3FY3A

Crystal structure of truncated hemolysin a from p. mirabilis
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQQEVFGIAAEYVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title Structural and functional studies of truncated hemolysin A from Proteus mirabilis.
pubmed doi rcsb
source organism Proteus mirabilis
molecule tags Toxin
total genus 77
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3fy3A00
2X6YA 3T9GA 4MXNA 4EW9A 1PE9A 3ZPPA 1RWRA 2UVEA 2NT6A 2PYHA 4XORA 1CZFA 4MR0A 3LMWA 4OJ5A 2O17A 4XLAA 4YELA 3VSUA 1NHCA 2VBKA 3KRGA 2QXZA 3B8YA 4XKWA 3VSVA 2NTQA 3UW0A 4AVZA 1EE6A 2X6XA 2PYGA 4URRA 2NTBA 4XR6A 4XQFA 4YZXA 4XLHA 3ZSCA 4I84A 1KCCA 4XLEA 1O8IA 1DBOA 4XMYA 1KTWA 1RU4A 2NZMA 4W8TA 5C1EA 4U49A 2O0VA 4HWVA 4YZ0A 3B4NA 2VBEA 1O8MA 1IDKA 3GQ7A 1H80A 2X6WA 1OOCA 2BSPA 2QY1A 3VMWA 1O88A 2Z8GA 3GQ9A 1RMGA 4XLCA 1BN8A 2O0WA 1OGMX 4W8SA 2O1DA 4OJPA 4Z06A 1O8KA 2INUA 3GQ8A 2X3HA 1IB4A 4U4BA 1OGOX 4XL9A 4YEJA 2QX3A 1IDJA 1JRGA 3B90A 1WMRA 1O8DA 1JTAA 1HG8A 1O8JA 4C2LA 2VJJA 2PECA 4XONA 3WWGA 1O8GA 2EWEA 4XKVA 4OJOA 4XN3A 2NT9A 5C1CA 1QCXA 4OJLA 1AIRA 1O8FA 1OFLA 4OZYA 4XM3A 3VSTA 1X0CA 2NSPA 4W8QA 2ODLA 3FY3A 4XN0A 1DBGA 2INVA 4XOTA 3SUCA 1PLUA 2NSTA 4NK6A 4OJ6A 4W8RA 1BHEA 2VBMA 2VJIA 3GRHA 1XG2A 1PXZA 1VBLA 4XLFA 4YZAA 1O8EA 4PMHA 4XOPA 3VMVA 2X85A 3JURA 1GQ8A 1OFMA 3EQOA 5AMVA 1QJVA 3EQNA 3GQAA 4NK8A 2O04A 4OZZA 1KCDA 1IA5A 2NTPA 1K5CA 1O8HA 4XNFA 2IQ7A 4YZQA 4Z03A 4Z05A 2UVFA 1O8LA
chains in the Genus database with same CATH superfamily
2BX6A 2X6YA 4MXNA 3T9GA 4EW9A 2XT2A 1PE9A 3BH7B 3ZPPA 1RWRA 1TYUA 2UVEA 2NT6A 2PYHA 4XORA 1CZFA 2YUHA 4MR0A 3JX8A 3LMWA 4OJ5A 2O17A 4XLAA 4YELA 3VSUA 2VFPA 1NHCA 2VBKA 3KRGA 2QXZA 2BM4A 3H09A 3B8YA 2QZAA 2B0RA 3AK5A 1QRBA 4XKWA 2VFNA 3VSVA 2NTQA 3UW0A 1O8LA 1EE6A 4AVZA 1CLWA 2X6XA 2PYGA 2W7ZA 3P4GA 4URRA 1HF2A 1KQ5A 2NTBA 3PSSA 4XR6A 4XQFA 4YZXA 4XLHA 3ZSCA 1WXRA 4I84A 1KCCA 4XLEA 1O8IA 1DBOA 4XMYA 3NAWA 1KTWA 1RU4A 2NZMA 4W8TA 5C1EA 3RIQA 4U49A 2O0VA 3PETA 4HWVA 4YZ0A 3B4NA 1TSPA 3PSZA 1DABA 2VBEA 1O8MA 1IDKA 5JMCB 2J8KA 3GQ7A 1H80A 2X6WA 1OOCA 1EA0A 2BSPA 2QY1A 5DNSA 3VMWA 4YDTA 1O88A 2V5IA 1EZGA 2Z8GA 3GQ9A 3N6ZA 4YC5A 2VFMA 3N90A 1RMGA 4XLCA 1BN8A 2O0WA 1TYVA 1OGMX 4W8SA 2O1DA 2XTXA 3NB2A 4OJPA 3SY2A 3BH6B 2O6WA 4Z06A 1O8KA 3SZEA 2INUA 4OPWA 3GQ8A 2X3HA 2XC1A 1IB4A 4OM9A 4U4BA 1OGOX 1OFEA 4XL9A 2QX3A 4YEJA 1LLWA 1IDJA 1JRGA 3B90A 1WMRA 1K4ZA 1JTAA 1O8DA 1HG8A 1O8JA 2J8IA 4C2LA 2VJJA 2VFOA 1L1IA 1OFDA 1QA2A 4V02C 2BM7A 3LJYA 2PECA 4XONA 4YEIA 3LYCA 3WWGA 1K8FA 1O8GA 2EWEA 2VFQA 2XTWA 4OJOA 4XKVA 4XN3A 1QA1A 1TYWA 2NT9A 5C1CA 1QCXA 4OJLA 1AIRA 1O8FA 1OFLA 4OZYA 4XM3A 3VSTA 1X0CA 2NSPA 4W8QA 3SYJA 3ML3A 2ODLA 3FY3A 4KH3A 4XN0A 1DBGA 2INVA 4XOTA 3SUCA 1PLUA 4YFOA 2NSTA 4NK6A 4OJ6A 4W8RA 1BHEA 2VBMA 2VJIA 3GRHA 1XG2A 1PXZA 1VBLA 4XLFA 4YZAA 4YCQA 1O8EA 1TYXA 4PMHA 4XOPA 3VMVA 2X85A 3JURA 3TH0A 1GQ8A 1OFMA 3EQOA 2QYUA 2XT4A 1QRCA 2XTYA 5AMVA 1QJVA 3EQNA 3GQAA 2F3LA 1LM1A 2O04A 4JRAC 4NK8A 4OZZA 3SQVA 1IA5A 1KCDA 2NTPA 1K5CA 1O8HA 4XNFA 2IQ7A 2IOUG 4YZQA 3DU1X 1QA3A 1QQ1A 2BM5A 4Z03A 2UVFA 1LLZA 4Z05A 2G0YA 2BM6A 5JLVC
chains in the Genus database with same CATH topology
2X6YA 3T9GA 4MXNA 4EW9A 1PE9A 3ZPPA 1RWRA 2UVEA 2NT6A 2PYHA 4XORA 1CZFA 4MR0A 3LMWA 4OJ5A 2O17A 4XLAA 4YELA 3VSUA 1NHCA 2VBKA 3KRGA 2QXZA 3B8YA 4XKWA 3VSVA 2NTQA 3UW0A 4AVZA 1EE6A 2X6XA 2PYGA 4URRA 2NTBA 4XR6A 4XQFA 4YZXA 4XLHA 3ZSCA 4I84A 1KCCA 4XLEA 1O8IA 1DBOA 4XMYA 1KTWA 1RU4A 2NZMA 4W8TA 5C1EA 4U49A 2O0VA 4HWVA 4YZ0A 3B4NA 2VBEA 1O8MA 1IDKA 3GQ7A 1H80A 2X6WA 1OOCA 2BSPA 2QY1A 3VMWA 1O88A 2Z8GA 3GQ9A 1RMGA 4XLCA 1BN8A 2O0WA 1OGMX 4W8SA 2O1DA 4OJPA 4Z06A 1O8KA 2INUA 3GQ8A 2X3HA 1IB4A 4U4BA 1OGOX 4XL9A 4YEJA 2QX3A 1IDJA 1JRGA 3B90A 1WMRA 1O8DA 1JTAA 1HG8A 1O8JA 4C2LA 2VJJA 2PECA 4XONA 3WWGA 1O8GA 2EWEA 4XKVA 4OJOA 4XN3A 2NT9A 5C1CA 1QCXA 4OJLA 1AIRA 1O8FA 1OFLA 4OZYA 4XM3A 3VSTA 1X0CA 2NSPA 4W8QA 2ODLA 3FY3A 4XN0A 1DBGA 2INVA 4XOTA 3SUCA 1PLUA 2NSTA 4NK6A 4OJ6A 4W8RA 1BHEA 2VBMA 2VJIA 3GRHA 1XG2A 1PXZA 1VBLA 4XLFA 4YZAA 1O8EA 4PMHA 4XOPA 3VMVA 2X85A 3JURA 1GQ8A 1OFMA 3EQOA 5AMVA 1QJVA 3EQNA 3GQAA 4NK8A 2O04A 4OZZA 1KCDA 1IA5A 2NTPA 1K5CA 1O8HA 4XNFA 2IQ7A 4YZQA 4Z03A 4Z05A 2UVFA 1O8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6Y A;  3T9G A;  4MXN A;  4EW9 A;  1PE9 A;  3ZPP A;  1RWR A;  2UVE A;  2NT6 A;  2PYH A;  4XOR A;  1CZF A;  4MR0 A;  3LMW A;  4OJ5 A;  2O17 A;  4XLA A;  4YEL A;  3VSU A;  1NHC A;  2VBK A;  3KRG A;  2QXZ A;  3B8Y A;  4XKW A;  3VSV A;  2NTQ A;  3UW0 A;  4AVZ A;  1EE6 A;  2X6X A;  2PYG A;  4URR A;  2NTB A;  4XR6 A;  4XQF A;  4YZX A;  4XLH A;  3ZSC A;  4I84 A;  1KCC A;  4XLE A;  1O8I A;  1DBO A;  4XMY A;  1KTW A;  1RU4 A;  2NZM A;  4W8T A;  5C1E A;  4U49 A;  2O0V A;  4HWV A;  4YZ0 A;  3B4N A;  2VBE A;  1O8M A;  1IDK A;  3GQ7 A;  1H80 A;  2X6W A;  1OOC A;  2BSP A;  2QY1 A;  3VMW A;  1O88 A;  2Z8G A;  3GQ9 A;  1RMG A;  4XLC A;  1BN8 A;  2O0W A;  1OGM X;  4W8S A;  2O1D A;  4OJP A;  4Z06 A;  1O8K A;  2INU A;  3GQ8 A;  2X3H A;  1IB4 A;  4U4B A;  1OGO X;  4XL9 A;  4YEJ A;  2QX3 A;  1IDJ A;  1JRG A;  3B90 A;  1WMR A;  1O8D A;  1JTA A;  1HG8 A;  1O8J A;  4C2L A;  2VJJ A;  2PEC A;  4XON A;  3WWG A;  1O8G A;  2EWE A;  4XKV A;  4OJO A;  4XN3 A;  2NT9 A;  5C1C A;  1QCX A;  4OJL A;  1AIR A;  1O8F A;  1OFL A;  4OZY A;  4XM3 A;  3VST A;  1X0C A;  2NSP A;  4W8Q A;  2ODL A;  3FY3 A;  4XN0 A;  1DBG A;  2INV A;  4XOT A;  3SUC A;  1PLU A;  2NST A;  4NK6 A;  4OJ6 A;  4W8R A;  1BHE A;  2VBM A;  2VJI A;  3GRH A;  1XG2 A;  1PXZ A;  1VBL A;  4XLF A;  4YZA A;  1O8E A;  4PMH A;  4XOP A;  3VMV A;  2X85 A;  3JUR A;  1GQ8 A;  1OFM A;  3EQO A;  5AMV A;  1QJV A;  3EQN A;  3GQA A;  4NK8 A;  2O04 A;  4OZZ A;  1KCD A;  1IA5 A;  2NTP A;  1K5C A;  1O8H A;  4XNF A;  2IQ7 A;  4YZQ A;  4Z03 A;  4Z05 A;  2UVF A;  1O8L A; 
#chains in the Genus database with same CATH topology
 2BX6 A;  2X6Y A;  4MXN A;  3T9G A;  4EW9 A;  2XT2 A;  1PE9 A;  3BH7 B;  3ZPP A;  1RWR A;  1TYU A;  2UVE A;  2NT6 A;  2PYH A;  4XOR A;  1CZF A;  2YUH A;  4MR0 A;  3JX8 A;  3LMW A;  4OJ5 A;  2O17 A;  4XLA A;  4YEL A;  3VSU A;  2VFP A;  1NHC A;  2VBK A;  3KRG A;  2QXZ A;  2BM4 A;  3H09 A;  3B8Y A;  2QZA A;  2B0R A;  3AK5 A;  1QRB A;  4XKW A;  2VFN A;  3VSV A;  2NTQ A;  3UW0 A;  1O8L A;  1EE6 A;  4AVZ A;  1CLW A;  2X6X A;  2PYG A;  2W7Z A;  3P4G A;  4URR A;  1HF2 A;  1KQ5 A;  2NTB A;  3PSS A;  4XR6 A;  4XQF A;  4YZX A;  4XLH A;  3ZSC A;  1WXR A;  4I84 A;  1KCC A;  4XLE A;  1O8I A;  1DBO A;  4XMY A;  3NAW A;  1KTW A;  1RU4 A;  2NZM A;  4W8T A;  5C1E A;  3RIQ A;  4U49 A;  2O0V A;  3PET A;  4HWV A;  4YZ0 A;  3B4N A;  1TSP A;  3PSZ A;  1DAB A;  2VBE A;  1O8M A;  1IDK A;  5JMC B;  2J8K A;  3GQ7 A;  1H80 A;  2X6W A;  1OOC A;  1EA0 A;  2BSP A;  2QY1 A;  5DNS A;  3VMW A;  4YDT A;  1O88 A;  2V5I A;  1EZG A;  2Z8G A;  3GQ9 A;  3N6Z A;  4YC5 A;  2VFM A;  3N90 A;  1RMG A;  4XLC A;  1BN8 A;  2O0W A;  1TYV A;  1OGM X;  4W8S A;  2O1D A;  2XTX A;  3NB2 A;  4OJP A;  3SY2 A;  3BH6 B;  2O6W A;  4Z06 A;  1O8K A;  3SZE A;  2INU A;  4OPW A;  3GQ8 A;  2X3H A;  2XC1 A;  1IB4 A;  4OM9 A;  4U4B A;  1OGO X;  1OFE A;  4XL9 A;  2QX3 A;  4YEJ A;  1LLW A;  1IDJ A;  1JRG A;  3B90 A;  1WMR A;  1K4Z A;  1JTA A;  1O8D A;  1HG8 A;  1O8J A;  2J8I A;  4C2L A;  2VJJ A;  2VFO A;  1L1I A;  1OFD A;  1QA2 A;  4V02 C;  2BM7 A;  3LJY A;  2PEC A;  4XON A;  4YEI A;  3LYC A;  3WWG A;  1K8F A;  1O8G A;  2EWE A;  2VFQ A;  2XTW A;  4OJO A;  4XKV A;  4XN3 A;  1QA1 A;  1TYW A;  2NT9 A;  5C1C A;  1QCX A;  4OJL A;  1AIR A;  1O8F A;  1OFL A;  4OZY A;  4XM3 A;  3VST A;  1X0C A;  2NSP A;  4W8Q A;  3SYJ A;  3ML3 A;  2ODL A;  3FY3 A;  4KH3 A;  4XN0 A;  1DBG A;  2INV A;  4XOT A;  3SUC A;  1PLU A;  4YFO A;  2NST A;  4NK6 A;  4OJ6 A;  4W8R A;  1BHE A;  2VBM A;  2VJI A;  3GRH A;  1XG2 A;  1PXZ A;  1VBL A;  4XLF A;  4YZA A;  4YCQ A;  1O8E A;  1TYX A;  4PMH A;  4XOP A;  3VMV A;  2X85 A;  3JUR A;  3TH0 A;  1GQ8 A;  1OFM A;  3EQO A;  2QYU A;  2XT4 A;  1QRC A;  2XTY A;  5AMV A;  1QJV A;  3EQN A;  3GQA A;  2F3L A;  1LM1 A;  2O04 A;  4JRA C;  4NK8 A;  4OZZ A;  3SQV A;  1IA5 A;  1KCD A;  2NTP A;  1K5C A;  1O8H A;  4XNF A;  2IQ7 A;  2IOU G;  4YZQ A;  3DU1 X;  1QA3 A;  1QQ1 A;  2BM5 A;  4Z03 A;  2UVF A;  1LLZ A;  4Z05 A;  2G0Y A;  2BM6 A;  5JLV C; 
#chains in the Genus database with same CATH homology
 2X6Y A;  3T9G A;  4MXN A;  4EW9 A;  1PE9 A;  3ZPP A;  1RWR A;  2UVE A;  2NT6 A;  2PYH A;  4XOR A;  1CZF A;  4MR0 A;  3LMW A;  4OJ5 A;  2O17 A;  4XLA A;  4YEL A;  3VSU A;  1NHC A;  2VBK A;  3KRG A;  2QXZ A;  3B8Y A;  4XKW A;  3VSV A;  2NTQ A;  3UW0 A;  4AVZ A;  1EE6 A;  2X6X A;  2PYG A;  4URR A;  2NTB A;  4XR6 A;  4XQF A;  4YZX A;  4XLH A;  3ZSC A;  4I84 A;  1KCC A;  4XLE A;  1O8I A;  1DBO A;  4XMY A;  1KTW A;  1RU4 A;  2NZM A;  4W8T A;  5C1E A;  4U49 A;  2O0V A;  4HWV A;  4YZ0 A;  3B4N A;  2VBE A;  1O8M A;  1IDK A;  3GQ7 A;  1H80 A;  2X6W A;  1OOC A;  2BSP A;  2QY1 A;  3VMW A;  1O88 A;  2Z8G A;  3GQ9 A;  1RMG A;  4XLC A;  1BN8 A;  2O0W A;  1OGM X;  4W8S A;  2O1D A;  4OJP A;  4Z06 A;  1O8K A;  2INU A;  3GQ8 A;  2X3H A;  1IB4 A;  4U4B A;  1OGO X;  4XL9 A;  4YEJ A;  2QX3 A;  1IDJ A;  1JRG A;  3B90 A;  1WMR A;  1O8D A;  1JTA A;  1HG8 A;  1O8J A;  4C2L A;  2VJJ A;  2PEC A;  4XON A;  3WWG A;  1O8G A;  2EWE A;  4XKV A;  4OJO A;  4XN3 A;  2NT9 A;  5C1C A;  1QCX A;  4OJL A;  1AIR A;  1O8F A;  1OFL A;  4OZY A;  4XM3 A;  3VST A;  1X0C A;  2NSP A;  4W8Q A;  2ODL A;  3FY3 A;  4XN0 A;  1DBG A;  2INV A;  4XOT A;  3SUC A;  1PLU A;  2NST A;  4NK6 A;  4OJ6 A;  4W8R A;  1BHE A;  2VBM A;  2VJI A;  3GRH A;  1XG2 A;  1PXZ A;  1VBL A;  4XLF A;  4YZA A;  1O8E A;  4PMH A;  4XOP A;  3VMV A;  2X85 A;  3JUR A;  1GQ8 A;  1OFM A;  3EQO A;  5AMV A;  1QJV A;  3EQN A;  3GQA A;  4NK8 A;  2O04 A;  4OZZ A;  1KCD A;  1IA5 A;  2NTP A;  1K5C A;  1O8H A;  4XNF A;  2IQ7 A;  4YZQ A;  4Z03 A;  4Z05 A;  2UVF A;  1O8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...