4XOTA

Tailspike protein mutant e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xotA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xotA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xotA02
2PYGA 1OGMX 2VBKA 1O8DA 1RMGA 1GQ8A 1OFMA 1CZFA 1JRGA 2NSTA 3JURA 2X6YA 2VBMA 3VSUA 4OZZA 3ZPPA 3T9GA 2IQ7A 4XLCA 4U49A 3GQ9A 1K5CA 1VBLA 4W8TA 2UVEA 1PLUA 1IA5A 2X6XA 4XORA 1QCXA 3GQAA 1HG8A 2Z8GA 3B4NA 1H80A 4U4BA 4Z05A 2EWEA 2INUA 4W8RA 4AVZA 3WWGA 1IB4A 5C1EA 1OGOX 4OJLA 4XLHA 2QX3A 4I84A 1OOCA 4YELA 1QJVA 3GQ8A 2NTPA 1O8GA 1DBGA 2O0VA 2QY1A 2O1DA 3KRGA 2X3HA 4XMYA 4C2LA 2NSPA 2NZMA 4XOTA 1BN8A 3UW0A 4MXNA 4XN3A 1XG2A 1O8IA 3B90A 4OJ5A 5AMVA 4XM3A 4XN0A 2BSPA 1X0CA 3VSTA 1IDKA 3LMWA 1AIRA 1RWRA 1EE6A 1OFLA 2NT6A 4Z03A 1KCCA 2O0WA 1WMRA 1JTAA 2PECA 3B8YA 1O8HA 4XLFA 1O8KA 1NHCA 4XR6A 4XOPA 4XNFA 1BHEA 2QXZA 1KTWA 2VBEA 4YZAA 1RU4A 1O88A 3EQOA 4XKVA 4YZQA 2NTBA 1O8JA 1O8MA 4XQFA 4OJ6A 3EQNA 4XLEA 2O17A 4XLAA 4YZXA 3SUCA 1DBOA 4NK8A 4OJPA 3FY3A 4XONA 4W8QA 3VMWA 3VMVA 2NTQA 4W8SA 2PYHA 4XL9A 1O8LA 4OJOA 2X6WA 2NT9A 1PXZA 2UVFA 4OZYA 4MR0A 1O8EA 3GRHA 2O04A 1KCDA 3GQ7A 1O8FA 2INVA 1PE9A 4EW9A 4Z06A 3VSVA 5C1CA 4NK6A 4PMHA 3ZSCA 2X85A 4HWVA 2ODLA 4XKWA 4URRA 1IDJA 4YEJA 2VJIA 4YZ0A 2VJJA
chains in the Genus database with same CATH superfamily
1XB4A 3JSOA 4MQ9F 5DV5A 4EATA 2BGCA 4GYIA 2JSCA 2RNJA 1S5LC 4XRFA 1R58A 5FRNA 2QVOA 2L7MP 1U6GA 2M87A 3CD6B 2X6YA 2YS9A 1AIPA 1HCRA 1GHCA 1EWYA 5E17F 3CMMA 3ML3A 2XAFA 4MIMA 3DLAA 1A36A 4W8TA 4N3NA 4RD0A 4Z4UA 4RLQA 1AWCA 3FZVA 5FLMJ 3SEZA 3PQJA 3JW4A 1EF4A 2IP2A 1ZRDA 5BSXA 1VQ9B 1VQKB 3T51B 4Z05A 3GEZA 3U21A 3RDIA 3Q3AA 3SJZA 2LY9A 2L9VA 3ZC3A 3JRHA 3U6BA 1VF9A 4HQMA 2XASA 2RGVA 5FL7A 1B4AA 1V3FA 4A12A 4HBLA 1DARA 2X53S 3BH4A 4IHVA 4QHYA 5LGTA 2CFXA 1D1BA 2M4GA 5EGOA 1YTYA 1G2HA 3V7AA 3LFKA 1DG1G 5LGUA 4BE2A 2ETHA 2HOAA 5AIQA 3OS0A 4BBSJ 1MMDA 5JFRA 4RD3A 2F5VA 2D9RA 4U88A 4H0EA 2V9PA 4XN3A 1D3YA 1P9QC 1RRJA 3S1QJ 5DD4A 2FBKA 3IP4B 4A5MA 1OYYA 3HL2A 1QFJA 4UZUA 3HTUA 2BSPA 1CGPA 2ZBVA 4YAUA 4L0YB 4ESJA 3DP7A 3DU5A 3FF5A 3QPLA 3IRQA 2ZMEB 3PETA 1KCCA 2WAEA 2DBBA 3MKLA 4L0ZB 2DI3A 2LTPA 4KYWA 1B72A 1FTZA 4XLFA 1YJWI 3HIFA 4L5JA 4RLFA 4DYRA 5GPCA 1WOOA 3CF2A 1MBGA 4RM3A 1QU3A 3OJXA 2ZNYA 1QNTA 2Y9YA 4EM1A 5IYPA 4HE5A 2V1NA 3WHCA 3BTLA 3WE3A 1COWA 2G7HA 2IGOA 4XQFA 5DM7F 2ZXJA 5HDNA 1JNYA 1T6SA 1ZRFA 1MRZA 3CJTB 4G1BA 1ZQ3P 3EDPA 2Y30A 1LFUP 1DBOA 2KZGA 3AG1H 4M73A 3P27A 1ZH5A 4YRVA 2B7CA 4LG3A 1UZCA 1XQBA 2IS2A 2DDAA 2ZJQF 1WVRA 1NB0A 3BR3A 3HRSA 2GQFA 2JK3A 4G7WA 1QA2A 2E2JJ 5H59A 2H94A 3OY9A 4MHGA 4YAWA 2DCEA 2FQ3A 3QYFA 4M71A 4J00A 2HCJB 2P7VB 4AU7A 2INVA 1A35A 3GUDA 3K6GA 3CCSI 2E19A 2DIEA 2NT9A 4G7XA 2JT1A 4I0BA 1SFKA 5F04A 1W5CC 3BZCA 1KTVA 3ASSA 3HSRA 2MGQA 3PUNA 2P8TA 2HKXA 4AUXA 4G6QA 4CCKA 4HV6A 5BMZA 1IG7A 3W2WA 2FXAA 1FTTA 4OPSA 4Z4RA 3RPUA 2ME6A 3KETA 2JQ7A 1YQAA 4YFKF 3P26A 4JMQA 5LMZA 5FLVA 2QDXA 2QZ8A 3MHPA 3RKYA 1MBHA 1ZLJA 3RPQA 1IDJA 3F6VA 1XDSA 2J5OA 4P1VA 3OL4A 3J7AY 4DNRB 3N05A 4XSZF 2X8KA 3I4NJ 3SY2A 1I50J 5DEQA 4LD5A 1WZ2A 3HOVJ 4BXFA 3CCUI 2YWEA 1RMGA 3I59A 3MKYB 3OJWA 2WB1A 1CZFA 3QFSA 2BMWA 1EP1B 2V7UA 2BBYA 4WF2A 1U2WA 5ICEA 4U0VA 2FMLA 1VQMB 3ZPPA 2JJ2A 2GWRA 4PZJA 2ZBUA 2Y31A 3BG7A 4OWRB 1G59A 4YEIA 4DZPA 2FBIA 1R4NB 2BOLA 3OYMA 4PC6A 4DIQA 2HGCA 2OU2A 1KU3A 1VQ5B 3HXLA 2CRGA 1S9HA 4PABA 1H80A 1IDZA 5E3NA 3A02A 2XPUA 3WTVC 4KNYA 2XF5A 4BY7J 1ZN2A 2KIMA 2I8DA 3G1LA 1EFRA 1E79A 1I1GA 1IB4A 1ON2A 3L2VA 1SANA 2DK5A 1IN7A 3WTUC 1QRBA 3KPHA 3WNBA 1EXMA 2NTPA 5L3DA 3TOBA 3IV5A 3ABTA 1P92A 1RKTA 1W7PA 3ZCOA 3GTJJ 1BC8C 1REPC 3PFYA 2BHZA 1EH6A 2VL8A 1KMHA 2D1HA 3BQYA 2F43A 2JSPA 3VSLA 4ENJA 3JQRA 2H27A 5ERIA 4B3AA 1YX2A 2QSFX 2UUZA 3KZIC 2K40A 3O3KA 3HKZA 4Y7CA 3EQLF 1ETWA 3A35A 2NT6A 3H5RA 4QPQA 3PUBA 3EPZA 3TO9A 3PA2A 2LD5A 4M3EA 2OQRA 3M8FA 2QQAA 1NHAA 2E1NA 1R5OA 2CU7A 5DM6F 3U9GA 2WV1A 1SD7A 3CUQA 2HS5A 5CVIA 3BPXA 3BG6A 5BPIA 3ISXA 3Q39A 1KC8D 4HX7A 4UZFA 1DUXC 1R1VA 1JJ6C 3ZQIA 3E97A 3OSFA 1LLZA 3I0TA 5FFXA 5DUIA 1YFHA 3DQVC 3CESA 3FXQA 3MEXA 3P5JA 1MDMA 3SLDA 3WBKA 1L0OC 3GXOA 4P9FA 4XLEA 3S93A 4DW6A 2V9KA 4P3IA 3H9QA 2BM5A 4R79A 1QRCA 2DJNA 1JUPA 2IBDA 2QQ8A 2WAQA 4NB5A 1K28D 1N8RD 2HWVA 1QBJA 2IPQX 3L00A 1W1WE 1W4MA 9ANTA 2WYRA 3BC8A 3RJPA 2K4BA 1AKHA 2KVOA 4W8QA 4CYCB 1E3PA 4ON0A 3HRMA 2G0YA 4YDTA 1H9GA 3W5HA 3VYTB 2K9MA 4PUSA 1PJ5A 2CMPA 4NDLA 4PJJA 1QVTA 1RQRA 3J81k 4UV8A 4CXFA 1TWHJ 4PC1A 4Y3OA 5ILVA 4PMHA 3GVAA 5D6EA 3BP8A 4HWVA 1LE8B 1TQPA 3W6VA 5A2QZ 1D5YA 5IYQA 3I56I 1EA3A 2HQ5A 1YITB 2O7OA 1QFZA 1Z67A 4M53A 3GIRA 1V5EA 2X4HA 2BYVE 3OOUA 4JP0A 1ZG5A 3KX2A 1FEXA 2VE8A 3BR0A 3Q9SA 4HX4A 1R5HA 2XTWA 4WCGA 4IRGA 2HTJA 3GQ9A 1K5CA 4BEHB 4LBZA 5FRMA 1OKRA 1ULYA 2H6BA 1XPXA 3BCDA 4Q48A 1NK3P 2BN4A 4P9SA 1WCMJ 3A8JA 2E1MB 1VQMI 2CV0A 2F6CA 2EWEA 4IKFA 3IKVA 4M6VA 1FRQA 4LBYA 3VNUA 1F43A 4YXWA 1TSPA 4A3JJ 3OZWA 5LFAA 3PL8A 2VI6A 1TWFJ 4IOCF 4BXXJ 1W7PD 1X1DA 1D0XA 1X3WB 2KQRA 3EYYA 2R7RA 3ZP5A 4ACAA 3M4OJ 4CUGA 4YHBA 2L4AA 2QBYB 3TEDA 2I1LA 3B6AA 1O8GA 1S0UA 3N4MA 5F08A 4HSTA 1VQ7I 1DP3A 3KYLA 2A6HF 4YAFA 2AXLA 1LDDA 2MSYA 4M3BA 2MC3A 2QA4I 1WOSA 2NZMA 1XSXA 5IP7J 2ICWG 4MFEA 4MXNA 1HA8A 2VFNA 4BE1A 2Q2EA 2W1OA 4MGRA 5IYBJ 2GIVA 1JJ8C 1YJNI 2KZVA 1GXPA 1EE6A 1QGYA 2KIUA 3CCQI 3F22A 1WH7A 1YYVA 3E1YE 2CW8A 5THXA 4MYTA 2DA3A 1BR1A 5KVRA 3TQNA 2PMZA 4F93B 1VQNB 4KN7X 1XTAA 2CQKA 2STTA 4I99C 4IF4A 3W2EA 1MKMA 3LSIA 4XNFA 2ZSHB 2RC6A 4DBQA 1MBEA 1Y0UA 2DT6A 2XKOA 3G4SB 1G4DA 1VQ4B 2EIJH 3S1MJ 5E1XA 2ZCWA 4WWVA 3LA2A 1N0UA 4BAYA 1JI8A 1JKRC 1EP3B 1ZG3A 4X1EA 4ZYGA 1FYKA 2QGUA 4PAAA 3JTHA 5HLIA 1MIJA 4XK4A 2NVUB 2D5VA 3T1BA 1H85A 1U9NA 1D1AA 2NS7A 2ZTNA 2Q6OA 5B5EC 3JREA 2GLOA 2XZLA 4I7HA 1BR2A 3D5RC 3GZ5A 4LFUA 2YPRA 5M5YJ 1W0TA 4XONA 3CXCB 4OIOF 1LJ9A 1MH4A 4ENNA 3TDUC 2DA6A 1GVDA 3DBRB 4M3FA 4NBQA 2LZJA 4IVNA 4KIGA 2HDDA 4YFNF 1H8HA 1I5ZA 5B1AH 3ASOH 1R49A 1LQ1A 2VKDA 1K6YA 5LBQA 3A8KA 2K9SA 5HVQC 4OM9A 2MH2A 1U3EM 1H8AC 3VSVA 2V6EA 3JX8A 3ML6A 1UJ8A 5C1CA 1VQOB 2EBIA 1IZ1A 4V2FA 3K69A 1XGSA 2DMPA 3H3VK 2M0CA 2IA2A 3S3NA 1IV6A 1G3TA 2Z5UA 4H9GA 1G8XA 2NAZA 3R60A 1HLVA 1JT6A 3K2ZA 5CKTA 1G7SA 1WOPA 2GJRA 1JUMA 4M6XA 1SVOA 1MMSA 4OPWA 4OOSA 2JUGA 1W5TA 3PSIA 2GXBA 3CMAB 3E6MA 3J80K 3TDZC 2QUFA 5D4RA 1OISA 3D5LA 5J1YA 2AS5F 5AONA 2VBYA 4BHPA 2B63J 1Q9SA 3SFZA 5IP6A 1LDJA 1FC3A 1LFBA 2X1DA 1B9NA 5H6QA 4S04A 1S72I 2A61A 3DTIA 4P26A 3JRFA 3CPWB 1GLNA 3T8TA 2ID3A 4M3GA 3VB2A 2XF7A 3F6OA 1B8IB 3Q3SA 4IPAA 2BVLA 3IH4A 2J5PA 3F9KA 3MMYB 5EMNA 1U5TC 4FWTA 2F48A 5KNLA 1WI9A 2QKMB 4YIRX 2PJRA 2YWGA 5FA6A 1I18A 2Y0MA 2KL4A 1NG7A 4WK8F 4OAZA 2XROA 1ERDA 2WY7Q 3N6ZA 3ZPNA 1QVUA 3SZGA 3ZXSA 1DU6A 2NOJB 1RZ4A 1GVHA 2JVGA 1H42A 5IP9J 1SAUA 2EB7A 3ECHA 1GUUA 4L9VA 4BJ6C 2DA7A 1JA1A 1Y0RA 1IDYA 1BN8A 1I7PA 3U2QA 1J7KA 2RREA 1IJWC 5HZBA 3TGNA 2OYNA 2ESNA 2KLOA 3PNVA 1FIAA 3QRFF 1XB2A 4F7DA 4NQWA 1TWCJ 3HSEA 3G05A 2K27A 2JN9A 4L9JA 3DKWA 3CMEB 1QPMA 1ETKA 2L5QA 2VQGA 5H20A 1IRXA 2R5YA 2V7VA 2JA5J 3SDGA 3QU3A 4DOZA 4RAYA 5LEJA 5F4JA 5A89A 2EPFA 3E6CC 3Q5FA 2WB1N 3SXYA 3OYAA 3S15J 2PLYA 4DZJA 1ETQA 5CPRB 1ZELA 4IHYA 4RS8A 3OS2A 5J47A 1VQNI 4OOVA 3ASTA 1STZA 4TMXA 2EV0A 2KT0A 5JMCB 3KP5A 3ZMZA 3L9FA 3TL4X 4B09A 3C3WA 4YG2F 4HEA2 2KDOA 3G4SI 1PYVA 2BSAA 4G6DA 2W85A 1VQ4I 1WSVA 3OW7A 4QUZA 1KA8A 2OUMA 3KE2A 4BDZA 2GOMA 4FK8A 4GO1A 3OYGA 3PO2J 4TT3A 4IZZA 1EA0A 1E17A 2XGEA 2IRFG 4RDJA 4G7HF 1VZ0A 4XL9A 3FXJA 2QE7A 3SDBA 5F4OA 4M6YA 3PFIA 5J1RA 4KIFA 2VT2A 1IHMA 1SVMA 2M8EA 2XIGA 1IAWA 3TO7A 3WU2C 2HDCA 1OB2A 5ICCA 3MAJA 2O8KA 1WXRA 1ZHFA 1PKVA 5HODA 1DQUA 5J8CA 5FROA 3TKYA 1BPLA 1XG1A 4P12A 4L5IA 3QAHA 4L18B 3HKZN 3P4GA 4QWQA 4RBOA 1Z7UA 3AFHA 4Y15A 4YEJA 5FKNA 1VQLI 3UNGC 3OYCA 1E1QA 1OB0A 2VFPA 4RGRA 1IXCA 2L9RA 1FSEA 2GOXB 2HZTA 2LKPA 1G3YA 3DXJF 3H36A 4HPQA 4LG0A 5J4VA 3WQZA 3DBHB 4IHXA 1UD6A 4B44A 3GTMJ 3CCYA 2EINH 1CNFA 2ZZQA 3I71A 2Y69H 5BNGA 3V7RA 2VQLA 4HX8A 4C0SA 2W4SA 3B78A 3FPKA 1E3ZA 2VNKA 1MNMC 4XORA 1D1CA 5FB2A 2PLFA 5E8GA 4U4BA 4HNUA 3SJPA 1Q7YD 3EETA 1Z77A 2VBTA 2WAQN 4AVZA 3G6EB 4UY8I 4C2UA 5FKMA 2XC1A 4XKCA 1UMQA 4HF0A 5B1BH 2L54A 5FO0A 2PFBA 1WJEA 3BT9A 4YIIA 4L8JA 3JSPA 3JQPA 1Y0NA 1R23A 1R1UA 3DEEA 2LDUA 1PDNC 3WTZA 5IOZA 2WR8A 5FNZA 1ZYRF 4U0YA 4I76A 3KYDB 2M4KA 1W35A 2E1CA 1JB9A 2HDNB 4DYQA 5LHHA 5JLWA 4XM3A 1X4PA 1BM9A 3V8JA 4FHTA 4IQ4A 1WP6A 2O03A 1F9NA 1KQSB 4LIVA 2J8KA 2CUEA 1K73D 3A2KA 3VOEA 1XCVA 2HOSA 4GXOA 2M1BA 2DY1A 4N9IA 3L1PA 2F4NA 1Z9CA 4XOPA 2L01A 4A3BJ 4II2A 2DQRA 3ZN1A 5GADJ 3HJEA 1RU4A 3DWLE 5ILSA 3TMOA 3J80Z 4BHBA 1IGNA 2DLLA 2DYRH 3FXLA 3LQQA 2NNYA 2BVNA 4RJLA 4R71A 1OFDA 2DFEA 5C4JJ 2V31A 3ZGKA 4L9TA 3OEHA 4OJ6A 5KAIC 3G1MA 1XMXA 4B8XA 2JIZA 1VFCA 5BQTA 1E3HA 4Y17A 2AHQA 3QP6A 2VYQA 4I98B 4P96A 1U78A 4TN1A 3K4JA 5DN6A 1BA5A 2E34A 2M7BA 4YFXF 4G6IA 4G12A 2NNNA 5L3FA 3OW2B 2COMA 1T0FC 4Z1MA 3JRGA 1GDTA 4RB0A 4A6DA 5E6TA 1JA0A 2MD0A 4ZJZA 3KLNA 5DCFA 4BU2A 1LUJB 2RQQA 1YE9A 4PDKA 1X1CA 4S0HB 1QVFB 2R5ZA 1Q1HA 3T0YA 3BJOA 3OYBA 3N90A 1HW5A 1OCCH 4LBVA 3QU6A 1K8AD 2QYUA 1IN6A 3J81K 4JBAA 3A8IA 2JTVA 2L7ZA 3BCAA 4XKWA 2NVTJ 2VBVA 2CQNA 1OMIA 1FIPA 3FIWA 4RAZA 2VJIA 5EG0A 4TMZA 3CCSB 4P5OA 2OC6A 2JWTA 4KT6A 2PMZN 1TNTA 1AU7A 4E0FA 5LEKA 1OFMA 3W2GA 3K4MA 3W6KB 3IL2A 3I9V2 4FISA 5GTHC 1EFCA 4X06A 2OD5A 2BM7A 3FISA 2WY8Q 4FXUA 1T39A 2ZITA 1K83J 1ETXA 2P5KA 5C4XJ 2F5FA 1FOWA 1O57A 4JX6A 3K1MA 1LKXA 4HZFA 3CCUB 2XF6A 2YSRA 3ZN0A 1VTNC 3AVWA 2PJPA 2DT5A 3WTYC 4UXNA 1BOBA 2XB0X 4NBSA 1OR7A 4EGZA 4W97A 2KFDA 2VJ4A 4KKTA 3CP8A 3H09A 2V1DA 3SQVA 2Q0OA 3LO8A 2EQRA 4M0LA 3FJOA 2N8GA 4OJLA 1B72B 2QX3A 1BJZA 5FKOA 3W2VA 1QH0A 3CW2A 3QYEA 1QQ1A 1TYUA 4EV0A 2IW5A 2OK7A 1AOYA 2NPFA 5IK2A 3MCZA 2CV2A 2E2IJ 1T95A 1LM1A 1SC7A 3G6EI 5CVVA 4MFDA 1HC8A 4UVBA 5JLXA 1WJAA 3I4PA 3VPRA 4ANJA 3L2QA 2BGIA 3PSSA 4CCMA 4Y52J 2LP0A 4K2EA 3NAUA 1SKYB 2CK3A 4BXUA 5JVGF 1HBXG 4HDUA 3S16J 2TCTA 3CJNA 3FMRA 4UHTA 1IDKA 4JX4A 1OFLA 5JVTA 3BCBA 1JTAA 2QGGA 4ZTFA 4PJ0C 2UV1A 3T5XA 1IXSB 3KEOA 2FU4A 5GV8A 2X48A 3HGGA 2ZMEC 3KCCA 4J19A 4ZYEA 2V7TA 4P6VF 2LOOA 3NAWA 2F1MA 1HF2A 2FJ1A 2BV3A 2E35A 4WX9A 2OBTA 2O6WA 2GXGA 1GJRA 1R36A 2HOEA 3CC7I 4LLNA 3QOPA 3M3YJ 2LG4A 2OBSA 3F8BA 3GFMA 1FRNA 2AHOA 1W5SA 4YC5A 3K4BA 2P81A 4BJTA 1I1SA 2P0WA 4IEJA 2V7QA 1DGWY 5K7HA 4Z4YA 4I2OA 4EM2A 1TLHB 2VASA 3Q0WA 1S4MA 4A3FJ 1BL0A 1LEBA 2ZJRF 1I39A 1NBMA 4DNTB 1X4OA 3MD2A 1H8EA 3L2CA 2GPJA 2MFZA 4ENKA 4WXDA 3G2BA 1OFCX 4XKBA 3QQAA 2HR3A 4OJOA 3ZMUA 2D1VA 1K4SA 2YX4A 2VOOA 2EZKA 4EVIA 3CCEI 2NVQJ 4I02A 3VSKA 2E5ZA 1UHSA 2MBFA 5E20A 1PJ7A 1FNBA 4A69C 4IRIA 3NWTA 1NRKA 1QA1A 4CICA 3U6KA 1HSJA 1SKQA 2LRDA 1MSFC 3CCJI 3ABUA 3HOYJ 3H3ZA 4W1UA 4V2GA 1W0JA 3QWLA 1J09A 1FSHA 1WHUA 1WQ2A 1D0ZA 3ASRA 2YU3A 2PYGA 2MG4A 3F3XA 1MZBA 3DPUA 1DDNA 4FN5A 1R00A 3JCUC 4S05A 4QFMA 2IGKA 1LLWA 4RMNA 3G3ZA 2ACJA 1B6AA 3GO5A 2F5DA 2K9LA 4XIDA 3GFIA 1DP7P 3T9GA 1FP2A 1Z3YA 2B7BA 1FYLA 2Q6KA 4A3KJ 1BIAA 3K4LA 3I56B 3EUHC 1MSEC 2F5CA 2HVQA 4HDVA 3HB9A 4GYGA 1X2MA 5IYCJ 3QP5A 2GXAA 5DSZA 1IN5A 1VLYA 3A0HC 4AM3A 2HVSA 3GTQJ 3IC7A 3DKXA 4E4HA 1G7TA 1Z1DA 4E70A 4JQFA 1WORA 1ACIA 2JRMA 2HXIA 1D8TA 3GQ8A 3I55B 2VNHA 1O3QA 3A3BA 4P6YA 4RD2A 3CUQB 1TNSA 2HQAA 2C6YA 1KJZA 2J7KA 3CC4I 2XNCA 3FX3A 1PJRA 3OYJA 5HS7A 4J0QA 3TBIA 1N06A 3HOWJ 3CF5F 1YHQB 5L3GA 1WJBA 4QVJA 2X6OA 2QWWA 1PUFB 1BOAA 3QFRA 3OMYA 3J81Z 1YLOA 2ZMEA 3E6DA 5E1ZB 4DK0A 3FMSA 3NQOA 4B48A 1GV2A 3B73A 1CF7A 1X1AA 2A68F 4NCNA 5JBQA 1U8BA 1VQ7B 1MBJA 1J0RA 2QA4B 3ELKA 5IPAA 4AIHA 1XSDA 4AIDA 2V7FA 2XGJA 3LNNA 4YZAA 2CBXA 1RKWA 1QGPA 1ZGAA 1YJNB 2OJED 2E1BA 1N0VC 1KQ0A 4Z4VA 4LLGF 1FOYA 5FLXK 3CCQB 5F0CA 2EIXA 2XB5A 2UXNA 3BJAA 1FBQA 2QMUA 3LAJA 3FXMA 2O17A 4YZXA 4B3GA 2STWA 4IHWA 4FETA 4GRIA 2Z2SB 5BPDA 1QUEA 4P22A 1P4AA 4KDPA 3WYAA 4ZGQB 4BS9A 2ZL7A 3BG9A 4PC7A 3KZYA 5LHGA 3OYIA 3BTJA 3OOCA 1R71A 2ZB9A 4ABZA 2VODA 1KK0A 1HKSA 3VMVA 2HZDA 1XDUA 1O8LA 2G9WA 1EH7A 4NC6A 2M5SA 2W6JA 4OZYA 3CDHA 3BDDA 4PGOA 1JTYA 1KCDA 4XBFA 4LC0A 2MD5A 1W87A 1V5VA 2RC4A 4GDFA 3DEUA 3GBGA 2EZLA 2IT0A 5FO1A 4Z6YA 4Q47A 2FRHA 3A0BC 3OYKA 2ESHA 4OPOA 5EYRA 4I6ZA 1SM4A 4ACBA 3AGQA 1XN7A 3ZIAA 5EEHA 2LVSA 3VR6A 2FNAA 1USTA 4U0WA 5AN9A 2WV0A 2M3AA 1SMTA 1YS6A 1RI7A 2K9NA 2V4DA 1JRGA 2KIFA 1FLIA 4P25A 1O8IA 1RIOH 3JURA 1ZLKA 3CRZA 4ESBA 4IXAA 3O8GA 1GAQA 1IRZA 3PNYA 3MFKA 3RCOA 3W2HA 3RIQA 3HHHA 1HDPA 1Z6RA 4UVAA 2CSOA 3MN2A 4B43A 2PIAA 5JLVC 5KW9A 1FT9A 2QSGX 1HG8A 4RLZA 2B7EA 1FBUA 3W5VA 2DMQA 1BN5A 1Z6TA 3NEUA 3OPOA 2D3LA 1MH3A 4LMYA 5GV7A 4ZDPA 1NB9A 1H9TA 2Y48A 2E1MC 2V79A 3QPSA 3GTOJ 1IRFA 2D45A 4IX7A 1K9MD 4ZC3A 3GSIA 2Q8KA 3CP2A 1P4WA 3GF2A 3IWZA 2KP6A 4LLLA 5DDGA 4HLYA 3FKJA 4M9XA 3LSPA 2CW0F 4P1WA 4BHCA 4XLPF 2KRCA 1YJ9I 1RQPA 2E1OA 4PC3A 3WHBA 3OFNA 1S72B 3MQ0A 4JK1X 2PN6A 1GAWA 1TLLA 3LA3A 3M1CA 4OINF 3LQEA 1V5GA 2NSPA 1VQPI 4RM2A 4X05A 3GTGJ 3BQZA 4GQNA 1XE1A 3I55I 2ID6A 5L3EA 3HOTA 1A31A 3P9IA 3CMYA 1V0FA 1UELB 2BEOA 2FOWA 2ZFWA 2ADUA 3FHNA 5E79C 2E71A 3WTSC 3GZNB 4OMYA 1OGJA 4XRSG 1ZRCA 1GR1A 4PCQA 4ZZLA 1YHQI 2ZL5A 1R6RA 3HBLA 4XLNF 1HA3A 5EZHA 2KHMA 2KDZA 2EZHA 2KRHA 1MD0A 3M8JA 1HXDA 2Y0SA 2ISYA 2JA6J 4PSXA 2W82A 2QENA 5L46A 3H0GJ 2CFOA 3KP2A 4A3GJ 4ZV4A 2GJKA 1HOMA 4B1RA 3HG9A 1O8JA 4KKSA 4X0CA 3ZMTA 3WY9A 3HPGA 2V26A 1ON1A 4X6AJ 4EJWA 1Y56A 1WSUA 3GTPJ 4PJMA 1ZK8A 5D6FA 2Z1DA 4LBWA 4AC0A 2XPWA 1G7RA 3KYCB 5F64A 5DUKA 3FY3A 2HXOA 2JVHA 2MLGA 4CYCA 3A01B 1T6ZA 1FOKA 3REOA 2H6CA 4RDUA 3JRIA 1RUOA 1DPRA 4IJAA 5J35A 1W36C 4XD7A 2NTQA 2KKOA 1YG2A 2V1XA 3M8EA 4BH9A 4WZLA 4DQKA 2WA0A 2PYHA 4KFCA 3V7SA 1T6YA 1LDKB 2R7WA 1PXZA 4E7SA 3AL0B 1FDRA 3L09A 2A05A 1TBXA 1Y8QB 2WAFA 2XGDA 5BS6A 3MKZA 3CCJB 2H1LA 1OGIA 2FUG2 3KLOA 4HSRA 1OCPA 2LBFA 1HQCA 4F7ZA 1A8PA 1VJSA 3KFWX 5GAGJ 1WH5A 1D8KA 3BJ6A 4CGZA 4NK6A 4RCYA 2JJ1A 3BTCA 5D5XB 2Q6LA 2GA2A 5ICGA 2LFBA 4RPBA 3DU6A 4UAJA 2X9DA 3A4CA 2LNBA 3S2HJ 1T8IA 1F20A 2DMTA 2F5EA 1K78B 1YI2B 3MKWB 2OCEA 2PI0A 4U87A 1IC8A 1O8DA 3PUMA 3RYPA 3B02A 1KGSA 2CW7A 4BYYA 1IUYA 2NSTA 3NB2A 3P9KA 1APLC 5H2FC 2Q6IA 4UV9A 4OZZA 2GBYA 4BEHA 3ZBTA 1QPIA 1YW9A 3C18A 1R4MB 3AGPA 3J7YJ 2BY0A 1ZR4A 1DDGA 1QZZA 3ABMH 2NV4A 4L5EA 1VQLB 2OQGA 2RKHA 4E7ZA 3LSJA 3OV8A 3ZQFA 3DU1X 3E5XA 4A3IJ 4WXHA 4FT8A 1ETVA 3W5UA 2KPMA 2FNPA 3JRCA 1V4RA 3LSTA 1SFXA 2YWHA 3SYJA 3GQBA 3WWGA 2CW5A 4D7NA 2P5LC 3H9NA 1CNEA 4C3HJ 4EM0B 3CO6C 1I6XA 3BR2A 3S3OA 3DBLB 1OLTA 4WXCA 4XSXF 3LQ6A 4HF1A 1BMFA 2QBYA 2QYOA 3PSFA 2EFNA 4OPVA 3TP0A 2F4IA 3I58A 3LA7A 3IHUA 1IUFA 2CV1A 2HPMA 1UD3A 2WJYA 5IT9K 1QGZA 4TKOB 4UZEA 3H5AA 2PMHA 3R0JA 5EDNA 3BQJA 2AQEA 3WU0A 2OTLB 1E63A 3D1NI 2BM6A 1QHHD 3AVUA 1TQIA 5E3OA 1IN8A 1OCRH 1HZEA 3VNVA 4XN0A 1TZLA 1EV7A 3ASPA 2R7FA 3CC2I 2LY1A 1FX7A 2HLDA 2NXNB 2XGCA 4OOXA 2OA4A 2O8XA 3W2FA 2RV8A 5HS8A 1NHCA 2P7CB 2FF4A 2QQBA 1RR8C 2CUZA 4DQLA 3QSYA 1BHEA 2FD5A 3FXOA 2W24A 4QPOA 1TW2A 1AA7A 2L9SA 3B82A 1RETA 1USSA 1Z3XA 1R5NA 5FD5A 1A5JA 3ZMSA 2GK6A 4C43A 1O8MA 1WKMA 2FA5A 3QPHA 2P4WA 2BW3B 1LVKA 2COBA 5BOXA 2XV4S 4XLAA 3BNWA 3SLNA 3BLYA 2CUJA 1TW3A 1HKTA 2LKXA 3CO7C 4EEFG 1MABA 2W25A 3PSZA 1S3JA 3KEYA 3S8PA 3EUAA 2XTYA 1YW7A 1PP8F 3K1PA 2KIQA 2R3SA 3HZJA 1R5BA 4FE7A 3BROA 3ABLH 2ZKZA 4E7JA 4EJVA 5L3BA 4BQQA 4LG0B 2HOTA 1CLWA 4QV2A 4CDGA 1VHOA 1TTYA 3H5NA 2CQ7A 2Q1ZB 3PNTA 1WJFA 3F8MA 4UB8C 3GQ7A 5CQGA 2DYSH 3FXKA 1BW6A 3BY2A 4N3GA 2H8WA 1A6IA 2QQ9A 2D74A 3H35A 4MEYF 2P6SA 3ZRGA 2VNJA 4P9UA 2HEOA 5EF6A 1MW7A 3PJRA 4AIKA 2VONA 2VKVA 5LGNA 2BM0A 2FOKA 1G3SA 1RPWA 1WJDA 1NH3A 3B6CA 3OP1A 3M1EA 3S3MA 4ASUA 1WWXA 6PAXA 1F36A 2Y2ZA 4PK4A 1QFYA 2VZLA 1DGRM 4N4NB 5KK1A 2DDBA 2B5OA 2CH0A 1S7AA 3X2QH 1YI2I 2CQXA 4XLCA 4U49A 2CQQA 4ZTJA 4ZCMA 3CCLI 3KP7A 2ELHA 1IA5A 3Q6QA 3WXMA 1B8IA 4ZYDA 1Y39A 1W0KA 2VFQA 3S32A 2R0QC 4TSFA 1P4MA 1KK1A 3MZ8A 2ZXWH 3LSMA 3V8LA 1EZGA 3OEEA 2DOGA 3S17J 4D9JA 1TTTA 2FE3A 4I84A 2IA1A 1OOCA 4Z2YA 1BIBA 3LSHA 3ISPA 4GGGA 3SYTA 2ZBKA 4OIQF 4IHTA 1DBGA 2XUBA 1SEUA 1OCTC 2ZC2A 2PE3A 2ZZFA 5J4YA 1SFEA 4XMYA 3HGYA 2OZUA 1J59A 3S1NJ 1E43A 1XC5A 4ZZDA 1U5TA 4N0BA 4IL6C 1FYMA 2XSJC 3QPTA 3VO2A 2OPTA 2XAQA 4IW3B 2EWNA 2QTZA 4WQMA 1X0CA 2QCOA 3HOSA 4UUSA 3E1SA 2GK7A 2OTLI 3DKYA 3OL3A 4EJUA 5TY0A 4BQAA 2BX6A 2DO7A 2VIXA 1VQ6I 3LYCA 4LB6B 2F4MB 2K3FA 4Q7JB 3QYBA 1S7EA 4O5VA 3BZ6A 3SQNA 5FD6A 3SHFA 1JGGA 3J7AO 3F8NA 1QZEA 5FGMA 4XKVA 3WTWC 2DA4A 3BC9A 4A0YA 2NOGA 4TMVA 1W36D 2IVMA 1BI0A 2DOEA 4CO8A 3ZZTA 1P7IA 2K5CA 2HNHA 2ZO4A 2GREA 2NS8A 2VBWA 3ASQA 4DQ2A 1MJBA 1NG6A 2UXXA 1FNCA 3QOEA 3PIOF 1X3UA 4QVAA 1KU2A 3PENA 2IA0A 3H9GA 1T38A 2M7AA 3CDIA 4RGXA 3EYIA 2DN0A 2XT2A 3HM5A 2YUHA 2H8RA 3CC7B 2LF7A 1FNDA 5FIUA 3GLXA 4KH3A 3AVTA 2VUMJ 2FEZA 4LOCA 4PGGA 1EH8A 1QO0D 5GAEJ 1ONVA 5B66C 1X58A 5DCMB 5IT9Z 4RPDA 5ED4A 1O8EA 3QFTA 3FKSA 2LF8A 1M1EB 2A5WA 1MNDA 4JOMA 3ESWB 3PIPF 2JA7J 3SKBA 4Z06A 2M9HA 1T2KA 1XD7A 1KK3A 1XFOA 2Z6BD 1XX5A 2XEXA 4RGUA 4TMTA 3TW7A 3JTGA 3RQ4A 1QA3A 1BI2A 3LL7A 3ECOA 1JKQC 5FKKA 1AMOA 2EV5A 3FXRA 1YLFA 2VJJA 2DPDA 3CCEB 3L7WA 2L0KA 2RN7A 4BQNA 2YWFA 2F4OB 1MMGA 1R7JA 5E8IA 1T56A 1GQ8A 5FO5A 4F91B 1BQEA 3OZUA 2CO5A 2Y0SN 4YAOA 4G9YA 2BHYA 4BDYA 3VODA 4EJOA 2A6EF 3RKQA 4AF6A 3HYIA 3D0SA 2AQFA 2W00A 2P6TA 3FBIB 3HEFA 3R61A 3IWFA 4HAMA 1SFOJ 1F5TA 3AG4H 2YU9J 5IYRA 3HUGA 1OHHA 4KJZA 2K9QA 2UVEA 1BLIA 4EMSA 4V19K 1BBYA 2DT7B 2X6XA 2CUFA 1MJ9A 3TH0A 1GXQA 4MLOA 3MVPA 3RKWA 3G73A 5IYDJ 4RD1A 3CCRI 2DTRA 5L3CA 2OTJI 1D2EA 1FNMA 1OYIA 2JN6A 1OGOX 3CCMB 2IAIA 2VT3A 1YOVB 1QJVA 1KU9A 2BXYA 2WADA 1BI1A 1Y1VJ 1VF7A 1T98A 3LSKA 2D2WA 2GA1A 1H89C 2PG4A 1YW8A 2XOKA 3KRGA 5EGOB 3A03A 1XGNA 2EZIA 4HA8A 1JKPC 4Y13A 4RB3C 1NJID 1N25A 3K1NA 1W2BB 1ZM3A 2R4GA 3C2HA 3B90A 5AMVA 3OYHA 2IGNA 1O7FA 3LMWA 2C5BA 5JR3A 1O4XA 2M34A 1WPCA 3DFGA 4HRIA 1EFUA 5H5JA 1XS9A 1ZGJA 2E2HJ 4IRHA 1OQYA 3ZQQA 2ZJ2A 3CC4B 1VNDA 2R7SA 1V54H 2ZTGA 4P2NA 3DTEA 1ZR2A 4CA0A 1ITYA 1MJAA 4E7KA 3E6BA 2ZZGA 1E0EA 2K7LA 5CVUA 5HDGA 4CZZA 1FY7A 4A0XA 1BJAA 4RB1A 3R6KA 3EQOA 5IT3A 4ROXA 2LMDA 2IOUG 3WG7H 3AVYA 3ZQCA 1T08B 2FMYA 2JZYA 1FMWA 5FKLA 3FWEA 4DBRA 2QEXB 3BOQA 2ZJPF 3MZHA 1UG2A 1KYWA 4FCYA 2WWYA 1S29A 4BACA 3AK5A 1LVAA 4DK1A 1BR4A 1ZM9A 1F4KA 3ES9A 3Q0VA 2BGJA 2ZL6A 2DQLA 4QSHA 1NTCA 4G5GA 3VMWA 5K1YA 1UFMA 4XICA 1TYVA 2EIKH 1KU7A 1CQTA 4H4KC 1IJFA 2DCUA 2UWMA 4NC7A 4BKXA 2PBIA 1Y8RB 2X6WA 3ZZUA 4DGWB 3GW2A 4D5FA 4A5NA 5AIPA 1VLOA 4C30A 1O8FA 1ODDA 1S6LA 4Q5SF 4E7LA 1LB2A 5A8AA 1PE9A 3BZKA 1N05A 2HU9A 3K0LA 3K7AJ 1DABA 3AVXA 1P7JA 3ZQHA 3HRUA 4LK1F 2A5YB 2OZ6A 2C77A 1T0FA 2HDWA 3AG3H 4I09A 4CSWA 3MMPA 4Z4WA 5EJCA 2R7UA 4C9YA 3GFJA 4URRA 2VOPA 1S7OA 2EA4A 2UZKA 4D7MA 3FM3A 2ZNZA 1YRNA 4G7OF 2E7WA 2NS0A 3VYRB 2CJJA 3RSNA 5C44J 1U8RA 3I59B 5BSYA 2LK2A 2X1EA 1JUSA 1VI0A 2L2OA 2VPLA 5IYNA 2VBMA 1FJLA 3Q6RA 3KL9A 1U0JA 2E60A 2IXSA 4RD6A 5K7FA 2HKOA 1IW7F 4R1HA 3TOAA 4BUPA 3HTSB 1VBLA 1OCZH 1FWZA 2XAHA 4XRMA 5JI6A 4CZCA 5A88A 2VQHA 2X51A 4FE4A 2XHKA 3ULQB 1NK2P 2WBMA 2DTZA 2IS4A 2EA2A 2VBSA 4RAFA 3DTKA 3IAS2 5A2QK 2HQRA 4NHJA 1QA6A 2CYYA 3DDYA 3UKGA 3R4KA 3O6BB 1LNWA 3LQRA 4E7HA 2DU9A 4LIUA 5D8LB 2EH3A 3OOPA 4ZYHA 2BY3A 5KHDA 3OYLA 1CF7B 1UD2A 2W57A 2X0LA 3CZ6A 2RQPA 3C2BA 5JHUA 2ELJA 2M8GX 2HTSA 3FXUA 4QLCU 1JT0A 5GP9A 2XAGA 3OS1A 1W7PB 2NYXA 4UVCA 1RC9A 2JMWA 3CCMI 3CUQC 3K9TA 5DS0A 5M3FJ 3BR5A 4BJ5C 3WE2A 2VLAA 4OJ5A 3PUFA 2OV7A 3GZ6A 2NVYJ 2V5IA 3VDXA 2C4TA 1E3OC 1X3ZB 4HW0A 1AIRA 2GQQA 3DPLC 5HNHA 2CNDA 1FMVA 1YJ9B 2GZWA 2RAEA 2PECA 2LC2A 1IO2A 1O8HA 3LSRA 4KMFA 2IJLA 2RNGA 3VFZA 4B47A 3BR1A 2BZTA 4AC9A 1ZTRA 4AF7A 1IV8A 1VQPB 1JJ2B 2RDPA 1IRGA 1H0MA 2LY2A 4YALA 2QXZA 1YS7A 1KTWA 4AIJA 3LMMA 3AKZA 1N75A 2JPCA 4FX0A 1O88A 3A3GA 2DYIA 1B1BA 4B4DA 3W2IA 1N77A 4YZQA 3I4MJ 3ASNH 4G6TB 4BQOA 1L1IA 3JRDA 4EH1A 4CHUA 3MCAA 2AXTC 1WU8A 1MDMB 4JYKA 5CYVA 4G7ZF 1J9ZA 1TVCA 1KQ5A 3SUCA 2V1UA 4EGYA 4RCZA 3G71I 4CCLA 2EFQA 1N08A 4F92B 4HV5A 5HXBA 1QHGA 2WTEA 2OCCH 2QEXI 1XCBA 3CPXA 1Z0XA 2MW8A 2VKHA 4W8SA 5FFZA 1F1ZA 1AKHB 2VJ5A 1ZKGA 2FSWA 1SAXA 2FQ4A 2VXZA 2KMUA 4AYBA 2VBUA 1LFPA 3GRHA 5F6FA 4JX5A 4UNOA 2X1CA 1E3XA 2QN6A 1SFUA 1TQMA 3K70C 3WU1B 1Z7LA 3CD6I 4CCNA 4X7DA 3V42A 5E18F 4RD4A 3I1FA 3ZSCA 5IY5H 2X85A 3FPPA 3ZQLA 1UCRA 1MMAA 4UB6C 1GVJA 1WJ5A 2DAOA 4UUTA 4B3FX 4X07A 3H0DA 1TUIA 1Z05A 4RDKA 3CLOA 2I5UA 4BGDA 1OGMX 1VQ9I 5F0HA 5D5WB 1VQKI 5HZAA 2LKSA 4IQJA 2X3UA 3KP3A 2EILH 1WTHD 3M07A 2R7ZJ 3OYFA 2JDIA 3CCVB 3NARA 1UB9A 2R7DA 2R7OA 3JQQA 2VQCA 2DXIA 5F4MA 3ZZ0A 4IO9F 2K4JA 1IF1A 4Y9UA 2FVGA 4RDLA 1RESA 1MBKA 2XTXA 2C5HA 2BV6A 2XSDC 3RY8A 1BJKA 3UR3C 4A0ZA 4BY1J 1QCXA 3VYUB 1R22A 2Z8GA 4OP7A 1K4TA 1IJEA 3SEJA 5B6IA 4Q4ZF 2R7TA 5E3LA 2ISZA 3GX4X 1TYWA 2R93J 2INUA 4NC8A 3ONQA 4HF2A 4W8RA 2G7UA 4V02C 4U9UA 3T53B 2M0MA 1HDDC 1WDTA 4K1XA 3E5QA 2TDXA 3L2WA 4C2LA 4MTDA 4XLHA 1D8JA 3VYSB 4Y4RA 1P2FA 1M1KD 2VXDA 1BC7C 3OE7A 2XRLA 2HPIA 2Z33A 3SJMA 3NRVA 3V7CA 1V55H 1OFEA 3DF8A 3EUHA 2Y9ZA 2ZZEA 2RC5A 1FNNA 1I3QJ 4Z4ZA 1JHHA 1WGXA 2H09A 2L4MA 2QF7A 2WSSA 1EFTA 2A07F 3H92A 2XPVA 2W6IA 1PUFA 5LD2C 4KISA 5M3MJ 2Y75A 3IUOA 3JU4A 5GAHJ 4PJLA 1TT5B 3SZPA 3HDDA 4OIPF 1HW2A 2VBXA 2A69F 2Q2EB 2YUSA 5HNFA 4KKUA 2L02A 3KIOA 4ZYAA 1KZLA 3A1YA 2W7ZA 1V0EA 3OIOA 3OR2C 4RAGA 1YO5C 4HE6A 1K8FA 4YIFA 1O8KA 5ILUA 3M7GA 1ETOA 3C2GA 3BWGA 3FDYA 1PVEA 3ZPLA 1ZM2A 3GMEA 3FHZA 3GCMA 1GO2A 4CQJA 1Z91A 2O3FA 2EFOA 2F2EA 4C3IJ 2MABA 5D4SA 3RPUD 1VQ8B 5HS9A 1K4ZA 3CC2B 1TWGJ 1N07A 4KITB 5TGTA 1KRHA 4WZTA 3S1RJ 3OR1C 2L3DA 1E1RA 2A6TA 3ZMDA 3LWFA 2LBFB 2R7VA 1O7LA 2M45A 1KZHA 3E20A 3EQNA 1TWAJ 2WZNA 1MGTA 1MMNA 4TMWA 4YCQA 3HAGA 4KN4X 5TRDA 4OJPA 5TJJA 5CLSA 1O3SA 1E64A 3H9JA 2DETA 5JHFA 3CJRB 1QQIA 3BH6B 2X0KA 4E7IA 2XAUA 2R7QA 4FTHA 3E0JB 5GPAA 3U2RA 1UD4A 2WZPP 4MTEA 2LSOA 2UVFA 2K85A 1UMKA 4EQQA 5J8FA 1QGAA 1R5ID 4A2UA 4M3DA 3E7LA 3LVBA 2PQ8A 3FMQA 5HKKA 4FASD 2WPDA 4RGSA 2ECBA 1UHMA 3AL0C 1FOXA 5M5WJ 1HVXA 1P4XA 3Q0UA 2XGXA 1BX1A 4EW9A 2QZAA 1SD4A 2Z3YA 2OBPA 1ZG1A 3P7NA 4HYEA 4ETSA 2JUCA 2ODLA 2V6CA 2HI3A 4FQGA 4Y7NJ 2Z9OA 3CLQA 3A1PA 5K7ZA 1TT0A 3OWTA 1VQ5I 2ELKA 3GTLJ 1WPKA 2CS3A 1Z21A 2XVCA 4OOIA 2JJ7A 2HQNA 3CJQB 3RZOJ 4PC2A 3O2PE 2DJIA 4ZCLA 3BR6A 3VSUA 4LGWA 4RA2A 1OPCA 1WI3A 3V4GA 3ZQGA 4YFOA 5F1JA 4Z4SA 5J3LA 2XAJA 3OSGA 1OB5A 1B23P 5E1WA 3BG3A 1JTXA 3ERED 2V4JC 1PLUA 3P9CA 1B2RA 3CCVI 3TP3A 1LE8A 2QTLA 2IS1A 3WTXC 3VMFA 2DK8A 2JRTA 3K10A 3R0AA 2KJBA 3WGIA 1G3WA 2P5VA 1OJLA 2O61A 5F27A 3ONYA 4OAYA 5K5RA 3BG5A 3FK7A 4A3EJ 4ZH4F 1D5VA 3WBJA 5FJ8J 2PJRB 3CB4A 4QTRA 1FP1D 2VKEA 3CCLB 3IH2A 3K4CA 4UUVA 1WJCA 4D0PA 4ZDLA 5HLTA 4C2TA 2G0EA 5CDFA 3T56B 3W6JB 2BF4A 1ZAOA 2EV6A 2IEKA 4BPRA 2KISA 3ERMA 4X7FA 4XOTA 1I8DA 5FLXZ 2XNJA 4C2MJ 2V7WA 4ZGNB 1FPQA 5F1RA 1YX3A 4PFOA 3GLLA 3DEWA 5HDKA 4AD9A 3ZOBA 3RZDJ 1T6XA 3VSTA 4NQWB 1GT0C 3HOXJ 2O0WA 2L9NA 2HFHA 3DV8A 2DW4A 4I0AA 2C4UA 3FM5A 3B8YA 1Q81D 2R5YB 2EFGA 3W3CA 3ZQ7A 1K7AA 4XR6A 1WSRA 1LPQA 4II3A 2VFOA 1IB0A 1ELOA 1SD5A 1T33A 3CTAA 3WTTC 4P3YA 1HSTA 1YX5A 3OIQA 3LSGA 4KMUX 1NDHA 2CF4A 2K3PA 2LREA 4KUMA 3IAM2 2R6HA 4X0GA 3DCFA 3D5SC 3LAPA 3GVKA 3F72A 3F21A 2ZSIB 2RVCA 3HOZJ 4WZEA 1RNLA 1L3LA 1Q86D 3QFCA 1HF0A 1K6OA 1UD8A 2B0RA 3F8CA 4MQVA 1VQ6B 1UAAA 4NK8A 1H88C 1VQ8I 4PSWA 3A01A 3WNCA 1MNEA 2DFIA 4P55A 2BM1A 2JA2A 3PQKA 2Z16A 2DOFA 3K70D 3QE2A 1HW1A 4O3MA 3K4NA 3GFLA 3ABKH 1I6HJ 3RQIA 1YITI 1RR7A 3H1CA 5EEAA 2W84A 2QSHX 3I5UA 3DPTA 3E5UA 3K4KA 3HC7A 1A6QA 1EJ9A 3SZTA 1Y0YA 4X8IA 3C7JA 2R9VA 4MEXF 3IH3A 1FZPB 3KEWA 3PM1A 2TRTA 5LHIA 2M2EA 3VWBA 2DPUA 3HOUJ 1ORKA 1AHDP 2VC1A 4GCVA 3WODF 5HLHA 4NNJA 5M5XJ 3JAMK 2NVXJ 1ZM4A 4FX4A 4KA4A 4RM0A 2K02A 3COAC 4BBRJ 2MA3A 1K78A 4C3JJ 3H3UA 4R8HA 2F1LA 3JRAA 1M90D 2VBKA 4N4OB 1QZYA 4B3XA 3IKTA 4OMZA 2JA8J 5E3MA 2CRVA 2VC0A 3WNDA 3M9AA 2E7XA 5KCMA 1QX4A 3SEQA 1A04A 4U7BA 3OYNA 1J2XA 2IGMA 1UD5A 2L7FP 1S8NA 4M74A 3GQAA 3O8HA 2O9LA 1U5TB 5TISC 3GTKJ 1T5EA 3B4NA 1W34A 3V8KA 1PUEE 1W9XA 4G8XA 1XSVA 4G1VA 2M30A 2E1RA 1G7CA 1DDIA 1JKOC 2W48A 3JRBA 4HQEA 2PMUA 4UUSB 3S2WA 1POGA 2BXZA 5C1EA 4G94A 3CDLA 2XNDA 1TL8A 2CWEA 2V7XA 3R6JA 4I01A 4TV7A 1B59A 2ZFUA 2DMNA 3T8RA 2PX9A 3BY6A 1R5GA 3C1DA 2FBHA 4QIWN 2VN2A 1QG0A 2DEUA 2QY1A 2O1DA 3RYRA 2EJRA 4AYBN 1FX0A 2VNIA 4CYDA 4MYUA 1HKQA 4KICA 4ASNA 2X3HA 3KP4A 3I64A 1I27A 5LRRA 2O0YA 3CCRB 4PGHA 2GJPA 2OTJB 3ZMVA 1ENHA 2QM3A 2OF7A 4WWCA 1Q82D 1XG2A 4KT5C 3F23A 4D5CA 2OBRA 4Y9RA 2CC2A 3FBNB 2XDVA 4CCOA 4MNUA 3I54A 3OIPA 2OK8A 2LH9A 3MZYA 2WC2A 1YIJB 3NWSA 1ZARA 2QKLB 4CCJA 3Q38A 5J40A 1KYZA 1PP7U 5H6RA 3KP6A 1XGMA 3G1OA 2EFWA 2B9SA 3V76A 4LB5A 1K61A 1JGSA 3WGGA 5IOYA 2VBEA 4CH7A 3AAFA 3VO1A 2VBZA 2XKPA 1ZGWA 2D3NA 2XZOA 2NRAC 2XZPA 1OCOH 3D26A 2BW3A 2HYFA 4AVPA 4ZDOA 1U2RA 4M72A 1WRJA 2AO9A 2M5WA 5DD8A 1TC3C 2XRNA 1E62A 5GTIC 1O3RA 3W2AA 5KSWB 1X1PA 1P6RA 1MBFA 3BY1A 1G6NA 2EIMH 1XMAA 2HYGD 3HHGA 3ROUA 2PEXA 2DA2A 4A3LJ 3ZUGA 5K5QA 1DPUA 5J3OA 3FKIJ 3PO3J 4LJZF 3RKXA 2EK5A 1FBSA 4PJNA 5KAFC 1VQOI 3B8HA 5IYWA 4IOAF 4F52A 1SMYF 1J75A 4A3CJ 3DLLF 4OU0A 3EUKL 3LOCA 4DNCA 2QLZA 5LLQA 2W7NA 2HVRA 2BY2A 2E36A 5F0FA 4OIRF 4DYCA 1N78A 2O04A 3JR9A 1QRYA 2ZXIA 4A93J 2ECCA 1D0YA 3L2UA 3HUGB 1B9MA 2HYJA 3CMAI 1J9IA 2R5ZB 2DA5A 2WJVA 4X7EA 1Q1VA 4PFPA 5DTDA 2CGPA 1KQ9A 1OYWA 2MH9A 1BX0A 4YZ0A 3S14J 1YIOA 1O3TA 5EG0B 4BE0A 2DFHA 1SVLA 2R92J 2LYCA 2MLKA 1BW5A 4MO7A 1OR7C 4HIZA 1KD1D 2J8IA 5K5OA 1SD6A 1WFXA 1JXSA 3S2DJ 4U7DA 2YR2A 2K86A 5D5UB 2IQ7A 4LK0F 4NUBA 5DS9A 4XRSA 3RI4A 1EP2B 4JRAC 2LLKA 2FX0A 1QUFA 5J1UA 2DA1A 4GFBA 4ZCIA 3BTIA 3OYEA 2BM4A 2F3LA 1GV5A 4HNVA 4M4SA 3I53A 3ONUA 2GM4A 1Y1WJ 3CQZJ 3OYDA 4M1KA 2I10A 4IHSA 5ICFA 3OAAA 4X7CA 3HPHA 5LRSA 2DOAA 2C78A 3CMEI 4YELA 3ZBUA 1BI3A 5CQEA 5DYMA 4HNTA 2O5RA 5HOOA 3MWMA 4M9SA 5TR9A 3GWZA 2MC4A 2O0VA 1ZREA 1F60A 2MYSA 1W0UA 3I3LA 1ETYA 4HLXA 4HOBA 4O6JA 5EZGA 3FK6A 4L9NA 5B3SH 5D5VB 3J7ZI 3ZR8X 3TO6A 2H1KA 3RTRA 2EFPA 3UW0A 1X1BA 3KZZA 2KRFA 4F55A 2VFMA 4F3QA 1V5FA 2PMDA 1YJWB 3U1KA 4DJAA 2JPBA 4AWXB 3TW6A 3JAMZ 4Z03A 1RWRA 1JE8A 1J5YA 3IRRA 3NE5B 1WMRA 5EEGA 1Y6IA 4N9HA 3SFIA 4BNCA 1KQ8A 2OAZA 4A3MJ 4Z4TA 1R1TA 3LNQA 2O6GE 2DERA 4J01A 1X2NA 2DMUA 3AG2H 1LEAA 2BE5F 4M9ZA 2LR8A 1XGOA 2BVMA 2DFFA 1I3AA 2ME0A 1YIJI 4M2LA 1UHWA 1X19A 1VHEA 2ZXHA 1EKEA 3N97A 3HRTA 5TV2A 4LITA 3WGHA 4ESFA 1U9OA 3R6SA 4A3DJ 2NTBA 1UG0A 2VB6A 4RB2C 1QVGB 4KIBA 5C3EJ 2CG4A 4B4CA 4E6KG 1PJ6A 1IN4A 3QODA 2V9VA 1TYXA 3GYHX 3CUOA 1ZUNB 3HSFA 2E5NA 2P3MA 3BPVA 1K79A 2FX3A 1XMKA 4A6EA 2IS6A 3VEPA 2A3SA 3RIRA 5J6XA 2R7XA 1CQXA 2KJCA 1E2XA 1KONA 2DODA 2Z99A 3F8FA 4HG2A 3BH7B 1TP4A 1R9TJ 3KEQA 3H94A 3PVDA 1YRNB 4ITVA 4BL0B 2C2WA 3GVJA 5DCMA 4Y33A 2L7KA 1DU0A 4D1QA 2HMAA 3L2RA 3OZVA 2BPOA 1JHFA 4MR0A 2VPRA 3K2AA 2VE9A 2GIZA 3PA1A 4EJTA 3G71B 3LFUA 4ENMA 1D1NA 1KK2A 3E3VA 3AVVA 4WZKA 3SZEA 1C0WA 2BY1A 3OKXA 5D8KB 3GVLA 2XT4A 2YX7A 1IXRC 3F0CA 5HLGA 5CJ9A 3LJYA 1RUNA 2B0LA 2XC7A 3Q9VA 5CVJA 5DNSA 3U1DA 3WG9A 3BCFA 2GAUA 5CVRA
chains in the Genus database with same CATH topology
4BGDA 1OGMX 3MKWB 2GOXB 4EATA 4HPQA 4U87A 1O8DA 3WQZA 4IQJA 2CW7A 4B44A 1UD6A 1WTHD 5FRNA 2NSTA 3OYFA 2JDIA 2ZZQA 2X6YA 4OZZA 2R7OA 2VQCA 4BEHA 2DXIA 3CMMA 2VQLA 3DLAA 4W8TA 2W4SA 4RLQA 4E7ZA 1E3ZA 3UR3C 4XORA 1D1CA 3SEZA 3VYUB 1QCXA 2Z8GA 2R7TA 3T51B 4U4BA 4HNUA 4Z05A 3U21A 2KPMA 3ONQA 4NC8A 2INUA 4W8RA 4AVZA 3GQBA 3T53B 3WWGA 2M0MA 4C2UA 3L2WA 3S3OA 1OLTA 4XKCA 4XLHA 5FL7A 3VYSB 1BMFA 3PSFA 2X53S 3BH4A 4Y4RA 2VXDA 3OE7A 2HPIA 1D1BA 1WJEA 2M4GA 4L8JA 2F4IA 3DEEA 2CV1A 2WJYA 2ZZEA 4TKOB 2HPMA 1UD3A 4BE2A 3H5AA 2WSSA 2M4KA 3OS0A 1MMDA 2AQEA 2F5VA 2W6IA 5LD2C 4KISA 1QHHD 4XN3A 1P9QC 3IUOA 1HZEA 3JU4A 3IP4B 4UZUA 4PJLA 1O8IA 3HL2A 4XM3A 1X4PA 4XN0A 1TZLA 2BSPA 4IQ4A 2Q2EB 5HNFA 1WP6A 4KKUA 4ZYAA 4LIVA 1KZLA 2LY1A 3A1YA 3A2KA 3DU5A 1KCCA 1V0EA 2WAEA 3OR2C 2HLDA 4XLFA 1O8KA 1NHCA 3C2GA 3FDYA 4XOPA 4RLFA 2CUZA 1BHEA 4II2A 3CF2A 4RM3A 1QU3A 4QPOA 1RU4A 3DWLE 1AA7A 2L9SA 2MABA 3TMOA 3RPUD 1Z3XA 2V1NA 2V31A 3ZGKA 2GK6A 4KITB 5TGTA 3OEHA 1COWA 1O8MA 2IGOA 3OR1C 4XQFA 4OJ6A 1E1RA 2A6TA 2BW3B 2R7VA 1LVKA 2LBFB 3EQNA 2JIZA 4XLAA 3BLYA 1MMNA 2CUJA 1DBOA 3HAGA 1MABA 3K4JA 4YRVA 4OJPA 4LG3A 3KEYA 3S8PA 3EUAA 5DN6A 2IS2A 2M7BA 4G6IA 3H9JA 5JHFA 3CJRB 4E7JA 4G7WA 1T0FC 3OY9A 4BQQA 2DCEA 4Z1MA 3QYFA 4J00A 2XAUA 2R7QA 4E7IA 3E0JB 4AU7A 1UD4A 3K6GA 2DIEA 2NT9A 3H5NA 2UVFA 2Q1ZB 2MD0A 4G7XA 4ZJZA 1SFKA 3PNTA 4BU2A 1WJFA 3GQ7A 4CCKA 2RQQA 5CQGA 5HKKA 1YE9A 4FASD 1X1CA 2WPDA 3AL0C 2WZPP 1HVXA 2INVA 4EW9A 3W2WA 3H35A 3OYBA 3ZRGA 4JMQA 3BCFA 2ODLA 3BCAA 1MW7A 4XKWA 3PJRA 1IDJA 3OL4A 3J7AY 2VJIA 3N05A 2X8KA 4DNRB 4P5OA 2OC6A 1TT0A 1WJDA 4ASUA 3S3MA 3OWTA 4KT6A 4BXFA 2CS3A 1Z21A 4E0FA 1RMGA 3MKYB 1OFMA 2WB1A 3CJQB 4PK4A 3K4MA 1CZFA 1DGRM 3I9V2 2DJIA 4N4NB 3VSUA 2CH0A 3ZPPA 2JJ2A 3BG7A 4OWRB 4XLCA 2WY8Q 4ZTJA 1G59A 4U49A 4FXUA 3OYMA 2BOLA 2V4JC 1PLUA 4DIQA 1IA5A 3HXLA 1LKXA 1W0KA 3S32A 1S9HA 4TSFA 2XF6A 1H80A 2IS1A 3LSMA 1BOBA 2XF5A 3K10A 3OEEA 2I8DA 2VJ4A 1EFRA 4KKTA 3CP8A 1E79A 1IB4A 3L2VA 4D9JA 4OAYA 4OJLA 2QX3A 3W2VA 4I84A 1OOCA 3QYEA 2PJRB 3LSHA 2NTPA 3SYTA 5IK2A 3K4CA 2CV2A 1WJCA 3ZCOA 1T95A 1DBGA 4ZDLA 5HLTA 4C2TA 3PFYA 2ZZFA 5CDFA 3T56B 2VL8A 4XMYA 1KMHA 2F43A 1WJAA 4XOTA 2JSPA 3VSLA 4ANJA 3L2QA 4CCMA 1E43A 1I8DA 1SKYB 2CK3A 1YX3A 2UUZA 2XSJC 4PFOA 1X0CA 3VSTA 1IDKA 3HKZA 2NT6A 3A35A 1OFLA 3H5RA 4QPQA 3PUBA 3EPZA 4NQWB 2O0WA 3HOSA 2L9NA 3BCBA 1JTAA 3E1SA 4ZTFA 2GK7A 3DKYA 3OL3A 3B8YA 2UV1A 2VIXA 3W3CA 4XR6A 4YEJA 4II3A 2LOOA 2F1MA 3QYBA 3BG6A 1YX5A 3OIQA 3LSGA 3OYCA 2K3PA 2LREA 3IAM2 4XKVA 4X0GA 2LG4A 3DQVC 3BC9A 3CESA 3D5SC 1W36D 3GVKA 2ZSIB 3K4BA 4XLEA 3S93A 4BJTA 2K5CA 2HNHA 2P0WA 2V9KA 3H9QA 1UD8A 2V7QA 1DGWY 4R79A 1NG6A 1UAAA 4NK8A 3QOEA 4PSWA 2VASA 2WAQA 1K28D 3H9GA 1MNEA 2M7AA 1NBMA 4DNTB 1X4OA 2JA2A 3MD2A 2Z16A 1H8EA 3K70D 3BC8A 2KVOA 2MFZA 4W8QA 3G2BA 3K4NA 4XKBA 4OJOA 3VYTB 2K9MA 4PUSA 2CMPA 3DPTA 3K4KA 4PJJA 3HC7A 1O8EA 3VSKA 2E5ZA 2R9VA 3FKSA 3KEWA 2A5WA 1MNDA 4JOMA 3VWBA 3NWTA 4Z06A 1NRKA 4Y3OA 2Z6BD 2LRDA 4PMHA 4NNJA 3RQ4A 3LL7A 4HWVA 1W0JA 1J09A 1EA3A 1D0ZA 2VJJA 2PYGA 4BQNA 2VBKA 3DPUA 4N4OB 4B3XA 1MMGA 1V5EA 1GQ8A 4F91B 3OOUA 2IGKA 3KX2A 4RMNA 4BDYA 5KCMA 2K9LA 3T9GA 3SEQA 4U7BA 2AQFA 2W00A 3FBIB 3OYNA 1Z3YA 3GQ9A 1K5CA 4BEHB 5FRMA 4KJZA 2IGMA 1OHHA 2UVEA 1BLIA 3K4LA 1UD5A 3EUHC 3BCDA 2X6XA 2DT7B 2HVQA 3GQAA 3B4NA 2E1MB 1T5EA 2CV0A 2F6CA 2EWEA 1W9XA 1VLYA 4MLOA 2HVSA 4IKFA 4YXWA 3DKXA 4E4HA 5C1EA 5LFAA 3PL8A 2XNDA 1OGOX 4JQFA 1X1DA 1D0XA 2KQRA 2R7RA 2ZFUA 1QJVA 3GQ8A 4CUGA 2WADA 1VF7A 3A3BA 1O8GA 2HQAA 3LSKA 2QY1A 2O1DA 2XOKA 4HSTA 1DP3A 1FX0A 1PJRA 3OYJA 3KYLA 2X3HA 3KRGA 3TBIA 2NZMA 4MXNA 1HA8A 2GJPA 1WJBA 2R4GA 3C2HA 4BE1A 1XG2A 3B90A 2W1OA 5AMVA 3OYHA 2IGNA 3OMYA 2KZVA 3FBNB 2XDVA 4CCOA 3LMWA 3OIPA 1EE6A 2LH9A 1WPCA 4HRIA 3NWSA 4DK0A 2QKLB 4CCJA 3ZQQA 2CW8A 4B48A 4F93B 1BR1A 1X1AA 2PMZA 2R7SA 2ZTGA 3DTEA 3LSIA 4XNFA 2ZSHB 4CA0A 4DBQA 2V7FA 4E7KA 2XGJA 2ZZGA 2DT6A 1E0EA 3LNNA 2VBEA 4YZAA 4CH7A 2XZOA 2D3NA 2E1BA 2XZPA 3EQOA 2BW3A 1JI8A 4ZDOA 1FMWA 4DBRA 3W2AA 2O17A 4YZXA 4B3GA 1D1AA 4FETA 4GRIA 2Z2SB 2ZTNA 4P22A 2XZLA 4BS9A 4BACA 1BR2A 3D5RC 3OYIA 4DK1A 1BR4A 4PJNA 3OOCA 4XONA 3VMWA 3VMVA 2HZDA 4F52A 1O8LA 4H4KC 2UWMA 4NC7A 2X6WA 3EUKL 2W7NA 4DGWB 2HVRA 2LZJA 2M5SA 2W6JA 4OZYA 1N78A 2O04A 1KCDA 1H8HA 4C30A 1O8FA 4E7LA 2ZXIA 2VKDA 1K6YA 1PE9A 2HU9A 5HVQC 1D0YA 3L2UA 3HUGB 3VSVA 3GBGA 2V6EA 2WJVA 5C1CA 3OYKA 4CSWA 2HDWA 4PFPA 2R7UA 4C9YA 4URRA 3S3NA 3ZIAA 3VR6A 4YZ0A 1G8XA 4BE0A 5CKTA 2M3AA 2GJRA 2LYCA 3VYRB 3RSNA 1OR7C 2V4DA 4HIZA 1JRGA 2JUGA 3PSIA 2VPLA 2X1EA 1WFXA 2L2OA 3JURA 2VBMA 1U0JA 2E60A 2IXSA 3D5LA 2IQ7A 4NUBA 1VBLA 3PNYA 4BUPA 3RCOA 2X1DA 4B43A 4CZCA 3DTIA 2VQHA 2X51A 1HG8A 2WBMA 1GLNA 2IS4A 2XF7A 3DTKA 3OPOA 3OYEA 3IAS2 2D3LA 2BVLA 3MMYB 4ZDPA 3F9KA 3DDYA 3OYDA 5KNLA 2E1MC 4E7HA 4LIUA 4IX7A 2QKMB 4ZC3A 3HPHA 2PJRA 3OAAA 1I18A 5KHDA 1UD2A 3CP2A 3OYLA 2DOAA 1NG7A 2KL4A 2KP6A 4OAZA 3FKJA 1ERDA 2WY7Q 4P1WA 5CQEA 4YELA 4HNTA 2KRCA 2O5RA 3CZ6A 5HOOA 3SZGA 3ZPNA 2ELJA 2MC4A 3ZXSA 2NOJB 3OFNA 2O0VA 2JVGA 2MYSA 3OS1A 3I3LA 3M1CA 4C2LA 1V5GA 2NSPA 1SAUA 3ZR8X 4BJ6C 4RM2A 3RTRA 4BJ5C 1BN8A 1X1BA 3UW0A 4GQNA 2RREA 2VLAA 4F55A 4OJ5A 4F3QA 1V5FA 2KLOA 2OV7A 3PNVA 3HOTA 3VDXA 4DJAA 1V0FA 3G05A 1UELB 4Z03A 1AIRA 1RWRA 3FHNA 3DPLC 5HNHA 1FMVA 2L5QA 2VQGA 1IRXA 1WMRA 3NE5B 2PECA 2LC2A 1Y6IA 1R6RA 1O8HA 4J01A 2RNGA 4B47A 2KHMA 4DOZA 2KRHA 3M8JA 2LY2A 2Y0SA 2QXZA 4PSXA 2W82A 2BVMA 3OYAA 1KTWA 3LMMA 3AKZA 5CPRB 1N75A 1X19A 1ZELA 2ZXHA 2CFOA 3OS2A 1O88A 3A3GA 2GJKA 4YZQA 4LITA 3HG9A 1N77A 4BQOA 4G6TB 4KKSA 1O8JA 1UG0A 2VB6A 2NTBA 3HPGA 2V26A 3TL4X 4E6KG 3QODA 1Y56A 4HEA2 2KDOA 3OW7A 1PYVA 4PJMA 3SUCA 2E5NA 2Z1DA 2OUMA 4BDZA 4CCLA 2GOMA 2IS6A 3OYGA 4TT3A 4F92B 4IZZA 3FY3A 1QHGA 2R7XA 2JVHA 1KONA 4HG2A 3H94A 1W36C 4XD7A 4ITVA 2NTQA 2VKHA 4W8SA 2PYHA 1VZ0A 4XL9A 2WA0A 4BL0B 3GVJA 2VJ5A 4Y33A 2L7KA 3SDBA 2QE7A 1LDKB 4D1QA 2VXZA 4E7SA 2R7WA 3AL0B 2KMUA 4AYBA 3L2RA 1PXZA 2WAFA 3MKZA 1LFPA 3GRHA 4MR0A 2FUG2 3LFUA 2X1CA 4HSRA 2LBFA 1E3XA 1PKVA 3K70C 1DQUA 1Z7LA 1VJSA 4CCNA 5FROA 3GVLA 3V42A 1BPLA 4NK6A 2JJ1A 3ZSCA 2X85A 3FPPA 3DU6A 2XC7A 1MMAA 3A4CA 1WJ5A 4B3FX 3AFHA 3H0DA 1OB0A 3UNGC 1E1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYG A;  1OGM X;  2VBK A;  1O8D A;  1RMG A;  1GQ8 A;  1OFM A;  1CZF A;  1JRG A;  2NST A;  3JUR A;  2X6Y A;  2VBM A;  3VSU A;  4OZZ A;  3ZPP A;  3T9G A;  2IQ7 A;  4XLC A;  4U49 A;  3GQ9 A;  1K5C A;  1VBL A;  4W8T A;  2UVE A;  1PLU A;  1IA5 A;  2X6X A;  4XOR A;  1QCX A;  3GQA A;  1HG8 A;  2Z8G A;  3B4N A;  1H80 A;  4U4B A;  4Z05 A;  2EWE A;  2INU A;  4W8R A;  4AVZ A;  3WWG A;  1IB4 A;  5C1E A;  1OGO X;  4OJL A;  4XLH A;  2QX3 A;  4I84 A;  1OOC A;  4YEL A;  1QJV A;  3GQ8 A;  2NTP A;  1O8G A;  1DBG A;  2O0V A;  2QY1 A;  2O1D A;  3KRG A;  2X3H A;  4XMY A;  4C2L A;  2NSP A;  2NZM A;  4XOT A;  1BN8 A;  3UW0 A;  4MXN A;  4XN3 A;  1XG2 A;  1O8I A;  3B90 A;  4OJ5 A;  5AMV A;  4XM3 A;  4XN0 A;  2BSP A;  1X0C A;  3VST A;  1IDK A;  3LMW A;  1AIR A;  1RWR A;  1EE6 A;  1OFL A;  2NT6 A;  4Z03 A;  1KCC A;  2O0W A;  1WMR A;  1JTA A;  2PEC A;  3B8Y A;  1O8H A;  4XLF A;  1O8K A;  1NHC A;  4XR6 A;  4XOP A;  4XNF A;  1BHE A;  2QXZ A;  1KTW A;  2VBE A;  4YZA A;  1RU4 A;  1O88 A;  3EQO A;  4XKV A;  4YZQ A;  2NTB A;  1O8J A;  1O8M A;  4XQF A;  4OJ6 A;  3EQN A;  4XLE A;  2O17 A;  4XLA A;  4YZX A;  3SUC A;  1DBO A;  4NK8 A;  4OJP A;  3FY3 A;  4XON A;  4W8Q A;  3VMW A;  3VMV A;  2NTQ A;  4W8S A;  2PYH A;  4XL9 A;  1O8L A;  4OJO A;  2X6W A;  2NT9 A;  1PXZ A;  2UVF A;  4OZY A;  4MR0 A;  1O8E A;  3GRH A;  2O04 A;  1KCD A;  3GQ7 A;  1O8F A;  2INV A;  1PE9 A;  4EW9 A;  4Z06 A;  3VSV A;  5C1C A;  4NK6 A;  4PMH A;  3ZSC A;  2X85 A;  4HWV A;  2ODL A;  4XKW A;  4URR A;  1IDJ A;  4YEJ A;  2VJI A;  4YZ0 A;  2VJJ A; 
#chains in the Genus database with same CATH topology
 1XB4 A;  3JSO A;  4MQ9 F;  5DV5 A;  4EAT A;  2BGC A;  4GYI A;  2JSC A;  2RNJ A;  1S5L C;  4XRF A;  1R58 A;  5FRN A;  2QVO A;  2L7M P;  1U6G A;  2M87 A;  3CD6 B;  2X6Y A;  2YS9 A;  1AIP A;  1HCR A;  1GHC A;  1EWY A;  5E17 F;  3CMM A;  3ML3 A;  2XAF A;  4MIM A;  3DLA A;  1A36 A;  4W8T A;  4N3N A;  4RD0 A;  4Z4U A;  4RLQ A;  1AWC A;  3FZV A;  5FLM J;  3SEZ A;  3PQJ A;  3JW4 A;  1EF4 A;  2IP2 A;  1ZRD A;  5BSX A;  1VQ9 B;  1VQK B;  3T51 B;  4Z05 A;  3GEZ A;  3U21 A;  3RDI A;  3Q3A A;  3SJZ A;  2LY9 A;  2L9V A;  3ZC3 A;  3JRH A;  3U6B A;  1VF9 A;  4HQM A;  2XAS A;  2RGV A;  5FL7 A;  1B4A A;  1V3F A;  4A12 A;  4HBL A;  1DAR A;  2X53 S;  3BH4 A;  4IHV A;  4QHY A;  5LGT A;  2CFX A;  1D1B A;  2M4G A;  5EGO A;  1YTY A;  1G2H A;  3V7A A;  3LFK A;  1DG1 G;  5LGU A;  4BE2 A;  2ETH A;  2HOA A;  5AIQ A;  3OS0 A;  4BBS J;  1MMD A;  5JFR A;  4RD3 A;  2F5V A;  2D9R A;  4U88 A;  4H0E A;  2V9P A;  4XN3 A;  1D3Y A;  1P9Q C;  1RRJ A;  3S1Q J;  5DD4 A;  2FBK A;  3IP4 B;  4A5M A;  1OYY A;  3HL2 A;  1QFJ A;  4UZU A;  3HTU A;  2BSP A;  1CGP A;  2ZBV A;  4YAU A;  4L0Y B;  4ESJ A;  3DP7 A;  3DU5 A;  3FF5 A;  3QPL A;  3IRQ A;  2ZME B;  3PET A;  1KCC A;  2WAE A;  2DBB A;  3MKL A;  4L0Z B;  2DI3 A;  2LTP A;  4KYW A;  1B72 A;  1FTZ A;  4XLF A;  1YJW I;  3HIF A;  4L5J A;  4RLF A;  4DYR A;  5GPC A;  1WOO A;  3CF2 A;  1MBG A;  4RM3 A;  1QU3 A;  3OJX A;  2ZNY A;  1QNT A;  2Y9Y A;  4EM1 A;  5IYP A;  4HE5 A;  2V1N A;  3WHC A;  3BTL A;  3WE3 A;  1COW A;  2G7H A;  2IGO A;  4XQF A;  5DM7 F;  2ZXJ A;  5HDN A;  1JNY A;  1T6S A;  1ZRF A;  1MRZ A;  3CJT B;  4G1B A;  1ZQ3 P;  3EDP A;  2Y30 A;  1LFU P;  1DBO A;  2KZG A;  3AG1 H;  4M73 A;  3P27 A;  1ZH5 A;  4YRV A;  2B7C A;  4LG3 A;  1UZC A;  1XQB A;  2IS2 A;  2DDA A;  2ZJQ F;  1WVR A;  1NB0 A;  3BR3 A;  3HRS A;  2GQF A;  2JK3 A;  4G7W A;  1QA2 A;  2E2J J;  5H59 A;  2H94 A;  3OY9 A;  4MHG A;  4YAW A;  2DCE A;  2FQ3 A;  3QYF A;  4M71 A;  4J00 A;  2HCJ B;  2P7V B;  4AU7 A;  2INV A;  1A35 A;  3GUD A;  3K6G A;  3CCS I;  2E19 A;  2DIE A;  2NT9 A;  4G7X A;  2JT1 A;  4I0B A;  1SFK A;  5F04 A;  1W5C C;  3BZC A;  1KTV A;  3ASS A;  3HSR A;  2MGQ A;  3PUN A;  2P8T A;  2HKX A;  4AUX A;  4G6Q A;  4CCK A;  4HV6 A;  5BMZ A;  1IG7 A;  3W2W A;  2FXA A;  1FTT A;  4OPS A;  4Z4R A;  3RPU A;  2ME6 A;  3KET A;  2JQ7 A;  1YQA A;  4YFK F;  3P26 A;  4JMQ A;  5LMZ A;  5FLV A;  2QDX A;  2QZ8 A;  3MHP A;  3RKY A;  1MBH A;  1ZLJ A;  3RPQ A;  1IDJ A;  3F6V A;  1XDS A;  2J5O A;  4P1V A;  3OL4 A;  3J7A Y;  4DNR B;  3N05 A;  4XSZ F;  2X8K A;  3I4N J;  3SY2 A;  1I50 J;  5DEQ A;  4LD5 A;  1WZ2 A;  3HOV J;  4BXF A;  3CCU I;  2YWE A;  1RMG A;  3I59 A;  3MKY B;  3OJW A;  2WB1 A;  1CZF A;  3QFS A;  2BMW A;  1EP1 B;  2V7U A;  2BBY A;  4WF2 A;  1U2W A;  5ICE A;  4U0V A;  2FML A;  1VQM B;  3ZPP A;  2JJ2 A;  2GWR A;  4PZJ A;  2ZBU A;  2Y31 A;  3BG7 A;  4OWR B;  1G59 A;  4YEI A;  4DZP A;  2FBI A;  1R4N B;  2BOL A;  3OYM A;  4PC6 A;  4DIQ A;  2HGC A;  2OU2 A;  1KU3 A;  1VQ5 B;  3HXL A;  2CRG A;  1S9H A;  4PAB A;  1H80 A;  1IDZ A;  5E3N A;  3A02 A;  2XPU A;  3WTV C;  4KNY A;  2XF5 A;  4BY7 J;  1ZN2 A;  2KIM A;  2I8D A;  3G1L A;  1EFR A;  1E79 A;  1I1G A;  1IB4 A;  1ON2 A;  3L2V A;  1SAN A;  2DK5 A;  1IN7 A;  3WTU C;  1QRB A;  3KPH A;  3WNB A;  1EXM A;  2NTP A;  5L3D A;  3TOB A;  3IV5 A;  3ABT A;  1P92 A;  1RKT A;  1W7P A;  3ZCO A;  3GTJ J;  1BC8 C;  1REP C;  3PFY A;  2BHZ A;  1EH6 A;  2VL8 A;  1KMH A;  2D1H A;  3BQY A;  2F43 A;  2JSP A;  3VSL A;  4ENJ A;  3JQR A;  2H27 A;  5ERI A;  4B3A A;  1YX2 A;  2QSF X;  2UUZ A;  3KZI C;  2K40 A;  3O3K A;  3HKZ A;  4Y7C A;  3EQL F;  1ETW A;  3A35 A;  2NT6 A;  3H5R A;  4QPQ A;  3PUB A;  3EPZ A;  3TO9 A;  3PA2 A;  2LD5 A;  4M3E A;  2OQR A;  3M8F A;  2QQA A;  1NHA A;  2E1N A;  1R5O A;  2CU7 A;  5DM6 F;  3U9G A;  2WV1 A;  1SD7 A;  3CUQ A;  2HS5 A;  5CVI A;  3BPX A;  3BG6 A;  5BPI A;  3ISX A;  3Q39 A;  1KC8 D;  4HX7 A;  4UZF A;  1DUX C;  1R1V A;  1JJ6 C;  3ZQI A;  3E97 A;  3OSF A;  1LLZ A;  3I0T A;  5FFX A;  5DUI A;  1YFH A;  3DQV C;  3CES A;  3FXQ A;  3MEX A;  3P5J A;  1MDM A;  3SLD A;  3WBK A;  1L0O C;  3GXO A;  4P9F A;  4XLE A;  3S93 A;  4DW6 A;  2V9K A;  4P3I A;  3H9Q A;  2BM5 A;  4R79 A;  1QRC A;  2DJN A;  1JUP A;  2IBD A;  2QQ8 A;  2WAQ A;  4NB5 A;  1K28 D;  1N8R D;  2HWV A;  1QBJ A;  2IPQ X;  3L00 A;  1W1W E;  1W4M A;  9ANT A;  2WYR A;  3BC8 A;  3RJP A;  2K4B A;  1AKH A;  2KVO A;  4W8Q A;  4CYC B;  1E3P A;  4ON0 A;  3HRM A;  2G0Y A;  4YDT A;  1H9G A;  3W5H A;  3VYT B;  2K9M A;  4PUS A;  1PJ5 A;  2CMP A;  4NDL A;  4PJJ A;  1QVT A;  1RQR A;  3J81 k;  4UV8 A;  4CXF A;  1TWH J;  4PC1 A;  4Y3O A;  5ILV A;  4PMH A;  3GVA A;  5D6E A;  3BP8 A;  4HWV A;  1LE8 B;  1TQP A;  3W6V A;  5A2Q Z;  1D5Y A;  5IYQ A;  3I56 I;  1EA3 A;  2HQ5 A;  1YIT B;  2O7O A;  1QFZ A;  1Z67 A;  4M53 A;  3GIR A;  1V5E A;  2X4H A;  2BYV E;  3OOU A;  4JP0 A;  1ZG5 A;  3KX2 A;  1FEX A;  2VE8 A;  3BR0 A;  3Q9S A;  4HX4 A;  1R5H A;  2XTW A;  4WCG A;  4IRG A;  2HTJ A;  3GQ9 A;  1K5C A;  4BEH B;  4LBZ A;  5FRM A;  1OKR A;  1ULY A;  2H6B A;  1XPX A;  3BCD A;  4Q48 A;  1NK3 P;  2BN4 A;  4P9S A;  1WCM J;  3A8J A;  2E1M B;  1VQM I;  2CV0 A;  2F6C A;  2EWE A;  4IKF A;  3IKV A;  4M6V A;  1FRQ A;  4LBY A;  3VNU A;  1F43 A;  4YXW A;  1TSP A;  4A3J J;  3OZW A;  5LFA A;  3PL8 A;  2VI6 A;  1TWF J;  4IOC F;  4BXX J;  1W7P D;  1X1D A;  1D0X A;  1X3W B;  2KQR A;  3EYY A;  2R7R A;  3ZP5 A;  4ACA A;  3M4O J;  4CUG A;  4YHB A;  2L4A A;  2QBY B;  3TED A;  2I1L A;  3B6A A;  1O8G A;  1S0U A;  3N4M A;  5F08 A;  4HST A;  1VQ7 I;  1DP3 A;  3KYL A;  2A6H F;  4YAF A;  2AXL A;  1LDD A;  2MSY A;  4M3B A;  2MC3 A;  2QA4 I;  1WOS A;  2NZM A;  1XSX A;  5IP7 J;  2ICW G;  4MFE A;  4MXN A;  1HA8 A;  2VFN A;  4BE1 A;  2Q2E A;  2W1O A;  4MGR A;  5IYB J;  2GIV A;  1JJ8 C;  1YJN I;  2KZV A;  1GXP A;  1EE6 A;  1QGY A;  2KIU A;  3CCQ I;  3F22 A;  1WH7 A;  1YYV A;  3E1Y E;  2CW8 A;  5THX A;  4MYT A;  2DA3 A;  1BR1 A;  5KVR A;  3TQN A;  2PMZ A;  4F93 B;  1VQN B;  4KN7 X;  1XTA A;  2CQK A;  2STT A;  4I99 C;  4IF4 A;  3W2E A;  1MKM A;  3LSI A;  4XNF A;  2ZSH B;  2RC6 A;  4DBQ A;  1MBE A;  1Y0U A;  2DT6 A;  2XKO A;  3G4S B;  1G4D A;  1VQ4 B;  2EIJ H;  3S1M J;  5E1X A;  2ZCW A;  4WWV A;  3LA2 A;  1N0U A;  4BAY A;  1JI8 A;  1JKR C;  1EP3 B;  1ZG3 A;  4X1E A;  4ZYG A;  1FYK A;  2QGU A;  4PAA A;  3JTH A;  5HLI A;  1MIJ A;  4XK4 A;  2NVU B;  2D5V A;  3T1B A;  1H85 A;  1U9N A;  1D1A A;  2NS7 A;  2ZTN A;  2Q6O A;  5B5E C;  3JRE A;  2GLO A;  2XZL A;  4I7H A;  1BR2 A;  3D5R C;  3GZ5 A;  4LFU A;  2YPR A;  5M5Y J;  1W0T A;  4XON A;  3CXC B;  4OIO F;  1LJ9 A;  1MH4 A;  4ENN A;  3TDU C;  2DA6 A;  1GVD A;  3DBR B;  4M3F A;  4NBQ A;  2LZJ A;  4IVN A;  4KIG A;  2HDD A;  4YFN F;  1H8H A;  1I5Z A;  5B1A H;  3ASO H;  1R49 A;  1LQ1 A;  2VKD A;  1K6Y A;  5LBQ A;  3A8K A;  2K9S A;  5HVQ C;  4OM9 A;  2MH2 A;  1U3E M;  1H8A C;  3VSV A;  2V6E A;  3JX8 A;  3ML6 A;  1UJ8 A;  5C1C A;  1VQO B;  2EBI A;  1IZ1 A;  4V2F A;  3K69 A;  1XGS A;  2DMP A;  3H3V K;  2M0C A;  2IA2 A;  3S3N A;  1IV6 A;  1G3T A;  2Z5U A;  4H9G A;  1G8X A;  2NAZ A;  3R60 A;  1HLV A;  1JT6 A;  3K2Z A;  5CKT A;  1G7S A;  1WOP A;  2GJR A;  1JUM A;  4M6X A;  1SVO A;  1MMS A;  4OPW A;  4OOS A;  2JUG A;  1W5T A;  3PSI A;  2GXB A;  3CMA B;  3E6M A;  3J80 K;  3TDZ C;  2QUF A;  5D4R A;  1OIS A;  3D5L A;  5J1Y A;  2AS5 F;  5AON A;  2VBY A;  4BHP A;  2B63 J;  1Q9S A;  3SFZ A;  5IP6 A;  1LDJ A;  1FC3 A;  1LFB A;  2X1D A;  1B9N A;  5H6Q A;  4S04 A;  1S72 I;  2A61 A;  3DTI A;  4P26 A;  3JRF A;  3CPW B;  1GLN A;  3T8T A;  2ID3 A;  4M3G A;  3VB2 A;  2XF7 A;  3F6O A;  1B8I B;  3Q3S A;  4IPA A;  2BVL A;  3IH4 A;  2J5P A;  3F9K A;  3MMY B;  5EMN A;  1U5T C;  4FWT A;  2F48 A;  5KNL A;  1WI9 A;  2QKM B;  4YIR X;  2PJR A;  2YWG A;  5FA6 A;  1I18 A;  2Y0M A;  2KL4 A;  1NG7 A;  4WK8 F;  4OAZ A;  2XRO A;  1ERD A;  2WY7 Q;  3N6Z A;  3ZPN A;  1QVU A;  3SZG A;  3ZXS A;  1DU6 A;  2NOJ B;  1RZ4 A;  1GVH A;  2JVG A;  1H42 A;  5IP9 J;  1SAU A;  2EB7 A;  3ECH A;  1GUU A;  4L9V A;  4BJ6 C;  2DA7 A;  1JA1 A;  1Y0R A;  1IDY A;  1BN8 A;  1I7P A;  3U2Q A;  1J7K A;  2RRE A;  1IJW C;  5HZB A;  3TGN A;  2OYN A;  2ESN A;  2KLO A;  3PNV A;  1FIA A;  3QRF F;  1XB2 A;  4F7D A;  4NQW A;  1TWC J;  3HSE A;  3G05 A;  2K27 A;  2JN9 A;  4L9J A;  3DKW A;  3CME B;  1QPM A;  1ETK A;  2L5Q A;  2VQG A;  5H20 A;  1IRX A;  2R5Y A;  2V7V A;  2JA5 J;  3SDG A;  3QU3 A;  4DOZ A;  4RAY A;  5LEJ A;  5F4J A;  5A89 A;  2EPF A;  3E6C C;  3Q5F A;  2WB1 N;  3SXY A;  3OYA A;  3S15 J;  2PLY A;  4DZJ A;  1ETQ A;  5CPR B;  1ZEL A;  4IHY A;  4RS8 A;  3OS2 A;  5J47 A;  1VQN I;  4OOV A;  3AST A;  1STZ A;  4TMX A;  2EV0 A;  2KT0 A;  5JMC B;  3KP5 A;  3ZMZ A;  3L9F A;  3TL4 X;  4B09 A;  3C3W A;  4YG2 F;  4HEA 2;  2KDO A;  3G4S I;  1PYV A;  2BSA A;  4G6D A;  2W85 A;  1VQ4 I;  1WSV A;  3OW7 A;  4QUZ A;  1KA8 A;  2OUM A;  3KE2 A;  4BDZ A;  2GOM A;  4FK8 A;  4GO1 A;  3OYG A;  3PO2 J;  4TT3 A;  4IZZ A;  1EA0 A;  1E17 A;  2XGE A;  2IRF G;  4RDJ A;  4G7H F;  1VZ0 A;  4XL9 A;  3FXJ A;  2QE7 A;  3SDB A;  5F4O A;  4M6Y A;  3PFI A;  5J1R A;  4KIF A;  2VT2 A;  1IHM A;  1SVM A;  2M8E A;  2XIG A;  1IAW A;  3TO7 A;  3WU2 C;  2HDC A;  1OB2 A;  5ICC A;  3MAJ A;  2O8K A;  1WXR A;  1ZHF A;  1PKV A;  5HOD A;  1DQU A;  5J8C A;  5FRO A;  3TKY A;  1BPL A;  1XG1 A;  4P12 A;  4L5I A;  3QAH A;  4L18 B;  3HKZ N;  3P4G A;  4QWQ A;  4RBO A;  1Z7U A;  3AFH A;  4Y15 A;  4YEJ A;  5FKN A;  1VQL I;  3UNG C;  3OYC A;  1E1Q A;  1OB0 A;  2VFP A;  4RGR A;  1IXC A;  2L9R A;  1FSE A;  2GOX B;  2HZT A;  2LKP A;  1G3Y A;  3DXJ F;  3H36 A;  4HPQ A;  4LG0 A;  5J4V A;  3WQZ A;  3DBH B;  4IHX A;  1UD6 A;  4B44 A;  3GTM J;  3CCY A;  2EIN H;  1CNF A;  2ZZQ A;  3I71 A;  2Y69 H;  5BNG A;  3V7R A;  2VQL A;  4HX8 A;  4C0S A;  2W4S A;  3B78 A;  3FPK A;  1E3Z A;  2VNK A;  1MNM C;  4XOR A;  1D1C A;  5FB2 A;  2PLF A;  5E8G A;  4U4B A;  4HNU A;  3SJP A;  1Q7Y D;  3EET A;  1Z77 A;  2VBT A;  2WAQ N;  4AVZ A;  3G6E B;  4UY8 I;  4C2U A;  5FKM A;  2XC1 A;  4XKC A;  1UMQ A;  4HF0 A;  5B1B H;  2L54 A;  5FO0 A;  2PFB A;  1WJE A;  3BT9 A;  4YII A;  4L8J A;  3JSP A;  3JQP A;  1Y0N A;  1R23 A;  1R1U A;  3DEE A;  2LDU A;  1PDN C;  3WTZ A;  5IOZ A;  2WR8 A;  5FNZ A;  1ZYR F;  4U0Y A;  4I76 A;  3KYD B;  2M4K A;  1W35 A;  2E1C A;  1JB9 A;  2HDN B;  4DYQ A;  5LHH A;  5JLW A;  4XM3 A;  1X4P A;  1BM9 A;  3V8J A;  4FHT A;  4IQ4 A;  1WP6 A;  2O03 A;  1F9N A;  1KQS B;  4LIV A;  2J8K A;  2CUE A;  1K73 D;  3A2K A;  3VOE A;  1XCV A;  2HOS A;  4GXO A;  2M1B A;  2DY1 A;  4N9I A;  3L1P A;  2F4N A;  1Z9C A;  4XOP A;  2L01 A;  4A3B J;  4II2 A;  2DQR A;  3ZN1 A;  5GAD J;  3HJE A;  1RU4 A;  3DWL E;  5ILS A;  3TMO A;  3J80 Z;  4BHB A;  1IGN A;  2DLL A;  2DYR H;  3FXL A;  3LQQ A;  2NNY A;  2BVN A;  4RJL A;  4R71 A;  1OFD A;  2DFE A;  5C4J J;  2V31 A;  3ZGK A;  4L9T A;  3OEH A;  4OJ6 A;  5KAI C;  3G1M A;  1XMX A;  4B8X A;  2JIZ A;  1VFC A;  5BQT A;  1E3H A;  4Y17 A;  2AHQ A;  3QP6 A;  2VYQ A;  4I98 B;  4P96 A;  1U78 A;  4TN1 A;  3K4J A;  5DN6 A;  1BA5 A;  2E34 A;  2M7B A;  4YFX F;  4G6I A;  4G12 A;  2NNN A;  5L3F A;  3OW2 B;  2COM A;  1T0F C;  4Z1M A;  3JRG A;  1GDT A;  4RB0 A;  4A6D A;  5E6T A;  1JA0 A;  2MD0 A;  4ZJZ A;  3KLN A;  5DCF A;  4BU2 A;  1LUJ B;  2RQQ A;  1YE9 A;  4PDK A;  1X1C A;  4S0H B;  1QVF B;  2R5Z A;  1Q1H A;  3T0Y A;  3BJO A;  3OYB A;  3N90 A;  1HW5 A;  1OCC H;  4LBV A;  3QU6 A;  1K8A D;  2QYU A;  1IN6 A;  3J81 K;  4JBA A;  3A8I A;  2JTV A;  2L7Z A;  3BCA A;  4XKW A;  2NVT J;  2VBV A;  2CQN A;  1OMI A;  1FIP A;  3FIW A;  4RAZ A;  2VJI A;  5EG0 A;  4TMZ A;  3CCS B;  4P5O A;  2OC6 A;  2JWT A;  4KT6 A;  2PMZ N;  1TNT A;  1AU7 A;  4E0F A;  5LEK A;  1OFM A;  3W2G A;  3K4M A;  3W6K B;  3IL2 A;  3I9V 2;  4FIS A;  5GTH C;  1EFC A;  4X06 A;  2OD5 A;  2BM7 A;  3FIS A;  2WY8 Q;  4FXU A;  1T39 A;  2ZIT A;  1K83 J;  1ETX A;  2P5K A;  5C4X J;  2F5F A;  1FOW A;  1O57 A;  4JX6 A;  3K1M A;  1LKX A;  4HZF A;  3CCU B;  2XF6 A;  2YSR A;  3ZN0 A;  1VTN C;  3AVW A;  2PJP A;  2DT5 A;  3WTY C;  4UXN A;  1BOB A;  2XB0 X;  4NBS A;  1OR7 A;  4EGZ A;  4W97 A;  2KFD A;  2VJ4 A;  4KKT A;  3CP8 A;  3H09 A;  2V1D A;  3SQV A;  2Q0O A;  3LO8 A;  2EQR A;  4M0L A;  3FJO A;  2N8G A;  4OJL A;  1B72 B;  2QX3 A;  1BJZ A;  5FKO A;  3W2V A;  1QH0 A;  3CW2 A;  3QYE A;  1QQ1 A;  1TYU A;  4EV0 A;  2IW5 A;  2OK7 A;  1AOY A;  2NPF A;  5IK2 A;  3MCZ A;  2CV2 A;  2E2I J;  1T95 A;  1LM1 A;  1SC7 A;  3G6E I;  5CVV A;  4MFD A;  1HC8 A;  4UVB A;  5JLX A;  1WJA A;  3I4P A;  3VPR A;  4ANJ A;  3L2Q A;  2BGI A;  3PSS A;  4CCM A;  4Y52 J;  2LP0 A;  4K2E A;  3NAU A;  1SKY B;  2CK3 A;  4BXU A;  5JVG F;  1HBX G;  4HDU A;  3S16 J;  2TCT A;  3CJN A;  3FMR A;  4UHT A;  1IDK A;  4JX4 A;  1OFL A;  5JVT A;  3BCB A;  1JTA A;  2QGG A;  4ZTF A;  4PJ0 C;  2UV1 A;  3T5X A;  1IXS B;  3KEO A;  2FU4 A;  5GV8 A;  2X48 A;  3HGG A;  2ZME C;  3KCC A;  4J19 A;  4ZYE A;  2V7T A;  4P6V F;  2LOO A;  3NAW A;  2F1M A;  1HF2 A;  2FJ1 A;  2BV3 A;  2E35 A;  4WX9 A;  2OBT A;  2O6W A;  2GXG A;  1GJR A;  1R36 A;  2HOE A;  3CC7 I;  4LLN A;  3QOP A;  3M3Y J;  2LG4 A;  2OBS A;  3F8B A;  3GFM A;  1FRN A;  2AHO A;  1W5S A;  4YC5 A;  3K4B A;  2P81 A;  4BJT A;  1I1S A;  2P0W A;  4IEJ A;  2V7Q A;  1DGW Y;  5K7H A;  4Z4Y A;  4I2O A;  4EM2 A;  1TLH B;  2VAS A;  3Q0W A;  1S4M A;  4A3F J;  1BL0 A;  1LEB A;  2ZJR F;  1I39 A;  1NBM A;  4DNT B;  1X4O A;  3MD2 A;  1H8E A;  3L2C A;  2GPJ A;  2MFZ A;  4ENK A;  4WXD A;  3G2B A;  1OFC X;  4XKB A;  3QQA A;  2HR3 A;  4OJO A;  3ZMU A;  2D1V A;  1K4S A;  2YX4 A;  2VOO A;  2EZK A;  4EVI A;  3CCE I;  2NVQ J;  4I02 A;  3VSK A;  2E5Z A;  1UHS A;  2MBF A;  5E20 A;  1PJ7 A;  1FNB A;  4A69 C;  4IRI A;  3NWT A;  1NRK A;  1QA1 A;  4CIC A;  3U6K A;  1HSJ A;  1SKQ A;  2LRD A;  1MSF C;  3CCJ I;  3ABU A;  3HOY J;  3H3Z A;  4W1U A;  4V2G A;  1W0J A;  3QWL A;  1J09 A;  1FSH A;  1WHU A;  1WQ2 A;  1D0Z A;  3ASR A;  2YU3 A;  2PYG A;  2MG4 A;  3F3X A;  1MZB A;  3DPU A;  1DDN A;  4FN5 A;  1R00 A;  3JCU C;  4S05 A;  4QFM A;  2IGK A;  1LLW A;  4RMN A;  3G3Z A;  2ACJ A;  1B6A A;  3GO5 A;  2F5D A;  2K9L A;  4XID A;  3GFI A;  1DP7 P;  3T9G A;  1FP2 A;  1Z3Y A;  2B7B A;  1FYL A;  2Q6K A;  4A3K J;  1BIA A;  3K4L A;  3I56 B;  3EUH C;  1MSE C;  2F5C A;  2HVQ A;  4HDV A;  3HB9 A;  4GYG A;  1X2M A;  5IYC J;  3QP5 A;  2GXA A;  5DSZ A;  1IN5 A;  1VLY A;  3A0H C;  4AM3 A;  2HVS A;  3GTQ J;  3IC7 A;  3DKX A;  4E4H A;  1G7T A;  1Z1D A;  4E70 A;  4JQF A;  1WOR A;  1ACI A;  2JRM A;  2HXI A;  1D8T A;  3GQ8 A;  3I55 B;  2VNH A;  1O3Q A;  3A3B A;  4P6Y A;  4RD2 A;  3CUQ B;  1TNS A;  2HQA A;  2C6Y A;  1KJZ A;  2J7K A;  3CC4 I;  2XNC A;  3FX3 A;  1PJR A;  3OYJ A;  5HS7 A;  4J0Q A;  3TBI A;  1N06 A;  3HOW J;  3CF5 F;  1YHQ B;  5L3G A;  1WJB A;  4QVJ A;  2X6O A;  2QWW A;  1PUF B;  1BOA A;  3QFR A;  3OMY A;  3J81 Z;  1YLO A;  2ZME A;  3E6D A;  5E1Z B;  4DK0 A;  3FMS A;  3NQO A;  4B48 A;  1GV2 A;  3B73 A;  1CF7 A;  1X1A A;  2A68 F;  4NCN A;  5JBQ A;  1U8B A;  1VQ7 B;  1MBJ A;  1J0R A;  2QA4 B;  3ELK A;  5IPA A;  4AIH A;  1XSD A;  4AID A;  2V7F A;  2XGJ A;  3LNN A;  4YZA A;  2CBX A;  1RKW A;  1QGP A;  1ZGA A;  1YJN B;  2OJE D;  2E1B A;  1N0V C;  1KQ0 A;  4Z4V A;  4LLG F;  1FOY A;  5FLX K;  3CCQ B;  5F0C A;  2EIX A;  2XB5 A;  2UXN A;  3BJA A;  1FBQ A;  2QMU A;  3LAJ A;  3FXM A;  2O17 A;  4YZX A;  4B3G A;  2STW A;  4IHW A;  4FET A;  4GRI A;  2Z2S B;  5BPD A;  1QUE A;  4P22 A;  1P4A A;  4KDP A;  3WYA A;  4ZGQ B;  4BS9 A;  2ZL7 A;  3BG9 A;  4PC7 A;  3KZY A;  5LHG A;  3OYI A;  3BTJ A;  3OOC A;  1R71 A;  2ZB9 A;  4ABZ A;  2VOD A;  1KK0 A;  1HKS A;  3VMV A;  2HZD A;  1XDU A;  1O8L A;  2G9W A;  1EH7 A;  4NC6 A;  2M5S A;  2W6J A;  4OZY A;  3CDH A;  3BDD A;  4PGO A;  1JTY A;  1KCD A;  4XBF A;  4LC0 A;  2MD5 A;  1W87 A;  1V5V A;  2RC4 A;  4GDF A;  3DEU A;  3GBG A;  2EZL A;  2IT0 A;  5FO1 A;  4Z6Y A;  4Q47 A;  2FRH A;  3A0B C;  3OYK A;  2ESH A;  4OPO A;  5EYR A;  4I6Z A;  1SM4 A;  4ACB A;  3AGQ A;  1XN7 A;  3ZIA A;  5EEH A;  2LVS A;  3VR6 A;  2FNA A;  1UST A;  4U0W A;  5AN9 A;  2WV0 A;  2M3A A;  1SMT A;  1YS6 A;  1RI7 A;  2K9N A;  2V4D A;  1JRG A;  2KIF A;  1FLI A;  4P25 A;  1O8I A;  1RIO H;  3JUR A;  1ZLK A;  3CRZ A;  4ESB A;  4IXA A;  3O8G A;  1GAQ A;  1IRZ A;  3PNY A;  3MFK A;  3RCO A;  3W2H A;  3RIQ A;  3HHH A;  1HDP A;  1Z6R A;  4UVA A;  2CSO A;  3MN2 A;  4B43 A;  2PIA A;  5JLV C;  5KW9 A;  1FT9 A;  2QSG X;  1HG8 A;  4RLZ A;  2B7E A;  1FBU A;  3W5V A;  2DMQ A;  1BN5 A;  1Z6T A;  3NEU A;  3OPO A;  2D3L A;  1MH3 A;  4LMY A;  5GV7 A;  4ZDP A;  1NB9 A;  1H9T A;  2Y48 A;  2E1M C;  2V79 A;  3QPS A;  3GTO J;  1IRF A;  2D45 A;  4IX7 A;  1K9M D;  4ZC3 A;  3GSI A;  2Q8K A;  3CP2 A;  1P4W A;  3GF2 A;  3IWZ A;  2KP6 A;  4LLL A;  5DDG A;  4HLY A;  3FKJ A;  4M9X A;  3LSP A;  2CW0 F;  4P1W A;  4BHC A;  4XLP F;  2KRC A;  1YJ9 I;  1RQP A;  2E1O A;  4PC3 A;  3WHB A;  3OFN A;  1S72 B;  3MQ0 A;  4JK1 X;  2PN6 A;  1GAW A;  1TLL A;  3LA3 A;  3M1C A;  4OIN F;  3LQE A;  1V5G A;  2NSP A;  1VQP I;  4RM2 A;  4X05 A;  3GTG J;  3BQZ A;  4GQN A;  1XE1 A;  3I55 I;  2ID6 A;  5L3E A;  3HOT A;  1A31 A;  3P9I A;  3CMY A;  1V0F A;  1UEL B;  2BEO A;  2FOW A;  2ZFW A;  2ADU A;  3FHN A;  5E79 C;  2E71 A;  3WTS C;  3GZN B;  4OMY A;  1OGJ A;  4XRS G;  1ZRC A;  1GR1 A;  4PCQ A;  4ZZL A;  1YHQ I;  2ZL5 A;  1R6R A;  3HBL A;  4XLN F;  1HA3 A;  5EZH A;  2KHM A;  2KDZ A;  2EZH A;  2KRH A;  1MD0 A;  3M8J A;  1HXD A;  2Y0S A;  2ISY A;  2JA6 J;  4PSX A;  2W82 A;  2QEN A;  5L46 A;  3H0G J;  2CFO A;  3KP2 A;  4A3G J;  4ZV4 A;  2GJK A;  1HOM A;  4B1R A;  3HG9 A;  1O8J A;  4KKS A;  4X0C A;  3ZMT A;  3WY9 A;  3HPG A;  2V26 A;  1ON1 A;  4X6A J;  4EJW A;  1Y56 A;  1WSU A;  3GTP J;  4PJM A;  1ZK8 A;  5D6F A;  2Z1D A;  4LBW A;  4AC0 A;  2XPW A;  1G7R A;  3KYC B;  5F64 A;  5DUK A;  3FY3 A;  2HXO A;  2JVH A;  2MLG A;  4CYC A;  3A01 B;  1T6Z A;  1FOK A;  3REO A;  2H6C A;  4RDU A;  3JRI A;  1RUO A;  1DPR A;  4IJA A;  5J35 A;  1W36 C;  4XD7 A;  2NTQ A;  2KKO A;  1YG2 A;  2V1X A;  3M8E A;  4BH9 A;  4WZL A;  4DQK A;  2WA0 A;  2PYH A;  4KFC A;  3V7S A;  1T6Y A;  1LDK B;  2R7W A;  1PXZ A;  4E7S A;  3AL0 B;  1FDR A;  3L09 A;  2A05 A;  1TBX A;  1Y8Q B;  2WAF A;  2XGD A;  5BS6 A;  3MKZ A;  3CCJ B;  2H1L A;  1OGI A;  2FUG 2;  3KLO A;  4HSR A;  1OCP A;  2LBF A;  1HQC A;  4F7Z A;  1A8P A;  1VJS A;  3KFW X;  5GAG J;  1WH5 A;  1D8K A;  3BJ6 A;  4CGZ A;  4NK6 A;  4RCY A;  2JJ1 A;  3BTC A;  5D5X B;  2Q6L A;  2GA2 A;  5ICG A;  2LFB A;  4RPB A;  3DU6 A;  4UAJ A;  2X9D A;  3A4C A;  2LNB A;  3S2H J;  1T8I A;  1F20 A;  2DMT A;  2F5E A;  1K78 B;  1YI2 B;  3MKW B;  2OCE A;  2PI0 A;  4U87 A;  1IC8 A;  1O8D A;  3PUM A;  3RYP A;  3B02 A;  1KGS A;  2CW7 A;  4BYY A;  1IUY A;  2NST A;  3NB2 A;  3P9K A;  1APL C;  5H2F C;  2Q6I A;  4UV9 A;  4OZZ A;  2GBY A;  4BEH A;  3ZBT A;  1QPI A;  1YW9 A;  3C18 A;  1R4M B;  3AGP A;  3J7Y J;  2BY0 A;  1ZR4 A;  1DDG A;  1QZZ A;  3ABM H;  2NV4 A;  4L5E A;  1VQL B;  2OQG A;  2RKH A;  4E7Z A;  3LSJ A;  3OV8 A;  3ZQF A;  3DU1 X;  3E5X A;  4A3I J;  4WXH A;  4FT8 A;  1ETV A;  3W5U A;  2KPM A;  2FNP A;  3JRC A;  1V4R A;  3LST A;  1SFX A;  2YWH A;  3SYJ A;  3GQB A;  3WWG A;  2CW5 A;  4D7N A;  2P5L C;  3H9N A;  1CNE A;  4C3H J;  4EM0 B;  3CO6 C;  1I6X A;  3BR2 A;  3S3O A;  3DBL B;  1OLT A;  4WXC A;  4XSX F;  3LQ6 A;  4HF1 A;  1BMF A;  2QBY A;  2QYO A;  3PSF A;  2EFN A;  4OPV A;  3TP0 A;  2F4I A;  3I58 A;  3LA7 A;  3IHU A;  1IUF A;  2CV1 A;  2HPM A;  1UD3 A;  2WJY A;  5IT9 K;  1QGZ A;  4TKO B;  4UZE A;  3H5A A;  2PMH A;  3R0J A;  5EDN A;  3BQJ A;  2AQE A;  3WU0 A;  2OTL B;  1E63 A;  3D1N I;  2BM6 A;  1QHH D;  3AVU A;  1TQI A;  5E3O A;  1IN8 A;  1OCR H;  1HZE A;  3VNV A;  4XN0 A;  1TZL A;  1EV7 A;  3ASP A;  2R7F A;  3CC2 I;  2LY1 A;  1FX7 A;  2HLD A;  2NXN B;  2XGC A;  4OOX A;  2OA4 A;  2O8X A;  3W2F A;  2RV8 A;  5HS8 A;  1NHC A;  2P7C B;  2FF4 A;  2QQB A;  1RR8 C;  2CUZ A;  4DQL A;  3QSY A;  1BHE A;  2FD5 A;  3FXO A;  2W24 A;  4QPO A;  1TW2 A;  1AA7 A;  2L9S A;  3B82 A;  1RET A;  1USS A;  1Z3X A;  1R5N A;  5FD5 A;  1A5J A;  3ZMS A;  2GK6 A;  4C43 A;  1O8M A;  1WKM A;  2FA5 A;  3QPH A;  2P4W A;  2BW3 B;  1LVK A;  2COB A;  5BOX A;  2XV4 S;  4XLA A;  3BNW A;  3SLN A;  3BLY A;  2CUJ A;  1TW3 A;  1HKT A;  2LKX A;  3CO7 C;  4EEF G;  1MAB A;  2W25 A;  3PSZ A;  1S3J A;  3KEY A;  3S8P A;  3EUA A;  2XTY A;  1YW7 A;  1PP8 F;  3K1P A;  2KIQ A;  2R3S A;  3HZJ A;  1R5B A;  4FE7 A;  3BRO A;  3ABL H;  2ZKZ A;  4E7J A;  4EJV A;  5L3B A;  4BQQ A;  4LG0 B;  2HOT A;  1CLW A;  4QV2 A;  4CDG A;  1VHO A;  1TTY A;  3H5N A;  2CQ7 A;  2Q1Z B;  3PNT A;  1WJF A;  3F8M A;  4UB8 C;  3GQ7 A;  5CQG A;  2DYS H;  3FXK A;  1BW6 A;  3BY2 A;  4N3G A;  2H8W A;  1A6I A;  2QQ9 A;  2D74 A;  3H35 A;  4MEY F;  2P6S A;  3ZRG A;  2VNJ A;  4P9U A;  2HEO A;  5EF6 A;  1MW7 A;  3PJR A;  4AIK A;  2VON A;  2VKV A;  5LGN A;  2BM0 A;  2FOK A;  1G3S A;  1RPW A;  1WJD A;  1NH3 A;  3B6C A;  3OP1 A;  3M1E A;  3S3M A;  4ASU A;  1WWX A;  6PAX A;  1F36 A;  2Y2Z A;  4PK4 A;  1QFY A;  2VZL A;  1DGR M;  4N4N B;  5KK1 A;  2DDB A;  2B5O A;  2CH0 A;  1S7A A;  3X2Q H;  1YI2 I;  2CQX A;  4XLC A;  4U49 A;  2CQQ A;  4ZTJ A;  4ZCM A;  3CCL I;  3KP7 A;  2ELH A;  1IA5 A;  3Q6Q A;  3WXM A;  1B8I A;  4ZYD A;  1Y39 A;  1W0K A;  2VFQ A;  3S32 A;  2R0Q C;  4TSF A;  1P4M A;  1KK1 A;  3MZ8 A;  2ZXW H;  3LSM A;  3V8L A;  1EZG A;  3OEE A;  2DOG A;  3S17 J;  4D9J A;  1TTT A;  2FE3 A;  4I84 A;  2IA1 A;  1OOC A;  4Z2Y A;  1BIB A;  3LSH A;  3ISP A;  4GGG A;  3SYT A;  2ZBK A;  4OIQ F;  4IHT A;  1DBG A;  2XUB A;  1SEU A;  1OCT C;  2ZC2 A;  2PE3 A;  2ZZF A;  5J4Y A;  1SFE A;  4XMY A;  3HGY A;  2OZU A;  1J59 A;  3S1N J;  1E43 A;  1XC5 A;  4ZZD A;  1U5T A;  4N0B A;  4IL6 C;  1FYM A;  2XSJ C;  3QPT A;  3VO2 A;  2OPT A;  2XAQ A;  4IW3 B;  2EWN A;  2QTZ A;  4WQM A;  1X0C A;  2QCO A;  3HOS A;  4UUS A;  3E1S A;  2GK7 A;  2OTL I;  3DKY A;  3OL3 A;  4EJU A;  5TY0 A;  4BQA A;  2BX6 A;  2DO7 A;  2VIX A;  1VQ6 I;  3LYC A;  4LB6 B;  2F4M B;  2K3F A;  4Q7J B;  3QYB A;  1S7E A;  4O5V A;  3BZ6 A;  3SQN A;  5FD6 A;  3SHF A;  1JGG A;  3J7A O;  3F8N A;  1QZE A;  5FGM A;  4XKV A;  3WTW C;  2DA4 A;  3BC9 A;  4A0Y A;  2NOG A;  4TMV A;  1W36 D;  2IVM A;  1BI0 A;  2DOE A;  4CO8 A;  3ZZT A;  1P7I A;  2K5C A;  2HNH A;  2ZO4 A;  2GRE A;  2NS8 A;  2VBW A;  3ASQ A;  4DQ2 A;  1MJB A;  1NG6 A;  2UXX A;  1FNC A;  3QOE A;  3PIO F;  1X3U A;  4QVA A;  1KU2 A;  3PEN A;  2IA0 A;  3H9G A;  1T38 A;  2M7A A;  3CDI A;  4RGX A;  3EYI A;  2DN0 A;  2XT2 A;  3HM5 A;  2YUH A;  2H8R A;  3CC7 B;  2LF7 A;  1FND A;  5FIU A;  3GLX A;  4KH3 A;  3AVT A;  2VUM J;  2FEZ A;  4LOC A;  4PGG A;  1EH8 A;  1QO0 D;  5GAE J;  1ONV A;  5B66 C;  1X58 A;  5DCM B;  5IT9 Z;  4RPD A;  5ED4 A;  1O8E A;  3QFT A;  3FKS A;  2LF8 A;  1M1E B;  2A5W A;  1MND A;  4JOM A;  3ESW B;  3PIP F;  2JA7 J;  3SKB A;  4Z06 A;  2M9H A;  1T2K A;  1XD7 A;  1KK3 A;  1XFO A;  2Z6B D;  1XX5 A;  2XEX A;  4RGU A;  4TMT A;  3TW7 A;  3JTG A;  3RQ4 A;  1QA3 A;  1BI2 A;  3LL7 A;  3ECO A;  1JKQ C;  5FKK A;  1AMO A;  2EV5 A;  3FXR A;  1YLF A;  2VJJ A;  2DPD A;  3CCE B;  3L7W A;  2L0K A;  2RN7 A;  4BQN A;  2YWF A;  2F4O B;  1MMG A;  1R7J A;  5E8I A;  1T56 A;  1GQ8 A;  5FO5 A;  4F91 B;  1BQE A;  3OZU A;  2CO5 A;  2Y0S N;  4YAO A;  4G9Y A;  2BHY A;  4BDY A;  3VOD A;  4EJO A;  2A6E F;  3RKQ A;  4AF6 A;  3HYI A;  3D0S A;  2AQF A;  2W00 A;  2P6T A;  3FBI B;  3HEF A;  3R61 A;  3IWF A;  4HAM A;  1SFO J;  1F5T A;  3AG4 H;  2YU9 J;  5IYR A;  3HUG A;  1OHH A;  4KJZ A;  2K9Q A;  2UVE A;  1BLI A;  4EMS A;  4V19 K;  1BBY A;  2DT7 B;  2X6X A;  2CUF A;  1MJ9 A;  3TH0 A;  1GXQ A;  4MLO A;  3MVP A;  3RKW A;  3G73 A;  5IYD J;  4RD1 A;  3CCR I;  2DTR A;  5L3C A;  2OTJ I;  1D2E A;  1FNM A;  1OYI A;  2JN6 A;  1OGO X;  3CCM B;  2IAI A;  2VT3 A;  1YOV B;  1QJV A;  1KU9 A;  2BXY A;  2WAD A;  1BI1 A;  1Y1V J;  1VF7 A;  1T98 A;  3LSK A;  2D2W A;  2GA1 A;  1H89 C;  2PG4 A;  1YW8 A;  2XOK A;  3KRG A;  5EGO B;  3A03 A;  1XGN A;  2EZI A;  4HA8 A;  1JKP C;  4Y13 A;  4RB3 C;  1NJI D;  1N25 A;  3K1N A;  1W2B B;  1ZM3 A;  2R4G A;  3C2H A;  3B90 A;  5AMV A;  3OYH A;  2IGN A;  1O7F A;  3LMW A;  2C5B A;  5JR3 A;  1O4X A;  2M34 A;  1WPC A;  3DFG A;  4HRI A;  1EFU A;  5H5J A;  1XS9 A;  1ZGJ A;  2E2H J;  4IRH A;  1OQY A;  3ZQQ A;  2ZJ2 A;  3CC4 B;  1VND A;  2R7S A;  1V54 H;  2ZTG A;  4P2N A;  3DTE A;  1ZR2 A;  4CA0 A;  1ITY A;  1MJA A;  4E7K A;  3E6B A;  2ZZG A;  1E0E A;  2K7L A;  5CVU A;  5HDG A;  4CZZ A;  1FY7 A;  4A0X A;  1BJA A;  4RB1 A;  3R6K A;  3EQO A;  5IT3 A;  4ROX A;  2LMD A;  2IOU G;  3WG7 H;  3AVY A;  3ZQC A;  1T08 B;  2FMY A;  2JZY A;  1FMW A;  5FKL A;  3FWE A;  4DBR A;  2QEX B;  3BOQ A;  2ZJP F;  3MZH A;  1UG2 A;  1KYW A;  4FCY A;  2WWY A;  1S29 A;  4BAC A;  3AK5 A;  1LVA A;  4DK1 A;  1BR4 A;  1ZM9 A;  1F4K A;  3ES9 A;  3Q0V A;  2BGJ A;  2ZL6 A;  2DQL A;  4QSH A;  1NTC A;  4G5G A;  3VMW A;  5K1Y A;  1UFM A;  4XIC A;  1TYV A;  2EIK H;  1KU7 A;  1CQT A;  4H4K C;  1IJF A;  2DCU A;  2UWM A;  4NC7 A;  4BKX A;  2PBI A;  1Y8R B;  2X6W A;  3ZZU A;  4DGW B;  3GW2 A;  4D5F A;  4A5N A;  5AIP A;  1VLO A;  4C30 A;  1O8F A;  1ODD A;  1S6L A;  4Q5S F;  4E7L A;  1LB2 A;  5A8A A;  1PE9 A;  3BZK A;  1N05 A;  2HU9 A;  3K0L A;  3K7A J;  1DAB A;  3AVX A;  1P7J A;  3ZQH A;  3HRU A;  4LK1 F;  2A5Y B;  2OZ6 A;  2C77 A;  1T0F A;  2HDW A;  3AG3 H;  4I09 A;  4CSW A;  3MMP A;  4Z4W A;  5EJC A;  2R7U A;  4C9Y A;  3GFJ A;  4URR A;  2VOP A;  1S7O A;  2EA4 A;  2UZK A;  4D7M A;  3FM3 A;  2ZNZ A;  1YRN A;  4G7O F;  2E7W A;  2NS0 A;  3VYR B;  2CJJ A;  3RSN A;  5C44 J;  1U8R A;  3I59 B;  5BSY A;  2LK2 A;  2X1E A;  1JUS A;  1VI0 A;  2L2O A;  2VPL A;  5IYN A;  2VBM A;  1FJL A;  3Q6R A;  3KL9 A;  1U0J A;  2E60 A;  2IXS A;  4RD6 A;  5K7F A;  2HKO A;  1IW7 F;  4R1H A;  3TOA A;  4BUP A;  3HTS B;  1VBL A;  1OCZ H;  1FWZ A;  2XAH A;  4XRM A;  5JI6 A;  4CZC A;  5A88 A;  2VQH A;  2X51 A;  4FE4 A;  2XHK A;  3ULQ B;  1NK2 P;  2WBM A;  2DTZ A;  2IS4 A;  2EA2 A;  2VBS A;  4RAF A;  3DTK A;  3IAS 2;  5A2Q K;  2HQR A;  4NHJ A;  1QA6 A;  2CYY A;  3DDY A;  3UKG A;  3R4K A;  3O6B B;  1LNW A;  3LQR A;  4E7H A;  2DU9 A;  4LIU A;  5D8L B;  2EH3 A;  3OOP A;  4ZYH A;  2BY3 A;  5KHD A;  3OYL A;  1CF7 B;  1UD2 A;  2W57 A;  2X0L A;  3CZ6 A;  2RQP A;  3C2B A;  5JHU A;  2ELJ A;  2M8G X;  2HTS A;  3FXU A;  4QLC U;  1JT0 A;  5GP9 A;  2XAG A;  3OS1 A;  1W7P B;  2NYX A;  4UVC A;  1RC9 A;  2JMW A;  3CCM I;  3CUQ C;  3K9T A;  5DS0 A;  5M3F J;  3BR5 A;  4BJ5 C;  3WE2 A;  2VLA A;  4OJ5 A;  3PUF A;  2OV7 A;  3GZ6 A;  2NVY J;  2V5I A;  3VDX A;  2C4T A;  1E3O C;  1X3Z B;  4HW0 A;  1AIR A;  2GQQ A;  3DPL C;  5HNH A;  2CND A;  1FMV A;  1YJ9 B;  2GZW A;  2RAE A;  2PEC A;  2LC2 A;  1IO2 A;  1O8H A;  3LSR A;  4KMF A;  2IJL A;  2RNG A;  3VFZ A;  4B47 A;  3BR1 A;  2BZT A;  4AC9 A;  1ZTR A;  4AF7 A;  1IV8 A;  1VQP B;  1JJ2 B;  2RDP A;  1IRG A;  1H0M A;  2LY2 A;  4YAL A;  2QXZ A;  1YS7 A;  1KTW A;  4AIJ A;  3LMM A;  3AKZ A;  1N75 A;  2JPC A;  4FX0 A;  1O88 A;  3A3G A;  2DYI A;  1B1B A;  4B4D A;  3W2I A;  1N77 A;  4YZQ A;  3I4M J;  3ASN H;  4G6T B;  4BQO A;  1L1I A;  3JRD A;  4EH1 A;  4CHU A;  3MCA A;  2AXT C;  1WU8 A;  1MDM B;  4JYK A;  5CYV A;  4G7Z F;  1J9Z A;  1TVC A;  1KQ5 A;  3SUC A;  2V1U A;  4EGY A;  4RCZ A;  3G71 I;  4CCL A;  2EFQ A;  1N08 A;  4F92 B;  4HV5 A;  5HXB A;  1QHG A;  2WTE A;  2OCC H;  2QEX I;  1XCB A;  3CPX A;  1Z0X A;  2MW8 A;  2VKH A;  4W8S A;  5FFZ A;  1F1Z A;  1AKH B;  2VJ5 A;  1ZKG A;  2FSW A;  1SAX A;  2FQ4 A;  2VXZ A;  2KMU A;  4AYB A;  2VBU A;  1LFP A;  3GRH A;  5F6F A;  4JX5 A;  4UNO A;  2X1C A;  1E3X A;  2QN6 A;  1SFU A;  1TQM A;  3K70 C;  3WU1 B;  1Z7L A;  3CD6 I;  4CCN A;  4X7D A;  3V42 A;  5E18 F;  4RD4 A;  3I1F A;  3ZSC A;  5IY5 H;  2X85 A;  3FPP A;  3ZQL A;  1UCR A;  1MMA A;  4UB6 C;  1GVJ A;  1WJ5 A;  2DAO A;  4UUT A;  4B3F X;  4X07 A;  3H0D A;  1TUI A;  1Z05 A;  4RDK A;  3CLO A;  2I5U A;  4BGD A;  1OGM X;  1VQ9 I;  5F0H A;  5D5W B;  1VQK I;  5HZA A;  2LKS A;  4IQJ A;  2X3U A;  3KP3 A;  2EIL H;  1WTH D;  3M07 A;  2R7Z J;  3OYF A;  2JDI A;  3CCV B;  3NAR A;  1UB9 A;  2R7D A;  2R7O A;  3JQQ A;  2VQC A;  2DXI A;  5F4M A;  3ZZ0 A;  4IO9 F;  2K4J A;  1IF1 A;  4Y9U A;  2FVG A;  4RDL A;  1RES A;  1MBK A;  2XTX A;  2C5H A;  2BV6 A;  2XSD C;  3RY8 A;  1BJK A;  3UR3 C;  4A0Z A;  4BY1 J;  1QCX A;  3VYU B;  1R22 A;  2Z8G A;  4OP7 A;  1K4T A;  1IJE A;  3SEJ A;  5B6I A;  4Q4Z F;  2R7T A;  5E3L A;  2ISZ A;  3GX4 X;  1TYW A;  2R93 J;  2INU A;  4NC8 A;  3ONQ A;  4HF2 A;  4W8R A;  2G7U A;  4V02 C;  4U9U A;  3T53 B;  2M0M A;  1HDD C;  1WDT A;  4K1X A;  3E5Q A;  2TDX A;  3L2W A;  4C2L A;  4MTD A;  4XLH A;  1D8J A;  3VYS B;  4Y4R A;  1P2F A;  1M1K D;  2VXD A;  1BC7 C;  3OE7 A;  2XRL A;  2HPI A;  2Z33 A;  3SJM A;  3NRV A;  3V7C A;  1V55 H;  1OFE A;  3DF8 A;  3EUH A;  2Y9Z A;  2ZZE A;  2RC5 A;  1FNN A;  1I3Q J;  4Z4Z A;  1JHH A;  1WGX A;  2H09 A;  2L4M A;  2QF7 A;  2WSS A;  1EFT A;  2A07 F;  3H92 A;  2XPV A;  2W6I A;  1PUF A;  5LD2 C;  4KIS A;  5M3M J;  2Y75 A;  3IUO A;  3JU4 A;  5GAH J;  4PJL A;  1TT5 B;  3SZP A;  3HDD A;  4OIP F;  1HW2 A;  2VBX A;  2A69 F;  2Q2E B;  2YUS A;  5HNF A;  4KKU A;  2L02 A;  3KIO A;  4ZYA A;  1KZL A;  3A1Y A;  2W7Z A;  1V0E A;  3OIO A;  3OR2 C;  4RAG A;  1YO5 C;  4HE6 A;  1K8F A;  4YIF A;  1O8K A;  5ILU A;  3M7G A;  1ETO A;  3C2G A;  3BWG A;  3FDY A;  1PVE A;  3ZPL A;  1ZM2 A;  3GME A;  3FHZ A;  3GCM A;  1GO2 A;  4CQJ A;  1Z91 A;  2O3F A;  2EFO A;  2F2E A;  4C3I J;  2MAB A;  5D4S A;  3RPU D;  1VQ8 B;  5HS9 A;  1K4Z A;  3CC2 B;  1TWG J;  1N07 A;  4KIT B;  5TGT A;  1KRH A;  4WZT A;  3S1R J;  3OR1 C;  2L3D A;  1E1R A;  2A6T A;  3ZMD A;  3LWF A;  2LBF B;  2R7V A;  1O7L A;  2M45 A;  1KZH A;  3E20 A;  3EQN A;  1TWA J;  2WZN A;  1MGT A;  1MMN A;  4TMW A;  4YCQ A;  3HAG A;  4KN4 X;  5TRD A;  4OJP A;  5TJJ A;  5CLS A;  1O3S A;  1E64 A;  3H9J A;  2DET A;  5JHF A;  3CJR B;  1QQI A;  3BH6 B;  2X0K A;  4E7I A;  2XAU A;  2R7Q A;  4FTH A;  3E0J B;  5GPA A;  3U2R A;  1UD4 A;  2WZP P;  4MTE A;  2LSO A;  2UVF A;  2K85 A;  1UMK A;  4EQQ A;  5J8F A;  1QGA A;  1R5I D;  4A2U A;  4M3D A;  3E7L A;  3LVB A;  2PQ8 A;  3FMQ A;  5HKK A;  4FAS D;  2WPD A;  4RGS A;  2ECB A;  1UHM A;  3AL0 C;  1FOX A;  5M5W J;  1HVX A;  1P4X A;  3Q0U A;  2XGX A;  1BX1 A;  4EW9 A;  2QZA A;  1SD4 A;  2Z3Y A;  2OBP A;  1ZG1 A;  3P7N A;  4HYE A;  4ETS A;  2JUC A;  2ODL A;  2V6C A;  2HI3 A;  4FQG A;  4Y7N J;  2Z9O A;  3CLQ A;  3A1P A;  5K7Z A;  1TT0 A;  3OWT A;  1VQ5 I;  2ELK A;  3GTL J;  1WPK A;  2CS3 A;  1Z21 A;  2XVC A;  4OOI A;  2JJ7 A;  2HQN A;  3CJQ B;  3RZO J;  4PC2 A;  3O2P E;  2DJI A;  4ZCL A;  3BR6 A;  3VSU A;  4LGW A;  4RA2 A;  1OPC A;  1WI3 A;  3V4G A;  3ZQG A;  4YFO A;  5F1J A;  4Z4S A;  5J3L A;  2XAJ A;  3OSG A;  1OB5 A;  1B23 P;  5E1W A;  3BG3 A;  1JTX A;  3ERE D;  2V4J C;  1PLU A;  3P9C A;  1B2R A;  3CCV I;  3TP3 A;  1LE8 A;  2QTL A;  2IS1 A;  3WTX C;  3VMF A;  2DK8 A;  2JRT A;  3K10 A;  3R0A A;  2KJB A;  3WGI A;  1G3W A;  2P5V A;  1OJL A;  2O61 A;  5F27 A;  3ONY A;  4OAY A;  5K5R A;  3BG5 A;  3FK7 A;  4A3E J;  4ZH4 F;  1D5V A;  3WBJ A;  5FJ8 J;  2PJR B;  3CB4 A;  4QTR A;  1FP1 D;  2VKE A;  3CCL B;  3IH2 A;  3K4C A;  4UUV A;  1WJC A;  4D0P A;  4ZDL A;  5HLT A;  4C2T A;  2G0E A;  5CDF A;  3T56 B;  3W6J B;  2BF4 A;  1ZAO A;  2EV6 A;  2IEK A;  4BPR A;  2KIS A;  3ERM A;  4X7F A;  4XOT A;  1I8D A;  5FLX Z;  2XNJ A;  4C2M J;  2V7W A;  4ZGN B;  1FPQ A;  5F1R A;  1YX3 A;  4PFO A;  3GLL A;  3DEW A;  5HDK A;  4AD9 A;  3ZOB A;  3RZD J;  1T6X A;  3VST A;  4NQW B;  1GT0 C;  3HOX J;  2O0W A;  2L9N A;  2HFH A;  3DV8 A;  2DW4 A;  4I0A A;  2C4U A;  3FM5 A;  3B8Y A;  1Q81 D;  2R5Y B;  2EFG A;  3W3C A;  3ZQ7 A;  1K7A A;  4XR6 A;  1WSR A;  1LPQ A;  4II3 A;  2VFO A;  1IB0 A;  1ELO A;  1SD5 A;  1T33 A;  3CTA A;  3WTT C;  4P3Y A;  1HST A;  1YX5 A;  3OIQ A;  3LSG A;  4KMU X;  1NDH A;  2CF4 A;  2K3P A;  2LRE A;  4KUM A;  3IAM 2;  2R6H A;  4X0G A;  3DCF A;  3D5S C;  3LAP A;  3GVK A;  3F72 A;  3F21 A;  2ZSI B;  2RVC A;  3HOZ J;  4WZE A;  1RNL A;  1L3L A;  1Q86 D;  3QFC A;  1HF0 A;  1K6O A;  1UD8 A;  2B0R A;  3F8C A;  4MQV A;  1VQ6 B;  1UAA A;  4NK8 A;  1H88 C;  1VQ8 I;  4PSW A;  3A01 A;  3WNC A;  1MNE A;  2DFI A;  4P55 A;  2BM1 A;  2JA2 A;  3PQK A;  2Z16 A;  2DOF A;  3K70 D;  3QE2 A;  1HW1 A;  4O3M A;  3K4N A;  3GFL A;  3ABK H;  1I6H J;  3RQI A;  1YIT I;  1RR7 A;  3H1C A;  5EEA A;  2W84 A;  2QSH X;  3I5U A;  3DPT A;  3E5U A;  3K4K A;  3HC7 A;  1A6Q A;  1EJ9 A;  3SZT A;  1Y0Y A;  4X8I A;  3C7J A;  2R9V A;  4MEX F;  3IH3 A;  1FZP B;  3KEW A;  3PM1 A;  2TRT A;  5LHI A;  2M2E A;  3VWB A;  2DPU A;  3HOU J;  1ORK A;  1AHD P;  2VC1 A;  4GCV A;  3WOD F;  5HLH A;  4NNJ A;  5M5X J;  3JAM K;  2NVX J;  1ZM4 A;  4FX4 A;  4KA4 A;  4RM0 A;  2K02 A;  3COA C;  4BBR J;  2MA3 A;  1K78 A;  4C3J J;  3H3U A;  4R8H A;  2F1L A;  3JRA A;  1M90 D;  2VBK A;  4N4O B;  1QZY A;  4B3X A;  3IKT A;  4OMZ A;  2JA8 J;  5E3M A;  2CRV A;  2VC0 A;  3WND A;  3M9A A;  2E7X A;  5KCM A;  1QX4 A;  3SEQ A;  1A04 A;  4U7B A;  3OYN A;  1J2X A;  2IGM A;  1UD5 A;  2L7F P;  1S8N A;  4M74 A;  3GQA A;  3O8H A;  2O9L A;  1U5T B;  5TIS C;  3GTK J;  1T5E A;  3B4N A;  1W34 A;  3V8K A;  1PUE E;  1W9X A;  4G8X A;  1XSV A;  4G1V A;  2M30 A;  2E1R A;  1G7C A;  1DDI A;  1JKO C;  2W48 A;  3JRB A;  4HQE A;  2PMU A;  4UUS B;  3S2W A;  1POG A;  2BXZ A;  5C1E A;  4G94 A;  3CDL A;  2XND A;  1TL8 A;  2CWE A;  2V7X A;  3R6J A;  4I01 A;  4TV7 A;  1B59 A;  2ZFU A;  2DMN A;  3T8R A;  2PX9 A;  3BY6 A;  1R5G A;  3C1D A;  2FBH A;  4QIW N;  2VN2 A;  1QG0 A;  2DEU A;  2QY1 A;  2O1D A;  3RYR A;  2EJR A;  4AYB N;  1FX0 A;  2VNI A;  4CYD A;  4MYU A;  1HKQ A;  4KIC A;  4ASN A;  2X3H A;  3KP4 A;  3I64 A;  1I27 A;  5LRR A;  2O0Y A;  3CCR B;  4PGH A;  2GJP A;  2OTJ B;  3ZMV A;  1ENH A;  2QM3 A;  2OF7 A;  4WWC A;  1Q82 D;  1XG2 A;  4KT5 C;  3F23 A;  4D5C A;  2OBR A;  4Y9R A;  2CC2 A;  3FBN B;  2XDV A;  4CCO A;  4MNU A;  3I54 A;  3OIP A;  2OK8 A;  2LH9 A;  3MZY A;  2WC2 A;  1YIJ B;  3NWS A;  1ZAR A;  2QKL B;  4CCJ A;  3Q38 A;  5J40 A;  1KYZ A;  1PP7 U;  5H6R A;  3KP6 A;  1XGM A;  3G1O A;  2EFW A;  2B9S A;  3V76 A;  4LB5 A;  1K61 A;  1JGS A;  3WGG A;  5IOY A;  2VBE A;  4CH7 A;  3AAF A;  3VO1 A;  2VBZ A;  2XKP A;  1ZGW A;  2D3N A;  2XZO A;  2NRA C;  2XZP A;  1OCO H;  3D26 A;  2BW3 A;  2HYF A;  4AVP A;  4ZDO A;  1U2R A;  4M72 A;  1WRJ A;  2AO9 A;  2M5W A;  5DD8 A;  1TC3 C;  2XRN A;  1E62 A;  5GTI C;  1O3R A;  3W2A A;  5KSW B;  1X1P A;  1P6R A;  1MBF A;  3BY1 A;  1G6N A;  2EIM H;  1XMA A;  2HYG D;  3HHG A;  3ROU A;  2PEX A;  2DA2 A;  4A3L J;  3ZUG A;  5K5Q A;  1DPU A;  5J3O A;  3FKI J;  3PO3 J;  4LJZ F;  3RKX A;  2EK5 A;  1FBS A;  4PJN A;  5KAF C;  1VQO I;  3B8H A;  5IYW A;  4IOA F;  4F52 A;  1SMY F;  1J75 A;  4A3C J;  3DLL F;  4OU0 A;  3EUK L;  3LOC A;  4DNC A;  2QLZ A;  5LLQ A;  2W7N A;  2HVR A;  2BY2 A;  2E36 A;  5F0F A;  4OIR F;  4DYC A;  1N78 A;  2O04 A;  3JR9 A;  1QRY A;  2ZXI A;  4A93 J;  2ECC A;  1D0Y A;  3L2U A;  3HUG B;  1B9M A;  2HYJ A;  3CMA I;  1J9I A;  2R5Z B;  2DA5 A;  2WJV A;  4X7E A;  1Q1V A;  4PFP A;  5DTD A;  2CGP A;  1KQ9 A;  1OYW A;  2MH9 A;  1BX0 A;  4YZ0 A;  3S14 J;  1YIO A;  1O3T A;  5EG0 B;  4BE0 A;  2DFH A;  1SVL A;  2R92 J;  2LYC A;  2MLK A;  1BW5 A;  4MO7 A;  1OR7 C;  4HIZ A;  1KD1 D;  2J8I A;  5K5O A;  1SD6 A;  1WFX A;  1JXS A;  3S2D J;  4U7D A;  2YR2 A;  2K86 A;  5D5U B;  2IQ7 A;  4LK0 F;  4NUB A;  5DS9 A;  4XRS A;  3RI4 A;  1EP2 B;  4JRA C;  2LLK A;  2FX0 A;  1QUF A;  5J1U A;  2DA1 A;  4GFB A;  4ZCI A;  3BTI A;  3OYE A;  2BM4 A;  2F3L A;  1GV5 A;  4HNV A;  4M4S A;  3I53 A;  3ONU A;  2GM4 A;  1Y1W J;  3CQZ J;  3OYD A;  4M1K A;  2I10 A;  4IHS A;  5ICF A;  3OAA A;  4X7C A;  3HPH A;  5LRS A;  2DOA A;  2C78 A;  3CME I;  4YEL A;  3ZBU A;  1BI3 A;  5CQE A;  5DYM A;  4HNT A;  2O5R A;  5HOO A;  3MWM A;  4M9S A;  5TR9 A;  3GWZ A;  2MC4 A;  2O0V A;  1ZRE A;  1F60 A;  2MYS A;  1W0U A;  3I3L A;  1ETY A;  4HLX A;  4HOB A;  4O6J A;  5EZG A;  3FK6 A;  4L9N A;  5B3S H;  5D5V B;  3J7Z I;  3ZR8 X;  3TO6 A;  2H1K A;  3RTR A;  2EFP A;  3UW0 A;  1X1B A;  3KZZ A;  2KRF A;  4F55 A;  2VFM A;  4F3Q A;  1V5F A;  2PMD A;  1YJW B;  3U1K A;  4DJA A;  2JPB A;  4AWX B;  3TW6 A;  3JAM Z;  4Z03 A;  1RWR A;  1JE8 A;  1J5Y A;  3IRR A;  3NE5 B;  1WMR A;  5EEG A;  1Y6I A;  4N9H A;  3SFI A;  4BNC A;  1KQ8 A;  2OAZ A;  4A3M J;  4Z4T A;  1R1T A;  3LNQ A;  2O6G E;  2DER A;  4J01 A;  1X2N A;  2DMU A;  3AG2 H;  1LEA A;  2BE5 F;  4M9Z A;  2LR8 A;  1XGO A;  2BVM A;  2DFF A;  1I3A A;  2ME0 A;  1YIJ I;  4M2L A;  1UHW A;  1X19 A;  1VHE A;  2ZXH A;  1EKE A;  3N97 A;  3HRT A;  5TV2 A;  4LIT A;  3WGH A;  4ESF A;  1U9O A;  3R6S A;  4A3D J;  2NTB A;  1UG0 A;  2VB6 A;  4RB2 C;  1QVG B;  4KIB A;  5C3E J;  2CG4 A;  4B4C A;  4E6K G;  1PJ6 A;  1IN4 A;  3QOD A;  2V9V A;  1TYX A;  3GYH X;  3CUO A;  1ZUN B;  3HSF A;  2E5N A;  2P3M A;  3BPV A;  1K79 A;  2FX3 A;  1XMK A;  4A6E A;  2IS6 A;  3VEP A;  2A3S A;  3RIR A;  5J6X A;  2R7X A;  1CQX A;  2KJC A;  1E2X A;  1KON A;  2DOD A;  2Z99 A;  3F8F A;  4HG2 A;  3BH7 B;  1TP4 A;  1R9T J;  3KEQ A;  3H94 A;  3PVD A;  1YRN B;  4ITV A;  4BL0 B;  2C2W A;  3GVJ A;  5DCM A;  4Y33 A;  2L7K A;  1DU0 A;  4D1Q A;  2HMA A;  3L2R A;  3OZV A;  2BPO A;  1JHF A;  4MR0 A;  2VPR A;  3K2A A;  2VE9 A;  2GIZ A;  3PA1 A;  4EJT A;  3G71 B;  3LFU A;  4ENM A;  1D1N A;  1KK2 A;  3E3V A;  3AVV A;  4WZK A;  3SZE A;  1C0W A;  2BY1 A;  3OKX A;  5D8K B;  3GVL A;  2XT4 A;  2YX7 A;  1IXR C;  3F0C A;  5HLG A;  5CJ9 A;  3LJY A;  1RUN A;  2B0L A;  2XC7 A;  3Q9V A;  5CVJ A;  5DNS A;  3U1D A;  3WG9 A;  3BCF A;  2GAU A;  5CVR A; 
#chains in the Genus database with same CATH homology
 4BGD A;  1OGM X;  3MKW B;  2GOX B;  4EAT A;  4HPQ A;  4U87 A;  1O8D A;  3WQZ A;  4IQJ A;  2CW7 A;  4B44 A;  1UD6 A;  1WTH D;  5FRN A;  2NST A;  3OYF A;  2JDI A;  2ZZQ A;  2X6Y A;  4OZZ A;  2R7O A;  2VQC A;  4BEH A;  2DXI A;  3CMM A;  2VQL A;  3DLA A;  4W8T A;  2W4S A;  4RLQ A;  4E7Z A;  1E3Z A;  3UR3 C;  4XOR A;  1D1C A;  3SEZ A;  3VYU B;  1QCX A;  2Z8G A;  2R7T A;  3T51 B;  4U4B A;  4HNU A;  4Z05 A;  3U21 A;  2KPM A;  3ONQ A;  4NC8 A;  2INU A;  4W8R A;  4AVZ A;  3GQB A;  3T53 B;  3WWG A;  2M0M A;  4C2U A;  3L2W A;  3S3O A;  1OLT A;  4XKC A;  4XLH A;  5FL7 A;  3VYS B;  1BMF A;  3PSF A;  2X53 S;  3BH4 A;  4Y4R A;  2VXD A;  3OE7 A;  2HPI A;  1D1B A;  1WJE A;  2M4G A;  4L8J A;  2F4I A;  3DEE A;  2CV1 A;  2WJY A;  2ZZE A;  4TKO B;  2HPM A;  1UD3 A;  4BE2 A;  3H5A A;  2WSS A;  2M4K A;  3OS0 A;  1MMD A;  2AQE A;  2F5V A;  2W6I A;  5LD2 C;  4KIS A;  1QHH D;  4XN3 A;  1P9Q C;  3IUO A;  1HZE A;  3JU4 A;  3IP4 B;  4UZU A;  4PJL A;  1O8I A;  3HL2 A;  4XM3 A;  1X4P A;  4XN0 A;  1TZL A;  2BSP A;  4IQ4 A;  2Q2E B;  5HNF A;  1WP6 A;  4KKU A;  4ZYA A;  4LIV A;  1KZL A;  2LY1 A;  3A1Y A;  3A2K A;  3DU5 A;  1KCC A;  1V0E A;  2WAE A;  3OR2 C;  2HLD A;  4XLF A;  1O8K A;  1NHC A;  3C2G A;  3FDY A;  4XOP A;  4RLF A;  2CUZ A;  1BHE A;  4II2 A;  3CF2 A;  4RM3 A;  1QU3 A;  4QPO A;  1RU4 A;  3DWL E;  1AA7 A;  2L9S A;  2MAB A;  3TMO A;  3RPU D;  1Z3X A;  2V1N A;  2V31 A;  3ZGK A;  2GK6 A;  4KIT B;  5TGT A;  3OEH A;  1COW A;  1O8M A;  2IGO A;  3OR1 C;  4XQF A;  4OJ6 A;  1E1R A;  2A6T A;  2BW3 B;  2R7V A;  1LVK A;  2LBF B;  3EQN A;  2JIZ A;  4XLA A;  3BLY A;  1MMN A;  2CUJ A;  1DBO A;  3HAG A;  1MAB A;  3K4J A;  4YRV A;  4OJP A;  4LG3 A;  3KEY A;  3S8P A;  3EUA A;  5DN6 A;  2IS2 A;  2M7B A;  4G6I A;  3H9J A;  5JHF A;  3CJR B;  4E7J A;  4G7W A;  1T0F C;  3OY9 A;  4BQQ A;  2DCE A;  4Z1M A;  3QYF A;  4J00 A;  2XAU A;  2R7Q A;  4E7I A;  3E0J B;  4AU7 A;  1UD4 A;  3K6G A;  2DIE A;  2NT9 A;  3H5N A;  2UVF A;  2Q1Z B;  2MD0 A;  4G7X A;  4ZJZ A;  1SFK A;  3PNT A;  4BU2 A;  1WJF A;  3GQ7 A;  4CCK A;  2RQQ A;  5CQG A;  5HKK A;  1YE9 A;  4FAS D;  1X1C A;  2WPD A;  3AL0 C;  2WZP P;  1HVX A;  2INV A;  4EW9 A;  3W2W A;  3H35 A;  3OYB A;  3ZRG A;  4JMQ A;  3BCF A;  2ODL A;  3BCA A;  1MW7 A;  4XKW A;  3PJR A;  1IDJ A;  3OL4 A;  3J7A Y;  2VJI A;  3N05 A;  2X8K A;  4DNR B;  4P5O A;  2OC6 A;  1TT0 A;  1WJD A;  4ASU A;  3S3M A;  3OWT A;  4KT6 A;  4BXF A;  2CS3 A;  1Z21 A;  4E0F A;  1RMG A;  3MKY B;  1OFM A;  2WB1 A;  3CJQ B;  4PK4 A;  3K4M A;  1CZF A;  1DGR M;  3I9V 2;  2DJI A;  4N4N B;  3VSU A;  2CH0 A;  3ZPP A;  2JJ2 A;  3BG7 A;  4OWR B;  4XLC A;  2WY8 Q;  4ZTJ A;  1G59 A;  4U49 A;  4FXU A;  3OYM A;  2BOL A;  2V4J C;  1PLU A;  4DIQ A;  1IA5 A;  3HXL A;  1LKX A;  1W0K A;  3S32 A;  1S9H A;  4TSF A;  2XF6 A;  1H80 A;  2IS1 A;  3LSM A;  1BOB A;  2XF5 A;  3K10 A;  3OEE A;  2I8D A;  2VJ4 A;  1EFR A;  4KKT A;  3CP8 A;  1E79 A;  1IB4 A;  3L2V A;  4D9J A;  4OAY A;  4OJL A;  2QX3 A;  3W2V A;  4I84 A;  1OOC A;  3QYE A;  2PJR B;  3LSH A;  2NTP A;  3SYT A;  5IK2 A;  3K4C A;  2CV2 A;  1WJC A;  3ZCO A;  1T95 A;  1DBG A;  4ZDL A;  5HLT A;  4C2T A;  3PFY A;  2ZZF A;  5CDF A;  3T56 B;  2VL8 A;  4XMY A;  1KMH A;  2F43 A;  1WJA A;  4XOT A;  2JSP A;  3VSL A;  4ANJ A;  3L2Q A;  4CCM A;  1E43 A;  1I8D A;  1SKY B;  2CK3 A;  1YX3 A;  2UUZ A;  2XSJ C;  4PFO A;  1X0C A;  3VST A;  1IDK A;  3HKZ A;  2NT6 A;  3A35 A;  1OFL A;  3H5R A;  4QPQ A;  3PUB A;  3EPZ A;  4NQW B;  2O0W A;  3HOS A;  2L9N A;  3BCB A;  1JTA A;  3E1S A;  4ZTF A;  2GK7 A;  3DKY A;  3OL3 A;  3B8Y A;  2UV1 A;  2VIX A;  3W3C A;  4XR6 A;  4YEJ A;  4II3 A;  2LOO A;  2F1M A;  3QYB A;  3BG6 A;  1YX5 A;  3OIQ A;  3LSG A;  3OYC A;  2K3P A;  2LRE A;  3IAM 2;  4XKV A;  4X0G A;  2LG4 A;  3DQV C;  3BC9 A;  3CES A;  3D5S C;  1W36 D;  3GVK A;  2ZSI B;  3K4B A;  4XLE A;  3S93 A;  4BJT A;  2K5C A;  2HNH A;  2P0W A;  2V9K A;  3H9Q A;  1UD8 A;  2V7Q A;  1DGW Y;  4R79 A;  1NG6 A;  1UAA A;  4NK8 A;  3QOE A;  4PSW A;  2VAS A;  2WAQ A;  1K28 D;  3H9G A;  1MNE A;  2M7A A;  1NBM A;  4DNT B;  1X4O A;  2JA2 A;  3MD2 A;  2Z16 A;  1H8E A;  3K70 D;  3BC8 A;  2KVO A;  2MFZ A;  4W8Q A;  3G2B A;  3K4N A;  4XKB A;  4OJO A;  3VYT B;  2K9M A;  4PUS A;  2CMP A;  3DPT A;  3K4K A;  4PJJ A;  3HC7 A;  1O8E A;  3VSK A;  2E5Z A;  2R9V A;  3FKS A;  3KEW A;  2A5W A;  1MND A;  4JOM A;  3VWB A;  3NWT A;  4Z06 A;  1NRK A;  4Y3O A;  2Z6B D;  2LRD A;  4PMH A;  4NNJ A;  3RQ4 A;  3LL7 A;  4HWV A;  1W0J A;  1J09 A;  1EA3 A;  1D0Z A;  2VJJ A;  2PYG A;  4BQN A;  2VBK A;  3DPU A;  4N4O B;  4B3X A;  1MMG A;  1V5E A;  1GQ8 A;  4F91 B;  3OOU A;  2IGK A;  3KX2 A;  4RMN A;  4BDY A;  5KCM A;  2K9L A;  3T9G A;  3SEQ A;  4U7B A;  2AQF A;  2W00 A;  3FBI B;  3OYN A;  1Z3Y A;  3GQ9 A;  1K5C A;  4BEH B;  5FRM A;  4KJZ A;  2IGM A;  1OHH A;  2UVE A;  1BLI A;  3K4L A;  1UD5 A;  3EUH C;  3BCD A;  2X6X A;  2DT7 B;  2HVQ A;  3GQA A;  3B4N A;  2E1M B;  1T5E A;  2CV0 A;  2F6C A;  2EWE A;  1W9X A;  1VLY A;  4MLO A;  2HVS A;  4IKF A;  4YXW A;  3DKX A;  4E4H A;  5C1E A;  5LFA A;  3PL8 A;  2XND A;  1OGO X;  4JQF A;  1X1D A;  1D0X A;  2KQR A;  2R7R A;  2ZFU A;  1QJV A;  3GQ8 A;  4CUG A;  2WAD A;  1VF7 A;  3A3B A;  1O8G A;  2HQA A;  3LSK A;  2QY1 A;  2O1D A;  2XOK A;  4HST A;  1DP3 A;  1FX0 A;  1PJR A;  3OYJ A;  3KYL A;  2X3H A;  3KRG A;  3TBI A;  2NZM A;  4MXN A;  1HA8 A;  2GJP A;  1WJB A;  2R4G A;  3C2H A;  4BE1 A;  1XG2 A;  3B90 A;  2W1O A;  5AMV A;  3OYH A;  2IGN A;  3OMY A;  2KZV A;  3FBN B;  2XDV A;  4CCO A;  3LMW A;  3OIP A;  1EE6 A;  2LH9 A;  1WPC A;  4HRI A;  3NWS A;  4DK0 A;  2QKL B;  4CCJ A;  3ZQQ A;  2CW8 A;  4B48 A;  4F93 B;  1BR1 A;  1X1A A;  2PMZ A;  2R7S A;  2ZTG A;  3DTE A;  3LSI A;  4XNF A;  2ZSH B;  4CA0 A;  4DBQ A;  2V7F A;  4E7K A;  2XGJ A;  2ZZG A;  2DT6 A;  1E0E A;  3LNN A;  2VBE A;  4YZA A;  4CH7 A;  2XZO A;  2D3N A;  2E1B A;  2XZP A;  3EQO A;  2BW3 A;  1JI8 A;  4ZDO A;  1FMW A;  4DBR A;  3W2A A;  2O17 A;  4YZX A;  4B3G A;  1D1A A;  4FET A;  4GRI A;  2Z2S B;  2ZTN A;  4P22 A;  2XZL A;  4BS9 A;  4BAC A;  1BR2 A;  3D5R C;  3OYI A;  4DK1 A;  1BR4 A;  4PJN A;  3OOC A;  4XON A;  3VMW A;  3VMV A;  2HZD A;  4F52 A;  1O8L A;  4H4K C;  2UWM A;  4NC7 A;  2X6W A;  3EUK L;  2W7N A;  4DGW B;  2HVR A;  2LZJ A;  2M5S A;  2W6J A;  4OZY A;  1N78 A;  2O04 A;  1KCD A;  1H8H A;  4C30 A;  1O8F A;  4E7L A;  2ZXI A;  2VKD A;  1K6Y A;  1PE9 A;  2HU9 A;  5HVQ C;  1D0Y A;  3L2U A;  3HUG B;  3VSV A;  3GBG A;  2V6E A;  2WJV A;  5C1C A;  3OYK A;  4CSW A;  2HDW A;  4PFP A;  2R7U A;  4C9Y A;  4URR A;  3S3N A;  3ZIA A;  3VR6 A;  4YZ0 A;  1G8X A;  4BE0 A;  5CKT A;  2M3A A;  2GJR A;  2LYC A;  3VYR B;  3RSN A;  1OR7 C;  2V4D A;  4HIZ A;  1JRG A;  2JUG A;  3PSI A;  2VPL A;  2X1E A;  1WFX A;  2L2O A;  3JUR A;  2VBM A;  1U0J A;  2E60 A;  2IXS A;  3D5L A;  2IQ7 A;  4NUB A;  1VBL A;  3PNY A;  4BUP A;  3RCO A;  2X1D A;  4B43 A;  4CZC A;  3DTI A;  2VQH A;  2X51 A;  1HG8 A;  2WBM A;  1GLN A;  2IS4 A;  2XF7 A;  3DTK A;  3OPO A;  3OYE A;  3IAS 2;  2D3L A;  2BVL A;  3MMY B;  4ZDP A;  3F9K A;  3DDY A;  3OYD A;  5KNL A;  2E1M C;  4E7H A;  4LIU A;  4IX7 A;  2QKM B;  4ZC3 A;  3HPH A;  2PJR A;  3OAA A;  1I18 A;  5KHD A;  1UD2 A;  3CP2 A;  3OYL A;  2DOA A;  1NG7 A;  2KL4 A;  2KP6 A;  4OAZ A;  3FKJ A;  1ERD A;  2WY7 Q;  4P1W A;  5CQE A;  4YEL A;  4HNT A;  2KRC A;  2O5R A;  3CZ6 A;  5HOO A;  3SZG A;  3ZPN A;  2ELJ A;  2MC4 A;  3ZXS A;  2NOJ B;  3OFN A;  2O0V A;  2JVG A;  2MYS A;  3OS1 A;  3I3L A;  3M1C A;  4C2L A;  1V5G A;  2NSP A;  1SAU A;  3ZR8 X;  4BJ6 C;  4RM2 A;  3RTR A;  4BJ5 C;  1BN8 A;  1X1B A;  3UW0 A;  4GQN A;  2RRE A;  2VLA A;  4F55 A;  4OJ5 A;  4F3Q A;  1V5F A;  2KLO A;  2OV7 A;  3PNV A;  3HOT A;  3VDX A;  4DJA A;  1V0F A;  3G05 A;  1UEL B;  4Z03 A;  1AIR A;  1RWR A;  3FHN A;  3DPL C;  5HNH A;  1FMV A;  2L5Q A;  2VQG A;  1IRX A;  1WMR A;  3NE5 B;  2PEC A;  2LC2 A;  1Y6I A;  1R6R A;  1O8H A;  4J01 A;  2RNG A;  4B47 A;  2KHM A;  4DOZ A;  2KRH A;  3M8J A;  2LY2 A;  2Y0S A;  2QXZ A;  4PSX A;  2W82 A;  2BVM A;  3OYA A;  1KTW A;  3LMM A;  3AKZ A;  5CPR B;  1N75 A;  1X19 A;  1ZEL A;  2ZXH A;  2CFO A;  3OS2 A;  1O88 A;  3A3G A;  2GJK A;  4YZQ A;  4LIT A;  3HG9 A;  1N77 A;  4BQO A;  4G6T B;  4KKS A;  1O8J A;  1UG0 A;  2VB6 A;  2NTB A;  3HPG A;  2V26 A;  3TL4 X;  4E6K G;  3QOD A;  1Y56 A;  4HEA 2;  2KDO A;  3OW7 A;  1PYV A;  4PJM A;  3SUC A;  2E5N A;  2Z1D A;  2OUM A;  4BDZ A;  4CCL A;  2GOM A;  2IS6 A;  3OYG A;  4TT3 A;  4F92 B;  4IZZ A;  3FY3 A;  1QHG A;  2R7X A;  2JVH A;  1KON A;  4HG2 A;  3H94 A;  1W36 C;  4XD7 A;  4ITV A;  2NTQ A;  2VKH A;  4W8S A;  2PYH A;  1VZ0 A;  4XL9 A;  2WA0 A;  4BL0 B;  3GVJ A;  2VJ5 A;  4Y33 A;  2L7K A;  3SDB A;  2QE7 A;  1LDK B;  4D1Q A;  2VXZ A;  4E7S A;  2R7W A;  3AL0 B;  2KMU A;  4AYB A;  3L2R A;  1PXZ A;  2WAF A;  3MKZ A;  1LFP A;  3GRH A;  4MR0 A;  2FUG 2;  3LFU A;  2X1C A;  4HSR A;  2LBF A;  1E3X A;  1PKV A;  3K70 C;  1DQU A;  1Z7L A;  1VJS A;  4CCN A;  5FRO A;  3GVL A;  3V42 A;  1BPL A;  4NK6 A;  2JJ1 A;  3ZSC A;  2X85 A;  3FPP A;  3DU6 A;  2XC7 A;  1MMA A;  3A4C A;  1WJ5 A;  4B3F X;  3AFH A;  3H0D A;  1OB0 A;  3UNG C;  1E1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...