4YFOA

Beta1_ex1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
233
structure length
233
Chain Sequence
MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGADLNGADLKQADLSGADLGGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords beta1_ex1
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
total genus 106
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2015-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4yfoA00
5DNSA 3NB2A 4YEIA 3PSZA 2O6WA 2XTXA 4YDTA 2XT2A 3DU1X 4YFOA 2XTYA 3SQVA 3NAWA 2XTWA 2QYUA 2J8KA 2QZAA 4YC5A 2XT4A 3SY2A 3PSSA 4YCQA
chains in the Genus database with same CATH superfamily
2UVEA 4W8SA 2UVFA 2NTBA 1X0CA 2VFMA 3N6ZA 3LMWA 2B0RA 1K5CA 2NSTA 1K8FA 4OJLA 1DBOA 2XTXA 2NZMA 4NK6A 4XMYA 1OOCA 1KTWA 3SYJA 3LYCA 1OFEA 4XR6A 3VSTA 5C1CA 2O0VA 2J8IA 2XT2A 4OM9A 2BX6A 3VSVA 1OFMA 1PLUA 1K4ZA 4YZQA 4XLFA 5AMVA 4U4BA 2VBKA 2X6XA 2VBEA 2XTWA 4W8RA 3ZSCA 1HF2A 4XLEA 1L1IA 1RWRA 1EA0A 3PETA 1PE9A 1QJVA 4C2LA 1KCCA 2NTPA 3JX8A 3VMWA 1LM1A 2PECA 4XOTA 4HWVA 3SUCA 3KRGA 1DBGA 1O8MA 4OZZA 2IQ7A 1HG8A 4Z05A 2PYHA 4YEIA 3PSZA 2O6WA 4NK8A 2G0YA 4U49A 2NT9A 1TYXA 2X85A 2VBMA 1IDKA 5JLVC 3VSUA 1O8IA 1JRGA 4V02C 3ZPPA 4XL9A 1LLZA 2V5IA 1PXZA 2X6YA 2XTYA 2BM5A 1OGOX 3GQ7A 1BHEA 3GQAA 3TH0A 3SZEA 1O8DA 1EE6A 4I84A 3BH6B 3WWGA 2NT6A 4XQFA 2QYUA 1O8GA 2EWEA 3B4NA 2QZAA 2F3LA 3FY3A 4YELA 4YC5A 1QA1A 3B8YA 1LLWA 4XLHA 1TYWA 1IDJA 4XONA 4EW9A 1O8LA 3UW0A 2XC1A 3GQ8A 4OJPA 1OGMX 2IOUG 1O8JA 1GQ8A 2O1DA 2VJJA 3BH7B 3EQOA 2QX3A 3GQ9A 3NB2A 1VBLA 1QA3A 1KCDA 4W8TA 4XNFA 1AIRA 2Z8GA 3H09A 4PMHA 5C1EA 3GRHA 1WMRA 4W8QA 1CZFA 4AVZA 1O8HA 2VFQA 2W7ZA 1QRCA 4OZYA 1IB4A 1BN8A 4OJ5A 3RIQA 3NAWA 1TYVA 2O04A 3JURA 4XLCA 3N90A 1O8KA 2J8KA 4KH3A 2BM6A 1QRBA 4YZXA 1TSPA 1KQ5A 4Z03A 2O0WA 1RMGA 1DABA 4YEJA 3LJYA 2XT4A 2VFPA 2VFNA 1CLWA 2INVA 2NTQA 2X3HA 3VMVA 4JRAC 3T9GA 4MXNA 4OPWA 3B90A 4XORA 1EZGA 2BM7A 1QA2A 5DNSA 1IA5A 1WXRA 2VFOA 2ODLA 2O17A 4MR0A 4XKWA 1TYUA 4XN0A 4YZAA 4YDTA 1O8FA 4URRA 4Z06A 1RU4A 1OFDA 3P4GA 4OJ6A 1JTAA 4XLAA 1NHCA 3DU1X 1XG2A 2QY1A 3EQNA 4XM3A 3AK5A 2PYGA 2VJIA 4YFOA 1QCXA 3SQVA 4XOPA 1O8EA 5JMCB 4XKVA 1O88A 4XN3A 2BM4A 4YZ0A 2YUHA 2INUA 2X6WA 3ML3A 1H80A 1OFLA 4OJOA 2QXZA 1QQ1A 2NSPA 2BSPA 3SY2A 3PSSA 4YCQA
chains in the Genus database with same CATH topology
5DNSA 3NB2A 4YEIA 3PSZA 2O6WA 2XTXA 4YDTA 2XT2A 3DU1X 4YFOA 2XTYA 3SQVA 3NAWA 2XTWA 2QYUA 2J8KA 2QZAA 4YC5A 2XT4A 3SY2A 3PSSA 4YCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNS A;  3NB2 A;  4YEI A;  3PSZ A;  2O6W A;  2XTX A;  4YDT A;  2XT2 A;  3DU1 X;  4YFO A;  2XTY A;  3SQV A;  3NAW A;  2XTW A;  2QYU A;  2J8K A;  2QZA A;  4YC5 A;  2XT4 A;  3SY2 A;  3PSS A;  4YCQ A; 
#chains in the Genus database with same CATH topology
 2UVE A;  4W8S A;  2UVF A;  2NTB A;  1X0C A;  2VFM A;  3N6Z A;  3LMW A;  2B0R A;  1K5C A;  2NST A;  1K8F A;  4OJL A;  1DBO A;  2XTX A;  2NZM A;  4NK6 A;  4XMY A;  1OOC A;  1KTW A;  3SYJ A;  3LYC A;  1OFE A;  4XR6 A;  3VST A;  5C1C A;  2O0V A;  2J8I A;  2XT2 A;  4OM9 A;  2BX6 A;  3VSV A;  1OFM A;  1PLU A;  1K4Z A;  4YZQ A;  4XLF A;  5AMV A;  4U4B A;  2VBK A;  2X6X A;  2VBE A;  2XTW A;  4W8R A;  3ZSC A;  1HF2 A;  4XLE A;  1L1I A;  1RWR A;  1EA0 A;  3PET A;  1PE9 A;  1QJV A;  4C2L A;  1KCC A;  2NTP A;  3JX8 A;  3VMW A;  1LM1 A;  2PEC A;  4XOT A;  4HWV A;  3SUC A;  3KRG A;  1DBG A;  1O8M A;  4OZZ A;  2IQ7 A;  1HG8 A;  4Z05 A;  2PYH A;  4YEI A;  3PSZ A;  2O6W A;  4NK8 A;  2G0Y A;  4U49 A;  2NT9 A;  1TYX A;  2X85 A;  2VBM A;  1IDK A;  5JLV C;  3VSU A;  1O8I A;  1JRG A;  4V02 C;  3ZPP A;  4XL9 A;  1LLZ A;  2V5I A;  1PXZ A;  2X6Y A;  2XTY A;  2BM5 A;  1OGO X;  3GQ7 A;  1BHE A;  3GQA A;  3TH0 A;  3SZE A;  1O8D A;  1EE6 A;  4I84 A;  3BH6 B;  3WWG A;  2NT6 A;  4XQF A;  2QYU A;  1O8G A;  2EWE A;  3B4N A;  2QZA A;  2F3L A;  3FY3 A;  4YEL A;  4YC5 A;  1QA1 A;  3B8Y A;  1LLW A;  4XLH A;  1TYW A;  1IDJ A;  4XON A;  4EW9 A;  1O8L A;  3UW0 A;  2XC1 A;  3GQ8 A;  4OJP A;  1OGM X;  2IOU G;  1O8J A;  1GQ8 A;  2O1D A;  2VJJ A;  3BH7 B;  3EQO A;  2QX3 A;  3GQ9 A;  3NB2 A;  1VBL A;  1QA3 A;  1KCD A;  4W8T A;  4XNF A;  1AIR A;  2Z8G A;  3H09 A;  4PMH A;  5C1E A;  3GRH A;  1WMR A;  4W8Q A;  1CZF A;  4AVZ A;  1O8H A;  2VFQ A;  2W7Z A;  1QRC A;  4OZY A;  1IB4 A;  1BN8 A;  4OJ5 A;  3RIQ A;  3NAW A;  1TYV A;  2O04 A;  3JUR A;  4XLC A;  3N90 A;  1O8K A;  2J8K A;  4KH3 A;  2BM6 A;  1QRB A;  4YZX A;  1TSP A;  1KQ5 A;  4Z03 A;  2O0W A;  1RMG A;  1DAB A;  4YEJ A;  3LJY A;  2XT4 A;  2VFP A;  2VFN A;  1CLW A;  2INV A;  2NTQ A;  2X3H A;  3VMV A;  4JRA C;  3T9G A;  4MXN A;  4OPW A;  3B90 A;  4XOR A;  1EZG A;  2BM7 A;  1QA2 A;  5DNS A;  1IA5 A;  1WXR A;  2VFO A;  2ODL A;  2O17 A;  4MR0 A;  4XKW A;  1TYU A;  4XN0 A;  4YZA A;  4YDT A;  1O8F A;  4URR A;  4Z06 A;  1RU4 A;  1OFD A;  3P4G A;  4OJ6 A;  1JTA A;  4XLA A;  1NHC A;  3DU1 X;  1XG2 A;  2QY1 A;  3EQN A;  4XM3 A;  3AK5 A;  2PYG A;  2VJI A;  4YFO A;  1QCX A;  3SQV A;  4XOP A;  1O8E A;  5JMC B;  4XKV A;  1O88 A;  4XN3 A;  2BM4 A;  4YZ0 A;  2YUH A;  2INU A;  2X6W A;  3ML3 A;  1H80 A;  1OFL A;  4OJO A;  2QXZ A;  1QQ1 A;  2NSP A;  2BSP A;  3SY2 A;  3PSS A;  4YCQ A; 
#chains in the Genus database with same CATH homology
 5DNS A;  3NB2 A;  4YEI A;  3PSZ A;  2O6W A;  2XTX A;  4YDT A;  2XT2 A;  3DU1 X;  4YFO A;  2XTY A;  3SQV A;  3NAW A;  2XTW A;  2QYU A;  2J8K A;  2QZA A;  4YC5 A;  2XT4 A;  3SY2 A;  3PSS A;  4YCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...