4YFOA

Beta1_ex1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
233
structure length
233
Chain Sequence
MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGADLNGADLKQADLSGADLGGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta1_ex1
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 106
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2015-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4yfoA00
2J8KA 3PSZA 2XTWA 3DU1X 4YDTA 2QYUA 4YCQA 2XT4A 3SQVA 2XTXA 2XT2A 3NAWA 2O6WA 3PSSA 4YEIA 2XTYA 3SY2A 4YFOA 4YC5A 2QZAA 3NB2A 5DNSA
chains in the Genus database with same CATH superfamily
4XONA 1O8LA 1O8GA 2VFNA 2XTWA 3DU1X 3B8YA 4YDTA 1TYXA 4MXNA 2PYHA 4V02C 5AMVA 1RMGA 1KCCA 1KCDA 2O17A 2VFOA 3LYCA 2X3HA 1JRGA 4XLHA 1O8EA 2BM5A 3EQOA 3RIQA 5C1CA 2NSTA 2INUA 2X85A 3FY3A 4URRA 4XLAA 1QJVA 3GQ9A 4NK8A 1O88A 2PECA 4OPWA 3T9GA 2VJJA 3ZPPA 1DABA 4Z03A 1XG2A 3BH7B 1HG8A 2NTQA 2O6WA 4MR0A 1IDJA 4OM9A 4W8QA 4U4BA 3SY2A 2O0VA 3VSUA 3ML3A 4OJPA 4XN0A 4YC5A 2BM4A 2IOUG 3VMWA 4OJOA 1PXZA 2G0YA 3PSZA 5C1EA 4OJ5A 3JURA 1WXRA 1QRBA 4XM3A 1LM1A 2YUHA 4C2LA 2UVFA 3KRGA 1O8MA 1OGMX 4YZQA 2IQ7A 1IB4A 1O8HA 4JRAC 4YZ0A 2O0WA 5JMCB 3LJYA 4XN3A 3VMVA 3WWGA 2XTXA 4OZZA 3AK5A 2XT2A 1NHCA 2J8IA 3B4NA 1X0CA 1LLWA 4PMHA 4XLCA 1K8FA 2XTYA 3LMWA 1O8KA 2NSPA 1BN8A 3VSVA 3N6ZA 1DBGA 2QY1A 2VFMA 2UVEA 4W8RA 3EQNA 1K4ZA 2NT6A 1RU4A 2QZAA 2Z8GA 4OJ6A 3GQ7A 1K5CA 1O8IA 4W8SA 3SZEA 2V5IA 3ZSCA 3JX8A 2QYUA 1JTAA 1EA0A 5JLVC 4YZAA 1CZFA 4OZYA 4XLEA 3TH0A 4I84A 1TYUA 2X6XA 2BM6A 1KQ5A 2VBMA 1OFLA 1QA1A 1OFDA 2NZMA 2VJIA 1PE9A 3SQVA 1KTWA 4AVZA 1O8DA 1LLZA 3SUCA 4XMYA 1HF2A 2QX3A 3PSSA 1QRCA 4Z05A 1O8JA 3B90A 4YZXA 1IA5A 1WMRA 2W7ZA 2ODLA 3GRHA 1QCXA 1GQ8A 3GQAA 2VBKA 1IDKA 2VFQA 2O1DA 4W8TA 1OFMA 1QA3A 3NB2A 2NT9A 1EE6A 5DNSA 3UW0A 4XLFA 2VBEA 2J8KA 2INVA 4XL9A 1TYVA 4YCQA 1DBOA 2NTPA 1H80A 1O8FA 3H09A 4XNFA 4YELA 4YEJA 3SYJA 4OJLA 1AIRA 3GQ8A 2XT4A 2B0RA 4HWVA 2BX6A 1EZGA 4Z06A 4XKWA 4KH3A 1QQ1A 1OFEA 2O04A 2XC1A 3VSTA 3NAWA 4EW9A 1VBLA 1QA2A 1TYWA 1CLWA 2NTBA 4U49A 2X6WA 4YEIA 2BSPA 2EWEA 4XKVA 4XOTA 2QXZA 3N90A 1RWRA 1OOCA 4XOPA 2VFPA 4XQFA 1BHEA 1L1IA 4YFOA 2F3LA 3BH6B 3P4GA 4NK6A 1PLUA 1OGOX 1TSPA 2X6YA 3PETA 4XR6A 4XORA 2BM7A 2PYGA
chains in the Genus database with same CATH topology
2J8KA 3PSZA 2XTWA 3DU1X 4YDTA 2QYUA 4YCQA 2XT4A 3SQVA 2XTXA 2XT2A 3NAWA 2O6WA 3PSSA 4YEIA 2XTYA 3SY2A 4YFOA 4YC5A 2QZAA 3NB2A 5DNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8K A;  3PSZ A;  2XTW A;  3DU1 X;  4YDT A;  2QYU A;  4YCQ A;  2XT4 A;  3SQV A;  2XTX A;  2XT2 A;  3NAW A;  2O6W A;  3PSS A;  4YEI A;  2XTY A;  3SY2 A;  4YFO A;  4YC5 A;  2QZA A;  3NB2 A;  5DNS A; 
#chains in the Genus database with same CATH topology
 4XON A;  1O8L A;  1O8G A;  2VFN A;  2XTW A;  3DU1 X;  3B8Y A;  4YDT A;  1TYX A;  4MXN A;  2PYH A;  4V02 C;  5AMV A;  1RMG A;  1KCC A;  1KCD A;  2O17 A;  2VFO A;  3LYC A;  2X3H A;  1JRG A;  4XLH A;  1O8E A;  2BM5 A;  3EQO A;  3RIQ A;  5C1C A;  2NST A;  2INU A;  2X85 A;  3FY3 A;  4URR A;  4XLA A;  1QJV A;  3GQ9 A;  4NK8 A;  1O88 A;  2PEC A;  4OPW A;  3T9G A;  2VJJ A;  3ZPP A;  1DAB A;  4Z03 A;  1XG2 A;  3BH7 B;  1HG8 A;  2NTQ A;  2O6W A;  4MR0 A;  1IDJ A;  4OM9 A;  4W8Q A;  4U4B A;  3SY2 A;  2O0V A;  3VSU A;  3ML3 A;  4OJP A;  4XN0 A;  4YC5 A;  2BM4 A;  2IOU G;  3VMW A;  4OJO A;  1PXZ A;  2G0Y A;  3PSZ A;  5C1E A;  4OJ5 A;  3JUR A;  1WXR A;  1QRB A;  4XM3 A;  1LM1 A;  2YUH A;  4C2L A;  2UVF A;  3KRG A;  1O8M A;  1OGM X;  4YZQ A;  2IQ7 A;  1IB4 A;  1O8H A;  4JRA C;  4YZ0 A;  2O0W A;  5JMC B;  3LJY A;  4XN3 A;  3VMV A;  3WWG A;  2XTX A;  4OZZ A;  3AK5 A;  2XT2 A;  1NHC A;  2J8I A;  3B4N A;  1X0C A;  1LLW A;  4PMH A;  4XLC A;  1K8F A;  2XTY A;  3LMW A;  1O8K A;  2NSP A;  1BN8 A;  3VSV A;  3N6Z A;  1DBG A;  2QY1 A;  2VFM A;  2UVE A;  4W8R A;  3EQN A;  1K4Z A;  2NT6 A;  1RU4 A;  2QZA A;  2Z8G A;  4OJ6 A;  3GQ7 A;  1K5C A;  1O8I A;  4W8S A;  3SZE A;  2V5I A;  3ZSC A;  3JX8 A;  2QYU A;  1JTA A;  1EA0 A;  5JLV C;  4YZA A;  1CZF A;  4OZY A;  4XLE A;  3TH0 A;  4I84 A;  1TYU A;  2X6X A;  2BM6 A;  1KQ5 A;  2VBM A;  1OFL A;  1QA1 A;  1OFD A;  2NZM A;  2VJI A;  1PE9 A;  3SQV A;  1KTW A;  4AVZ A;  1O8D A;  1LLZ A;  3SUC A;  4XMY A;  1HF2 A;  2QX3 A;  3PSS A;  1QRC A;  4Z05 A;  1O8J A;  3B90 A;  4YZX A;  1IA5 A;  1WMR A;  2W7Z A;  2ODL A;  3GRH A;  1QCX A;  1GQ8 A;  3GQA A;  2VBK A;  1IDK A;  2VFQ A;  2O1D A;  4W8T A;  1OFM A;  1QA3 A;  3NB2 A;  2NT9 A;  1EE6 A;  5DNS A;  3UW0 A;  4XLF A;  2VBE A;  2J8K A;  2INV A;  4XL9 A;  1TYV A;  4YCQ A;  1DBO A;  2NTP A;  1H80 A;  1O8F A;  3H09 A;  4XNF A;  4YEL A;  4YEJ A;  3SYJ A;  4OJL A;  1AIR A;  3GQ8 A;  2XT4 A;  2B0R A;  4HWV A;  2BX6 A;  1EZG A;  4Z06 A;  4XKW A;  4KH3 A;  1QQ1 A;  1OFE A;  2O04 A;  2XC1 A;  3VST A;  3NAW A;  4EW9 A;  1VBL A;  1QA2 A;  1TYW A;  1CLW A;  2NTB A;  4U49 A;  2X6W A;  4YEI A;  2BSP A;  2EWE A;  4XKV A;  4XOT A;  2QXZ A;  3N90 A;  1RWR A;  1OOC A;  4XOP A;  2VFP A;  4XQF A;  1BHE A;  1L1I A;  4YFO A;  2F3L A;  3BH6 B;  3P4G A;  4NK6 A;  1PLU A;  1OGO X;  1TSP A;  2X6Y A;  3PET A;  4XR6 A;  4XOR A;  2BM7 A;  2PYG A; 
#chains in the Genus database with same CATH homology
 2J8K A;  3PSZ A;  2XTW A;  3DU1 X;  4YDT A;  2QYU A;  4YCQ A;  2XT4 A;  3SQV A;  2XTX A;  2XT2 A;  3NAW A;  2O6W A;  3PSS A;  4YEI A;  2XTY A;  3SY2 A;  4YFO A;  4YC5 A;  2QZA A;  3NB2 A;  5DNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...