4YFOA

Beta1_ex1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
233
structure length
233
Chain Sequence
MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGADLNGADLKQADLSGADLGGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords beta1_ex1
total genus 106
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2015-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4yfoA00
5DNSA 2J8KA 2XTYA 4YFOA 3SQVA 4YDTA 3NB2A 2XT4A 2XTXA 3DU1X 4YCQA 4YC5A 2QYUA 3PSSA 3PSZA 2O6WA 3SY2A 2QZAA 2XT2A 3NAWA 2XTWA 4YEIA
chains in the Genus database with same CATH superfamily
1OFEA 1O8HA 1K8FA 2XTYA 4YFOA 2O17A 2O1DA 1LM1A 2X85A 2BM7A 3SQVA 4YDTA 4XLCA 4YZAA 2X3HA 2O04A 4OJ6A 1OGMX 3GRHA 1RWRA 2QY1A 4Z06A 1GQ8A 3VMVA 1QA3A 1JRGA 4XNFA 1NHCA 4W8TA 4XN3A 3KRGA 3PSSA 3PSZA 1O8IA 4EW9A 2O6WA 4XORA 1KTWA 2PYHA 4I84A 4KH3A 2NTPA 4U49A 1CLWA 1HG8A 2O0VA 1OOCA 4W8QA 2EWEA 2NSPA 4NK6A 5JMCB 1QA2A 1KQ5A 1X0CA 3LMWA 2XC1A 1XG2A 1IA5A 1PE9A 2G0YA 5DNSA 1EA0A 3SZEA 3EQNA 2NTBA 4YZXA 4XL9A 2VFPA 1H80A 3JURA 4XOPA 4YZQA 1TYVA 1O8KA 1PXZA 2F3LA 1RU4A 3PETA 1TSPA 1VBLA 3DU1X 4YC5A 2VFMA 4XLAA 1O8JA 2VBMA 2NSTA 4XMYA 3VSVA 1IDJA 3ZPPA 1HF2A 4URRA 3SY2A 2QZAA 4OJOA 4W8SA 2NTQA 1LLWA 1IB4A 2X6WA 3VMWA 3EQOA 1K5CA 2BX6A 4U4BA 2NZMA 2BM4A 2IOUG 3NAWA 2X6XA 2INUA 1AIRA 3RIQA 4MXNA 1DABA 2UVFA 2UVEA 2VFNA 2O0WA 1QRBA 1RMGA 2BM5A 2V5IA 1OGOX 3GQ9A 1O8LA 4XLEA 2VBEA 4OJPA 5AMVA 4XN0A 3JX8A 5C1EA 3BH7B 3SUCA 2VFQA 4V02C 4AVZA 3N90A 1EE6A 3WWGA 1KCCA 4XKVA 3NB2A 4XM3A 2VFOA 1WMRA 1O8FA 1OFMA 2QX3A 1QQ1A 2NT9A 2XTXA 4OJLA 3LJYA 4YCQA 2BM6A 3T9GA 1QA1A 4XONA 4W8RA 2IQ7A 3ML3A 1QCXA 1L1IA 4OM9A 2J8IA 2NT6A 3FY3A 4YELA 2ODLA 2INVA 1K4ZA 2B0RA 1O8EA 1TYUA 4OZZA 4JRAC 2XTWA 2Z8GA 3GQ7A 3VSUA 4YEIA 3H09A 4MR0A 3TH0A 4OPWA 1JTAA 4OJ5A 1TYXA 2QXZA 1BHEA 2W7ZA 3GQ8A 1PLUA 1DBOA 2J8KA 4XLHA 4Z03A 3SYJA 1IDKA 3VSTA 3B4NA 1EZGA 3UW0A 5C1CA 1OFDA 2XT4A 4NK8A 1BN8A 2VJJA 5JLVC 4PMHA 3P4GA 1O8GA 1O88A 2QYUA 3N6ZA 4C2LA 3ZSCA 4YZ0A 3BH6B 3AK5A 3LYCA 4XKWA 1O8MA 4HWVA 4XR6A 4XOTA 1QJVA 3B90A 1LLZA 2PECA 1TYWA 2XT2A 2YUHA 1KCDA 2VJIA 1CZFA 2BSPA 1QRCA 2VBKA 4Z05A 4OZYA 4XQFA 3B8YA 1OFLA 1WXRA 1O8DA 2X6YA 2PYGA 3GQAA 4YEJA 4XLFA 1DBGA
chains in the Genus database with same CATH topology
5DNSA 2J8KA 2XTYA 4YFOA 3SQVA 4YDTA 3NB2A 2XT4A 2XTXA 3DU1X 4YCQA 4YC5A 2QYUA 3PSSA 3PSZA 2O6WA 3SY2A 2QZAA 2XT2A 3NAWA 2XTWA 4YEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNS A;  2J8K A;  2XTY A;  4YFO A;  3SQV A;  4YDT A;  3NB2 A;  2XT4 A;  2XTX A;  3DU1 X;  4YCQ A;  4YC5 A;  2QYU A;  3PSS A;  3PSZ A;  2O6W A;  3SY2 A;  2QZA A;  2XT2 A;  3NAW A;  2XTW A;  4YEI A; 
#chains in the Genus database with same CATH topology
 1OFE A;  1O8H A;  1K8F A;  2XTY A;  4YFO A;  2O17 A;  2O1D A;  1LM1 A;  2X85 A;  2BM7 A;  3SQV A;  4YDT A;  4XLC A;  4YZA A;  2X3H A;  2O04 A;  4OJ6 A;  1OGM X;  3GRH A;  1RWR A;  2QY1 A;  4Z06 A;  1GQ8 A;  3VMV A;  1QA3 A;  1JRG A;  4XNF A;  1NHC A;  4W8T A;  4XN3 A;  3KRG A;  3PSS A;  3PSZ A;  1O8I A;  4EW9 A;  2O6W A;  4XOR A;  1KTW A;  2PYH A;  4I84 A;  4KH3 A;  2NTP A;  4U49 A;  1CLW A;  1HG8 A;  2O0V A;  1OOC A;  4W8Q A;  2EWE A;  2NSP A;  4NK6 A;  5JMC B;  1QA2 A;  1KQ5 A;  1X0C A;  3LMW A;  2XC1 A;  1XG2 A;  1IA5 A;  1PE9 A;  2G0Y A;  5DNS A;  1EA0 A;  3SZE A;  3EQN A;  2NTB A;  4YZX A;  4XL9 A;  2VFP A;  1H80 A;  3JUR A;  4XOP A;  4YZQ A;  1TYV A;  1O8K A;  1PXZ A;  2F3L A;  1RU4 A;  3PET A;  1TSP A;  1VBL A;  3DU1 X;  4YC5 A;  2VFM A;  4XLA A;  1O8J A;  2VBM A;  2NST A;  4XMY A;  3VSV A;  1IDJ A;  3ZPP A;  1HF2 A;  4URR A;  3SY2 A;  2QZA A;  4OJO A;  4W8S A;  2NTQ A;  1LLW A;  1IB4 A;  2X6W A;  3VMW A;  3EQO A;  1K5C A;  2BX6 A;  4U4B A;  2NZM A;  2BM4 A;  2IOU G;  3NAW A;  2X6X A;  2INU A;  1AIR A;  3RIQ A;  4MXN A;  1DAB A;  2UVF A;  2UVE A;  2VFN A;  2O0W A;  1QRB A;  1RMG A;  2BM5 A;  2V5I A;  1OGO X;  3GQ9 A;  1O8L A;  4XLE A;  2VBE A;  4OJP A;  5AMV A;  4XN0 A;  3JX8 A;  5C1E A;  3BH7 B;  3SUC A;  2VFQ A;  4V02 C;  4AVZ A;  3N90 A;  1EE6 A;  3WWG A;  1KCC A;  4XKV A;  3NB2 A;  4XM3 A;  2VFO A;  1WMR A;  1O8F A;  1OFM A;  2QX3 A;  1QQ1 A;  2NT9 A;  2XTX A;  4OJL A;  3LJY A;  4YCQ A;  2BM6 A;  3T9G A;  1QA1 A;  4XON A;  4W8R A;  2IQ7 A;  3ML3 A;  1QCX A;  1L1I A;  4OM9 A;  2J8I A;  2NT6 A;  3FY3 A;  4YEL A;  2ODL A;  2INV A;  1K4Z A;  2B0R A;  1O8E A;  1TYU A;  4OZZ A;  4JRA C;  2XTW A;  2Z8G A;  3GQ7 A;  3VSU A;  4YEI A;  3H09 A;  4MR0 A;  3TH0 A;  4OPW A;  1JTA A;  4OJ5 A;  1TYX A;  2QXZ A;  1BHE A;  2W7Z A;  3GQ8 A;  1PLU A;  1DBO A;  2J8K A;  4XLH A;  4Z03 A;  3SYJ A;  1IDK A;  3VST A;  3B4N A;  1EZG A;  3UW0 A;  5C1C A;  1OFD A;  2XT4 A;  4NK8 A;  1BN8 A;  2VJJ A;  5JLV C;  4PMH A;  3P4G A;  1O8G A;  1O88 A;  2QYU A;  3N6Z A;  4C2L A;  3ZSC A;  4YZ0 A;  3BH6 B;  3AK5 A;  3LYC A;  4XKW A;  1O8M A;  4HWV A;  4XR6 A;  4XOT A;  1QJV A;  3B90 A;  1LLZ A;  2PEC A;  1TYW A;  2XT2 A;  2YUH A;  1KCD A;  2VJI A;  1CZF A;  2BSP A;  1QRC A;  2VBK A;  4Z05 A;  4OZY A;  4XQF A;  3B8Y A;  1OFL A;  1WXR A;  1O8D A;  2X6Y A;  2PYG A;  3GQA A;  4YEJ A;  4XLF A;  1DBG A; 
#chains in the Genus database with same CATH homology
 5DNS A;  2J8K A;  2XTY A;  4YFO A;  3SQV A;  4YDT A;  3NB2 A;  2XT4 A;  2XTX A;  3DU1 X;  4YCQ A;  4YC5 A;  2QYU A;  3PSS A;  3PSZ A;  2O6W A;  3SY2 A;  2QZA A;  2XT2 A;  3NAW A;  2XTW A;  4YEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...