4XOTA

Tailspike protein mutant e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xotA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xotA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xotA02
4XQFA 4MXNA 3JURA 1OFLA 4XONA 5C1CA 2INUA 1XG2A 3GQ7A 4OZYA 1VBLA 4OJ6A 4XKWA 1KTWA 2QY1A 4OJ5A 2IQ7A 1DBOA 2QX3A 4XLCA 1O8IA 2X85A 4XOTA 2O0VA 4OZZA 4Z06A 4XLFA 4OJPA 3GQ9A 2PYHA 2X6XA 4NK6A 2NZMA 1RMGA 3SUCA 3EQOA 2VBKA 3ZSCA 1BHEA 4XL9A 3VSTA 1KCDA 4W8RA 4XLAA 2UVFA 4OJOA 2ODLA 2O0WA 5C1EA 4NK8A 1O8JA 3LMWA 4YZXA 3UW0A 4YELA 4YZQA 1WMRA 4HWVA 3B8YA 4XMYA 4YZAA 1BN8A 4XOPA 3FY3A 1CZFA 3GQ8A 1OOCA 1JRGA 4U49A 4XLEA 1O8HA 1RU4A 3KRGA 2PECA 1IA5A 1O8GA 4XR6A 2VJJA 3T9GA 1IDJA 2X3HA 4XLHA 2NT9A 1X0CA 1O8KA 1QCXA 1NHCA 4XN0A 1IB4A 3VSUA 2X6YA 4Z05A 4YZ0A 1OGMX 3VSVA 1IDKA 2X6WA 1KCCA 1K5CA 4YEJA 1O8FA 4W8QA 2NT6A 3B90A 1RWRA 2O1DA 2VBEA 1H80A 2NSTA 1QJVA 1EE6A 2NSPA 2EWEA 3ZPPA 3VMWA 4XORA 4C2LA 2NTPA 1O8MA 4XNFA 3WWGA 1JTAA 4W8SA 4MR0A 3VMVA 1O88A 2BSPA 2INVA 2PYGA 2QXZA 4OJLA 1PLUA 4EW9A 1GQ8A 3GRHA 3GQAA 2O04A 1PXZA 4Z03A 2Z8GA 2UVEA 4URRA 1OGOX 1DBGA 4W8TA 3EQNA 5AMVA 1O8LA 4XM3A 4I84A 4AVZA 1O8EA 2NTQA 1OFMA 1HG8A 3B4NA 4XKVA 4PMHA 1O8DA 1AIRA 2VBMA 4XN3A 4U4BA 1PE9A 2NTBA 2VJIA 2O17A
chains in the Genus database with same CATH superfamily
2Z9OA 5H5JA 2QQ9A 2P5LC 1TTTA 1OFLA 4AYBA 2PQ8A 4BQAA 2FBKA 3CCRI 1FBUA 2E5NA 3F8NA 1F60A 1OMIA 4HV6A 2XC1A 2QLZA 3BJ6A 2HPIA 3OKXA 1YITI 2DQRA 4MYTA 3IL2A 4XKBA 5LGUA 3VR6A 2F4MB 3PNYA 2HI3A 4XLCA 1B23P 5LGTA 3CDLA 4PJMA 3S32A 3ZQFA 3Q6RA 2BGCA 1TWGJ 4TMTA 5HVQC 2CFOA 1D5VA 1BQEA 1G7TA 3GCMA 1D0YA 3FX3A 4QWQA 2LY2A 1N77A 1FBSA 4LITA 3ABMH 5FNZA 1XMXA 4UB8C 2XEXA 2VKDA 1IF1A 1VQ8B 3K70D 2Y31A 2P6SA 3P4GA 3HTUA 3A1PA 3CLOA 3PNTA 3ZBTA 2OV7A 4U87A 3ZPLA 1JGGA 1RQRA 1KCDA 3IAM2 2V7VA 3VSLA 4M9ZA 4TT3A 3C1DA 2LKPA 5EG0B 1ETQA 4G1BA 5DNSA 3UW0A 3OEHA 3PFIA 4YZQA 3A8JA 4RGSA 3EYIA 2L7KA 1GR1A 2K85A 2JRMA 1FY7A 5GPAA 5F4MA 1QZYA 5AIQA 2JN6A 5FKOA 5FKLA 1JJ8C 4AM3A 1HLVA 1VQKB 5ILSA 1RR8C 2E2IJ 4YZAA 2KRFA 1COWA 3I4PA 1O8HA 3P9IA 3HRSA 2JSCA 4RAFA 3JRAA 2YWFA 3VOEA 3CCSB 3LSJA 2YR2A 3GMEA 5GPCA 3RZOJ 2PMZA 1EP1B 3KLOA 1E62A 1R5HA 3L2VA 1QFZA 1ETVA 3AFHA 5EZHA 5K5RA 3HYIA 4S04A 2QTLA 2ZZEA 2E34A 1ZHFA 1LFBA 3ZQCA 2VIXA 3VO2A 1OPCA 2YUSA 4KNYA 1JUSA 1XCBA 1DARA 3BCFA 3TH0A 2ZCWA 1QPMA 1ZLJA 2W57A 2R9VA 3A8IA 5DD8A 4D9JA 1VQMI 3WWGA 4F93B 3HRUA 2COBA 1ODDA 3ESWB 3VMVA 2GXAA 5LHGA 1F4KA 2PYGA 2YS9A 3DEWA 4E7HA 4M53A 2E1OA 3NWSA 3KPHA 2ME6A 4AIHA 1ZRFA 3SJZA 3CXCB 2XSJC 4JK1X 4OOIA 1QA1A 3DPLC 1DBGA 3OEEA 5FO5A 3MHPA 3LWFA 3OPOA 1OGJA 3CD6B 1O8LA 4BE1A 3U2QA 1EF4A 2D3LA 2TCTA 2W48A 3F72A 1V3FA 1D8JA 4Y9RA 3JAMZ 1B72B 1O8DA 5B3SH 1EV7A 4IHWA 4X7DA 5B5EC 3WTZA 1B9MA 5FLMJ 4HF1A 1NDHA 1JGSA 2ZSIB 2CV2A 3U2RA 3HOWJ 1K28D 1R5OA 4BBRJ 4EGZA 3F8FA 3BCAA 4OPSA 4KFCA 2DW4A 3SEJA 1QX4A 2I10A 4FQGA 2B63J 5F0CA 3BPVA 1R23A 1RESA 1EA0A 4OZYA 4XKWA 1Q1VA 5CPRB 3GFIA 1NB9A 4OM9A 4HIZA 2X85A 4QTRA 3JREA 1WOSA 2KJCA 1ON2A 5HXBA 1T2KA 1XE1A 3X2QH 3E6DA 3ZMUA 1LM1A 3F21A 1MNEA 2H8RA 2JMWA 3OYBA 2KIMA 5E3LA 4AYBN 3VMFA 1IN6A 5LEJA 5CKTA 2QA4I 3LO8A 1O7FA 2XT4A 5CYVA 5JHUA 4CCLA 3U6KA 4ASNA 5E3OA 2XV4S 3H36A 2B0RA 2FD5A 2IBDA 1KK2A 1X1PA 2N8GA 1ULYA 4IRGA 4B43A 4IHXA 1IV8A 2VL8A 3V4GA 1V4RA 4HWVA 3SKBA 1E3PA 3KL9A 5GTHC 1UFMA 5F0HA 4BQOA 4PC6A 1Z0XA 1XGMA 4XOPA 3FY3A 2DJNA 1WTHD 2OUMA 5E3MA 2VOPA 1OR7A 5D5UB 3SFIA 3K4MA 1OJLA 2F5VA 2XIGA 4U0WA 5CQEA 4XLHA 1EA3A 5E18F 2H6BA 3BG7A 1O8KA 2XNJA 1PE9A 1BR1A 4ZGQB 3BCBA 1KJZA 2FMLA 3K0LA 4NQWA 1Z7LA 4X07A 2CS3A 1W9XA 1IDKA 2KIFA 3N4MA 4U9UA 2ELJA 4B3FX 3H92A 3K4BA 2GWRA 1WHUA 2FX0A 4LLGF 2V6EA 3FPPA 1DUXC 2A6TA 4OIQF 2XAQA 4Y7NJ 1WGXA 4IHSA 5DV5A 1SD4A 2H1KA 3ONYA 2YSRA 3KEQA 1IXRC 2CNDA 2WB1A 3L09A 3AG2H 1HW2A 1ACIA 1MSEC 1GAWA 3IUOA 2VQGA 3VNUA 4MR0A 1WQ2A 4HA8A 3CUQC 1I6XA 2PMZN 2Y69H 1R71A 4YFKF 4UV8A 3ASRA 3U1KA 1IXSB 2D2WA 2OZ6A 1A6IA 1W0UA 2IS1A 1WDTA 5HLIA 5IP9J 2CWEA 1HOMA 3A35A 1HW1A 1I5ZA 2DYRH 3V8KA 4WZLA 3VFZA 2PG4A 1JB9A 3J7YJ 3RKQA 4L9JA 2LF7A 1UG2A 3DLAA 1WSRA 3WTYC 2I1LA 1D0ZA 3ML3A 3D0SA 3C2GA 3KP4A 2NTQA 3WU1B 3R61A 3D26A 3GX4X 1PKVA 2R4GA 3SZPA 1UHMA 2E1MB 1XPXA 3D5RC 1S29A 4FASD 3F8CA 2VQCA 2P4WA 2DOFA 3M8FA 2BEOA 3G6EB 2EINH 4E70A 2DT5A 4XIDA 2F3LA 1FJLA 4CHUA 2WSSA 3I59B 4X1EA 3PSFA 3S16J 1QU3A 5B1BH 2O03A 3KYCB 3NEUA 3HUGB 1QFYA 4J00A 2MLKA 4A93J 1D1BA 4Q47A 2HVRA 4QLCU 3DPTA 1IN7A 4XLNF 3P5JA 1UD4A 1ZM9A 4DK1A 3BOQA 5FFZA 3A03A 2GOXB 1KZLA 4F3QA 2ZB9A 4MTDA 1DDGA 2RQPA 4ZDLA 2EFWA 3GTOJ 3HM5A 2HYJA 5AN9A 3BG3A 4R79A 3DLLF 1N75A 4D5CA 1JKPC 1T38A 4I01A 1A04A 1GVJA 1QHGA 3GW2A 3VWBA 1B6AA 2LTPA 2OAZA 1TW2A 2K7LA 1AU7A 2QEXB 1Y1WJ 2OYNA 4ZYDA 3BJAA 4AWXB 4G6TB 1GO2A 1QG0A 2C2WA 4OJOA 2MH9A 1W7PD 4B1RA 5DM6F 2UWMA 2Q6KA 5TY0A 1QVFB 5E3NA 3J7ZI 2X51A 4LBYA 1VHEA 2E1BA 4UZFA 4E6KG 3MZ8A 3IKVA 2E60A 4M71A 1AOYA 2V1UA 1XMAA 3RY8A 3OOCA 4LOCA 3KP5A 5HLGA 3GXOA 4NC8A 2DOEA 2HYGD 3RZDJ 2OCEA 3ZGKA 4BUPA 5FRMA 2R7SA 1P7JA 1YHQI 2K40A 4JMQA 2NPFA 4L5JA 2W25A 2HMAA 1JUMA 5DD4A 4N3NA 1BOAA 3ERED 1YJ9B 1EKEA 3K9TA 1SC7A 1WOPA 2IS2A 3VSUA 1K4ZA 2M34A 2VODA 2D1VA 2K27A 2X6WA 3GIRA 4G7WA 1OGOX 2EQRA 2QBYA 2PMDA 2IT0A 4Y3OA 4EQQA 3REOA 4UUSA 4OMYA 3BCDA 5FIUA 3PNVA 5LHHA 1ETXA 1X2MA 2JPBA 1P4AA 1RC9A 4F91B 4A0XA 4ESFA 4RD4A 1BOBA 4RGXA 1FX7A 5KVRA 3TGNA 2Y9ZA 3MCAA 1ON1A 3CCLI 1XX5A 1R00A 2TDXA 2CGPA 4B47A 3FWEA 1KGSA 3LOCA 1Z3YA 2Q6IA 4EGYA 3RCOA 2KZGA 3FXKA 1MKMA 2V1DA 5LRRA 2OTLI 2V7XA 2KISA 1MMGA 1MRZA 5TGTA 1Z67A 1IUFA 2Z8GA 2UVEA 4X0GA 4IW3B 2MLGA 3BROA 4M6YA 5EEAA 4A3IJ 3GVAA 1Q82D 4P2NA 1OFMA 3S3NA 2XT2A 1JNYA 3CO7C 1XFOA 2VBWA 3OZVA 2HS5A 3NRVA 3LFUA 4EJOA 1XB2A 3CP8A 4EATA 3ZMTA 2CW7A 3OIOA 4LFUA 2VZLA 4KUMA 5FL7A 1YO5C 3HC7A 3HUGA 4PC1A 1M1KD 2DMUA 2DI3A 3VYSB 1E63A 1XG1A 5DUKA 2VJIA 1YJWI 5JLWA 1FTZA 3IP4B 2QWWA 3G4SI 2GA2A 1T0FC 2YUHA 4KICA 4DNCA 4PK4A 5L3EA 1FDRA 3WNCA 3M1CA 3OV8A 3JW4A 2K02A 4HNVA 1W0JA 5BSYA 3VYRB 5HLTA 2J8KA 2VBZA 1ZLKA 3FPKA 1VBLA 1JTXA 2BZTA 1FP1D 2FF4A 2BVNA 4AF7A 5DUIA 1N06A 1KU9A 2XAFA 4C30A 4Z06A 1RR7A 4XLFA 1LLZA 4NC7A 1FRQA 5ED4A 3DU6A 2PJRA 2DT6A 4A3CJ 4KMUX 2P0WA 2HDNB 4B3AA 2COMA 3ZMVA 2W84A 4ZJZA 1KZHA 4ESJA 2V5IA 3BQYA 5ILVA 1X1DA 4ZCIA 4M4SA 3PQKA 5A89A 1JA1A 4M6XA 1JKQC 3ZMDA 3BZ6A 5IPAA 3IRRA 2Z1DA 1V5EA 2QZAA 1G2HA 2VBYA 1DP7P 4HX8A 2H94A 3I54A 4N4OB 3I64A 4DBRA 5LBQA 3GF2A 1GJRA 2L4AA 4YZXA 3LSTA 2O0YA 2RNGA 3CZ6A 4G9YA 4LB6B 4YFXF 1JXSA 1YG2A 4JX6A 5TJJA 1DPUA 4ANJA 4IQJA 1KK1A 4OIPF 1TWHJ 3EETA 2HVQA 4TV7A 5H6QA 3P7NA 1FYLA 4L8JA 1WSVA 3EDPA 3PVDA 4C43A 2IVMA 4BU2A 2XDVA 1TNSA 4KITB 3KCCA 3KYLA 2QQAA 2C78A 3FXQA 3HZJA 4JOMA 1IA5A 3JX8A 2Q2EB 3FK6A 2DDBA 2Q6OA 1B8IB 1N25A 3CCYA 3J80K 4KKTA 2KL4A 1UMQA 2ZMEC 4MTEA 1FBQA 3RPQA 1W5CC 4HYEA 2L9NA 4N9HA 3CCJB 3DTIA 4DQ2A 1O8FA 3LSRA 1XN7A 3B90A 2NSTA 1H8AC 2EWEA 3OYCA 1WOOA 4HX7A 2JVHA 2GXGA 3S17J 4C2LA 2NTPA 3AVXA 4FETA 4ZCMA 3PUBA 1KK3A 2EV0A 4XRMA 3BNWA 2VOOA 2GK6A 2FUG2 1HBXG 1D1AA 3C2BA 5GV8A 2ZSHB 3N6ZA 3O2PE 1VQ4B 4M1KA 4BY7J 4PC7A 2C4UA 2B0LA 2AXTC 2GIZA 2E71A 3K2ZA 4TMVA 2DA5A 3K69A 4GCVA 5K5OA 5FA6A 1KTVA 4CDGA 2P5KA 1DU6A 3OJWA 4HF2A 2O8XA 4RS8A 1I39A 2AHQA 3I55I 3OYJA 5E1ZB 3F6VA 3PSZA 1IDYA 4JX5A 4RD0A 3TW6A 3ZQIA 3LNNA 1HDPA 4XN3A 3AK5A 2B7CA 2NTBA 5F1RA 1Z7UA 3WTWC 1SVMA 2L3DA 3FXRA 1X4PA 5D6FA 4ETSA 4LG0B 1WH5A 1ZGAA 1QH0A 4U7BA 5FD5A 5L46A 4R8HA 5D5XB 2QKMB 1BC7C 1GT0C 4PC3A 3WE3A 3KFWX 2Y0MA 1J59A 3B6AA 3WTXC 1FNCA 4KDPA 3HIFA 2OQGA 5DCFA 2VFQA 4E7JA 2ZTNA 1DG1G 4OZZA 3WBJA 3R0JA 1PP7U 1BI0A 3QE2A 1WRJA 3QYBA 2LVSA 2M30A 1FNMA 3E7LA 5GTIC 2GBYA 3HHGA 4YAWA 2VLAA 4ZH4F 1EFTA 1WI3A 1ZK8A 2XNCA 4GRIA 1J9IA 1WWXA 3SZGA 4RB3C 4WZKA 4RD3A 2BHZA 4XL9A 3WGGA 3CMMA 5GV7A 1VQ7B 4Y52J 3CMEB 4EM1A 3RIQA 2DFFA 1T5EA 3G1MA 5C1EA 1QQIA 4P9SA 2G9WA 4GGGA 1R9TJ 4UB6C 5ICGA 4RGUA 1LB2A 4UNOA 3I4MJ 4WZEA 3B78A 3LAPA 3W5UA 5C44J 1RUOA 1O3TA 2F5FA 2LH9A 2VONA 2L02A 5FRNA 4YFOA 2MABA 2X53S 1HKSA 1J7KA 5IOYA 1HA3A 1PVEA 2AQEA 2EJRA 4I0AA 1YIJI 2ZFWA 4XICA 4XRFA 3CUOA 4UUVA 4X06A 1KYZA 1SM4A 3B8HA 3QYEA 1RU4A 3N97A 2OK8A 1O8GA 2FOWA 1SVOA 2O61A 2IJLA 3A02A 2OPTA 3DF8A 2VQLA 3JSPA 3UKGA 4D5FA 4B4CA 1MDMB 1T39A 1PYVA 1GLNA 2UV1A 1QVUA 2DA7A 2EPFA 1ZRCA 3M4OJ 1D2EA 1Z3XA 2X1CA 1W2BB 4PABA 2QE7A 1F36A 2VBEA 4HSRA 5BPDA 5EEGA 3CCMB 3F23A 3SLNA 2DY1A 3ES9A 2XUBA 3R6SA 1MBKA 3K6GA 1H80A 1QJVA 1SD6A 5HODA 4G7OF 4JP0A 1EE6A 3GZ6A 1RPWA 3VMWA 2V7QA 4XORA 3MZHA 3ISXA 2P5VA 1D3YA 4Z4RA 2WZNA 4YC5A 1WKMA 3OZWA 3J81Z 5DS0A 4W8SA 2HQNA 4UVBA 3SQVA 3IAS2 3RYPA 3J7AY 2BGIA 3U1DA 2WJVA 2QXZA 4PZJA 1G6NA 2CQQA 1MD0A 5F4OA 2PBIA 4M9XA 3TP3A 2MC3A 1BIBA 4OMZA 1PXZA 2RC5A 3G1OA 1YLOA 3ECHA 2FRHA 1TT0A 2DMQA 1WVRA 2KFDA 1X1CA 1MJBA 5IYBJ 4AUXA 2XGXA 1HDDC 2DJIA 2XRNA 1O57A 1YW8A 2G0YA 3JRFA 4OIRF 4N0BA 3GVLA 2DAOA 1W4MA 2F5EA 3BZKA 5L3BA 1EXMA 2F1MA 4AVPA 2KDZA 1CF7A 4WWVA 4LG0A 4YIFA 2NS8A 1Z77A 1SMYF 2WADA 3R60A 3DDYA 2Y30A 4M6VA 3L2QA 1LPQA 1KRHA 4KA4A 1HVXA 2QSFX 4S05A 4ZYEA 2NAZA 1SFEA 3MAJA 1R22A 1F20A 1USSA 4WQMA 3GTJJ 2VFNA 2CRGA 3I4NJ 4Y4RA 3OYAA 1G59A 3V42A 3GTLJ 5DM7F 3CDIA 5LMZA 3MMYB 2NNNA 4PAAA 4HLXA 2YU3A 1VI0A 3L1PA 4P9FA 9ANTA 1B59A 4YEIA 4EV0A 1ETWA 2FBHA 3FBNB 2P81A 4A6DA 4F55A 2EH3A 3OZUA 4G1VA 2W00A 4YIIA 2ZXJA 4EVIA 2E2HJ 1VQNI 3ZQLA 5FKMA 1UD5A 1OLTA 2JUCA 3GTQJ 2R0QC 2ECBA 2PEXA 3CCQB 2LD5A 3KEWA 2F4IA 3ZPNA 4AC0A 3I71A 1ZELA 1QGPA 2MG4A 2VPRA 3F8BA 3RDIA 2BVLA 2BX6A 3OSGA 1TL8A 6PAXA 4HX4A 3EQOA 2VNHA 2XOKA 2VC0A 3ZZUA 1T56A 4ITVA 3TBIA 5F0FA 1JTYA 3TP0A 3T51B 2ACJA 2QGGA 4DBQA 4HZFA 1VQ6I 3IH2A 3FK7A 2IGKA 1LVAA 4O6JA 1P4WA 4BH9A 2DA4A 4RDJA 4BYYA 4KT5C 3PFYA 4RB0A 1TW3A 3JAMK 3GFJA 1V5FA 1WJBA 4FHTA 4Z6YA 1IRGA 2X1EA 2K9LA 4A6EA 5FLXK 3L2UA 4X6AJ 5L3CA 4LIUA 3S93A 3JRBA 2JA6J 3W5VA 3J81k 2OBSA 2R7WA 5E1WA 1MDMA 1U0JA 5F4JA 2L2OA 5J35A 5K1YA 5J1UA 2M7BA 3DXJF 5M5XJ 1ZARA 2Z16A 2ZKZA 1CGPA 2GPJA 1XGSA 5IOZA 3WTTC 1U6GA 2DCEA 2FEZA 1K6OA 1FMVA 3G2BA 2B5OA 4DNRB 3OYIA 3ZN1A 3OYFA 4QSHA 4P96A 4ENMA 1T8IA 4OOXA 2IS4A 3KZZA 2JN9A 4QFMA 4OU0A 1IB4A 1EZGA 2QCOA 1D8KA 1MH3A 3M8JA 3PUFA 2XKOA 4WF2A 4EMSA 5EYRA 1EH7A 1U9NA 2STTA 3WBKA 1T6XA 3MEXA 1U8RA 3H9QA 1SFKA 1DU0A 1HC8A 2ZJQF 2X0KA 3PUNA 1PJ5A 3BG6A 2ZC2A 2ZNYA 3B6CA 2CO5A 4DQLA 1NJID 2QN6A 1WU8A 3CRZA 3F6OA 1FLIA 3TO6A 2O8KA 3GLLA 3ZCOA 1FPQA 2ZJRF 3RIRA 4BPRA 1QA6A 4MQ9F 1ITYA 2HXIA 1X3ZB 3F22A 3IRQA 1VQ5B 4II2A 1R5BA 2R7RA 3GQAA 5IYDJ 4X7CA 3RKWA 4G7ZF 4I7HA 2F48A 2ZFUA 3ZMZA 2XB0X 4EM0B 3VYTB 4HE5A 3HL2A 4D1QA 1S7AA 4M3BA 2KPMA 4W8TA 1E1QA 1YYVA 4CCJA 1YE9A 4XM3A 3A2KA 1HZEA 1YI2B 2LZJA 2XROA 4A12A 1ZQ3P 2BXZA 2IGOA 3ABKH 4OPOA 4HDUA 1AIRA 2CUEA 4LGWA 4P1WA 2DFHA 4MHGA 4IOCF 4NQWB 2OBRA 1YIOA 1OB0A 2O6WA 1HXDA 1WORA 1VQPB 3R0AA 2NNYA 1X3WB 5CQGA 2ZZFA 1D8TA 4ABZA 1HKQA 3TKYA 2GJPA 3OE7A 2GREA 3CMAB 4BACA 3I56I 3Q0WA 1UB9A 2JRTA 3CMYA 4XRSG 4HF0A 1Y8RB 4RM2A 4ZZLA 3W2VA 1ZKGA 4R1HA 1EFRA 4OOSA 4QUZA 2ZITA 4P6VF 3FHZA 2JA5J 5DN6A 2M8GX 3F8MA 5DTDA 1KTWA 3WTUC 1W7PB 2OF7A 3CTAA 3V8LA 1N0VC 2HCJB 4TMZA 2GJRA 2BSAA 4OJPA 1W36C 3BP8A 4MIMA 5IK2A 4NK6A 4NHJA 1LFUP 4CXFA 2L7FP 2JSPA 1GV2A 3BTIA 2VBUA 4GXOA 5BMZA 3ASPA 4L0YB 3CB4A 5L3FA 3CF5F 1LUJB 2R7FA 4IL6C 4BL0B 1J75A 2CF4A 4UAJA 4XLAA 1W5SA 3P9KA 2WBMA 4Q4ZF 2ESHA 4XLPF 1WJEA 1S72I 2QSHX 3HGGA 2HFHA 4M3GA 1VF7A 3G71I 4EM2A 2VNKA 1H0MA 1AIPA 1FIAA 4IJAA 4YAFA 2IP2A 4D7MA 1O3SA 1YIJB 2MD5A 1IB0A 2HQRA 4U0YA 5ICCA 3OOUA 2D3NA 1O3RA 2F1LA 4CCKA 3WTVC 1IXCA 2M5SA 3AGPA 3CCUB 2IOUG 4I76A 5F6FA 3RPUD 1BJKA 2F4OB 1ZGWA 2EFOA 4LK0F 4U49A 3KZIC 1KC8D 1F5TA 5K5QA 4UHTA 4D7NA 3KRGA 1TLHB 5LHIA 2CMPA 2P6TA 3SHFA 2R6HA 1UZCA 1FOYA 2GM4A 2X3HA 3OIQA 3S3OA 2M3AA 1K8FA 1Y8QB 3HSEA 1BN5A 1VQ9I 1SMTA 3WXMA 1LDJA 4G5GA 4P1VA 5IYWA 3WQZA 4RB1A 2ICWG 4YZ0A 3PQJA 2DTZA 2X1DA 3I5UA 3SQNA 2NRAC 1YTYA 1WJCA 2P8TA 2X6OA 3H3UA 2DN0A 3HB9A 4HV5A 4L9NA 4G94A 4NUBA 2L7ZA 1R4MB 3EUHC 5D8LB 1QUEA 1VHOA 2DYSH 2NVYJ 5IYQA 2NOJB 4F7ZA 3NQOA 4M3FA 1QA3A 1FX0A 4PFOA 3CC7B 2NSPA 2A3SA 3ZPPA 1ZR4A 4CUGA 1BX1A 2D9RA 3ABUA 3DKXA 4FX4A 1IN8A 2HTSA 2L5QA 4KN7X 5H20A 1SEUA 5BNGA 5AIPA 3OYEA 1Z6RA 4BHPA 1NHAA 3K1NA 4I0BA 4ESBA 4E7KA 2GLOA 3CJRB 1MBFA 2IRFG 1I1GA 4C3HJ 2WYRA 3OY9A 5IYNA 1SFUA 1E79A 4Z03A 3SYTA 1YS7A 3H35A 3GWZA 2FVGA 2VYQA 2ELHA 3H1CA 3G1LA 3D5SC 5FO1A 2E1MC 5DEQA 2MA3A 3Q3AA 1XDUA 3ZZ0A 1IN4A 1E2XA 2HDWA 5F27A 5D8KB 1OCTC 2DTRA 5IP7J 4G7XA 3B4NA 1OCZH 2Q8KA 2LYCA 1DDIA 1S5LC 3IH3A 3KETA 3JRDA 3AAFA 1UELB 1SFOJ 3JU4A 2OTJB 4N4NB 1SAUA 2NVTJ 2VBMA 2HYFA 5EZGA 1KQ9A 1I1SA 3PM1A 4K1XA 4U4BA 1NG6A 3GFMA 4P12A 4Z2YA 1W7PA 2K4BA 2OZUA 3T5XA 4DK0A 2DERA 1FC3A 3DBLB 2QBYB 2XZPA 2L9SA 4ON0A 5JR3A 3T1BA 3G73A 1H9TA 3T0YA 4EJVA 4UUSB 3ZP5A 4CGZA 2JA7J 1K83J 3QFTA 2R93J 3WG7H 3W6VA 3CLQA 1HCRA 1Y0NA 5HDGA 1OFEA 2BW3B 5LRSA 4OJ6A 1DGRM 2DQLA 3IC7A 4KJZA 3VB2A 3QWLA 4FXUA 3OFNA 1JUPA 1GVHA 2HLDA 3ASNH 1KA8A 2JZYA 5HS7A 2FQ3A 1IJWC 1KD1D 1YJNI 3S1QJ 2DFEA 3OL4A 3HAGA 1RMGA 3OWTA 2BV6A 4PJ0C 3SUCA 1XGNA 4M73A 2UZKA 2DCUA 1OFDA 2M4GA 3NARA 4Z4TA 5J1YA 2IAIA 3AG3H 3CCRB 4UVAA 2LKSA 2XAJA 3T8TA 2BY3A 2ZBKA 1YX2A 3OW7A 4UXNA 1YITB 2VT2A 1KQ0A 3VYUB 3OS1A 2MSYA 2V1XA 1JJ6C 1JHFA 1TUIA 2NVUB 2K9SA 2D45A 1G3YA 4HQMA 5TV2A 3K4CA 2AHOA 1E3XA 4EH1A 3HJEA 1H88C 1HKTA 2UUZA 1G4DA 1MW7A 3OS2A 1B1BA 3SEZA 4BJ6C 1L3LA 5ERIA 1NH3A 4IO9F 4YCQA 2LP0A 1OKRA 4ZV4A 1TQIA 1XDSA 4E7LA 1JKOC 2EBIA 1FNDA 3T9GA 4Q48A 1R5GA 3BJOA 5D4SA 2XSDC 3JRCA 2VPLA 1PJ7A 2ZZQA 2VN2A 3Q38A 1I8DA 2X6YA 4XKCA 2PJRB 3SDGA 3CCVI 4R71A 4G8XA 2HDDA 1MH4A 4HSTA 4DOZA 2HTJA 2NT6A 2XAGA 3FDYA 3QP5A 3OYNA 4ZTJA 1LQ1A 1KU7A 4QVAA 2RQQA 3PIPF 3QOPA 2D74A 3OJXA 1HF2A 1QQ1A 3Q3SA 2M87A 3QFRA 4WX9A 5TISC 1H8EA 3OYKA 1WXRA 1JHHA 4F7DA 3CCEI 1VF9A 4OJLA 1OCRH 2AS5F 3LSHA 2JVGA 4Q5SF 1K61A 3WNDA 3L7WA 2GQQA 1H8HA 3BG9A 1Y1VJ 2XGEA 3V7CA 2R92J 3PUMA 3MKLA 4BAYA 2HOEA 4LBZA 1UHWA 1AA7A 4IVNA 4V2GA 2WTEA 1N0UA 4URRA 3H9JA 4ZZDA 5JMCB 4CCMA 3JQPA 2HDCA 2RC6A 4M72A 3V7RA 3WYAA 4DW6A 2K9QA 4AVZA 4YFNF 3ISPA 2E1RA 2R7OA 3O6BB 1VQMB 3BDDA 2F4NA 3ABTA 5EGOA 2QENA 3JCUC 4N9IA 1LDDA 4AD9A 2LREA 5JVGF 3BZCA 3S2DJ 1WPKA 3WHCA 5KK1A 2BW3A 2XPWA 3DTEA 2J7KA 2NOGA 3K7AJ 2EB7A 3GSIA 4II3A 1IRXA 3W2GA 5J8CA 3UR3C 1R1UA 4L9TA 5M3MJ 4OOVA 2CUZA 4C2UA 4PDKA 3GQ8A 2F6CA 4X8IA 4WCGA 4MXNA 1LLWA 3JURA 1NK2P 1OISA 3W5HA 2QZ8A 2LY1A 1UD6A 2QKLB 1XGOA 1Z1DA 4KISA 1OYIA 2QQBA 3GO5A 2WAEA 1J0RA 4N3GA 3LSKA 1OCCH 1OHHA 3GQ7A 5A88A 1YW7A 2K3PA 3CC4I 4OJ5A 2E35A 4AIKA 2BVMA 1WI9A 2ZJPF 1O8IA 3DU5A 4B3GA 1FP2A 3E97A 1VQLI 2WPDA 2WAQA 4DIQA 1FZPB 2CU7A 2WY7Q 1V0EA 1STZA 3KEYA 4HEA2 2CQNA 2WA0A 1GVDA 4JQFA 1RETA 1E43A 1R1TA 2AXLA 2A6HF 2PMUA 2Z99A 3BY1A 3DPUA 1MBJA 2A6EF 3O8HA 2R7QA 5JFRA 5C4JJ 1OGIA 1KQ8A 4ENJA 4M0LA 4G6DA 4IPAA 2IS6A 1D5YA 3H94A 2HQAA 3QU3A 4B8XA 4Z4UA 4L18B 4OP7A 2FMYA 1POGA 2XVCA 3QOEA 2C4TA 4BKXA 1O8JA 4LBVA 3TEDA 1XSVA 5IYPA 4NBSA 4U88A 1Y6IA 2PJPA 3OYDA 1ZREA 5TRDA 2R7TA 4JYKA 4OWRB 1E64A 1OB2A 2XTWA 1BR4A 2FBIA 2O9LA 3A8KA 5FFXA 2GIVA 3DU1X 3EQLF 2RAEA 3CW2A 2FQ4A 1K4SA 3HOZJ 3PA2A 1IG7A 2QA4B 1GV5A 3CUQA 4XLEA 3DKYA 3L2WA 4HG2A 3K1PA 1XTAA 5FLVA 2Y75A 2BMWA 3WY9A 3ZBUA 1K9MD 4RAZA 4J0QA 3ASOH 2Z2SB 2VBTA 2M5WA 2YX4A 1TYWA 3CPXA 2WZPP 4PJJA 3H3VK 1I27A 1VQOI 2LOOA 5DDGA 3CC2I 4HBLA 2IGNA 1T33A 2AQFA 4G7HF 1ETOA 1C0WA 2J5OA 2VKEA 3E1SA 4H0EA 4UUTA 4X0CA 3FZVA 2DODA 5M3FJ 4P3IA 3BH7B 1WPCA 2DDAA 3LL7A 5EEHA 2GA1A 3TMOA 4UV9A 3K4KA 2DFIA 3B02A 1IDZA 4XD7A 1U3EM 4AC9A 2XRLA 1JTAA 4EEFG 3P9CA 2E36A 2LC2A 1MABA 1M1EB 4PGOA 4RBOA 1PLUA 4KH3A 3WGHA 2DA6A 2V26A 2NVXJ 4FK8A 3K2AA 1ENHA 5C3EJ 2OD5A 1RI7A 4YAUA 1R5NA 4IX7A 2O5RA 1PUEE 1Q9SA 4I84A 2LR8A 2VBXA 3W6KB 4HPQA 1MJ9A 2ETHA 3HPGA 5KNLA 2WWYA 5E79C 1R36A 2ZL6A 4TKOB 4Y9UA 2DXIA 2EFGA 1E17A 3K70C 4PFPA 4I2OA 2MGQA 4KKSA 3S15J 1QO0D 2WV1A 3ZN0A 1BBYA 4I09A 3GBGA 2NXNB 3RKYA 2MBFA 4C3IJ 3IH4A 1L0OC 5J4VA 5C1CA 2M0CA 1VQ8I 4IOAF 2EZIA 4RDKA 3A0HC 4WXCA 2INUA 1SKYB 3R6JA 4CYDA 2NV4A 4A0YA 1MMNA 5E20A 4CCOA 4CZZA 1FOWA 3SJMA 1LE8A 3J81K 3KZYA 2XAUA 4IEJA 1AHDP 5JBQA 3IWFA 2LY9A 1N8RD 3E5UA 2RREA 2XPUA 2B9SA 1MSFC 1QGYA 1LKXA 1V54H 2P7VB 3CQZJ 1VFCA 1U78A 1A36A 1VQKI 2E1CA 2O6GE 5HZBA 4C9YA 1ZG1A 1XMKA 3ML6A 2L7MP 4Y15A 2GZWA 1S7EA 3WGIA 1CF7B 4RPBA 4TMWA 4Z4SA 4W8RA 3VO1A 3F9KA 2O0WA 4U7DA 1FSHA 3CCSI 1J9ZA 3DP7A 1GHCA 1O3QA 2WAQN 1MGTA 1QVGB 3KYDB 3RJPA 4DGWB 2KIQA 4F92B 3HKZA 2E7WA 4DJAA 3Q0VA 2GJKA 1OYWA 4L5EA 3JSOA 2LK2A 1V0FA 3BLYA 1AMOA 3MQ0A 2Y9YA 5CVRA 2BY1A 4ZDOA 1MBEA 5CVJA 3AVYA 3E6MA 3PJRA 2DYIA 3QSYA 1MNMC 3EPZA 1UMKA 1OFCX 2DBBA 2RNJA 3W3CA 1IRZA 3MKYB 1FNNA 1I3AA 4V19K 2G7UA 1I18A 4BXUA 4HDVA 2LBFB 1VNDA 1MBHA 4Y7CA 4JX4A 2QVOA 2H6CA 5EJCA 2IGMA 4BXXJ 1PJ6A 1CNFA 4WZTA 5A8AA 2OQRA 3ZIAA 1OGMX 1FWZA 3C18A 2LKXA 2FNPA 2BM6A 1CQTA 2DO7A 4RGRA 3ZRGA 4M3DA 5JI6A 1FTTA 3GTGJ 2E19A 1YHQB 4H9GA 3KE2A 3CCEB 3TDZC 3JQRA 2IA0A 3CD6I 2GK7A 2EV5A 4RMNA 3NAUA 1DP3A 2M8EA 2DT7B 2LMDA 1ETYA 4XNFA 4YG2F 3J7AO 1E3OC 1R7JA 1T0FA 3KP2A 4G12A 3W6JB 4P6YA 2DIEA 3HRTA 3AL0B 3MZYA 5GP9A 5DCMB 1YS6A 1Q86D 2O04A 1CQXA 2BF4A 3FXJA 5L3DA 2VQHA 3SEQA 3OL3A 1QRYA 2JA8J 1KQSB 5HOOA 2OBTA 2I5UA 2XAHA 3VNVA 4QPQA 3J80Z 2KHMA 2XHKA 4RD6A 2MW8A 1R5ID 5CVVA 1ZH5A 3CCLB 3DKWA 5KW9A 4P3YA 5HDNA 1W5TA 5FD6A 1I6HJ 5CVUA 3S1NJ 1NK3P 3SJPA 2OC6A 4D0PA 3GQBA 2Z6BD 2OTLB 2OA4A 3U21A 2KRHA 4UVCA 4XK4A 1Y0UA 2ZXWH 1KONA 2KT0A 2NYXA 2CW8A 3F3XA 1FIPA 3LA3A 4RA2A 3ROUA 4BJTA 2M0MA 3O8GA 2BM1A 1HA8A 2VFPA 2Z5UA 1VQLB 2A69F 2DMNA 2X4HA 3ZQQA 2E5ZA 5HS8A 2VFMA 3RKXA 1TZLA 3QFSA 4CO8A 3PENA 1QRBA 1P7IA 1ZTRA 2JK3A 2CQXA 3RYRA 3HOSA 4DYRA 5B1AH 5IYRA 1U5TB 2WV0A 3HXLA 4CCNA 4BBSJ 3L2RA 1YJWB 1VLYA 2PLFA 3G4SB 3I3LA 5FJ8J 1P92A 3OAAA 1I3QJ 4P9UA 3HDDA 2BM7A 4AF6A 1EP3B 1VJSA 1DABA 3A4CA 2XGCA 4PGGA 1WZ2A 1N05A 1SVLA 3ASTA 3MD2A 4U0VA 4C2TA 2CUFA 2RC4A 4WXHA 2ZMEA 4YIRX 3OMYA 4RCYA 4F52A 3CPWB 4IHYA 4GQNA 3PIOF 1U8BA 3H5NA 5IT3A 1MMDA 5B66C 4M2LA 3WG9A 2DMPA 2QM3A 5ILUA 3SXYA 1R1VA 2DA1A 1F1ZA 2LBFA 5GAGJ 3JQQA 1GDTA 1QHHD 2HOTA 3FKSA 3W2HA 1ZG5A 5GADJ 1T08B 4BXFA 3E5XA 2PECA 4RAGA 1T6ZA 4XR6A 1IZ1A 2M9HA 5EDNA 5J3LA 3EUKL 1JA0A 1G7RA 2NT9A 4BEHA 3ZQGA 3N05A 4W1UA 2IA2A 3FF5A 3H5AA 5FKKA 2PLYA 3LQ6A 4UZUA 2M1BA 3L9FA 3AGQA 1O7LA 3HKZN 5LEKA 2E2JJ 1RRJA 2EFQA 4QHYA 4HRIA 2HPMA 4IF4A 5DCMA 3Q9VA 1SANA 4LMYA 1PDNC 1HQCA 3FMQA 1Z6TA 3S1MJ 4M3EA 1ZN2A 1IJFA 4BHBA 4RLFA 1TWAJ 2DA3A 3V76A 5D6EA 3T53B 2H8WA 4L9VA 5K7HA 2W85A 3KX2A 4NBQA 3BC9A 3LSGA 4P26A 2BSPA 2H27A 2A05A 1OR7C 3E0JB 4AU7A 4I02A 3G6EI 2JA2A 2Q6LA 1Y39A 2AO9A 5LFAA 2PE3A 2Y48A 3RSNA 4CICA 2YWHA 4M9SA 2FNAA 4G6QA 2VE8A 2KIUA 3MN2A 3EQNA 2PX9A 1X4OA 4DYQA 1O8EA 1FYMA 3BR6A 3SY2A 3I1FA 1K7AA 3BR1A 1CNEA 2Q0OA 1DDNA 3GTKJ 5HLHA 3A01B 2A68F 1DGWY 2VBVA 4EJWA 2M2EA 2VI6A 2L9RA 2NS7A 2PN6A 4NNJA 4HNTA 1N78A 3M7GA 5J8FA 1JJ2B 2CW5A 1CLWA 4LD5A 4CYCB 3W2EA 4LG3A 4ACAA 4FE4A 3Q6QA 1U5TA 1BPLA 4XQFA 1AWCA 5D5WB 2XZLA 4A3BJ 3U6BA 5LD2C 3VEPA 3OW2B 5A2QZ 1R4NB 2G7HA 2PFBA 3A0BC 2QEXI 3F0CA 1U2RA 3IV5A 3A3GA 2YX7A 1IO2A 4NCNA 4FWTA 2K9MA 2KZVA 3I55B 1FSEA 2GOMA 2VJ4A 3RPUA 1DBOA 1ZRDA 5FKNA 5JVTA 3QAHA 2V31A 4A0ZA 4A3EJ 2Y0SA 5IT9Z 2HZTA 4RD1A 1IW7F 4TN1A 1UAAA 3LYCA 3DBRB 1REPC 2HNHA 2IPQX 3ONUA 2E7XA 4B4DA 3OYLA 4BY1J 2FX3A 2FSWA 3QP6A 1M90D 4PC2A 4Y13A 1W1WE 2EZKA 1OB5A 3R6KA 3QYFA 5LLQA 2EFPA 2LNBA 3KP3A 1YJ9I 1N08A 1RZ4A 4PUSA 3LQRA 4XSZF 3V7SA 3GYHX 2ZBUA 3JRHA 2VASA 1LFPA 1EFCA 5BSXA 3TOBA 1GAQA 1WMRA 1ZR2A 1YOVB 4BE0A 5KHDA 3LJYA 1N07A 2Q1ZB 3VPRA 3M9AA 5E8IA 2E1NA 3FXMA 1WCMJ 2D1HA 1FOKA 2R7VA 4QV2A 2QYUA 2Z3YA 4OAYA 2BE5F 1L1IA 2J5PA 4B44A 2PIAA 4BQQA 1MMAA 1YW9A 3JTHA 1TYUA 3WE2A 1RUNA 2HR3A 1G3TA 2I8DA 2WJYA 1IDJA 1QCXA 4ASUA 5DYMA 1QPIA 2L01A 3SZEA 3I9V2 1W35A 2KRCA 1BA5A 2OCCH 3OP1A 3BH4A 3E6CC 2EA4A 3A1YA 4GYIA 1H9GA 4FTHA 1IUYA 3ZR8X 1JE8A 2CG4A 1K79A 2VT3A 5K7ZA 3QFCA 1Q7YD 2ID3A 3HOUJ 2KJBA 2V6CA 4KIGA 4JBAA 4BS9A 5FLXZ 3BQJA 4BHCA 1XSXA 1MZBA 2V7UA 2CQKA 1O8MA 1LEBA 3S3MA 1G3SA 4Z1MA 3PO2J 2F43A 3BR3A 4IKFA 3UNGC 2IEKA 1UHSA 3BY2A 3G3ZA 1W87A 4EW9A 5CLSA 2CQ7A 2M7AA 3IHUA 2EV6A 1J2XA 1Z9CA 1EH6A 2VNJA 4ZYGA 2LG4A 3A01A 1S9HA 2FJ1A 3CO6C 2BN4A 5J1RA 5ICEA 1GXPA 2BGJA 3W2IA 2OU2A 3PO3J 4RM0A 1MJAA 3P27A 4CYCA 3MKWB 3A3BA 2QUFA 2DLLA 3IWZA 2JDIA 5THXA 1KU2A 3S1RJ 2WR8A 3LSMA 1UG0A 3W2WA 2L54A 2CK3A 3CP2A 3NB2A 4MEXF 3RTRA 2ADUA 1A6QA 2Z33A 4IZZA 2HOAA 1SAXA 4HLYA 1XQBA 5EG0A 5CVIA 1EP2B 2ZJ2A 4JRAC 2DMTA 1S0UA 1O4XA 3FMRA 1B4AA 1AKHB 2UXXA 4PJLA 5H2FC 4ZTFA 2K4JA 1D1NA 3KP6A 3BTLA 2XC7A 2XB5A 1YX3A 5F08A 1TC3C 3C7JA 3W2FA 4XONA 4A5MA 2QDXA 1ONVA 1TTYA 3WU0A 2ISZA 1EWYA 2QY1A 3GLXA 1RKWA 5ICFA 2IQ7A 1TQMA 4BGDA 3AKZA 2O0VA 3C3WA 5D5VB 1TNTA 2XF5A 3E6BA 4Y17A 1E3ZA 1TSPA 2B7BA 2W7ZA 4E7SA 4RAYA 2V4JC 2RVCA 1G8XA 1HSTA 4IHTA 2V79A 3FM3A 5E1XA 2EZLA 3H3ZA 4MQVA 2JQ7A 1DQUA 2VBKA 4I98B 1BHEA 3LQEA 2CV1A 2XZOA 2BM0A 3S2HJ 5IYCJ 1VQNB 2W24A 3SZTA 4ZYHA 1P4MA 2LSOA 2LF8A 5EGOB 1JT0A 3AVWA 2HGCA 1A31A 1F43A 4DNTB 2BY0A 1ZM4A 2Y0SN 4A3GJ 4DYCA 1BM9A 2JTVA 1FT9A 3FKIJ 5J47A 1BI3A 5F64A 1LEAA 3ABLH 3TO9A 3OR2C 1YFHA 4P5OA 3M8EA 2DK8A 2H09A 4XMYA 3MFKA 3B82A 1TYXA 4RD2A 3CCJI 3LA2A 1BN8A 4WWCA 1WJ5A 2K3FA 4BNCA 3MMPA 4B09A 2HZDA 2BXYA 1J09A 2EFNA 3JRGA 1VQ6B 4YXWA 4QPOA 1BIAA 2A5WA 2FU4A 3C2HA 3LMMA 4CH7A 2XTXA 3TDUC 4J01A 2F5CA 3GZNB 2VJJA 3DV8A 4CZCA 3WTSC 3CESA 4TMXA 3CJQB 4ZYAA 2JJ7A 1B72A 3WHBA 1I50J 2HKXA 4FISA 2A07F 2X0LA 3VSVA 3GTPJ 2R7ZJ 1X19A 2QYOA 3TW7A 1BC8C 2HEOA 3K4JA 3JR9A 4KN4X 2XNDA 2YWGA 4LJZF 4X05A 3FISA 1K5CA 3LNQA 2MYSA 2W1OA 1VQ4I 1B2RA 1EJ9A 3OSFA 2LFBA 1FNBA 2XF7A 3GTMJ 2EIKH 1QFJA 2DETA 3K10A 2JJ2A 1IC8A 3E1YE 3OYGA 5BPIA 3BT9A 5HS9A 4RCZA 2CUJA 1ERDA 4B48A 3MWMA 5FO0A 2UXNA 3HPHA 5J40A 3GVJA 1P9QC 3DFGA 1GQ8A 3Q5FA 1W0KA 4OPVA 4EJUA 4BDZA 1TT5B 2LRDA 1ZG3A 3HSRA 1P6RA 4ENKA 1NB0A 4A2UA 3CF2A 3BPXA 2YU9J 3WODF 2VNIA 1EFUA 2VC1A 5GAHJ 4IRHA 4CQJA 4AIDA 1B9NA 2CSOA 3CUQB 1AKHA 1IJEA 3PL8A 1ELOA 2CBXA 3LQQA 2W4SA 1MNDA 3HRMA 4P25A 2RN7A 3BY6A 2YWEA 3BC8A 4ZC3A 2HVSA 3JRIA 3DEEA 1Y56A 2QQ8A 1D0XA 1FYKA 1E0EA 2RV8A 2ZTGA 3GUDA 5TR9A 1WJDA 4UY8I 3I58A 1X3UA 3TOAA 4W97A 2K86A 3PSIA 3HGYA 4LC0A 2F5DA 5K7FA 1T98A 4ZCLA 4OINF 3T56B 4Z4ZA 4Z4WA 3BR2A 4L5IA 1K4TA 2V7WA 1ZYRF 1WSUA 3M1EA 3CJNA 1VQ7I 1ETKA 4Z4YA 3ZC3A 2VFOA 1F9NA 3K4NA 3VSKA 3CMEI 3WU2C 1JKRC 1QBJA 2HWVA 5EMNA 2QX3A 2A5YB 3GFLA 1K6YA 4PSXA 3BR5A 3QRFF 3HOTA 4QVJA 3AVUA 4X7FA 1FMWA 4GO1A 2V7TA 2O7OA 3CJTB 1OCOH 1QZEA 2OJED 3EUAA 4LLLA 1XSDA 3DWLE 1MBGA 3TO7A 4E0FA 1Z05A 3I56B 3I53A 2KLOA 4ZDPA 4DZJA 2EIMH 2OK7A 3AG4H 1S7OA 1XD7A 1PUFB 5CDFA 1Z91A 1TYVA 4Z4VA 3H5RA 4BE2A 4GYGA 2QSGX 2ID6A 4NC6A 2ODLA 2V7FA 2JUGA 3ONQA 5KAIC 3KP7A 3EUHA 3S8PA 1MMSA 2R7DA 1SKQA 4AIJA 5E6TA 3NAWA 2L4MA 1K73D 2R7UA 5D4RA 4MLOA 4RDUA 2P7CB 2X48A 3E5QA 3QPHA 4MGRA 3I0TA 4XSXF 3MCZA 3G05A 1QRCA 2WY8Q 2GAUA 3ZQ7A 2KKOA 4E4HA 2PI0A 3CCMI 1Z21A 4LB5A 3HOYJ 2DOGA 1MIJA 2JWTA 3VODA 5M5WJ 3E20A 5B6IA 1EH8A 1XC5A 1YRNB 3QPLA 1W36D 1BW5A 4M74A 5H6RA 2ECCA 4MFEA 1S72B 4IQ4A 3K1MA 5J3OA 3G71B 1Y0RA 5GAEJ 1LE8B 1WP6A 2Y2ZA 2ZL7A 2V4DA 2KP6A 2O3FA 1BX0A 1Y0YA 4DQKA 2BOLA 4KIFA 2DPUA 1P2FA 2JIZA 4OIOF 1RWRA 2VBSA 2WB1N 5BS6A 2C5HA 2HU9A 3I59A 3FKJA 1YLFA 3DBHB 1Q81D 2G0EA 2BY2A 3CDHA 4IXAA 2ZZGA 3OR1C 3GVKA 4ZGNB 1RKTA 2KDOA 4RDLA 2R5ZB 3ASQA 4ROXA 3M07A 2V9PA 1VQ9B 4BQNA 2DK5A 2FOKA 2HQ5A 1JI8A 4A5NA 4Y33A 2KMUA 4C2MJ 2V1NA 3H9NA 4I99C 1RIOH 2VKHA 2CRVA 2XGJA 2F2EA 1NBMA 4LK1F 2LLKA 1X58A 5J4YA 4LLNA 1KK0A 5JLXA 3Q9SA 3JTGA 1U9OA 2CH0A 1LJ9A 1LDKB 1BJAA 4XKVA 4FE7A 3BWGA 4PMHA 1IAWA 4K2EA 1G7SA 3TQNA 2OBPA 1KMHA 2C6YA 1GUUA 3AG1H 1W34A 3CCQI 2ZO4A 4MEYF 1QA2A 1FRNA 1Q1HA 3KLNA 5E17F 4V02C 1QZZA 3LAJA 4OPWA 2K9NA 4I6ZA 3K4LA 3H0DA 1FOXA 4A3MJ 2WC2A 3HOXJ 4GDFA 2BPOA 2RKHA 2M45A 2R3SA 2QF7A 1WFXA 2EA2A 3TL4X 4RPDA 4YRVA 1BW6A 4S0HB 2NVQJ 1J5YA 4KIBA 1PUFA 2DU9A 4XOTA 1T95A 3ZOBA 4A3DJ 2MH2A 2D5VA 5F04A 3M3YJ 1K8AD 3QQAA 3VDXA 4YDTA 5DS9A 2RDPA 2VXZA 4RJLA 3ZSCA 4A3KJ 5C4XJ 3HG9A 4P22A 4ENNA 2CV0A 5IP6A 4A3FJ 1T6YA 1LVKA 1S6LA 3VSTA 2XKPA 5KCMA 2UVFA 2ME0A 5BQTA 4BDYA 1IN5A 1R58A 1SFXA 2EWNA 3BH6B 4NK8A 4BJ5C 4CA0A 2KVOA 4TSFA 3LMWA 1ZAOA 2ZBVA 2VB6A 5CJ9A 4RB2C 1YRNA 4NB5A 1QGZA 3OS0A 4GFBA 4NDLA 1YJNB 2A61A 3SYJA 3OYMA 1USTA 4YAOA 2TRTA 1K78B 4X7EA 1BL0A 2H1LA 3QU6A 5FROA 1BR2A 2QGUA 4O5VA 2BBYA 4IHVA 2GQFA 1CZFA 1BI1A 1UD2A 1ORKA 2ZXHA 2HXOA 2BHYA 3MVPA 3R4KA 1WJAA 2DEUA 1V5GA 3OOPA 1X2NA 3RQ4A 3U9GA 3BTCA 4MFDA 4WK8F 3S14J 2EILH 2IXSA 5F1JA 3COAC 2X8KA 1X0CA 5J6XA 4FCYA 3ECOA 3ZQHA 4Z05A 2BV3A 3ULQB 1BJZA 1VQ5I 1VLOA 3PSSA 1UJ8A 1V55H 2ZL5A 4YEJA 4B3XA 1T6SA 2R5ZA 1TQPA 2V9KA 3QPTA 2CFXA 3T8RA 3BG5A 4UZEA 3HEFA 3ZZTA 3AL0C 2DPDA 4PJNA 2ZMEB 2ZXIA 2YPRA 1S3JA 2W7NA 4HE6A 3S2WA 5E8GA 1YI2I 2JPCA 3FHNA 3V8JA 3OYHA 1O88A 4PSWA 1R49A 1V5VA 3GZ5A 3ASSA 2FXAA 3D5LA 1I7PA 2R5YB 3FXOA 1XB4A 3CCVB 1VQPI 2QMUA 3B73A 3GRHA 2NS0A 4KYWA 3ERMA 2QTZA 3FJOA 2J8IA 3V7AA 3SLDA 3Q0UA 2IW5A 1LNWA 2DA2A 1BMFA 2L0KA 1ZM3A 5HKKA 3CMAI 2X3UA 5JLVC 5AMVA 2EIJH 4ACBA 1E1RA 3KEOA 3LSPA 1BLIA 1XS9A 2P3MA 3RI4A 4DZPA 1QUFA 4BEHB 1A8PA 3FBIB 4MO7A 1PJRA 1IRFA 2W6IA 5L3GA 2FE3A 4H4KC 2XASA 3HHHA 2HKOA 3N90A 2WAFA 1TVCA 2W6JA 3LA7A 1QVTA 3W2AA 4RM3A 4HQEA 4Q7JB 4PCQA 4PGHA 4CSWA 2PMHA 1VTNC 1U5TC 2C77A 4A69C 5JHFA 3HTSB 4FX0A 4YALA 1XG2A 4J19A 1OCPA 4A3JJ 4RLZA 1X1BA 1XCVA 3RQIA 4A3LJ 1TWCJ 3DTKA 3LFKA 3QODA 5FB2A 2XF6A 3BR0A 3IKTA 2HOSA 3LSIA 2Q2EA 1NG7A 3QPSA 1B8IA 1OYYA 3BQZA 4HAMA 2VUMJ 2JJ1A 3GQ9A 2PYHA 2X6XA 1A35A 2RGVA 3SFZA 2NZMA 4LIVA 2ELKA 3PETA 1KU3A 3HBLA 4FN5A 3Q39A 2BM5A 5DSZA 3ELKA 3CCUI 2DOAA 2GXBA 1RNLA 1OQYA 4QIWN 3DQVC 4IRIA 1RQPA 4C0SA 1P4XA 1K78A 2VKVA 3P26A 4C3JJ 3NE5B 2L9VA 1WH7A 5IY5H 1W0TA 3CC4B 5M5YJ 4O3MA 1G3WA 1IV6A 2M4KA 3FMSA 3H9GA 2MFZA 3FM5A 4V2FA 4OAZA 4YELA 1DPRA 3FXUA 1HF0A 1KYWA 2KQRA 5HNFA 2LDUA 2IA1A 3L2CA 2VE9A 1NRKA 3E3VA 3B8YA 3HOVJ 4G6IA 1IHMA 2CC2A 1ZGJA 4YHBA 1UD3A 4E7IA 1HW5A 1JRGA 1KQ5A 2XGDA 1U2WA 1OOCA 3CC7I 1S4MA 1R6RA 4P55A 5A2QK 2ISYA 2STWA 1JT6A 2CJJA 2BYVE 4MNUA 4RLQA 1UD8A 4KKUA 1TLLA 3HSFA 4HW0A 1NHCA 4XN0A 2CW0F 3AVTA 4L0ZB 1ZUNB 5IT9K 5KSWB 2B7EA 3FXLA 4LBWA 3OIPA 4XBFA 1H42A 1KCCA 1YX5A 4XRSA 4WXDA 1SD7A 4W8QA 2C5BA 3O3KA 2X9DA 2O1DA 2XTYA 3GEZA 3H09A 2R5YA 1HSJA 1ZM2A 3D1NI 1FEXA 2CYYA 3DEUA 1WJFA 5HNHA 3NWTA 1H85A 1VZ0A 2W82A 4FT8A 1G7CA 2ESNA 4HNUA 3WNBA 3KIOA 4KT6A 3AVVA 4HOBA 1E3HA 2VXDA 2MD0A 2ZNZA 2INVA 5H59A 1GXQA 2OTJI 3BTJA 1VQOB 2VJ5A 4EJTA 1IGNA 3MKZA 3CC2B 2V9VA 1QNTA 5FGMA 1A5JA 1PP8F 5AONA 5BOXA 1TWFJ 3DCFA 2EZHA 1BI2A 3L00A 5HDKA 1H89C 2R7XA 3H0GJ 4MYUA 1SD5A 1APLC 1QGAA 1NTCA 3ZUGA 1TP4A 2MC4A 1TBXA 2XPVA 4KMFA 2JT1A 2EIXA 1HG8A 2BM4A 1X1AA 2FA5A 5LGNA 1D1CA 4E7ZA 1YQAA 3SDBA 3PA1A 1UCRA 3EYYA 5EF6A 1S8NA 2EK5A 5KAFC 2K5CA 3ZMSA 5HZAA 3FIWA 3LVBA 2O17A 3ZXSA
chains in the Genus database with same CATH topology
4MXNA 1YX3A 3JURA 1OFLA 4XONA 4AYBA 2LY1A 1UD6A 2QKLB 4U7BA 2E5NA 4KISA 2QKMB 2WAEA 3GQ7A 3LSKA 1OHHA 2HPIA 2K3PA 2QY1A 4OJ5A 2IQ7A 4XKBA 2BVMA 4BGDA 3VR6A 3PNYA 4XLCA 4E7JA 3DU5A 2ZTNA 4B3GA 1O8IA 3AKZA 2O0VA 4OZZA 4PJMA 3S32A 2WPDA 2XF5A 1E3ZA 4E7SA 2WAQA 4DIQA 2V4JC 5HVQC 2CFOA 2WY7Q 3QYBA 4HEA2 3KEYA 1V0EA 2WA0A 1D0YA 1G8XA 4JQFA 2LY2A 2VLAA 4LITA 1N77A 1E43A 3DPUA 1DQUA 2VKDA 2VBKA 4GRIA 3K70D 3SZGA 1BHEA 2R7QA 4XL9A 2CV1A 3CMMA 2IS6A 3PNTA 3H94A 2HQAA 2OV7A 4U87A 1KCDA 1T5EA 3IAM2 3VSLA 4TT3A 3QOEA 5C1EA 4DNTB 1O8JA 3UW0A 3OEHA 1Y6IA 3OYDA 4YZQA 2R7TA 4OWRB 3OR2C 2L7KA 1BR4A 4P5OA 4XMYA 2LH9A 5FRNA 4YZAA 1BN8A 2MABA 2X53S 1WJ5A 2AQEA 2HZDA 1COWA 1J09A 4XLEA 3DKYA 4YXWA 4QPOA 1O8HA 2A5WA 3C2HA 3LMMA 3QYEA 4HG2A 4CH7A 3L2WA 1RU4A 4J01A 1O8GA 4CZCA 2VJJA 3CESA 3CJQB 4ZYAA 2VQLA 2Z2SB 4PJJA 2PMZA 1PYVA 1GLNA 2UV1A 3VSVA 2LOOA 3L2VA 1X19A 3AFHA 1Z3XA 2X1CA 2XNDA 3K4JA 2ZZEA 1K5CA 2IGNA 2QE7A 2AQFA 2MYSA 2W1OA 2VBEA 4HSRA 2VIXA 1H80A 3K6GA 3E1SA 1QJVA 1EE6A 3BCFA 2XF7A 1WPCA 3LL7A 3TMOA 3K10A 2JJ2A 3VMWA 2R9VA 4XORA 3K4KA 2V7QA 3OYGA 4XD7A 4D9JA 3WWGA 1JTAA 4F93B 4W8SA 3VMVA 2CUJA 1ERDA 4B48A 3IAS2 3J7AY 2LC2A 1MABA 2WJVA 2PYGA 3HPHA 3GVJA 2QXZA 1P9QC 4E7HA 1PLUA 1GQ8A 1W0KA 4BDZA 1PXZA 2LRDA 3NWSA 2V26A 1TT0A 3CF2A 2XSJC 1X1CA 2DJIA 3DPLC 1DBGA 3OEEA 3OPOA 3PL8A 4IX7A 3GVLA 2O5RA 2F1MA 2W4SA 1MNDA 4BE1A 1O8LA 4I84A 2D3LA 3BC8A 4HPQA 4ZC3A 2HVSA 2WADA 3HPGA 5KNLA 4TKOB 3DDYA 3DEEA 2DXIA 3L2QA 1Y56A 3K70C 1D0XA 4PFPA 1O8DA 1HVXA 4KKSA 1E0EA 2ZTGA 1WJDA 2ZSIB 2CV2A 3GBGA 1K28D 4Y4RA 3PSIA 3OYAA 3BCAA 3V42A 1G59A 3MMYB 3T56B 5C1CA 2INUA 4OZYA 3FBNB 4F55A 4XKWA 2W00A 3K4NA 5CPRB 3VSKA 1SKYB 2WZPP 2QX3A 1UD5A 1OLTA 1MMNA 4CCOA 4HIZA 1K6YA 2X85A 4PSXA 2XAUA 3ZPNA 2F4IA 1FMWA 1ZELA 4C2UA 2BVLA 3EUAA 3DWLE 2RREA 4E0FA 3EQOA 1LKXA 1MNEA 4ZDPA 2KLOA 3OYBA 2XOKA 4C9YA 5CDFA 4ITVA 3TBIA 5CKTA 3T51B 3H5RA 4DBQA 4BE2A 4W8RA 4CCLA 2IGKA 3F9KA 2ODLA 2O0WA 2V7FA 2JUGA 3ONQA 3PFYA 3S8PA 1V5FA 1WJBA 2X1EA 2K9LA 4B43A 3L2UA 2VL8A 4DGWB 2R7UA 4MLOA 4LIUA 4F92B 3S93A 3HKZA 4DJAA 2GJKA 4HWVA 1V0FA 3BLYA 2R7WA 3G05A 4BQOA 1U0JA 2WY8Q 4XOPA 4E4HA 2L2OA 3FY3A 3GQ8A 4ZDOA 1Z21A 2M7BA 1WTHD 2OUMA 2Z16A 3PJRA 3EPZA 1W36D 3K4MA 3W3CA 2F5VA 2DCEA 3MKYB 5CQEA 4IQ4A 1FMVA 3G2BA 4DNRB 1I18A 3OYIA 1WP6A 3OYFA 4XLHA 1EA3A 2LBFB 2IS4A 3BG7A 2V4DA 1O8KA 2KP6A 1IB4A 1BR1A 2IGMA 3BCBA 3ZIAA 1Z7LA 1OGMX 2CS3A 1W9XA 1IDKA 3M8JA 2BOLA 2ELJA 3ZRGA 4B3FX 3K4BA 3H9QA 1SFKA 2JIZA 1RWRA 2HU9A 3BG6A 2V6EA 3FPPA 3FKJA 2A6TA 2GK7A 2ZZGA 3OR1C 2WB1A 4RMNA 1DP3A 3GVKA 2DT7B 4XNFA 2KDOA 3IUOA 2VQGA 3ZCOA 4MR0A 2DIEA 4BQNA 3AL0B 1JI8A 4Y33A 4II2A 2KMUA 2V1NA 2R7RA 3GQAA 2IS1A 2O04A 2VKHA 2VQHA 2ZFUA 3A35A 2XGJA 3SEQA 3OL3A 1NBMA 3VYTB 3HL2A 4D1QA 5HOOA 2KPMA 4W8TA 1E1QA 4CCJA 4QPQA 1YE9A 2KHMA 3DLAA 4XM3A 3A2KA 2CH0A 1D0ZA 1HZEA 2LZJA 3C2GA 2NTQA 1LDKB 4XKVA 4PMHA 2IGOA 1PKVA 1AIRA 4P1WA 1KMHA 2R4GA 4NQWB 1OB0A 2E1MB 2OC6A 3D5RC 4FASD 3GQBA 2VQCA 5CQGA 2Z6BD 2ZZFA 3U21A 2KRHA 1KONA 3ZXSA 2CW8A 2GJPA 3OE7A 4BACA 2WSSA 3K4LA 2M0MA 4BJTA 3H0DA 4RM2A 3PSFA 1HA8A 3W2VA 1EFRA 1QU3A 3ZQQA 2E5ZA 1WFXA 5DN6A 3TL4X 3HUGB 1KTWA 4J00A 1TZLA 4YRVA 1D1BA 2HVRA 3DPTA 1UD4A 4XOTA 3HOSA 4DK1A 1T95A 1KZLA 2GOXB 3HXLA 2GJRA 4F3QA 4OJPA 4ZDLA 4CCNA 1W36C 3L2RA 5IK2A 4NK6A 1VLYA 2JSPA 4R79A 1N75A 3I3LA 3OAAA 3VDXA 1QHGA 2VXZA 1VJSA 3A4CA 3VWBA 3ZSCA 3MD2A 3HG9A 4P22A 4C2TA 2CV0A 1LVKA 4BL0B 3OMYA 3VSTA 5KCMA 4G6TB 4XLAA 4F52A 2UVFA 2WBMA 4BDYA 1WJEA 1VF7A 4OJOA 4GQNA 2UWMA 4NK8A 4BJ5C 4CA0A 2KVOA 3H5NA 2X51A 4TSFA 3LMWA 2VB6A 1MMDA 3OS0A 2E1BA 4E6KG 3OYMA 2E60A 3OOUA 2LBFA 2D3NA 5FROA 1BR2A 4CCKA 2M5SA 3OOCA 1CZFA 3RPUD 1QHHD 4NC8A 3FKSA 1UD2A 5FRMA 3ZGKA 2ZXHA 4BUPA 2R7SA 4BXFA 4JMQA 1WJAA 2XZOA 4U49A 3KRGA 1V5GA 2PECA 3RQ4A 2CMPA 4XR6A 2IXSA 3EUKL 2X3HA 3OIQA 2X8KA 1X0CA 3S3OA 4BEHA 2NT9A 2M3AA 2IS2A 3VSUA 4Z05A 3N05A 3H5AA 4UZUA 3WQZA 4YZ0A 4G7WA 2X1DA 2X6WA 1WJCA 4YEJA 4NUBA 4B3XA 3HOTA 3KEWA 3EUHC 2V9KA 4Y3OA 4HRIA 2HPMA 2NOJB 3BCDA 3PNVA 3AL0C 4PFOA 1FX0A 4PJNA 2NSPA 4F91B 2ZXIA 3ZPPA 4CUGA 2W7NA 1BOBA 3DKXA 4RLFA 3FHNA 2L5QA 3OYHA 3T53B 3BC9A 1O88A 3KX2A 2BSPA 3LSGA 4PSWA 4B47A 3OYEA 3D5LA 1Z3YA 1OR7C 3E0JB 3GRHA 3RCOA 4AU7A 4E7KA 3CJRB 2JA2A 3OY9A 5LFAA 1E79A 3RSNA 4Z03A 1MMGA 3SYTA 5TGTA 1BMFA 3H35A 2Z8GA 2UVEA 5HKKA 4X0GA 3D5SC 2E1MC 3EQNA 5AMVA 1X4OA 2HDWA 1E1RA 1O8EA 4G7XA 1OFMA 1BLIA 3S3NA 3B4NA 2LYCA 3JU4A 4BEHB 1UELB 3FBIB 3LFUA 4N4NB 1PJRA 3CP8A 1DGWY 2W6IA 1SAUA 2CW7A 2VBMA 4HNTA 1N78A 4H4KC 4NNJA 5FL7A 3HC7A 4U4BA 1NG6A 3VYSB 4DK0A 2WAFA 2VJIA 2XZPA 2W6JA 3IP4B 2L9SA 4LG3A 1T0FC 3W2AA 4RM3A 1BPLA 4XQFA 4PK4A 2XZLA 4CSWA 3M1CA 5LD2C 1W0JA 3VYRB 5JHFA 5HLTA 3A3GA 1XG2A 1VBLA 4OJ6A 2BW3B 2K9MA 1X1BA 2KZVA 2GOMA 1DGRM 2VJ4A 3DTKA 1DBOA 3QODA 4KJZA 2XF6A 4FXUA 3LSIA 3OFNA 1NG7A 2HLDA 2V31A 4C30A 2Y0SA 4Z06A 4XLFA 2JJ1A 4NC7A 1UAAA 3GQ9A 3DU6A 2PJRA 2DT6A 2X6XA 3OL4A 3HAGA 2HNHA 2NZMA 1RMGA 2PYHA 3OWTA 4LIVA 2P0WA 3SUCA 3OYLA 2M4GA 4ZJZA 2DOAA 3DQVC 1X1DA 3OW7A 3NE5B 3VYUB 3QYFA 3OS1A 2Z1DA 1V5EA 4PUSA 4N4OB 2M4KA 3H9GA 4DBRA 4YZXA 2MFZA 2VASA 4OAZA 1LFPA 4YELA 3K4CA 1E3XA 2KQRA 3CZ6A 2RNGA 5HNFA 1NRKA 1WMRA 2UUZA 3B8YA 1MW7A 3OS2A 4BE0A 5KHDA 4ANJA 4IQJA 3SEZA 4BJ6C 4G6IA 2HVQA 2Q1ZB 4L8JA 2R7VA 4E7IA 1UD3A 1JRGA 4BU2A 1OOCA 2XDVA 4OAYA 4KITB 1R6RA 3KYLA 4E7LA 4B44A 4BQQA 4JOMA 1MMAA 1IA5A 3T9GA 4RLQA 2Q2EB 2VPLA 2I8DA 1UD8A 2WJYA 4KKUA 1IDJA 2ZZQA 1QCXA 1NHCA 4XN0A 4ASUA 1I8DA 2X6YA 4XKCA 2PJRB 2KL4A 4KKTA 3I9V2 2KRCA 3OIPA 2L9NA 3BH4A 1KCCA 4HSTA 3A1YA 1YX5A 3DTIA 4DOZA 1O8FA 4W8QA 3ZR8X 2NT6A 3B90A 3FDYA 2O1DA 3OYNA 4ZTJA 2NSTA 2RQQA 1WJFA 2EWEA 5HNHA 3NWTA 4BS9A 3OYCA 1VZ0A 2W82A 2JVHA 4HNUA 4KT6A 2NTPA 4C2LA 1O8MA 2VXDA 3S3MA 2MD0A 4FETA 1H8EA 4Z1MA 3PUBA 3OYKA 2F43A 2INVA 4IKFA 3UNGC 4OJLA 3LSHA 2VJ5A 2GK6A 2FUG2 2JVGA 4EW9A 1D1AA 2M7AA 3MKZA 2ZSHB 1H8HA 2LG4A 1S9HA 1AA7A 4URRA 2R7XA 1OGOX 3H9JA 4CCMA 2MC4A 3MKWB 3A3BA 4AVZA 2JDIA 3LSMA 1UG0A 3W2WA 2R7OA 1X1AA 3CP2A 2CK3A 1HG8A 3RTRA 3OYJA 4IZZA 1D1CA 2LREA 4E7ZA 3SDBA 3LNNA 2BW3A 4XN3A 3DTEA 1PE9A 2NTBA 4PJLA 4II3A 1IRXA 4ZTFA 3UR3C 2K5CA 2CUZA 4EATA 2F6CA 2XC7A 2O17A 1X4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQF A;  4MXN A;  3JUR A;  1OFL A;  4XON A;  5C1C A;  2INU A;  1XG2 A;  3GQ7 A;  4OZY A;  1VBL A;  4OJ6 A;  4XKW A;  1KTW A;  2QY1 A;  4OJ5 A;  2IQ7 A;  1DBO A;  2QX3 A;  4XLC A;  1O8I A;  2X85 A;  4XOT A;  2O0V A;  4OZZ A;  4Z06 A;  4XLF A;  4OJP A;  3GQ9 A;  2PYH A;  2X6X A;  4NK6 A;  2NZM A;  1RMG A;  3SUC A;  3EQO A;  2VBK A;  3ZSC A;  1BHE A;  4XL9 A;  3VST A;  1KCD A;  4W8R A;  4XLA A;  2UVF A;  4OJO A;  2ODL A;  2O0W A;  5C1E A;  4NK8 A;  1O8J A;  3LMW A;  4YZX A;  3UW0 A;  4YEL A;  4YZQ A;  1WMR A;  4HWV A;  3B8Y A;  4XMY A;  4YZA A;  1BN8 A;  4XOP A;  3FY3 A;  1CZF A;  3GQ8 A;  1OOC A;  1JRG A;  4U49 A;  4XLE A;  1O8H A;  1RU4 A;  3KRG A;  2PEC A;  1IA5 A;  1O8G A;  4XR6 A;  2VJJ A;  3T9G A;  1IDJ A;  2X3H A;  4XLH A;  2NT9 A;  1X0C A;  1O8K A;  1QCX A;  1NHC A;  4XN0 A;  1IB4 A;  3VSU A;  2X6Y A;  4Z05 A;  4YZ0 A;  1OGM X;  3VSV A;  1IDK A;  2X6W A;  1KCC A;  1K5C A;  4YEJ A;  1O8F A;  4W8Q A;  2NT6 A;  3B90 A;  1RWR A;  2O1D A;  2VBE A;  1H80 A;  2NST A;  1QJV A;  1EE6 A;  2NSP A;  2EWE A;  3ZPP A;  3VMW A;  4XOR A;  4C2L A;  2NTP A;  1O8M A;  4XNF A;  3WWG A;  1JTA A;  4W8S A;  4MR0 A;  3VMV A;  1O88 A;  2BSP A;  2INV A;  2PYG A;  2QXZ A;  4OJL A;  1PLU A;  4EW9 A;  1GQ8 A;  3GRH A;  3GQA A;  2O04 A;  1PXZ A;  4Z03 A;  2Z8G A;  2UVE A;  4URR A;  1OGO X;  1DBG A;  4W8T A;  3EQN A;  5AMV A;  1O8L A;  4XM3 A;  4I84 A;  4AVZ A;  1O8E A;  2NTQ A;  1OFM A;  1HG8 A;  3B4N A;  4XKV A;  4PMH A;  1O8D A;  1AIR A;  2VBM A;  4XN3 A;  4U4B A;  1PE9 A;  2NTB A;  2VJI A;  2O17 A; 
#chains in the Genus database with same CATH topology
 2Z9O A;  5H5J A;  2QQ9 A;  2P5L C;  1TTT A;  1OFL A;  4AYB A;  2PQ8 A;  4BQA A;  2FBK A;  3CCR I;  1FBU A;  2E5N A;  3F8N A;  1F60 A;  1OMI A;  4HV6 A;  2XC1 A;  2QLZ A;  3BJ6 A;  2HPI A;  3OKX A;  1YIT I;  2DQR A;  4MYT A;  3IL2 A;  4XKB A;  5LGU A;  3VR6 A;  2F4M B;  3PNY A;  2HI3 A;  4XLC A;  1B23 P;  5LGT A;  3CDL A;  4PJM A;  3S32 A;  3ZQF A;  3Q6R A;  2BGC A;  1TWG J;  4TMT A;  5HVQ C;  2CFO A;  1D5V A;  1BQE A;  1G7T A;  3GCM A;  1D0Y A;  3FX3 A;  4QWQ A;  2LY2 A;  1N77 A;  1FBS A;  4LIT A;  3ABM H;  5FNZ A;  1XMX A;  4UB8 C;  2XEX A;  2VKD A;  1IF1 A;  1VQ8 B;  3K70 D;  2Y31 A;  2P6S A;  3P4G A;  3HTU A;  3A1P A;  3CLO A;  3PNT A;  3ZBT A;  2OV7 A;  4U87 A;  3ZPL A;  1JGG A;  1RQR A;  1KCD A;  3IAM 2;  2V7V A;  3VSL A;  4M9Z A;  4TT3 A;  3C1D A;  2LKP A;  5EG0 B;  1ETQ A;  4G1B A;  5DNS A;  3UW0 A;  3OEH A;  3PFI A;  4YZQ A;  3A8J A;  4RGS A;  3EYI A;  2L7K A;  1GR1 A;  2K85 A;  2JRM A;  1FY7 A;  5GPA A;  5F4M A;  1QZY A;  5AIQ A;  2JN6 A;  5FKO A;  5FKL A;  1JJ8 C;  4AM3 A;  1HLV A;  1VQK B;  5ILS A;  1RR8 C;  2E2I J;  4YZA A;  2KRF A;  1COW A;  3I4P A;  1O8H A;  3P9I A;  3HRS A;  2JSC A;  4RAF A;  3JRA A;  2YWF A;  3VOE A;  3CCS B;  3LSJ A;  2YR2 A;  3GME A;  5GPC A;  3RZO J;  2PMZ A;  1EP1 B;  3KLO A;  1E62 A;  1R5H A;  3L2V A;  1QFZ A;  1ETV A;  3AFH A;  5EZH A;  5K5R A;  3HYI A;  4S04 A;  2QTL A;  2ZZE A;  2E34 A;  1ZHF A;  1LFB A;  3ZQC A;  2VIX A;  3VO2 A;  1OPC A;  2YUS A;  4KNY A;  1JUS A;  1XCB A;  1DAR A;  3BCF A;  3TH0 A;  2ZCW A;  1QPM A;  1ZLJ A;  2W57 A;  2R9V A;  3A8I A;  5DD8 A;  4D9J A;  1VQM I;  3WWG A;  4F93 B;  3HRU A;  2COB A;  1ODD A;  3ESW B;  3VMV A;  2GXA A;  5LHG A;  1F4K A;  2PYG A;  2YS9 A;  3DEW A;  4E7H A;  4M53 A;  2E1O A;  3NWS A;  3KPH A;  2ME6 A;  4AIH A;  1ZRF A;  3SJZ A;  3CXC B;  2XSJ C;  4JK1 X;  4OOI A;  1QA1 A;  3DPL C;  1DBG A;  3OEE A;  5FO5 A;  3MHP A;  3LWF A;  3OPO A;  1OGJ A;  3CD6 B;  1O8L A;  4BE1 A;  3U2Q A;  1EF4 A;  2D3L A;  2TCT A;  2W48 A;  3F72 A;  1V3F A;  1D8J A;  4Y9R A;  3JAM Z;  1B72 B;  1O8D A;  5B3S H;  1EV7 A;  4IHW A;  4X7D A;  5B5E C;  3WTZ A;  1B9M A;  5FLM J;  4HF1 A;  1NDH A;  1JGS A;  2ZSI B;  2CV2 A;  3U2R A;  3HOW J;  1K28 D;  1R5O A;  4BBR J;  4EGZ A;  3F8F A;  3BCA A;  4OPS A;  4KFC A;  2DW4 A;  3SEJ A;  1QX4 A;  2I10 A;  4FQG A;  2B63 J;  5F0C A;  3BPV A;  1R23 A;  1RES A;  1EA0 A;  4OZY A;  4XKW A;  1Q1V A;  5CPR B;  3GFI A;  1NB9 A;  4OM9 A;  4HIZ A;  2X85 A;  4QTR A;  3JRE A;  1WOS A;  2KJC A;  1ON2 A;  5HXB A;  1T2K A;  1XE1 A;  3X2Q H;  3E6D A;  3ZMU A;  1LM1 A;  3F21 A;  1MNE A;  2H8R A;  2JMW A;  3OYB A;  2KIM A;  5E3L A;  4AYB N;  3VMF A;  1IN6 A;  5LEJ A;  5CKT A;  2QA4 I;  3LO8 A;  1O7F A;  2XT4 A;  5CYV A;  5JHU A;  4CCL A;  3U6K A;  4ASN A;  5E3O A;  2XV4 S;  3H36 A;  2B0R A;  2FD5 A;  2IBD A;  1KK2 A;  1X1P A;  2N8G A;  1ULY A;  4IRG A;  4B43 A;  4IHX A;  1IV8 A;  2VL8 A;  3V4G A;  1V4R A;  4HWV A;  3SKB A;  1E3P A;  3KL9 A;  5GTH C;  1UFM A;  5F0H A;  4BQO A;  4PC6 A;  1Z0X A;  1XGM A;  4XOP A;  3FY3 A;  2DJN A;  1WTH D;  2OUM A;  5E3M A;  2VOP A;  1OR7 A;  5D5U B;  3SFI A;  3K4M A;  1OJL A;  2F5V A;  2XIG A;  4U0W A;  5CQE A;  4XLH A;  1EA3 A;  5E18 F;  2H6B A;  3BG7 A;  1O8K A;  2XNJ A;  1PE9 A;  1BR1 A;  4ZGQ B;  3BCB A;  1KJZ A;  2FML A;  3K0L A;  4NQW A;  1Z7L A;  4X07 A;  2CS3 A;  1W9X A;  1IDK A;  2KIF A;  3N4M A;  4U9U A;  2ELJ A;  4B3F X;  3H92 A;  3K4B A;  2GWR A;  1WHU A;  2FX0 A;  4LLG F;  2V6E A;  3FPP A;  1DUX C;  2A6T A;  4OIQ F;  2XAQ A;  4Y7N J;  1WGX A;  4IHS A;  5DV5 A;  1SD4 A;  2H1K A;  3ONY A;  2YSR A;  3KEQ A;  1IXR C;  2CND A;  2WB1 A;  3L09 A;  3AG2 H;  1HW2 A;  1ACI A;  1MSE C;  1GAW A;  3IUO A;  2VQG A;  3VNU A;  4MR0 A;  1WQ2 A;  4HA8 A;  3CUQ C;  1I6X A;  2PMZ N;  2Y69 H;  1R71 A;  4YFK F;  4UV8 A;  3ASR A;  3U1K A;  1IXS B;  2D2W A;  2OZ6 A;  1A6I A;  1W0U A;  2IS1 A;  1WDT A;  5HLI A;  5IP9 J;  2CWE A;  1HOM A;  3A35 A;  1HW1 A;  1I5Z A;  2DYR H;  3V8K A;  4WZL A;  3VFZ A;  2PG4 A;  1JB9 A;  3J7Y J;  3RKQ A;  4L9J A;  2LF7 A;  1UG2 A;  3DLA A;  1WSR A;  3WTY C;  2I1L A;  1D0Z A;  3ML3 A;  3D0S A;  3C2G A;  3KP4 A;  2NTQ A;  3WU1 B;  3R61 A;  3D26 A;  3GX4 X;  1PKV A;  2R4G A;  3SZP A;  1UHM A;  2E1M B;  1XPX A;  3D5R C;  1S29 A;  4FAS D;  3F8C A;  2VQC A;  2P4W A;  2DOF A;  3M8F A;  2BEO A;  3G6E B;  2EIN H;  4E70 A;  2DT5 A;  4XID A;  2F3L A;  1FJL A;  4CHU A;  2WSS A;  3I59 B;  4X1E A;  3PSF A;  3S16 J;  1QU3 A;  5B1B H;  2O03 A;  3KYC B;  3NEU A;  3HUG B;  1QFY A;  4J00 A;  2MLK A;  4A93 J;  1D1B A;  4Q47 A;  2HVR A;  4QLC U;  3DPT A;  1IN7 A;  4XLN F;  3P5J A;  1UD4 A;  1ZM9 A;  4DK1 A;  3BOQ A;  5FFZ A;  3A03 A;  2GOX B;  1KZL A;  4F3Q A;  2ZB9 A;  4MTD A;  1DDG A;  2RQP A;  4ZDL A;  2EFW A;  3GTO J;  3HM5 A;  2HYJ A;  5AN9 A;  3BG3 A;  4R79 A;  3DLL F;  1N75 A;  4D5C A;  1JKP C;  1T38 A;  4I01 A;  1A04 A;  1GVJ A;  1QHG A;  3GW2 A;  3VWB A;  1B6A A;  2LTP A;  2OAZ A;  1TW2 A;  2K7L A;  1AU7 A;  2QEX B;  1Y1W J;  2OYN A;  4ZYD A;  3BJA A;  4AWX B;  4G6T B;  1GO2 A;  1QG0 A;  2C2W A;  4OJO A;  2MH9 A;  1W7P D;  4B1R A;  5DM6 F;  2UWM A;  2Q6K A;  5TY0 A;  1QVF B;  5E3N A;  3J7Z I;  2X51 A;  4LBY A;  1VHE A;  2E1B A;  4UZF A;  4E6K G;  3MZ8 A;  3IKV A;  2E60 A;  4M71 A;  1AOY A;  2V1U A;  1XMA A;  3RY8 A;  3OOC A;  4LOC A;  3KP5 A;  5HLG A;  3GXO A;  4NC8 A;  2DOE A;  2HYG D;  3RZD J;  2OCE A;  3ZGK A;  4BUP A;  5FRM A;  2R7S A;  1P7J A;  1YHQ I;  2K40 A;  4JMQ A;  2NPF A;  4L5J A;  2W25 A;  2HMA A;  1JUM A;  5DD4 A;  4N3N A;  1BOA A;  3ERE D;  1YJ9 B;  1EKE A;  3K9T A;  1SC7 A;  1WOP A;  2IS2 A;  3VSU A;  1K4Z A;  2M34 A;  2VOD A;  2D1V A;  2K27 A;  2X6W A;  3GIR A;  4G7W A;  1OGO X;  2EQR A;  2QBY A;  2PMD A;  2IT0 A;  4Y3O A;  4EQQ A;  3REO A;  4UUS A;  4OMY A;  3BCD A;  5FIU A;  3PNV A;  5LHH A;  1ETX A;  1X2M A;  2JPB A;  1P4A A;  1RC9 A;  4F91 B;  4A0X A;  4ESF A;  4RD4 A;  1BOB A;  4RGX A;  1FX7 A;  5KVR A;  3TGN A;  2Y9Z A;  3MCA A;  1ON1 A;  3CCL I;  1XX5 A;  1R00 A;  2TDX A;  2CGP A;  4B47 A;  3FWE A;  1KGS A;  3LOC A;  1Z3Y A;  2Q6I A;  4EGY A;  3RCO A;  2KZG A;  3FXK A;  1MKM A;  2V1D A;  5LRR A;  2OTL I;  2V7X A;  2KIS A;  1MMG A;  1MRZ A;  5TGT A;  1Z67 A;  1IUF A;  2Z8G A;  2UVE A;  4X0G A;  4IW3 B;  2MLG A;  3BRO A;  4M6Y A;  5EEA A;  4A3I J;  3GVA A;  1Q82 D;  4P2N A;  1OFM A;  3S3N A;  2XT2 A;  1JNY A;  3CO7 C;  1XFO A;  2VBW A;  3OZV A;  2HS5 A;  3NRV A;  3LFU A;  4EJO A;  1XB2 A;  3CP8 A;  4EAT A;  3ZMT A;  2CW7 A;  3OIO A;  4LFU A;  2VZL A;  4KUM A;  5FL7 A;  1YO5 C;  3HC7 A;  3HUG A;  4PC1 A;  1M1K D;  2DMU A;  2DI3 A;  3VYS B;  1E63 A;  1XG1 A;  5DUK A;  2VJI A;  1YJW I;  5JLW A;  1FTZ A;  3IP4 B;  2QWW A;  3G4S I;  2GA2 A;  1T0F C;  2YUH A;  4KIC A;  4DNC A;  4PK4 A;  5L3E A;  1FDR A;  3WNC A;  3M1C A;  3OV8 A;  3JW4 A;  2K02 A;  4HNV A;  1W0J A;  5BSY A;  3VYR B;  5HLT A;  2J8K A;  2VBZ A;  1ZLK A;  3FPK A;  1VBL A;  1JTX A;  2BZT A;  1FP1 D;  2FF4 A;  2BVN A;  4AF7 A;  5DUI A;  1N06 A;  1KU9 A;  2XAF A;  4C30 A;  4Z06 A;  1RR7 A;  4XLF A;  1LLZ A;  4NC7 A;  1FRQ A;  5ED4 A;  3DU6 A;  2PJR A;  2DT6 A;  4A3C J;  4KMU X;  2P0W A;  2HDN B;  4B3A A;  2COM A;  3ZMV A;  2W84 A;  4ZJZ A;  1KZH A;  4ESJ A;  2V5I A;  3BQY A;  5ILV A;  1X1D A;  4ZCI A;  4M4S A;  3PQK A;  5A89 A;  1JA1 A;  4M6X A;  1JKQ C;  3ZMD A;  3BZ6 A;  5IPA A;  3IRR A;  2Z1D A;  1V5E A;  2QZA A;  1G2H A;  2VBY A;  1DP7 P;  4HX8 A;  2H94 A;  3I54 A;  4N4O B;  3I64 A;  4DBR A;  5LBQ A;  3GF2 A;  1GJR A;  2L4A A;  4YZX A;  3LST A;  2O0Y A;  2RNG A;  3CZ6 A;  4G9Y A;  4LB6 B;  4YFX F;  1JXS A;  1YG2 A;  4JX6 A;  5TJJ A;  1DPU A;  4ANJ A;  4IQJ A;  1KK1 A;  4OIP F;  1TWH J;  3EET A;  2HVQ A;  4TV7 A;  5H6Q A;  3P7N A;  1FYL A;  4L8J A;  1WSV A;  3EDP A;  3PVD A;  4C43 A;  2IVM A;  4BU2 A;  2XDV A;  1TNS A;  4KIT B;  3KCC A;  3KYL A;  2QQA A;  2C78 A;  3FXQ A;  3HZJ A;  4JOM A;  1IA5 A;  3JX8 A;  2Q2E B;  3FK6 A;  2DDB A;  2Q6O A;  1B8I B;  1N25 A;  3CCY A;  3J80 K;  4KKT A;  2KL4 A;  1UMQ A;  2ZME C;  4MTE A;  1FBQ A;  3RPQ A;  1W5C C;  4HYE A;  2L9N A;  4N9H A;  3CCJ B;  3DTI A;  4DQ2 A;  1O8F A;  3LSR A;  1XN7 A;  3B90 A;  2NST A;  1H8A C;  2EWE A;  3OYC A;  1WOO A;  4HX7 A;  2JVH A;  2GXG A;  3S17 J;  4C2L A;  2NTP A;  3AVX A;  4FET A;  4ZCM A;  3PUB A;  1KK3 A;  2EV0 A;  4XRM A;  3BNW A;  2VOO A;  2GK6 A;  2FUG 2;  1HBX G;  1D1A A;  3C2B A;  5GV8 A;  2ZSH B;  3N6Z A;  3O2P E;  1VQ4 B;  4M1K A;  4BY7 J;  4PC7 A;  2C4U A;  2B0L A;  2AXT C;  2GIZ A;  2E71 A;  3K2Z A;  4TMV A;  2DA5 A;  3K69 A;  4GCV A;  5K5O A;  5FA6 A;  1KTV A;  4CDG A;  2P5K A;  1DU6 A;  3OJW A;  4HF2 A;  2O8X A;  4RS8 A;  1I39 A;  2AHQ A;  3I55 I;  3OYJ A;  5E1Z B;  3F6V A;  3PSZ A;  1IDY A;  4JX5 A;  4RD0 A;  3TW6 A;  3ZQI A;  3LNN A;  1HDP A;  4XN3 A;  3AK5 A;  2B7C A;  2NTB A;  5F1R A;  1Z7U A;  3WTW C;  1SVM A;  2L3D A;  3FXR A;  1X4P A;  5D6F A;  4ETS A;  4LG0 B;  1WH5 A;  1ZGA A;  1QH0 A;  4U7B A;  5FD5 A;  5L46 A;  4R8H A;  5D5X B;  2QKM B;  1BC7 C;  1GT0 C;  4PC3 A;  3WE3 A;  3KFW X;  2Y0M A;  1J59 A;  3B6A A;  3WTX C;  1FNC A;  4KDP A;  3HIF A;  2OQG A;  5DCF A;  2VFQ A;  4E7J A;  2ZTN A;  1DG1 G;  4OZZ A;  3WBJ A;  3R0J A;  1PP7 U;  1BI0 A;  3QE2 A;  1WRJ A;  3QYB A;  2LVS A;  2M30 A;  1FNM A;  3E7L A;  5GTI C;  2GBY A;  3HHG A;  4YAW A;  2VLA A;  4ZH4 F;  1EFT A;  1WI3 A;  1ZK8 A;  2XNC A;  4GRI A;  1J9I A;  1WWX A;  3SZG A;  4RB3 C;  4WZK A;  4RD3 A;  2BHZ A;  4XL9 A;  3WGG A;  3CMM A;  5GV7 A;  1VQ7 B;  4Y52 J;  3CME B;  4EM1 A;  3RIQ A;  2DFF A;  1T5E A;  3G1M A;  5C1E A;  1QQI A;  4P9S A;  2G9W A;  4GGG A;  1R9T J;  4UB6 C;  5ICG A;  4RGU A;  1LB2 A;  4UNO A;  3I4M J;  4WZE A;  3B78 A;  3LAP A;  3W5U A;  5C44 J;  1RUO A;  1O3T A;  2F5F A;  2LH9 A;  2VON A;  2L02 A;  5FRN A;  4YFO A;  2MAB A;  2X53 S;  1HKS A;  1J7K A;  5IOY A;  1HA3 A;  1PVE A;  2AQE A;  2EJR A;  4I0A A;  1YIJ I;  2ZFW A;  4XIC A;  4XRF A;  3CUO A;  4UUV A;  4X06 A;  1KYZ A;  1SM4 A;  3B8H A;  3QYE A;  1RU4 A;  3N97 A;  2OK8 A;  1O8G A;  2FOW A;  1SVO A;  2O61 A;  2IJL A;  3A02 A;  2OPT A;  3DF8 A;  2VQL A;  3JSP A;  3UKG A;  4D5F A;  4B4C A;  1MDM B;  1T39 A;  1PYV A;  1GLN A;  2UV1 A;  1QVU A;  2DA7 A;  2EPF A;  1ZRC A;  3M4O J;  1D2E A;  1Z3X A;  2X1C A;  1W2B B;  4PAB A;  2QE7 A;  1F36 A;  2VBE A;  4HSR A;  5BPD A;  5EEG A;  3CCM B;  3F23 A;  3SLN A;  2DY1 A;  3ES9 A;  2XUB A;  3R6S A;  1MBK A;  3K6G A;  1H80 A;  1QJV A;  1SD6 A;  5HOD A;  4G7O F;  4JP0 A;  1EE6 A;  3GZ6 A;  1RPW A;  3VMW A;  2V7Q A;  4XOR A;  3MZH A;  3ISX A;  2P5V A;  1D3Y A;  4Z4R A;  2WZN A;  4YC5 A;  1WKM A;  3OZW A;  3J81 Z;  5DS0 A;  4W8S A;  2HQN A;  4UVB A;  3SQV A;  3IAS 2;  3RYP A;  3J7A Y;  2BGI A;  3U1D A;  2WJV A;  2QXZ A;  4PZJ A;  1G6N A;  2CQQ A;  1MD0 A;  5F4O A;  2PBI A;  4M9X A;  3TP3 A;  2MC3 A;  1BIB A;  4OMZ A;  1PXZ A;  2RC5 A;  3G1O A;  1YLO A;  3ECH A;  2FRH A;  1TT0 A;  2DMQ A;  1WVR A;  2KFD A;  1X1C A;  1MJB A;  5IYB J;  4AUX A;  2XGX A;  1HDD C;  2DJI A;  2XRN A;  1O57 A;  1YW8 A;  2G0Y A;  3JRF A;  4OIR F;  4N0B A;  3GVL A;  2DAO A;  1W4M A;  2F5E A;  3BZK A;  5L3B A;  1EXM A;  2F1M A;  4AVP A;  2KDZ A;  1CF7 A;  4WWV A;  4LG0 A;  4YIF A;  2NS8 A;  1Z77 A;  1SMY F;  2WAD A;  3R60 A;  3DDY A;  2Y30 A;  4M6V A;  3L2Q A;  1LPQ A;  1KRH A;  4KA4 A;  1HVX A;  2QSF X;  4S05 A;  4ZYE A;  2NAZ A;  1SFE A;  3MAJ A;  1R22 A;  1F20 A;  1USS A;  4WQM A;  3GTJ J;  2VFN A;  2CRG A;  3I4N J;  4Y4R A;  3OYA A;  1G59 A;  3V42 A;  3GTL J;  5DM7 F;  3CDI A;  5LMZ A;  3MMY B;  2NNN A;  4PAA A;  4HLX A;  2YU3 A;  1VI0 A;  3L1P A;  4P9F A;  9ANT A;  1B59 A;  4YEI A;  4EV0 A;  1ETW A;  2FBH A;  3FBN B;  2P81 A;  4A6D A;  4F55 A;  2EH3 A;  3OZU A;  4G1V A;  2W00 A;  4YII A;  2ZXJ A;  4EVI A;  2E2H J;  1VQN I;  3ZQL A;  5FKM A;  1UD5 A;  1OLT A;  2JUC A;  3GTQ J;  2R0Q C;  2ECB A;  2PEX A;  3CCQ B;  2LD5 A;  3KEW A;  2F4I A;  3ZPN A;  4AC0 A;  3I71 A;  1ZEL A;  1QGP A;  2MG4 A;  2VPR A;  3F8B A;  3RDI A;  2BVL A;  2BX6 A;  3OSG A;  1TL8 A;  6PAX A;  4HX4 A;  3EQO A;  2VNH A;  2XOK A;  2VC0 A;  3ZZU A;  1T56 A;  4ITV A;  3TBI A;  5F0F A;  1JTY A;  3TP0 A;  3T51 B;  2ACJ A;  2QGG A;  4DBQ A;  4HZF A;  1VQ6 I;  3IH2 A;  3FK7 A;  2IGK A;  1LVA A;  4O6J A;  1P4W A;  4BH9 A;  2DA4 A;  4RDJ A;  4BYY A;  4KT5 C;  3PFY A;  4RB0 A;  1TW3 A;  3JAM K;  3GFJ A;  1V5F A;  1WJB A;  4FHT A;  4Z6Y A;  1IRG A;  2X1E A;  2K9L A;  4A6E A;  5FLX K;  3L2U A;  4X6A J;  5L3C A;  4LIU A;  3S93 A;  3JRB A;  2JA6 J;  3W5V A;  3J81 k;  2OBS A;  2R7W A;  5E1W A;  1MDM A;  1U0J A;  5F4J A;  2L2O A;  5J35 A;  5K1Y A;  5J1U A;  2M7B A;  3DXJ F;  5M5X J;  1ZAR A;  2Z16 A;  2ZKZ A;  1CGP A;  2GPJ A;  1XGS A;  5IOZ A;  3WTT C;  1U6G A;  2DCE A;  2FEZ A;  1K6O A;  1FMV A;  3G2B A;  2B5O A;  4DNR B;  3OYI A;  3ZN1 A;  3OYF A;  4QSH A;  4P96 A;  4ENM A;  1T8I A;  4OOX A;  2IS4 A;  3KZZ A;  2JN9 A;  4QFM A;  4OU0 A;  1IB4 A;  1EZG A;  2QCO A;  1D8K A;  1MH3 A;  3M8J A;  3PUF A;  2XKO A;  4WF2 A;  4EMS A;  5EYR A;  1EH7 A;  1U9N A;  2STT A;  3WBK A;  1T6X A;  3MEX A;  1U8R A;  3H9Q A;  1SFK A;  1DU0 A;  1HC8 A;  2ZJQ F;  2X0K A;  3PUN A;  1PJ5 A;  3BG6 A;  2ZC2 A;  2ZNY A;  3B6C A;  2CO5 A;  4DQL A;  1NJI D;  2QN6 A;  1WU8 A;  3CRZ A;  3F6O A;  1FLI A;  3TO6 A;  2O8K A;  3GLL A;  3ZCO A;  1FPQ A;  2ZJR F;  3RIR A;  4BPR A;  1QA6 A;  4MQ9 F;  1ITY A;  2HXI A;  1X3Z B;  3F22 A;  3IRQ A;  1VQ5 B;  4II2 A;  1R5B A;  2R7R A;  3GQA A;  5IYD J;  4X7C A;  3RKW A;  4G7Z F;  4I7H A;  2F48 A;  2ZFU A;  3ZMZ A;  2XB0 X;  4EM0 B;  3VYT B;  4HE5 A;  3HL2 A;  4D1Q A;  1S7A A;  4M3B A;  2KPM A;  4W8T A;  1E1Q A;  1YYV A;  4CCJ A;  1YE9 A;  4XM3 A;  3A2K A;  1HZE A;  1YI2 B;  2LZJ A;  2XRO A;  4A12 A;  1ZQ3 P;  2BXZ A;  2IGO A;  3ABK H;  4OPO A;  4HDU A;  1AIR A;  2CUE A;  4LGW A;  4P1W A;  2DFH A;  4MHG A;  4IOC F;  4NQW B;  2OBR A;  1YIO A;  1OB0 A;  2O6W A;  1HXD A;  1WOR A;  1VQP B;  3R0A A;  2NNY A;  1X3W B;  5CQG A;  2ZZF A;  1D8T A;  4ABZ A;  1HKQ A;  3TKY A;  2GJP A;  3OE7 A;  2GRE A;  3CMA B;  4BAC A;  3I56 I;  3Q0W A;  1UB9 A;  2JRT A;  3CMY A;  4XRS G;  4HF0 A;  1Y8R B;  4RM2 A;  4ZZL A;  3W2V A;  1ZKG A;  4R1H A;  1EFR A;  4OOS A;  4QUZ A;  2ZIT A;  4P6V F;  3FHZ A;  2JA5 J;  5DN6 A;  2M8G X;  3F8M A;  5DTD A;  1KTW A;  3WTU C;  1W7P B;  2OF7 A;  3CTA A;  3V8L A;  1N0V C;  2HCJ B;  4TMZ A;  2GJR A;  2BSA A;  4OJP A;  1W36 C;  3BP8 A;  4MIM A;  5IK2 A;  4NK6 A;  4NHJ A;  1LFU P;  4CXF A;  2L7F P;  2JSP A;  1GV2 A;  3BTI A;  2VBU A;  4GXO A;  5BMZ A;  3ASP A;  4L0Y B;  3CB4 A;  5L3F A;  3CF5 F;  1LUJ B;  2R7F A;  4IL6 C;  4BL0 B;  1J75 A;  2CF4 A;  4UAJ A;  4XLA A;  1W5S A;  3P9K A;  2WBM A;  4Q4Z F;  2ESH A;  4XLP F;  1WJE A;  1S72 I;  2QSH X;  3HGG A;  2HFH A;  4M3G A;  1VF7 A;  3G71 I;  4EM2 A;  2VNK A;  1H0M A;  1AIP A;  1FIA A;  4IJA A;  4YAF A;  2IP2 A;  4D7M A;  1O3S A;  1YIJ B;  2MD5 A;  1IB0 A;  2HQR A;  4U0Y A;  5ICC A;  3OOU A;  2D3N A;  1O3R A;  2F1L A;  4CCK A;  3WTV C;  1IXC A;  2M5S A;  3AGP A;  3CCU B;  2IOU G;  4I76 A;  5F6F A;  3RPU D;  1BJK A;  2F4O B;  1ZGW A;  2EFO A;  4LK0 F;  4U49 A;  3KZI C;  1KC8 D;  1F5T A;  5K5Q A;  4UHT A;  4D7N A;  3KRG A;  1TLH B;  5LHI A;  2CMP A;  2P6T A;  3SHF A;  2R6H A;  1UZC A;  1FOY A;  2GM4 A;  2X3H A;  3OIQ A;  3S3O A;  2M3A A;  1K8F A;  1Y8Q B;  3HSE A;  1BN5 A;  1VQ9 I;  1SMT A;  3WXM A;  1LDJ A;  4G5G A;  4P1V A;  5IYW A;  3WQZ A;  4RB1 A;  2ICW G;  4YZ0 A;  3PQJ A;  2DTZ A;  2X1D A;  3I5U A;  3SQN A;  2NRA C;  1YTY A;  1WJC A;  2P8T A;  2X6O A;  3H3U A;  2DN0 A;  3HB9 A;  4HV5 A;  4L9N A;  4G94 A;  4NUB A;  2L7Z A;  1R4M B;  3EUH C;  5D8L B;  1QUE A;  1VHO A;  2DYS H;  2NVY J;  5IYQ A;  2NOJ B;  4F7Z A;  3NQO A;  4M3F A;  1QA3 A;  1FX0 A;  4PFO A;  3CC7 B;  2NSP A;  2A3S A;  3ZPP A;  1ZR4 A;  4CUG A;  1BX1 A;  2D9R A;  3ABU A;  3DKX A;  4FX4 A;  1IN8 A;  2HTS A;  2L5Q A;  4KN7 X;  5H20 A;  1SEU A;  5BNG A;  5AIP A;  3OYE A;  1Z6R A;  4BHP A;  1NHA A;  3K1N A;  4I0B A;  4ESB A;  4E7K A;  2GLO A;  3CJR B;  1MBF A;  2IRF G;  1I1G A;  4C3H J;  2WYR A;  3OY9 A;  5IYN A;  1SFU A;  1E79 A;  4Z03 A;  3SYT A;  1YS7 A;  3H35 A;  3GWZ A;  2FVG A;  2VYQ A;  2ELH A;  3H1C A;  3G1L A;  3D5S C;  5FO1 A;  2E1M C;  5DEQ A;  2MA3 A;  3Q3A A;  1XDU A;  3ZZ0 A;  1IN4 A;  1E2X A;  2HDW A;  5F27 A;  5D8K B;  1OCT C;  2DTR A;  5IP7 J;  4G7X A;  3B4N A;  1OCZ H;  2Q8K A;  2LYC A;  1DDI A;  1S5L C;  3IH3 A;  3KET A;  3JRD A;  3AAF A;  1UEL B;  1SFO J;  3JU4 A;  2OTJ B;  4N4N B;  1SAU A;  2NVT J;  2VBM A;  2HYF A;  5EZG A;  1KQ9 A;  1I1S A;  3PM1 A;  4K1X A;  4U4B A;  1NG6 A;  3GFM A;  4P12 A;  4Z2Y A;  1W7P A;  2K4B A;  2OZU A;  3T5X A;  4DK0 A;  2DER A;  1FC3 A;  3DBL B;  2QBY B;  2XZP A;  2L9S A;  4ON0 A;  5JR3 A;  3T1B A;  3G73 A;  1H9T A;  3T0Y A;  4EJV A;  4UUS B;  3ZP5 A;  4CGZ A;  2JA7 J;  1K83 J;  3QFT A;  2R93 J;  3WG7 H;  3W6V A;  3CLQ A;  1HCR A;  1Y0N A;  5HDG A;  1OFE A;  2BW3 B;  5LRS A;  4OJ6 A;  1DGR M;  2DQL A;  3IC7 A;  4KJZ A;  3VB2 A;  3QWL A;  4FXU A;  3OFN A;  1JUP A;  1GVH A;  2HLD A;  3ASN H;  1KA8 A;  2JZY A;  5HS7 A;  2FQ3 A;  1IJW C;  1KD1 D;  1YJN I;  3S1Q J;  2DFE A;  3OL4 A;  3HAG A;  1RMG A;  3OWT A;  2BV6 A;  4PJ0 C;  3SUC A;  1XGN A;  4M73 A;  2UZK A;  2DCU A;  1OFD A;  2M4G A;  3NAR A;  4Z4T A;  5J1Y A;  2IAI A;  3AG3 H;  3CCR B;  4UVA A;  2LKS A;  2XAJ A;  3T8T A;  2BY3 A;  2ZBK A;  1YX2 A;  3OW7 A;  4UXN A;  1YIT B;  2VT2 A;  1KQ0 A;  3VYU B;  3OS1 A;  2MSY A;  2V1X A;  1JJ6 C;  1JHF A;  1TUI A;  2NVU B;  2K9S A;  2D45 A;  1G3Y A;  4HQM A;  5TV2 A;  3K4C A;  2AHO A;  1E3X A;  4EH1 A;  3HJE A;  1H88 C;  1HKT A;  2UUZ A;  1G4D A;  1MW7 A;  3OS2 A;  1B1B A;  3SEZ A;  4BJ6 C;  1L3L A;  5ERI A;  1NH3 A;  4IO9 F;  4YCQ A;  2LP0 A;  1OKR A;  4ZV4 A;  1TQI A;  1XDS A;  4E7L A;  1JKO C;  2EBI A;  1FND A;  3T9G A;  4Q48 A;  1R5G A;  3BJO A;  5D4S A;  2XSD C;  3JRC A;  2VPL A;  1PJ7 A;  2ZZQ A;  2VN2 A;  3Q38 A;  1I8D A;  2X6Y A;  4XKC A;  2PJR B;  3SDG A;  3CCV I;  4R71 A;  4G8X A;  2HDD A;  1MH4 A;  4HST A;  4DOZ A;  2HTJ A;  2NT6 A;  2XAG A;  3FDY A;  3QP5 A;  3OYN A;  4ZTJ A;  1LQ1 A;  1KU7 A;  4QVA A;  2RQQ A;  3PIP F;  3QOP A;  2D74 A;  3OJX A;  1HF2 A;  1QQ1 A;  3Q3S A;  2M87 A;  3QFR A;  4WX9 A;  5TIS C;  1H8E A;  3OYK A;  1WXR A;  1JHH A;  4F7D A;  3CCE I;  1VF9 A;  4OJL A;  1OCR H;  2AS5 F;  3LSH A;  2JVG A;  4Q5S F;  1K61 A;  3WND A;  3L7W A;  2GQQ A;  1H8H A;  3BG9 A;  1Y1V J;  2XGE A;  3V7C A;  2R92 J;  3PUM A;  3MKL A;  4BAY A;  2HOE A;  4LBZ A;  1UHW A;  1AA7 A;  4IVN A;  4V2G A;  2WTE A;  1N0U A;  4URR A;  3H9J A;  4ZZD A;  5JMC B;  4CCM A;  3JQP A;  2HDC A;  2RC6 A;  4M72 A;  3V7R A;  3WYA A;  4DW6 A;  2K9Q A;  4AVZ A;  4YFN F;  3ISP A;  2E1R A;  2R7O A;  3O6B B;  1VQM B;  3BDD A;  2F4N A;  3ABT A;  5EGO A;  2QEN A;  3JCU C;  4N9I A;  1LDD A;  4AD9 A;  2LRE A;  5JVG F;  3BZC A;  3S2D J;  1WPK A;  3WHC A;  5KK1 A;  2BW3 A;  2XPW A;  3DTE A;  2J7K A;  2NOG A;  3K7A J;  2EB7 A;  3GSI A;  4II3 A;  1IRX A;  3W2G A;  5J8C A;  3UR3 C;  1R1U A;  4L9T A;  5M3M J;  4OOV A;  2CUZ A;  4C2U A;  4PDK A;  3GQ8 A;  2F6C A;  4X8I A;  4WCG A;  4MXN A;  1LLW A;  3JUR A;  1NK2 P;  1OIS A;  3W5H A;  2QZ8 A;  2LY1 A;  1UD6 A;  2QKL B;  1XGO A;  1Z1D A;  4KIS A;  1OYI A;  2QQB A;  3GO5 A;  2WAE A;  1J0R A;  4N3G A;  3LSK A;  1OCC H;  1OHH A;  3GQ7 A;  5A88 A;  1YW7 A;  2K3P A;  3CC4 I;  4OJ5 A;  2E35 A;  4AIK A;  2BVM A;  1WI9 A;  2ZJP F;  1O8I A;  3DU5 A;  4B3G A;  1FP2 A;  3E97 A;  1VQL I;  2WPD A;  2WAQ A;  4DIQ A;  1FZP B;  2CU7 A;  2WY7 Q;  1V0E A;  1STZ A;  3KEY A;  4HEA 2;  2CQN A;  2WA0 A;  1GVD A;  4JQF A;  1RET A;  1E43 A;  1R1T A;  2AXL A;  2A6H F;  2PMU A;  2Z99 A;  3BY1 A;  3DPU A;  1MBJ A;  2A6E F;  3O8H A;  2R7Q A;  5JFR A;  5C4J J;  1OGI A;  1KQ8 A;  4ENJ A;  4M0L A;  4G6D A;  4IPA A;  2IS6 A;  1D5Y A;  3H94 A;  2HQA A;  3QU3 A;  4B8X A;  4Z4U A;  4L18 B;  4OP7 A;  2FMY A;  1POG A;  2XVC A;  3QOE A;  2C4T A;  4BKX A;  1O8J A;  4LBV A;  3TED A;  1XSV A;  5IYP A;  4NBS A;  4U88 A;  1Y6I A;  2PJP A;  3OYD A;  1ZRE A;  5TRD A;  2R7T A;  4JYK A;  4OWR B;  1E64 A;  1OB2 A;  2XTW A;  1BR4 A;  2FBI A;  2O9L A;  3A8K A;  5FFX A;  2GIV A;  3DU1 X;  3EQL F;  2RAE A;  3CW2 A;  2FQ4 A;  1K4S A;  3HOZ J;  3PA2 A;  1IG7 A;  2QA4 B;  1GV5 A;  3CUQ A;  4XLE A;  3DKY A;  3L2W A;  4HG2 A;  3K1P A;  1XTA A;  5FLV A;  2Y75 A;  2BMW A;  3WY9 A;  3ZBU A;  1K9M D;  4RAZ A;  4J0Q A;  3ASO H;  2Z2S B;  2VBT A;  2M5W A;  2YX4 A;  1TYW A;  3CPX A;  2WZP P;  4PJJ A;  3H3V K;  1I27 A;  1VQO I;  2LOO A;  5DDG A;  3CC2 I;  4HBL A;  2IGN A;  1T33 A;  2AQF A;  4G7H F;  1ETO A;  1C0W A;  2J5O A;  2VKE A;  3E1S A;  4H0E A;  4UUT A;  4X0C A;  3FZV A;  2DOD A;  5M3F J;  4P3I A;  3BH7 B;  1WPC A;  2DDA A;  3LL7 A;  5EEH A;  2GA1 A;  3TMO A;  4UV9 A;  3K4K A;  2DFI A;  3B02 A;  1IDZ A;  4XD7 A;  1U3E M;  4AC9 A;  2XRL A;  1JTA A;  4EEF G;  3P9C A;  2E36 A;  2LC2 A;  1MAB A;  1M1E B;  4PGO A;  4RBO A;  1PLU A;  4KH3 A;  3WGH A;  2DA6 A;  2V26 A;  2NVX J;  4FK8 A;  3K2A A;  1ENH A;  5C3E J;  2OD5 A;  1RI7 A;  4YAU A;  1R5N A;  4IX7 A;  2O5R A;  1PUE E;  1Q9S A;  4I84 A;  2LR8 A;  2VBX A;  3W6K B;  4HPQ A;  1MJ9 A;  2ETH A;  3HPG A;  5KNL A;  2WWY A;  5E79 C;  1R36 A;  2ZL6 A;  4TKO B;  4Y9U A;  2DXI A;  2EFG A;  1E17 A;  3K70 C;  4PFP A;  4I2O A;  2MGQ A;  4KKS A;  3S15 J;  1QO0 D;  2WV1 A;  3ZN0 A;  1BBY A;  4I09 A;  3GBG A;  2NXN B;  3RKY A;  2MBF A;  4C3I J;  3IH4 A;  1L0O C;  5J4V A;  5C1C A;  2M0C A;  1VQ8 I;  4IOA F;  2EZI A;  4RDK A;  3A0H C;  4WXC A;  2INU A;  1SKY B;  3R6J A;  4CYD A;  2NV4 A;  4A0Y A;  1MMN A;  5E20 A;  4CCO A;  4CZZ A;  1FOW A;  3SJM A;  1LE8 A;  3J81 K;  3KZY A;  2XAU A;  4IEJ A;  1AHD P;  5JBQ A;  3IWF A;  2LY9 A;  1N8R D;  3E5U A;  2RRE A;  2XPU A;  2B9S A;  1MSF C;  1QGY A;  1LKX A;  1V54 H;  2P7V B;  3CQZ J;  1VFC A;  1U78 A;  1A36 A;  1VQK I;  2E1C A;  2O6G E;  5HZB A;  4C9Y A;  1ZG1 A;  1XMK A;  3ML6 A;  2L7M P;  4Y15 A;  2GZW A;  1S7E A;  3WGI A;  1CF7 B;  4RPB A;  4TMW A;  4Z4S A;  4W8R A;  3VO1 A;  3F9K A;  2O0W A;  4U7D A;  1FSH A;  3CCS I;  1J9Z A;  3DP7 A;  1GHC A;  1O3Q A;  2WAQ N;  1MGT A;  1QVG B;  3KYD B;  3RJP A;  4DGW B;  2KIQ A;  4F92 B;  3HKZ A;  2E7W A;  4DJA A;  3Q0V A;  2GJK A;  1OYW A;  4L5E A;  3JSO A;  2LK2 A;  1V0F A;  3BLY A;  1AMO A;  3MQ0 A;  2Y9Y A;  5CVR A;  2BY1 A;  4ZDO A;  1MBE A;  5CVJ A;  3AVY A;  3E6M A;  3PJR A;  2DYI A;  3QSY A;  1MNM C;  3EPZ A;  1UMK A;  1OFC X;  2DBB A;  2RNJ A;  3W3C A;  1IRZ A;  3MKY B;  1FNN A;  1I3A A;  4V19 K;  2G7U A;  1I18 A;  4BXU A;  4HDV A;  2LBF B;  1VND A;  1MBH A;  4Y7C A;  4JX4 A;  2QVO A;  2H6C A;  5EJC A;  2IGM A;  4BXX J;  1PJ6 A;  1CNF A;  4WZT A;  5A8A A;  2OQR A;  3ZIA A;  1OGM X;  1FWZ A;  3C18 A;  2LKX A;  2FNP A;  2BM6 A;  1CQT A;  2DO7 A;  4RGR A;  3ZRG A;  4M3D A;  5JI6 A;  1FTT A;  3GTG J;  2E19 A;  1YHQ B;  4H9G A;  3KE2 A;  3CCE B;  3TDZ C;  3JQR A;  2IA0 A;  3CD6 I;  2GK7 A;  2EV5 A;  4RMN A;  3NAU A;  1DP3 A;  2M8E A;  2DT7 B;  2LMD A;  1ETY A;  4XNF A;  4YG2 F;  3J7A O;  1E3O C;  1R7J A;  1T0F A;  3KP2 A;  4G12 A;  3W6J B;  4P6Y A;  2DIE A;  3HRT A;  3AL0 B;  3MZY A;  5GP9 A;  5DCM B;  1YS6 A;  1Q86 D;  2O04 A;  1CQX A;  2BF4 A;  3FXJ A;  5L3D A;  2VQH A;  3SEQ A;  3OL3 A;  1QRY A;  2JA8 J;  1KQS B;  5HOO A;  2OBT A;  2I5U A;  2XAH A;  3VNV A;  4QPQ A;  3J80 Z;  2KHM A;  2XHK A;  4RD6 A;  2MW8 A;  1R5I D;  5CVV A;  1ZH5 A;  3CCL B;  3DKW A;  5KW9 A;  4P3Y A;  5HDN A;  1W5T A;  5FD6 A;  1I6H J;  5CVU A;  3S1N J;  1NK3 P;  3SJP A;  2OC6 A;  4D0P A;  3GQB A;  2Z6B D;  2OTL B;  2OA4 A;  3U21 A;  2KRH A;  4UVC A;  4XK4 A;  1Y0U A;  2ZXW H;  1KON A;  2KT0 A;  2NYX A;  2CW8 A;  3F3X A;  1FIP A;  3LA3 A;  4RA2 A;  3ROU A;  4BJT A;  2M0M A;  3O8G A;  2BM1 A;  1HA8 A;  2VFP A;  2Z5U A;  1VQL B;  2A69 F;  2DMN A;  2X4H A;  3ZQQ A;  2E5Z A;  5HS8 A;  2VFM A;  3RKX A;  1TZL A;  3QFS A;  4CO8 A;  3PEN A;  1QRB A;  1P7I A;  1ZTR A;  2JK3 A;  2CQX A;  3RYR A;  3HOS A;  4DYR A;  5B1A H;  5IYR A;  1U5T B;  2WV0 A;  3HXL A;  4CCN A;  4BBS J;  3L2R A;  1YJW B;  1VLY A;  2PLF A;  3G4S B;  3I3L A;  5FJ8 J;  1P92 A;  3OAA A;  1I3Q J;  4P9U A;  3HDD A;  2BM7 A;  4AF6 A;  1EP3 B;  1VJS A;  1DAB A;  3A4C A;  2XGC A;  4PGG A;  1WZ2 A;  1N05 A;  1SVL A;  3AST A;  3MD2 A;  4U0V A;  4C2T A;  2CUF A;  2RC4 A;  4WXH A;  2ZME A;  4YIR X;  3OMY A;  4RCY A;  4F52 A;  3CPW B;  4IHY A;  4GQN A;  3PIO F;  1U8B A;  3H5N A;  5IT3 A;  1MMD A;  5B66 C;  4M2L A;  3WG9 A;  2DMP A;  2QM3 A;  5ILU A;  3SXY A;  1R1V A;  2DA1 A;  1F1Z A;  2LBF A;  5GAG J;  3JQQ A;  1GDT A;  1QHH D;  2HOT A;  3FKS A;  3W2H A;  1ZG5 A;  5GAD J;  1T08 B;  4BXF A;  3E5X A;  2PEC A;  4RAG A;  1T6Z A;  4XR6 A;  1IZ1 A;  2M9H A;  5EDN A;  5J3L A;  3EUK L;  1JA0 A;  1G7R A;  2NT9 A;  4BEH A;  3ZQG A;  3N05 A;  4W1U A;  2IA2 A;  3FF5 A;  3H5A A;  5FKK A;  2PLY A;  3LQ6 A;  4UZU A;  2M1B A;  3L9F A;  3AGQ A;  1O7L A;  3HKZ N;  5LEK A;  2E2J J;  1RRJ A;  2EFQ A;  4QHY A;  4HRI A;  2HPM A;  4IF4 A;  5DCM A;  3Q9V A;  1SAN A;  4LMY A;  1PDN C;  1HQC A;  3FMQ A;  1Z6T A;  3S1M J;  4M3E A;  1ZN2 A;  1IJF A;  4BHB A;  4RLF A;  1TWA J;  2DA3 A;  3V76 A;  5D6E A;  3T53 B;  2H8W A;  4L9V A;  5K7H A;  2W85 A;  3KX2 A;  4NBQ A;  3BC9 A;  3LSG A;  4P26 A;  2BSP A;  2H27 A;  2A05 A;  1OR7 C;  3E0J B;  4AU7 A;  4I02 A;  3G6E I;  2JA2 A;  2Q6L A;  1Y39 A;  2AO9 A;  5LFA A;  2PE3 A;  2Y48 A;  3RSN A;  4CIC A;  2YWH A;  4M9S A;  2FNA A;  4G6Q A;  2VE8 A;  2KIU A;  3MN2 A;  3EQN A;  2PX9 A;  1X4O A;  4DYQ A;  1O8E A;  1FYM A;  3BR6 A;  3SY2 A;  3I1F A;  1K7A A;  3BR1 A;  1CNE A;  2Q0O A;  1DDN A;  3GTK J;  5HLH A;  3A01 B;  2A68 F;  1DGW Y;  2VBV A;  4EJW A;  2M2E A;  2VI6 A;  2L9R A;  2NS7 A;  2PN6 A;  4NNJ A;  4HNT A;  1N78 A;  3M7G A;  5J8F A;  1JJ2 B;  2CW5 A;  1CLW A;  4LD5 A;  4CYC B;  3W2E A;  4LG3 A;  4ACA A;  4FE4 A;  3Q6Q A;  1U5T A;  1BPL A;  4XQF A;  1AWC A;  5D5W B;  2XZL A;  4A3B J;  3U6B A;  5LD2 C;  3VEP A;  3OW2 B;  5A2Q Z;  1R4N B;  2G7H A;  2PFB A;  3A0B C;  2QEX I;  3F0C A;  1U2R A;  3IV5 A;  3A3G A;  2YX7 A;  1IO2 A;  4NCN A;  4FWT A;  2K9M A;  2KZV A;  3I55 B;  1FSE A;  2GOM A;  2VJ4 A;  3RPU A;  1DBO A;  1ZRD A;  5FKN A;  5JVT A;  3QAH A;  2V31 A;  4A0Z A;  4A3E J;  2Y0S A;  5IT9 Z;  2HZT A;  4RD1 A;  1IW7 F;  4TN1 A;  1UAA A;  3LYC A;  3DBR B;  1REP C;  2HNH A;  2IPQ X;  3ONU A;  2E7X A;  4B4D A;  3OYL A;  4BY1 J;  2FX3 A;  2FSW A;  3QP6 A;  1M90 D;  4PC2 A;  4Y13 A;  1W1W E;  2EZK A;  1OB5 A;  3R6K A;  3QYF A;  5LLQ A;  2EFP A;  2LNB A;  3KP3 A;  1YJ9 I;  1N08 A;  1RZ4 A;  4PUS A;  3LQR A;  4XSZ F;  3V7S A;  3GYH X;  2ZBU A;  3JRH A;  2VAS A;  1LFP A;  1EFC A;  5BSX A;  3TOB A;  1GAQ A;  1WMR A;  1ZR2 A;  1YOV B;  4BE0 A;  5KHD A;  3LJY A;  1N07 A;  2Q1Z B;  3VPR A;  3M9A A;  5E8I A;  2E1N A;  3FXM A;  1WCM J;  2D1H A;  1FOK A;  2R7V A;  4QV2 A;  2QYU A;  2Z3Y A;  4OAY A;  2BE5 F;  1L1I A;  2J5P A;  4B44 A;  2PIA A;  4BQQ A;  1MMA A;  1YW9 A;  3JTH A;  1TYU A;  3WE2 A;  1RUN A;  2HR3 A;  1G3T A;  2I8D A;  2WJY A;  1IDJ A;  1QCX A;  4ASU A;  5DYM A;  1QPI A;  2L01 A;  3SZE A;  3I9V 2;  1W35 A;  2KRC A;  1BA5 A;  2OCC H;  3OP1 A;  3BH4 A;  3E6C C;  2EA4 A;  3A1Y A;  4GYI A;  1H9G A;  4FTH A;  1IUY A;  3ZR8 X;  1JE8 A;  2CG4 A;  1K79 A;  2VT3 A;  5K7Z A;  3QFC A;  1Q7Y D;  2ID3 A;  3HOU J;  2KJB A;  2V6C A;  4KIG A;  4JBA A;  4BS9 A;  5FLX Z;  3BQJ A;  4BHC A;  1XSX A;  1MZB A;  2V7U A;  2CQK A;  1O8M A;  1LEB A;  3S3M A;  1G3S A;  4Z1M A;  3PO2 J;  2F43 A;  3BR3 A;  4IKF A;  3UNG C;  2IEK A;  1UHS A;  3BY2 A;  3G3Z A;  1W87 A;  4EW9 A;  5CLS A;  2CQ7 A;  2M7A A;  3IHU A;  2EV6 A;  1J2X A;  1Z9C A;  1EH6 A;  2VNJ A;  4ZYG A;  2LG4 A;  3A01 A;  1S9H A;  2FJ1 A;  3CO6 C;  2BN4 A;  5J1R A;  5ICE A;  1GXP A;  2BGJ A;  3W2I A;  2OU2 A;  3PO3 J;  4RM0 A;  1MJA A;  3P27 A;  4CYC A;  3MKW B;  3A3B A;  2QUF A;  2DLL A;  3IWZ A;  2JDI A;  5THX A;  1KU2 A;  3S1R J;  2WR8 A;  3LSM A;  1UG0 A;  3W2W A;  2L54 A;  2CK3 A;  3CP2 A;  3NB2 A;  4MEX F;  3RTR A;  2ADU A;  1A6Q A;  2Z33 A;  4IZZ A;  2HOA A;  1SAX A;  4HLY A;  1XQB A;  5EG0 A;  5CVI A;  1EP2 B;  2ZJ2 A;  4JRA C;  2DMT A;  1S0U A;  1O4X A;  3FMR A;  1B4A A;  1AKH B;  2UXX A;  4PJL A;  5H2F C;  4ZTF A;  2K4J A;  1D1N A;  3KP6 A;  3BTL A;  2XC7 A;  2XB5 A;  1YX3 A;  5F08 A;  1TC3 C;  3C7J A;  3W2F A;  4XON A;  4A5M A;  2QDX A;  1ONV A;  1TTY A;  3WU0 A;  2ISZ A;  1EWY A;  2QY1 A;  3GLX A;  1RKW A;  5ICF A;  2IQ7 A;  1TQM A;  4BGD A;  3AKZ A;  2O0V A;  3C3W A;  5D5V B;  1TNT A;  2XF5 A;  3E6B A;  4Y17 A;  1E3Z A;  1TSP A;  2B7B A;  2W7Z A;  4E7S A;  4RAY A;  2V4J C;  2RVC A;  1G8X A;  1HST A;  4IHT A;  2V79 A;  3FM3 A;  5E1X A;  2EZL A;  3H3Z A;  4MQV A;  2JQ7 A;  1DQU A;  2VBK A;  4I98 B;  1BHE A;  3LQE A;  2CV1 A;  2XZO A;  2BM0 A;  3S2H J;  5IYC J;  1VQN B;  2W24 A;  3SZT A;  4ZYH A;  1P4M A;  2LSO A;  2LF8 A;  5EGO B;  1JT0 A;  3AVW A;  2HGC A;  1A31 A;  1F43 A;  4DNT B;  2BY0 A;  1ZM4 A;  2Y0S N;  4A3G J;  4DYC A;  1BM9 A;  2JTV A;  1FT9 A;  3FKI J;  5J47 A;  1BI3 A;  5F64 A;  1LEA A;  3ABL H;  3TO9 A;  3OR2 C;  1YFH A;  4P5O A;  3M8E A;  2DK8 A;  2H09 A;  4XMY A;  3MFK A;  3B82 A;  1TYX A;  4RD2 A;  3CCJ I;  3LA2 A;  1BN8 A;  4WWC A;  1WJ5 A;  2K3F A;  4BNC A;  3MMP A;  4B09 A;  2HZD A;  2BXY A;  1J09 A;  2EFN A;  3JRG A;  1VQ6 B;  4YXW A;  4QPO A;  1BIA A;  2A5W A;  2FU4 A;  3C2H A;  3LMM A;  4CH7 A;  2XTX A;  3TDU C;  4J01 A;  2F5C A;  3GZN B;  2VJJ A;  3DV8 A;  4CZC A;  3WTS C;  3CES A;  4TMX A;  3CJQ B;  4ZYA A;  2JJ7 A;  1B72 A;  3WHB A;  1I50 J;  2HKX A;  4FIS A;  2A07 F;  2X0L A;  3VSV A;  3GTP J;  2R7Z J;  1X19 A;  2QYO A;  3TW7 A;  1BC8 C;  2HEO A;  3K4J A;  3JR9 A;  4KN4 X;  2XND A;  2YWG A;  4LJZ F;  4X05 A;  3FIS A;  1K5C A;  3LNQ A;  2MYS A;  2W1O A;  1VQ4 I;  1B2R A;  1EJ9 A;  3OSF A;  2LFB A;  1FNB A;  2XF7 A;  3GTM J;  2EIK H;  1QFJ A;  2DET A;  3K10 A;  2JJ2 A;  1IC8 A;  3E1Y E;  3OYG A;  5BPI A;  3BT9 A;  5HS9 A;  4RCZ A;  2CUJ A;  1ERD A;  4B48 A;  3MWM A;  5FO0 A;  2UXN A;  3HPH A;  5J40 A;  3GVJ A;  1P9Q C;  3DFG A;  1GQ8 A;  3Q5F A;  1W0K A;  4OPV A;  4EJU A;  4BDZ A;  1TT5 B;  2LRD A;  1ZG3 A;  3HSR A;  1P6R A;  4ENK A;  1NB0 A;  4A2U A;  3CF2 A;  3BPX A;  2YU9 J;  3WOD F;  2VNI A;  1EFU A;  2VC1 A;  5GAH J;  4IRH A;  4CQJ A;  4AID A;  1B9N A;  2CSO A;  3CUQ B;  1AKH A;  1IJE A;  3PL8 A;  1ELO A;  2CBX A;  3LQQ A;  2W4S A;  1MND A;  3HRM A;  4P25 A;  2RN7 A;  3BY6 A;  2YWE A;  3BC8 A;  4ZC3 A;  2HVS A;  3JRI A;  3DEE A;  1Y56 A;  2QQ8 A;  1D0X A;  1FYK A;  1E0E A;  2RV8 A;  2ZTG A;  3GUD A;  5TR9 A;  1WJD A;  4UY8 I;  3I58 A;  1X3U A;  3TOA A;  4W97 A;  2K86 A;  3PSI A;  3HGY A;  4LC0 A;  2F5D A;  5K7F A;  1T98 A;  4ZCL A;  4OIN F;  3T56 B;  4Z4Z A;  4Z4W A;  3BR2 A;  4L5I A;  1K4T A;  2V7W A;  1ZYR F;  1WSU A;  3M1E A;  3CJN A;  1VQ7 I;  1ETK A;  4Z4Y A;  3ZC3 A;  2VFO A;  1F9N A;  3K4N A;  3VSK A;  3CME I;  3WU2 C;  1JKR C;  1QBJ A;  2HWV A;  5EMN A;  2QX3 A;  2A5Y B;  3GFL A;  1K6Y A;  4PSX A;  3BR5 A;  3QRF F;  3HOT A;  4QVJ A;  3AVU A;  4X7F A;  1FMW A;  4GO1 A;  2V7T A;  2O7O A;  3CJT B;  1OCO H;  1QZE A;  2OJE D;  3EUA A;  4LLL A;  1XSD A;  3DWL E;  1MBG A;  3TO7 A;  4E0F A;  1Z05 A;  3I56 B;  3I53 A;  2KLO A;  4ZDP A;  4DZJ A;  2EIM H;  2OK7 A;  3AG4 H;  1S7O A;  1XD7 A;  1PUF B;  5CDF A;  1Z91 A;  1TYV A;  4Z4V A;  3H5R A;  4BE2 A;  4GYG A;  2QSG X;  2ID6 A;  4NC6 A;  2ODL A;  2V7F A;  2JUG A;  3ONQ A;  5KAI C;  3KP7 A;  3EUH A;  3S8P A;  1MMS A;  2R7D A;  1SKQ A;  4AIJ A;  5E6T A;  3NAW A;  2L4M A;  1K73 D;  2R7U A;  5D4R A;  4MLO A;  4RDU A;  2P7C B;  2X48 A;  3E5Q A;  3QPH A;  4MGR A;  3I0T A;  4XSX F;  3MCZ A;  3G05 A;  1QRC A;  2WY8 Q;  2GAU A;  3ZQ7 A;  2KKO A;  4E4H A;  2PI0 A;  3CCM I;  1Z21 A;  4LB5 A;  3HOY J;  2DOG A;  1MIJ A;  2JWT A;  3VOD A;  5M5W J;  3E20 A;  5B6I A;  1EH8 A;  1XC5 A;  1YRN B;  3QPL A;  1W36 D;  1BW5 A;  4M74 A;  5H6R A;  2ECC A;  4MFE A;  1S72 B;  4IQ4 A;  3K1M A;  5J3O A;  3G71 B;  1Y0R A;  5GAE J;  1LE8 B;  1WP6 A;  2Y2Z A;  2ZL7 A;  2V4D A;  2KP6 A;  2O3F A;  1BX0 A;  1Y0Y A;  4DQK A;  2BOL A;  4KIF A;  2DPU A;  1P2F A;  2JIZ A;  4OIO F;  1RWR A;  2VBS A;  2WB1 N;  5BS6 A;  2C5H A;  2HU9 A;  3I59 A;  3FKJ A;  1YLF A;  3DBH B;  1Q81 D;  2G0E A;  2BY2 A;  3CDH A;  4IXA A;  2ZZG A;  3OR1 C;  3GVK A;  4ZGN B;  1RKT A;  2KDO A;  4RDL A;  2R5Z B;  3ASQ A;  4ROX A;  3M07 A;  2V9P A;  1VQ9 B;  4BQN A;  2DK5 A;  2FOK A;  2HQ5 A;  1JI8 A;  4A5N A;  4Y33 A;  2KMU A;  4C2M J;  2V1N A;  3H9N A;  4I99 C;  1RIO H;  2VKH A;  2CRV A;  2XGJ A;  2F2E A;  1NBM A;  4LK1 F;  2LLK A;  1X58 A;  5J4Y A;  4LLN A;  1KK0 A;  5JLX A;  3Q9S A;  3JTG A;  1U9O A;  2CH0 A;  1LJ9 A;  1LDK B;  1BJA A;  4XKV A;  4FE7 A;  3BWG A;  4PMH A;  1IAW A;  4K2E A;  1G7S A;  3TQN A;  2OBP A;  1KMH A;  2C6Y A;  1GUU A;  3AG1 H;  1W34 A;  3CCQ I;  2ZO4 A;  4MEY F;  1QA2 A;  1FRN A;  1Q1H A;  3KLN A;  5E17 F;  4V02 C;  1QZZ A;  3LAJ A;  4OPW A;  2K9N A;  4I6Z A;  3K4L A;  3H0D A;  1FOX A;  4A3M J;  2WC2 A;  3HOX J;  4GDF A;  2BPO A;  2RKH A;  2M45 A;  2R3S A;  2QF7 A;  1WFX A;  2EA2 A;  3TL4 X;  4RPD A;  4YRV A;  1BW6 A;  4S0H B;  2NVQ J;  1J5Y A;  4KIB A;  1PUF A;  2DU9 A;  4XOT A;  1T95 A;  3ZOB A;  4A3D J;  2MH2 A;  2D5V A;  5F04 A;  3M3Y J;  1K8A D;  3QQA A;  3VDX A;  4YDT A;  5DS9 A;  2RDP A;  2VXZ A;  4RJL A;  3ZSC A;  4A3K J;  5C4X J;  3HG9 A;  4P22 A;  4ENN A;  2CV0 A;  5IP6 A;  4A3F J;  1T6Y A;  1LVK A;  1S6L A;  3VST A;  2XKP A;  5KCM A;  2UVF A;  2ME0 A;  5BQT A;  4BDY A;  1IN5 A;  1R58 A;  1SFX A;  2EWN A;  3BH6 B;  4NK8 A;  4BJ5 C;  4CA0 A;  2KVO A;  4TSF A;  3LMW A;  1ZAO A;  2ZBV A;  2VB6 A;  5CJ9 A;  4RB2 C;  1YRN A;  4NB5 A;  1QGZ A;  3OS0 A;  4GFB A;  4NDL A;  1YJN B;  2A61 A;  3SYJ A;  3OYM A;  1UST A;  4YAO A;  2TRT A;  1K78 B;  4X7E A;  1BL0 A;  2H1L A;  3QU6 A;  5FRO A;  1BR2 A;  2QGU A;  4O5V A;  2BBY A;  4IHV A;  2GQF A;  1CZF A;  1BI1 A;  1UD2 A;  1ORK A;  2ZXH A;  2HXO A;  2BHY A;  3MVP A;  3R4K A;  1WJA A;  2DEU A;  1V5G A;  3OOP A;  1X2N A;  3RQ4 A;  3U9G A;  3BTC A;  4MFD A;  4WK8 F;  3S14 J;  2EIL H;  2IXS A;  5F1J A;  3COA C;  2X8K A;  1X0C A;  5J6X A;  4FCY A;  3ECO A;  3ZQH A;  4Z05 A;  2BV3 A;  3ULQ B;  1BJZ A;  1VQ5 I;  1VLO A;  3PSS A;  1UJ8 A;  1V55 H;  2ZL5 A;  4YEJ A;  4B3X A;  1T6S A;  2R5Z A;  1TQP A;  2V9K A;  3QPT A;  2CFX A;  3T8R A;  3BG5 A;  4UZE A;  3HEF A;  3ZZT A;  3AL0 C;  2DPD A;  4PJN A;  2ZME B;  2ZXI A;  2YPR A;  1S3J A;  2W7N A;  4HE6 A;  3S2W A;  5E8G A;  1YI2 I;  2JPC A;  3FHN A;  3V8J A;  3OYH A;  1O88 A;  4PSW A;  1R49 A;  1V5V A;  3GZ5 A;  3ASS A;  2FXA A;  3D5L A;  1I7P A;  2R5Y B;  3FXO A;  1XB4 A;  3CCV B;  1VQP I;  2QMU A;  3B73 A;  3GRH A;  2NS0 A;  4KYW A;  3ERM A;  2QTZ A;  3FJO A;  2J8I A;  3V7A A;  3SLD A;  3Q0U A;  2IW5 A;  1LNW A;  2DA2 A;  1BMF A;  2L0K A;  1ZM3 A;  5HKK A;  3CMA I;  2X3U A;  5JLV C;  5AMV A;  2EIJ H;  4ACB A;  1E1R A;  3KEO A;  3LSP A;  1BLI A;  1XS9 A;  2P3M A;  3RI4 A;  4DZP A;  1QUF A;  4BEH B;  1A8P A;  3FBI B;  4MO7 A;  1PJR A;  1IRF A;  2W6I A;  5L3G A;  2FE3 A;  4H4K C;  2XAS A;  3HHH A;  2HKO A;  3N90 A;  2WAF A;  1TVC A;  2W6J A;  3LA7 A;  1QVT A;  3W2A A;  4RM3 A;  4HQE A;  4Q7J B;  4PCQ A;  4PGH A;  4CSW A;  2PMH A;  1VTN C;  1U5T C;  2C77 A;  4A69 C;  5JHF A;  3HTS B;  4FX0 A;  4YAL A;  1XG2 A;  4J19 A;  1OCP A;  4A3J J;  4RLZ A;  1X1B A;  1XCV A;  3RQI A;  4A3L J;  1TWC J;  3DTK A;  3LFK A;  3QOD A;  5FB2 A;  2XF6 A;  3BR0 A;  3IKT A;  2HOS A;  3LSI A;  2Q2E A;  1NG7 A;  3QPS A;  1B8I A;  1OYY A;  3BQZ A;  4HAM A;  2VUM J;  2JJ1 A;  3GQ9 A;  2PYH A;  2X6X A;  1A35 A;  2RGV A;  3SFZ A;  2NZM A;  4LIV A;  2ELK A;  3PET A;  1KU3 A;  3HBL A;  4FN5 A;  3Q39 A;  2BM5 A;  5DSZ A;  3ELK A;  3CCU I;  2DOA A;  2GXB A;  1RNL A;  1OQY A;  4QIW N;  3DQV C;  4IRI A;  1RQP A;  4C0S A;  1P4X A;  1K78 A;  2VKV A;  3P26 A;  4C3J J;  3NE5 B;  2L9V A;  1WH7 A;  5IY5 H;  1W0T A;  3CC4 B;  5M5Y J;  4O3M A;  1G3W A;  1IV6 A;  2M4K A;  3FMS A;  3H9G A;  2MFZ A;  3FM5 A;  4V2F A;  4OAZ A;  4YEL A;  1DPR A;  3FXU A;  1HF0 A;  1KYW A;  2KQR A;  5HNF A;  2LDU A;  2IA1 A;  3L2C A;  2VE9 A;  1NRK A;  3E3V A;  3B8Y A;  3HOV J;  4G6I A;  1IHM A;  2CC2 A;  1ZGJ A;  4YHB A;  1UD3 A;  4E7I A;  1HW5 A;  1JRG A;  1KQ5 A;  2XGD A;  1U2W A;  1OOC A;  3CC7 I;  1S4M A;  1R6R A;  4P55 A;  5A2Q K;  2ISY A;  2STW A;  1JT6 A;  2CJJ A;  2BYV E;  4MNU A;  4RLQ A;  1UD8 A;  4KKU A;  1TLL A;  3HSF A;  4HW0 A;  1NHC A;  4XN0 A;  2CW0 F;  3AVT A;  4L0Z B;  1ZUN B;  5IT9 K;  5KSW B;  2B7E A;  3FXL A;  4LBW A;  3OIP A;  4XBF A;  1H42 A;  1KCC A;  1YX5 A;  4XRS A;  4WXD A;  1SD7 A;  4W8Q A;  2C5B A;  3O3K A;  2X9D A;  2O1D A;  2XTY A;  3GEZ A;  3H09 A;  2R5Y A;  1HSJ A;  1ZM2 A;  3D1N I;  1FEX A;  2CYY A;  3DEU A;  1WJF A;  5HNH A;  3NWT A;  1H85 A;  1VZ0 A;  2W82 A;  4FT8 A;  1G7C A;  2ESN A;  4HNU A;  3WNB A;  3KIO A;  4KT6 A;  3AVV A;  4HOB A;  1E3H A;  2VXD A;  2MD0 A;  2ZNZ A;  2INV A;  5H59 A;  1GXQ A;  2OTJ I;  3BTJ A;  1VQO B;  2VJ5 A;  4EJT A;  1IGN A;  3MKZ A;  3CC2 B;  2V9V A;  1QNT A;  5FGM A;  1A5J A;  1PP8 F;  5AON A;  5BOX A;  1TWF J;  3DCF A;  2EZH A;  1BI2 A;  3L00 A;  5HDK A;  1H89 C;  2R7X A;  3H0G J;  4MYU A;  1SD5 A;  1APL C;  1QGA A;  1NTC A;  3ZUG A;  1TP4 A;  2MC4 A;  1TBX A;  2XPV A;  4KMF A;  2JT1 A;  2EIX A;  1HG8 A;  2BM4 A;  1X1A A;  2FA5 A;  5LGN A;  1D1C A;  4E7Z A;  1YQA A;  3SDB A;  3PA1 A;  1UCR A;  3EYY A;  5EF6 A;  1S8N A;  2EK5 A;  5KAF C;  2K5C A;  3ZMS A;  5HZA A;  3FIW A;  3LVB A;  2O17 A;  3ZXS A; 
#chains in the Genus database with same CATH homology
 4MXN A;  1YX3 A;  3JUR A;  1OFL A;  4XON A;  4AYB A;  2LY1 A;  1UD6 A;  2QKL B;  4U7B A;  2E5N A;  4KIS A;  2QKM B;  2WAE A;  3GQ7 A;  3LSK A;  1OHH A;  2HPI A;  2K3P A;  2QY1 A;  4OJ5 A;  2IQ7 A;  4XKB A;  2BVM A;  4BGD A;  3VR6 A;  3PNY A;  4XLC A;  4E7J A;  3DU5 A;  2ZTN A;  4B3G A;  1O8I A;  3AKZ A;  2O0V A;  4OZZ A;  4PJM A;  3S32 A;  2WPD A;  2XF5 A;  1E3Z A;  4E7S A;  2WAQ A;  4DIQ A;  2V4J C;  5HVQ C;  2CFO A;  2WY7 Q;  3QYB A;  4HEA 2;  3KEY A;  1V0E A;  2WA0 A;  1D0Y A;  1G8X A;  4JQF A;  2LY2 A;  2VLA A;  4LIT A;  1N77 A;  1E43 A;  3DPU A;  1DQU A;  2VKD A;  2VBK A;  4GRI A;  3K70 D;  3SZG A;  1BHE A;  2R7Q A;  4XL9 A;  2CV1 A;  3CMM A;  2IS6 A;  3PNT A;  3H94 A;  2HQA A;  2OV7 A;  4U87 A;  1KCD A;  1T5E A;  3IAM 2;  3VSL A;  4TT3 A;  3QOE A;  5C1E A;  4DNT B;  1O8J A;  3UW0 A;  3OEH A;  1Y6I A;  3OYD A;  4YZQ A;  2R7T A;  4OWR B;  3OR2 C;  2L7K A;  1BR4 A;  4P5O A;  4XMY A;  2LH9 A;  5FRN A;  4YZA A;  1BN8 A;  2MAB A;  2X53 S;  1WJ5 A;  2AQE A;  2HZD A;  1COW A;  1J09 A;  4XLE A;  3DKY A;  4YXW A;  4QPO A;  1O8H A;  2A5W A;  3C2H A;  3LMM A;  3QYE A;  4HG2 A;  4CH7 A;  3L2W A;  1RU4 A;  4J01 A;  1O8G A;  4CZC A;  2VJJ A;  3CES A;  3CJQ B;  4ZYA A;  2VQL A;  2Z2S B;  4PJJ A;  2PMZ A;  1PYV A;  1GLN A;  2UV1 A;  3VSV A;  2LOO A;  3L2V A;  1X19 A;  3AFH A;  1Z3X A;  2X1C A;  2XND A;  3K4J A;  2ZZE A;  1K5C A;  2IGN A;  2QE7 A;  2AQF A;  2MYS A;  2W1O A;  2VBE A;  4HSR A;  2VIX A;  1H80 A;  3K6G A;  3E1S A;  1QJV A;  1EE6 A;  3BCF A;  2XF7 A;  1WPC A;  3LL7 A;  3TMO A;  3K10 A;  2JJ2 A;  3VMW A;  2R9V A;  4XOR A;  3K4K A;  2V7Q A;  3OYG A;  4XD7 A;  4D9J A;  3WWG A;  1JTA A;  4F93 B;  4W8S A;  3VMV A;  2CUJ A;  1ERD A;  4B48 A;  3IAS 2;  3J7A Y;  2LC2 A;  1MAB A;  2WJV A;  2PYG A;  3HPH A;  3GVJ A;  2QXZ A;  1P9Q C;  4E7H A;  1PLU A;  1GQ8 A;  1W0K A;  4BDZ A;  1PXZ A;  2LRD A;  3NWS A;  2V26 A;  1TT0 A;  3CF2 A;  2XSJ C;  1X1C A;  2DJI A;  3DPL C;  1DBG A;  3OEE A;  3OPO A;  3PL8 A;  4IX7 A;  3GVL A;  2O5R A;  2F1M A;  2W4S A;  1MND A;  4BE1 A;  1O8L A;  4I84 A;  2D3L A;  3BC8 A;  4HPQ A;  4ZC3 A;  2HVS A;  2WAD A;  3HPG A;  5KNL A;  4TKO B;  3DDY A;  3DEE A;  2DXI A;  3L2Q A;  1Y56 A;  3K70 C;  1D0X A;  4PFP A;  1O8D A;  1HVX A;  4KKS A;  1E0E A;  2ZTG A;  1WJD A;  2ZSI B;  2CV2 A;  3GBG A;  1K28 D;  4Y4R A;  3PSI A;  3OYA A;  3BCA A;  3V42 A;  1G59 A;  3MMY B;  3T56 B;  5C1C A;  2INU A;  4OZY A;  3FBN B;  4F55 A;  4XKW A;  2W00 A;  3K4N A;  5CPR B;  3VSK A;  1SKY B;  2WZP P;  2QX3 A;  1UD5 A;  1OLT A;  1MMN A;  4CCO A;  4HIZ A;  1K6Y A;  2X85 A;  4PSX A;  2XAU A;  3ZPN A;  2F4I A;  1FMW A;  1ZEL A;  4C2U A;  2BVL A;  3EUA A;  3DWL E;  2RRE A;  4E0F A;  3EQO A;  1LKX A;  1MNE A;  4ZDP A;  2KLO A;  3OYB A;  2XOK A;  4C9Y A;  5CDF A;  4ITV A;  3TBI A;  5CKT A;  3T51 B;  3H5R A;  4DBQ A;  4BE2 A;  4W8R A;  4CCL A;  2IGK A;  3F9K A;  2ODL A;  2O0W A;  2V7F A;  2JUG A;  3ONQ A;  3PFY A;  3S8P A;  1V5F A;  1WJB A;  2X1E A;  2K9L A;  4B43 A;  3L2U A;  2VL8 A;  4DGW B;  2R7U A;  4MLO A;  4LIU A;  4F92 B;  3S93 A;  3HKZ A;  4DJA A;  2GJK A;  4HWV A;  1V0F A;  3BLY A;  2R7W A;  3G05 A;  4BQO A;  1U0J A;  2WY8 Q;  4XOP A;  4E4H A;  2L2O A;  3FY3 A;  3GQ8 A;  4ZDO A;  1Z21 A;  2M7B A;  1WTH D;  2OUM A;  2Z16 A;  3PJR A;  3EPZ A;  1W36 D;  3K4M A;  3W3C A;  2F5V A;  2DCE A;  3MKY B;  5CQE A;  4IQ4 A;  1FMV A;  3G2B A;  4DNR B;  1I18 A;  3OYI A;  1WP6 A;  3OYF A;  4XLH A;  1EA3 A;  2LBF B;  2IS4 A;  3BG7 A;  2V4D A;  1O8K A;  2KP6 A;  1IB4 A;  1BR1 A;  2IGM A;  3BCB A;  3ZIA A;  1Z7L A;  1OGM X;  2CS3 A;  1W9X A;  1IDK A;  3M8J A;  2BOL A;  2ELJ A;  3ZRG A;  4B3F X;  3K4B A;  3H9Q A;  1SFK A;  2JIZ A;  1RWR A;  2HU9 A;  3BG6 A;  2V6E A;  3FPP A;  3FKJ A;  2A6T A;  2GK7 A;  2ZZG A;  3OR1 C;  2WB1 A;  4RMN A;  1DP3 A;  3GVK A;  2DT7 B;  4XNF A;  2KDO A;  3IUO A;  2VQG A;  3ZCO A;  4MR0 A;  2DIE A;  4BQN A;  3AL0 B;  1JI8 A;  4Y33 A;  4II2 A;  2KMU A;  2V1N A;  2R7R A;  3GQA A;  2IS1 A;  2O04 A;  2VKH A;  2VQH A;  2ZFU A;  3A35 A;  2XGJ A;  3SEQ A;  3OL3 A;  1NBM A;  3VYT B;  3HL2 A;  4D1Q A;  5HOO A;  2KPM A;  4W8T A;  1E1Q A;  4CCJ A;  4QPQ A;  1YE9 A;  2KHM A;  3DLA A;  4XM3 A;  3A2K A;  2CH0 A;  1D0Z A;  1HZE A;  2LZJ A;  3C2G A;  2NTQ A;  1LDK B;  4XKV A;  4PMH A;  2IGO A;  1PKV A;  1AIR A;  4P1W A;  1KMH A;  2R4G A;  4NQW B;  1OB0 A;  2E1M B;  2OC6 A;  3D5R C;  4FAS D;  3GQB A;  2VQC A;  5CQG A;  2Z6B D;  2ZZF A;  3U21 A;  2KRH A;  1KON A;  3ZXS A;  2CW8 A;  2GJP A;  3OE7 A;  4BAC A;  2WSS A;  3K4L A;  2M0M A;  4BJT A;  3H0D A;  4RM2 A;  3PSF A;  1HA8 A;  3W2V A;  1EFR A;  1QU3 A;  3ZQQ A;  2E5Z A;  1WFX A;  5DN6 A;  3TL4 X;  3HUG B;  1KTW A;  4J00 A;  1TZL A;  4YRV A;  1D1B A;  2HVR A;  3DPT A;  1UD4 A;  4XOT A;  3HOS A;  4DK1 A;  1T95 A;  1KZL A;  2GOX B;  3HXL A;  2GJR A;  4F3Q A;  4OJP A;  4ZDL A;  4CCN A;  1W36 C;  3L2R A;  5IK2 A;  4NK6 A;  1VLY A;  2JSP A;  4R79 A;  1N75 A;  3I3L A;  3OAA A;  3VDX A;  1QHG A;  2VXZ A;  1VJS A;  3A4C A;  3VWB A;  3ZSC A;  3MD2 A;  3HG9 A;  4P22 A;  4C2T A;  2CV0 A;  1LVK A;  4BL0 B;  3OMY A;  3VST A;  5KCM A;  4G6T B;  4XLA A;  4F52 A;  2UVF A;  2WBM A;  4BDY A;  1WJE A;  1VF7 A;  4OJO A;  4GQN A;  2UWM A;  4NK8 A;  4BJ5 C;  4CA0 A;  2KVO A;  3H5N A;  2X51 A;  4TSF A;  3LMW A;  2VB6 A;  1MMD A;  3OS0 A;  2E1B A;  4E6K G;  3OYM A;  2E60 A;  3OOU A;  2LBF A;  2D3N A;  5FRO A;  1BR2 A;  4CCK A;  2M5S A;  3OOC A;  1CZF A;  3RPU D;  1QHH D;  4NC8 A;  3FKS A;  1UD2 A;  5FRM A;  3ZGK A;  2ZXH A;  4BUP A;  2R7S A;  4BXF A;  4JMQ A;  1WJA A;  2XZO A;  4U49 A;  3KRG A;  1V5G A;  2PEC A;  3RQ4 A;  2CMP A;  4XR6 A;  2IXS A;  3EUK L;  2X3H A;  3OIQ A;  2X8K A;  1X0C A;  3S3O A;  4BEH A;  2NT9 A;  2M3A A;  2IS2 A;  3VSU A;  4Z05 A;  3N05 A;  3H5A A;  4UZU A;  3WQZ A;  4YZ0 A;  4G7W A;  2X1D A;  2X6W A;  1WJC A;  4YEJ A;  4NUB A;  4B3X A;  3HOT A;  3KEW A;  3EUH C;  2V9K A;  4Y3O A;  4HRI A;  2HPM A;  2NOJ B;  3BCD A;  3PNV A;  3AL0 C;  4PFO A;  1FX0 A;  4PJN A;  2NSP A;  4F91 B;  2ZXI A;  3ZPP A;  4CUG A;  2W7N A;  1BOB A;  3DKX A;  4RLF A;  3FHN A;  2L5Q A;  3OYH A;  3T53 B;  3BC9 A;  1O88 A;  3KX2 A;  2BSP A;  3LSG A;  4PSW A;  4B47 A;  3OYE A;  3D5L A;  1Z3Y A;  1OR7 C;  3E0J B;  3GRH A;  3RCO A;  4AU7 A;  4E7K A;  3CJR B;  2JA2 A;  3OY9 A;  5LFA A;  1E79 A;  3RSN A;  4Z03 A;  1MMG A;  3SYT A;  5TGT A;  1BMF A;  3H35 A;  2Z8G A;  2UVE A;  5HKK A;  4X0G A;  3D5S C;  2E1M C;  3EQN A;  5AMV A;  1X4O A;  2HDW A;  1E1R A;  1O8E A;  4G7X A;  1OFM A;  1BLI A;  3S3N A;  3B4N A;  2LYC A;  3JU4 A;  4BEH B;  1UEL B;  3FBI B;  3LFU A;  4N4N B;  1PJR A;  3CP8 A;  1DGW Y;  2W6I A;  1SAU A;  2CW7 A;  2VBM A;  4HNT A;  1N78 A;  4H4K C;  4NNJ A;  5FL7 A;  3HC7 A;  4U4B A;  1NG6 A;  3VYS B;  4DK0 A;  2WAF A;  2VJI A;  2XZP A;  2W6J A;  3IP4 B;  2L9S A;  4LG3 A;  1T0F C;  3W2A A;  4RM3 A;  1BPL A;  4XQF A;  4PK4 A;  2XZL A;  4CSW A;  3M1C A;  5LD2 C;  1W0J A;  3VYR B;  5JHF A;  5HLT A;  3A3G A;  1XG2 A;  1VBL A;  4OJ6 A;  2BW3 B;  2K9M A;  1X1B A;  2KZV A;  2GOM A;  1DGR M;  2VJ4 A;  3DTK A;  1DBO A;  3QOD A;  4KJZ A;  2XF6 A;  4FXU A;  3LSI A;  3OFN A;  1NG7 A;  2HLD A;  2V31 A;  4C30 A;  2Y0S A;  4Z06 A;  4XLF A;  2JJ1 A;  4NC7 A;  1UAA A;  3GQ9 A;  3DU6 A;  2PJR A;  2DT6 A;  2X6X A;  3OL4 A;  3HAG A;  2HNH A;  2NZM A;  1RMG A;  2PYH A;  3OWT A;  4LIV A;  2P0W A;  3SUC A;  3OYL A;  2M4G A;  4ZJZ A;  2DOA A;  3DQV C;  1X1D A;  3OW7 A;  3NE5 B;  3VYU B;  3QYF A;  3OS1 A;  2Z1D A;  1V5E A;  4PUS A;  4N4O B;  2M4K A;  3H9G A;  4DBR A;  4YZX A;  2MFZ A;  2VAS A;  4OAZ A;  1LFP A;  4YEL A;  3K4C A;  1E3X A;  2KQR A;  3CZ6 A;  2RNG A;  5HNF A;  1NRK A;  1WMR A;  2UUZ A;  3B8Y A;  1MW7 A;  3OS2 A;  4BE0 A;  5KHD A;  4ANJ A;  4IQJ A;  3SEZ A;  4BJ6 C;  4G6I A;  2HVQ A;  2Q1Z B;  4L8J A;  2R7V A;  4E7I A;  1UD3 A;  1JRG A;  4BU2 A;  1OOC A;  2XDV A;  4OAY A;  4KIT B;  1R6R A;  3KYL A;  4E7L A;  4B44 A;  4BQQ A;  4JOM A;  1MMA A;  1IA5 A;  3T9G A;  4RLQ A;  2Q2E B;  2VPL A;  2I8D A;  1UD8 A;  2WJY A;  4KKU A;  1IDJ A;  2ZZQ A;  1QCX A;  1NHC A;  4XN0 A;  4ASU A;  1I8D A;  2X6Y A;  4XKC A;  2PJR B;  2KL4 A;  4KKT A;  3I9V 2;  2KRC A;  3OIP A;  2L9N A;  3BH4 A;  1KCC A;  4HST A;  3A1Y A;  1YX5 A;  3DTI A;  4DOZ A;  1O8F A;  4W8Q A;  3ZR8 X;  2NT6 A;  3B90 A;  3FDY A;  2O1D A;  3OYN A;  4ZTJ A;  2NST A;  2RQQ A;  1WJF A;  2EWE A;  5HNH A;  3NWT A;  4BS9 A;  3OYC A;  1VZ0 A;  2W82 A;  2JVH A;  4HNU A;  4KT6 A;  2NTP A;  4C2L A;  1O8M A;  2VXD A;  3S3M A;  2MD0 A;  4FET A;  1H8E A;  4Z1M A;  3PUB A;  3OYK A;  2F43 A;  2INV A;  4IKF A;  3UNG C;  4OJL A;  3LSH A;  2VJ5 A;  2GK6 A;  2FUG 2;  2JVG A;  4EW9 A;  1D1A A;  2M7A A;  3MKZ A;  2ZSH B;  1H8H A;  2LG4 A;  1S9H A;  1AA7 A;  4URR A;  2R7X A;  1OGO X;  3H9J A;  4CCM A;  2MC4 A;  3MKW B;  3A3B A;  4AVZ A;  2JDI A;  3LSM A;  1UG0 A;  3W2W A;  2R7O A;  1X1A A;  3CP2 A;  2CK3 A;  1HG8 A;  3RTR A;  3OYJ A;  4IZZ A;  1D1C A;  2LRE A;  4E7Z A;  3SDB A;  3LNN A;  2BW3 A;  4XN3 A;  3DTE A;  1PE9 A;  2NTB A;  4PJL A;  4II3 A;  1IRX A;  4ZTF A;  3UR3 C;  2K5C A;  2CUZ A;  4EAT A;  2F6C A;  2XC7 A;  2O17 A;  1X4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...