3FY3A

Crystal structure of truncated hemolysin a from p. mirabilis
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQQEVFGIAAEYVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Hemolysin
publication title Structural and functional studies of truncated hemolysin A from Proteus mirabilis.
pubmed doi rcsb
source organism Proteus mirabilis
total genus 77
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3fy3A00
4YZQA 2VBKA 4URRA 1OFLA 1X0CA 2VJIA 3GQ8A 4W8TA 5C1CA 4XN0A 1JTAA 4YZ0A 3GQ7A 4Z03A 1K5CA 1OFMA 2VJJA 2QXZA 3GQ9A 4U49A 1O8MA 4OJLA 2X6XA 1GQ8A 2NSPA 1O88A 4W8SA 2O17A 1QJVA 4XNFA 4XOPA 1O8HA 2O0VA 4W8QA 3LMWA 2PYGA 2O1DA 4NK6A 2O04A 3B90A 1DBOA 3ZPPA 1IA5A 2INVA 4XOTA 4W8RA 1WMRA 1H80A 1O8LA 4XR6A 4XQFA 4OZYA 4XORA 1OGMX 2NTPA 2X6YA 1CZFA 4YZXA 1QCXA 4MXNA 2NT9A 1HG8A 2EWEA 4OJOA 3VSTA 1RMGA 2X3HA 3GRHA 4AVZA 1KCDA 4XKWA 2ODLA 4YZAA 1PE9A 4PMHA 2UVFA 2PYHA 2O0WA 2VBMA 1BN8A 1O8DA 2QX3A 1O8IA 2X6WA 3GQAA 4I84A 4C2LA 1JRGA 1PXZA 3VSVA 4XLAA 4XM3A 4XLFA 4XLHA 2X85A 2Z8GA 4OJ6A 1RWRA 4XMYA 4U4BA 3B8YA 2BSPA 4YEJA 1RU4A 1OOCA 1KCCA 1O8KA 4EW9A 3JURA 1O8FA 2NTBA 1OGOX 3WWGA 4Z05A 3FY3A 3VSUA 2NZMA 2VBEA 5AMVA 3KRGA 1BHEA 4MR0A 1IB4A 3UW0A 3B4NA 1PLUA 3EQNA 1O8JA 4OJPA 2IQ7A 3SUCA 4XN3A 3EQOA 4OZZA 4XONA 4NK8A 1IDJA 3VMVA 2INUA 4XKVA 1AIRA 4XLEA 1O8EA 1O8GA 1KTWA 2QY1A 3ZSCA 2NT6A 3T9GA 1VBLA 1EE6A 4OJ5A 3VMWA 4YELA 4XL9A 2NTQA 2UVEA 4Z06A 5C1EA 1DBGA 1IDKA 1XG2A 2NSTA 2PECA 4HWVA 1NHCA 4XLCA
chains in the Genus database with same CATH superfamily
2QYUA 2QZAA 4YZQA 1QRBA 2VBKA 4URRA 5JLVC 1OFLA 1X0CA 2VJIA 3GQ8A 3PSZA 3BH6B 4W8TA 2VFQA 1JTAA 4XN0A 3SY2A 4YZ0A 3GQ7A 4Z03A 1K5CA 2V5IA 1OFMA 2VJJA 2QXZA 3GQ9A 4U49A 1O8MA 1K8FA 1OFEA 1QA2A 4OJLA 2X6XA 1GQ8A 2NSPA 1O88A 4W8SA 2O17A 1QJVA 3BH7B 2BM6A 1O8HA 2O0VA 4XOPA 4XNFA 4W8QA 3LMWA 2PYGA 2O1DA 4NK6A 2O04A 3B90A 1DBOA 1LLWA 1QA1A 2BX6A 3ZPPA 1IA5A 2VFPA 2INVA 2XTYA 1QA3A 4XOTA 4W8RA 4YC5A 1WMRA 1H80A 1HF2A 3TH0A 3RIQA 1O8LA 4XR6A 1OFDA 4XQFA 3SQVA 1TYUA 4OZYA 4XORA 1OGMX 2J8IA 1QRCA 1TSPA 2NTPA 1CZFA 2X6YA 2XT2A 2BM7A 5DNSA 4YZXA 1QCXA 2W7ZA 4MXNA 2NT9A 4V02C 3NB2A 3PSSA 1HG8A 4YFOA 2G0YA 1EZGA 2EWEA 2VFMA 4OJOA 3VSTA 1RMGA 2X3HA 2XTWA 4KH3A 3GRHA 4AVZA 1KCDA 4XKWA 2ODLA 4YZAA 1PE9A 4PMHA 2UVFA 2PYHA 1CLWA 2O0WA 1BN8A 2VBMA 1O8DA 1O8IA 2QX3A 2X6WA 3GQAA 3NAWA 2VFOA 4I84A 3N6ZA 3SYJA 4C2LA 1JRGA 3H09A 1PXZA 1L1IA 3VSVA 4XLAA 4XM3A 4XLFA 4XLHA 2O6WA 2X85A 2Z8GA 4OJ6A 1RWRA 4OM9A 4XMYA 2XTXA 4U4BA 5JMCB 3B8YA 2BSPA 4YEJA 1RU4A 1OOCA 1KCCA 1O8KA 2XC1A 4EW9A 3JURA 1O8FA 2NTBA 1OGOX 3WWGA 4Z05A 3FY3A 1TYXA 3VSUA 2BM4A 2NZMA 2VBEA 5AMVA 2BM5A 3LYCA 3KRGA 1BHEA 4MR0A 1IB4A 1LLZA 3UW0A 3LJYA 3B4NA 1PLUA 3EQNA 1O8JA 4OJPA 2IQ7A 3SUCA 1EA0A 4XN3A 2F3LA 3EQOA 3P4GA 4OZZA 4XONA 4NK8A 1LM1A 1IDJA 3SZEA 4YCQA 3VMVA 2INUA 2VFNA 1K4ZA 1AIRA 1KQ5A 4XKVA 4XLEA 4YDTA 1O8EA 1O8GA 4OPWA 1DABA 3AK5A 3ML3A 1KTWA 2XT4A 4JRAC 2QY1A 3ZSCA 2NT6A 1TYVA 3T9GA 1VBLA 1EE6A 4OJ5A 3VMWA 3DU1X 3JX8A 2IOUG 3N90A 4XL9A 4YELA 1TYWA 5C1CA 2NTQA 2UVEA 4Z06A 2YUHA 4YEIA 2J8KA 5C1EA 1DBGA 1IDKA 1QQ1A 1XG2A 2NSTA 2PECA 4HWVA 1WXRA 2B0RA 1NHCA 3PETA 4XLCA
chains in the Genus database with same CATH topology
4YZQA 2VBKA 4URRA 1OFLA 1X0CA 2VJIA 3GQ8A 4W8TA 5C1CA 4XN0A 1JTAA 4YZ0A 3GQ7A 4Z03A 1K5CA 1OFMA 2VJJA 2QXZA 3GQ9A 4U49A 1O8MA 4OJLA 2X6XA 1GQ8A 2NSPA 1O88A 4W8SA 2O17A 1QJVA 4XNFA 4XOPA 1O8HA 2O0VA 4W8QA 3LMWA 2PYGA 2O1DA 4NK6A 2O04A 3B90A 1DBOA 3ZPPA 1IA5A 2INVA 4XOTA 4W8RA 1WMRA 1H80A 1O8LA 4XR6A 4XQFA 4OZYA 4XORA 1OGMX 2NTPA 2X6YA 1CZFA 4YZXA 1QCXA 4MXNA 2NT9A 1HG8A 2EWEA 4OJOA 3VSTA 1RMGA 2X3HA 3GRHA 4AVZA 1KCDA 4XKWA 2ODLA 4YZAA 1PE9A 4PMHA 2UVFA 2PYHA 2O0WA 2VBMA 1BN8A 1O8DA 2QX3A 1O8IA 2X6WA 3GQAA 4I84A 4C2LA 1JRGA 1PXZA 3VSVA 4XLAA 4XM3A 4XLFA 4XLHA 2X85A 2Z8GA 4OJ6A 1RWRA 4XMYA 4U4BA 3B8YA 2BSPA 4YEJA 1RU4A 1OOCA 1KCCA 1O8KA 4EW9A 3JURA 1O8FA 2NTBA 1OGOX 3WWGA 4Z05A 3FY3A 3VSUA 2NZMA 2VBEA 5AMVA 3KRGA 1BHEA 4MR0A 1IB4A 3UW0A 3B4NA 1PLUA 3EQNA 1O8JA 4OJPA 2IQ7A 3SUCA 4XN3A 3EQOA 4OZZA 4XONA 4NK8A 1IDJA 3VMVA 2INUA 4XKVA 1AIRA 4XLEA 1O8EA 1O8GA 1KTWA 2QY1A 3ZSCA 2NT6A 3T9GA 1VBLA 1EE6A 4OJ5A 3VMWA 4YELA 4XL9A 2NTQA 2UVEA 4Z06A 5C1EA 1DBGA 1IDKA 1XG2A 2NSTA 2PECA 4HWVA 1NHCA 4XLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZQ A;  2VBK A;  4URR A;  1OFL A;  1X0C A;  2VJI A;  3GQ8 A;  4W8T A;  5C1C A;  4XN0 A;  1JTA A;  4YZ0 A;  3GQ7 A;  4Z03 A;  1K5C A;  1OFM A;  2VJJ A;  2QXZ A;  3GQ9 A;  4U49 A;  1O8M A;  4OJL A;  2X6X A;  1GQ8 A;  2NSP A;  1O88 A;  4W8S A;  2O17 A;  1QJV A;  4XNF A;  4XOP A;  1O8H A;  2O0V A;  4W8Q A;  3LMW A;  2PYG A;  2O1D A;  4NK6 A;  2O04 A;  3B90 A;  1DBO A;  3ZPP A;  1IA5 A;  2INV A;  4XOT A;  4W8R A;  1WMR A;  1H80 A;  1O8L A;  4XR6 A;  4XQF A;  4OZY A;  4XOR A;  1OGM X;  2NTP A;  2X6Y A;  1CZF A;  4YZX A;  1QCX A;  4MXN A;  2NT9 A;  1HG8 A;  2EWE A;  4OJO A;  3VST A;  1RMG A;  2X3H A;  3GRH A;  4AVZ A;  1KCD A;  4XKW A;  2ODL A;  4YZA A;  1PE9 A;  4PMH A;  2UVF A;  2PYH A;  2O0W A;  2VBM A;  1BN8 A;  1O8D A;  2QX3 A;  1O8I A;  2X6W A;  3GQA A;  4I84 A;  4C2L A;  1JRG A;  1PXZ A;  3VSV A;  4XLA A;  4XM3 A;  4XLF A;  4XLH A;  2X85 A;  2Z8G A;  4OJ6 A;  1RWR A;  4XMY A;  4U4B A;  3B8Y A;  2BSP A;  4YEJ A;  1RU4 A;  1OOC A;  1KCC A;  1O8K A;  4EW9 A;  3JUR A;  1O8F A;  2NTB A;  1OGO X;  3WWG A;  4Z05 A;  3FY3 A;  3VSU A;  2NZM A;  2VBE A;  5AMV A;  3KRG A;  1BHE A;  4MR0 A;  1IB4 A;  3UW0 A;  3B4N A;  1PLU A;  3EQN A;  1O8J A;  4OJP A;  2IQ7 A;  3SUC A;  4XN3 A;  3EQO A;  4OZZ A;  4XON A;  4NK8 A;  1IDJ A;  3VMV A;  2INU A;  4XKV A;  1AIR A;  4XLE A;  1O8E A;  1O8G A;  1KTW A;  2QY1 A;  3ZSC A;  2NT6 A;  3T9G A;  1VBL A;  1EE6 A;  4OJ5 A;  3VMW A;  4YEL A;  4XL9 A;  2NTQ A;  2UVE A;  4Z06 A;  5C1E A;  1DBG A;  1IDK A;  1XG2 A;  2NST A;  2PEC A;  4HWV A;  1NHC A;  4XLC A; 
#chains in the Genus database with same CATH topology
 2QYU A;  2QZA A;  4YZQ A;  1QRB A;  2VBK A;  4URR A;  5JLV C;  1OFL A;  1X0C A;  2VJI A;  3GQ8 A;  3PSZ A;  3BH6 B;  4W8T A;  2VFQ A;  1JTA A;  4XN0 A;  3SY2 A;  4YZ0 A;  3GQ7 A;  4Z03 A;  1K5C A;  2V5I A;  1OFM A;  2VJJ A;  2QXZ A;  3GQ9 A;  4U49 A;  1O8M A;  1K8F A;  1OFE A;  1QA2 A;  4OJL A;  2X6X A;  1GQ8 A;  2NSP A;  1O88 A;  4W8S A;  2O17 A;  1QJV A;  3BH7 B;  2BM6 A;  1O8H A;  2O0V A;  4XOP A;  4XNF A;  4W8Q A;  3LMW A;  2PYG A;  2O1D A;  4NK6 A;  2O04 A;  3B90 A;  1DBO A;  1LLW A;  1QA1 A;  2BX6 A;  3ZPP A;  1IA5 A;  2VFP A;  2INV A;  2XTY A;  1QA3 A;  4XOT A;  4W8R A;  4YC5 A;  1WMR A;  1H80 A;  1HF2 A;  3TH0 A;  3RIQ A;  1O8L A;  4XR6 A;  1OFD A;  4XQF A;  3SQV A;  1TYU A;  4OZY A;  4XOR A;  1OGM X;  2J8I A;  1QRC A;  1TSP A;  2NTP A;  1CZF A;  2X6Y A;  2XT2 A;  2BM7 A;  5DNS A;  4YZX A;  1QCX A;  2W7Z A;  4MXN A;  2NT9 A;  4V02 C;  3NB2 A;  3PSS A;  1HG8 A;  4YFO A;  2G0Y A;  1EZG A;  2EWE A;  2VFM A;  4OJO A;  3VST A;  1RMG A;  2X3H A;  2XTW A;  4KH3 A;  3GRH A;  4AVZ A;  1KCD A;  4XKW A;  2ODL A;  4YZA A;  1PE9 A;  4PMH A;  2UVF A;  2PYH A;  1CLW A;  2O0W A;  1BN8 A;  2VBM A;  1O8D A;  1O8I A;  2QX3 A;  2X6W A;  3GQA A;  3NAW A;  2VFO A;  4I84 A;  3N6Z A;  3SYJ A;  4C2L A;  1JRG A;  3H09 A;  1PXZ A;  1L1I A;  3VSV A;  4XLA A;  4XM3 A;  4XLF A;  4XLH A;  2O6W A;  2X85 A;  2Z8G A;  4OJ6 A;  1RWR A;  4OM9 A;  4XMY A;  2XTX A;  4U4B A;  5JMC B;  3B8Y A;  2BSP A;  4YEJ A;  1RU4 A;  1OOC A;  1KCC A;  1O8K A;  2XC1 A;  4EW9 A;  3JUR A;  1O8F A;  2NTB A;  1OGO X;  3WWG A;  4Z05 A;  3FY3 A;  1TYX A;  3VSU A;  2BM4 A;  2NZM A;  2VBE A;  5AMV A;  2BM5 A;  3LYC A;  3KRG A;  1BHE A;  4MR0 A;  1IB4 A;  1LLZ A;  3UW0 A;  3LJY A;  3B4N A;  1PLU A;  3EQN A;  1O8J A;  4OJP A;  2IQ7 A;  3SUC A;  1EA0 A;  4XN3 A;  2F3L A;  3EQO A;  3P4G A;  4OZZ A;  4XON A;  4NK8 A;  1LM1 A;  1IDJ A;  3SZE A;  4YCQ A;  3VMV A;  2INU A;  2VFN A;  1K4Z A;  1AIR A;  1KQ5 A;  4XKV A;  4XLE A;  4YDT A;  1O8E A;  1O8G A;  4OPW A;  1DAB A;  3AK5 A;  3ML3 A;  1KTW A;  2XT4 A;  4JRA C;  2QY1 A;  3ZSC A;  2NT6 A;  1TYV A;  3T9G A;  1VBL A;  1EE6 A;  4OJ5 A;  3VMW A;  3DU1 X;  3JX8 A;  2IOU G;  3N90 A;  4XL9 A;  4YEL A;  1TYW A;  5C1C A;  2NTQ A;  2UVE A;  4Z06 A;  2YUH A;  4YEI A;  2J8K A;  5C1E A;  1DBG A;  1IDK A;  1QQ1 A;  1XG2 A;  2NST A;  2PEC A;  4HWV A;  1WXR A;  2B0R A;  1NHC A;  3PET A;  4XLC A; 
#chains in the Genus database with same CATH homology
 4YZQ A;  2VBK A;  4URR A;  1OFL A;  1X0C A;  2VJI A;  3GQ8 A;  4W8T A;  5C1C A;  4XN0 A;  1JTA A;  4YZ0 A;  3GQ7 A;  4Z03 A;  1K5C A;  1OFM A;  2VJJ A;  2QXZ A;  3GQ9 A;  4U49 A;  1O8M A;  4OJL A;  2X6X A;  1GQ8 A;  2NSP A;  1O88 A;  4W8S A;  2O17 A;  1QJV A;  4XNF A;  4XOP A;  1O8H A;  2O0V A;  4W8Q A;  3LMW A;  2PYG A;  2O1D A;  4NK6 A;  2O04 A;  3B90 A;  1DBO A;  3ZPP A;  1IA5 A;  2INV A;  4XOT A;  4W8R A;  1WMR A;  1H80 A;  1O8L A;  4XR6 A;  4XQF A;  4OZY A;  4XOR A;  1OGM X;  2NTP A;  2X6Y A;  1CZF A;  4YZX A;  1QCX A;  4MXN A;  2NT9 A;  1HG8 A;  2EWE A;  4OJO A;  3VST A;  1RMG A;  2X3H A;  3GRH A;  4AVZ A;  1KCD A;  4XKW A;  2ODL A;  4YZA A;  1PE9 A;  4PMH A;  2UVF A;  2PYH A;  2O0W A;  2VBM A;  1BN8 A;  1O8D A;  2QX3 A;  1O8I A;  2X6W A;  3GQA A;  4I84 A;  4C2L A;  1JRG A;  1PXZ A;  3VSV A;  4XLA A;  4XM3 A;  4XLF A;  4XLH A;  2X85 A;  2Z8G A;  4OJ6 A;  1RWR A;  4XMY A;  4U4B A;  3B8Y A;  2BSP A;  4YEJ A;  1RU4 A;  1OOC A;  1KCC A;  1O8K A;  4EW9 A;  3JUR A;  1O8F A;  2NTB A;  1OGO X;  3WWG A;  4Z05 A;  3FY3 A;  3VSU A;  2NZM A;  2VBE A;  5AMV A;  3KRG A;  1BHE A;  4MR0 A;  1IB4 A;  3UW0 A;  3B4N A;  1PLU A;  3EQN A;  1O8J A;  4OJP A;  2IQ7 A;  3SUC A;  4XN3 A;  3EQO A;  4OZZ A;  4XON A;  4NK8 A;  1IDJ A;  3VMV A;  2INU A;  4XKV A;  1AIR A;  4XLE A;  1O8E A;  1O8G A;  1KTW A;  2QY1 A;  3ZSC A;  2NT6 A;  3T9G A;  1VBL A;  1EE6 A;  4OJ5 A;  3VMW A;  4YEL A;  4XL9 A;  2NTQ A;  2UVE A;  4Z06 A;  5C1E A;  1DBG A;  1IDK A;  1XG2 A;  2NST A;  2PEC A;  4HWV A;  1NHC A;  4XLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...