4Z06A

C. bescii family 3 pectate lyase double mutant k108a/r133a in complex with alpha-d-galactopyranuronic acid
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVAQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
molecule keywords Pectate lyase
total genus 79
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z06A00
5C1CA 4XLFA 1EE6A 1RWRA 1O8IA 2QXZA 1IDKA 2BSPA 1AIRA 4XOTA 4C2LA 4Z05A 1KCCA 1RMGA 4OJLA 1X0CA 4MXNA 3WWGA 2X6YA 3EQOA 1IB4A 4OZZA 4XKVA 4OJOA 4XLEA 2NTPA 3B8YA 1GQ8A 4OJPA 1BN8A 1H80A 1QJVA 1PE9A 4XLAA 3ZSCA 3LMWA 4W8SA 1CZFA 4YEJA 2NSPA 4W8QA 4Z06A 2NSTA 2UVFA 2PYHA 3SUCA 1QCXA 1PXZA 1XG2A 4PMHA 1O8EA 1O8GA 4XL9A 2X6XA 3VMWA 4U4BA 3EQNA 2PYGA 3GRHA 1PLUA 2UVEA 3VSVA 2VBKA 3GQ8A 4XONA 5C1EA 1O88A 1RU4A 2INUA 4XM3A 4XR6A 1WMRA 4W8RA 1DBOA 4YZ0A 4NK6A 4XOPA 4HWVA 3T9GA 1K5CA 3JURA 4MR0A 1O8HA 2Z8GA 2INVA 1IDJA 4XQFA 1OOCA 1O8FA 1O8DA 4YELA 2PECA 1DBGA 4U49A 2O17A 1OFMA 2NTQA 4XLHA 2VJJA 3VSUA 1OGMX 3FY3A 1JRGA 4YZAA 1JTAA 1KTWA 4OJ6A 2VJIA 4I84A 2O0WA 3VSTA 4XN3A 3B4NA 1VBLA 4W8TA 4XLCA 1IA5A 2O0VA 2VBMA 4XORA 4AVZA 1O8LA 3B90A 4OZYA 1NHCA 4XN0A 1O8MA 3UW0A 2ODLA 2NTBA 3KRGA 2O04A 3GQ9A 2NT9A 5AMVA 2EWEA 4Z03A 3ZPPA 4YZQA 4YZXA 2QY1A 3GQ7A 4EW9A 1O8JA 2NZMA 2IQ7A 4XNFA 1O8KA 3GQAA 2X85A 2O1DA 2X6WA 4URRA 1OGOX 4XKWA 2VBEA 4XMYA 1BHEA 2X3HA 1OFLA 1KCDA 3VMVA 4NK8A 1HG8A 2QX3A 4OJ5A 2NT6A
chains in the Genus database with same CATH superfamily
5C1CA 2BM4A 4XLFA 1EA0A 1EE6A 2J8KA 1RWRA 1O8IA 2QXZA 1LLZA 1IDKA 2BSPA 1AIRA 4XOTA 1K4ZA 4Z05A 4C2LA 1DABA 1KCCA 1RMGA 4OJLA 1X0CA 4MXNA 3WWGA 4JRAC 2X6YA 3EQOA 1IB4A 3LJYA 4OZZA 4XKVA 4OJOA 4V02C 4XLEA 2NTPA 3B8YA 1GQ8A 4OJPA 1BN8A 2XTWA 1H80A 1QJVA 2V5IA 2YUHA 3DU1X 1TYUA 1PE9A 3LYCA 4XLAA 3ZSCA 3LMWA 4W8SA 2XTXA 1CZFA 4YEJA 2NSPA 5JLVC 1QA2A 1EZGA 1OFEA 4YFOA 2VFQA 4W8QA 3H09A 4Z06A 4OPWA 2NSTA 2UVFA 2PYHA 2J8IA 2G0YA 1QCXA 1PXZA 1XG2A 4PMHA 3SUCA 1O8EA 1O8GA 1QA3A 4XL9A 2X6XA 3VMWA 1WXRA 2VFNA 4U4BA 3EQNA 1OFDA 1TYVA 2PYGA 3N90A 2F3LA 4YEIA 3GRHA 2BX6A 1PLUA 1L1IA 3N6ZA 4KH3A 2BM5A 3SQVA 2UVEA 3VSVA 2VBKA 2BM7A 3GQ8A 5JMCB 3BH7B 4XONA 5C1EA 1O88A 1RU4A 2INUA 4XM3A 4XR6A 1LM1A 1WMRA 4W8RA 1DBOA 4YZ0A 4NK6A 4XOPA 4HWVA 3T9GA 1K5CA 4OJ5A 5DNSA 2XT4A 1KQ5A 1QRCA 2VFOA 3JURA 4MR0A 1O8HA 1QRBA 1QQ1A 2Z8GA 2INVA 1IDJA 4XQFA 1TYWA 1CLWA 1O8FA 1O8DA 1OOCA 4YCQA 2PECA 4YELA 1DBGA 4U49A 2O17A 4YDTA 1OFMA 3BH6B 2NTQA 4XLHA 2VJJA 2B0RA 1OGMX 3VSUA 3FY3A 1JRGA 3AK5A 3NAWA 1K8FA 4YZAA 2XC1A 1JTAA 1KTWA 2XT2A 4OJ6A 2VFPA 2VJIA 4I84A 3SY2A 2O0WA 3VSTA 4XN3A 3B4NA 2XTYA 3PSSA 4YC5A 2W7ZA 1VBLA 2O6WA 4W8TA 4XLCA 1TYXA 2BM6A 1IA5A 2O0VA 2VBMA 4XORA 4AVZA 3P4GA 4OM9A 1O8LA 2VFMA 3B90A 4OZYA 3SZEA 1NHCA 4XN0A 1O8MA 3UW0A 2ODLA 2NTBA 3KRGA 3SYJA 3PSZA 2O04A 3GQ9A 2NT9A 5AMVA 2EWEA 4Z03A 3ZPPA 3NB2A 4YZQA 4YZXA 2QZAA 3PETA 1TSPA 3RIQA 2QY1A 3GQ7A 3TH0A 4EW9A 1QA1A 1O8JA 2NZMA 2IQ7A 2QYUA 1O8KA 4XNFA 3GQAA 2X85A 1LLWA 2O1DA 2X6WA 4URRA 1OGOX 1HF2A 2VBEA 4XKWA 4XMYA 1BHEA 2X3HA 1OFLA 1KCDA 3ML3A 3JX8A 4NK8A 3VMVA 1HG8A 2QX3A 2IOUG 2NT6A
chains in the Genus database with same CATH topology
5C1CA 4XLFA 1EE6A 1RWRA 1O8IA 2QXZA 1IDKA 2BSPA 1AIRA 4XOTA 4C2LA 4Z05A 1KCCA 1RMGA 4OJLA 1X0CA 4MXNA 3WWGA 2X6YA 3EQOA 1IB4A 4OZZA 4XKVA 4OJOA 4XLEA 2NTPA 3B8YA 1GQ8A 4OJPA 1BN8A 1H80A 1QJVA 1PE9A 4XLAA 3ZSCA 3LMWA 4W8SA 1CZFA 4YEJA 2NSPA 4W8QA 4Z06A 2NSTA 2UVFA 2PYHA 3SUCA 1QCXA 1PXZA 1XG2A 4PMHA 1O8EA 1O8GA 4XL9A 2X6XA 3VMWA 4U4BA 3EQNA 2PYGA 3GRHA 1PLUA 2UVEA 3VSVA 2VBKA 3GQ8A 4XONA 5C1EA 1O88A 1RU4A 2INUA 4XM3A 4XR6A 1WMRA 4W8RA 1DBOA 4YZ0A 4NK6A 4XOPA 4HWVA 3T9GA 1K5CA 3JURA 4MR0A 1O8HA 2Z8GA 2INVA 1IDJA 4XQFA 1OOCA 1O8FA 1O8DA 4YELA 2PECA 1DBGA 4U49A 2O17A 1OFMA 2NTQA 4XLHA 2VJJA 3VSUA 1OGMX 3FY3A 1JRGA 4YZAA 1JTAA 1KTWA 4OJ6A 2VJIA 4I84A 2O0WA 3VSTA 4XN3A 3B4NA 1VBLA 4W8TA 4XLCA 1IA5A 2O0VA 2VBMA 4XORA 4AVZA 1O8LA 3B90A 4OZYA 1NHCA 4XN0A 1O8MA 3UW0A 2ODLA 2NTBA 3KRGA 2O04A 3GQ9A 2NT9A 5AMVA 2EWEA 4Z03A 3ZPPA 4YZQA 4YZXA 2QY1A 3GQ7A 4EW9A 1O8JA 2NZMA 2IQ7A 4XNFA 1O8KA 3GQAA 2X85A 2O1DA 2X6WA 4URRA 1OGOX 4XKWA 2VBEA 4XMYA 1BHEA 2X3HA 1OFLA 1KCDA 3VMVA 4NK8A 1HG8A 2QX3A 4OJ5A 2NT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1C A;  4XLF A;  1EE6 A;  1RWR A;  1O8I A;  2QXZ A;  1IDK A;  2BSP A;  1AIR A;  4XOT A;  4C2L A;  4Z05 A;  1KCC A;  1RMG A;  4OJL A;  1X0C A;  4MXN A;  3WWG A;  2X6Y A;  3EQO A;  1IB4 A;  4OZZ A;  4XKV A;  4OJO A;  4XLE A;  2NTP A;  3B8Y A;  1GQ8 A;  4OJP A;  1BN8 A;  1H80 A;  1QJV A;  1PE9 A;  4XLA A;  3ZSC A;  3LMW A;  4W8S A;  1CZF A;  4YEJ A;  2NSP A;  4W8Q A;  4Z06 A;  2NST A;  2UVF A;  2PYH A;  3SUC A;  1QCX A;  1PXZ A;  1XG2 A;  4PMH A;  1O8E A;  1O8G A;  4XL9 A;  2X6X A;  3VMW A;  4U4B A;  3EQN A;  2PYG A;  3GRH A;  1PLU A;  2UVE A;  3VSV A;  2VBK A;  3GQ8 A;  4XON A;  5C1E A;  1O88 A;  1RU4 A;  2INU A;  4XM3 A;  4XR6 A;  1WMR A;  4W8R A;  1DBO A;  4YZ0 A;  4NK6 A;  4XOP A;  4HWV A;  3T9G A;  1K5C A;  3JUR A;  4MR0 A;  1O8H A;  2Z8G A;  2INV A;  1IDJ A;  4XQF A;  1OOC A;  1O8F A;  1O8D A;  4YEL A;  2PEC A;  1DBG A;  4U49 A;  2O17 A;  1OFM A;  2NTQ A;  4XLH A;  2VJJ A;  3VSU A;  1OGM X;  3FY3 A;  1JRG A;  4YZA A;  1JTA A;  1KTW A;  4OJ6 A;  2VJI A;  4I84 A;  2O0W A;  3VST A;  4XN3 A;  3B4N A;  1VBL A;  4W8T A;  4XLC A;  1IA5 A;  2O0V A;  2VBM A;  4XOR A;  4AVZ A;  1O8L A;  3B90 A;  4OZY A;  1NHC A;  4XN0 A;  1O8M A;  3UW0 A;  2ODL A;  2NTB A;  3KRG A;  2O04 A;  3GQ9 A;  2NT9 A;  5AMV A;  2EWE A;  4Z03 A;  3ZPP A;  4YZQ A;  4YZX A;  2QY1 A;  3GQ7 A;  4EW9 A;  1O8J A;  2NZM A;  2IQ7 A;  4XNF A;  1O8K A;  3GQA A;  2X85 A;  2O1D A;  2X6W A;  4URR A;  1OGO X;  4XKW A;  2VBE A;  4XMY A;  1BHE A;  2X3H A;  1OFL A;  1KCD A;  3VMV A;  4NK8 A;  1HG8 A;  2QX3 A;  4OJ5 A;  2NT6 A; 
#chains in the Genus database with same CATH topology
 5C1C A;  2BM4 A;  4XLF A;  1EA0 A;  1EE6 A;  2J8K A;  1RWR A;  1O8I A;  2QXZ A;  1LLZ A;  1IDK A;  2BSP A;  1AIR A;  4XOT A;  1K4Z A;  4Z05 A;  4C2L A;  1DAB A;  1KCC A;  1RMG A;  4OJL A;  1X0C A;  4MXN A;  3WWG A;  4JRA C;  2X6Y A;  3EQO A;  1IB4 A;  3LJY A;  4OZZ A;  4XKV A;  4OJO A;  4V02 C;  4XLE A;  2NTP A;  3B8Y A;  1GQ8 A;  4OJP A;  1BN8 A;  2XTW A;  1H80 A;  1QJV A;  2V5I A;  2YUH A;  3DU1 X;  1TYU A;  1PE9 A;  3LYC A;  4XLA A;  3ZSC A;  3LMW A;  4W8S A;  2XTX A;  1CZF A;  4YEJ A;  2NSP A;  5JLV C;  1QA2 A;  1EZG A;  1OFE A;  4YFO A;  2VFQ A;  4W8Q A;  3H09 A;  4Z06 A;  4OPW A;  2NST A;  2UVF A;  2PYH A;  2J8I A;  2G0Y A;  1QCX A;  1PXZ A;  1XG2 A;  4PMH A;  3SUC A;  1O8E A;  1O8G A;  1QA3 A;  4XL9 A;  2X6X A;  3VMW A;  1WXR A;  2VFN A;  4U4B A;  3EQN A;  1OFD A;  1TYV A;  2PYG A;  3N90 A;  2F3L A;  4YEI A;  3GRH A;  2BX6 A;  1PLU A;  1L1I A;  3N6Z A;  4KH3 A;  2BM5 A;  3SQV A;  2UVE A;  3VSV A;  2VBK A;  2BM7 A;  3GQ8 A;  5JMC B;  3BH7 B;  4XON A;  5C1E A;  1O88 A;  1RU4 A;  2INU A;  4XM3 A;  4XR6 A;  1LM1 A;  1WMR A;  4W8R A;  1DBO A;  4YZ0 A;  4NK6 A;  4XOP A;  4HWV A;  3T9G A;  1K5C A;  4OJ5 A;  5DNS A;  2XT4 A;  1KQ5 A;  1QRC A;  2VFO A;  3JUR A;  4MR0 A;  1O8H A;  1QRB A;  1QQ1 A;  2Z8G A;  2INV A;  1IDJ A;  4XQF A;  1TYW A;  1CLW A;  1O8F A;  1O8D A;  1OOC A;  4YCQ A;  2PEC A;  4YEL A;  1DBG A;  4U49 A;  2O17 A;  4YDT A;  1OFM A;  3BH6 B;  2NTQ A;  4XLH A;  2VJJ A;  2B0R A;  1OGM X;  3VSU A;  3FY3 A;  1JRG A;  3AK5 A;  3NAW A;  1K8F A;  4YZA A;  2XC1 A;  1JTA A;  1KTW A;  2XT2 A;  4OJ6 A;  2VFP A;  2VJI A;  4I84 A;  3SY2 A;  2O0W A;  3VST A;  4XN3 A;  3B4N A;  2XTY A;  3PSS A;  4YC5 A;  2W7Z A;  1VBL A;  2O6W A;  4W8T A;  4XLC A;  1TYX A;  2BM6 A;  1IA5 A;  2O0V A;  2VBM A;  4XOR A;  4AVZ A;  3P4G A;  4OM9 A;  1O8L A;  2VFM A;  3B90 A;  4OZY A;  3SZE A;  1NHC A;  4XN0 A;  1O8M A;  3UW0 A;  2ODL A;  2NTB A;  3KRG A;  3SYJ A;  3PSZ A;  2O04 A;  3GQ9 A;  2NT9 A;  5AMV A;  2EWE A;  4Z03 A;  3ZPP A;  3NB2 A;  4YZQ A;  4YZX A;  2QZA A;  3PET A;  1TSP A;  3RIQ A;  2QY1 A;  3GQ7 A;  3TH0 A;  4EW9 A;  1QA1 A;  1O8J A;  2NZM A;  2IQ7 A;  2QYU A;  1O8K A;  4XNF A;  3GQA A;  2X85 A;  1LLW A;  2O1D A;  2X6W A;  4URR A;  1OGO X;  1HF2 A;  2VBE A;  4XKW A;  4XMY A;  1BHE A;  2X3H A;  1OFL A;  1KCD A;  3ML3 A;  3JX8 A;  4NK8 A;  3VMV A;  1HG8 A;  2QX3 A;  2IOU G;  2NT6 A; 
#chains in the Genus database with same CATH homology
 5C1C A;  4XLF A;  1EE6 A;  1RWR A;  1O8I A;  2QXZ A;  1IDK A;  2BSP A;  1AIR A;  4XOT A;  4C2L A;  4Z05 A;  1KCC A;  1RMG A;  4OJL A;  1X0C A;  4MXN A;  3WWG A;  2X6Y A;  3EQO A;  1IB4 A;  4OZZ A;  4XKV A;  4OJO A;  4XLE A;  2NTP A;  3B8Y A;  1GQ8 A;  4OJP A;  1BN8 A;  1H80 A;  1QJV A;  1PE9 A;  4XLA A;  3ZSC A;  3LMW A;  4W8S A;  1CZF A;  4YEJ A;  2NSP A;  4W8Q A;  4Z06 A;  2NST A;  2UVF A;  2PYH A;  3SUC A;  1QCX A;  1PXZ A;  1XG2 A;  4PMH A;  1O8E A;  1O8G A;  4XL9 A;  2X6X A;  3VMW A;  4U4B A;  3EQN A;  2PYG A;  3GRH A;  1PLU A;  2UVE A;  3VSV A;  2VBK A;  3GQ8 A;  4XON A;  5C1E A;  1O88 A;  1RU4 A;  2INU A;  4XM3 A;  4XR6 A;  1WMR A;  4W8R A;  1DBO A;  4YZ0 A;  4NK6 A;  4XOP A;  4HWV A;  3T9G A;  1K5C A;  3JUR A;  4MR0 A;  1O8H A;  2Z8G A;  2INV A;  1IDJ A;  4XQF A;  1OOC A;  1O8F A;  1O8D A;  4YEL A;  2PEC A;  1DBG A;  4U49 A;  2O17 A;  1OFM A;  2NTQ A;  4XLH A;  2VJJ A;  3VSU A;  1OGM X;  3FY3 A;  1JRG A;  4YZA A;  1JTA A;  1KTW A;  4OJ6 A;  2VJI A;  4I84 A;  2O0W A;  3VST A;  4XN3 A;  3B4N A;  1VBL A;  4W8T A;  4XLC A;  1IA5 A;  2O0V A;  2VBM A;  4XOR A;  4AVZ A;  1O8L A;  3B90 A;  4OZY A;  1NHC A;  4XN0 A;  1O8M A;  3UW0 A;  2ODL A;  2NTB A;  3KRG A;  2O04 A;  3GQ9 A;  2NT9 A;  5AMV A;  2EWE A;  4Z03 A;  3ZPP A;  4YZQ A;  4YZX A;  2QY1 A;  3GQ7 A;  4EW9 A;  1O8J A;  2NZM A;  2IQ7 A;  4XNF A;  1O8K A;  3GQA A;  2X85 A;  2O1D A;  2X6W A;  4URR A;  1OGO X;  4XKW A;  2VBE A;  4XMY A;  1BHE A;  2X3H A;  1OFL A;  1KCD A;  3VMV A;  4NK8 A;  1HG8 A;  2QX3 A;  4OJ5 A;  2NT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...