3FY3A

Crystal structure of truncated hemolysin a from p. mirabilis
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQQEVFGIAAEYVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of truncated hemolysin A from Proteus mirabilis.
pubmed doi rcsb
source organism Proteus mirabilis
molecule tags Toxin
molecule keywords Hemolysin
total genus 77
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3fy3A00
4PMHA 4XLAA 1DBOA 3VMWA 4NK8A 1H80A 2X6YA 2O17A 2NT9A 3B8YA 4YELA 4OZZA 4U49A 4W8QA 3KRGA 2X85A 2VBMA 2PYHA 4XR6A 1IDKA 2QX3A 4W8RA 4XOTA 1IA5A 1PLUA 4XL9A 1GQ8A 4URRA 3B90A 1EE6A 4OJ5A 4EW9A 2NT6A 1JRGA 1OGMX 4YZXA 1K5CA 4AVZA 2PECA 2O04A 5C1CA 4XM3A 4XKVA 2QXZA 2INVA 4XMYA 1DBGA 2VBKA 1NHCA 2O0VA 4OJLA 2INUA 1O88A 4OJPA 2NZMA 2VJIA 3GQ7A 1O8IA 2NSTA 2BSPA 3VSTA 2UVFA 2VBEA 2NTBA 4YEJA 3GQ9A 1O8KA 3EQNA 1OGOX 1OFLA 4XN3A 3VSVA 4W8SA 1IDJA 1IB4A 4YZQA 1PE9A 4W8TA 2X6WA 1WMRA 4MXNA 4YZAA 3GRHA 4XN0A 4XOPA 4XLCA 4OZYA 1KTWA 2NTPA 1OOCA 3GQ8A 4U4BA 2EWEA 1BHEA 1O8EA 4XLEA 3SUCA 4Z06A 1O8MA 1QJVA 1XG2A 2UVEA 3T9GA 3WWGA 3GQAA 1O8GA 2QY1A 4XONA 4Z03A 4XLHA 4NK6A 1O8JA 1VBLA 4YZ0A 4OJ6A 4HWVA 1RWRA 4MR0A 2O0WA 1RMGA 1O8DA 1RU4A 1HG8A 4I84A 4OJOA 4XLFA 4XNFA 1JTAA 4XORA 5C1EA 2VJJA 1CZFA 2Z8GA 1O8FA 3VMVA 4XKWA 1KCCA 3JURA 3LMWA 1X0CA 3VSUA 5AMVA 3UW0A 2PYGA 2X6XA 2ODLA 1O8LA 3ZSCA 3ZPPA 1O8HA 1QCXA 3EQOA 1OFMA 2NSPA 4Z05A 2X3HA 3FY3A 1BN8A 2NTQA 2O1DA 4C2LA 3B4NA 1AIRA 1PXZA 1KCDA 2IQ7A 4XQFA
chains in the Genus database with same CATH superfamily
4PMHA 4KH3A 4XLAA 1DBOA 3BH7B 2VFPA 3VMWA 4NK8A 1H80A 2X6YA 4YC5A 2O17A 2NT9A 3B8YA 1HF2A 4YELA 4OZZA 2IOUG 4U49A 4W8QA 1TYXA 2YUHA 2X85A 3KRGA 2VBMA 2PYHA 4V02C 4XR6A 2XTYA 4YCQA 1IDKA 4OM9A 3TH0A 2QX3A 4W8RA 4XOTA 1IA5A 1CLWA 1PLUA 1QRCA 4XL9A 3RIQA 1GQ8A 2VFOA 4URRA 3B90A 1EE6A 3PSSA 4OJ5A 1QQ1A 4EW9A 2XT4A 3N90A 2NT6A 3LYCA 1JRGA 1OGMX 4YZXA 1LLWA 1K5CA 4AVZA 2PECA 1OFDA 4YFOA 2O04A 3N6ZA 1LM1A 5C1CA 1EA0A 2VFQA 4XKVA 4XM3A 2QXZA 1TYVA 2INVA 4XMYA 3DU1X 2XTWA 1DBGA 3BH6B 2VBKA 1NHCA 2O0VA 4OJLA 2INUA 1O88A 2XTXA 2NZMA 4OJPA 2VJIA 4YEIA 2V5IA 1O8IA 3GQ7A 2NSTA 2XC1A 2BSPA 3PETA 4OJOA 3VSTA 2UVFA 2VBEA 2NTBA 4YEJA 3GQ9A 1WXRA 1O8KA 3EQNA 1OGOX 1OFLA 4XN3A 3VSVA 4W8SA 1IDJA 1IB4A 4YZQA 4OPWA 5JMCB 1PE9A 4W8TA 2X6WA 3P4GA 1WMRA 5DNSA 2BM4A 4MXNA 1KCDA 1QA2A 4YZAA 3GRHA 2QYUA 4XN0A 4XOPA 4XLCA 1K4ZA 1KQ5A 2G0YA 3SY2A 1TYWA 4OZYA 1KTWA 2F3LA 2NTPA 2BX6A 2J8KA 2BM7A 1OOCA 3GQ8A 4U4BA 2EWEA 3SYJA 1BHEA 1O8EA 4XLEA 3SUCA 4Z06A 3SQVA 3NB2A 1L1IA 1QRBA 2QZAA 3AK5A 1O8MA 1QJVA 1XG2A 2UVEA 3T9GA 3WWGA 1LLZA 3GQAA 2XT2A 1K8FA 1O8GA 2QY1A 4XONA 4Z03A 4XLHA 2W7ZA 1O8JA 4NK6A 1VBLA 4YZ0A 4OJ6A 5JLVC 4HWVA 1RWRA 4MR0A 2O0WA 1RMGA 1O8DA 1RU4A 1HG8A 3H09A 4I84A 1OFEA 2B0RA 3PSZA 4XLFA 4XNFA 1JTAA 4XORA 3LJYA 5C1EA 2VJJA 1CZFA 1TSPA 2Z8GA 1O8FA 3VMVA 4XKWA 2O6WA 2J8IA 1KCCA 3JURA 3ML3A 3LMWA 1X0CA 3VSUA 1DABA 2VFMA 5AMVA 3UW0A 1EZGA 1QA1A 1QA3A 3JX8A 4JRAC 2PYGA 2X6XA 2ODLA 1O8LA 3NAWA 4YDTA 3ZSCA 3ZPPA 1TYUA 1O8HA 1QCXA 3EQOA 1OFMA 2NSPA 4Z05A 2BM5A 2X3HA 3FY3A 3SZEA 1BN8A 2NTQA 2BM6A 2O1DA 4C2LA 3B4NA 1AIRA 1PXZA 2VFNA 2IQ7A 4XQFA
chains in the Genus database with same CATH topology
4PMHA 4XLAA 1DBOA 3VMWA 4NK8A 1H80A 2X6YA 2O17A 2NT9A 3B8YA 4YELA 4OZZA 4U49A 4W8QA 3KRGA 2X85A 2VBMA 2PYHA 4XR6A 1IDKA 2QX3A 4W8RA 4XOTA 1IA5A 1PLUA 4XL9A 1GQ8A 4URRA 3B90A 1EE6A 4OJ5A 4EW9A 2NT6A 1JRGA 1OGMX 4YZXA 1K5CA 4AVZA 2PECA 2O04A 5C1CA 4XM3A 4XKVA 2QXZA 2INVA 4XMYA 1DBGA 2VBKA 1NHCA 2O0VA 4OJLA 2INUA 1O88A 4OJPA 2NZMA 2VJIA 3GQ7A 1O8IA 2NSTA 2BSPA 3VSTA 2UVFA 2VBEA 2NTBA 4YEJA 3GQ9A 1O8KA 3EQNA 1OGOX 1OFLA 4XN3A 3VSVA 4W8SA 1IDJA 1IB4A 4YZQA 1PE9A 4W8TA 2X6WA 1WMRA 4MXNA 4YZAA 3GRHA 4XN0A 4XOPA 4XLCA 4OZYA 1KTWA 2NTPA 1OOCA 3GQ8A 4U4BA 2EWEA 1BHEA 1O8EA 4XLEA 3SUCA 4Z06A 1O8MA 1QJVA 1XG2A 2UVEA 3T9GA 3WWGA 3GQAA 1O8GA 2QY1A 4XONA 4Z03A 4XLHA 4NK6A 1O8JA 1VBLA 4YZ0A 4OJ6A 4HWVA 1RWRA 4MR0A 2O0WA 1RMGA 1O8DA 1RU4A 1HG8A 4I84A 4OJOA 4XLFA 4XNFA 1JTAA 4XORA 5C1EA 2VJJA 1CZFA 2Z8GA 1O8FA 3VMVA 4XKWA 1KCCA 3JURA 3LMWA 1X0CA 3VSUA 5AMVA 3UW0A 2PYGA 2X6XA 2ODLA 1O8LA 3ZSCA 3ZPPA 1O8HA 1QCXA 3EQOA 1OFMA 2NSPA 4Z05A 2X3HA 3FY3A 1BN8A 2NTQA 2O1DA 4C2LA 3B4NA 1AIRA 1PXZA 1KCDA 2IQ7A 4XQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMH A;  4XLA A;  1DBO A;  3VMW A;  4NK8 A;  1H80 A;  2X6Y A;  2O17 A;  2NT9 A;  3B8Y A;  4YEL A;  4OZZ A;  4U49 A;  4W8Q A;  3KRG A;  2X85 A;  2VBM A;  2PYH A;  4XR6 A;  1IDK A;  2QX3 A;  4W8R A;  4XOT A;  1IA5 A;  1PLU A;  4XL9 A;  1GQ8 A;  4URR A;  3B90 A;  1EE6 A;  4OJ5 A;  4EW9 A;  2NT6 A;  1JRG A;  1OGM X;  4YZX A;  1K5C A;  4AVZ A;  2PEC A;  2O04 A;  5C1C A;  4XM3 A;  4XKV A;  2QXZ A;  2INV A;  4XMY A;  1DBG A;  2VBK A;  1NHC A;  2O0V A;  4OJL A;  2INU A;  1O88 A;  4OJP A;  2NZM A;  2VJI A;  3GQ7 A;  1O8I A;  2NST A;  2BSP A;  3VST A;  2UVF A;  2VBE A;  2NTB A;  4YEJ A;  3GQ9 A;  1O8K A;  3EQN A;  1OGO X;  1OFL A;  4XN3 A;  3VSV A;  4W8S A;  1IDJ A;  1IB4 A;  4YZQ A;  1PE9 A;  4W8T A;  2X6W A;  1WMR A;  4MXN A;  4YZA A;  3GRH A;  4XN0 A;  4XOP A;  4XLC A;  4OZY A;  1KTW A;  2NTP A;  1OOC A;  3GQ8 A;  4U4B A;  2EWE A;  1BHE A;  1O8E A;  4XLE A;  3SUC A;  4Z06 A;  1O8M A;  1QJV A;  1XG2 A;  2UVE A;  3T9G A;  3WWG A;  3GQA A;  1O8G A;  2QY1 A;  4XON A;  4Z03 A;  4XLH A;  4NK6 A;  1O8J A;  1VBL A;  4YZ0 A;  4OJ6 A;  4HWV A;  1RWR A;  4MR0 A;  2O0W A;  1RMG A;  1O8D A;  1RU4 A;  1HG8 A;  4I84 A;  4OJO A;  4XLF A;  4XNF A;  1JTA A;  4XOR A;  5C1E A;  2VJJ A;  1CZF A;  2Z8G A;  1O8F A;  3VMV A;  4XKW A;  1KCC A;  3JUR A;  3LMW A;  1X0C A;  3VSU A;  5AMV A;  3UW0 A;  2PYG A;  2X6X A;  2ODL A;  1O8L A;  3ZSC A;  3ZPP A;  1O8H A;  1QCX A;  3EQO A;  1OFM A;  2NSP A;  4Z05 A;  2X3H A;  3FY3 A;  1BN8 A;  2NTQ A;  2O1D A;  4C2L A;  3B4N A;  1AIR A;  1PXZ A;  1KCD A;  2IQ7 A;  4XQF A; 
#chains in the Genus database with same CATH topology
 4PMH A;  4KH3 A;  4XLA A;  1DBO A;  3BH7 B;  2VFP A;  3VMW A;  4NK8 A;  1H80 A;  2X6Y A;  4YC5 A;  2O17 A;  2NT9 A;  3B8Y A;  1HF2 A;  4YEL A;  4OZZ A;  2IOU G;  4U49 A;  4W8Q A;  1TYX A;  2YUH A;  2X85 A;  3KRG A;  2VBM A;  2PYH A;  4V02 C;  4XR6 A;  2XTY A;  4YCQ A;  1IDK A;  4OM9 A;  3TH0 A;  2QX3 A;  4W8R A;  4XOT A;  1IA5 A;  1CLW A;  1PLU A;  1QRC A;  4XL9 A;  3RIQ A;  1GQ8 A;  2VFO A;  4URR A;  3B90 A;  1EE6 A;  3PSS A;  4OJ5 A;  1QQ1 A;  4EW9 A;  2XT4 A;  3N90 A;  2NT6 A;  3LYC A;  1JRG A;  1OGM X;  4YZX A;  1LLW A;  1K5C A;  4AVZ A;  2PEC A;  1OFD A;  4YFO A;  2O04 A;  3N6Z A;  1LM1 A;  5C1C A;  1EA0 A;  2VFQ A;  4XKV A;  4XM3 A;  2QXZ A;  1TYV A;  2INV A;  4XMY A;  3DU1 X;  2XTW A;  1DBG A;  3BH6 B;  2VBK A;  1NHC A;  2O0V A;  4OJL A;  2INU A;  1O88 A;  2XTX A;  2NZM A;  4OJP A;  2VJI A;  4YEI A;  2V5I A;  1O8I A;  3GQ7 A;  2NST A;  2XC1 A;  2BSP A;  3PET A;  4OJO A;  3VST A;  2UVF A;  2VBE A;  2NTB A;  4YEJ A;  3GQ9 A;  1WXR A;  1O8K A;  3EQN A;  1OGO X;  1OFL A;  4XN3 A;  3VSV A;  4W8S A;  1IDJ A;  1IB4 A;  4YZQ A;  4OPW A;  5JMC B;  1PE9 A;  4W8T A;  2X6W A;  3P4G A;  1WMR A;  5DNS A;  2BM4 A;  4MXN A;  1KCD A;  1QA2 A;  4YZA A;  3GRH A;  2QYU A;  4XN0 A;  4XOP A;  4XLC A;  1K4Z A;  1KQ5 A;  2G0Y A;  3SY2 A;  1TYW A;  4OZY A;  1KTW A;  2F3L A;  2NTP A;  2BX6 A;  2J8K A;  2BM7 A;  1OOC A;  3GQ8 A;  4U4B A;  2EWE A;  3SYJ A;  1BHE A;  1O8E A;  4XLE A;  3SUC A;  4Z06 A;  3SQV A;  3NB2 A;  1L1I A;  1QRB A;  2QZA A;  3AK5 A;  1O8M A;  1QJV A;  1XG2 A;  2UVE A;  3T9G A;  3WWG A;  1LLZ A;  3GQA A;  2XT2 A;  1K8F A;  1O8G A;  2QY1 A;  4XON A;  4Z03 A;  4XLH A;  2W7Z A;  1O8J A;  4NK6 A;  1VBL A;  4YZ0 A;  4OJ6 A;  5JLV C;  4HWV A;  1RWR A;  4MR0 A;  2O0W A;  1RMG A;  1O8D A;  1RU4 A;  1HG8 A;  3H09 A;  4I84 A;  1OFE A;  2B0R A;  3PSZ A;  4XLF A;  4XNF A;  1JTA A;  4XOR A;  3LJY A;  5C1E A;  2VJJ A;  1CZF A;  1TSP A;  2Z8G A;  1O8F A;  3VMV A;  4XKW A;  2O6W A;  2J8I A;  1KCC A;  3JUR A;  3ML3 A;  3LMW A;  1X0C A;  3VSU A;  1DAB A;  2VFM A;  5AMV A;  3UW0 A;  1EZG A;  1QA1 A;  1QA3 A;  3JX8 A;  4JRA C;  2PYG A;  2X6X A;  2ODL A;  1O8L A;  3NAW A;  4YDT A;  3ZSC A;  3ZPP A;  1TYU A;  1O8H A;  1QCX A;  3EQO A;  1OFM A;  2NSP A;  4Z05 A;  2BM5 A;  2X3H A;  3FY3 A;  3SZE A;  1BN8 A;  2NTQ A;  2BM6 A;  2O1D A;  4C2L A;  3B4N A;  1AIR A;  1PXZ A;  2VFN A;  2IQ7 A;  4XQF A; 
#chains in the Genus database with same CATH homology
 4PMH A;  4XLA A;  1DBO A;  3VMW A;  4NK8 A;  1H80 A;  2X6Y A;  2O17 A;  2NT9 A;  3B8Y A;  4YEL A;  4OZZ A;  4U49 A;  4W8Q A;  3KRG A;  2X85 A;  2VBM A;  2PYH A;  4XR6 A;  1IDK A;  2QX3 A;  4W8R A;  4XOT A;  1IA5 A;  1PLU A;  4XL9 A;  1GQ8 A;  4URR A;  3B90 A;  1EE6 A;  4OJ5 A;  4EW9 A;  2NT6 A;  1JRG A;  1OGM X;  4YZX A;  1K5C A;  4AVZ A;  2PEC A;  2O04 A;  5C1C A;  4XM3 A;  4XKV A;  2QXZ A;  2INV A;  4XMY A;  1DBG A;  2VBK A;  1NHC A;  2O0V A;  4OJL A;  2INU A;  1O88 A;  4OJP A;  2NZM A;  2VJI A;  3GQ7 A;  1O8I A;  2NST A;  2BSP A;  3VST A;  2UVF A;  2VBE A;  2NTB A;  4YEJ A;  3GQ9 A;  1O8K A;  3EQN A;  1OGO X;  1OFL A;  4XN3 A;  3VSV A;  4W8S A;  1IDJ A;  1IB4 A;  4YZQ A;  1PE9 A;  4W8T A;  2X6W A;  1WMR A;  4MXN A;  4YZA A;  3GRH A;  4XN0 A;  4XOP A;  4XLC A;  4OZY A;  1KTW A;  2NTP A;  1OOC A;  3GQ8 A;  4U4B A;  2EWE A;  1BHE A;  1O8E A;  4XLE A;  3SUC A;  4Z06 A;  1O8M A;  1QJV A;  1XG2 A;  2UVE A;  3T9G A;  3WWG A;  3GQA A;  1O8G A;  2QY1 A;  4XON A;  4Z03 A;  4XLH A;  4NK6 A;  1O8J A;  1VBL A;  4YZ0 A;  4OJ6 A;  4HWV A;  1RWR A;  4MR0 A;  2O0W A;  1RMG A;  1O8D A;  1RU4 A;  1HG8 A;  4I84 A;  4OJO A;  4XLF A;  4XNF A;  1JTA A;  4XOR A;  5C1E A;  2VJJ A;  1CZF A;  2Z8G A;  1O8F A;  3VMV A;  4XKW A;  1KCC A;  3JUR A;  3LMW A;  1X0C A;  3VSU A;  5AMV A;  3UW0 A;  2PYG A;  2X6X A;  2ODL A;  1O8L A;  3ZSC A;  3ZPP A;  1O8H A;  1QCX A;  3EQO A;  1OFM A;  2NSP A;  4Z05 A;  2X3H A;  3FY3 A;  1BN8 A;  2NTQ A;  2O1D A;  4C2L A;  3B4N A;  1AIR A;  1PXZ A;  1KCD A;  2IQ7 A;  4XQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...