 A;  1IXS B;  3SZP A;  3S1R J;  3IAM 2;  3FZV A;  4EVI A;  1QX4 A;  2DET A;  5A2Q K;  3VYS B;  1WWX A;  4KH3 A;  4GDF A;  3L09 A;  4MFE A;  4A93 J;  4GYI A;  1UEL B;  3RPQ A;  1G59 A;  1TW2 A;  1V54 H;  3HBL A;  3KEY A;  3P4G A;  4DNR B;  1IXR C;  4Z2Y A;  2JDI A;  5A89 A;  3CCM B;  5EEH A;  4AUX A;  1MBG A;  1VFC A;  3LA3 A;  5J1Y A;  2AS5 F;  4RPD A;  3FXU A;  1O8J A;  4S04 A;  1R5B A;  1O8E A;  1W5T A;  2JPB A;  2QN6 A;  3PNT A;  5M3F J;  2EBI A;  5TY0 A;  1MBF A;  1ORK A;  2OK7 A;  4YZX A;  2KMU A;  5HOO A;  1PJ5 A;  4BY7 J;  2FMY A;  1EA3 A;  4RMN A;  3GTQ J;  1FTZ A;  4A3L J;  2JN6 A;  1I3A A;  3PL8 A;  2FBK A;  3HB9 A;  3C1D A;  1JUP A;  1YI2 I;  1QCX A;  2Q2E B;  4MR0 A;  4YDT A;  2HYF A;  1O8K A;  4DQK A;  3HRU A;  5F0H A;  5CVU A;  1RI7 A;  2HVQ A;  5GAE J;  3CCY A;  2BE5 F;  2XZO A;  1RZ4 A;  4OIQ F;  3I58 A;  3ZMZ A;  3L2V A;  2AQE A;  2ZME B;  5LD2 C;  1VQN B;  1KCD A;  3I56 B;  3O8H A;  4N0B A;  1YJW B;  3EYI A;  5DCM A;  2L7K A;  4ENJ A;  1KRH A;  3MD2 A;  1K73 D;  4U4B A;  5J6X A;  5DS0 A;  2O03 A;  3A4C A;  1O7L A;  4M2L A;  1DP3 A;  2AHO A;  5THX A;  2DK8 A;  3FKS A;  1B4A A;  2X6O A;  3LQE A;  2NVT J;  3SY2 A;  3ELK A;  4P3I A;  1ZK8 A;  1VBL A;  4QWQ A;  4M53 A;  1T6S A;  3ZQH A;  3PVD A; 
#chains in the Genus database with same CATH homology
 1AA7 A;  5CPR B;  2VQC A;  4CH7 A;  3DWL E;  2WY7 Q;  1LKX A;  1E3Z A;  1UG0 A;  4BU2 A;  3A2K A;  2AQF A;  2CV2 A;  1K6Y A;  3K70 D;  4B3X A;  2R7T A;  4PJN A;  3H9J A;  3DEE A;  4XD7 A;  2UUZ A;  1WJB A;  2DJI A;  3RTR A;  1BPL A;  2GK7 A;  2W82 A;  1O8G A;  1OGO X;  2VJI A;  4XOP A;  2NTP A;  3K4J A;  3FHN A;  2RNG A;  2KHM A;  1W0J A;  1D1A A;  4TT3 A;  3DQV C;  4HRI A;  3VSU A;  4F52 A;  1Z3Y A;  3D5R C;  2CMP A;  2R7X A;  2X6W A;  3OIP A;  3TBI A;  3VDX A;  1E3X A;  1OFM A;  2EWE A;  3M1C A;  4HNU A;  5C1E A;  2ZZE A;  1D1C A;  3AFH A;  3S8P A;  3ZR8 X;  1DBG A;  1IDJ A;  3E1S A;  4II2 A;  2JJ2 A;  2JUG A;  4NUB A;  2M4K A;  1MMD A;  3VWB A;  4U49 A;  2XGJ A;  1T0F C;  2HU9 A;  4PK4 A;  2BSP A;  4NC8 A;  2MFZ A;  4PJM A;  1NG6 A;  2ZXH A;  2VLA A;  3VYR B;  2ZFU A;  3PSF A;  3TMO A;  2VJJ A;  3AL0 B;  1V0F A;  4E7K A;  2E1M C;  2PJR B;  4L8J A;  2BW3 A;  2KDO A;  2KL4 A;  3D5L A;  3W2W A;  4HEA 2;  1BOB A;  2A5W A;  2LBF B;  1V0E A;  1H80 A;  3IUO A;  3L2U A;  3U21 A;  2KRC A;  4CCL A;  2ZTN A;  5DN6 A;  4YZ0 A;  4J00 A;  2ZSI B;  3AKZ A;  2VJ5 A;  2K5C A;  3OYD A;  3JUR A;  4ITV A;  4LIU A;  2X1C A;  3K10 A;  2LY1 A;  2KLO A;  4OJ5 A;  2RQQ A;  2W7N A;  1X4P A;  3D5S C;  2F6C A;  3SEQ A;  4E0F A;  4DJA A;  4EAT A;  1NBM A;  2PYG A;  2M7B A;  3MMY B;  4BXF A;  2Z8G A;  3B4N A;  2E1B A;  4PJL A;  4JOM A;  3H9G A;  3K4B A;  4IQ4 A;  2X1D A;  2VL8 A;  2VBM A;  4PUS A;  4BE0 A;  3FKJ A;  2DCE A;  3S32 A;  3LSK A;  5KHD A;  1YE9 A;  3FY3 A;  3K4C A;  3KEW A;  4CCM A;  2X1E A;  3PSI A;  3PJR A;  1PJR A;  4XLH A;  2CV1 A;  1I18 A;  3SZG A;  3OWT A;  2O04 A;  2O0V A;  3SDB A;  3PNV A;  3H0D A;  5CQG A;  1UD5 A;  2UVF A;  2X6X A;  4RLF A;  3LSG A;  2R7Q A;  2E1M B;  3VYU B;  2WAQ A;  4B48 A;  2V31 A;  4C2U A;  4G6I A;  2V7F A;  3HC7 A;  1NG7 A;  1LDK B;  2Z1D A;  1DGR M;  1K5C A;  4G7X A;  2LBF A;  3V42 A;  1WTH D;  2V6E A;  1O8H A;  2VXZ A;  1MNE A;  2V7Q A;  2PYH A;  2IGM A;  1YX3 A;  4C30 A;  2XOK A;  2HNH A;  3CES A;  4W8T A;  3F9K A;  4XOR A;  3ONQ A;  3GQ7 A;  2X6Y A;  3SYT A;  1D1B A;  1X1D A;  3K6G A;  4DK0 A;  2HPI A;  3QYB A;  4KT6 A;  4LG3 A;  3TL4 X;  4DK1 A;  2NT9 A;  2JVH A;  1QHG A;  3C2H A;  3EPZ A;  3HUG B;  3OIQ A;  4BQQ A;  1DGW Y;  4BE1 A;  2CK3 A;  3H5N A;  3J7A Y;  2F43 A;  3EQO A;  1BR1 A;  1WJF A;  4ASU A;  4B3F X;  3OYH A;  1X1B A;  2MC4 A;  4YXW A;  3DPU A;  3OYG A;  1KTW A;  3EUK L;  1EE6 A;  2X8K A;  2LZJ A;  2L9S A;  4RLQ A;  4OZZ A;  5HVQ C;  2XZP A;  1UD3 A;  2IGN A;  3GRH A;  3OFN A;  4BEH B;  4YZQ A;  5AMV A;  2HZD A;  3HOT A;  3A3B A;  4XQF A;  3DDY A;  3T53 B;  4OAY A;  2UVE A;  3ZPN A;  3DTI A;  3M8J A;  3RPU D;  3VST A;  5HNH A;  3SEZ A;  3LSI A;  2W4S A;  3H5R A;  4UZU A;  5CKT A;  2WAE A;  1H8E A;  1UAA A;  2CH0 A;  4XKB A;  1GQ8 A;  4BUP A;  4D1Q A;  2V1N A;  4GRI A;  4B43 A;  1OB0 A;  2QY1 A;  3VSV A;  3K4M A;  2F5V A;  2PMZ A;  4PFO A;  3VSK A;  4ZTF A;  4OAZ A;  1W36 D;  1G8X A;  3WQZ A;  2QKL B;  3S93 A;  4ZTJ A;  4BGD A;  4CA0 A;  1BN8 A;  3NWT A;  1BMF A;  1V5E A;  1TT0 A;  2WAD A;  2VAS A;  2HVR A;  3VR6 A;  1LFP A;  1OFL A;  4NNJ A;  1IDK A;  3EUA A;  3VYT B;  1WMR A;  1FMW A;  1UD4 A;  2WB1 A;  4XKW A;  2E5Z A;  3QYE A;  3I9V 2;  3ZSC A;  3QYF A;  3T56 B;  4DBQ A;  2CUZ A;  3HKZ A;  2GOM A;  2CW7 A;  2LRD A;  2V9K A;  5TGT A;  2OUM A;  2A6T A;  1HVX A;  1KMH A;  2UV1 A;  3HPG A;  4N4N B;  4Y4R A;  1ERD A;  1DQU A;  3OAA A;  1LVK A;  1VF7 A;  1QHH D;  3GVL A;  4CCO A;  4URR A;  4HWV A;  4Z06 A;  1NHC A;  3OYJ A;  3ZIA A;  2NOJ B;  2L9N A;  3HOS A;  1PXZ A;  1N77 A;  2HPM A;  3CJQ B;  1ZEL A;  3UR3 C;  2WJV A;  1Y56 A;  1JI8 A;  2Q1Z B;  2XAU A;  2HVS A;  4ZDO A;  4HIZ A;  3FDY A;  3KX2 A;  3OMY A;  4HSR A;  4W8S A;  2QE7 A;  1JTA A;  3PNY A;  2MD0 A;  4HST A;  4IKF A;  3T51 B;  2CUJ A;  2L5Q A;  2CS3 A;  3DKY A;  3DPT A;  4H4K C;  2ELJ A;  3W2V A;  4J01 A;  4Y33 A;  1I8D A;  2WBM A;  2K9M A;  4BE2 A;  4RM2 A;  4XOT A;  4CZC A;  3I3L A;  3LMW A;  2O0W A;  3KRG A;  2INU A;  4JQF A;  4OJ6 A;  4KKT A;  3OYE A;  2WAF A;  4FXU A;  3G2B A;  4TSF A;  2NST A;  5FRN A;  3LSH A;  2GJP A;  1DBO A;  4R79 A;  4E7Z A;  4QPO A;  1W9X A;  2WPD A;  2LOO A;  4B44 A;  2D3N A;  1SAU A;  1Z7L A;  3OYA A;  4LIV A;  4LIT A;  3W3C A;  4Y3O A;  3RSN A;  3NE5 B;  3CMM A;  4E4H A;  3EUH C;  4U7B A;  3H35 A;  4E7L A;  3S3O A;  2WZP P;  1X1C A;  4CCN A;  1QJV A;  4NK8 A;  1O8I A;  3AL0 C;  3ZXS A;  4BS9 A;  2R4G A;  2QKM B;  4W8Q A;  4BQO A;  2DT7 B;  1N78 A;  1WJ5 A;  1YX5 A;  2XDV A;  3K4L A;  4AU7 A;  1COW A;  1UD6 A;  2JJ1 A;  2VJ4 A;  3DPL C;  2M4G A;  4BJ6 C;  1OOC A;  3K4N A;  3C2G A;  1QU3 A;  2R7U A;  2KRH A;  1PYV A;  3LFU A;  2VXD A;  4HNT A;  5HNF A;  3ZCO A;  2NT6 A;  3GQA A;  3T9G A;  3OY9 A;  2F4I A;  2GK6 A;  2LRE A;  2WA0 A;  3CP2 A;  5CDF A;  3OYI A;  4CCJ A;  2JVG A;  4OWR B;  2D3L A;  1VZ0 A;  1HZE A;  2XND A;  2BVM A;  5KNL A;  3HG9 A;  2IS2 A;  3UNG C;  3VMV A;  3MKY B;  4XL9 A;  3ZRG A;  4PMH A;  3BCF A;  1V5G A;  3VMW A;  1TZL A;  2JIZ A;  2M0M A;  5FRO A;  2IQ7 A;  4XKV A;  1P9Q C;  2MYS A;  2XF5 A;  4XMY A;  4XLC A;  4BQN A;  3BCB A;  1E43 A;  4YZA A;  3OS1 A;  1UD8 A;  3OYN A;  4XKC A;  2XF7 A;  2GOX B;  4IQJ A;  2KQR A;  4XR6 A;  1HA8 A;  2OV7 A;  1MAB A;  4JMQ A;  3DU5 A;  1O8F A;  1VJS A;  1SFK A;  1KCC A;  2IS1 A;  1BLI A;  3OYK A;  1RU4 A;  1MW7 A;  3A1Y A;  3PFY A;  2LY2 A;  4C2L A;  2R7R A;  4FET A;  2CV0 A;  3L2W A;  4CUG A;  3ZGK A;  5FRM A;  3HL2 A;  4B3G A;  3PUB A;  1RWR A;  2LG4 A;  4ANJ A;  3L2R A;  2M5S A;  4DNT B;  1BR4 A;  3BG7 A;  3FBN B;  1BHE A;  1X1A A;  5KCM A;  4YEL A;  4DGW B;  4F3Q A;  2LYC A;  2NTB A;  2VBK A;  4E7S A;  3LMM A;  3SUC A;  2VPL A;  4PSX A;  4XLA A;  1WJA A;  3ZPP A;  3OL3 A;  2WY8 Q;  2ZSH B;  1W0K A;  2W1O A;  2HDW A;  3FPP A;  3HPH A;  2O17 A;  4TKO B;  3OYL A;  3CP8 A;  3BCD A;  3OE7 A;  2FUG 2;  4D9J A;  4NK6 A;  4N4O B;  4XON A;  5IK2 A;  2V26 A;  1D0X A;  2XSJ C;  4DBR A;  5LFA A;  3RCO A;  2O1D A;  3A3G A;  4BDY A;  2ZTG A;  2XF6 A;  4NC7 A;  3MKZ A;  4F93 B;  2X3H A;  3GQ9 A;  3WWG A;  2E60 A;  4B47 A;  1MMN A;  4E7J A;  2JSP A;  1XG2 A;  2R7W A;  4CCK A;  4W8R A;  5C1C A;  4NQW B;  4P5O A;  4ZDL A;  2XC7 A;  2BOL A;  4OJL A;  3BC8 A;  4C2T A;  2M7A A;  5FL7 A;  1J09 A;  4G6T B;  1OLT A;  4OJO A;  2KVO A;  4XM3 A;  4P22 A;  1EFR A;  4HPQ A;  3KYL A;  2LC2 A;  2BW3 B;  3OS2 A;  1PE9 A;  1GLN A;  2IGK A;  4PSW A;  2ZZG A;  3OYB A;  4PJJ A;  1Y6I A;  3BCA A;  1KZL A;  3CZ6 A;  4IX7 A;  4AVZ A;  2JA2 A;  1HG8 A;  1WFX A;  2KPM A;  2BVL A;  3K70 C;  2IGO A;  1MMA A;  2ZXI A;  4XN3 A;  2V4D A;  3G05 A;  2DOA A;  2IXS A;  3BG6 A;  3HXL A;  4F55 A;  1PLU A;  2M3A A;  3LSM A;  4ZC3 A;  4I84 A;  1WPC A;  3N05 A;  1IA5 A;  3S3M A;  4U87 A;  1RMG A;  2Z2S B;  1E1R A;  2OC6 A;  2VIX A;  3H5A A;  2R9V A;  2RRE A;  4G7W A;  4XNF A;  4XLE A;  2KZV A;  3H9Q A;  3VSL A;  3DTE A;  2VBE A;  3E0J B;  3QOE A;  3EQN A;  2Y0S A;  1T5E A;  3B8Y A;  5HLT A;  4OJP A;  3NWS A;  3DLA A;  1IRX A;  1KON A;  2K3P A;  3FBI B;  4E7I A;  3OEE A;  3B90 A;  2XZL A;  2HLD A;  3ZQQ A;  4PFP A;  4E7H A;  1JRG A;  2NTQ A;  5HKK A;  4Z05 A;  3OYM A;  4P1W A;  1OHH A;  3MKW B;  4FAS D;  3QOD A;  1U0J A;  1H8H A;  4C9Y A;  2DIE A;  1AIR A;  2ODL A;  4BEH A;  3BH4 A;  4IZZ A;  1O88 A;  2PEC A;  3GQ8 A;  2KP6 A;  4ZJZ A;  3LNN A;  3DKX A;  3GQB A;  4CSW A;  2LH9 A;  4YEJ A;  4ZDP A;  3OEH A;  1FX0 A;  1OGM X;  4HG2 A;  2UWM A;  1E79 A;  3CF2 A;  1S9H A;  3DU6 A;  4AYB A;  2VKD A;  1CZF A;  3IAS 2;  3OR1 C;  1E1Q A;  2ZZQ A;  1IB4 A;  1E0E A;  1Z3X A;  3OPO A;  2K9L A;  2W00 A;  3RQ4 A;  3IP4 B;  2NSP A;  3HAG A;  4F92 B;  2P0W A;  2Z16 A;  3OR2 C;  4Z03 A;  4KJZ A;  3GBG A;  1T95 A;  4MXN A;  2CW8 A;  3CJR B;  1X4O A;  4YRV A;  4KIT B;  1SKY B;  4KIS A;  1X0C A;  1Z21 A;  1WJE A;  4XLF A;  4GQN A;  2IS6 A;  3GVK A;  3OS0 A;  2R7V A;  3A35 A;  2NZM A;  4E6K G;  2O5R A;  3GVJ A;  3LL7 A;  4BDZ A;  1O8D A;  3OYC A;  1O8L A;  2WSS A;  4KKS A;  3OOU A;  2DXI A;  1WP6 A;  3IAM 2;  4Z1M A;  3K4K A;  1BR2 A;  3L2Q A;  3VYS B;  3OL4 A;  4XN0 A;  1X19 A;  4OZY A;  1UEL B;  5CQE A;  1G59 A;  3KEY A;  2F1M A;  4DNR B;  2E5N A;  2JDI A;  2CFO A;  2QXZ A;  1WJC A;  4DIQ A;  4BAC A;  2ZZF A;  2W6J A;  2MAB A;  3BLY A;  1MMG A;  1O8E A;  4QPQ A;  1O8J A;  4ZYA A;  4EW9 A;  1FMV A;  1UD2 A;  4BJT A;  2VKH A;  3PNT A;  3DTK A;  5JHF A;  1D0Y A;  2L2O A;  2X51 A;  4YZX A;  2KMU A;  1W36 C;  4F91 B;  5HOO A;  2GJR A;  2GJK A;  3BC9 A;  2INV A;  2V4J C;  2HQA A;  1EA3 A;  4RMN A;  2PJR A;  2VQH A;  2X53 S;  3PL8 A;  2I8D A;  3OW7 A;  4II3 A;  4DOZ A;  2R7O A;  1QCX A;  2Q2E B;  4MR0 A;  1WJD A;  1MND A;  4MLO A;  1NRK A;  1O8K A;  3H94 A;  2R7S A;  4RM3 A;  1VLY A;  3JU4 A;  2HVQ A;  2VQG A;  2XZO A;  3OYF A;  3OOC A;  1O8M A;  3L2V A;  2AQE A;  1KCD A;  5LD2 C;  3W2A A;  1N75 A;  2VQL A;  2L7K A;  4X0G A;  1K28 D;  4KKU A;  3MD2 A;  2WJY A;  2VB6 A;  1R6R A;  4U4B A;  2Z6B D;  1OR7 C;  3A4C A;  1PKV A;  1V5F A;  1DP3 A;  2W6I A;  2IS4 A;  3FKS A;  2X85 A;  3UW0 A;  4BJ5 C;  1D0Z A;  4BL0 B;  3S3N A;  2QX3 A;  1VBL A;  2DT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...