4Z06A

C. bescii family 3 pectate lyase double mutant k108a/r133a in complex with alpha-d-galactopyranuronic acid
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVAQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 79
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z06A00
1DBGA 4XKWA 2ODLA 2NTPA 3FY3A 3ZSCA 4XR6A 4OZYA 3GQ8A 1OFLA 2NT9A 3B90A 3B8YA 2Z8GA 4XLAA 4MR0A 4XLCA 3UW0A 1O8EA 4YZXA 2O1DA 1EE6A 4XLFA 1IA5A 4NK8A 4W8RA 2QY1A 1QCXA 4URRA 2O0WA 3GQ9A 3LMWA 1OGOX 4XKVA 3VMWA 3SUCA 1RWRA 2EWEA 4XNFA 1PLUA 5AMVA 4YELA 1RU4A 1O8GA 2NTBA 1O8FA 1OOCA 1XG2A 2O17A 3GRHA 4XOTA 4Z05A 2PYHA 1IDJA 3B4NA 2VBMA 4W8SA 4XLEA 1VBLA 2VJJA 2VBEA 4XONA 4U49A 2UVEA 3VMVA 4NK6A 1OFMA 4HWVA 2UVFA 4XLHA 1K5CA 4YZQA 4XM3A 2PECA 4U4BA 3ZPPA 1O8HA 3KRGA 2QXZA 1CZFA 4YZAA 1AIRA 5C1CA 4C2LA 3VSTA 1X0CA 1KCDA 4I84A 2NTQA 4OJLA 2IQ7A 4OJOA 1O88A 1O8KA 2X3HA 3VSVA 1KTWA 1RMGA 2NZMA 1IB4A 1BN8A 1O8MA 2X6WA 4XN3A 4AVZA 4PMHA 1IDKA 2INVA 1JRGA 1JTAA 2NSPA 2PYGA 2O04A 3VSUA 1H80A 1QJVA 2INUA 3GQ7A 4W8QA 2X6XA 3GQAA 2VJIA 2NSTA 4OZZA 4OJPA 1NHCA 1BHEA 4OJ6A 4W8TA 2X6YA 3T9GA 4MXNA 1O8IA 1DBOA 2X85A 1O8DA 4Z03A 1HG8A 4XN0A 1KCCA 1OGMX 2BSPA 4Z06A 4OJ5A 3JURA 3EQNA 4XOPA 4XQFA 1O8LA 5C1EA 2VBKA 1O8JA 4XORA 4XMYA 4YEJA 1WMRA 2O0VA 1PE9A 4XL9A 2NT6A 4EW9A 3WWGA 4YZ0A 1GQ8A 2QX3A 3EQOA 1PXZA
chains in the Genus database with same CATH superfamily
4OM9A 1DBGA 4YDTA 2VFQA 4XKWA 2VFNA 2XC1A 2ODLA 2NTPA 3FY3A 3ZSCA 4XR6A 4OZYA 4V02C 4JRAC 1TYWA 5JMCB 3GQ8A 1OFLA 2NT9A 3B90A 1HF2A 4OPWA 3B8YA 1WXRA 2Z8GA 4KH3A 4MR0A 2BM5A 2IOUG 4XLAA 4XLCA 2VFMA 3N90A 3UW0A 4YEIA 1KQ5A 2G0YA 1O8EA 4YZXA 2O1DA 1EE6A 4XLFA 3NAWA 4NK8A 4W8RA 2QY1A 3P4GA 1QCXA 1IA5A 1QQ1A 4URRA 2YUHA 2O0WA 1QA3A 3GQ9A 3LMWA 1OGOX 4XKVA 3VMWA 2O6WA 3SUCA 1RWRA 2EWEA 4XNFA 1PLUA 5AMVA 4YELA 1RU4A 3RIQA 1O8GA 2NTBA 1O8FA 1OOCA 1XG2A 2O17A 3GRHA 3LYCA 3SZEA 4XOTA 1TYXA 4Z05A 1TSPA 2PYHA 1LLWA 1IDJA 3B4NA 4YC5A 3SQVA 2VBMA 4W8SA 4XLEA 1VBLA 2VJJA 2VBEA 3ML3A 4U49A 2UVEA 4XONA 3VMVA 4NK6A 1OFMA 4HWVA 2UVFA 2XTYA 4XLHA 2W7ZA 1K5CA 4YZQA 1OFEA 5DNSA 3PSSA 4XM3A 1K8FA 2PECA 3DU1X 4U4BA 3ZPPA 1O8HA 3KRGA 2V5IA 1TYVA 2QXZA 1CZFA 4YZAA 1QA1A 1AIRA 5C1CA 4C2LA 3VSTA 1X0CA 1KCDA 4I84A 2NTQA 4OJLA 2IQ7A 1EZGA 1TYUA 1O88A 1O8KA 2X3HA 3BH6B 4OJOA 3VSVA 1KTWA 1RMGA 1LM1A 2XTWA 2NZMA 1IB4A 1BN8A 1O8MA 1DABA 2X6WA 2BX6A 3LJYA 4XN3A 4AVZA 3BH7B 4PMHA 1IDKA 2BM7A 1OFDA 2INVA 2XT2A 3PSZA 5JLVC 1JRGA 1JTAA 1QRCA 3SYJA 1L1IA 2NSPA 2PYGA 2O04A 3VSUA 1H80A 1QJVA 2INUA 3GQ7A 4W8QA 2X6XA 3GQAA 2VJIA 3JX8A 4YCQA 2NSTA 4OZZA 4OJPA 3H09A 1NHCA 2QZAA 1CLWA 2XT4A 1BHEA 1K4ZA 4OJ6A 4W8TA 2X6YA 1EA0A 3T9GA 2J8KA 4MXNA 1DBOA 1O8IA 2X85A 3PETA 4YFOA 1O8DA 1QRBA 2VFOA 4Z03A 1HG8A 1LLZA 4XN0A 2B0RA 1KCCA 1OGMX 2BSPA 4Z06A 3SY2A 2BM4A 2XTXA 4OJ5A 3AK5A 2QX3A 2QYUA 3EQNA 3JURA 2F3LA 4XOPA 3TH0A 1O8LA 2VFPA 4XQFA 3N6ZA 5C1EA 2VBKA 1O8JA 4XORA 4XMYA 4YEJA 1WMRA 2O0VA 1QA2A 1PE9A 4XL9A 2NT6A 3NB2A 4EW9A 3WWGA 4YZ0A 1GQ8A 2J8IA 3EQOA 1PXZA 2BM6A
chains in the Genus database with same CATH topology
1DBGA 4XKWA 2ODLA 2NTPA 3FY3A 3ZSCA 4XR6A 4OZYA 3GQ8A 1OFLA 2NT9A 3B90A 3B8YA 2Z8GA 4XLAA 4MR0A 4XLCA 3UW0A 1O8EA 4YZXA 2O1DA 1EE6A 4XLFA 1IA5A 4NK8A 4W8RA 2QY1A 1QCXA 4URRA 2O0WA 3GQ9A 3LMWA 1OGOX 4XKVA 3VMWA 3SUCA 1RWRA 2EWEA 4XNFA 1PLUA 5AMVA 4YELA 1RU4A 1O8GA 2NTBA 1O8FA 1OOCA 1XG2A 2O17A 3GRHA 4XOTA 4Z05A 2PYHA 1IDJA 3B4NA 2VBMA 4W8SA 4XLEA 1VBLA 2VJJA 2VBEA 4XONA 4U49A 2UVEA 3VMVA 4NK6A 1OFMA 4HWVA 2UVFA 4XLHA 1K5CA 4YZQA 4XM3A 2PECA 4U4BA 3ZPPA 1O8HA 3KRGA 2QXZA 1CZFA 4YZAA 1AIRA 5C1CA 4C2LA 3VSTA 1X0CA 1KCDA 4I84A 2NTQA 4OJLA 2IQ7A 4OJOA 1O88A 1O8KA 2X3HA 3VSVA 1KTWA 1RMGA 2NZMA 1IB4A 1BN8A 1O8MA 2X6WA 4XN3A 4AVZA 4PMHA 1IDKA 2INVA 1JRGA 1JTAA 2NSPA 2PYGA 2O04A 3VSUA 1H80A 1QJVA 2INUA 3GQ7A 4W8QA 2X6XA 3GQAA 2VJIA 2NSTA 4OZZA 4OJPA 1NHCA 1BHEA 4OJ6A 4W8TA 2X6YA 3T9GA 4MXNA 1O8IA 1DBOA 2X85A 1O8DA 4Z03A 1HG8A 4XN0A 1KCCA 1OGMX 2BSPA 4Z06A 4OJ5A 3JURA 3EQNA 4XOPA 4XQFA 1O8LA 5C1EA 2VBKA 1O8JA 4XORA 4XMYA 4YEJA 1WMRA 2O0VA 1PE9A 4XL9A 2NT6A 4EW9A 3WWGA 4YZ0A 1GQ8A 2QX3A 3EQOA 1PXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBG A;  4XKW A;  2ODL A;  2NTP A;  3FY3 A;  3ZSC A;  4XR6 A;  4OZY A;  3GQ8 A;  1OFL A;  2NT9 A;  3B90 A;  3B8Y A;  2Z8G A;  4XLA A;  4MR0 A;  4XLC A;  3UW0 A;  1O8E A;  4YZX A;  2O1D A;  1EE6 A;  4XLF A;  1IA5 A;  4NK8 A;  4W8R A;  2QY1 A;  1QCX A;  4URR A;  2O0W A;  3GQ9 A;  3LMW A;  1OGO X;  4XKV A;  3VMW A;  3SUC A;  1RWR A;  2EWE A;  4XNF A;  1PLU A;  5AMV A;  4YEL A;  1RU4 A;  1O8G A;  2NTB A;  1O8F A;  1OOC A;  1XG2 A;  2O17 A;  3GRH A;  4XOT A;  4Z05 A;  2PYH A;  1IDJ A;  3B4N A;  2VBM A;  4W8S A;  4XLE A;  1VBL A;  2VJJ A;  2VBE A;  4XON A;  4U49 A;  2UVE A;  3VMV A;  4NK6 A;  1OFM A;  4HWV A;  2UVF A;  4XLH A;  1K5C A;  4YZQ A;  4XM3 A;  2PEC A;  4U4B A;  3ZPP A;  1O8H A;  3KRG A;  2QXZ A;  1CZF A;  4YZA A;  1AIR A;  5C1C A;  4C2L A;  3VST A;  1X0C A;  1KCD A;  4I84 A;  2NTQ A;  4OJL A;  2IQ7 A;  4OJO A;  1O88 A;  1O8K A;  2X3H A;  3VSV A;  1KTW A;  1RMG A;  2NZM A;  1IB4 A;  1BN8 A;  1O8M A;  2X6W A;  4XN3 A;  4AVZ A;  4PMH A;  1IDK A;  2INV A;  1JRG A;  1JTA A;  2NSP A;  2PYG A;  2O04 A;  3VSU A;  1H80 A;  1QJV A;  2INU A;  3GQ7 A;  4W8Q A;  2X6X A;  3GQA A;  2VJI A;  2NST A;  4OZZ A;  4OJP A;  1NHC A;  1BHE A;  4OJ6 A;  4W8T A;  2X6Y A;  3T9G A;  4MXN A;  1O8I A;  1DBO A;  2X85 A;  1O8D A;  4Z03 A;  1HG8 A;  4XN0 A;  1KCC A;  1OGM X;  2BSP A;  4Z06 A;  4OJ5 A;  3JUR A;  3EQN A;  4XOP A;  4XQF A;  1O8L A;  5C1E A;  2VBK A;  1O8J A;  4XOR A;  4XMY A;  4YEJ A;  1WMR A;  2O0V A;  1PE9 A;  4XL9 A;  2NT6 A;  4EW9 A;  3WWG A;  4YZ0 A;  1GQ8 A;  2QX3 A;  3EQO A;  1PXZ A; 
#chains in the Genus database with same CATH topology
 4OM9 A;  1DBG A;  4YDT A;  2VFQ A;  4XKW A;  2VFN A;  2XC1 A;  2ODL A;  2NTP A;  3FY3 A;  3ZSC A;  4XR6 A;  4OZY A;  4V02 C;  4JRA C;  1TYW A;  5JMC B;  3GQ8 A;  1OFL A;  2NT9 A;  3B90 A;  1HF2 A;  4OPW A;  3B8Y A;  1WXR A;  2Z8G A;  4KH3 A;  4MR0 A;  2BM5 A;  2IOU G;  4XLA A;  4XLC A;  2VFM A;  3N90 A;  3UW0 A;  4YEI A;  1KQ5 A;  2G0Y A;  1O8E A;  4YZX A;  2O1D A;  1EE6 A;  4XLF A;  3NAW A;  4NK8 A;  4W8R A;  2QY1 A;  3P4G A;  1QCX A;  1IA5 A;  1QQ1 A;  4URR A;  2YUH A;  2O0W A;  1QA3 A;  3GQ9 A;  3LMW A;  1OGO X;  4XKV A;  3VMW A;  2O6W A;  3SUC A;  1RWR A;  2EWE A;  4XNF A;  1PLU A;  5AMV A;  4YEL A;  1RU4 A;  3RIQ A;  1O8G A;  2NTB A;  1O8F A;  1OOC A;  1XG2 A;  2O17 A;  3GRH A;  3LYC A;  3SZE A;  4XOT A;  1TYX A;  4Z05 A;  1TSP A;  2PYH A;  1LLW A;  1IDJ A;  3B4N A;  4YC5 A;  3SQV A;  2VBM A;  4W8S A;  4XLE A;  1VBL A;  2VJJ A;  2VBE A;  3ML3 A;  4U49 A;  2UVE A;  4XON A;  3VMV A;  4NK6 A;  1OFM A;  4HWV A;  2UVF A;  2XTY A;  4XLH A;  2W7Z A;  1K5C A;  4YZQ A;  1OFE A;  5DNS A;  3PSS A;  4XM3 A;  1K8F A;  2PEC A;  3DU1 X;  4U4B A;  3ZPP A;  1O8H A;  3KRG A;  2V5I A;  1TYV A;  2QXZ A;  1CZF A;  4YZA A;  1QA1 A;  1AIR A;  5C1C A;  4C2L A;  3VST A;  1X0C A;  1KCD A;  4I84 A;  2NTQ A;  4OJL A;  2IQ7 A;  1EZG A;  1TYU A;  1O88 A;  1O8K A;  2X3H A;  3BH6 B;  4OJO A;  3VSV A;  1KTW A;  1RMG A;  1LM1 A;  2XTW A;  2NZM A;  1IB4 A;  1BN8 A;  1O8M A;  1DAB A;  2X6W A;  2BX6 A;  3LJY A;  4XN3 A;  4AVZ A;  3BH7 B;  4PMH A;  1IDK A;  2BM7 A;  1OFD A;  2INV A;  2XT2 A;  3PSZ A;  5JLV C;  1JRG A;  1JTA A;  1QRC A;  3SYJ A;  1L1I A;  2NSP A;  2PYG A;  2O04 A;  3VSU A;  1H80 A;  1QJV A;  2INU A;  3GQ7 A;  4W8Q A;  2X6X A;  3GQA A;  2VJI A;  3JX8 A;  4YCQ A;  2NST A;  4OZZ A;  4OJP A;  3H09 A;  1NHC A;  2QZA A;  1CLW A;  2XT4 A;  1BHE A;  1K4Z A;  4OJ6 A;  4W8T A;  2X6Y A;  1EA0 A;  3T9G A;  2J8K A;  4MXN A;  1DBO A;  1O8I A;  2X85 A;  3PET A;  4YFO A;  1O8D A;  1QRB A;  2VFO A;  4Z03 A;  1HG8 A;  1LLZ A;  4XN0 A;  2B0R A;  1KCC A;  1OGM X;  2BSP A;  4Z06 A;  3SY2 A;  2BM4 A;  2XTX A;  4OJ5 A;  3AK5 A;  2QX3 A;  2QYU A;  3EQN A;  3JUR A;  2F3L A;  4XOP A;  3TH0 A;  1O8L A;  2VFP A;  4XQF A;  3N6Z A;  5C1E A;  2VBK A;  1O8J A;  4XOR A;  4XMY A;  4YEJ A;  1WMR A;  2O0V A;  1QA2 A;  1PE9 A;  4XL9 A;  2NT6 A;  3NB2 A;  4EW9 A;  3WWG A;  4YZ0 A;  1GQ8 A;  2J8I A;  3EQO A;  1PXZ A;  2BM6 A; 
#chains in the Genus database with same CATH homology
 1DBG A;  4XKW A;  2ODL A;  2NTP A;  3FY3 A;  3ZSC A;  4XR6 A;  4OZY A;  3GQ8 A;  1OFL A;  2NT9 A;  3B90 A;  3B8Y A;  2Z8G A;  4XLA A;  4MR0 A;  4XLC A;  3UW0 A;  1O8E A;  4YZX A;  2O1D A;  1EE6 A;  4XLF A;  1IA5 A;  4NK8 A;  4W8R A;  2QY1 A;  1QCX A;  4URR A;  2O0W A;  3GQ9 A;  3LMW A;  1OGO X;  4XKV A;  3VMW A;  3SUC A;  1RWR A;  2EWE A;  4XNF A;  1PLU A;  5AMV A;  4YEL A;  1RU4 A;  1O8G A;  2NTB A;  1O8F A;  1OOC A;  1XG2 A;  2O17 A;  3GRH A;  4XOT A;  4Z05 A;  2PYH A;  1IDJ A;  3B4N A;  2VBM A;  4W8S A;  4XLE A;  1VBL A;  2VJJ A;  2VBE A;  4XON A;  4U49 A;  2UVE A;  3VMV A;  4NK6 A;  1OFM A;  4HWV A;  2UVF A;  4XLH A;  1K5C A;  4YZQ A;  4XM3 A;  2PEC A;  4U4B A;  3ZPP A;  1O8H A;  3KRG A;  2QXZ A;  1CZF A;  4YZA A;  1AIR A;  5C1C A;  4C2L A;  3VST A;  1X0C A;  1KCD A;  4I84 A;  2NTQ A;  4OJL A;  2IQ7 A;  4OJO A;  1O88 A;  1O8K A;  2X3H A;  3VSV A;  1KTW A;  1RMG A;  2NZM A;  1IB4 A;  1BN8 A;  1O8M A;  2X6W A;  4XN3 A;  4AVZ A;  4PMH A;  1IDK A;  2INV A;  1JRG A;  1JTA A;  2NSP A;  2PYG A;  2O04 A;  3VSU A;  1H80 A;  1QJV A;  2INU A;  3GQ7 A;  4W8Q A;  2X6X A;  3GQA A;  2VJI A;  2NST A;  4OZZ A;  4OJP A;  1NHC A;  1BHE A;  4OJ6 A;  4W8T A;  2X6Y A;  3T9G A;  4MXN A;  1O8I A;  1DBO A;  2X85 A;  1O8D A;  4Z03 A;  1HG8 A;  4XN0 A;  1KCC A;  1OGM X;  2BSP A;  4Z06 A;  4OJ5 A;  3JUR A;  3EQN A;  4XOP A;  4XQF A;  1O8L A;  5C1E A;  2VBK A;  1O8J A;  4XOR A;  4XMY A;  4YEJ A;  1WMR A;  2O0V A;  1PE9 A;  4XL9 A;  2NT6 A;  4EW9 A;  3WWG A;  4YZ0 A;  1GQ8 A;  2QX3 A;  3EQO A;  1PXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...