4Z06A

C. bescii family 3 pectate lyase double mutant k108a/r133a in complex with alpha-d-galactopyranuronic acid
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVAQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 79
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z06A00
3ZPPA 1OFMA 4XLHA 2X6XA 4YZQA 1BN8A 2NTQA 3VSTA 1XG2A 2O0WA 4XL9A 1RMGA 4OJLA 3EQOA 4XOTA 4XOPA 2ODLA 2UVEA 4XKWA 1O8KA 1VBLA 1NHCA 2VJIA 4W8RA 1QCXA 2NZMA 3SUCA 1IDKA 4XM3A 3B90A 1O8LA 3GQAA 2VJJA 4W8TA 3WWGA 3ZSCA 1RWRA 1O8EA 1IDJA 2NSPA 4YZXA 4YZAA 1JRGA 1O8IA 3JURA 3VSUA 2O1DA 2VBKA 4XORA 5AMVA 4EW9A 2VBMA 1EE6A 4U4BA 4NK8A 4AVZA 2Z8GA 1PXZA 4OJOA 3UW0A 2X6WA 4OJ5A 1OGOX 4U49A 4XNFA 2EWEA 1PLUA 2X3HA 2X6YA 2NT6A 1BHEA 2NTBA 2PYGA 3GRHA 1RU4A 5C1CA 2VBEA 4NK6A 4HWVA 4W8SA 3GQ7A 1PE9A 2INVA 2PYHA 4MR0A 4OZYA 3VSVA 4YZ0A 2IQ7A 1O8GA 3KRGA 3GQ9A 3EQNA 4XLFA 1H80A 4YEJA 4XLEA 2BSPA 1O8JA 4XR6A 1QJVA 4XN0A 1OOCA 1CZFA 1OGMX 4XONA 1O88A 2O17A 5C1EA 1DBOA 4C2LA 1IB4A 1O8MA 1HG8A 2INUA 2UVFA 3FY3A 2X85A 1X0CA 4XKVA 2PECA 4Z05A 1GQ8A 1KCDA 2QXZA 4Z06A 2NTPA 1JTAA 1DBGA 4PMHA 1IA5A 2O0VA 4XLAA 4XMYA 1WMRA 4XLCA 4XQFA 1O8DA 4OZZA 4I84A 1KCCA 3B4NA 3LMWA 4Z03A 1AIRA 1O8FA 4YELA 3T9GA 3VMVA 4MXNA 2QY1A 4OJPA 1K5CA 2NSTA 3GQ8A 4W8QA 1O8HA 2NT9A 1OFLA 1KTWA 2O04A 2QX3A 3VMWA 4URRA 4OJ6A 4XN3A 3B8YA
chains in the Genus database with same CATH superfamily
3N6ZA 5JLVC 3ZPPA 1OFMA 4XLHA 2X6XA 4YZQA 1BN8A 2NTQA 3VSTA 1EA0A 1CLWA 1XG2A 2O0WA 4XL9A 1RMGA 4OJLA 3EQOA 4XOTA 1QRBA 4XOPA 3NB2A 2ODLA 2UVEA 1TYXA 2VFQA 4XKWA 1O8KA 2B0RA 2V5IA 2W7ZA 2XT2A 2VFPA 2IOUG 3AK5A 1VBLA 1QA3A 1NHCA 1WXRA 3DU1X 2VJIA 4W8RA 1QCXA 2NZMA 3SUCA 2BM4A 1IDKA 2G0YA 4XM3A 3B90A 1O8LA 3SQVA 2QZAA 3GQAA 2VJJA 4W8TA 3RIQA 3WWGA 3ZSCA 1RWRA 1K4ZA 1O8EA 1IDJA 2NSPA 3NAWA 3P4GA 4YZXA 4YZAA 1JRGA 1O8IA 3JURA 4YEIA 3JX8A 2BM6A 2BM7A 1LM1A 4YCQA 3VSUA 2O1DA 2VBKA 4XORA 3PSSA 3SZEA 1EZGA 5AMVA 2VBMA 4EW9A 1QRCA 2XTYA 1EE6A 2VFNA 4U4BA 2BM5A 4NK8A 4AVZA 1TYWA 1PXZA 2Z8GA 4OJOA 3UW0A 2X6WA 4OJ5A 1OGOX 4U49A 4XNFA 2EWEA 1PLUA 2X3HA 2X6YA 2NT6A 1BHEA 2NTBA 1TYVA 2PYGA 3GRHA 1RU4A 5C1CA 2VBEA 3SYJA 4NK6A 4HWVA 4W8SA 3GQ7A 1PE9A 2INVA 2PYHA 4MR0A 1LLZA 4OZYA 3VSVA 2IQ7A 1O8GA 2BX6A 2YUHA 3GQ9A 3EQNA 3KRGA 1H80A 3BH7B 4XLFA 3PSZA 4YEJA 2QYUA 4XLEA 3SY2A 2XTXA 2BSPA 1O8JA 3LYCA 1K8FA 4XR6A 4KH3A 1QJVA 4XN0A 1HF2A 3LJYA 1OOCA 3TH0A 2VFMA 3BH6B 1TYUA 1QA1A 4OPWA 1CZFA 1OGMX 4XONA 1O88A 2O17A 4V02C 5C1EA 1DBOA 3H09A 4YDTA 4C2LA 1IB4A 1LLWA 3N90A 5JMCB 1O8MA 1HG8A 2INUA 2UVFA 3FY3A 2X85A 1X0CA 2VFOA 4XKVA 2PECA 4Z05A 1GQ8A 1KCDA 2QXZA 1QQ1A 4Z06A 1OFDA 1JTAA 2NTPA 1DBGA 2XTWA 4PMHA 1IA5A 2O0VA 2XC1A 4XLAA 1WMRA 4XMYA 4XLCA 4YFOA 4XQFA 1O8DA 5DNSA 4OZZA 4I84A 4YC5A 1KCCA 3B4NA 1QA2A 3LMWA 4Z03A 1AIRA 1O8FA 4YELA 4YZ0A 1DABA 1KQ5A 2F3LA 2J8KA 2J8IA 3T9GA 3VMVA 3ML3A 4MXNA 2QY1A 4OJPA 1K5CA 1TSPA 2NSTA 3GQ8A 4OJ6A 4W8QA 1O8HA 1OFEA 2NT9A 2XT4A 4OM9A 1OFLA 1L1IA 1KTWA 3PETA 2O04A 2QX3A 3VMWA 4URRA 4JRAC 4XN3A 2O6WA 3B8YA
chains in the Genus database with same CATH topology
3ZPPA 1OFMA 4XLHA 2X6XA 4YZQA 1BN8A 2NTQA 3VSTA 1XG2A 2O0WA 4XL9A 1RMGA 4OJLA 3EQOA 4XOTA 4XOPA 2ODLA 2UVEA 4XKWA 1O8KA 1VBLA 1NHCA 2VJIA 4W8RA 1QCXA 2NZMA 3SUCA 1IDKA 4XM3A 3B90A 1O8LA 3GQAA 2VJJA 4W8TA 3WWGA 3ZSCA 1RWRA 1O8EA 1IDJA 2NSPA 4YZXA 4YZAA 1JRGA 1O8IA 3JURA 3VSUA 2O1DA 2VBKA 4XORA 5AMVA 4EW9A 2VBMA 1EE6A 4U4BA 4NK8A 4AVZA 2Z8GA 1PXZA 4OJOA 3UW0A 2X6WA 4OJ5A 1OGOX 4U49A 4XNFA 2EWEA 1PLUA 2X3HA 2X6YA 2NT6A 1BHEA 2NTBA 2PYGA 3GRHA 1RU4A 5C1CA 2VBEA 4NK6A 4HWVA 4W8SA 3GQ7A 1PE9A 2INVA 2PYHA 4MR0A 4OZYA 3VSVA 4YZ0A 2IQ7A 1O8GA 3KRGA 3GQ9A 3EQNA 4XLFA 1H80A 4YEJA 4XLEA 2BSPA 1O8JA 4XR6A 1QJVA 4XN0A 1OOCA 1CZFA 1OGMX 4XONA 1O88A 2O17A 5C1EA 1DBOA 4C2LA 1IB4A 1O8MA 1HG8A 2INUA 2UVFA 3FY3A 2X85A 1X0CA 4XKVA 2PECA 4Z05A 1GQ8A 1KCDA 2QXZA 4Z06A 2NTPA 1JTAA 1DBGA 4PMHA 1IA5A 2O0VA 4XLAA 4XMYA 1WMRA 4XLCA 4XQFA 1O8DA 4OZZA 4I84A 1KCCA 3B4NA 3LMWA 4Z03A 1AIRA 1O8FA 4YELA 3T9GA 3VMVA 4MXNA 2QY1A 4OJPA 1K5CA 2NSTA 3GQ8A 4W8QA 1O8HA 2NT9A 1OFLA 1KTWA 2O04A 2QX3A 3VMWA 4URRA 4OJ6A 4XN3A 3B8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZPP A;  1OFM A;  4XLH A;  2X6X A;  4YZQ A;  1BN8 A;  2NTQ A;  3VST A;  1XG2 A;  2O0W A;  4XL9 A;  1RMG A;  4OJL A;  3EQO A;  4XOT A;  4XOP A;  2ODL A;  2UVE A;  4XKW A;  1O8K A;  1VBL A;  1NHC A;  2VJI A;  4W8R A;  1QCX A;  2NZM A;  3SUC A;  1IDK A;  4XM3 A;  3B90 A;  1O8L A;  3GQA A;  2VJJ A;  4W8T A;  3WWG A;  3ZSC A;  1RWR A;  1O8E A;  1IDJ A;  2NSP A;  4YZX A;  4YZA A;  1JRG A;  1O8I A;  3JUR A;  3VSU A;  2O1D A;  2VBK A;  4XOR A;  5AMV A;  4EW9 A;  2VBM A;  1EE6 A;  4U4B A;  4NK8 A;  4AVZ A;  2Z8G A;  1PXZ A;  4OJO A;  3UW0 A;  2X6W A;  4OJ5 A;  1OGO X;  4U49 A;  4XNF A;  2EWE A;  1PLU A;  2X3H A;  2X6Y A;  2NT6 A;  1BHE A;  2NTB A;  2PYG A;  3GRH A;  1RU4 A;  5C1C A;  2VBE A;  4NK6 A;  4HWV A;  4W8S A;  3GQ7 A;  1PE9 A;  2INV A;  2PYH A;  4MR0 A;  4OZY A;  3VSV A;  4YZ0 A;  2IQ7 A;  1O8G A;  3KRG A;  3GQ9 A;  3EQN A;  4XLF A;  1H80 A;  4YEJ A;  4XLE A;  2BSP A;  1O8J A;  4XR6 A;  1QJV A;  4XN0 A;  1OOC A;  1CZF A;  1OGM X;  4XON A;  1O88 A;  2O17 A;  5C1E A;  1DBO A;  4C2L A;  1IB4 A;  1O8M A;  1HG8 A;  2INU A;  2UVF A;  3FY3 A;  2X85 A;  1X0C A;  4XKV A;  2PEC A;  4Z05 A;  1GQ8 A;  1KCD A;  2QXZ A;  4Z06 A;  2NTP A;  1JTA A;  1DBG A;  4PMH A;  1IA5 A;  2O0V A;  4XLA A;  4XMY A;  1WMR A;  4XLC A;  4XQF A;  1O8D A;  4OZZ A;  4I84 A;  1KCC A;  3B4N A;  3LMW A;  4Z03 A;  1AIR A;  1O8F A;  4YEL A;  3T9G A;  3VMV A;  4MXN A;  2QY1 A;  4OJP A;  1K5C A;  2NST A;  3GQ8 A;  4W8Q A;  1O8H A;  2NT9 A;  1OFL A;  1KTW A;  2O04 A;  2QX3 A;  3VMW A;  4URR A;  4OJ6 A;  4XN3 A;  3B8Y A; 
#chains in the Genus database with same CATH topology
 3N6Z A;  5JLV C;  3ZPP A;  1OFM A;  4XLH A;  2X6X A;  4YZQ A;  1BN8 A;  2NTQ A;  3VST A;  1EA0 A;  1CLW A;  1XG2 A;  2O0W A;  4XL9 A;  1RMG A;  4OJL A;  3EQO A;  4XOT A;  1QRB A;  4XOP A;  3NB2 A;  2ODL A;  2UVE A;  1TYX A;  2VFQ A;  4XKW A;  1O8K A;  2B0R A;  2V5I A;  2W7Z A;  2XT2 A;  2VFP A;  2IOU G;  3AK5 A;  1VBL A;  1QA3 A;  1NHC A;  1WXR A;  3DU1 X;  2VJI A;  4W8R A;  1QCX A;  2NZM A;  3SUC A;  2BM4 A;  1IDK A;  2G0Y A;  4XM3 A;  3B90 A;  1O8L A;  3SQV A;  2QZA A;  3GQA A;  2VJJ A;  4W8T A;  3RIQ A;  3WWG A;  3ZSC A;  1RWR A;  1K4Z A;  1O8E A;  1IDJ A;  2NSP A;  3NAW A;  3P4G A;  4YZX A;  4YZA A;  1JRG A;  1O8I A;  3JUR A;  4YEI A;  3JX8 A;  2BM6 A;  2BM7 A;  1LM1 A;  4YCQ A;  3VSU A;  2O1D A;  2VBK A;  4XOR A;  3PSS A;  3SZE A;  1EZG A;  5AMV A;  2VBM A;  4EW9 A;  1QRC A;  2XTY A;  1EE6 A;  2VFN A;  4U4B A;  2BM5 A;  4NK8 A;  4AVZ A;  1TYW A;  1PXZ A;  2Z8G A;  4OJO A;  3UW0 A;  2X6W A;  4OJ5 A;  1OGO X;  4U49 A;  4XNF A;  2EWE A;  1PLU A;  2X3H A;  2X6Y A;  2NT6 A;  1BHE A;  2NTB A;  1TYV A;  2PYG A;  3GRH A;  1RU4 A;  5C1C A;  2VBE A;  3SYJ A;  4NK6 A;  4HWV A;  4W8S A;  3GQ7 A;  1PE9 A;  2INV A;  2PYH A;  4MR0 A;  1LLZ A;  4OZY A;  3VSV A;  2IQ7 A;  1O8G A;  2BX6 A;  2YUH A;  3GQ9 A;  3EQN A;  3KRG A;  1H80 A;  3BH7 B;  4XLF A;  3PSZ A;  4YEJ A;  2QYU A;  4XLE A;  3SY2 A;  2XTX A;  2BSP A;  1O8J A;  3LYC A;  1K8F A;  4XR6 A;  4KH3 A;  1QJV A;  4XN0 A;  1HF2 A;  3LJY A;  1OOC A;  3TH0 A;  2VFM A;  3BH6 B;  1TYU A;  1QA1 A;  4OPW A;  1CZF A;  1OGM X;  4XON A;  1O88 A;  2O17 A;  4V02 C;  5C1E A;  1DBO A;  3H09 A;  4YDT A;  4C2L A;  1IB4 A;  1LLW A;  3N90 A;  5JMC B;  1O8M A;  1HG8 A;  2INU A;  2UVF A;  3FY3 A;  2X85 A;  1X0C A;  2VFO A;  4XKV A;  2PEC A;  4Z05 A;  1GQ8 A;  1KCD A;  2QXZ A;  1QQ1 A;  4Z06 A;  1OFD A;  1JTA A;  2NTP A;  1DBG A;  2XTW A;  4PMH A;  1IA5 A;  2O0V A;  2XC1 A;  4XLA A;  1WMR A;  4XMY A;  4XLC A;  4YFO A;  4XQF A;  1O8D A;  5DNS A;  4OZZ A;  4I84 A;  4YC5 A;  1KCC A;  3B4N A;  1QA2 A;  3LMW A;  4Z03 A;  1AIR A;  1O8F A;  4YEL A;  4YZ0 A;  1DAB A;  1KQ5 A;  2F3L A;  2J8K A;  2J8I A;  3T9G A;  3VMV A;  3ML3 A;  4MXN A;  2QY1 A;  4OJP A;  1K5C A;  1TSP A;  2NST A;  3GQ8 A;  4OJ6 A;  4W8Q A;  1O8H A;  1OFE A;  2NT9 A;  2XT4 A;  4OM9 A;  1OFL A;  1L1I A;  1KTW A;  3PET A;  2O04 A;  2QX3 A;  3VMW A;  4URR A;  4JRA C;  4XN3 A;  2O6W A;  3B8Y A; 
#chains in the Genus database with same CATH homology
 3ZPP A;  1OFM A;  4XLH A;  2X6X A;  4YZQ A;  1BN8 A;  2NTQ A;  3VST A;  1XG2 A;  2O0W A;  4XL9 A;  1RMG A;  4OJL A;  3EQO A;  4XOT A;  4XOP A;  2ODL A;  2UVE A;  4XKW A;  1O8K A;  1VBL A;  1NHC A;  2VJI A;  4W8R A;  1QCX A;  2NZM A;  3SUC A;  1IDK A;  4XM3 A;  3B90 A;  1O8L A;  3GQA A;  2VJJ A;  4W8T A;  3WWG A;  3ZSC A;  1RWR A;  1O8E A;  1IDJ A;  2NSP A;  4YZX A;  4YZA A;  1JRG A;  1O8I A;  3JUR A;  3VSU A;  2O1D A;  2VBK A;  4XOR A;  5AMV A;  4EW9 A;  2VBM A;  1EE6 A;  4U4B A;  4NK8 A;  4AVZ A;  2Z8G A;  1PXZ A;  4OJO A;  3UW0 A;  2X6W A;  4OJ5 A;  1OGO X;  4U49 A;  4XNF A;  2EWE A;  1PLU A;  2X3H A;  2X6Y A;  2NT6 A;  1BHE A;  2NTB A;  2PYG A;  3GRH A;  1RU4 A;  5C1C A;  2VBE A;  4NK6 A;  4HWV A;  4W8S A;  3GQ7 A;  1PE9 A;  2INV A;  2PYH A;  4MR0 A;  4OZY A;  3VSV A;  4YZ0 A;  2IQ7 A;  1O8G A;  3KRG A;  3GQ9 A;  3EQN A;  4XLF A;  1H80 A;  4YEJ A;  4XLE A;  2BSP A;  1O8J A;  4XR6 A;  1QJV A;  4XN0 A;  1OOC A;  1CZF A;  1OGM X;  4XON A;  1O88 A;  2O17 A;  5C1E A;  1DBO A;  4C2L A;  1IB4 A;  1O8M A;  1HG8 A;  2INU A;  2UVF A;  3FY3 A;  2X85 A;  1X0C A;  4XKV A;  2PEC A;  4Z05 A;  1GQ8 A;  1KCD A;  2QXZ A;  4Z06 A;  2NTP A;  1JTA A;  1DBG A;  4PMH A;  1IA5 A;  2O0V A;  4XLA A;  4XMY A;  1WMR A;  4XLC A;  4XQF A;  1O8D A;  4OZZ A;  4I84 A;  1KCC A;  3B4N A;  3LMW A;  4Z03 A;  1AIR A;  1O8F A;  4YEL A;  3T9G A;  3VMV A;  4MXN A;  2QY1 A;  4OJP A;  1K5C A;  2NST A;  3GQ8 A;  4W8Q A;  1O8H A;  2NT9 A;  1OFL A;  1KTW A;  2O04 A;  2QX3 A;  3VMW A;  4URR A;  4OJ6 A;  4XN3 A;  3B8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...