3FY3A

Crystal structure of truncated hemolysin a from p. mirabilis
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
b'NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQQEVFGIAAEYVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title Structural and functional studies of truncated hemolysin A from Proteus mirabilis.
pubmed doi rcsb
source organism Proteus mirabilis
molecule tags Toxin
total genus 77
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3fy3A00
2X6YA 1GQ8A 2UVEA 2X3HA 2X85A 1O8KA 2QXZA 3VMVA 1IB4A 4XQFA 2UVFA 1K5CA 2NTQA 4XLEA 2VBKA 2EWEA 4OZZA 1WMRA 4Z05A 1O8MA 3KRGA 1DBGA 2O0WA 2NT9A 5C1CA 1PLUA 4OJ5A 4URRA 2X6XA 3JURA 3T9GA 2NSTA 2O04A 4OJLA 4YEJA 2PECA 4XOPA 1O8GA 3ZSCA 4XLHA 2PYHA 4XL9A 1OOCA 4XNFA 1IDKA 2IQ7A 1KCCA 4W8QA 1BHEA 1XG2A 2VBEA 3WWGA 4XLFA 4NK8A 3ZPPA 2VJJA 2NSPA 1HG8A 3GRHA 2PYGA 1JTAA 1AIRA 1KTWA 2Z8GA 4EW9A 1QCXA 2NT6A 3GQ8A 4XORA 4W8SA 1O8EA 1H80A 2NTPA 3EQNA 4XLAA 1IA5A 1KCDA 4XONA 1EE6A 1O8LA 4XN3A 1CZFA 1OFLA 3FY3A 4OJOA 4YZXA 3GQAA 1BN8A 4XLCA 4MR0A 3SUCA 4C2LA 4Z03A 2VBMA 2O0VA 4W8RA 4XR6A 3UW0A 3B4NA 2QY1A 2NZMA 4XOTA 2X6WA 1OGOX 1IDJA 4NK6A 3GQ7A 1RMGA 2QX3A 1OFMA 4HWVA 3LMWA 1RU4A 2BSPA 4Z06A 4YZ0A 4AVZA 4XN0A 4PMHA 4XM3A 4I84A 5C1EA 1O8FA 1JRGA 4YZQA 3VSUA 3GQ9A 3VSTA 2ODLA 3B90A 4OJPA 1VBLA 4U49A 4U4BA 1PE9A 4XMYA 1O88A 4XKWA 1QJVA 4YZAA 4MXNA 4YELA 1O8HA 4OZYA 2O1DA 1RWRA 2INVA 2O17A 1O8IA 4W8TA 1O8DA 1X0CA 2NTBA 1DBOA 1OGMX 4XKVA 2VJIA 3EQOA 3B8YA 1NHCA 1O8JA 1PXZA 4OJ6A 3VMWA 3VSVA 2INUA 5AMVA
chains in the Genus database with same CATH superfamily
1QRBA 2X6YA 1GQ8A 2UVEA 2X3HA 2XT4A 2XTXA 1TYXA 2X85A 1O8KA 2QXZA 3VMVA 3DU1X 2O6WA 3N6ZA 1IB4A 4XQFA 2UVFA 1K5CA 2NTQA 4XLEA 2VBKA 2VFOA 1QA1A 2EWEA 4OZZA 2BM5A 2F3LA 3SYJA 1WMRA 4Z05A 1O8MA 3KRGA 1DBGA 2O0WA 2B0RA 2NT9A 1WXRA 5DNSA 5C1CA 4OM9A 1PLUA 4OJ5A 3H09A 4URRA 2X6XA 4V02C 1LLZA 3JURA 3T9GA 2NSTA 1HF2A 2O04A 4OJLA 1EZGA 4YEJA 2PECA 4XOPA 1O8GA 3ZSCA 4XLHA 2PYHA 4XL9A 1OOCA 4XNFA 1IDKA 2IQ7A 3RIQA 2QZAA 2BX6A 1KCCA 4YC5A 4W8QA 1BHEA 1XG2A 2VBEA 3WWGA 1TYWA 3N90A 3LYCA 4XLFA 3PSSA 1TYUA 2VJJA 4NK8A 3ZPPA 2NSPA 1HG8A 4YDTA 3ML3A 3GRHA 5JLVC 2PYGA 1JTAA 1AIRA 1KQ5A 1KTWA 2Z8GA 4EW9A 1QCXA 4YFOA 2NT6A 3GQ8A 4XORA 4W8SA 1O8EA 2V5IA 2BM4A 2XTWA 1H80A 2NTPA 3EQNA 4KH3A 4XLAA 1IA5A 1KCDA 4XONA 1EE6A 2VFQA 2YUHA 1O8LA 3AK5A 4XN3A 1CZFA 1TSPA 1OFLA 3NB2A 3FY3A 2J8KA 1QQ1A 4OJOA 4YZXA 3GQAA 3SQVA 1BN8A 4XLCA 4MR0A 3SUCA 4C2LA 1CLWA 2VBMA 4Z03A 2O0VA 4W8RA 4XR6A 3UW0A 3B4NA 1OFEA 2QY1A 2NZMA 2VFMA 4XOTA 1QA3A 2X6WA 1OGOX 1EA0A 1K4ZA 3PSZA 4YEIA 1IDJA 4NK6A 3GQ7A 1RMGA 2J8IA 2QX3A 3PETA 1OFMA 3P4GA 4HWVA 3LMWA 3SZEA 2W7ZA 1RU4A 2BSPA 2VFNA 4Z06A 4YZ0A 1K8FA 4XN0A 4PMHA 4AVZA 1L1IA 1LM1A 4XM3A 4I84A 5C1EA 1O8FA 1JRGA 2XT2A 4YZQA 3BH7B 3VSUA 3GQ9A 3NAWA 3VSTA 2G0YA 2ODLA 3B90A 3LJYA 1VBLA 4OJPA 2XTYA 4U49A 1QA2A 3BH6B 4U4BA 1PE9A 2IOUG 3SY2A 4YCQA 2BM6A 4XMYA 1QRCA 1O88A 4XKWA 1QJVA 1LLWA 4YZAA 4MXNA 4YELA 1O8HA 4OZYA 1TYVA 2O1DA 1RWRA 2INVA 3TH0A 2O17A 2XC1A 1O8IA 4OPWA 4W8TA 1O8DA 2VFPA 1X0CA 2NTBA 1DBOA 1OGMX 4XKVA 2VJIA 3EQOA 1OFDA 3B8YA 1NHCA 1O8JA 1PXZA 2BM7A 3JX8A 4JRAC 2QYUA 4OJ6A 3VMWA 3VSVA 2INUA 5JMCB 1DABA 5AMVA
chains in the Genus database with same CATH topology
2X6YA 1GQ8A 2UVEA 2X3HA 2X85A 1O8KA 2QXZA 3VMVA 1IB4A 4XQFA 2UVFA 1K5CA 2NTQA 4XLEA 2VBKA 2EWEA 4OZZA 1WMRA 4Z05A 1O8MA 3KRGA 1DBGA 2O0WA 2NT9A 5C1CA 1PLUA 4OJ5A 4URRA 2X6XA 3JURA 3T9GA 2NSTA 2O04A 4OJLA 4YEJA 2PECA 4XOPA 1O8GA 3ZSCA 4XLHA 2PYHA 4XL9A 1OOCA 4XNFA 1IDKA 2IQ7A 1KCCA 4W8QA 1BHEA 1XG2A 2VBEA 3WWGA 4XLFA 4NK8A 3ZPPA 2VJJA 2NSPA 1HG8A 3GRHA 2PYGA 1JTAA 1AIRA 1KTWA 2Z8GA 4EW9A 1QCXA 2NT6A 3GQ8A 4XORA 4W8SA 1O8EA 1H80A 2NTPA 3EQNA 4XLAA 1IA5A 1KCDA 4XONA 1EE6A 1O8LA 4XN3A 1CZFA 1OFLA 3FY3A 4OJOA 4YZXA 3GQAA 1BN8A 4XLCA 4MR0A 3SUCA 4C2LA 4Z03A 2VBMA 2O0VA 4W8RA 4XR6A 3UW0A 3B4NA 2QY1A 2NZMA 4XOTA 2X6WA 1OGOX 1IDJA 4NK6A 3GQ7A 1RMGA 2QX3A 1OFMA 4HWVA 3LMWA 1RU4A 2BSPA 4Z06A 4YZ0A 4AVZA 4XN0A 4PMHA 4XM3A 4I84A 5C1EA 1O8FA 1JRGA 4YZQA 3VSUA 3GQ9A 3VSTA 2ODLA 3B90A 4OJPA 1VBLA 4U49A 4U4BA 1PE9A 4XMYA 1O88A 4XKWA 1QJVA 4YZAA 4MXNA 4YELA 1O8HA 4OZYA 2O1DA 1RWRA 2INVA 2O17A 1O8IA 4W8TA 1O8DA 1X0CA 2NTBA 1DBOA 1OGMX 4XKVA 2VJIA 3EQOA 3B8YA 1NHCA 1O8JA 1PXZA 4OJ6A 3VMWA 3VSVA 2INUA 5AMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6Y A;  1GQ8 A;  2UVE A;  2X3H A;  2X85 A;  1O8K A;  2QXZ A;  3VMV A;  1IB4 A;  4XQF A;  2UVF A;  1K5C A;  2NTQ A;  4XLE A;  2VBK A;  2EWE A;  4OZZ A;  1WMR A;  4Z05 A;  1O8M A;  3KRG A;  1DBG A;  2O0W A;  2NT9 A;  5C1C A;  1PLU A;  4OJ5 A;  4URR A;  2X6X A;  3JUR A;  3T9G A;  2NST A;  2O04 A;  4OJL A;  4YEJ A;  2PEC A;  4XOP A;  1O8G A;  3ZSC A;  4XLH A;  2PYH A;  4XL9 A;  1OOC A;  4XNF A;  1IDK A;  2IQ7 A;  1KCC A;  4W8Q A;  1BHE A;  1XG2 A;  2VBE A;  3WWG A;  4XLF A;  4NK8 A;  3ZPP A;  2VJJ A;  2NSP A;  1HG8 A;  3GRH A;  2PYG A;  1JTA A;  1AIR A;  1KTW A;  2Z8G A;  4EW9 A;  1QCX A;  2NT6 A;  3GQ8 A;  4XOR A;  4W8S A;  1O8E A;  1H80 A;  2NTP A;  3EQN A;  4XLA A;  1IA5 A;  1KCD A;  4XON A;  1EE6 A;  1O8L A;  4XN3 A;  1CZF A;  1OFL A;  3FY3 A;  4OJO A;  4YZX A;  3GQA A;  1BN8 A;  4XLC A;  4MR0 A;  3SUC A;  4C2L A;  4Z03 A;  2VBM A;  2O0V A;  4W8R A;  4XR6 A;  3UW0 A;  3B4N A;  2QY1 A;  2NZM A;  4XOT A;  2X6W A;  1OGO X;  1IDJ A;  4NK6 A;  3GQ7 A;  1RMG A;  2QX3 A;  1OFM A;  4HWV A;  3LMW A;  1RU4 A;  2BSP A;  4Z06 A;  4YZ0 A;  4AVZ A;  4XN0 A;  4PMH A;  4XM3 A;  4I84 A;  5C1E A;  1O8F A;  1JRG A;  4YZQ A;  3VSU A;  3GQ9 A;  3VST A;  2ODL A;  3B90 A;  4OJP A;  1VBL A;  4U49 A;  4U4B A;  1PE9 A;  4XMY A;  1O88 A;  4XKW A;  1QJV A;  4YZA A;  4MXN A;  4YEL A;  1O8H A;  4OZY A;  2O1D A;  1RWR A;  2INV A;  2O17 A;  1O8I A;  4W8T A;  1O8D A;  1X0C A;  2NTB A;  1DBO A;  1OGM X;  4XKV A;  2VJI A;  3EQO A;  3B8Y A;  1NHC A;  1O8J A;  1PXZ A;  4OJ6 A;  3VMW A;  3VSV A;  2INU A;  5AMV A; 
#chains in the Genus database with same CATH topology
 1QRB A;  2X6Y A;  1GQ8 A;  2UVE A;  2X3H A;  2XT4 A;  2XTX A;  1TYX A;  2X85 A;  1O8K A;  2QXZ A;  3VMV A;  3DU1 X;  2O6W A;  3N6Z A;  1IB4 A;  4XQF A;  2UVF A;  1K5C A;  2NTQ A;  4XLE A;  2VBK A;  2VFO A;  1QA1 A;  2EWE A;  4OZZ A;  2BM5 A;  2F3L A;  3SYJ A;  1WMR A;  4Z05 A;  1O8M A;  3KRG A;  1DBG A;  2O0W A;  2B0R A;  2NT9 A;  1WXR A;  5DNS A;  5C1C A;  4OM9 A;  1PLU A;  4OJ5 A;  3H09 A;  4URR A;  2X6X A;  4V02 C;  1LLZ A;  3JUR A;  3T9G A;  2NST A;  1HF2 A;  2O04 A;  4OJL A;  1EZG A;  4YEJ A;  2PEC A;  4XOP A;  1O8G A;  3ZSC A;  4XLH A;  2PYH A;  4XL9 A;  1OOC A;  4XNF A;  1IDK A;  2IQ7 A;  3RIQ A;  2QZA A;  2BX6 A;  1KCC A;  4YC5 A;  4W8Q A;  1BHE A;  1XG2 A;  2VBE A;  3WWG A;  1TYW A;  3N90 A;  3LYC A;  4XLF A;  3PSS A;  1TYU A;  2VJJ A;  4NK8 A;  3ZPP A;  2NSP A;  1HG8 A;  4YDT A;  3ML3 A;  3GRH A;  5JLV C;  2PYG A;  1JTA A;  1AIR A;  1KQ5 A;  1KTW A;  2Z8G A;  4EW9 A;  1QCX A;  4YFO A;  2NT6 A;  3GQ8 A;  4XOR A;  4W8S A;  1O8E A;  2V5I A;  2BM4 A;  2XTW A;  1H80 A;  2NTP A;  3EQN A;  4KH3 A;  4XLA A;  1IA5 A;  1KCD A;  4XON A;  1EE6 A;  2VFQ A;  2YUH A;  1O8L A;  3AK5 A;  4XN3 A;  1CZF A;  1TSP A;  1OFL A;  3NB2 A;  3FY3 A;  2J8K A;  1QQ1 A;  4OJO A;  4YZX A;  3GQA A;  3SQV A;  1BN8 A;  4XLC A;  4MR0 A;  3SUC A;  4C2L A;  1CLW A;  2VBM A;  4Z03 A;  2O0V A;  4W8R A;  4XR6 A;  3UW0 A;  3B4N A;  1OFE A;  2QY1 A;  2NZM A;  2VFM A;  4XOT A;  1QA3 A;  2X6W A;  1OGO X;  1EA0 A;  1K4Z A;  3PSZ A;  4YEI A;  1IDJ A;  4NK6 A;  3GQ7 A;  1RMG A;  2J8I A;  2QX3 A;  3PET A;  1OFM A;  3P4G A;  4HWV A;  3LMW A;  3SZE A;  2W7Z A;  1RU4 A;  2BSP A;  2VFN A;  4Z06 A;  4YZ0 A;  1K8F A;  4XN0 A;  4PMH A;  4AVZ A;  1L1I A;  1LM1 A;  4XM3 A;  4I84 A;  5C1E A;  1O8F A;  1JRG A;  2XT2 A;  4YZQ A;  3BH7 B;  3VSU A;  3GQ9 A;  3NAW A;  3VST A;  2G0Y A;  2ODL A;  3B90 A;  3LJY A;  1VBL A;  4OJP A;  2XTY A;  4U49 A;  1QA2 A;  3BH6 B;  4U4B A;  1PE9 A;  2IOU G;  3SY2 A;  4YCQ A;  2BM6 A;  4XMY A;  1QRC A;  1O88 A;  4XKW A;  1QJV A;  1LLW A;  4YZA A;  4MXN A;  4YEL A;  1O8H A;  4OZY A;  1TYV A;  2O1D A;  1RWR A;  2INV A;  3TH0 A;  2O17 A;  2XC1 A;  1O8I A;  4OPW A;  4W8T A;  1O8D A;  2VFP A;  1X0C A;  2NTB A;  1DBO A;  1OGM X;  4XKV A;  2VJI A;  3EQO A;  1OFD A;  3B8Y A;  1NHC A;  1O8J A;  1PXZ A;  2BM7 A;  3JX8 A;  4JRA C;  2QYU A;  4OJ6 A;  3VMW A;  3VSV A;  2INU A;  5JMC B;  1DAB A;  5AMV A; 
#chains in the Genus database with same CATH homology
 2X6Y A;  1GQ8 A;  2UVE A;  2X3H A;  2X85 A;  1O8K A;  2QXZ A;  3VMV A;  1IB4 A;  4XQF A;  2UVF A;  1K5C A;  2NTQ A;  4XLE A;  2VBK A;  2EWE A;  4OZZ A;  1WMR A;  4Z05 A;  1O8M A;  3KRG A;  1DBG A;  2O0W A;  2NT9 A;  5C1C A;  1PLU A;  4OJ5 A;  4URR A;  2X6X A;  3JUR A;  3T9G A;  2NST A;  2O04 A;  4OJL A;  4YEJ A;  2PEC A;  4XOP A;  1O8G A;  3ZSC A;  4XLH A;  2PYH A;  4XL9 A;  1OOC A;  4XNF A;  1IDK A;  2IQ7 A;  1KCC A;  4W8Q A;  1BHE A;  1XG2 A;  2VBE A;  3WWG A;  4XLF A;  4NK8 A;  3ZPP A;  2VJJ A;  2NSP A;  1HG8 A;  3GRH A;  2PYG A;  1JTA A;  1AIR A;  1KTW A;  2Z8G A;  4EW9 A;  1QCX A;  2NT6 A;  3GQ8 A;  4XOR A;  4W8S A;  1O8E A;  1H80 A;  2NTP A;  3EQN A;  4XLA A;  1IA5 A;  1KCD A;  4XON A;  1EE6 A;  1O8L A;  4XN3 A;  1CZF A;  1OFL A;  3FY3 A;  4OJO A;  4YZX A;  3GQA A;  1BN8 A;  4XLC A;  4MR0 A;  3SUC A;  4C2L A;  4Z03 A;  2VBM A;  2O0V A;  4W8R A;  4XR6 A;  3UW0 A;  3B4N A;  2QY1 A;  2NZM A;  4XOT A;  2X6W A;  1OGO X;  1IDJ A;  4NK6 A;  3GQ7 A;  1RMG A;  2QX3 A;  1OFM A;  4HWV A;  3LMW A;  1RU4 A;  2BSP A;  4Z06 A;  4YZ0 A;  4AVZ A;  4XN0 A;  4PMH A;  4XM3 A;  4I84 A;  5C1E A;  1O8F A;  1JRG A;  4YZQ A;  3VSU A;  3GQ9 A;  3VST A;  2ODL A;  3B90 A;  4OJP A;  1VBL A;  4U49 A;  4U4B A;  1PE9 A;  4XMY A;  1O88 A;  4XKW A;  1QJV A;  4YZA A;  4MXN A;  4YEL A;  1O8H A;  4OZY A;  2O1D A;  1RWR A;  2INV A;  2O17 A;  1O8I A;  4W8T A;  1O8D A;  1X0C A;  2NTB A;  1DBO A;  1OGM X;  4XKV A;  2VJI A;  3EQO A;  3B8Y A;  1NHC A;  1O8J A;  1PXZ A;  4OJ6 A;  3VMW A;  3VSV A;  2INU A;  5AMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...