3FY3A

Crystal structure of truncated hemolysin a from p. mirabilis
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQQEVFGIAAEYVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of truncated hemolysin A from Proteus mirabilis.
pubmed doi rcsb
source organism Proteus mirabilis
molecule tags Toxin
molecule keywords Hemolysin
total genus 77
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3fy3A00
1BN8A 2X6XA 1BHEA 3EQNA 1PXZA 1KTWA 3T9GA 1HG8A 4OJ5A 4I84A 1K5CA 1O8FA 1KCCA 2PYHA 4XR6A 4C2LA 4XQFA 2O0WA 1IDJA 1IA5A 1O88A 4YZ0A 4XM3A 4OJOA 2O04A 1AIRA 2NTPA 2UVEA 3GQ9A 4NK6A 3VMWA 3VSTA 3B90A 2NTQA 3B8YA 1RWRA 1JRGA 4EW9A 2O17A 3FY3A 1IDKA 4XLCA 3VSVA 3VSUA 1DBGA 2VBEA 1OFMA 1O8JA 2PYGA 4W8SA 1XG2A 1JTAA 2O1DA 4XL9A 1RMGA 1VBLA 1X0CA 4YEJA 4XKWA 2O0VA 4W8RA 2NZMA 2INUA 3EQOA 4PMHA 1QCXA 1O8EA 2QY1A 4XONA 1DBOA 4XLFA 4YELA 1OGOX 2X6YA 1CZFA 1O8GA 4XNFA 4OZZA 4XOPA 4OJ6A 1H80A 4YZXA 4XLHA 1O8IA 3ZSCA 1O8DA 4Z06A 4XMYA 4YZQA 3VMVA 3WWGA 3UW0A 1O8HA 2NSTA 3JURA 4XLAA 1RU4A 4MR0A 2X85A 5AMVA 5C1CA 3GQAA 4OZYA 4Z03A 2UVFA 2VBKA 2QXZA 3KRGA 4URRA 2NTBA 4U49A 3SUCA 1EE6A 4YZAA 1NHCA 2ODLA 4U4BA 1O8LA 1O8KA 2PECA 1OOCA 2BSPA 2Z8GA 4OJLA 4Z05A 3ZPPA 1PLUA 4W8QA 2QX3A 2INVA 2NSPA 2VJIA 2EWEA 1O8MA 4W8TA 4XORA 2NT9A 4NK8A 4AVZA 2X3HA 4XN3A 4HWVA 1GQ8A 3LMWA 4XLEA 2VBMA 5C1EA 1KCDA 4XOTA 1PE9A 3GQ7A 1OGMX 2X6WA 4OJPA 3GRHA 2IQ7A 3B4NA 2NT6A 1IB4A 1WMRA 1OFLA 4XKVA 3GQ8A 4MXNA 1QJVA 4XN0A 2VJJA
chains in the Genus database with same CATH superfamily
1BN8A 2J8IA 2VFQA 1BHEA 2X6XA 3EQNA 1PXZA 1KTWA 1K4ZA 2QYUA 1HG8A 2VFMA 4JRAC 4OJ5A 1KQ5A 4OM9A 4YFOA 4I84A 3T9GA 2IOUG 1O8FA 1K5CA 1KCCA 2PYHA 4XR6A 4C2LA 4XQFA 2O0WA 1IDJA 1TYUA 1EA0A 1IA5A 2BM6A 1O88A 1LLWA 4YZ0A 4XM3A 4OJOA 1TYWA 2B0RA 2O04A 5JLVC 1AIRA 2NTPA 2UVEA 3GQ9A 2BX6A 4NK6A 3VMWA 1DABA 3VSTA 3B90A 2NTQA 3B8YA 3SQVA 1L1IA 1RWRA 1JRGA 3BH7B 4EW9A 1TYXA 2O17A 3FY3A 1IDKA 4XLCA 3VSVA 3VSUA 1DBGA 1OFMA 2VBEA 1O8JA 2PYGA 4YEIA 4W8SA 1XG2A 1JTAA 2YUHA 3AK5A 2O1DA 3NAWA 2O6WA 4XL9A 4W8QA 1RMGA 1VBLA 1X0CA 4YEJA 4XKWA 3JX8A 2XTWA 2O0VA 2VFNA 4W8RA 3SYJA 1LM1A 2NZMA 4KH3A 3N6ZA 2INUA 3P4GA 1QRCA 3EQOA 2VFOA 4PMHA 1QCXA 1EZGA 1O8EA 2QY1A 4XONA 1TSPA 2J8KA 2BM5A 1DBOA 3LJYA 4XLFA 4YELA 2XT2A 1OGOX 1CZFA 2X6YA 1O8GA 3N90A 4OZZA 4XOPA 4XNFA 3SZEA 4OJ6A 4V02C 3ML3A 1H80A 1TYVA 1HF2A 4YZXA 4XLHA 2G0YA 2BM4A 1CLWA 1O8IA 3H09A 4YCQA 1O8DA 4Z06A 4XMYA 4YZQA 3VMVA 1OFDA 3ZSCA 3WWGA 1K8FA 1O8HA 5DNSA 2NSTA 3UW0A 3JURA 4XLAA 1RU4A 3SY2A 4MR0A 2X85A 3PSSA 5AMVA 5C1CA 1WXRA 3GQAA 4OZYA 4Z03A 2F3LA 2UVFA 2QXZA 2VBKA 3KRGA 4YC5A 3RIQA 2QZAA 1QA2A 4URRA 1QA1A 4OPWA 2NTBA 4U49A 3TH0A 3SUCA 1QRBA 1EE6A 3DU1X 4YZAA 1NHCA 3BH6B 2ODLA 4U4BA 1O8LA 1O8KA 2PECA 1OOCA 2BSPA 2Z8GA 4OJLA 4Z05A 3ZPPA 2BM7A 1PLUA 1LLZA 2QX3A 2W7ZA 3PSZA 3LYCA 1QQ1A 2INVA 2NSPA 2V5IA 2EWEA 2VJIA 1O8MA 4W8TA 4XORA 2NT9A 4NK8A 4YDTA 4AVZA 1OFEA 2X3HA 4XN3A 4HWVA 1GQ8A 2XT4A 3LMWA 4XLEA 2XTYA 2VBMA 5C1EA 1KCDA 4XOTA 1PE9A 2VFPA 3GQ7A 2XC1A 1OGMX 2X6WA 2XTXA 4OJPA 3GRHA 2IQ7A 3B4NA 2NT6A 3NB2A 5JMCB 3PETA 1WMRA 1IB4A 1OFLA 4XKVA 3GQ8A 1QA3A 4MXNA 1QJVA 4XN0A 2VJJA
chains in the Genus database with same CATH topology
1BN8A 2X6XA 1BHEA 3EQNA 1PXZA 1KTWA 3T9GA 1HG8A 4OJ5A 4I84A 1K5CA 1O8FA 1KCCA 2PYHA 4XR6A 4C2LA 4XQFA 2O0WA 1IDJA 1IA5A 1O88A 4YZ0A 4XM3A 4OJOA 2O04A 1AIRA 2NTPA 2UVEA 3GQ9A 4NK6A 3VMWA 3VSTA 3B90A 2NTQA 3B8YA 1RWRA 1JRGA 4EW9A 2O17A 3FY3A 1IDKA 4XLCA 3VSVA 3VSUA 1DBGA 2VBEA 1OFMA 1O8JA 2PYGA 4W8SA 1XG2A 1JTAA 2O1DA 4XL9A 1RMGA 1VBLA 1X0CA 4YEJA 4XKWA 2O0VA 4W8RA 2NZMA 2INUA 3EQOA 4PMHA 1QCXA 1O8EA 2QY1A 4XONA 1DBOA 4XLFA 4YELA 1OGOX 2X6YA 1CZFA 1O8GA 4XNFA 4OZZA 4XOPA 4OJ6A 1H80A 4YZXA 4XLHA 1O8IA 3ZSCA 1O8DA 4Z06A 4XMYA 4YZQA 3VMVA 3WWGA 3UW0A 1O8HA 2NSTA 3JURA 4XLAA 1RU4A 4MR0A 2X85A 5AMVA 5C1CA 3GQAA 4OZYA 4Z03A 2UVFA 2VBKA 2QXZA 3KRGA 4URRA 2NTBA 4U49A 3SUCA 1EE6A 4YZAA 1NHCA 2ODLA 4U4BA 1O8LA 1O8KA 2PECA 1OOCA 2BSPA 2Z8GA 4OJLA 4Z05A 3ZPPA 1PLUA 4W8QA 2QX3A 2INVA 2NSPA 2VJIA 2EWEA 1O8MA 4W8TA 4XORA 2NT9A 4NK8A 4AVZA 2X3HA 4XN3A 4HWVA 1GQ8A 3LMWA 4XLEA 2VBMA 5C1EA 1KCDA 4XOTA 1PE9A 3GQ7A 1OGMX 2X6WA 4OJPA 3GRHA 2IQ7A 3B4NA 2NT6A 1IB4A 1WMRA 1OFLA 4XKVA 3GQ8A 4MXNA 1QJVA 4XN0A 2VJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BN8 A;  2X6X A;  1BHE A;  3EQN A;  1PXZ A;  1KTW A;  3T9G A;  1HG8 A;  4OJ5 A;  4I84 A;  1K5C A;  1O8F A;  1KCC A;  2PYH A;  4XR6 A;  4C2L A;  4XQF A;  2O0W A;  1IDJ A;  1IA5 A;  1O88 A;  4YZ0 A;  4XM3 A;  4OJO A;  2O04 A;  1AIR A;  2NTP A;  2UVE A;  3GQ9 A;  4NK6 A;  3VMW A;  3VST A;  3B90 A;  2NTQ A;  3B8Y A;  1RWR A;  1JRG A;  4EW9 A;  2O17 A;  3FY3 A;  1IDK A;  4XLC A;  3VSV A;  3VSU A;  1DBG A;  2VBE A;  1OFM A;  1O8J A;  2PYG A;  4W8S A;  1XG2 A;  1JTA A;  2O1D A;  4XL9 A;  1RMG A;  1VBL A;  1X0C A;  4YEJ A;  4XKW A;  2O0V A;  4W8R A;  2NZM A;  2INU A;  3EQO A;  4PMH A;  1QCX A;  1O8E A;  2QY1 A;  4XON A;  1DBO A;  4XLF A;  4YEL A;  1OGO X;  2X6Y A;  1CZF A;  1O8G A;  4XNF A;  4OZZ A;  4XOP A;  4OJ6 A;  1H80 A;  4YZX A;  4XLH A;  1O8I A;  3ZSC A;  1O8D A;  4Z06 A;  4XMY A;  4YZQ A;  3VMV A;  3WWG A;  3UW0 A;  1O8H A;  2NST A;  3JUR A;  4XLA A;  1RU4 A;  4MR0 A;  2X85 A;  5AMV A;  5C1C A;  3GQA A;  4OZY A;  4Z03 A;  2UVF A;  2VBK A;  2QXZ A;  3KRG A;  4URR A;  2NTB A;  4U49 A;  3SUC A;  1EE6 A;  4YZA A;  1NHC A;  2ODL A;  4U4B A;  1O8L A;  1O8K A;  2PEC A;  1OOC A;  2BSP A;  2Z8G A;  4OJL A;  4Z05 A;  3ZPP A;  1PLU A;  4W8Q A;  2QX3 A;  2INV A;  2NSP A;  2VJI A;  2EWE A;  1O8M A;  4W8T A;  4XOR A;  2NT9 A;  4NK8 A;  4AVZ A;  2X3H A;  4XN3 A;  4HWV A;  1GQ8 A;  3LMW A;  4XLE A;  2VBM A;  5C1E A;  1KCD A;  4XOT A;  1PE9 A;  3GQ7 A;  1OGM X;  2X6W A;  4OJP A;  3GRH A;  2IQ7 A;  3B4N A;  2NT6 A;  1IB4 A;  1WMR A;  1OFL A;  4XKV A;  3GQ8 A;  4MXN A;  1QJV A;  4XN0 A;  2VJJ A; 
#chains in the Genus database with same CATH topology
 1BN8 A;  2J8I A;  2VFQ A;  1BHE A;  2X6X A;  3EQN A;  1PXZ A;  1KTW A;  1K4Z A;  2QYU A;  1HG8 A;  2VFM A;  4JRA C;  4OJ5 A;  1KQ5 A;  4OM9 A;  4YFO A;  4I84 A;  3T9G A;  2IOU G;  1O8F A;  1K5C A;  1KCC A;  2PYH A;  4XR6 A;  4C2L A;  4XQF A;  2O0W A;  1IDJ A;  1TYU A;  1EA0 A;  1IA5 A;  2BM6 A;  1O88 A;  1LLW A;  4YZ0 A;  4XM3 A;  4OJO A;  1TYW A;  2B0R A;  2O04 A;  5JLV C;  1AIR A;  2NTP A;  2UVE A;  3GQ9 A;  2BX6 A;  4NK6 A;  3VMW A;  1DAB A;  3VST A;  3B90 A;  2NTQ A;  3B8Y A;  3SQV A;  1L1I A;  1RWR A;  1JRG A;  3BH7 B;  4EW9 A;  1TYX A;  2O17 A;  3FY3 A;  1IDK A;  4XLC A;  3VSV A;  3VSU A;  1DBG A;  1OFM A;  2VBE A;  1O8J A;  2PYG A;  4YEI A;  4W8S A;  1XG2 A;  1JTA A;  2YUH A;  3AK5 A;  2O1D A;  3NAW A;  2O6W A;  4XL9 A;  4W8Q A;  1RMG A;  1VBL A;  1X0C A;  4YEJ A;  4XKW A;  3JX8 A;  2XTW A;  2O0V A;  2VFN A;  4W8R A;  3SYJ A;  1LM1 A;  2NZM A;  4KH3 A;  3N6Z A;  2INU A;  3P4G A;  1QRC A;  3EQO A;  2VFO A;  4PMH A;  1QCX A;  1EZG A;  1O8E A;  2QY1 A;  4XON A;  1TSP A;  2J8K A;  2BM5 A;  1DBO A;  3LJY A;  4XLF A;  4YEL A;  2XT2 A;  1OGO X;  1CZF A;  2X6Y A;  1O8G A;  3N90 A;  4OZZ A;  4XOP A;  4XNF A;  3SZE A;  4OJ6 A;  4V02 C;  3ML3 A;  1H80 A;  1TYV A;  1HF2 A;  4YZX A;  4XLH A;  2G0Y A;  2BM4 A;  1CLW A;  1O8I A;  3H09 A;  4YCQ A;  1O8D A;  4Z06 A;  4XMY A;  4YZQ A;  3VMV A;  1OFD A;  3ZSC A;  3WWG A;  1K8F A;  1O8H A;  5DNS A;  2NST A;  3UW0 A;  3JUR A;  4XLA A;  1RU4 A;  3SY2 A;  4MR0 A;  2X85 A;  3PSS A;  5AMV A;  5C1C A;  1WXR A;  3GQA A;  4OZY A;  4Z03 A;  2F3L A;  2UVF A;  2QXZ A;  2VBK A;  3KRG A;  4YC5 A;  3RIQ A;  2QZA A;  1QA2 A;  4URR A;  1QA1 A;  4OPW A;  2NTB A;  4U49 A;  3TH0 A;  3SUC A;  1QRB A;  1EE6 A;  3DU1 X;  4YZA A;  1NHC A;  3BH6 B;  2ODL A;  4U4B A;  1O8L A;  1O8K A;  2PEC A;  1OOC A;  2BSP A;  2Z8G A;  4OJL A;  4Z05 A;  3ZPP A;  2BM7 A;  1PLU A;  1LLZ A;  2QX3 A;  2W7Z A;  3PSZ A;  3LYC A;  1QQ1 A;  2INV A;  2NSP A;  2V5I A;  2EWE A;  2VJI A;  1O8M A;  4W8T A;  4XOR A;  2NT9 A;  4NK8 A;  4YDT A;  4AVZ A;  1OFE A;  2X3H A;  4XN3 A;  4HWV A;  1GQ8 A;  2XT4 A;  3LMW A;  4XLE A;  2XTY A;  2VBM A;  5C1E A;  1KCD A;  4XOT A;  1PE9 A;  2VFP A;  3GQ7 A;  2XC1 A;  1OGM X;  2X6W A;  2XTX A;  4OJP A;  3GRH A;  2IQ7 A;  3B4N A;  2NT6 A;  3NB2 A;  5JMC B;  3PET A;  1WMR A;  1IB4 A;  1OFL A;  4XKV A;  3GQ8 A;  1QA3 A;  4MXN A;  1QJV A;  4XN0 A;  2VJJ A; 
#chains in the Genus database with same CATH homology
 1BN8 A;  2X6X A;  1BHE A;  3EQN A;  1PXZ A;  1KTW A;  3T9G A;  1HG8 A;  4OJ5 A;  4I84 A;  1K5C A;  1O8F A;  1KCC A;  2PYH A;  4XR6 A;  4C2L A;  4XQF A;  2O0W A;  1IDJ A;  1IA5 A;  1O88 A;  4YZ0 A;  4XM3 A;  4OJO A;  2O04 A;  1AIR A;  2NTP A;  2UVE A;  3GQ9 A;  4NK6 A;  3VMW A;  3VST A;  3B90 A;  2NTQ A;  3B8Y A;  1RWR A;  1JRG A;  4EW9 A;  2O17 A;  3FY3 A;  1IDK A;  4XLC A;  3VSV A;  3VSU A;  1DBG A;  2VBE A;  1OFM A;  1O8J A;  2PYG A;  4W8S A;  1XG2 A;  1JTA A;  2O1D A;  4XL9 A;  1RMG A;  1VBL A;  1X0C A;  4YEJ A;  4XKW A;  2O0V A;  4W8R A;  2NZM A;  2INU A;  3EQO A;  4PMH A;  1QCX A;  1O8E A;  2QY1 A;  4XON A;  1DBO A;  4XLF A;  4YEL A;  1OGO X;  2X6Y A;  1CZF A;  1O8G A;  4XNF A;  4OZZ A;  4XOP A;  4OJ6 A;  1H80 A;  4YZX A;  4XLH A;  1O8I A;  3ZSC A;  1O8D A;  4Z06 A;  4XMY A;  4YZQ A;  3VMV A;  3WWG A;  3UW0 A;  1O8H A;  2NST A;  3JUR A;  4XLA A;  1RU4 A;  4MR0 A;  2X85 A;  5AMV A;  5C1C A;  3GQA A;  4OZY A;  4Z03 A;  2UVF A;  2VBK A;  2QXZ A;  3KRG A;  4URR A;  2NTB A;  4U49 A;  3SUC A;  1EE6 A;  4YZA A;  1NHC A;  2ODL A;  4U4B A;  1O8L A;  1O8K A;  2PEC A;  1OOC A;  2BSP A;  2Z8G A;  4OJL A;  4Z05 A;  3ZPP A;  1PLU A;  4W8Q A;  2QX3 A;  2INV A;  2NSP A;  2VJI A;  2EWE A;  1O8M A;  4W8T A;  4XOR A;  2NT9 A;  4NK8 A;  4AVZ A;  2X3H A;  4XN3 A;  4HWV A;  1GQ8 A;  3LMW A;  4XLE A;  2VBM A;  5C1E A;  1KCD A;  4XOT A;  1PE9 A;  3GQ7 A;  1OGM X;  2X6W A;  4OJP A;  3GRH A;  2IQ7 A;  3B4N A;  2NT6 A;  1IB4 A;  1WMR A;  1OFL A;  4XKV A;  3GQ8 A;  4MXN A;  1QJV A;  4XN0 A;  2VJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...