2NSTA

Crystal structure of pectin methylesterase d178a mutant in complex with hexasaccharide ii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQATLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords Pectinesterase A
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2nstA00
4XKVA 1O88A 2O17A 3B4NA 3UW0A 3FY3A 2QXZA 1DBGA 4NK6A 4AVZA 3KRGA 3GQ8A 1IA5A 4C2LA 4OJOA 4Z05A 1O8DA 1XG2A 4YEJA 4Z06A 4YZ0A 2UVEA 3EQNA 4XKWA 4XM3A 2INVA 1AIRA 3JURA 4URRA 1BN8A 4YZXA 3VSUA 1BHEA 3T9GA 1O8FA 4OZZA 4OJ5A 4W8QA 3VSVA 1O8JA 3B8YA 2PYHA 4XLEA 2QX3A 2NTBA 4EW9A 2IQ7A 3GQ9A 1RU4A 4MR0A 2UVFA 2X3HA 4XLHA 4XOTA 1IDJA 2EWEA 1JRGA 1KCCA 4OJPA 1GQ8A 2VBKA 2VJIA 1IDKA 4XONA 2VBEA 1RWRA 3VMWA 3GRHA 4XQFA 2O0WA 3B90A 3LMWA 2X6YA 2Z8GA 4W8SA 4MXNA 1OFMA 4YZQA 4PMHA 1KTWA 2O1DA 4YELA 1PXZA 1RMGA 5AMVA 2VJJA 4OJLA 1JTAA 4U49A 2NZMA 1OOCA 2INUA 4XNFA 2NSTA 2NTQA 2O04A 1H80A 4I84A 1QCXA 2NT9A 1WMRA 2ODLA 4XN3A 1O8KA 1O8IA 1OGMX 3EQOA 1PE9A 4W8RA 1K5CA 3SUCA 1O8HA 2X6WA 1O8EA 4YZAA 4XLCA 1PLUA 1NHCA 2QY1A 2NTPA 4XORA 1X0CA 1QJVA 2BSPA 2PYGA 4XN0A 3GQAA 4XMYA 1OGOX 2NSPA 4XR6A 1KCDA 1IB4A 4XL9A 3ZSCA 3VSTA 5C1CA 4Z03A 1EE6A 2X85A 3ZPPA 3GQ7A 2NT6A 1O8LA 5C1EA 4NK8A 3WWGA 4HWVA 4W8TA 1OFLA 1CZFA 1VBLA 4XLAA 3VMVA 4XOPA 1O8MA 4OJ6A 4OZYA 2PECA 2O0VA 1O8GA 4XLFA 1HG8A 4U4BA 2X6XA 2VBMA 1DBOA
chains in the Genus database with same CATH superfamily
2XT4A 4XKVA 1O88A 2O17A 2XTYA 3B4NA 3UW0A 3FY3A 2QYUA 3ML3A 2QXZA 1QRCA 1DBGA 1QQ1A 4NK6A 4AVZA 1TYVA 2BX6A 3KRGA 3GQ8A 1IA5A 4C2LA 4OJOA 4V02C 4Z05A 1O8DA 3NB2A 1XG2A 4YEJA 4Z06A 4YZ0A 2UVEA 3EQNA 2VFMA 3PSSA 4XKWA 4XM3A 2INVA 1AIRA 3JURA 4JRAC 1BN8A 4URRA 4YZXA 3JX8A 3VSUA 1BHEA 3PETA 4YC5A 3NAWA 1L1IA 5DNSA 3T9GA 1TYXA 1O8FA 3LYCA 4OZZA 4OJ5A 4W8QA 4YEIA 2XT2A 3VSVA 3H09A 1O8JA 3B8YA 2PYHA 4YCQA 4XLEA 1K8FA 2QX3A 2NTBA 3TH0A 4EW9A 2IQ7A 1K4ZA 3LJYA 3GQ9A 1RU4A 4MR0A 3SY2A 2UVFA 2X3HA 3BH6B 4XLHA 1TYUA 4OM9A 1IDJA 2EWEA 1JRGA 4XOTA 1KCCA 4OJPA 1GQ8A 2VBKA 2VJIA 1IDKA 2J8KA 2VBEA 1RWRA 4XONA 3VMWA 2B0RA 2VFOA 3GRHA 4XQFA 4OPWA 2O0WA 1LLZA 3B90A 3LMWA 2X6YA 2Z8GA 4W8SA 4MXNA 1OFMA 4YZQA 4PMHA 1KTWA 2O1DA 4YELA 1PXZA 1RMGA 5AMVA 2VJJA 4OJLA 1EA0A 4YFOA 1JTAA 4U49A 2NZMA 2XC1A 1OOCA 1KQ5A 2INUA 4XNFA 2NSTA 2NTQA 2O04A 1H80A 2IOUG 4I84A 1TSPA 5JLVC 1QCXA 1QRBA 1WMRA 2NT9A 2ODLA 1WXRA 3SYJA 4XN3A 1O8KA 1O8IA 1OGMX 1OFDA 1TYWA 3EQOA 1PE9A 3N90A 2YUHA 1HF2A 4W8RA 1K5CA 1EZGA 3SUCA 1OFEA 1O8HA 2X6WA 2W7ZA 1O8EA 1QA3A 3RIQA 4YZAA 1LLWA 4XLCA 1DABA 1PLUA 1NHCA 2QY1A 3P4GA 2NTPA 3DU1X 3SZEA 1QA1A 4XORA 1X0CA 1QJVA 2BSPA 2PYGA 4XN0A 2J8IA 3GQAA 4XMYA 2QZAA 1OGOX 2NSPA 2XTXA 4XR6A 1KCDA 1IB4A 2VFPA 2O6WA 4XL9A 2XTWA 3VSTA 3ZSCA 5C1CA 4Z03A 1EE6A 5JMCB 4KH3A 2X85A 3ZPPA 1QA2A 3GQ7A 2VFNA 2NT6A 2BM6A 1O8LA 5C1EA 4NK8A 3WWGA 1CLWA 3AK5A 4HWVA 4W8TA 1OFLA 2VFQA 1CZFA 1VBLA 4XLAA 3N6ZA 3VMVA 2BM7A 4XOPA 2V5IA 1LM1A 1O8MA 4YDTA 4OJ6A 4OZYA 2PECA 3SQVA 2BM4A 1O8GA 2O0VA 3BH7B 2G0YA 2BM5A 2F3LA 4XLFA 1HG8A 4U4BA 2X6XA 2VBMA 3PSZA 1DBOA
chains in the Genus database with same CATH topology
4XKVA 1O88A 2O17A 3B4NA 3UW0A 3FY3A 2QXZA 1DBGA 4NK6A 4AVZA 3KRGA 3GQ8A 1IA5A 4C2LA 4OJOA 4Z05A 1O8DA 1XG2A 4YEJA 4Z06A 4YZ0A 2UVEA 3EQNA 4XKWA 4XM3A 2INVA 1AIRA 3JURA 4URRA 1BN8A 4YZXA 3VSUA 1BHEA 3T9GA 1O8FA 4OZZA 4OJ5A 4W8QA 3VSVA 1O8JA 3B8YA 2PYHA 4XLEA 2QX3A 2NTBA 4EW9A 2IQ7A 3GQ9A 1RU4A 4MR0A 2UVFA 2X3HA 4XLHA 4XOTA 1IDJA 2EWEA 1JRGA 1KCCA 4OJPA 1GQ8A 2VBKA 2VJIA 1IDKA 4XONA 2VBEA 1RWRA 3VMWA 3GRHA 4XQFA 2O0WA 3B90A 3LMWA 2X6YA 2Z8GA 4W8SA 4MXNA 1OFMA 4YZQA 4PMHA 1KTWA 2O1DA 4YELA 1PXZA 1RMGA 5AMVA 2VJJA 4OJLA 1JTAA 4U49A 2NZMA 1OOCA 2INUA 4XNFA 2NSTA 2NTQA 2O04A 1H80A 4I84A 1QCXA 2NT9A 1WMRA 2ODLA 4XN3A 1O8KA 1O8IA 1OGMX 3EQOA 1PE9A 4W8RA 1K5CA 3SUCA 1O8HA 2X6WA 1O8EA 4YZAA 4XLCA 1PLUA 1NHCA 2QY1A 2NTPA 4XORA 1X0CA 1QJVA 2BSPA 2PYGA 4XN0A 3GQAA 4XMYA 1OGOX 2NSPA 4XR6A 1KCDA 1IB4A 4XL9A 3ZSCA 3VSTA 5C1CA 4Z03A 1EE6A 2X85A 3ZPPA 3GQ7A 2NT6A 1O8LA 5C1EA 4NK8A 3WWGA 4HWVA 4W8TA 1OFLA 1CZFA 1VBLA 4XLAA 3VMVA 4XOPA 1O8MA 4OJ6A 4OZYA 2PECA 2O0VA 1O8GA 4XLFA 1HG8A 4U4BA 2X6XA 2VBMA 1DBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XKV A;  1O88 A;  2O17 A;  3B4N A;  3UW0 A;  3FY3 A;  2QXZ A;  1DBG A;  4NK6 A;  4AVZ A;  3KRG A;  3GQ8 A;  1IA5 A;  4C2L A;  4OJO A;  4Z05 A;  1O8D A;  1XG2 A;  4YEJ A;  4Z06 A;  4YZ0 A;  2UVE A;  3EQN A;  4XKW A;  4XM3 A;  2INV A;  1AIR A;  3JUR A;  4URR A;  1BN8 A;  4YZX A;  3VSU A;  1BHE A;  3T9G A;  1O8F A;  4OZZ A;  4OJ5 A;  4W8Q A;  3VSV A;  1O8J A;  3B8Y A;  2PYH A;  4XLE A;  2QX3 A;  2NTB A;  4EW9 A;  2IQ7 A;  3GQ9 A;  1RU4 A;  4MR0 A;  2UVF A;  2X3H A;  4XLH A;  4XOT A;  1IDJ A;  2EWE A;  1JRG A;  1KCC A;  4OJP A;  1GQ8 A;  2VBK A;  2VJI A;  1IDK A;  4XON A;  2VBE A;  1RWR A;  3VMW A;  3GRH A;  4XQF A;  2O0W A;  3B90 A;  3LMW A;  2X6Y A;  2Z8G A;  4W8S A;  4MXN A;  1OFM A;  4YZQ A;  4PMH A;  1KTW A;  2O1D A;  4YEL A;  1PXZ A;  1RMG A;  5AMV A;  2VJJ A;  4OJL A;  1JTA A;  4U49 A;  2NZM A;  1OOC A;  2INU A;  4XNF A;  2NST A;  2NTQ A;  2O04 A;  1H80 A;  4I84 A;  1QCX A;  2NT9 A;  1WMR A;  2ODL A;  4XN3 A;  1O8K A;  1O8I A;  1OGM X;  3EQO A;  1PE9 A;  4W8R A;  1K5C A;  3SUC A;  1O8H A;  2X6W A;  1O8E A;  4YZA A;  4XLC A;  1PLU A;  1NHC A;  2QY1 A;  2NTP A;  4XOR A;  1X0C A;  1QJV A;  2BSP A;  2PYG A;  4XN0 A;  3GQA A;  4XMY A;  1OGO X;  2NSP A;  4XR6 A;  1KCD A;  1IB4 A;  4XL9 A;  3ZSC A;  3VST A;  5C1C A;  4Z03 A;  1EE6 A;  2X85 A;  3ZPP A;  3GQ7 A;  2NT6 A;  1O8L A;  5C1E A;  4NK8 A;  3WWG A;  4HWV A;  4W8T A;  1OFL A;  1CZF A;  1VBL A;  4XLA A;  3VMV A;  4XOP A;  1O8M A;  4OJ6 A;  4OZY A;  2PEC A;  2O0V A;  1O8G A;  4XLF A;  1HG8 A;  4U4B A;  2X6X A;  2VBM A;  1DBO A; 
#chains in the Genus database with same CATH topology
 2XT4 A;  4XKV A;  1O88 A;  2O17 A;  2XTY A;  3B4N A;  3UW0 A;  3FY3 A;  2QYU A;  3ML3 A;  2QXZ A;  1QRC A;  1DBG A;  1QQ1 A;  4NK6 A;  4AVZ A;  1TYV A;  2BX6 A;  3KRG A;  3GQ8 A;  1IA5 A;  4C2L A;  4OJO A;  4V02 C;  4Z05 A;  1O8D A;  3NB2 A;  1XG2 A;  4YEJ A;  4Z06 A;  4YZ0 A;  2UVE A;  3EQN A;  2VFM A;  3PSS A;  4XKW A;  4XM3 A;  2INV A;  1AIR A;  3JUR A;  4JRA C;  1BN8 A;  4URR A;  4YZX A;  3JX8 A;  3VSU A;  1BHE A;  3PET A;  4YC5 A;  3NAW A;  1L1I A;  5DNS A;  3T9G A;  1TYX A;  1O8F A;  3LYC A;  4OZZ A;  4OJ5 A;  4W8Q A;  4YEI A;  2XT2 A;  3VSV A;  3H09 A;  1O8J A;  3B8Y A;  2PYH A;  4YCQ A;  4XLE A;  1K8F A;  2QX3 A;  2NTB A;  3TH0 A;  4EW9 A;  2IQ7 A;  1K4Z A;  3LJY A;  3GQ9 A;  1RU4 A;  4MR0 A;  3SY2 A;  2UVF A;  2X3H A;  3BH6 B;  4XLH A;  1TYU A;  4OM9 A;  1IDJ A;  2EWE A;  1JRG A;  4XOT A;  1KCC A;  4OJP A;  1GQ8 A;  2VBK A;  2VJI A;  1IDK A;  2J8K A;  2VBE A;  1RWR A;  4XON A;  3VMW A;  2B0R A;  2VFO A;  3GRH A;  4XQF A;  4OPW A;  2O0W A;  1LLZ A;  3B90 A;  3LMW A;  2X6Y A;  2Z8G A;  4W8S A;  4MXN A;  1OFM A;  4YZQ A;  4PMH A;  1KTW A;  2O1D A;  4YEL A;  1PXZ A;  1RMG A;  5AMV A;  2VJJ A;  4OJL A;  1EA0 A;  4YFO A;  1JTA A;  4U49 A;  2NZM A;  2XC1 A;  1OOC A;  1KQ5 A;  2INU A;  4XNF A;  2NST A;  2NTQ A;  2O04 A;  1H80 A;  2IOU G;  4I84 A;  1TSP A;  5JLV C;  1QCX A;  1QRB A;  1WMR A;  2NT9 A;  2ODL A;  1WXR A;  3SYJ A;  4XN3 A;  1O8K A;  1O8I A;  1OGM X;  1OFD A;  1TYW A;  3EQO A;  1PE9 A;  3N90 A;  2YUH A;  1HF2 A;  4W8R A;  1K5C A;  1EZG A;  3SUC A;  1OFE A;  1O8H A;  2X6W A;  2W7Z A;  1O8E A;  1QA3 A;  3RIQ A;  4YZA A;  1LLW A;  4XLC A;  1DAB A;  1PLU A;  1NHC A;  2QY1 A;  3P4G A;  2NTP A;  3DU1 X;  3SZE A;  1QA1 A;  4XOR A;  1X0C A;  1QJV A;  2BSP A;  2PYG A;  4XN0 A;  2J8I A;  3GQA A;  4XMY A;  2QZA A;  1OGO X;  2NSP A;  2XTX A;  4XR6 A;  1KCD A;  1IB4 A;  2VFP A;  2O6W A;  4XL9 A;  2XTW A;  3VST A;  3ZSC A;  5C1C A;  4Z03 A;  1EE6 A;  5JMC B;  4KH3 A;  2X85 A;  3ZPP A;  1QA2 A;  3GQ7 A;  2VFN A;  2NT6 A;  2BM6 A;  1O8L A;  5C1E A;  4NK8 A;  3WWG A;  1CLW A;  3AK5 A;  4HWV A;  4W8T A;  1OFL A;  2VFQ A;  1CZF A;  1VBL A;  4XLA A;  3N6Z A;  3VMV A;  2BM7 A;  4XOP A;  2V5I A;  1LM1 A;  1O8M A;  4YDT A;  4OJ6 A;  4OZY A;  2PEC A;  3SQV A;  2BM4 A;  1O8G A;  2O0V A;  3BH7 B;  2G0Y A;  2BM5 A;  2F3L A;  4XLF A;  1HG8 A;  4U4B A;  2X6X A;  2VBM A;  3PSZ A;  1DBO A; 
#chains in the Genus database with same CATH homology
 4XKV A;  1O88 A;  2O17 A;  3B4N A;  3UW0 A;  3FY3 A;  2QXZ A;  1DBG A;  4NK6 A;  4AVZ A;  3KRG A;  3GQ8 A;  1IA5 A;  4C2L A;  4OJO A;  4Z05 A;  1O8D A;  1XG2 A;  4YEJ A;  4Z06 A;  4YZ0 A;  2UVE A;  3EQN A;  4XKW A;  4XM3 A;  2INV A;  1AIR A;  3JUR A;  4URR A;  1BN8 A;  4YZX A;  3VSU A;  1BHE A;  3T9G A;  1O8F A;  4OZZ A;  4OJ5 A;  4W8Q A;  3VSV A;  1O8J A;  3B8Y A;  2PYH A;  4XLE A;  2QX3 A;  2NTB A;  4EW9 A;  2IQ7 A;  3GQ9 A;  1RU4 A;  4MR0 A;  2UVF A;  2X3H A;  4XLH A;  4XOT A;  1IDJ A;  2EWE A;  1JRG A;  1KCC A;  4OJP A;  1GQ8 A;  2VBK A;  2VJI A;  1IDK A;  4XON A;  2VBE A;  1RWR A;  3VMW A;  3GRH A;  4XQF A;  2O0W A;  3B90 A;  3LMW A;  2X6Y A;  2Z8G A;  4W8S A;  4MXN A;  1OFM A;  4YZQ A;  4PMH A;  1KTW A;  2O1D A;  4YEL A;  1PXZ A;  1RMG A;  5AMV A;  2VJJ A;  4OJL A;  1JTA A;  4U49 A;  2NZM A;  1OOC A;  2INU A;  4XNF A;  2NST A;  2NTQ A;  2O04 A;  1H80 A;  4I84 A;  1QCX A;  2NT9 A;  1WMR A;  2ODL A;  4XN3 A;  1O8K A;  1O8I A;  1OGM X;  3EQO A;  1PE9 A;  4W8R A;  1K5C A;  3SUC A;  1O8H A;  2X6W A;  1O8E A;  4YZA A;  4XLC A;  1PLU A;  1NHC A;  2QY1 A;  2NTP A;  4XOR A;  1X0C A;  1QJV A;  2BSP A;  2PYG A;  4XN0 A;  3GQA A;  4XMY A;  1OGO X;  2NSP A;  4XR6 A;  1KCD A;  1IB4 A;  4XL9 A;  3ZSC A;  3VST A;  5C1C A;  4Z03 A;  1EE6 A;  2X85 A;  3ZPP A;  3GQ7 A;  2NT6 A;  1O8L A;  5C1E A;  4NK8 A;  3WWG A;  4HWV A;  4W8T A;  1OFL A;  1CZF A;  1VBL A;  4XLA A;  3VMV A;  4XOP A;  1O8M A;  4OJ6 A;  4OZY A;  2PEC A;  2O0V A;  1O8G A;  4XLF A;  1HG8 A;  4U4B A;  2X6X A;  2VBM A;  1DBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...