1KCCA

Endopolygalacturonase i from stereum purpureum complexed with a galacturonate at 1.00 a resolution.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOPOLYGALACTURONASE
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1kccA00
2EWEA 1OFLA 1DBGA 4AVZA 5AMVA 2NZMA 2NTPA 1QCXA 2BSPA 2IQ7A 3EQOA 2NSTA 1KCDA 4XOPA 2X6XA 4EW9A 4XL9A 1NHCA 4NK8A 4I84A 4XQFA 4PMHA 1WMRA 4XONA 3ZPPA 1OFMA 2X6YA 4XNFA 3T9GA 1O8KA 4XLFA 3VMWA 1CZFA 1PLUA 1O88A 5C1CA 2VJIA 4OZYA 1XG2A 2QXZA 2PYGA 1KTWA 4W8SA 4C2LA 4YZ0A 3UW0A 2VJJA 4OJ6A 4Z05A 2VBMA 2NT9A 1QJVA 2NSPA 2UVEA 2O0WA 3GQ8A 4MXNA 3VMVA 1O8HA 3B90A 3GRHA 3FY3A 1X0CA 1IDKA 3EQNA 4YZXA 3JURA 3GQ7A 3VSVA 4OJPA 4OJLA 4XLHA 2QX3A 4YZQA 4OJ5A 1BN8A 3B4NA 1AIRA 4MR0A 3SUCA 1JTAA 4U49A 1PE9A 3GQ9A 1BHEA 1VBLA 1RU4A 1KCCA 4XKVA 3VSUA 4YELA 4XM3A 3KRGA 1PXZA 2NTQA 2O17A 2X6WA 4XN3A 2NT6A 2NTBA 4XLCA 2INVA 4Z03A 4XOTA 5C1EA 1DBOA 2INUA 4XLEA 1IDJA 2O0VA 4NK6A 4XR6A 1RMGA 1EE6A 1JRGA 1O8MA 1OGMX 2UVFA 1O8EA 1O8IA 1O8JA 4YZAA 1H80A 4W8QA 2VBEA 4YEJA 2X3HA 4OZZA 1OOCA 4HWVA 2VBKA 2O1DA 2O04A 4OJOA 4W8RA 1O8GA 1GQ8A 1RWRA 1O8FA 4URRA 2QY1A 4XORA 3WWGA 1HG8A 3B8YA 1IB4A 2PYHA 4Z06A 4W8TA 2ODLA 2PECA 3ZSCA 2Z8GA 3GQAA 1IA5A 4XMYA 4XN0A 4XKWA 1OGOX 3VSTA 1O8DA 4U4BA 3LMWA 1O8LA 1K5CA 4XLAA 2X85A
chains in the Genus database with same CATH superfamily
2EWEA 1OFLA 1DBGA 4OM9A 5AMVA 4AVZA 2NZMA 3PETA 2BM5A 2NTPA 1QCXA 2BSPA 2YUHA 3BH7B 2IQ7A 3EQOA 2NSTA 1KCDA 4XOPA 2X6XA 4EW9A 1OFEA 4XL9A 1NHCA 4NK8A 4I84A 4XQFA 4PMHA 1WMRA 4XONA 1CLWA 3ZPPA 1OFMA 3JX8A 2X6YA 3NAWA 1TSPA 4XNFA 3T9GA 1O8KA 1TYVA 4XLFA 2XT2A 3VMWA 1CZFA 1PLUA 1O88A 5C1CA 2VJIA 3N90A 4OZYA 5JMCB 1XG2A 2QXZA 2XTWA 2VFPA 2J8KA 2PYGA 2VFQA 1KTWA 2IOUG 4W8SA 4C2LA 2XTYA 4YZ0A 3UW0A 2VJJA 2XT4A 4OJ6A 4Z05A 2VBMA 2BM7A 2NT9A 1QJVA 2NSPA 1LLWA 2UVEA 2O0WA 3GQ8A 4MXNA 3VMVA 1O8HA 3B90A 2G0YA 2VFNA 3GRHA 3FY3A 1X0CA 1IDKA 3EQNA 4YZXA 3AK5A 3H09A 2QYUA 3JURA 5JLVC 3GQ7A 1HF2A 1EZGA 3LJYA 3P4GA 1QQ1A 4OJPA 4OJLA 4XLHA 2QX3A 4YZQA 3VSVA 4OJ5A 1BN8A 3B4NA 1AIRA 3N6ZA 4YDTA 3ML3A 4MR0A 3SUCA 1JTAA 4U49A 1DABA 1PE9A 3GQ9A 3SY2A 1BHEA 1VBLA 1RU4A 1TYXA 4XKVA 1KCCA 2VFOA 3NB2A 3SZEA 3VSUA 4YELA 4XM3A 3KRGA 1EA0A 1K8FA 1PXZA 1TYUA 2NTQA 4YCQA 2O17A 2X6WA 4XN3A 2NT6A 4YFOA 2NTBA 1QA1A 2QZAA 4XLCA 2INVA 4Z03A 4XOTA 5C1EA 1DBOA 2BM4A 1L1IA 2INUA 3BH6B 3SYJA 3PSSA 1IDJA 2O0VA 4NK6A 4OPWA 4KH3A 4XLEA 4XR6A 1RMGA 1EE6A 1JRGA 4YC5A 1O8MA 4JRAC 1QRCA 1OGMX 2UVFA 1O8EA 1O8IA 1O8JA 3DU1X 1H80A 4W8QA 4YZAA 2VFMA 2VBEA 4YEJA 2X3HA 2BX6A 3LYCA 1KQ5A 2BM6A 4OZZA 1OOCA 4V02C 4HWVA 2VBKA 2O1DA 2O04A 1K4ZA 2XTXA 4OJOA 4W8RA 4YEIA 1O8GA 3RIQA 1GQ8A 5DNSA 1RWRA 1O8FA 2F3LA 4URRA 2QY1A 4XLAA 1LLZA 4XORA 3WWGA 1HG8A 2J8IA 3B8YA 1IB4A 2B0RA 2PYHA 4Z06A 2XC1A 2O6WA 1TYWA 1QA3A 4W8TA 2ODLA 2PECA 1LM1A 3SQVA 3ZSCA 2W7ZA 2Z8GA 1QRBA 3GQAA 1IA5A 4XMYA 4XN0A 4XKWA 1OGOX 1WXRA 3PSZA 3VSTA 1O8DA 2V5IA 4U4BA 3LMWA 1O8LA 3TH0A 1QA2A 1K5CA 1OFDA 2X85A
chains in the Genus database with same CATH topology
2EWEA 1OFLA 1DBGA 4AVZA 5AMVA 2NZMA 2NTPA 1QCXA 2BSPA 2IQ7A 3EQOA 2NSTA 1KCDA 4XOPA 2X6XA 4EW9A 4XL9A 1NHCA 4NK8A 4I84A 4XQFA 4PMHA 1WMRA 4XONA 3ZPPA 1OFMA 2X6YA 4XNFA 3T9GA 1O8KA 4XLFA 3VMWA 1CZFA 1PLUA 1O88A 5C1CA 2VJIA 4OZYA 1XG2A 2QXZA 2PYGA 1KTWA 4W8SA 4C2LA 4YZ0A 3UW0A 2VJJA 4OJ6A 4Z05A 2VBMA 2NT9A 1QJVA 2NSPA 2UVEA 2O0WA 3GQ8A 4MXNA 3VMVA 1O8HA 3B90A 3GRHA 3FY3A 1X0CA 1IDKA 3EQNA 4YZXA 3JURA 3GQ7A 3VSVA 4OJPA 4OJLA 4XLHA 2QX3A 4YZQA 4OJ5A 1BN8A 3B4NA 1AIRA 4MR0A 3SUCA 1JTAA 4U49A 1PE9A 3GQ9A 1BHEA 1VBLA 1RU4A 1KCCA 4XKVA 3VSUA 4YELA 4XM3A 3KRGA 1PXZA 2NTQA 2O17A 2X6WA 4XN3A 2NT6A 2NTBA 4XLCA 2INVA 4Z03A 4XOTA 5C1EA 1DBOA 2INUA 4XLEA 1IDJA 2O0VA 4NK6A 4XR6A 1RMGA 1EE6A 1JRGA 1O8MA 1OGMX 2UVFA 1O8EA 1O8IA 1O8JA 4YZAA 1H80A 4W8QA 2VBEA 4YEJA 2X3HA 4OZZA 1OOCA 4HWVA 2VBKA 2O1DA 2O04A 4OJOA 4W8RA 1O8GA 1GQ8A 1RWRA 1O8FA 4URRA 2QY1A 4XORA 3WWGA 1HG8A 3B8YA 1IB4A 2PYHA 4Z06A 4W8TA 2ODLA 2PECA 3ZSCA 2Z8GA 3GQAA 1IA5A 4XMYA 4XN0A 4XKWA 1OGOX 3VSTA 1O8DA 4U4BA 3LMWA 1O8LA 1K5CA 4XLAA 2X85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWE A;  1OFL A;  1DBG A;  4AVZ A;  5AMV A;  2NZM A;  2NTP A;  1QCX A;  2BSP A;  2IQ7 A;  3EQO A;  2NST A;  1KCD A;  4XOP A;  2X6X A;  4EW9 A;  4XL9 A;  1NHC A;  4NK8 A;  4I84 A;  4XQF A;  4PMH A;  1WMR A;  4XON A;  3ZPP A;  1OFM A;  2X6Y A;  4XNF A;  3T9G A;  1O8K A;  4XLF A;  3VMW A;  1CZF A;  1PLU A;  1O88 A;  5C1C A;  2VJI A;  4OZY A;  1XG2 A;  2QXZ A;  2PYG A;  1KTW A;  4W8S A;  4C2L A;  4YZ0 A;  3UW0 A;  2VJJ A;  4OJ6 A;  4Z05 A;  2VBM A;  2NT9 A;  1QJV A;  2NSP A;  2UVE A;  2O0W A;  3GQ8 A;  4MXN A;  3VMV A;  1O8H A;  3B90 A;  3GRH A;  3FY3 A;  1X0C A;  1IDK A;  3EQN A;  4YZX A;  3JUR A;  3GQ7 A;  3VSV A;  4OJP A;  4OJL A;  4XLH A;  2QX3 A;  4YZQ A;  4OJ5 A;  1BN8 A;  3B4N A;  1AIR A;  4MR0 A;  3SUC A;  1JTA A;  4U49 A;  1PE9 A;  3GQ9 A;  1BHE A;  1VBL A;  1RU4 A;  1KCC A;  4XKV A;  3VSU A;  4YEL A;  4XM3 A;  3KRG A;  1PXZ A;  2NTQ A;  2O17 A;  2X6W A;  4XN3 A;  2NT6 A;  2NTB A;  4XLC A;  2INV A;  4Z03 A;  4XOT A;  5C1E A;  1DBO A;  2INU A;  4XLE A;  1IDJ A;  2O0V A;  4NK6 A;  4XR6 A;  1RMG A;  1EE6 A;  1JRG A;  1O8M A;  1OGM X;  2UVF A;  1O8E A;  1O8I A;  1O8J A;  4YZA A;  1H80 A;  4W8Q A;  2VBE A;  4YEJ A;  2X3H A;  4OZZ A;  1OOC A;  4HWV A;  2VBK A;  2O1D A;  2O04 A;  4OJO A;  4W8R A;  1O8G A;  1GQ8 A;  1RWR A;  1O8F A;  4URR A;  2QY1 A;  4XOR A;  3WWG A;  1HG8 A;  3B8Y A;  1IB4 A;  2PYH A;  4Z06 A;  4W8T A;  2ODL A;  2PEC A;  3ZSC A;  2Z8G A;  3GQA A;  1IA5 A;  4XMY A;  4XN0 A;  4XKW A;  1OGO X;  3VST A;  1O8D A;  4U4B A;  3LMW A;  1O8L A;  1K5C A;  4XLA A;  2X85 A; 
#chains in the Genus database with same CATH topology
 2EWE A;  1OFL A;  1DBG A;  4OM9 A;  5AMV A;  4AVZ A;  2NZM A;  3PET A;  2BM5 A;  2NTP A;  1QCX A;  2BSP A;  2YUH A;  3BH7 B;  2IQ7 A;  3EQO A;  2NST A;  1KCD A;  4XOP A;  2X6X A;  4EW9 A;  1OFE A;  4XL9 A;  1NHC A;  4NK8 A;  4I84 A;  4XQF A;  4PMH A;  1WMR A;  4XON A;  1CLW A;  3ZPP A;  1OFM A;  3JX8 A;  2X6Y A;  3NAW A;  1TSP A;  4XNF A;  3T9G A;  1O8K A;  1TYV A;  4XLF A;  2XT2 A;  3VMW A;  1CZF A;  1PLU A;  1O88 A;  5C1C A;  2VJI A;  3N90 A;  4OZY A;  5JMC B;  1XG2 A;  2QXZ A;  2XTW A;  2VFP A;  2J8K A;  2PYG A;  2VFQ A;  1KTW A;  2IOU G;  4W8S A;  4C2L A;  2XTY A;  4YZ0 A;  3UW0 A;  2VJJ A;  2XT4 A;  4OJ6 A;  4Z05 A;  2VBM A;  2BM7 A;  2NT9 A;  1QJV A;  2NSP A;  1LLW A;  2UVE A;  2O0W A;  3GQ8 A;  4MXN A;  3VMV A;  1O8H A;  3B90 A;  2G0Y A;  2VFN A;  3GRH A;  3FY3 A;  1X0C A;  1IDK A;  3EQN A;  4YZX A;  3AK5 A;  3H09 A;  2QYU A;  3JUR A;  5JLV C;  3GQ7 A;  1HF2 A;  1EZG A;  3LJY A;  3P4G A;  1QQ1 A;  4OJP A;  4OJL A;  4XLH A;  2QX3 A;  4YZQ A;  3VSV A;  4OJ5 A;  1BN8 A;  3B4N A;  1AIR A;  3N6Z A;  4YDT A;  3ML3 A;  4MR0 A;  3SUC A;  1JTA A;  4U49 A;  1DAB A;  1PE9 A;  3GQ9 A;  3SY2 A;  1BHE A;  1VBL A;  1RU4 A;  1TYX A;  4XKV A;  1KCC A;  2VFO A;  3NB2 A;  3SZE A;  3VSU A;  4YEL A;  4XM3 A;  3KRG A;  1EA0 A;  1K8F A;  1PXZ A;  1TYU A;  2NTQ A;  4YCQ A;  2O17 A;  2X6W A;  4XN3 A;  2NT6 A;  4YFO A;  2NTB A;  1QA1 A;  2QZA A;  4XLC A;  2INV A;  4Z03 A;  4XOT A;  5C1E A;  1DBO A;  2BM4 A;  1L1I A;  2INU A;  3BH6 B;  3SYJ A;  3PSS A;  1IDJ A;  2O0V A;  4NK6 A;  4OPW A;  4KH3 A;  4XLE A;  4XR6 A;  1RMG A;  1EE6 A;  1JRG A;  4YC5 A;  1O8M A;  4JRA C;  1QRC A;  1OGM X;  2UVF A;  1O8E A;  1O8I A;  1O8J A;  3DU1 X;  1H80 A;  4W8Q A;  4YZA A;  2VFM A;  2VBE A;  4YEJ A;  2X3H A;  2BX6 A;  3LYC A;  1KQ5 A;  2BM6 A;  4OZZ A;  1OOC A;  4V02 C;  4HWV A;  2VBK A;  2O1D A;  2O04 A;  1K4Z A;  2XTX A;  4OJO A;  4W8R A;  4YEI A;  1O8G A;  3RIQ A;  1GQ8 A;  5DNS A;  1RWR A;  1O8F A;  2F3L A;  4URR A;  2QY1 A;  4XLA A;  1LLZ A;  4XOR A;  3WWG A;  1HG8 A;  2J8I A;  3B8Y A;  1IB4 A;  2B0R A;  2PYH A;  4Z06 A;  2XC1 A;  2O6W A;  1TYW A;  1QA3 A;  4W8T A;  2ODL A;  2PEC A;  1LM1 A;  3SQV A;  3ZSC A;  2W7Z A;  2Z8G A;  1QRB A;  3GQA A;  1IA5 A;  4XMY A;  4XN0 A;  4XKW A;  1OGO X;  1WXR A;  3PSZ A;  3VST A;  1O8D A;  2V5I A;  4U4B A;  3LMW A;  1O8L A;  3TH0 A;  1QA2 A;  1K5C A;  1OFD A;  2X85 A; 
#chains in the Genus database with same CATH homology
 2EWE A;  1OFL A;  1DBG A;  4AVZ A;  5AMV A;  2NZM A;  2NTP A;  1QCX A;  2BSP A;  2IQ7 A;  3EQO A;  2NST A;  1KCD A;  4XOP A;  2X6X A;  4EW9 A;  4XL9 A;  1NHC A;  4NK8 A;  4I84 A;  4XQF A;  4PMH A;  1WMR A;  4XON A;  3ZPP A;  1OFM A;  2X6Y A;  4XNF A;  3T9G A;  1O8K A;  4XLF A;  3VMW A;  1CZF A;  1PLU A;  1O88 A;  5C1C A;  2VJI A;  4OZY A;  1XG2 A;  2QXZ A;  2PYG A;  1KTW A;  4W8S A;  4C2L A;  4YZ0 A;  3UW0 A;  2VJJ A;  4OJ6 A;  4Z05 A;  2VBM A;  2NT9 A;  1QJV A;  2NSP A;  2UVE A;  2O0W A;  3GQ8 A;  4MXN A;  3VMV A;  1O8H A;  3B90 A;  3GRH A;  3FY3 A;  1X0C A;  1IDK A;  3EQN A;  4YZX A;  3JUR A;  3GQ7 A;  3VSV A;  4OJP A;  4OJL A;  4XLH A;  2QX3 A;  4YZQ A;  4OJ5 A;  1BN8 A;  3B4N A;  1AIR A;  4MR0 A;  3SUC A;  1JTA A;  4U49 A;  1PE9 A;  3GQ9 A;  1BHE A;  1VBL A;  1RU4 A;  1KCC A;  4XKV A;  3VSU A;  4YEL A;  4XM3 A;  3KRG A;  1PXZ A;  2NTQ A;  2O17 A;  2X6W A;  4XN3 A;  2NT6 A;  2NTB A;  4XLC A;  2INV A;  4Z03 A;  4XOT A;  5C1E A;  1DBO A;  2INU A;  4XLE A;  1IDJ A;  2O0V A;  4NK6 A;  4XR6 A;  1RMG A;  1EE6 A;  1JRG A;  1O8M A;  1OGM X;  2UVF A;  1O8E A;  1O8I A;  1O8J A;  4YZA A;  1H80 A;  4W8Q A;  2VBE A;  4YEJ A;  2X3H A;  4OZZ A;  1OOC A;  4HWV A;  2VBK A;  2O1D A;  2O04 A;  4OJO A;  4W8R A;  1O8G A;  1GQ8 A;  1RWR A;  1O8F A;  4URR A;  2QY1 A;  4XOR A;  3WWG A;  1HG8 A;  3B8Y A;  1IB4 A;  2PYH A;  4Z06 A;  4W8T A;  2ODL A;  2PEC A;  3ZSC A;  2Z8G A;  3GQA A;  1IA5 A;  4XMY A;  4XN0 A;  4XKW A;  1OGO X;  3VST A;  1O8D A;  4U4B A;  3LMW A;  1O8L A;  1K5C A;  4XLA A;  2X85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...