1RWRA

Crystal structure of filamentous hemagglutinin secretion domain
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
297
Chain Sequence
QGLVPQGQTQVLQGGNKVPVVNIADPNSGGVSHNKFQQFNVANPGVVFNNGLTDGVSRIGGALTKNPNLTRQASAILAEVTDTSPSRLAGTLEVYGKGADLIIANPNGISVNGLSTLNASNLTLTTGRPSVNGGRIGLDVQQGTVTIERGGVNATGLGYFDVVARLVKLQGAVSSKQGKPLADIAVVAGANRYDHATRRATPIAAGARGAAAGAYAIDGTAAGAMYGKHITLVSSDSGLGVRQLGSLSSPSAITVSSQGEIALGDATVQRGPLSLKGAGVVSAGKLASGGGAVNVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamentous hemagglutinin
publication title The crystal structure of filamentous hemagglutinin secretion domain and its implications for the two-partner secretion pathway
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Cell adhesion
total genus 110
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2003-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1rwrA00
1RU4A 4XLAA 1RMGA 1O8HA 3B4NA 4XKWA 4OZYA 4PMHA 1EE6A 1PLUA 4OJ5A 4XLEA 4HWVA 4XNFA 4W8RA 4XKVA 4XQFA 4YELA 4YZAA 2NSTA 2QX3A 1O8KA 2VJJA 4OZZA 1KTWA 3GQAA 3KRGA 4Z06A 1O8FA 4XOPA 3UW0A 1JTAA 1OFMA 1JRGA 1IDKA 4Z05A 2PYGA 1PXZA 3SUCA 4MXNA 1O8LA 1X0CA 4XR6A 1O88A 2VBKA 2Z8GA 3EQOA 4U4BA 2NT6A 2O04A 4U49A 2NTQA 4XMYA 4XM3A 4YZXA 4EW9A 4Z03A 4XORA 2NT9A 2PECA 1NHCA 1O8EA 3VMWA 1H80A 1KCDA 2ODLA 1AIRA 2PYHA 1RWRA 4W8QA 4W8TA 2NTBA 2X6YA 3B8YA 1O8GA 2O1DA 4XLCA 4OJPA 1CZFA 3FY3A 3VSUA 1IA5A 1DBGA 1HG8A 2EWEA 2O0VA 3VSTA 1WMRA 3JURA 5AMVA 2NTPA 4OJ6A 3GQ9A 4MR0A 1O8DA 1O8MA 1O8JA 1GQ8A 4YEJA 1OGMX 2UVFA 4NK8A 1XG2A 1OGOX 1VBLA 3EQNA 2QXZA 3ZSCA 2X85A 4XLHA 2VJIA 2BSPA 3LMWA 4YZQA 1DBOA 1BHEA 4C2LA 1O8IA 4AVZA 1IDJA 2UVEA 4YZ0A 3ZPPA 3GRHA 3VSVA 4I84A 1OOCA 4XLFA 2VBEA 1K5CA 1QCXA 4XN0A 1KCCA 3VMVA 2QY1A 5C1CA 3WWGA 1IB4A 2O0WA 4OJLA 2NZMA 4XN3A 2INUA 2NSPA 2INVA 4NK6A 2IQ7A 2X3HA 3GQ7A 1PE9A 1OFLA 4OJOA 2X6XA 5C1EA 4XOTA 2VBMA 1BN8A 3B90A 4URRA 1QJVA 4XONA 3T9GA 3GQ8A 4W8SA 4XL9A 2O17A 2X6WA
chains in the Genus database with same CATH superfamily
1RU4A 3DU1X 2BM4A 4XLAA 5JLVC 1RMGA 3P4GA 2V5IA 1O8HA 3LJYA 3B4NA 4XKWA 1QA2A 4OZYA 4PMHA 1EE6A 1PLUA 1QQ1A 4OJ5A 2XT4A 4XLEA 4KH3A 4HWVA 4XNFA 1QA1A 4W8RA 1OFDA 1TYUA 5JMCB 3ML3A 4XKVA 4XQFA 4YELA 4YZAA 2NSTA 2QX3A 1CLWA 2QZAA 2YUHA 2XC1A 1O8KA 1LLZA 2VJJA 1KTWA 3GQAA 4OZZA 3KRGA 4Z06A 2XTYA 1O8FA 4XOPA 3UW0A 1JTAA 1OFMA 3RIQA 1JRGA 1EZGA 1IDKA 4Z05A 1TYWA 2W7ZA 2PYGA 3TH0A 1PXZA 3SUCA 4MXNA 1O8LA 1X0CA 3SYJA 4XR6A 1O88A 2VBKA 2Z8GA 1OFEA 1HF2A 2XTWA 3EQOA 2B0RA 4U4BA 2NT6A 2O04A 4U49A 2BM7A 1TYVA 2J8KA 2G0YA 2NTQA 4XMYA 4XM3A 2IOUG 2BM5A 4YZXA 4EW9A 2QYUA 1WXRA 4Z03A 4YDTA 4XORA 2NT9A 2O6WA 2PECA 1NHCA 1O8EA 3VMWA 1H80A 1KCDA 2VFQA 2ODLA 1AIRA 1TSPA 3LYCA 2PYHA 2VFMA 1RWRA 4W8QA 4W8TA 1TYXA 2NTBA 1LM1A 2X6YA 3B8YA 3SY2A 2F3LA 1O8GA 2O1DA 4XLCA 4OJPA 1CZFA 3FY3A 3VSUA 4YCQA 1IA5A 1DBGA 4YFOA 1QRCA 1HG8A 2EWEA 2O0VA 3VSTA 5DNSA 1WMRA 4YC5A 3JURA 5AMVA 2NTPA 1QRBA 1LLWA 3GQ9A 4MR0A 4OJ6A 1O8DA 4V02C 1O8MA 1O8JA 1GQ8A 4YEJA 1L1IA 1OGMX 4OM9A 2UVFA 4NK8A 1XG2A 1OGOX 1VBLA 2XTXA 4YEIA 3EQNA 2QXZA 3ZSCA 2X85A 4XLHA 3AK5A 1KQ5A 2VJIA 3PETA 3SQVA 3N90A 3PSZA 2BSPA 3LMWA 4YZQA 1DBOA 3NB2A 1BHEA 4C2LA 1O8IA 4AVZA 1IDJA 2BM6A 2J8IA 2UVEA 2XT2A 3H09A 3JX8A 4OPWA 1EA0A 2VFPA 4YZ0A 3ZPPA 3GRHA 3VSVA 1DABA 4I84A 1OOCA 4XLFA 2VBEA 1K5CA 1QCXA 4XN0A 1KCCA 3VMVA 1K4ZA 3BH7B 2QY1A 5C1CA 3WWGA 1IB4A 3PSSA 2O0WA 4OJLA 3N6ZA 3SZEA 2NZMA 4XN3A 2INUA 2NSPA 2INVA 2VFNA 1K8FA 4NK6A 2IQ7A 2X3HA 3GQ7A 1PE9A 3BH6B 1OFLA 4OJOA 2X6XA 5C1EA 4XOTA 2VBMA 1BN8A 2VFOA 3B90A 3NAWA 4URRA 1QJVA 4JRAC 4XONA 3T9GA 1QA3A 3GQ8A 4W8SA 4XL9A 2O17A 2X6WA 2BX6A
chains in the Genus database with same CATH topology
1RU4A 4XLAA 1RMGA 1O8HA 3B4NA 4XKWA 4OZYA 4PMHA 1EE6A 1PLUA 4OJ5A 4XLEA 4HWVA 4XNFA 4W8RA 4XKVA 4XQFA 4YELA 4YZAA 2NSTA 2QX3A 1O8KA 2VJJA 4OZZA 1KTWA 3GQAA 3KRGA 4Z06A 1O8FA 4XOPA 3UW0A 1JTAA 1OFMA 1JRGA 1IDKA 4Z05A 2PYGA 1PXZA 3SUCA 4MXNA 1O8LA 1X0CA 4XR6A 1O88A 2VBKA 2Z8GA 3EQOA 4U4BA 2NT6A 2O04A 4U49A 2NTQA 4XMYA 4XM3A 4YZXA 4EW9A 4Z03A 4XORA 2NT9A 2PECA 1NHCA 1O8EA 3VMWA 1H80A 1KCDA 2ODLA 1AIRA 2PYHA 1RWRA 4W8QA 4W8TA 2NTBA 2X6YA 3B8YA 1O8GA 2O1DA 4XLCA 4OJPA 1CZFA 3FY3A 3VSUA 1IA5A 1DBGA 1HG8A 2EWEA 2O0VA 3VSTA 1WMRA 3JURA 5AMVA 2NTPA 4OJ6A 3GQ9A 4MR0A 1O8DA 1O8MA 1O8JA 1GQ8A 4YEJA 1OGMX 2UVFA 4NK8A 1XG2A 1OGOX 1VBLA 3EQNA 2QXZA 3ZSCA 2X85A 4XLHA 2VJIA 2BSPA 3LMWA 4YZQA 1DBOA 1BHEA 4C2LA 1O8IA 4AVZA 1IDJA 2UVEA 4YZ0A 3ZPPA 3GRHA 3VSVA 4I84A 1OOCA 4XLFA 2VBEA 1K5CA 1QCXA 4XN0A 1KCCA 3VMVA 2QY1A 5C1CA 3WWGA 1IB4A 2O0WA 4OJLA 2NZMA 4XN3A 2INUA 2NSPA 2INVA 4NK6A 2IQ7A 2X3HA 3GQ7A 1PE9A 1OFLA 4OJOA 2X6XA 5C1EA 4XOTA 2VBMA 1BN8A 3B90A 4URRA 1QJVA 4XONA 3T9GA 3GQ8A 4W8SA 4XL9A 2O17A 2X6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU4 A;  4XLA A;  1RMG A;  1O8H A;  3B4N A;  4XKW A;  4OZY A;  4PMH A;  1EE6 A;  1PLU A;  4OJ5 A;  4XLE A;  4HWV A;  4XNF A;  4W8R A;  4XKV A;  4XQF A;  4YEL A;  4YZA A;  2NST A;  2QX3 A;  1O8K A;  2VJJ A;  4OZZ A;  1KTW A;  3GQA A;  3KRG A;  4Z06 A;  1O8F A;  4XOP A;  3UW0 A;  1JTA A;  1OFM A;  1JRG A;  1IDK A;  4Z05 A;  2PYG A;  1PXZ A;  3SUC A;  4MXN A;  1O8L A;  1X0C A;  4XR6 A;  1O88 A;  2VBK A;  2Z8G A;  3EQO A;  4U4B A;  2NT6 A;  2O04 A;  4U49 A;  2NTQ A;  4XMY A;  4XM3 A;  4YZX A;  4EW9 A;  4Z03 A;  4XOR A;  2NT9 A;  2PEC A;  1NHC A;  1O8E A;  3VMW A;  1H80 A;  1KCD A;  2ODL A;  1AIR A;  2PYH A;  1RWR A;  4W8Q A;  4W8T A;  2NTB A;  2X6Y A;  3B8Y A;  1O8G A;  2O1D A;  4XLC A;  4OJP A;  1CZF A;  3FY3 A;  3VSU A;  1IA5 A;  1DBG A;  1HG8 A;  2EWE A;  2O0V A;  3VST A;  1WMR A;  3JUR A;  5AMV A;  2NTP A;  4OJ6 A;  3GQ9 A;  4MR0 A;  1O8D A;  1O8M A;  1O8J A;  1GQ8 A;  4YEJ A;  1OGM X;  2UVF A;  4NK8 A;  1XG2 A;  1OGO X;  1VBL A;  3EQN A;  2QXZ A;  3ZSC A;  2X85 A;  4XLH A;  2VJI A;  2BSP A;  3LMW A;  4YZQ A;  1DBO A;  1BHE A;  4C2L A;  1O8I A;  4AVZ A;  1IDJ A;  2UVE A;  4YZ0 A;  3ZPP A;  3GRH A;  3VSV A;  4I84 A;  1OOC A;  4XLF A;  2VBE A;  1K5C A;  1QCX A;  4XN0 A;  1KCC A;  3VMV A;  2QY1 A;  5C1C A;  3WWG A;  1IB4 A;  2O0W A;  4OJL A;  2NZM A;  4XN3 A;  2INU A;  2NSP A;  2INV A;  4NK6 A;  2IQ7 A;  2X3H A;  3GQ7 A;  1PE9 A;  1OFL A;  4OJO A;  2X6X A;  5C1E A;  4XOT A;  2VBM A;  1BN8 A;  3B90 A;  4URR A;  1QJV A;  4XON A;  3T9G A;  3GQ8 A;  4W8S A;  4XL9 A;  2O17 A;  2X6W A; 
#chains in the Genus database with same CATH topology
 1RU4 A;  3DU1 X;  2BM4 A;  4XLA A;  5JLV C;  1RMG A;  3P4G A;  2V5I A;  1O8H A;  3LJY A;  3B4N A;  4XKW A;  1QA2 A;  4OZY A;  4PMH A;  1EE6 A;  1PLU A;  1QQ1 A;  4OJ5 A;  2XT4 A;  4XLE A;  4KH3 A;  4HWV A;  4XNF A;  1QA1 A;  4W8R A;  1OFD A;  1TYU A;  5JMC B;  3ML3 A;  4XKV A;  4XQF A;  4YEL A;  4YZA A;  2NST A;  2QX3 A;  1CLW A;  2QZA A;  2YUH A;  2XC1 A;  1O8K A;  1LLZ A;  2VJJ A;  1KTW A;  3GQA A;  4OZZ A;  3KRG A;  4Z06 A;  2XTY A;  1O8F A;  4XOP A;  3UW0 A;  1JTA A;  1OFM A;  3RIQ A;  1JRG A;  1EZG A;  1IDK A;  4Z05 A;  1TYW A;  2W7Z A;  2PYG A;  3TH0 A;  1PXZ A;  3SUC A;  4MXN A;  1O8L A;  1X0C A;  3SYJ A;  4XR6 A;  1O88 A;  2VBK A;  2Z8G A;  1OFE A;  1HF2 A;  2XTW A;  3EQO A;  2B0R A;  4U4B A;  2NT6 A;  2O04 A;  4U49 A;  2BM7 A;  1TYV A;  2J8K A;  2G0Y A;  2NTQ A;  4XMY A;  4XM3 A;  2IOU G;  2BM5 A;  4YZX A;  4EW9 A;  2QYU A;  1WXR A;  4Z03 A;  4YDT A;  4XOR A;  2NT9 A;  2O6W A;  2PEC A;  1NHC A;  1O8E A;  3VMW A;  1H80 A;  1KCD A;  2VFQ A;  2ODL A;  1AIR A;  1TSP A;  3LYC A;  2PYH A;  2VFM A;  1RWR A;  4W8Q A;  4W8T A;  1TYX A;  2NTB A;  1LM1 A;  2X6Y A;  3B8Y A;  3SY2 A;  2F3L A;  1O8G A;  2O1D A;  4XLC A;  4OJP A;  1CZF A;  3FY3 A;  3VSU A;  4YCQ A;  1IA5 A;  1DBG A;  4YFO A;  1QRC A;  1HG8 A;  2EWE A;  2O0V A;  3VST A;  5DNS A;  1WMR A;  4YC5 A;  3JUR A;  5AMV A;  2NTP A;  1QRB A;  1LLW A;  3GQ9 A;  4MR0 A;  4OJ6 A;  1O8D A;  4V02 C;  1O8M A;  1O8J A;  1GQ8 A;  4YEJ A;  1L1I A;  1OGM X;  4OM9 A;  2UVF A;  4NK8 A;  1XG2 A;  1OGO X;  1VBL A;  2XTX A;  4YEI A;  3EQN A;  2QXZ A;  3ZSC A;  2X85 A;  4XLH A;  3AK5 A;  1KQ5 A;  2VJI A;  3PET A;  3SQV A;  3N90 A;  3PSZ A;  2BSP A;  3LMW A;  4YZQ A;  1DBO A;  3NB2 A;  1BHE A;  4C2L A;  1O8I A;  4AVZ A;  1IDJ A;  2BM6 A;  2J8I A;  2UVE A;  2XT2 A;  3H09 A;  3JX8 A;  4OPW A;  1EA0 A;  2VFP A;  4YZ0 A;  3ZPP A;  3GRH A;  3VSV A;  1DAB A;  4I84 A;  1OOC A;  4XLF A;  2VBE A;  1K5C A;  1QCX A;  4XN0 A;  1KCC A;  3VMV A;  1K4Z A;  3BH7 B;  2QY1 A;  5C1C A;  3WWG A;  1IB4 A;  3PSS A;  2O0W A;  4OJL A;  3N6Z A;  3SZE A;  2NZM A;  4XN3 A;  2INU A;  2NSP A;  2INV A;  2VFN A;  1K8F A;  4NK6 A;  2IQ7 A;  2X3H A;  3GQ7 A;  1PE9 A;  3BH6 B;  1OFL A;  4OJO A;  2X6X A;  5C1E A;  4XOT A;  2VBM A;  1BN8 A;  2VFO A;  3B90 A;  3NAW A;  4URR A;  1QJV A;  4JRA C;  4XON A;  3T9G A;  1QA3 A;  3GQ8 A;  4W8S A;  4XL9 A;  2O17 A;  2X6W A;  2BX6 A; 
#chains in the Genus database with same CATH homology
 1RU4 A;  4XLA A;  1RMG A;  1O8H A;  3B4N A;  4XKW A;  4OZY A;  4PMH A;  1EE6 A;  1PLU A;  4OJ5 A;  4XLE A;  4HWV A;  4XNF A;  4W8R A;  4XKV A;  4XQF A;  4YEL A;  4YZA A;  2NST A;  2QX3 A;  1O8K A;  2VJJ A;  4OZZ A;  1KTW A;  3GQA A;  3KRG A;  4Z06 A;  1O8F A;  4XOP A;  3UW0 A;  1JTA A;  1OFM A;  1JRG A;  1IDK A;  4Z05 A;  2PYG A;  1PXZ A;  3SUC A;  4MXN A;  1O8L A;  1X0C A;  4XR6 A;  1O88 A;  2VBK A;  2Z8G A;  3EQO A;  4U4B A;  2NT6 A;  2O04 A;  4U49 A;  2NTQ A;  4XMY A;  4XM3 A;  4YZX A;  4EW9 A;  4Z03 A;  4XOR A;  2NT9 A;  2PEC A;  1NHC A;  1O8E A;  3VMW A;  1H80 A;  1KCD A;  2ODL A;  1AIR A;  2PYH A;  1RWR A;  4W8Q A;  4W8T A;  2NTB A;  2X6Y A;  3B8Y A;  1O8G A;  2O1D A;  4XLC A;  4OJP A;  1CZF A;  3FY3 A;  3VSU A;  1IA5 A;  1DBG A;  1HG8 A;  2EWE A;  2O0V A;  3VST A;  1WMR A;  3JUR A;  5AMV A;  2NTP A;  4OJ6 A;  3GQ9 A;  4MR0 A;  1O8D A;  1O8M A;  1O8J A;  1GQ8 A;  4YEJ A;  1OGM X;  2UVF A;  4NK8 A;  1XG2 A;  1OGO X;  1VBL A;  3EQN A;  2QXZ A;  3ZSC A;  2X85 A;  4XLH A;  2VJI A;  2BSP A;  3LMW A;  4YZQ A;  1DBO A;  1BHE A;  4C2L A;  1O8I A;  4AVZ A;  1IDJ A;  2UVE A;  4YZ0 A;  3ZPP A;  3GRH A;  3VSV A;  4I84 A;  1OOC A;  4XLF A;  2VBE A;  1K5C A;  1QCX A;  4XN0 A;  1KCC A;  3VMV A;  2QY1 A;  5C1C A;  3WWG A;  1IB4 A;  2O0W A;  4OJL A;  2NZM A;  4XN3 A;  2INU A;  2NSP A;  2INV A;  4NK6 A;  2IQ7 A;  2X3H A;  3GQ7 A;  1PE9 A;  1OFL A;  4OJO A;  2X6X A;  5C1E A;  4XOT A;  2VBM A;  1BN8 A;  3B90 A;  4URR A;  1QJV A;  4XON A;  3T9G A;  3GQ8 A;  4W8S A;  4XL9 A;  2O17 A;  2X6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...