1KCCA

Endopolygalacturonase i from stereum purpureum complexed with a galacturonate at 1.00 a resolution.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOPOLYGALACTURONASE
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1kccA00
4XLAA 1OGMX 2VJJA 2O04A 1IDJA 4XLFA 4XMYA 3WWGA 1BHEA 2QX3A 1K5CA 1OOCA 1OFMA 1X0CA 4NK6A 1BN8A 4U49A 3VMVA 3B90A 3T9GA 1JRGA 2INVA 2O17A 1H80A 2X85A 4XLCA 2X6XA 1NHCA 3B8YA 2NT9A 4XOPA 2O1DA 1O8MA 1KTWA 1QJVA 2VBEA 3EQOA 4HWVA 4YELA 5C1CA 3B4NA 1O8FA 4OJPA 2VBKA 4XORA 1PLUA 3GRHA 4YZ0A 4OJ6A 3VSVA 4YZAA 4NK8A 1RU4A 4C2LA 2NTBA 3GQ7A 2INUA 4XN0A 4MXNA 3GQ9A 3GQAA 1O88A 4PMHA 4YZQA 4U4BA 4W8RA 3JURA 4MR0A 4OZYA 3GQ8A 1QCXA 1O8DA 1KCDA 4URRA 2EWEA 2QXZA 1RWRA 4Z06A 3EQNA 4OJLA 1PXZA 4XLEA 1DBOA 4XR6A 2X6WA 2VBMA 4W8QA 2QY1A 4XL9A 1IB4A 1JTAA 4XKVA 2PYHA 4YEJA 2NSTA 1KCCA 4Z05A 2Z8GA 4XONA 4I84A 1PE9A 3SUCA 3UW0A 1IA5A 2O0WA 3VSTA 1OGOX 5AMVA 3VMWA 3KRGA 1XG2A 4Z03A 5C1EA 1GQ8A 3VSUA 2NTQA 3ZPPA 4XNFA 4XM3A 1O8EA 2UVFA 1OFLA 3LMWA 2NTPA 4XKWA 4OJOA 1AIRA 1O8GA 4OZZA 1O8KA 2X3HA 3ZSCA 2UVEA 4OJ5A 4XN3A 4EW9A 1O8IA 2PECA 2PYGA 4YZXA 4XLHA 1DBGA 1CZFA 2NZMA 4W8TA 4XQFA 1O8HA 3FY3A 2BSPA 1O8JA 4AVZA 1WMRA 2IQ7A 1EE6A 1IDKA 2NSPA 2ODLA 2X6YA 4W8SA 4XOTA 2O0VA 1RMGA 2VJIA 1VBLA 1O8LA 1HG8A 2NT6A
chains in the Genus database with same CATH superfamily
4XLAA 1OGMX 2VJJA 2O04A 1IDJA 4XLFA 4XMYA 3WWGA 1LLWA 1BHEA 1TYVA 2QX3A 4JRAC 1TYUA 1K5CA 1OOCA 4EW9A 1OFMA 1X0CA 2B0RA 2YUHA 4NK6A 1EA0A 1BN8A 1QRBA 4U49A 1EZGA 3VMVA 2V5IA 3B90A 3T9GA 1LLZA 1JRGA 2INVA 4YDTA 2O17A 1H80A 2X85A 3NB2A 2X6XA 1QRCA 4XLCA 1NHCA 3B8YA 2NT9A 4XOPA 2O1DA 1O8MA 1KTWA 1QJVA 2VBEA 3EQOA 3LJYA 4HWVA 4YELA 5C1CA 3B4NA 2J8KA 1O8FA 4OJPA 2VBKA 4XORA 3JX8A 1DABA 4V02C 3SY2A 3N6ZA 1PLUA 3GRHA 2XT2A 4YZ0A 4OJ6A 3VSVA 1OFDA 3BH7B 1QQ1A 4YZAA 4NK8A 1RU4A 2O6WA 4C2LA 1QA1A 2NTBA 5JMCB 2F3LA 2VFPA 3GQ7A 2INUA 3PETA 1TYXA 2IOUG 4XN0A 4MXNA 3GQ9A 2XTXA 3GQAA 1O88A 4PMHA 4YZQA 2W7ZA 4U4BA 4W8RA 3JURA 2BM5A 2G0YA 3H09A 3PSZA 4MR0A 4OPWA 4OZYA 1OFEA 4YFOA 4YEIA 5JLVC 3GQ8A 1QCXA 1O8DA 4YCQA 4URRA 1KCDA 2EWEA 2VFOA 2QXZA 1RWRA 4Z06A 3EQNA 4OJLA 1PXZA 2QZAA 1DBOA 4XLEA 4XR6A 3SQVA 2X6WA 2VBMA 4W8QA 2QY1A 4XL9A 1IB4A 1JTAA 4XKVA 2PYHA 4YEJA 1TYWA 2NSTA 1KCCA 4Z05A 2Z8GA 4XONA 1HF2A 3TH0A 4I84A 1PE9A 3SUCA 3UW0A 1IA5A 3BH6B 2O0WA 3PSSA 2XT4A 3VSTA 1OGOX 5AMVA 3VMWA 2J8IA 3KRGA 1WXRA 1XG2A 2VFMA 4Z03A 5C1EA 3ML3A 1GQ8A 3VSUA 2NTQA 4KH3A 4XNFA 4XM3A 3ZPPA 1O8EA 3LYCA 2UVFA 1OFLA 3LMWA 2BM6A 3SZEA 2NTPA 4XKWA 2BM7A 2XC1A 1CLWA 1QA3A 4OJOA 1AIRA 1O8GA 4OZZA 1O8KA 2X3HA 1LM1A 2BX6A 1QA2A 3ZSCA 2UVEA 4OJ5A 3P4GA 4XN3A 1O8IA 2PECA 2PYGA 3NAWA 4XLHA 4YZXA 1DBGA 1CZFA 2NZMA 4W8TA 3SYJA 4XQFA 3DU1X 2XTWA 1O8HA 3FY3A 1L1IA 2BM4A 1K8FA 4YC5A 2BSPA 1O8JA 4AVZA 1WMRA 2IQ7A 1EE6A 3N90A 1IDKA 1K4ZA 2NSPA 3RIQA 5DNSA 2ODLA 2X6YA 2XTYA 2VFQA 2QYUA 4W8SA 2O0VA 4XOTA 1KQ5A 1RMGA 2VJIA 1TSPA 2VFNA 1VBLA 1O8LA 1HG8A 2NT6A 4OM9A 3AK5A
chains in the Genus database with same CATH topology
4XLAA 1OGMX 2VJJA 2O04A 1IDJA 4XLFA 4XMYA 3WWGA 1BHEA 2QX3A 1K5CA 1OOCA 1OFMA 1X0CA 4NK6A 1BN8A 4U49A 3VMVA 3B90A 3T9GA 1JRGA 2INVA 2O17A 1H80A 2X85A 4XLCA 2X6XA 1NHCA 3B8YA 2NT9A 4XOPA 2O1DA 1O8MA 1KTWA 1QJVA 2VBEA 3EQOA 4HWVA 4YELA 5C1CA 3B4NA 1O8FA 4OJPA 2VBKA 4XORA 1PLUA 3GRHA 4YZ0A 4OJ6A 3VSVA 4YZAA 4NK8A 1RU4A 4C2LA 2NTBA 3GQ7A 2INUA 4XN0A 4MXNA 3GQ9A 3GQAA 1O88A 4PMHA 4YZQA 4U4BA 4W8RA 3JURA 4MR0A 4OZYA 3GQ8A 1QCXA 1O8DA 1KCDA 4URRA 2EWEA 2QXZA 1RWRA 4Z06A 3EQNA 4OJLA 1PXZA 4XLEA 1DBOA 4XR6A 2X6WA 2VBMA 4W8QA 2QY1A 4XL9A 1IB4A 1JTAA 4XKVA 2PYHA 4YEJA 2NSTA 1KCCA 4Z05A 2Z8GA 4XONA 4I84A 1PE9A 3SUCA 3UW0A 1IA5A 2O0WA 3VSTA 1OGOX 5AMVA 3VMWA 3KRGA 1XG2A 4Z03A 5C1EA 1GQ8A 3VSUA 2NTQA 3ZPPA 4XNFA 4XM3A 1O8EA 2UVFA 1OFLA 3LMWA 2NTPA 4XKWA 4OJOA 1AIRA 1O8GA 4OZZA 1O8KA 2X3HA 3ZSCA 2UVEA 4OJ5A 4XN3A 4EW9A 1O8IA 2PECA 2PYGA 4YZXA 4XLHA 1DBGA 1CZFA 2NZMA 4W8TA 4XQFA 1O8HA 3FY3A 2BSPA 1O8JA 4AVZA 1WMRA 2IQ7A 1EE6A 1IDKA 2NSPA 2ODLA 2X6YA 4W8SA 4XOTA 2O0VA 1RMGA 2VJIA 1VBLA 1O8LA 1HG8A 2NT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLA A;  1OGM X;  2VJJ A;  2O04 A;  1IDJ A;  4XLF A;  4XMY A;  3WWG A;  1BHE A;  2QX3 A;  1K5C A;  1OOC A;  1OFM A;  1X0C A;  4NK6 A;  1BN8 A;  4U49 A;  3VMV A;  3B90 A;  3T9G A;  1JRG A;  2INV A;  2O17 A;  1H80 A;  2X85 A;  4XLC A;  2X6X A;  1NHC A;  3B8Y A;  2NT9 A;  4XOP A;  2O1D A;  1O8M A;  1KTW A;  1QJV A;  2VBE A;  3EQO A;  4HWV A;  4YEL A;  5C1C A;  3B4N A;  1O8F A;  4OJP A;  2VBK A;  4XOR A;  1PLU A;  3GRH A;  4YZ0 A;  4OJ6 A;  3VSV A;  4YZA A;  4NK8 A;  1RU4 A;  4C2L A;  2NTB A;  3GQ7 A;  2INU A;  4XN0 A;  4MXN A;  3GQ9 A;  3GQA A;  1O88 A;  4PMH A;  4YZQ A;  4U4B A;  4W8R A;  3JUR A;  4MR0 A;  4OZY A;  3GQ8 A;  1QCX A;  1O8D A;  1KCD A;  4URR A;  2EWE A;  2QXZ A;  1RWR A;  4Z06 A;  3EQN A;  4OJL A;  1PXZ A;  4XLE A;  1DBO A;  4XR6 A;  2X6W A;  2VBM A;  4W8Q A;  2QY1 A;  4XL9 A;  1IB4 A;  1JTA A;  4XKV A;  2PYH A;  4YEJ A;  2NST A;  1KCC A;  4Z05 A;  2Z8G A;  4XON A;  4I84 A;  1PE9 A;  3SUC A;  3UW0 A;  1IA5 A;  2O0W A;  3VST A;  1OGO X;  5AMV A;  3VMW A;  3KRG A;  1XG2 A;  4Z03 A;  5C1E A;  1GQ8 A;  3VSU A;  2NTQ A;  3ZPP A;  4XNF A;  4XM3 A;  1O8E A;  2UVF A;  1OFL A;  3LMW A;  2NTP A;  4XKW A;  4OJO A;  1AIR A;  1O8G A;  4OZZ A;  1O8K A;  2X3H A;  3ZSC A;  2UVE A;  4OJ5 A;  4XN3 A;  4EW9 A;  1O8I A;  2PEC A;  2PYG A;  4YZX A;  4XLH A;  1DBG A;  1CZF A;  2NZM A;  4W8T A;  4XQF A;  1O8H A;  3FY3 A;  2BSP A;  1O8J A;  4AVZ A;  1WMR A;  2IQ7 A;  1EE6 A;  1IDK A;  2NSP A;  2ODL A;  2X6Y A;  4W8S A;  4XOT A;  2O0V A;  1RMG A;  2VJI A;  1VBL A;  1O8L A;  1HG8 A;  2NT6 A; 
#chains in the Genus database with same CATH topology
 4XLA A;  1OGM X;  2VJJ A;  2O04 A;  1IDJ A;  4XLF A;  4XMY A;  3WWG A;  1LLW A;  1BHE A;  1TYV A;  2QX3 A;  4JRA C;  1TYU A;  1K5C A;  1OOC A;  4EW9 A;  1OFM A;  1X0C A;  2B0R A;  2YUH A;  4NK6 A;  1EA0 A;  1BN8 A;  1QRB A;  4U49 A;  1EZG A;  3VMV A;  2V5I A;  3B90 A;  3T9G A;  1LLZ A;  1JRG A;  2INV A;  4YDT A;  2O17 A;  1H80 A;  2X85 A;  3NB2 A;  2X6X A;  1QRC A;  4XLC A;  1NHC A;  3B8Y A;  2NT9 A;  4XOP A;  2O1D A;  1O8M A;  1KTW A;  1QJV A;  2VBE A;  3EQO A;  3LJY A;  4HWV A;  4YEL A;  5C1C A;  3B4N A;  2J8K A;  1O8F A;  4OJP A;  2VBK A;  4XOR A;  3JX8 A;  1DAB A;  4V02 C;  3SY2 A;  3N6Z A;  1PLU A;  3GRH A;  2XT2 A;  4YZ0 A;  4OJ6 A;  3VSV A;  1OFD A;  3BH7 B;  1QQ1 A;  4YZA A;  4NK8 A;  1RU4 A;  2O6W A;  4C2L A;  1QA1 A;  2NTB A;  5JMC B;  2F3L A;  2VFP A;  3GQ7 A;  2INU A;  3PET A;  1TYX A;  2IOU G;  4XN0 A;  4MXN A;  3GQ9 A;  2XTX A;  3GQA A;  1O88 A;  4PMH A;  4YZQ A;  2W7Z A;  4U4B A;  4W8R A;  3JUR A;  2BM5 A;  2G0Y A;  3H09 A;  3PSZ A;  4MR0 A;  4OPW A;  4OZY A;  1OFE A;  4YFO A;  4YEI A;  5JLV C;  3GQ8 A;  1QCX A;  1O8D A;  4YCQ A;  4URR A;  1KCD A;  2EWE A;  2VFO A;  2QXZ A;  1RWR A;  4Z06 A;  3EQN A;  4OJL A;  1PXZ A;  2QZA A;  1DBO A;  4XLE A;  4XR6 A;  3SQV A;  2X6W A;  2VBM A;  4W8Q A;  2QY1 A;  4XL9 A;  1IB4 A;  1JTA A;  4XKV A;  2PYH A;  4YEJ A;  1TYW A;  2NST A;  1KCC A;  4Z05 A;  2Z8G A;  4XON A;  1HF2 A;  3TH0 A;  4I84 A;  1PE9 A;  3SUC A;  3UW0 A;  1IA5 A;  3BH6 B;  2O0W A;  3PSS A;  2XT4 A;  3VST A;  1OGO X;  5AMV A;  3VMW A;  2J8I A;  3KRG A;  1WXR A;  1XG2 A;  2VFM A;  4Z03 A;  5C1E A;  3ML3 A;  1GQ8 A;  3VSU A;  2NTQ A;  4KH3 A;  4XNF A;  4XM3 A;  3ZPP A;  1O8E A;  3LYC A;  2UVF A;  1OFL A;  3LMW A;  2BM6 A;  3SZE A;  2NTP A;  4XKW A;  2BM7 A;  2XC1 A;  1CLW A;  1QA3 A;  4OJO A;  1AIR A;  1O8G A;  4OZZ A;  1O8K A;  2X3H A;  1LM1 A;  2BX6 A;  1QA2 A;  3ZSC A;  2UVE A;  4OJ5 A;  3P4G A;  4XN3 A;  1O8I A;  2PEC A;  2PYG A;  3NAW A;  4XLH A;  4YZX A;  1DBG A;  1CZF A;  2NZM A;  4W8T A;  3SYJ A;  4XQF A;  3DU1 X;  2XTW A;  1O8H A;  3FY3 A;  1L1I A;  2BM4 A;  1K8F A;  4YC5 A;  2BSP A;  1O8J A;  4AVZ A;  1WMR A;  2IQ7 A;  1EE6 A;  3N90 A;  1IDK A;  1K4Z A;  2NSP A;  3RIQ A;  5DNS A;  2ODL A;  2X6Y A;  2XTY A;  2VFQ A;  2QYU A;  4W8S A;  2O0V A;  4XOT A;  1KQ5 A;  1RMG A;  2VJI A;  1TSP A;  2VFN A;  1VBL A;  1O8L A;  1HG8 A;  2NT6 A;  4OM9 A;  3AK5 A; 
#chains in the Genus database with same CATH homology
 4XLA A;  1OGM X;  2VJJ A;  2O04 A;  1IDJ A;  4XLF A;  4XMY A;  3WWG A;  1BHE A;  2QX3 A;  1K5C A;  1OOC A;  1OFM A;  1X0C A;  4NK6 A;  1BN8 A;  4U49 A;  3VMV A;  3B90 A;  3T9G A;  1JRG A;  2INV A;  2O17 A;  1H80 A;  2X85 A;  4XLC A;  2X6X A;  1NHC A;  3B8Y A;  2NT9 A;  4XOP A;  2O1D A;  1O8M A;  1KTW A;  1QJV A;  2VBE A;  3EQO A;  4HWV A;  4YEL A;  5C1C A;  3B4N A;  1O8F A;  4OJP A;  2VBK A;  4XOR A;  1PLU A;  3GRH A;  4YZ0 A;  4OJ6 A;  3VSV A;  4YZA A;  4NK8 A;  1RU4 A;  4C2L A;  2NTB A;  3GQ7 A;  2INU A;  4XN0 A;  4MXN A;  3GQ9 A;  3GQA A;  1O88 A;  4PMH A;  4YZQ A;  4U4B A;  4W8R A;  3JUR A;  4MR0 A;  4OZY A;  3GQ8 A;  1QCX A;  1O8D A;  1KCD A;  4URR A;  2EWE A;  2QXZ A;  1RWR A;  4Z06 A;  3EQN A;  4OJL A;  1PXZ A;  4XLE A;  1DBO A;  4XR6 A;  2X6W A;  2VBM A;  4W8Q A;  2QY1 A;  4XL9 A;  1IB4 A;  1JTA A;  4XKV A;  2PYH A;  4YEJ A;  2NST A;  1KCC A;  4Z05 A;  2Z8G A;  4XON A;  4I84 A;  1PE9 A;  3SUC A;  3UW0 A;  1IA5 A;  2O0W A;  3VST A;  1OGO X;  5AMV A;  3VMW A;  3KRG A;  1XG2 A;  4Z03 A;  5C1E A;  1GQ8 A;  3VSU A;  2NTQ A;  3ZPP A;  4XNF A;  4XM3 A;  1O8E A;  2UVF A;  1OFL A;  3LMW A;  2NTP A;  4XKW A;  4OJO A;  1AIR A;  1O8G A;  4OZZ A;  1O8K A;  2X3H A;  3ZSC A;  2UVE A;  4OJ5 A;  4XN3 A;  4EW9 A;  1O8I A;  2PEC A;  2PYG A;  4YZX A;  4XLH A;  1DBG A;  1CZF A;  2NZM A;  4W8T A;  4XQF A;  1O8H A;  3FY3 A;  2BSP A;  1O8J A;  4AVZ A;  1WMR A;  2IQ7 A;  1EE6 A;  1IDK A;  2NSP A;  2ODL A;  2X6Y A;  4W8S A;  4XOT A;  2O0V A;  1RMG A;  2VJI A;  1VBL A;  1O8L A;  1HG8 A;  2NT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...