4Z06A

C. bescii family 3 pectate lyase double mutant k108a/r133a in complex with alpha-d-galactopyranuronic acid
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFQLNAPCTFKVKNFTATNIGKLVAQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
total genus 79
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z06A00
1CZFA 4W8RA 1O8MA 1QCXA 2Z8GA 4EW9A 1O88A 2INUA 3GQ7A 2QY1A 4XQFA 1VBLA 2O17A 1GQ8A 2NT9A 2UVEA 1OOCA 3VSTA 2BSPA 2X6YA 3ZSCA 3GQAA 1KTWA 1O8DA 4OJPA 2ODLA 5C1EA 2INVA 4AVZA 2NT6A 4XLEA 2VBMA 2PYGA 3VSUA 2VBKA 1IDKA 1RU4A 3GQ8A 3VMWA 1PLUA 2O0WA 1HG8A 4OJLA 4XLHA 1O8JA 2QX3A 4MXNA 4XOPA 2VJIA 1XG2A 2NTPA 1EE6A 4OJOA 3KRGA 4YZAA 1O8FA 4XR6A 4XOTA 1RWRA 4PMHA 4W8TA 2X85A 4XLAA 4YZQA 4C2LA 1PXZA 4XN3A 4OZYA 1IDJA 4XMYA 4Z05A 2O04A 4W8QA 1K5CA 3LMWA 2PECA 3JURA 4Z06A 3B90A 2X6XA 4OJ6A 1KCCA 4XN0A 3SUCA 3WWGA 3T9GA 1NHCA 4URRA 5C1CA 4XNFA 3VMVA 1IA5A 4W8SA 1RMGA 1OFLA 2IQ7A 2UVFA 2NSTA 4HWVA 4XKWA 1O8LA 5AMVA 2O1DA 2VJJA 1DBGA 1BN8A 2NTQA 3EQNA 3EQOA 1IB4A 4NK6A 2X6WA 4YELA 4NK8A 3ZPPA 4XLFA 3UW0A 4YZ0A 4YZXA 1O8KA 4YEJA 3B8YA 2EWEA 1KCDA 4U49A 4XORA 3FY3A 1OFMA 1O8HA 1O8IA 1O8GA 1H80A 1PE9A 4OZZA 1JRGA 4Z03A 1BHEA 3GRHA 1X0CA 3GQ9A 1AIRA 4XLCA 2VBEA 4XONA 3VSVA 2NTBA 2O0VA 2QXZA 2X3HA 1QJVA 4U4BA 1WMRA 1O8EA 2NSPA 4XL9A 1OGOX 1OGMX 3B4NA 4OJ5A 2PYHA 4XKVA 4XM3A 4I84A 4MR0A 2NZMA 1JTAA 1DBOA
chains in the Genus database with same CATH superfamily
1CZFA 4W8RA 1O8MA 1QCXA 2Z8GA 4EW9A 2XC1A 2QYUA 1O88A 2INUA 2G0YA 3GQ7A 2QY1A 2XT4A 1EA0A 4XQFA 1VBLA 1EZGA 2O17A 3ML3A 4W8SA 1L1IA 1GQ8A 2NT9A 2UVEA 2XTYA 1OOCA 3VSTA 2BSPA 3BH7B 1OFEA 2X6YA 3ZSCA 3GQAA 4V02C 3SY2A 1O8DA 4OJPA 2ODLA 2BM4A 5C1EA 4JRAC 3H09A 2INVA 2XTXA 4YCQA 4AVZA 1K4ZA 2XT2A 2NT6A 3NAWA 3NB2A 2BM6A 2J8KA 4XLEA 4YDTA 2VBMA 2PYGA 3VSUA 2VBKA 4YC5A 1IDKA 1RU4A 3GQ8A 3VMWA 1HF2A 1CLWA 1QRBA 1PLUA 2O0WA 1HG8A 4OJLA 4XLHA 3TH0A 5JMCB 1O8JA 2VFOA 2QX3A 4MXNA 4XOPA 2VJIA 1XG2A 2NTPA 1EE6A 1LM1A 2VFQA 3KRGA 4OJOA 4YZAA 2VFPA 1O8FA 1QQ1A 4XR6A 3PSZA 1RWRA 1TSPA 4PMHA 2X85A 4W8TA 4XLAA 4XOTA 4YZQA 4C2LA 1PXZA 2V5IA 4XN3A 4OZYA 1IDJA 4XMYA 4Z05A 2O04A 2VFMA 2NZMA 4W8QA 1K5CA 3LMWA 2PECA 3JURA 4Z06A 1QA3A 3B90A 2X6XA 4OJ6A 1KCCA 4XN0A 4OPWA 1TYVA 2VFNA 3SUCA 3WWGA 3T9GA 1NHCA 4URRA 5C1CA 4XNFA 3VMVA 2BX6A 3P4GA 4KH3A 1IA5A 3N6ZA 1RMGA 1OFLA 2IQ7A 2UVFA 1OFDA 2B0RA 2NSTA 1O8LA 4HWVA 2O1DA 2VJJA 3LYCA 5AMVA 1QA2A 1DBGA 1BN8A 3SZEA 3PSSA 2NTQA 3EQNA 2YUHA 2F3LA 3LJYA 3N90A 3EQOA 3RIQA 1IB4A 4NK6A 1LLWA 2X6WA 4YELA 4NK8A 3ZPPA 3SYJA 2BM7A 4XLFA 3UW0A 4YZ0A 4YZXA 1O8KA 4YEJA 3B8YA 2O6WA 2EWEA 1TYWA 1KCDA 4U49A 4XORA 4YEIA 3FY3A 2W7ZA 1OFMA 1O8HA 1QRCA 1O8IA 1TYXA 2QZAA 1WXRA 1O8GA 5DNSA 1DABA 1H80A 1PE9A 4OZZA 3SQVA 2IOUG 1JRGA 4Z03A 1BHEA 3GRHA 1X0CA 3GQ9A 1AIRA 2XTWA 4XLCA 2VBEA 1LLZA 4XONA 3VSVA 2NTBA 2O0VA 2QXZA 2X3HA 1QJVA 3AK5A 2BM5A 4U4BA 1WMRA 1O8EA 4OM9A 2NSPA 1TYUA 4XL9A 5JLVC 1OGOX 1OGMX 3JX8A 3DU1X 4YFOA 1QA1A 3PETA 1KQ5A 3B4NA 3BH6B 4OJ5A 2J8IA 2PYHA 4XKVA 4XM3A 4I84A 4MR0A 4XKWA 1K8FA 1KTWA 1JTAA 1DBOA
chains in the Genus database with same CATH topology
1CZFA 4W8RA 1O8MA 1QCXA 2Z8GA 4EW9A 1O88A 2INUA 3GQ7A 2QY1A 4XQFA 1VBLA 2O17A 1GQ8A 2NT9A 2UVEA 1OOCA 3VSTA 2BSPA 2X6YA 3ZSCA 3GQAA 1KTWA 1O8DA 4OJPA 2ODLA 5C1EA 2INVA 4AVZA 2NT6A 4XLEA 2VBMA 2PYGA 3VSUA 2VBKA 1IDKA 1RU4A 3GQ8A 3VMWA 1PLUA 2O0WA 1HG8A 4OJLA 4XLHA 1O8JA 2QX3A 4MXNA 4XOPA 2VJIA 1XG2A 2NTPA 1EE6A 4OJOA 3KRGA 4YZAA 1O8FA 4XR6A 4XOTA 1RWRA 4PMHA 4W8TA 2X85A 4XLAA 4YZQA 4C2LA 1PXZA 4XN3A 4OZYA 1IDJA 4XMYA 4Z05A 2O04A 4W8QA 1K5CA 3LMWA 2PECA 3JURA 4Z06A 3B90A 2X6XA 4OJ6A 1KCCA 4XN0A 3SUCA 3WWGA 3T9GA 1NHCA 4URRA 5C1CA 4XNFA 3VMVA 1IA5A 4W8SA 1RMGA 1OFLA 2IQ7A 2UVFA 2NSTA 4HWVA 4XKWA 1O8LA 5AMVA 2O1DA 2VJJA 1DBGA 1BN8A 2NTQA 3EQNA 3EQOA 1IB4A 4NK6A 2X6WA 4YELA 4NK8A 3ZPPA 4XLFA 3UW0A 4YZ0A 4YZXA 1O8KA 4YEJA 3B8YA 2EWEA 1KCDA 4U49A 4XORA 3FY3A 1OFMA 1O8HA 1O8IA 1O8GA 1H80A 1PE9A 4OZZA 1JRGA 4Z03A 1BHEA 3GRHA 1X0CA 3GQ9A 1AIRA 4XLCA 2VBEA 4XONA 3VSVA 2NTBA 2O0VA 2QXZA 2X3HA 1QJVA 4U4BA 1WMRA 1O8EA 2NSPA 4XL9A 1OGOX 1OGMX 3B4NA 4OJ5A 2PYHA 4XKVA 4XM3A 4I84A 4MR0A 2NZMA 1JTAA 1DBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZF A;  4W8R A;  1O8M A;  1QCX A;  2Z8G A;  4EW9 A;  1O88 A;  2INU A;  3GQ7 A;  2QY1 A;  4XQF A;  1VBL A;  2O17 A;  1GQ8 A;  2NT9 A;  2UVE A;  1OOC A;  3VST A;  2BSP A;  2X6Y A;  3ZSC A;  3GQA A;  1KTW A;  1O8D A;  4OJP A;  2ODL A;  5C1E A;  2INV A;  4AVZ A;  2NT6 A;  4XLE A;  2VBM A;  2PYG A;  3VSU A;  2VBK A;  1IDK A;  1RU4 A;  3GQ8 A;  3VMW A;  1PLU A;  2O0W A;  1HG8 A;  4OJL A;  4XLH A;  1O8J A;  2QX3 A;  4MXN A;  4XOP A;  2VJI A;  1XG2 A;  2NTP A;  1EE6 A;  4OJO A;  3KRG A;  4YZA A;  1O8F A;  4XR6 A;  4XOT A;  1RWR A;  4PMH A;  4W8T A;  2X85 A;  4XLA A;  4YZQ A;  4C2L A;  1PXZ A;  4XN3 A;  4OZY A;  1IDJ A;  4XMY A;  4Z05 A;  2O04 A;  4W8Q A;  1K5C A;  3LMW A;  2PEC A;  3JUR A;  4Z06 A;  3B90 A;  2X6X A;  4OJ6 A;  1KCC A;  4XN0 A;  3SUC A;  3WWG A;  3T9G A;  1NHC A;  4URR A;  5C1C A;  4XNF A;  3VMV A;  1IA5 A;  4W8S A;  1RMG A;  1OFL A;  2IQ7 A;  2UVF A;  2NST A;  4HWV A;  4XKW A;  1O8L A;  5AMV A;  2O1D A;  2VJJ A;  1DBG A;  1BN8 A;  2NTQ A;  3EQN A;  3EQO A;  1IB4 A;  4NK6 A;  2X6W A;  4YEL A;  4NK8 A;  3ZPP A;  4XLF A;  3UW0 A;  4YZ0 A;  4YZX A;  1O8K A;  4YEJ A;  3B8Y A;  2EWE A;  1KCD A;  4U49 A;  4XOR A;  3FY3 A;  1OFM A;  1O8H A;  1O8I A;  1O8G A;  1H80 A;  1PE9 A;  4OZZ A;  1JRG A;  4Z03 A;  1BHE A;  3GRH A;  1X0C A;  3GQ9 A;  1AIR A;  4XLC A;  2VBE A;  4XON A;  3VSV A;  2NTB A;  2O0V A;  2QXZ A;  2X3H A;  1QJV A;  4U4B A;  1WMR A;  1O8E A;  2NSP A;  4XL9 A;  1OGO X;  1OGM X;  3B4N A;  4OJ5 A;  2PYH A;  4XKV A;  4XM3 A;  4I84 A;  4MR0 A;  2NZM A;  1JTA A;  1DBO A; 
#chains in the Genus database with same CATH topology
 1CZF A;  4W8R A;  1O8M A;  1QCX A;  2Z8G A;  4EW9 A;  2XC1 A;  2QYU A;  1O88 A;  2INU A;  2G0Y A;  3GQ7 A;  2QY1 A;  2XT4 A;  1EA0 A;  4XQF A;  1VBL A;  1EZG A;  2O17 A;  3ML3 A;  4W8S A;  1L1I A;  1GQ8 A;  2NT9 A;  2UVE A;  2XTY A;  1OOC A;  3VST A;  2BSP A;  3BH7 B;  1OFE A;  2X6Y A;  3ZSC A;  3GQA A;  4V02 C;  3SY2 A;  1O8D A;  4OJP A;  2ODL A;  2BM4 A;  5C1E A;  4JRA C;  3H09 A;  2INV A;  2XTX A;  4YCQ A;  4AVZ A;  1K4Z A;  2XT2 A;  2NT6 A;  3NAW A;  3NB2 A;  2BM6 A;  2J8K A;  4XLE A;  4YDT A;  2VBM A;  2PYG A;  3VSU A;  2VBK A;  4YC5 A;  1IDK A;  1RU4 A;  3GQ8 A;  3VMW A;  1HF2 A;  1CLW A;  1QRB A;  1PLU A;  2O0W A;  1HG8 A;  4OJL A;  4XLH A;  3TH0 A;  5JMC B;  1O8J A;  2VFO A;  2QX3 A;  4MXN A;  4XOP A;  2VJI A;  1XG2 A;  2NTP A;  1EE6 A;  1LM1 A;  2VFQ A;  3KRG A;  4OJO A;  4YZA A;  2VFP A;  1O8F A;  1QQ1 A;  4XR6 A;  3PSZ A;  1RWR A;  1TSP A;  4PMH A;  2X85 A;  4W8T A;  4XLA A;  4XOT A;  4YZQ A;  4C2L A;  1PXZ A;  2V5I A;  4XN3 A;  4OZY A;  1IDJ A;  4XMY A;  4Z05 A;  2O04 A;  2VFM A;  2NZM A;  4W8Q A;  1K5C A;  3LMW A;  2PEC A;  3JUR A;  4Z06 A;  1QA3 A;  3B90 A;  2X6X A;  4OJ6 A;  1KCC A;  4XN0 A;  4OPW A;  1TYV A;  2VFN A;  3SUC A;  3WWG A;  3T9G A;  1NHC A;  4URR A;  5C1C A;  4XNF A;  3VMV A;  2BX6 A;  3P4G A;  4KH3 A;  1IA5 A;  3N6Z A;  1RMG A;  1OFL A;  2IQ7 A;  2UVF A;  1OFD A;  2B0R A;  2NST A;  1O8L A;  4HWV A;  2O1D A;  2VJJ A;  3LYC A;  5AMV A;  1QA2 A;  1DBG A;  1BN8 A;  3SZE A;  3PSS A;  2NTQ A;  3EQN A;  2YUH A;  2F3L A;  3LJY A;  3N90 A;  3EQO A;  3RIQ A;  1IB4 A;  4NK6 A;  1LLW A;  2X6W A;  4YEL A;  4NK8 A;  3ZPP A;  3SYJ A;  2BM7 A;  4XLF A;  3UW0 A;  4YZ0 A;  4YZX A;  1O8K A;  4YEJ A;  3B8Y A;  2O6W A;  2EWE A;  1TYW A;  1KCD A;  4U49 A;  4XOR A;  4YEI A;  3FY3 A;  2W7Z A;  1OFM A;  1O8H A;  1QRC A;  1O8I A;  1TYX A;  2QZA A;  1WXR A;  1O8G A;  5DNS A;  1DAB A;  1H80 A;  1PE9 A;  4OZZ A;  3SQV A;  2IOU G;  1JRG A;  4Z03 A;  1BHE A;  3GRH A;  1X0C A;  3GQ9 A;  1AIR A;  2XTW A;  4XLC A;  2VBE A;  1LLZ A;  4XON A;  3VSV A;  2NTB A;  2O0V A;  2QXZ A;  2X3H A;  1QJV A;  3AK5 A;  2BM5 A;  4U4B A;  1WMR A;  1O8E A;  4OM9 A;  2NSP A;  1TYU A;  4XL9 A;  5JLV C;  1OGO X;  1OGM X;  3JX8 A;  3DU1 X;  4YFO A;  1QA1 A;  3PET A;  1KQ5 A;  3B4N A;  3BH6 B;  4OJ5 A;  2J8I A;  2PYH A;  4XKV A;  4XM3 A;  4I84 A;  4MR0 A;  4XKW A;  1K8F A;  1KTW A;  1JTA A;  1DBO A; 
#chains in the Genus database with same CATH homology
 1CZF A;  4W8R A;  1O8M A;  1QCX A;  2Z8G A;  4EW9 A;  1O88 A;  2INU A;  3GQ7 A;  2QY1 A;  4XQF A;  1VBL A;  2O17 A;  1GQ8 A;  2NT9 A;  2UVE A;  1OOC A;  3VST A;  2BSP A;  2X6Y A;  3ZSC A;  3GQA A;  1KTW A;  1O8D A;  4OJP A;  2ODL A;  5C1E A;  2INV A;  4AVZ A;  2NT6 A;  4XLE A;  2VBM A;  2PYG A;  3VSU A;  2VBK A;  1IDK A;  1RU4 A;  3GQ8 A;  3VMW A;  1PLU A;  2O0W A;  1HG8 A;  4OJL A;  4XLH A;  1O8J A;  2QX3 A;  4MXN A;  4XOP A;  2VJI A;  1XG2 A;  2NTP A;  1EE6 A;  4OJO A;  3KRG A;  4YZA A;  1O8F A;  4XR6 A;  4XOT A;  1RWR A;  4PMH A;  4W8T A;  2X85 A;  4XLA A;  4YZQ A;  4C2L A;  1PXZ A;  4XN3 A;  4OZY A;  1IDJ A;  4XMY A;  4Z05 A;  2O04 A;  4W8Q A;  1K5C A;  3LMW A;  2PEC A;  3JUR A;  4Z06 A;  3B90 A;  2X6X A;  4OJ6 A;  1KCC A;  4XN0 A;  3SUC A;  3WWG A;  3T9G A;  1NHC A;  4URR A;  5C1C A;  4XNF A;  3VMV A;  1IA5 A;  4W8S A;  1RMG A;  1OFL A;  2IQ7 A;  2UVF A;  2NST A;  4HWV A;  4XKW A;  1O8L A;  5AMV A;  2O1D A;  2VJJ A;  1DBG A;  1BN8 A;  2NTQ A;  3EQN A;  3EQO A;  1IB4 A;  4NK6 A;  2X6W A;  4YEL A;  4NK8 A;  3ZPP A;  4XLF A;  3UW0 A;  4YZ0 A;  4YZX A;  1O8K A;  4YEJ A;  3B8Y A;  2EWE A;  1KCD A;  4U49 A;  4XOR A;  3FY3 A;  1OFM A;  1O8H A;  1O8I A;  1O8G A;  1H80 A;  1PE9 A;  4OZZ A;  1JRG A;  4Z03 A;  1BHE A;  3GRH A;  1X0C A;  3GQ9 A;  1AIR A;  4XLC A;  2VBE A;  4XON A;  3VSV A;  2NTB A;  2O0V A;  2QXZ A;  2X3H A;  1QJV A;  4U4B A;  1WMR A;  1O8E A;  2NSP A;  4XL9 A;  1OGO X;  1OGM X;  3B4N A;  4OJ5 A;  2PYH A;  4XKV A;  4XM3 A;  4I84 A;  4MR0 A;  2NZM A;  1JTA A;  1DBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...