1KCCA

Endopolygalacturonase i from stereum purpureum complexed with a galacturonate at 1.00 a resolution.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ENDOPOLYGALACTURONASE
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1kccA00
4I84A 4W8SA 4AVZA 1GQ8A 1O8FA 4HWVA 1AIRA 3EQNA 4OZYA 4XOPA 1PLUA 1QCXA 4MR0A 1H80A 4XKWA 3VSVA 3VSUA 4MXNA 1XG2A 4Z05A 4NK8A 2X85A 1DBGA 2O1DA 4YZQA 1KCDA 1O8JA 2IQ7A 1OOCA 5C1CA 4XORA 1KCCA 1VBLA 4YELA 2X6WA 4W8RA 4XLAA 1O88A 2O17A 2NSPA 4Z03A 3VMVA 3VMWA 2O0WA 3B4NA 2O04A 2NTQA 2PECA 3B8YA 1OFMA 3FY3A 4W8QA 4OJ6A 1O8LA 1IDKA 4YZ0A 3VSTA 1HG8A 1X0CA 1RMGA 1O8IA 4XNFA 3JURA 4C2LA 2NTPA 2VBEA 3UW0A 2INVA 2QY1A 5AMVA 1RWRA 4XQFA 2UVEA 1OGOX 3T9GA 2O0VA 1K5CA 2NZMA 1PE9A 3WWGA 1O8MA 2NSTA 4XOTA 1NHCA 5C1EA 3ZPPA 2VJJA 2X6XA 3GQ9A 4XL9A 2QX3A 1JRGA 3B90A 3ZSCA 1O8GA 1OFLA 2X3HA 3LMWA 2PYHA 4OJOA 1IA5A 4XLFA 2ODLA 1PXZA 1O8DA 1JTAA 4XKVA 2NT6A 4NK6A 2PYGA 2Z8GA 2QXZA 2UVFA 4XONA 3GQ8A 4OJ5A 2X6YA 1BN8A 1RU4A 2VBMA 4XR6A 4U4BA 4OJLA 4XLHA 4YEJA 1CZFA 4U49A 2EWEA 2INUA 2VBKA 4XN0A 1O8HA 3SUCA 4W8TA 4XLCA 1BHEA 4EW9A 1O8KA 4XN3A 3GQAA 4URRA 4XM3A 2BSPA 4XMYA 1WMRA 4YZXA 4OJPA 2NTBA 4OZZA 1QJVA 3GQ7A 3EQOA 1IB4A 1EE6A 4Z06A 3GRHA 1IDJA 2VJIA 1KTWA 1DBOA 1O8EA 1OGMX 4YZAA 4PMHA 3KRGA 4XLEA 2NT9A
chains in the Genus database with same CATH superfamily
4I84A 2XT2A 4W8SA 4AVZA 1GQ8A 1O8FA 2BM6A 3N6ZA 3NAWA 1AIRA 2BM7A 3EQNA 2XT4A 4HWVA 5JMCB 4OZYA 4XOPA 1PLUA 1QCXA 4MR0A 1H80A 4XKWA 3VSVA 3VSUA 4MXNA 1XG2A 4Z05A 4NK8A 1EZGA 2X85A 1DBGA 2IOUG 2O1DA 4YZQA 1QA3A 1KCDA 1O8JA 2IQ7A 2VFNA 1OOCA 5C1CA 4XORA 4OPWA 2J8IA 1KCCA 1VBLA 1QA1A 1OFEA 4YELA 2X6WA 1DABA 4W8RA 4XLAA 1O88A 2O17A 2VFMA 2NSPA 3PETA 4Z03A 3VMVA 3VMWA 2O0WA 3B4NA 2O04A 2NTQA 2PECA 3B8YA 4YDTA 1OFMA 2W7ZA 3FY3A 4W8QA 4OJ6A 1O8LA 1IDKA 2G0YA 1EA0A 4YZ0A 3VSTA 1TYVA 1HG8A 1X0CA 1TYXA 3LYCA 3BH7B 1RMGA 1O8IA 4XNFA 3DU1X 1HF2A 3LJYA 3P4GA 1OFDA 3JURA 1LM1A 4JRAC 4C2LA 2QZAA 3SY2A 1TSPA 1QA2A 1TYUA 4KH3A 3RIQA 2NTPA 3H09A 1L1IA 2VBEA 3UW0A 2INVA 2QY1A 5DNSA 5AMVA 1RWRA 4XQFA 1QRBA 2B0RA 1OGOX 2UVEA 2O0VA 3T9GA 1K5CA 2XTWA 1PE9A 2NZMA 3WWGA 1LLZA 3SYJA 1O8MA 2NSTA 2VFPA 4XOTA 1NHCA 5C1EA 3ZPPA 2VJJA 2X6XA 3GQ9A 4XL9A 2QX3A 1JRGA 3B90A 3ZSCA 1O8GA 1OFLA 2X3HA 3LMWA 2PYHA 4OJOA 3SZEA 1IA5A 2O6WA 4XLFA 2ODLA 1PXZA 1O8DA 1JTAA 4XKVA 2VFQA 2NT6A 4NK6A 2PYGA 2Z8GA 3PSSA 2F3LA 2QXZA 2UVFA 3TH0A 4XONA 4YCQA 3AK5A 2XTXA 3GQ8A 4OJ5A 2X6YA 1BN8A 1RU4A 2VBMA 4XR6A 4U4BA 2J8KA 4OJLA 4XLHA 4YEJA 1CZFA 4U49A 2EWEA 2INUA 2VFOA 2BX6A 4YFOA 2VBKA 4XN0A 1O8HA 3SUCA 1QQ1A 3ML3A 2XC1A 4W8TA 2XTYA 4XLCA 5JLVC 2QYUA 2BM5A 1BHEA 4EW9A 2BM4A 1O8KA 1QRCA 1LLWA 3GQAA 4URRA 4XN3A 2BSPA 4XM3A 3PSZA 3NB2A 1K4ZA 4V02C 4XMYA 1WMRA 4YZXA 4OJPA 2NTBA 4OZZA 1QJVA 3GQ7A 1TYWA 1CLWA 3EQOA 1IB4A 1EE6A 2YUHA 4Z06A 1K8FA 3GRHA 4YC5A 4YEIA 1IDJA 2VJIA 3JX8A 1KQ5A 3BH6B 4OM9A 3SQVA 2V5IA 1WXRA 1KTWA 1DBOA 1O8EA 1OGMX 4YZAA 4PMHA 3KRGA 3N90A 4XLEA 2NT9A
chains in the Genus database with same CATH topology
4I84A 4W8SA 4AVZA 1GQ8A 1O8FA 4HWVA 1AIRA 3EQNA 4OZYA 4XOPA 1PLUA 1QCXA 4MR0A 1H80A 4XKWA 3VSVA 3VSUA 4MXNA 1XG2A 4Z05A 4NK8A 2X85A 1DBGA 2O1DA 4YZQA 1KCDA 1O8JA 2IQ7A 1OOCA 5C1CA 4XORA 1KCCA 1VBLA 4YELA 2X6WA 4W8RA 4XLAA 1O88A 2O17A 2NSPA 4Z03A 3VMVA 3VMWA 2O0WA 3B4NA 2O04A 2NTQA 2PECA 3B8YA 1OFMA 3FY3A 4W8QA 4OJ6A 1O8LA 1IDKA 4YZ0A 3VSTA 1HG8A 1X0CA 1RMGA 1O8IA 4XNFA 3JURA 4C2LA 2NTPA 2VBEA 3UW0A 2INVA 2QY1A 5AMVA 1RWRA 4XQFA 2UVEA 1OGOX 3T9GA 2O0VA 1K5CA 2NZMA 1PE9A 3WWGA 1O8MA 2NSTA 4XOTA 1NHCA 5C1EA 3ZPPA 2VJJA 2X6XA 3GQ9A 4XL9A 2QX3A 1JRGA 3B90A 3ZSCA 1O8GA 1OFLA 2X3HA 3LMWA 2PYHA 4OJOA 1IA5A 4XLFA 2ODLA 1PXZA 1O8DA 1JTAA 4XKVA 2NT6A 4NK6A 2PYGA 2Z8GA 2QXZA 2UVFA 4XONA 3GQ8A 4OJ5A 2X6YA 1BN8A 1RU4A 2VBMA 4XR6A 4U4BA 4OJLA 4XLHA 4YEJA 1CZFA 4U49A 2EWEA 2INUA 2VBKA 4XN0A 1O8HA 3SUCA 4W8TA 4XLCA 1BHEA 4EW9A 1O8KA 4XN3A 3GQAA 4URRA 4XM3A 2BSPA 4XMYA 1WMRA 4YZXA 4OJPA 2NTBA 4OZZA 1QJVA 3GQ7A 3EQOA 1IB4A 1EE6A 4Z06A 3GRHA 1IDJA 2VJIA 1KTWA 1DBOA 1O8EA 1OGMX 4YZAA 4PMHA 3KRGA 4XLEA 2NT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I84 A;  4W8S A;  4AVZ A;  1GQ8 A;  1O8F A;  4HWV A;  1AIR A;  3EQN A;  4OZY A;  4XOP A;  1PLU A;  1QCX A;  4MR0 A;  1H80 A;  4XKW A;  3VSV A;  3VSU A;  4MXN A;  1XG2 A;  4Z05 A;  4NK8 A;  2X85 A;  1DBG A;  2O1D A;  4YZQ A;  1KCD A;  1O8J A;  2IQ7 A;  1OOC A;  5C1C A;  4XOR A;  1KCC A;  1VBL A;  4YEL A;  2X6W A;  4W8R A;  4XLA A;  1O88 A;  2O17 A;  2NSP A;  4Z03 A;  3VMV A;  3VMW A;  2O0W A;  3B4N A;  2O04 A;  2NTQ A;  2PEC A;  3B8Y A;  1OFM A;  3FY3 A;  4W8Q A;  4OJ6 A;  1O8L A;  1IDK A;  4YZ0 A;  3VST A;  1HG8 A;  1X0C A;  1RMG A;  1O8I A;  4XNF A;  3JUR A;  4C2L A;  2NTP A;  2VBE A;  3UW0 A;  2INV A;  2QY1 A;  5AMV A;  1RWR A;  4XQF A;  2UVE A;  1OGO X;  3T9G A;  2O0V A;  1K5C A;  2NZM A;  1PE9 A;  3WWG A;  1O8M A;  2NST A;  4XOT A;  1NHC A;  5C1E A;  3ZPP A;  2VJJ A;  2X6X A;  3GQ9 A;  4XL9 A;  2QX3 A;  1JRG A;  3B90 A;  3ZSC A;  1O8G A;  1OFL A;  2X3H A;  3LMW A;  2PYH A;  4OJO A;  1IA5 A;  4XLF A;  2ODL A;  1PXZ A;  1O8D A;  1JTA A;  4XKV A;  2NT6 A;  4NK6 A;  2PYG A;  2Z8G A;  2QXZ A;  2UVF A;  4XON A;  3GQ8 A;  4OJ5 A;  2X6Y A;  1BN8 A;  1RU4 A;  2VBM A;  4XR6 A;  4U4B A;  4OJL A;  4XLH A;  4YEJ A;  1CZF A;  4U49 A;  2EWE A;  2INU A;  2VBK A;  4XN0 A;  1O8H A;  3SUC A;  4W8T A;  4XLC A;  1BHE A;  4EW9 A;  1O8K A;  4XN3 A;  3GQA A;  4URR A;  4XM3 A;  2BSP A;  4XMY A;  1WMR A;  4YZX A;  4OJP A;  2NTB A;  4OZZ A;  1QJV A;  3GQ7 A;  3EQO A;  1IB4 A;  1EE6 A;  4Z06 A;  3GRH A;  1IDJ A;  2VJI A;  1KTW A;  1DBO A;  1O8E A;  1OGM X;  4YZA A;  4PMH A;  3KRG A;  4XLE A;  2NT9 A; 
#chains in the Genus database with same CATH topology
 4I84 A;  2XT2 A;  4W8S A;  4AVZ A;  1GQ8 A;  1O8F A;  2BM6 A;  3N6Z A;  3NAW A;  1AIR A;  2BM7 A;  3EQN A;  2XT4 A;  4HWV A;  5JMC B;  4OZY A;  4XOP A;  1PLU A;  1QCX A;  4MR0 A;  1H80 A;  4XKW A;  3VSV A;  3VSU A;  4MXN A;  1XG2 A;  4Z05 A;  4NK8 A;  1EZG A;  2X85 A;  1DBG A;  2IOU G;  2O1D A;  4YZQ A;  1QA3 A;  1KCD A;  1O8J A;  2IQ7 A;  2VFN A;  1OOC A;  5C1C A;  4XOR A;  4OPW A;  2J8I A;  1KCC A;  1VBL A;  1QA1 A;  1OFE A;  4YEL A;  2X6W A;  1DAB A;  4W8R A;  4XLA A;  1O88 A;  2O17 A;  2VFM A;  2NSP A;  3PET A;  4Z03 A;  3VMV A;  3VMW A;  2O0W A;  3B4N A;  2O04 A;  2NTQ A;  2PEC A;  3B8Y A;  4YDT A;  1OFM A;  2W7Z A;  3FY3 A;  4W8Q A;  4OJ6 A;  1O8L A;  1IDK A;  2G0Y A;  1EA0 A;  4YZ0 A;  3VST A;  1TYV A;  1HG8 A;  1X0C A;  1TYX A;  3LYC A;  3BH7 B;  1RMG A;  1O8I A;  4XNF A;  3DU1 X;  1HF2 A;  3LJY A;  3P4G A;  1OFD A;  3JUR A;  1LM1 A;  4JRA C;  4C2L A;  2QZA A;  3SY2 A;  1TSP A;  1QA2 A;  1TYU A;  4KH3 A;  3RIQ A;  2NTP A;  3H09 A;  1L1I A;  2VBE A;  3UW0 A;  2INV A;  2QY1 A;  5DNS A;  5AMV A;  1RWR A;  4XQF A;  1QRB A;  2B0R A;  1OGO X;  2UVE A;  2O0V A;  3T9G A;  1K5C A;  2XTW A;  1PE9 A;  2NZM A;  3WWG A;  1LLZ A;  3SYJ A;  1O8M A;  2NST A;  2VFP A;  4XOT A;  1NHC A;  5C1E A;  3ZPP A;  2VJJ A;  2X6X A;  3GQ9 A;  4XL9 A;  2QX3 A;  1JRG A;  3B90 A;  3ZSC A;  1O8G A;  1OFL A;  2X3H A;  3LMW A;  2PYH A;  4OJO A;  3SZE A;  1IA5 A;  2O6W A;  4XLF A;  2ODL A;  1PXZ A;  1O8D A;  1JTA A;  4XKV A;  2VFQ A;  2NT6 A;  4NK6 A;  2PYG A;  2Z8G A;  3PSS A;  2F3L A;  2QXZ A;  2UVF A;  3TH0 A;  4XON A;  4YCQ A;  3AK5 A;  2XTX A;  3GQ8 A;  4OJ5 A;  2X6Y A;  1BN8 A;  1RU4 A;  2VBM A;  4XR6 A;  4U4B A;  2J8K A;  4OJL A;  4XLH A;  4YEJ A;  1CZF A;  4U49 A;  2EWE A;  2INU A;  2VFO A;  2BX6 A;  4YFO A;  2VBK A;  4XN0 A;  1O8H A;  3SUC A;  1QQ1 A;  3ML3 A;  2XC1 A;  4W8T A;  2XTY A;  4XLC A;  5JLV C;  2QYU A;  2BM5 A;  1BHE A;  4EW9 A;  2BM4 A;  1O8K A;  1QRC A;  1LLW A;  3GQA A;  4URR A;  4XN3 A;  2BSP A;  4XM3 A;  3PSZ A;  3NB2 A;  1K4Z A;  4V02 C;  4XMY A;  1WMR A;  4YZX A;  4OJP A;  2NTB A;  4OZZ A;  1QJV A;  3GQ7 A;  1TYW A;  1CLW A;  3EQO A;  1IB4 A;  1EE6 A;  2YUH A;  4Z06 A;  1K8F A;  3GRH A;  4YC5 A;  4YEI A;  1IDJ A;  2VJI A;  3JX8 A;  1KQ5 A;  3BH6 B;  4OM9 A;  3SQV A;  2V5I A;  1WXR A;  1KTW A;  1DBO A;  1O8E A;  1OGM X;  4YZA A;  4PMH A;  3KRG A;  3N90 A;  4XLE A;  2NT9 A; 
#chains in the Genus database with same CATH homology
 4I84 A;  4W8S A;  4AVZ A;  1GQ8 A;  1O8F A;  4HWV A;  1AIR A;  3EQN A;  4OZY A;  4XOP A;  1PLU A;  1QCX A;  4MR0 A;  1H80 A;  4XKW A;  3VSV A;  3VSU A;  4MXN A;  1XG2 A;  4Z05 A;  4NK8 A;  2X85 A;  1DBG A;  2O1D A;  4YZQ A;  1KCD A;  1O8J A;  2IQ7 A;  1OOC A;  5C1C A;  4XOR A;  1KCC A;  1VBL A;  4YEL A;  2X6W A;  4W8R A;  4XLA A;  1O88 A;  2O17 A;  2NSP A;  4Z03 A;  3VMV A;  3VMW A;  2O0W A;  3B4N A;  2O04 A;  2NTQ A;  2PEC A;  3B8Y A;  1OFM A;  3FY3 A;  4W8Q A;  4OJ6 A;  1O8L A;  1IDK A;  4YZ0 A;  3VST A;  1HG8 A;  1X0C A;  1RMG A;  1O8I A;  4XNF A;  3JUR A;  4C2L A;  2NTP A;  2VBE A;  3UW0 A;  2INV A;  2QY1 A;  5AMV A;  1RWR A;  4XQF A;  2UVE A;  1OGO X;  3T9G A;  2O0V A;  1K5C A;  2NZM A;  1PE9 A;  3WWG A;  1O8M A;  2NST A;  4XOT A;  1NHC A;  5C1E A;  3ZPP A;  2VJJ A;  2X6X A;  3GQ9 A;  4XL9 A;  2QX3 A;  1JRG A;  3B90 A;  3ZSC A;  1O8G A;  1OFL A;  2X3H A;  3LMW A;  2PYH A;  4OJO A;  1IA5 A;  4XLF A;  2ODL A;  1PXZ A;  1O8D A;  1JTA A;  4XKV A;  2NT6 A;  4NK6 A;  2PYG A;  2Z8G A;  2QXZ A;  2UVF A;  4XON A;  3GQ8 A;  4OJ5 A;  2X6Y A;  1BN8 A;  1RU4 A;  2VBM A;  4XR6 A;  4U4B A;  4OJL A;  4XLH A;  4YEJ A;  1CZF A;  4U49 A;  2EWE A;  2INU A;  2VBK A;  4XN0 A;  1O8H A;  3SUC A;  4W8T A;  4XLC A;  1BHE A;  4EW9 A;  1O8K A;  4XN3 A;  3GQA A;  4URR A;  4XM3 A;  2BSP A;  4XMY A;  1WMR A;  4YZX A;  4OJP A;  2NTB A;  4OZZ A;  1QJV A;  3GQ7 A;  3EQO A;  1IB4 A;  1EE6 A;  4Z06 A;  3GRH A;  1IDJ A;  2VJI A;  1KTW A;  1DBO A;  1O8E A;  1OGM X;  4YZA A;  4PMH A;  3KRG A;  4XLE A;  2NT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...