4YFOA

Beta1_ex1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
233
structure length
233
Chain Sequence
b'MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGADLNGADLKQADLSGADLGGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta1_ex1
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 106
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2015-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4yfoA00
4YDTA 2J8KA 3NAWA 2XTWA 5DNSA 2XT4A 2QZAA 4YCQA 2XTXA 2XTYA 3DU1X 3SY2A 3SQVA 4YEIA 2O6WA 3PSSA 4YFOA 3NB2A 2XT2A 2QYUA 3PSZA 4YC5A
chains in the Genus database with same CATH superfamily
5JLVC 1O8LA 2O04A 2NSTA 3GQ7A 1OFMA 1PXZA 1OFLA 1QRCA 2IOUG 4YELA 1IDJA 2O0WA 2QX3A 2INVA 1QCXA 4JRAC 2X3HA 1HG8A 4Z03A 2UVEA 2QZAA 2V5IA 2XTXA 4OJLA 1JRGA 1O88A 2VFMA 2ODLA 4OZZA 4KH3A 2NTBA 1QA2A 4XN3A 1EA0A 4YEIA 1O8MA 4YZAA 1OFEA 3LMWA 1BHEA 3NB2A 1PE9A 3PETA 1IB4A 1O8GA 4YZ0A 4XLCA 1DBGA 1VBLA 1IA5A 3GRHA 4NK8A 1TYVA 2VJIA 4OM9A 4XMYA 3P4GA 4YC5A 2BM7A 2O17A 1PLUA 3UW0A 1QA1A 4XQFA 1TYWA 3RIQA 2NZMA 1DBOA 1QJVA 4OZYA 4OJOA 2QY1A 1QQ1A 4XLEA 5AMVA 3ZSCA 1WXRA 2X6WA 4XOPA 2B0RA 4YCQA 1KTWA 4XONA 3DU1X 2NSPA 3VSTA 2BM6A 3SZEA 3VMVA 3ZPPA 3EQOA 4Z06A 2O0VA 2NTPA 2X6YA 3SQVA 2INUA 5JMCB 2NT6A 3GQAA 1KCDA 3B4NA 2VFPA 4OPWA 2PECA 4XKWA 4XORA 1KQ5A 2Z8GA 2XT2A 2QYUA 2VBKA 3N90A 3PSZA 2X85A 4XLFA 1IDKA 1LM1A 1GQ8A 2O1DA 5C1EA 4OJ6A 4XLHA 1WMRA 3LYCA 3VMWA 1O8EA 4URRA 4V02C 2J8KA 3T9GA 3NAWA 1RMGA 1TYUA 4PMHA 3WWGA 1EE6A 2XTWA 5C1CA 1KCCA 1K4ZA 3GQ9A 2VBMA 3KRGA 2UVFA 4I84A 1O8HA 2EWEA 1JTAA 4Z05A 2BM4A 4NK6A 3SY2A 3VSUA 3AK5A 3BH6B 2NT9A 3TH0A 1OOCA 4W8QA 1OGMX 2F3LA 4U49A 4W8SA 1X0CA 2BM5A 2O6WA 3N6ZA 4XN0A 4YFOA 2VFOA 1O8KA 4XOTA 4YZXA 1QRBA 4W8TA 3H09A 3GQ8A 2G0YA 4OJ5A 2XC1A 4XR6A 4YEJA 1OGOX 1CLWA 3FY3A 1LLWA 4XLAA 1O8JA 1RU4A 2IQ7A 4XKVA 4YDTA 3EQNA 4MR0A 4OJPA 2J8IA 2PYGA 1BN8A 1TYXA 1TSPA 2PYHA 4AVZA 1H80A 1NHCA 5DNSA 1AIRA 2VFNA 1O8IA 2XT4A 4EW9A 2VBEA 1EZGA 1K8FA 2VJJA 2XTYA 4U4BA 4XNFA 2W7ZA 1LLZA 2VFQA 1DABA 1L1IA 1HF2A 1RWRA 3B8YA 1O8DA 3BH7B 4YZQA 2X6XA 3B90A 3PSSA 2NTQA 4XL9A 1O8FA 2BSPA 1QA3A 1OFDA 3SUCA 3SYJA 1K5CA 3LJYA 2BX6A 4XM3A 2QXZA 3JURA 4HWVA 2YUHA 3VSVA 3JX8A 1CZFA 4W8RA 4MXNA 4C2LA 1XG2A 3ML3A
chains in the Genus database with same CATH topology
4YDTA 2J8KA 3NAWA 2XTWA 5DNSA 2XT4A 2QZAA 4YCQA 2XTXA 2XTYA 3DU1X 3SY2A 3SQVA 4YEIA 2O6WA 3PSSA 4YFOA 3NB2A 2XT2A 2QYUA 3PSZA 4YC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDT A;  2J8K A;  3NAW A;  2XTW A;  5DNS A;  2XT4 A;  2QZA A;  4YCQ A;  2XTX A;  2XTY A;  3DU1 X;  3SY2 A;  3SQV A;  4YEI A;  2O6W A;  3PSS A;  4YFO A;  3NB2 A;  2XT2 A;  2QYU A;  3PSZ A;  4YC5 A; 
#chains in the Genus database with same CATH topology
 5JLV C;  1O8L A;  2O04 A;  2NST A;  3GQ7 A;  1OFM A;  1PXZ A;  1OFL A;  1QRC A;  2IOU G;  4YEL A;  1IDJ A;  2O0W A;  2QX3 A;  2INV A;  1QCX A;  4JRA C;  2X3H A;  1HG8 A;  4Z03 A;  2UVE A;  2QZA A;  2V5I A;  2XTX A;  4OJL A;  1JRG A;  1O88 A;  2VFM A;  2ODL A;  4OZZ A;  4KH3 A;  2NTB A;  1QA2 A;  4XN3 A;  1EA0 A;  4YEI A;  1O8M A;  4YZA A;  1OFE A;  3LMW A;  1BHE A;  3NB2 A;  1PE9 A;  3PET A;  1IB4 A;  1O8G A;  4YZ0 A;  4XLC A;  1DBG A;  1VBL A;  1IA5 A;  3GRH A;  4NK8 A;  1TYV A;  2VJI A;  4OM9 A;  4XMY A;  3P4G A;  4YC5 A;  2BM7 A;  2O17 A;  1PLU A;  3UW0 A;  1QA1 A;  4XQF A;  1TYW A;  3RIQ A;  2NZM A;  1DBO A;  1QJV A;  4OZY A;  4OJO A;  2QY1 A;  1QQ1 A;  4XLE A;  5AMV A;  3ZSC A;  1WXR A;  2X6W A;  4XOP A;  2B0R A;  4YCQ A;  1KTW A;  4XON A;  3DU1 X;  2NSP A;  3VST A;  2BM6 A;  3SZE A;  3VMV A;  3ZPP A;  3EQO A;  4Z06 A;  2O0V A;  2NTP A;  2X6Y A;  3SQV A;  2INU A;  5JMC B;  2NT6 A;  3GQA A;  1KCD A;  3B4N A;  2VFP A;  4OPW A;  2PEC A;  4XKW A;  4XOR A;  1KQ5 A;  2Z8G A;  2XT2 A;  2QYU A;  2VBK A;  3N90 A;  3PSZ A;  2X85 A;  4XLF A;  1IDK A;  1LM1 A;  1GQ8 A;  2O1D A;  5C1E A;  4OJ6 A;  4XLH A;  1WMR A;  3LYC A;  3VMW A;  1O8E A;  4URR A;  4V02 C;  2J8K A;  3T9G A;  3NAW A;  1RMG A;  1TYU A;  4PMH A;  3WWG A;  1EE6 A;  2XTW A;  5C1C A;  1KCC A;  1K4Z A;  3GQ9 A;  2VBM A;  3KRG A;  2UVF A;  4I84 A;  1O8H A;  2EWE A;  1JTA A;  4Z05 A;  2BM4 A;  4NK6 A;  3SY2 A;  3VSU A;  3AK5 A;  3BH6 B;  2NT9 A;  3TH0 A;  1OOC A;  4W8Q A;  1OGM X;  2F3L A;  4U49 A;  4W8S A;  1X0C A;  2BM5 A;  2O6W A;  3N6Z A;  4XN0 A;  4YFO A;  2VFO A;  1O8K A;  4XOT A;  4YZX A;  1QRB A;  4W8T A;  3H09 A;  3GQ8 A;  2G0Y A;  4OJ5 A;  2XC1 A;  4XR6 A;  4YEJ A;  1OGO X;  1CLW A;  3FY3 A;  1LLW A;  4XLA A;  1O8J A;  1RU4 A;  2IQ7 A;  4XKV A;  4YDT A;  3EQN A;  4MR0 A;  4OJP A;  2J8I A;  2PYG A;  1BN8 A;  1TYX A;  1TSP A;  2PYH A;  4AVZ A;  1H80 A;  1NHC A;  5DNS A;  1AIR A;  2VFN A;  1O8I A;  2XT4 A;  4EW9 A;  2VBE A;  1EZG A;  1K8F A;  2VJJ A;  2XTY A;  4U4B A;  4XNF A;  2W7Z A;  1LLZ A;  2VFQ A;  1DAB A;  1L1I A;  1HF2 A;  1RWR A;  3B8Y A;  1O8D A;  3BH7 B;  4YZQ A;  2X6X A;  3B90 A;  3PSS A;  2NTQ A;  4XL9 A;  1O8F A;  2BSP A;  1QA3 A;  1OFD A;  3SUC A;  3SYJ A;  1K5C A;  3LJY A;  2BX6 A;  4XM3 A;  2QXZ A;  3JUR A;  4HWV A;  2YUH A;  3VSV A;  3JX8 A;  1CZF A;  4W8R A;  4MXN A;  4C2L A;  1XG2 A;  3ML3 A; 
#chains in the Genus database with same CATH homology
 4YDT A;  2J8K A;  3NAW A;  2XTW A;  5DNS A;  2XT4 A;  2QZA A;  4YCQ A;  2XTX A;  2XTY A;  3DU1 X;  3SY2 A;  3SQV A;  4YEI A;  2O6W A;  3PSS A;  4YFO A;  3NB2 A;  2XT2 A;  2QYU A;  3PSZ A;  4YC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...