1RWRA

Crystal structure of filamentous hemagglutinin secretion domain
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
297
Chain Sequence
QGLVPQGQTQVLQGGNKVPVVNIADPNSGGVSHNKFQQFNVANPGVVFNNGLTDGVSRIGGALTKNPNLTRQASAILAEVTDTSPSRLAGTLEVYGKGADLIIANPNGISVNGLSTLNASNLTLTTGRPSVNGGRIGLDVQQGTVTIERGGVNATGLGYFDVVARLVKLQGAVSSKQGKPLADIAVVAGANRYDHATRRATPIAAGARGAAAGAYAIDGTAAGAMYGKHITLVSSDSGLGVRQLGSLSSPSAITVSSQGEIALGDATVQRGPLSLKGAGVVSAGKLASGGGAVNVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Filamentous hemagglutinin
publication title The crystal structure of filamentous hemagglutinin secretion domain and its implications for the two-partner secretion pathway
pubmed doi rcsb
source organism Bordetella pertussis
total genus 110
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2003-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1rwrA00
2VBMA 2NTBA 2NT9A 2NSPA 2PYGA 4HWVA 4AVZA 1O88A 4OJ5A 3B90A 4YELA 1IB4A 4W8RA 1DBOA 1O8FA 1BHEA 1IDJA 4XQFA 1OGMX 3GQ8A 2X85A 4XN0A 1O8DA 5C1EA 4U4BA 3GRHA 4MR0A 1EE6A 4OJLA 4U49A 3VSUA 1OFLA 2INVA 4I84A 2X6WA 3FY3A 1RMGA 2NSTA 4C2LA 4OJPA 4Z05A 4YZAA 1QJVA 2X3HA 1JRGA 4YZXA 1NHCA 4YZ0A 2O0WA 2O0VA 3B8YA 3T9GA 4Z06A 1RU4A 3ZPPA 2EWEA 2PYHA 2VJIA 3LMWA 1OGOX 1OOCA 1KCCA 4XKVA 3ZSCA 3GQ7A 2O1DA 2NT6A 2BSPA 4XL9A 4XN3A 2QX3A 4NK8A 4URRA 1KTWA 1O8EA 1GQ8A 2INUA 4XR6A 4MXNA 4XORA 3VMWA 1X0CA 1O8JA 1HG8A 1PE9A 1O8KA 2UVEA 2O17A 3EQOA 3UW0A 4XONA 2PECA 4OJ6A 3SUCA 4OZZA 4PMHA 4XOPA 1PLUA 4XLHA 1KCDA 2X6XA 3JURA 1XG2A 2X6YA 1IA5A 1PXZA 4OJOA 2UVFA 4W8TA 1K5CA 2ODLA 1JTAA 4EW9A 3EQNA 2VBEA 4YEJA 1H80A 2VJJA 4Z03A 1RWRA 5AMVA 3WWGA 4XLAA 1O8IA 2NZMA 2NTQA 1WMRA 1AIRA 1O8LA 2QY1A 4NK6A 4XMYA 2IQ7A 2QXZA 1OFMA 2Z8GA 4XLEA 5C1CA 1O8HA 3GQ9A 1DBGA 4XLCA 1VBLA 2O04A 1CZFA 4XKWA 1O8GA 2NTPA 2VBKA 4W8SA 4OZYA 4YZQA 1QCXA 4XOTA 4XM3A 4XLFA 3VSVA 1BN8A 4XNFA 3GQAA 3VSTA 3KRGA 4W8QA 3B4NA 1IDKA 3VMVA 1O8MA
chains in the Genus database with same CATH superfamily
2VBMA 2NTBA 1K8FA 2NT9A 2NSPA 2PYGA 4HWVA 3DU1X 1QRBA 4AVZA 1LLZA 3RIQA 1O88A 4OJ5A 3B90A 4YELA 1QRCA 2XTYA 4W8RA 5JMCB 3JX8A 1IB4A 1DBOA 1O8FA 1BHEA 3SQVA 1QA2A 2F3LA 1IDJA 4XQFA 1OGMX 3GQ8A 2X85A 4XN0A 1O8DA 5C1EA 2QYUA 4U4BA 1TSPA 3GRHA 3N6ZA 4MR0A 1EE6A 1TYWA 4OJLA 4U49A 1OFLA 3VSUA 2INVA 4I84A 4YEIA 2X6WA 3FY3A 1RMGA 2NSTA 4V02C 4C2LA 4YFOA 4OJPA 1EA0A 4Z05A 4YZAA 3H09A 1QA1A 3AK5A 1QJVA 1QA3A 2IOUG 4OM9A 1WXRA 2X3HA 2XC1A 1JRGA 4YZXA 3SZEA 1NHCA 2BM4A 4YZ0A 2O0WA 2O0VA 2VFPA 3B8YA 3T9GA 4Z06A 1RU4A 3ZPPA 2EWEA 2PYHA 2XTWA 2VJIA 3LMWA 4OPWA 1OGOX 1OOCA 5JLVC 1KCCA 1OFDA 4XKVA 3ZSCA 3GQ7A 2O6WA 2O1DA 2NT6A 2BSPA 1K4ZA 3PETA 4XL9A 4XN3A 2QX3A 4NK8A 4URRA 1KTWA 1O8EA 1GQ8A 2INUA 4XR6A 4MXNA 4XORA 3VMWA 1X0CA 1O8JA 1HG8A 1PE9A 1DABA 1O8KA 1HF2A 3SYJA 2UVEA 2O17A 3EQOA 3NAWA 1TYVA 3UW0A 1L1IA 4XONA 3P4GA 2PECA 4OJ6A 3SUCA 4KH3A 2W7ZA 4OZZA 3PSSA 4PMHA 4XOPA 2BM5A 1PLUA 4XLHA 3PSZA 1KCDA 2X6XA 3JURA 1XG2A 2VFQA 2X6YA 1IA5A 1PXZA 4OJOA 2UVFA 1TYUA 4W8TA 1K5CA 4YDTA 4JRAC 2G0YA 2ODLA 1JTAA 2QZAA 4EW9A 3EQNA 3LYCA 2VBEA 4YEJA 1H80A 3SY2A 2VJJA 4Z03A 3TH0A 2XT4A 3BH6B 1RWRA 1CLWA 5AMVA 3WWGA 3ML3A 4XLAA 1O8IA 2NZMA 5DNSA 1TYXA 1WMRA 2NTQA 2BX6A 1EZGA 1AIRA 1KQ5A 1O8LA 2QY1A 4NK6A 4XMYA 2IQ7A 2J8KA 1OFMA 2QXZA 2Z8GA 4XLEA 5C1CA 4YC5A 1O8HA 3GQ9A 2VFNA 1DBGA 2J8IA 4XLCA 1VBLA 2O04A 1OFEA 1CZFA 1LM1A 4YCQA 2BM6A 4XKWA 1O8GA 2BM7A 2NTPA 3N90A 2VBKA 4W8SA 4OZYA 4YZQA 1QQ1A 1QCXA 2B0RA 4XOTA 1LLWA 4XM3A 2XTXA 4XLFA 1BN8A 3VSVA 2V5IA 3GQAA 4XNFA 3VSTA 2VFMA 2VFOA 3KRGA 4W8QA 2YUHA 1IDKA 3B4NA 3BH7B 3LJYA 3NB2A 3VMVA 2XT2A 1O8MA
chains in the Genus database with same CATH topology
2VBMA 2NTBA 2NT9A 2NSPA 2PYGA 4HWVA 4AVZA 1O88A 4OJ5A 3B90A 4YELA 1IB4A 4W8RA 1DBOA 1O8FA 1BHEA 1IDJA 4XQFA 1OGMX 3GQ8A 2X85A 4XN0A 1O8DA 5C1EA 4U4BA 3GRHA 4MR0A 1EE6A 4OJLA 4U49A 3VSUA 1OFLA 2INVA 4I84A 2X6WA 3FY3A 1RMGA 2NSTA 4C2LA 4OJPA 4Z05A 4YZAA 1QJVA 2X3HA 1JRGA 4YZXA 1NHCA 4YZ0A 2O0WA 2O0VA 3B8YA 3T9GA 4Z06A 1RU4A 3ZPPA 2EWEA 2PYHA 2VJIA 3LMWA 1OGOX 1OOCA 1KCCA 4XKVA 3ZSCA 3GQ7A 2O1DA 2NT6A 2BSPA 4XL9A 4XN3A 2QX3A 4NK8A 4URRA 1KTWA 1O8EA 1GQ8A 2INUA 4XR6A 4MXNA 4XORA 3VMWA 1X0CA 1O8JA 1HG8A 1PE9A 1O8KA 2UVEA 2O17A 3EQOA 3UW0A 4XONA 2PECA 4OJ6A 3SUCA 4OZZA 4PMHA 4XOPA 1PLUA 4XLHA 1KCDA 2X6XA 3JURA 1XG2A 2X6YA 1IA5A 1PXZA 4OJOA 2UVFA 4W8TA 1K5CA 2ODLA 1JTAA 4EW9A 3EQNA 2VBEA 4YEJA 1H80A 2VJJA 4Z03A 1RWRA 5AMVA 3WWGA 4XLAA 1O8IA 2NZMA 2NTQA 1WMRA 1AIRA 1O8LA 2QY1A 4NK6A 4XMYA 2IQ7A 2QXZA 1OFMA 2Z8GA 4XLEA 5C1CA 1O8HA 3GQ9A 1DBGA 4XLCA 1VBLA 2O04A 1CZFA 4XKWA 1O8GA 2NTPA 2VBKA 4W8SA 4OZYA 4YZQA 1QCXA 4XOTA 4XM3A 4XLFA 3VSVA 1BN8A 4XNFA 3GQAA 3VSTA 3KRGA 4W8QA 3B4NA 1IDKA 3VMVA 1O8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBM A;  2NTB A;  2NT9 A;  2NSP A;  2PYG A;  4HWV A;  4AVZ A;  1O88 A;  4OJ5 A;  3B90 A;  4YEL A;  1IB4 A;  4W8R A;  1DBO A;  1O8F A;  1BHE A;  1IDJ A;  4XQF A;  1OGM X;  3GQ8 A;  2X85 A;  4XN0 A;  1O8D A;  5C1E A;  4U4B A;  3GRH A;  4MR0 A;  1EE6 A;  4OJL A;  4U49 A;  3VSU A;  1OFL A;  2INV A;  4I84 A;  2X6W A;  3FY3 A;  1RMG A;  2NST A;  4C2L A;  4OJP A;  4Z05 A;  4YZA A;  1QJV A;  2X3H A;  1JRG A;  4YZX A;  1NHC A;  4YZ0 A;  2O0W A;  2O0V A;  3B8Y A;  3T9G A;  4Z06 A;  1RU4 A;  3ZPP A;  2EWE A;  2PYH A;  2VJI A;  3LMW A;  1OGO X;  1OOC A;  1KCC A;  4XKV A;  3ZSC A;  3GQ7 A;  2O1D A;  2NT6 A;  2BSP A;  4XL9 A;  4XN3 A;  2QX3 A;  4NK8 A;  4URR A;  1KTW A;  1O8E A;  1GQ8 A;  2INU A;  4XR6 A;  4MXN A;  4XOR A;  3VMW A;  1X0C A;  1O8J A;  1HG8 A;  1PE9 A;  1O8K A;  2UVE A;  2O17 A;  3EQO A;  3UW0 A;  4XON A;  2PEC A;  4OJ6 A;  3SUC A;  4OZZ A;  4PMH A;  4XOP A;  1PLU A;  4XLH A;  1KCD A;  2X6X A;  3JUR A;  1XG2 A;  2X6Y A;  1IA5 A;  1PXZ A;  4OJO A;  2UVF A;  4W8T A;  1K5C A;  2ODL A;  1JTA A;  4EW9 A;  3EQN A;  2VBE A;  4YEJ A;  1H80 A;  2VJJ A;  4Z03 A;  1RWR A;  5AMV A;  3WWG A;  4XLA A;  1O8I A;  2NZM A;  2NTQ A;  1WMR A;  1AIR A;  1O8L A;  2QY1 A;  4NK6 A;  4XMY A;  2IQ7 A;  2QXZ A;  1OFM A;  2Z8G A;  4XLE A;  5C1C A;  1O8H A;  3GQ9 A;  1DBG A;  4XLC A;  1VBL A;  2O04 A;  1CZF A;  4XKW A;  1O8G A;  2NTP A;  2VBK A;  4W8S A;  4OZY A;  4YZQ A;  1QCX A;  4XOT A;  4XM3 A;  4XLF A;  3VSV A;  1BN8 A;  4XNF A;  3GQA A;  3VST A;  3KRG A;  4W8Q A;  3B4N A;  1IDK A;  3VMV A;  1O8M A; 
#chains in the Genus database with same CATH topology
 2VBM A;  2NTB A;  1K8F A;  2NT9 A;  2NSP A;  2PYG A;  4HWV A;  3DU1 X;  1QRB A;  4AVZ A;  1LLZ A;  3RIQ A;  1O88 A;  4OJ5 A;  3B90 A;  4YEL A;  1QRC A;  2XTY A;  4W8R A;  5JMC B;  3JX8 A;  1IB4 A;  1DBO A;  1O8F A;  1BHE A;  3SQV A;  1QA2 A;  2F3L A;  1IDJ A;  4XQF A;  1OGM X;  3GQ8 A;  2X85 A;  4XN0 A;  1O8D A;  5C1E A;  2QYU A;  4U4B A;  1TSP A;  3GRH A;  3N6Z A;  4MR0 A;  1EE6 A;  1TYW A;  4OJL A;  4U49 A;  1OFL A;  3VSU A;  2INV A;  4I84 A;  4YEI A;  2X6W A;  3FY3 A;  1RMG A;  2NST A;  4V02 C;  4C2L A;  4YFO A;  4OJP A;  1EA0 A;  4Z05 A;  4YZA A;  3H09 A;  1QA1 A;  3AK5 A;  1QJV A;  1QA3 A;  2IOU G;  4OM9 A;  1WXR A;  2X3H A;  2XC1 A;  1JRG A;  4YZX A;  3SZE A;  1NHC A;  2BM4 A;  4YZ0 A;  2O0W A;  2O0V A;  2VFP A;  3B8Y A;  3T9G A;  4Z06 A;  1RU4 A;  3ZPP A;  2EWE A;  2PYH A;  2XTW A;  2VJI A;  3LMW A;  4OPW A;  1OGO X;  1OOC A;  5JLV C;  1KCC A;  1OFD A;  4XKV A;  3ZSC A;  3GQ7 A;  2O6W A;  2O1D A;  2NT6 A;  2BSP A;  1K4Z A;  3PET A;  4XL9 A;  4XN3 A;  2QX3 A;  4NK8 A;  4URR A;  1KTW A;  1O8E A;  1GQ8 A;  2INU A;  4XR6 A;  4MXN A;  4XOR A;  3VMW A;  1X0C A;  1O8J A;  1HG8 A;  1PE9 A;  1DAB A;  1O8K A;  1HF2 A;  3SYJ A;  2UVE A;  2O17 A;  3EQO A;  3NAW A;  1TYV A;  3UW0 A;  1L1I A;  4XON A;  3P4G A;  2PEC A;  4OJ6 A;  3SUC A;  4KH3 A;  2W7Z A;  4OZZ A;  3PSS A;  4PMH A;  4XOP A;  2BM5 A;  1PLU A;  4XLH A;  3PSZ A;  1KCD A;  2X6X A;  3JUR A;  1XG2 A;  2VFQ A;  2X6Y A;  1IA5 A;  1PXZ A;  4OJO A;  2UVF A;  1TYU A;  4W8T A;  1K5C A;  4YDT A;  4JRA C;  2G0Y A;  2ODL A;  1JTA A;  2QZA A;  4EW9 A;  3EQN A;  3LYC A;  2VBE A;  4YEJ A;  1H80 A;  3SY2 A;  2VJJ A;  4Z03 A;  3TH0 A;  2XT4 A;  3BH6 B;  1RWR A;  1CLW A;  5AMV A;  3WWG A;  3ML3 A;  4XLA A;  1O8I A;  2NZM A;  5DNS A;  1TYX A;  1WMR A;  2NTQ A;  2BX6 A;  1EZG A;  1AIR A;  1KQ5 A;  1O8L A;  2QY1 A;  4NK6 A;  4XMY A;  2IQ7 A;  2J8K A;  1OFM A;  2QXZ A;  2Z8G A;  4XLE A;  5C1C A;  4YC5 A;  1O8H A;  3GQ9 A;  2VFN A;  1DBG A;  2J8I A;  4XLC A;  1VBL A;  2O04 A;  1OFE A;  1CZF A;  1LM1 A;  4YCQ A;  2BM6 A;  4XKW A;  1O8G A;  2BM7 A;  2NTP A;  3N90 A;  2VBK A;  4W8S A;  4OZY A;  4YZQ A;  1QQ1 A;  1QCX A;  2B0R A;  4XOT A;  1LLW A;  4XM3 A;  2XTX A;  4XLF A;  1BN8 A;  3VSV A;  2V5I A;  3GQA A;  4XNF A;  3VST A;  2VFM A;  2VFO A;  3KRG A;  4W8Q A;  2YUH A;  1IDK A;  3B4N A;  3BH7 B;  3LJY A;  3NB2 A;  3VMV A;  2XT2 A;  1O8M A; 
#chains in the Genus database with same CATH homology
 2VBM A;  2NTB A;  2NT9 A;  2NSP A;  2PYG A;  4HWV A;  4AVZ A;  1O88 A;  4OJ5 A;  3B90 A;  4YEL A;  1IB4 A;  4W8R A;  1DBO A;  1O8F A;  1BHE A;  1IDJ A;  4XQF A;  1OGM X;  3GQ8 A;  2X85 A;  4XN0 A;  1O8D A;  5C1E A;  4U4B A;  3GRH A;  4MR0 A;  1EE6 A;  4OJL A;  4U49 A;  3VSU A;  1OFL A;  2INV A;  4I84 A;  2X6W A;  3FY3 A;  1RMG A;  2NST A;  4C2L A;  4OJP A;  4Z05 A;  4YZA A;  1QJV A;  2X3H A;  1JRG A;  4YZX A;  1NHC A;  4YZ0 A;  2O0W A;  2O0V A;  3B8Y A;  3T9G A;  4Z06 A;  1RU4 A;  3ZPP A;  2EWE A;  2PYH A;  2VJI A;  3LMW A;  1OGO X;  1OOC A;  1KCC A;  4XKV A;  3ZSC A;  3GQ7 A;  2O1D A;  2NT6 A;  2BSP A;  4XL9 A;  4XN3 A;  2QX3 A;  4NK8 A;  4URR A;  1KTW A;  1O8E A;  1GQ8 A;  2INU A;  4XR6 A;  4MXN A;  4XOR A;  3VMW A;  1X0C A;  1O8J A;  1HG8 A;  1PE9 A;  1O8K A;  2UVE A;  2O17 A;  3EQO A;  3UW0 A;  4XON A;  2PEC A;  4OJ6 A;  3SUC A;  4OZZ A;  4PMH A;  4XOP A;  1PLU A;  4XLH A;  1KCD A;  2X6X A;  3JUR A;  1XG2 A;  2X6Y A;  1IA5 A;  1PXZ A;  4OJO A;  2UVF A;  4W8T A;  1K5C A;  2ODL A;  1JTA A;  4EW9 A;  3EQN A;  2VBE A;  4YEJ A;  1H80 A;  2VJJ A;  4Z03 A;  1RWR A;  5AMV A;  3WWG A;  4XLA A;  1O8I A;  2NZM A;  2NTQ A;  1WMR A;  1AIR A;  1O8L A;  2QY1 A;  4NK6 A;  4XMY A;  2IQ7 A;  2QXZ A;  1OFM A;  2Z8G A;  4XLE A;  5C1C A;  1O8H A;  3GQ9 A;  1DBG A;  4XLC A;  1VBL A;  2O04 A;  1CZF A;  4XKW A;  1O8G A;  2NTP A;  2VBK A;  4W8S A;  4OZY A;  4YZQ A;  1QCX A;  4XOT A;  4XM3 A;  4XLF A;  3VSV A;  1BN8 A;  4XNF A;  3GQA A;  3VST A;  3KRG A;  4W8Q A;  3B4N A;  1IDK A;  3VMV A;  1O8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...