4Z06A

C. bescii family 3 pectate lyase double mutant k108a/r133a in complex with alpha-d-galactopyranuronic acid
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVAQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
molecule keywords Pectate lyase
total genus 79
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z06A00
4YZQA 1O8GA 3EQOA 4YZXA 3GQ8A 1RMGA 2X6YA 2NZMA 3VSUA 1K5CA 1DBOA 2QXZA 2X85A 5C1EA 2INVA 4YELA 1O8LA 1OGOX 4XN3A 4AVZA 1PLUA 4I84A 4XOTA 3B90A 4EW9A 4URRA 1OGMX 1KCCA 4XLEA 3VMVA 1HG8A 2ODLA 5AMVA 3VSVA 1OFMA 3EQNA 4C2LA 4W8QA 1GQ8A 3ZPPA 4OJOA 4OJPA 4Z03A 4XNFA 2X3HA 2O0WA 4W8SA 1O8IA 2QX3A 4NK8A 1OFLA 1OOCA 2O04A 2PYGA 1AIRA 4XR6A 4OJLA 2UVEA 3ZSCA 1QJVA 4XORA 4XLFA 3SUCA 1O8JA 2O17A 4MXNA 4HWVA 1EE6A 2UVFA 1BHEA 2VBKA 2PYHA 4OJ5A 1H80A 4YZ0A 4OZYA 1NHCA 1O8DA 1PE9A 1IA5A 3T9GA 1O8MA 1JRGA 3KRGA 4XLAA 3FY3A 1DBGA 1XG2A 3GQ7A 1O8HA 1CZFA 1VBLA 4PMHA 2EWEA 2Z8GA 3B4NA 4NK6A 1IB4A 3JURA 2X6WA 4W8TA 1QCXA 4U49A 4W8RA 2NTPA 3GQAA 2NT9A 2BSPA 1O8EA 1KTWA 1KCDA 1RU4A 4XLCA 4MR0A 3GQ9A 4YEJA 4XMYA 1IDKA 2VJIA 3LMWA 4Z06A 2X6XA 4U4BA 2PECA 2O0VA 2NT6A 3WWGA 4XN0A 2VJJA 2NSPA 1BN8A 4OJ6A 4XKVA 3GRHA 4OZZA 2O1DA 2QY1A 1O88A 3UW0A 4XKWA 3B8YA 1X0CA 2NTQA 4Z05A 1RWRA 3VMWA 5C1CA 2IQ7A 4XOPA 1O8FA 2INUA 1O8KA 1WMRA 4XLHA 2VBEA 1IDJA 1PXZA 2VBMA 4XL9A 4XM3A 4XQFA 4XONA 3VSTA 2NSTA 1JTAA 2NTBA 4YZAA
chains in the Genus database with same CATH superfamily
1TYWA 4YZQA 1O8GA 3EQOA 2G0YA 4YZXA 3GQ8A 5JLVC 3PSSA 3AK5A 1RMGA 2X6YA 2NZMA 4OM9A 3VSUA 4V02C 1K5CA 2XTYA 1DBOA 2QXZA 2X85A 5C1EA 2INVA 4YELA 1O8LA 1OGOX 2O6WA 4YC5A 3TH0A 3LYCA 4XN3A 1QRBA 4AVZA 2XTWA 1PLUA 4I84A 4YDTA 4XOTA 3B90A 4EW9A 4URRA 1OGMX 1KCCA 4XLEA 3VMVA 1HG8A 2J8IA 2ODLA 2XC1A 3BH7B 5AMVA 2QYUA 3VSVA 1OFMA 2BM5A 3EQNA 4C2LA 4W8QA 1GQ8A 3ZPPA 4OJOA 2XT4A 4OJPA 4Z03A 4XNFA 2X3HA 2O0WA 3ML3A 1O8IA 2QX3A 4NK8A 1K8FA 2B0RA 1OFLA 1OOCA 4W8SA 2O04A 2PYGA 2BM7A 1QA3A 3N90A 1L1IA 2VFNA 1AIRA 4XR6A 4OJLA 2UVEA 3ZSCA 2J8KA 1WXRA 1QJVA 4XORA 3JX8A 4XLFA 3SUCA 1O8JA 1TSPA 2O17A 4MXNA 3PSZA 4HWVA 1EE6A 2UVFA 1K4ZA 1BHEA 2VBKA 1QRCA 2PYHA 3PETA 1QA1A 1EZGA 4OJ5A 1H80A 4YZ0A 2QZAA 4OZYA 1NHCA 1O8DA 1PE9A 3RIQA 1IA5A 3T9GA 1O8MA 4JRAC 1JRGA 3KRGA 2V5IA 4XLAA 3FY3A 3NB2A 1LM1A 4YFOA 4OPWA 1DBGA 1XG2A 1HF2A 3GQ7A 1LLWA 1O8HA 1OFDA 1CZFA 2VFMA 1VBLA 4PMHA 2EWEA 1TYUA 2Z8GA 3B4NA 3NAWA 4NK6A 1IB4A 3JURA 2XT2A 3P4GA 2BM6A 2X6WA 1CLWA 4W8TA 1QCXA 2IOUG 2VFPA 4U49A 1TYVA 2NTPA 4W8RA 3GQAA 2NT9A 2BSPA 3SZEA 1O8EA 1KTWA 3H09A 1KCDA 4YCQA 3SQVA 1RU4A 4XLCA 4MR0A 3GQ9A 4YEJA 4XMYA 1IDKA 2VJIA 3LMWA 5DNSA 4Z06A 2X6XA 4U4BA 2XTXA 2PECA 3SYJA 2O0VA 2NT6A 3WWGA 4XN0A 2VJJA 2NSPA 1BN8A 2F3LA 3LJYA 1EA0A 4OJ6A 2YUHA 1QQ1A 1LLZA 1TYXA 2VFOA 4XKVA 3SY2A 3GRHA 1KQ5A 3DU1X 2O1DA 2QY1A 1O88A 4OZZA 4XKWA 3UW0A 3B8YA 1X0CA 4YEIA 2W7ZA 2BM4A 2NTQA 4KH3A 4Z05A 2BX6A 1RWRA 3VMWA 5C1CA 2IQ7A 1QA2A 4XOPA 1OFEA 1O8FA 2INUA 3N6ZA 3BH6B 1O8KA 5JMCB 1DABA 1WMRA 4XLHA 2VBEA 2VFQA 1IDJA 1PXZA 2VBMA 4XL9A 4XM3A 4XQFA 4XONA 3VSTA 2NSTA 1JTAA 2NTBA 4YZAA
chains in the Genus database with same CATH topology
4YZQA 1O8GA 3EQOA 4YZXA 3GQ8A 1RMGA 2X6YA 2NZMA 3VSUA 1K5CA 1DBOA 2QXZA 2X85A 5C1EA 2INVA 4YELA 1O8LA 1OGOX 4XN3A 4AVZA 1PLUA 4I84A 4XOTA 3B90A 4EW9A 4URRA 1OGMX 1KCCA 4XLEA 3VMVA 1HG8A 2ODLA 5AMVA 3VSVA 1OFMA 3EQNA 4C2LA 4W8QA 1GQ8A 3ZPPA 4OJOA 4OJPA 4Z03A 4XNFA 2X3HA 2O0WA 4W8SA 1O8IA 2QX3A 4NK8A 1OFLA 1OOCA 2O04A 2PYGA 1AIRA 4XR6A 4OJLA 2UVEA 3ZSCA 1QJVA 4XORA 4XLFA 3SUCA 1O8JA 2O17A 4MXNA 4HWVA 1EE6A 2UVFA 1BHEA 2VBKA 2PYHA 4OJ5A 1H80A 4YZ0A 4OZYA 1NHCA 1O8DA 1PE9A 1IA5A 3T9GA 1O8MA 1JRGA 3KRGA 4XLAA 3FY3A 1DBGA 1XG2A 3GQ7A 1O8HA 1CZFA 1VBLA 4PMHA 2EWEA 2Z8GA 3B4NA 4NK6A 1IB4A 3JURA 2X6WA 4W8TA 1QCXA 4U49A 4W8RA 2NTPA 3GQAA 2NT9A 2BSPA 1O8EA 1KTWA 1KCDA 1RU4A 4XLCA 4MR0A 3GQ9A 4YEJA 4XMYA 1IDKA 2VJIA 3LMWA 4Z06A 2X6XA 4U4BA 2PECA 2O0VA 2NT6A 3WWGA 4XN0A 2VJJA 2NSPA 1BN8A 4OJ6A 4XKVA 3GRHA 4OZZA 2O1DA 2QY1A 1O88A 3UW0A 4XKWA 3B8YA 1X0CA 2NTQA 4Z05A 1RWRA 3VMWA 5C1CA 2IQ7A 4XOPA 1O8FA 2INUA 1O8KA 1WMRA 4XLHA 2VBEA 1IDJA 1PXZA 2VBMA 4XL9A 4XM3A 4XQFA 4XONA 3VSTA 2NSTA 1JTAA 2NTBA 4YZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZQ A;  1O8G A;  3EQO A;  4YZX A;  3GQ8 A;  1RMG A;  2X6Y A;  2NZM A;  3VSU A;  1K5C A;  1DBO A;  2QXZ A;  2X85 A;  5C1E A;  2INV A;  4YEL A;  1O8L A;  1OGO X;  4XN3 A;  4AVZ A;  1PLU A;  4I84 A;  4XOT A;  3B90 A;  4EW9 A;  4URR A;  1OGM X;  1KCC A;  4XLE A;  3VMV A;  1HG8 A;  2ODL A;  5AMV A;  3VSV A;  1OFM A;  3EQN A;  4C2L A;  4W8Q A;  1GQ8 A;  3ZPP A;  4OJO A;  4OJP A;  4Z03 A;  4XNF A;  2X3H A;  2O0W A;  4W8S A;  1O8I A;  2QX3 A;  4NK8 A;  1OFL A;  1OOC A;  2O04 A;  2PYG A;  1AIR A;  4XR6 A;  4OJL A;  2UVE A;  3ZSC A;  1QJV A;  4XOR A;  4XLF A;  3SUC A;  1O8J A;  2O17 A;  4MXN A;  4HWV A;  1EE6 A;  2UVF A;  1BHE A;  2VBK A;  2PYH A;  4OJ5 A;  1H80 A;  4YZ0 A;  4OZY A;  1NHC A;  1O8D A;  1PE9 A;  1IA5 A;  3T9G A;  1O8M A;  1JRG A;  3KRG A;  4XLA A;  3FY3 A;  1DBG A;  1XG2 A;  3GQ7 A;  1O8H A;  1CZF A;  1VBL A;  4PMH A;  2EWE A;  2Z8G A;  3B4N A;  4NK6 A;  1IB4 A;  3JUR A;  2X6W A;  4W8T A;  1QCX A;  4U49 A;  4W8R A;  2NTP A;  3GQA A;  2NT9 A;  2BSP A;  1O8E A;  1KTW A;  1KCD A;  1RU4 A;  4XLC A;  4MR0 A;  3GQ9 A;  4YEJ A;  4XMY A;  1IDK A;  2VJI A;  3LMW A;  4Z06 A;  2X6X A;  4U4B A;  2PEC A;  2O0V A;  2NT6 A;  3WWG A;  4XN0 A;  2VJJ A;  2NSP A;  1BN8 A;  4OJ6 A;  4XKV A;  3GRH A;  4OZZ A;  2O1D A;  2QY1 A;  1O88 A;  3UW0 A;  4XKW A;  3B8Y A;  1X0C A;  2NTQ A;  4Z05 A;  1RWR A;  3VMW A;  5C1C A;  2IQ7 A;  4XOP A;  1O8F A;  2INU A;  1O8K A;  1WMR A;  4XLH A;  2VBE A;  1IDJ A;  1PXZ A;  2VBM A;  4XL9 A;  4XM3 A;  4XQF A;  4XON A;  3VST A;  2NST A;  1JTA A;  2NTB A;  4YZA A; 
#chains in the Genus database with same CATH topology
 1TYW A;  4YZQ A;  1O8G A;  3EQO A;  2G0Y A;  4YZX A;  3GQ8 A;  5JLV C;  3PSS A;  3AK5 A;  1RMG A;  2X6Y A;  2NZM A;  4OM9 A;  3VSU A;  4V02 C;  1K5C A;  2XTY A;  1DBO A;  2QXZ A;  2X85 A;  5C1E A;  2INV A;  4YEL A;  1O8L A;  1OGO X;  2O6W A;  4YC5 A;  3TH0 A;  3LYC A;  4XN3 A;  1QRB A;  4AVZ A;  2XTW A;  1PLU A;  4I84 A;  4YDT A;  4XOT A;  3B90 A;  4EW9 A;  4URR A;  1OGM X;  1KCC A;  4XLE A;  3VMV A;  1HG8 A;  2J8I A;  2ODL A;  2XC1 A;  3BH7 B;  5AMV A;  2QYU A;  3VSV A;  1OFM A;  2BM5 A;  3EQN A;  4C2L A;  4W8Q A;  1GQ8 A;  3ZPP A;  4OJO A;  2XT4 A;  4OJP A;  4Z03 A;  4XNF A;  2X3H A;  2O0W A;  3ML3 A;  1O8I A;  2QX3 A;  4NK8 A;  1K8F A;  2B0R A;  1OFL A;  1OOC A;  4W8S A;  2O04 A;  2PYG A;  2BM7 A;  1QA3 A;  3N90 A;  1L1I A;  2VFN A;  1AIR A;  4XR6 A;  4OJL A;  2UVE A;  3ZSC A;  2J8K A;  1WXR A;  1QJV A;  4XOR A;  3JX8 A;  4XLF A;  3SUC A;  1O8J A;  1TSP A;  2O17 A;  4MXN A;  3PSZ A;  4HWV A;  1EE6 A;  2UVF A;  1K4Z A;  1BHE A;  2VBK A;  1QRC A;  2PYH A;  3PET A;  1QA1 A;  1EZG A;  4OJ5 A;  1H80 A;  4YZ0 A;  2QZA A;  4OZY A;  1NHC A;  1O8D A;  1PE9 A;  3RIQ A;  1IA5 A;  3T9G A;  1O8M A;  4JRA C;  1JRG A;  3KRG A;  2V5I A;  4XLA A;  3FY3 A;  3NB2 A;  1LM1 A;  4YFO A;  4OPW A;  1DBG A;  1XG2 A;  1HF2 A;  3GQ7 A;  1LLW A;  1O8H A;  1OFD A;  1CZF A;  2VFM A;  1VBL A;  4PMH A;  2EWE A;  1TYU A;  2Z8G A;  3B4N A;  3NAW A;  4NK6 A;  1IB4 A;  3JUR A;  2XT2 A;  3P4G A;  2BM6 A;  2X6W A;  1CLW A;  4W8T A;  1QCX A;  2IOU G;  2VFP A;  4U49 A;  1TYV A;  2NTP A;  4W8R A;  3GQA A;  2NT9 A;  2BSP A;  3SZE A;  1O8E A;  1KTW A;  3H09 A;  1KCD A;  4YCQ A;  3SQV A;  1RU4 A;  4XLC A;  4MR0 A;  3GQ9 A;  4YEJ A;  4XMY A;  1IDK A;  2VJI A;  3LMW A;  5DNS A;  4Z06 A;  2X6X A;  4U4B A;  2XTX A;  2PEC A;  3SYJ A;  2O0V A;  2NT6 A;  3WWG A;  4XN0 A;  2VJJ A;  2NSP A;  1BN8 A;  2F3L A;  3LJY A;  1EA0 A;  4OJ6 A;  2YUH A;  1QQ1 A;  1LLZ A;  1TYX A;  2VFO A;  4XKV A;  3SY2 A;  3GRH A;  1KQ5 A;  3DU1 X;  2O1D A;  2QY1 A;  1O88 A;  4OZZ A;  4XKW A;  3UW0 A;  3B8Y A;  1X0C A;  4YEI A;  2W7Z A;  2BM4 A;  2NTQ A;  4KH3 A;  4Z05 A;  2BX6 A;  1RWR A;  3VMW A;  5C1C A;  2IQ7 A;  1QA2 A;  4XOP A;  1OFE A;  1O8F A;  2INU A;  3N6Z A;  3BH6 B;  1O8K A;  5JMC B;  1DAB A;  1WMR A;  4XLH A;  2VBE A;  2VFQ A;  1IDJ A;  1PXZ A;  2VBM A;  4XL9 A;  4XM3 A;  4XQF A;  4XON A;  3VST A;  2NST A;  1JTA A;  2NTB A;  4YZA A; 
#chains in the Genus database with same CATH homology
 4YZQ A;  1O8G A;  3EQO A;  4YZX A;  3GQ8 A;  1RMG A;  2X6Y A;  2NZM A;  3VSU A;  1K5C A;  1DBO A;  2QXZ A;  2X85 A;  5C1E A;  2INV A;  4YEL A;  1O8L A;  1OGO X;  4XN3 A;  4AVZ A;  1PLU A;  4I84 A;  4XOT A;  3B90 A;  4EW9 A;  4URR A;  1OGM X;  1KCC A;  4XLE A;  3VMV A;  1HG8 A;  2ODL A;  5AMV A;  3VSV A;  1OFM A;  3EQN A;  4C2L A;  4W8Q A;  1GQ8 A;  3ZPP A;  4OJO A;  4OJP A;  4Z03 A;  4XNF A;  2X3H A;  2O0W A;  4W8S A;  1O8I A;  2QX3 A;  4NK8 A;  1OFL A;  1OOC A;  2O04 A;  2PYG A;  1AIR A;  4XR6 A;  4OJL A;  2UVE A;  3ZSC A;  1QJV A;  4XOR A;  4XLF A;  3SUC A;  1O8J A;  2O17 A;  4MXN A;  4HWV A;  1EE6 A;  2UVF A;  1BHE A;  2VBK A;  2PYH A;  4OJ5 A;  1H80 A;  4YZ0 A;  4OZY A;  1NHC A;  1O8D A;  1PE9 A;  1IA5 A;  3T9G A;  1O8M A;  1JRG A;  3KRG A;  4XLA A;  3FY3 A;  1DBG A;  1XG2 A;  3GQ7 A;  1O8H A;  1CZF A;  1VBL A;  4PMH A;  2EWE A;  2Z8G A;  3B4N A;  4NK6 A;  1IB4 A;  3JUR A;  2X6W A;  4W8T A;  1QCX A;  4U49 A;  4W8R A;  2NTP A;  3GQA A;  2NT9 A;  2BSP A;  1O8E A;  1KTW A;  1KCD A;  1RU4 A;  4XLC A;  4MR0 A;  3GQ9 A;  4YEJ A;  4XMY A;  1IDK A;  2VJI A;  3LMW A;  4Z06 A;  2X6X A;  4U4B A;  2PEC A;  2O0V A;  2NT6 A;  3WWG A;  4XN0 A;  2VJJ A;  2NSP A;  1BN8 A;  4OJ6 A;  4XKV A;  3GRH A;  4OZZ A;  2O1D A;  2QY1 A;  1O88 A;  3UW0 A;  4XKW A;  3B8Y A;  1X0C A;  2NTQ A;  4Z05 A;  1RWR A;  3VMW A;  5C1C A;  2IQ7 A;  4XOP A;  1O8F A;  2INU A;  1O8K A;  1WMR A;  4XLH A;  2VBE A;  1IDJ A;  1PXZ A;  2VBM A;  4XL9 A;  4XM3 A;  4XQF A;  4XON A;  3VST A;  2NST A;  1JTA A;  2NTB A;  4YZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...