1RWRA

Crystal structure of filamentous hemagglutinin secretion domain
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
297
Chain Sequence
QGLVPQGQTQVLQGGNKVPVVNIADPNSGGVSHNKFQQFNVANPGVVFNNGLTDGVSRIGGALTKNPNLTRQASAILAEVTDTSPSRLAGTLEVYGKGADLIIANPNGISVNGLSTLNASNLTLTTGRPSVNGGRIGLDVQQGTVTIERGGVNATGLGYFDVVARLVKLQGAVSSKQGKPLADIAVVAGANRYDHATRRATPIAAGARGAAAGAYAIDGTAAGAMYGKHITLVSSDSGLGVRQLGSLSSPSAITVSSQGEIALGDATVQRGPLSLKGAGVVSAGKLASGGGAVNVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of filamentous hemagglutinin secretion domain and its implications for the two-partner secretion pathway
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Cell adhesion
molecule keywords Filamentous hemagglutinin
total genus 110
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2003-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1rwrA00
2NSTA 1PLUA 4Z06A 4OZZA 4OJOA 3SUCA 4XOTA 2X6WA 3B4NA 4U49A 1OFMA 4NK6A 1O8LA 1WMRA 1RMGA 3UW0A 3ZSCA 1DBGA 4OJPA 2BSPA 2NT9A 3GRHA 1O8JA 1XG2A 3JURA 2QXZA 1BHEA 1NHCA 2IQ7A 4XLFA 1OGMX 2QY1A 4OJ5A 5C1CA 2PECA 2VJJA 4YZAA 4HWVA 1K5CA 3WWGA 4W8QA 1JRGA 1O8FA 4XNFA 4NK8A 1IB4A 2NZMA 3T9GA 4YZXA 3VMVA 2EWEA 4Z05A 4EW9A 4XKWA 2NTQA 4XMYA 4U4BA 1X0CA 1VBLA 4URRA 1O8KA 2PYGA 2PYHA 1IA5A 4YZ0A 4PMHA 3GQ7A 4OJLA 4XQFA 3VSUA 4W8SA 1HG8A 2X6YA 4XLAA 4MR0A 1JTAA 4XLCA 5AMVA 3VMWA 4MXNA 3GQAA 4XR6A 1O8HA 2VBEA 3B8YA 4XM3A 2O0VA 2X6XA 2NT6A 2UVFA 2VJIA 4XLHA 3VSVA 3FY3A 2X85A 4XL9A 4XOPA 1GQ8A 2O1DA 1EE6A 1O8MA 1RWRA 1KTWA 4XN0A 4AVZA 4YELA 4XLEA 1RU4A 3KRGA 1H80A 1IDKA 2O17A 1PXZA 3B90A 4W8TA 1CZFA 4XN3A 1OOCA 4XORA 3EQNA 3LMWA 3GQ8A 1BN8A 2O04A 3EQOA 1QJVA 4YZQA 1DBOA 4YEJA 1AIRA 1OFLA 1KCCA 2Z8GA 2NTBA 2INVA 1O8IA 2QX3A 2X3HA 2NTPA 2INUA 1PE9A 1OGOX 1IDJA 2UVEA 1O8EA 2O0WA 4Z03A 2NSPA 1KCDA 1O8GA 4OZYA 4C2LA 1O8DA 4I84A 4W8RA 3VSTA 4OJ6A 2VBMA 3GQ9A 5C1EA 2VBKA 3ZPPA 2ODLA 4XONA 4XKVA 1QCXA 1O88A
chains in the Genus database with same CATH superfamily
2NSTA 1PLUA 4Z06A 4OZZA 4YFOA 4OJOA 3SUCA 4XOTA 2X6WA 3B4NA 4U49A 1OFMA 1K4ZA 2QYUA 4YDTA 4NK6A 1O8LA 1WMRA 1RMGA 3UW0A 5DNSA 3ZSCA 1DBGA 4OJPA 2BSPA 2NT9A 1OFEA 3GRHA 1O8JA 2XT2A 3SQVA 1XG2A 2VFPA 2QXZA 1BHEA 3JURA 2YUHA 4V02C 1NHCA 2IQ7A 4XLFA 1HF2A 1OGMX 1QRBA 2QY1A 4OPWA 4OJ5A 3NB2A 5C1CA 2PECA 3PSZA 3BH7B 3AK5A 2VJJA 2VFQA 4YZAA 1EZGA 1LLWA 4HWVA 1K5CA 3WWGA 4W8QA 1QA3A 1JRGA 1O8FA 2VFMA 4XNFA 4NK8A 1IB4A 2BM7A 3SZEA 2NZMA 3T9GA 4YZXA 1CLWA 1WXRA 3VMVA 2EWEA 2O6WA 2J8IA 2VFNA 3BH6B 4JRAC 4OM9A 1QRCA 3P4GA 4Z05A 4EW9A 1TYVA 3NAWA 4XKWA 2NTQA 3SY2A 4XMYA 4U4BA 3PSSA 1L1IA 1X0CA 1VBLA 3H09A 4URRA 1O8KA 2PYGA 2PYHA 3PETA 4KH3A 1IA5A 4YZ0A 4PMHA 3GQ7A 4OJLA 4XQFA 3VSUA 4W8SA 1HG8A 2X6YA 4XLAA 2BM4A 1JTAA 4MR0A 4XLCA 5AMVA 3VMWA 4MXNA 3GQAA 4XR6A 1O8HA 1LLZA 2VBEA 2VFOA 2XTYA 3B8YA 3JX8A 2O0VA 2X6XA 2NT6A 4XM3A 2UVFA 2VJIA 4XLHA 3VSVA 1QA2A 3FY3A 2X85A 4XL9A 4XOPA 1TYWA 1TYXA 2B0RA 3N6ZA 1GQ8A 1OFDA 2BM6A 2O1DA 1EE6A 1O8MA 1RWRA 1KTWA 1TYUA 4XN0A 4AVZA 4YEIA 4YELA 4XLEA 3RIQA 1RU4A 1TSPA 3KRGA 4YCQA 1H80A 2BM5A 1IDKA 2O17A 1PXZA 3B90A 3TH0A 4W8TA 3SYJA 1CZFA 3ML3A 4XN3A 1OOCA 2XC1A 4XORA 3EQNA 1QQ1A 3LMWA 3DU1X 3GQ8A 4XKVA 1BN8A 2O04A 3EQOA 1QJVA 2J8KA 4YZQA 5JLVC 1DBOA 1EA0A 4YEJA 1AIRA 1OFLA 1KCCA 2Z8GA 2NTBA 5JMCB 4YC5A 2INVA 1O8IA 2F3LA 2QX3A 2IOUG 3N90A 2X3HA 2NTPA 1QA1A 2INUA 1PE9A 1OGOX 1IDJA 2V5IA 2UVEA 3LYCA 1O8EA 2O0WA 4Z03A 2NSPA 1KCDA 1O8GA 2QZAA 2XTWA 4OZYA 4C2LA 1K8FA 2XT4A 2XTXA 1O8DA 4I84A 4W8RA 2BX6A 3VSTA 4OJ6A 2VBMA 3GQ9A 5C1EA 2VBKA 3ZPPA 1KQ5A 1DABA 2ODLA 4XONA 2W7ZA 3LJYA 1QCXA 2G0YA 1O88A 1LM1A
chains in the Genus database with same CATH topology
2NSTA 1PLUA 4Z06A 4OZZA 4OJOA 3SUCA 4XOTA 2X6WA 3B4NA 4U49A 1OFMA 4NK6A 1O8LA 1WMRA 1RMGA 3UW0A 3ZSCA 1DBGA 4OJPA 2BSPA 2NT9A 3GRHA 1O8JA 1XG2A 3JURA 2QXZA 1BHEA 1NHCA 2IQ7A 4XLFA 1OGMX 2QY1A 4OJ5A 5C1CA 2PECA 2VJJA 4YZAA 4HWVA 1K5CA 3WWGA 4W8QA 1JRGA 1O8FA 4XNFA 4NK8A 1IB4A 2NZMA 3T9GA 4YZXA 3VMVA 2EWEA 4Z05A 4EW9A 4XKWA 2NTQA 4XMYA 4U4BA 1X0CA 1VBLA 4URRA 1O8KA 2PYGA 2PYHA 1IA5A 4YZ0A 4PMHA 3GQ7A 4OJLA 4XQFA 3VSUA 4W8SA 1HG8A 2X6YA 4XLAA 4MR0A 1JTAA 4XLCA 5AMVA 3VMWA 4MXNA 3GQAA 4XR6A 1O8HA 2VBEA 3B8YA 4XM3A 2O0VA 2X6XA 2NT6A 2UVFA 2VJIA 4XLHA 3VSVA 3FY3A 2X85A 4XL9A 4XOPA 1GQ8A 2O1DA 1EE6A 1O8MA 1RWRA 1KTWA 4XN0A 4AVZA 4YELA 4XLEA 1RU4A 3KRGA 1H80A 1IDKA 2O17A 1PXZA 3B90A 4W8TA 1CZFA 4XN3A 1OOCA 4XORA 3EQNA 3LMWA 3GQ8A 1BN8A 2O04A 3EQOA 1QJVA 4YZQA 1DBOA 4YEJA 1AIRA 1OFLA 1KCCA 2Z8GA 2NTBA 2INVA 1O8IA 2QX3A 2X3HA 2NTPA 2INUA 1PE9A 1OGOX 1IDJA 2UVEA 1O8EA 2O0WA 4Z03A 2NSPA 1KCDA 1O8GA 4OZYA 4C2LA 1O8DA 4I84A 4W8RA 3VSTA 4OJ6A 2VBMA 3GQ9A 5C1EA 2VBKA 3ZPPA 2ODLA 4XONA 4XKVA 1QCXA 1O88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NST A;  1PLU A;  4Z06 A;  4OZZ A;  4OJO A;  3SUC A;  4XOT A;  2X6W A;  3B4N A;  4U49 A;  1OFM A;  4NK6 A;  1O8L A;  1WMR A;  1RMG A;  3UW0 A;  3ZSC A;  1DBG A;  4OJP A;  2BSP A;  2NT9 A;  3GRH A;  1O8J A;  1XG2 A;  3JUR A;  2QXZ A;  1BHE A;  1NHC A;  2IQ7 A;  4XLF A;  1OGM X;  2QY1 A;  4OJ5 A;  5C1C A;  2PEC A;  2VJJ A;  4YZA A;  4HWV A;  1K5C A;  3WWG A;  4W8Q A;  1JRG A;  1O8F A;  4XNF A;  4NK8 A;  1IB4 A;  2NZM A;  3T9G A;  4YZX A;  3VMV A;  2EWE A;  4Z05 A;  4EW9 A;  4XKW A;  2NTQ A;  4XMY A;  4U4B A;  1X0C A;  1VBL A;  4URR A;  1O8K A;  2PYG A;  2PYH A;  1IA5 A;  4YZ0 A;  4PMH A;  3GQ7 A;  4OJL A;  4XQF A;  3VSU A;  4W8S A;  1HG8 A;  2X6Y A;  4XLA A;  4MR0 A;  1JTA A;  4XLC A;  5AMV A;  3VMW A;  4MXN A;  3GQA A;  4XR6 A;  1O8H A;  2VBE A;  3B8Y A;  4XM3 A;  2O0V A;  2X6X A;  2NT6 A;  2UVF A;  2VJI A;  4XLH A;  3VSV A;  3FY3 A;  2X85 A;  4XL9 A;  4XOP A;  1GQ8 A;  2O1D A;  1EE6 A;  1O8M A;  1RWR A;  1KTW A;  4XN0 A;  4AVZ A;  4YEL A;  4XLE A;  1RU4 A;  3KRG A;  1H80 A;  1IDK A;  2O17 A;  1PXZ A;  3B90 A;  4W8T A;  1CZF A;  4XN3 A;  1OOC A;  4XOR A;  3EQN A;  3LMW A;  3GQ8 A;  1BN8 A;  2O04 A;  3EQO A;  1QJV A;  4YZQ A;  1DBO A;  4YEJ A;  1AIR A;  1OFL A;  1KCC A;  2Z8G A;  2NTB A;  2INV A;  1O8I A;  2QX3 A;  2X3H A;  2NTP A;  2INU A;  1PE9 A;  1OGO X;  1IDJ A;  2UVE A;  1O8E A;  2O0W A;  4Z03 A;  2NSP A;  1KCD A;  1O8G A;  4OZY A;  4C2L A;  1O8D A;  4I84 A;  4W8R A;  3VST A;  4OJ6 A;  2VBM A;  3GQ9 A;  5C1E A;  2VBK A;  3ZPP A;  2ODL A;  4XON A;  4XKV A;  1QCX A;  1O88 A; 
#chains in the Genus database with same CATH topology
 2NST A;  1PLU A;  4Z06 A;  4OZZ A;  4YFO A;  4OJO A;  3SUC A;  4XOT A;  2X6W A;  3B4N A;  4U49 A;  1OFM A;  1K4Z A;  2QYU A;  4YDT A;  4NK6 A;  1O8L A;  1WMR A;  1RMG A;  3UW0 A;  5DNS A;  3ZSC A;  1DBG A;  4OJP A;  2BSP A;  2NT9 A;  1OFE A;  3GRH A;  1O8J A;  2XT2 A;  3SQV A;  1XG2 A;  2VFP A;  2QXZ A;  1BHE A;  3JUR A;  2YUH A;  4V02 C;  1NHC A;  2IQ7 A;  4XLF A;  1HF2 A;  1OGM X;  1QRB A;  2QY1 A;  4OPW A;  4OJ5 A;  3NB2 A;  5C1C A;  2PEC A;  3PSZ A;  3BH7 B;  3AK5 A;  2VJJ A;  2VFQ A;  4YZA A;  1EZG A;  1LLW A;  4HWV A;  1K5C A;  3WWG A;  4W8Q A;  1QA3 A;  1JRG A;  1O8F A;  2VFM A;  4XNF A;  4NK8 A;  1IB4 A;  2BM7 A;  3SZE A;  2NZM A;  3T9G A;  4YZX A;  1CLW A;  1WXR A;  3VMV A;  2EWE A;  2O6W A;  2J8I A;  2VFN A;  3BH6 B;  4JRA C;  4OM9 A;  1QRC A;  3P4G A;  4Z05 A;  4EW9 A;  1TYV A;  3NAW A;  4XKW A;  2NTQ A;  3SY2 A;  4XMY A;  4U4B A;  3PSS A;  1L1I A;  1X0C A;  1VBL A;  3H09 A;  4URR A;  1O8K A;  2PYG A;  2PYH A;  3PET A;  4KH3 A;  1IA5 A;  4YZ0 A;  4PMH A;  3GQ7 A;  4OJL A;  4XQF A;  3VSU A;  4W8S A;  1HG8 A;  2X6Y A;  4XLA A;  2BM4 A;  1JTA A;  4MR0 A;  4XLC A;  5AMV A;  3VMW A;  4MXN A;  3GQA A;  4XR6 A;  1O8H A;  1LLZ A;  2VBE A;  2VFO A;  2XTY A;  3B8Y A;  3JX8 A;  2O0V A;  2X6X A;  2NT6 A;  4XM3 A;  2UVF A;  2VJI A;  4XLH A;  3VSV A;  1QA2 A;  3FY3 A;  2X85 A;  4XL9 A;  4XOP A;  1TYW A;  1TYX A;  2B0R A;  3N6Z A;  1GQ8 A;  1OFD A;  2BM6 A;  2O1D A;  1EE6 A;  1O8M A;  1RWR A;  1KTW A;  1TYU A;  4XN0 A;  4AVZ A;  4YEI A;  4YEL A;  4XLE A;  3RIQ A;  1RU4 A;  1TSP A;  3KRG A;  4YCQ A;  1H80 A;  2BM5 A;  1IDK A;  2O17 A;  1PXZ A;  3B90 A;  3TH0 A;  4W8T A;  3SYJ A;  1CZF A;  3ML3 A;  4XN3 A;  1OOC A;  2XC1 A;  4XOR A;  3EQN A;  1QQ1 A;  3LMW A;  3DU1 X;  3GQ8 A;  4XKV A;  1BN8 A;  2O04 A;  3EQO A;  1QJV A;  2J8K A;  4YZQ A;  5JLV C;  1DBO A;  1EA0 A;  4YEJ A;  1AIR A;  1OFL A;  1KCC A;  2Z8G A;  2NTB A;  5JMC B;  4YC5 A;  2INV A;  1O8I A;  2F3L A;  2QX3 A;  2IOU G;  3N90 A;  2X3H A;  2NTP A;  1QA1 A;  2INU A;  1PE9 A;  1OGO X;  1IDJ A;  2V5I A;  2UVE A;  3LYC A;  1O8E A;  2O0W A;  4Z03 A;  2NSP A;  1KCD A;  1O8G A;  2QZA A;  2XTW A;  4OZY A;  4C2L A;  1K8F A;  2XT4 A;  2XTX A;  1O8D A;  4I84 A;  4W8R A;  2BX6 A;  3VST A;  4OJ6 A;  2VBM A;  3GQ9 A;  5C1E A;  2VBK A;  3ZPP A;  1KQ5 A;  1DAB A;  2ODL A;  4XON A;  2W7Z A;  3LJY A;  1QCX A;  2G0Y A;  1O88 A;  1LM1 A; 
#chains in the Genus database with same CATH homology
 2NST A;  1PLU A;  4Z06 A;  4OZZ A;  4OJO A;  3SUC A;  4XOT A;  2X6W A;  3B4N A;  4U49 A;  1OFM A;  4NK6 A;  1O8L A;  1WMR A;  1RMG A;  3UW0 A;  3ZSC A;  1DBG A;  4OJP A;  2BSP A;  2NT9 A;  3GRH A;  1O8J A;  1XG2 A;  3JUR A;  2QXZ A;  1BHE A;  1NHC A;  2IQ7 A;  4XLF A;  1OGM X;  2QY1 A;  4OJ5 A;  5C1C A;  2PEC A;  2VJJ A;  4YZA A;  4HWV A;  1K5C A;  3WWG A;  4W8Q A;  1JRG A;  1O8F A;  4XNF A;  4NK8 A;  1IB4 A;  2NZM A;  3T9G A;  4YZX A;  3VMV A;  2EWE A;  4Z05 A;  4EW9 A;  4XKW A;  2NTQ A;  4XMY A;  4U4B A;  1X0C A;  1VBL A;  4URR A;  1O8K A;  2PYG A;  2PYH A;  1IA5 A;  4YZ0 A;  4PMH A;  3GQ7 A;  4OJL A;  4XQF A;  3VSU A;  4W8S A;  1HG8 A;  2X6Y A;  4XLA A;  4MR0 A;  1JTA A;  4XLC A;  5AMV A;  3VMW A;  4MXN A;  3GQA A;  4XR6 A;  1O8H A;  2VBE A;  3B8Y A;  4XM3 A;  2O0V A;  2X6X A;  2NT6 A;  2UVF A;  2VJI A;  4XLH A;  3VSV A;  3FY3 A;  2X85 A;  4XL9 A;  4XOP A;  1GQ8 A;  2O1D A;  1EE6 A;  1O8M A;  1RWR A;  1KTW A;  4XN0 A;  4AVZ A;  4YEL A;  4XLE A;  1RU4 A;  3KRG A;  1H80 A;  1IDK A;  2O17 A;  1PXZ A;  3B90 A;  4W8T A;  1CZF A;  4XN3 A;  1OOC A;  4XOR A;  3EQN A;  3LMW A;  3GQ8 A;  1BN8 A;  2O04 A;  3EQO A;  1QJV A;  4YZQ A;  1DBO A;  4YEJ A;  1AIR A;  1OFL A;  1KCC A;  2Z8G A;  2NTB A;  2INV A;  1O8I A;  2QX3 A;  2X3H A;  2NTP A;  2INU A;  1PE9 A;  1OGO X;  1IDJ A;  2UVE A;  1O8E A;  2O0W A;  4Z03 A;  2NSP A;  1KCD A;  1O8G A;  4OZY A;  4C2L A;  1O8D A;  4I84 A;  4W8R A;  3VST A;  4OJ6 A;  2VBM A;  3GQ9 A;  5C1E A;  2VBK A;  3ZPP A;  2ODL A;  4XON A;  4XKV A;  1QCX A;  1O88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...