2NSTA

Crystal structure of pectin methylesterase d178a mutant in complex with hexasaccharide ii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQATLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2nstA00
3B8YA 1OFLA 4C2LA 4YZ0A 4PMHA 2NSTA 1OGMX 2NTQA 4OZZA 4OJ6A 4XL9A 1JTAA 2VBEA 3VSVA 1OFMA 3GRHA 1IDKA 1XG2A 4XKWA 1KCCA 3LMWA 4XN3A 4XOPA 3UW0A 3VSUA 1RU4A 2X6WA 3KRGA 2BSPA 1AIRA 2NTBA 4XLFA 1BHEA 3EQNA 4XLAA 4XLHA 2VBMA 3T9GA 4XLEA 1O8IA 1O8FA 2NTPA 2O0VA 4EW9A 2UVEA 2X6YA 1OOCA 4XONA 3VMWA 4OJ5A 3GQ7A 3B4NA 4YZAA 4YZQA 3ZSCA 4NK6A 2PECA 4XOTA 4U4BA 4XLCA 1OGOX 2IQ7A 2NT6A 1IB4A 2PYHA 5AMVA 1O8EA 4U49A 1O8GA 2X85A 4MXNA 2VBKA 4I84A 1KCDA 2O0WA 2PYGA 2INUA 2EWEA 3EQOA 2VJJA 2O17A 3VSTA 1O8MA 3GQ8A 4MR0A 1O8KA 3B90A 3GQ9A 2X3HA 4AVZA 4URRA 2NSPA 4OJOA 4OJLA 1K5CA 2NZMA 1DBGA 4Z06A 4XQFA 4XNFA 2ODLA 3SUCA 1RWRA 4W8QA 1QJVA 4W8TA 4XKVA 4XORA 4NK8A 4XR6A 4OZYA 1WMRA 2X6XA 2INVA 4XN0A 1BN8A 1X0CA 1O8DA 4HWVA 1O8HA 4Z03A 3WWGA 1VBLA 2O1DA 4XMYA 1O88A 3GQAA 4YZXA 1O8JA 1EE6A 4XM3A 3VMVA 1DBOA 2UVFA 1JRGA 2QX3A 4W8RA 1CZFA 1IDJA 2Z8GA 2QXZA 3FY3A 3ZPPA 4W8SA 5C1EA 1NHCA 1PLUA 5C1CA 1PE9A 1QCXA 1HG8A 3JURA 1GQ8A 2VJIA 2QY1A 1H80A 1RMGA 4OJPA 4Z05A 1PXZA 4YEJA 1IA5A 1KTWA 4YELA 1O8LA 2O04A 2NT9A
chains in the Genus database with same CATH superfamily
3B8YA 3PETA 4YFOA 2V5IA 2QZAA 1OFLA 4C2LA 4YZ0A 4PMHA 2W7ZA 3PSSA 2NSTA 1KQ5A 1OGMX 2NTQA 4OZZA 3SZEA 4OJ6A 4YEIA 4XL9A 1JTAA 1L1IA 2VBEA 4V02C 1OFMA 3VSVA 1LLZA 3GRHA 1IDKA 1K4ZA 1QQ1A 1XG2A 2YUHA 3PSZA 3LMWA 1TYVA 4XKWA 4XN3A 1KCCA 4XOPA 3UW0A 3VSUA 1RU4A 2X6WA 2XTXA 4YDTA 3KRGA 2BSPA 2J8IA 1AIRA 2QYUA 2NTBA 4OM9A 1BHEA 3EQNA 4XLAA 4XLFA 4XLHA 2VBMA 2BX6A 3T9GA 2XTWA 3P4GA 4XLEA 4OPWA 1O8IA 3H09A 1TYUA 1O8FA 2NTPA 2O0VA 4EW9A 2UVEA 2VFNA 2X6YA 3JX8A 1OOCA 5DNSA 5JLVC 4XONA 3VMWA 4OJ5A 1EA0A 3GQ7A 1QRBA 3B4NA 4YZAA 1TYXA 4YZQA 3ZSCA 2XT4A 2XT2A 1LM1A 1TSPA 2PECA 4NK6A 4XOTA 2BM7A 1QA1A 4U4BA 2F3LA 4XLCA 1OGOX 2IQ7A 2NT6A 1IB4A 2PYHA 5AMVA 3AK5A 1O8EA 4U49A 1EZGA 1O8GA 1QA2A 1QA3A 2X85A 3ML3A 4MXNA 2VBKA 4I84A 1KCDA 2B0RA 2O0WA 2PYGA 2INUA 2EWEA 3EQOA 3N6ZA 2VJJA 2J8KA 2O17A 3VSTA 1LLWA 2IOUG 3SYJA 1O8MA 4KH3A 1CLWA 3LJYA 3GQ8A 2VFMA 4YC5A 2G0YA 2XC1A 4MR0A 1O8KA 3B90A 3GQ9A 2X3HA 1OFEA 4AVZA 4URRA 2NSPA 3DU1X 2VFOA 4OJLA 4OJOA 1K5CA 2NZMA 1DBGA 3SY2A 4Z06A 4XQFA 4XNFA 2ODLA 3SUCA 1RWRA 3BH7B 4W8QA 1QJVA 4W8TA 4XKVA 4XORA 4NK8A 2BM6A 3BH6B 1OFDA 3N90A 4XR6A 1TYWA 3TH0A 4OZYA 1WMRA 2X6XA 2INVA 4XN0A 1BN8A 1X0CA 1O8DA 4HWVA 1O8HA 3NAWA 2BM5A 4JRAC 4YCQA 4Z03A 2VFPA 3WWGA 1QRCA 1VBLA 5JMCB 2O1DA 4XMYA 1O88A 3GQAA 4YZXA 1O8JA 1EE6A 3LYCA 2O6WA 4XM3A 3VMVA 3NB2A 1DBOA 2UVFA 2XTYA 1JRGA 2QX3A 2VFQA 4W8RA 1CZFA 1IDJA 1K8FA 2BM4A 2Z8GA 2QXZA 1DABA 1HF2A 3FY3A 3ZPPA 4W8SA 5C1EA 1NHCA 1PLUA 5C1CA 1PE9A 1WXRA 1QCXA 1HG8A 3JURA 1GQ8A 2VJIA 2QY1A 1H80A 1RMGA 4OJPA 4Z05A 3SQVA 1PXZA 4YEJA 1IA5A 1KTWA 4YELA 3RIQA 1O8LA 2O04A 2NT9A
chains in the Genus database with same CATH topology
3B8YA 1OFLA 4C2LA 4YZ0A 4PMHA 2NSTA 1OGMX 2NTQA 4OZZA 4OJ6A 4XL9A 1JTAA 2VBEA 3VSVA 1OFMA 3GRHA 1IDKA 1XG2A 4XKWA 1KCCA 3LMWA 4XN3A 4XOPA 3UW0A 3VSUA 1RU4A 2X6WA 3KRGA 2BSPA 1AIRA 2NTBA 4XLFA 1BHEA 3EQNA 4XLAA 4XLHA 2VBMA 3T9GA 4XLEA 1O8IA 1O8FA 2NTPA 2O0VA 4EW9A 2UVEA 2X6YA 1OOCA 4XONA 3VMWA 4OJ5A 3GQ7A 3B4NA 4YZAA 4YZQA 3ZSCA 4NK6A 2PECA 4XOTA 4U4BA 4XLCA 1OGOX 2IQ7A 2NT6A 1IB4A 2PYHA 5AMVA 1O8EA 4U49A 1O8GA 2X85A 4MXNA 2VBKA 4I84A 1KCDA 2O0WA 2PYGA 2INUA 2EWEA 3EQOA 2VJJA 2O17A 3VSTA 1O8MA 3GQ8A 4MR0A 1O8KA 3B90A 3GQ9A 2X3HA 4AVZA 4URRA 2NSPA 4OJOA 4OJLA 1K5CA 2NZMA 1DBGA 4Z06A 4XQFA 4XNFA 2ODLA 3SUCA 1RWRA 4W8QA 1QJVA 4W8TA 4XKVA 4XORA 4NK8A 4XR6A 4OZYA 1WMRA 2X6XA 2INVA 4XN0A 1BN8A 1X0CA 1O8DA 4HWVA 1O8HA 4Z03A 3WWGA 1VBLA 2O1DA 4XMYA 1O88A 3GQAA 4YZXA 1O8JA 1EE6A 4XM3A 3VMVA 1DBOA 2UVFA 1JRGA 2QX3A 4W8RA 1CZFA 1IDJA 2Z8GA 2QXZA 3FY3A 3ZPPA 4W8SA 5C1EA 1NHCA 1PLUA 5C1CA 1PE9A 1QCXA 1HG8A 3JURA 1GQ8A 2VJIA 2QY1A 1H80A 1RMGA 4OJPA 4Z05A 1PXZA 4YEJA 1IA5A 1KTWA 4YELA 1O8LA 2O04A 2NT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8Y A;  1OFL A;  4C2L A;  4YZ0 A;  4PMH A;  2NST A;  1OGM X;  2NTQ A;  4OZZ A;  4OJ6 A;  4XL9 A;  1JTA A;  2VBE A;  3VSV A;  1OFM A;  3GRH A;  1IDK A;  1XG2 A;  4XKW A;  1KCC A;  3LMW A;  4XN3 A;  4XOP A;  3UW0 A;  3VSU A;  1RU4 A;  2X6W A;  3KRG A;  2BSP A;  1AIR A;  2NTB A;  4XLF A;  1BHE A;  3EQN A;  4XLA A;  4XLH A;  2VBM A;  3T9G A;  4XLE A;  1O8I A;  1O8F A;  2NTP A;  2O0V A;  4EW9 A;  2UVE A;  2X6Y A;  1OOC A;  4XON A;  3VMW A;  4OJ5 A;  3GQ7 A;  3B4N A;  4YZA A;  4YZQ A;  3ZSC A;  4NK6 A;  2PEC A;  4XOT A;  4U4B A;  4XLC A;  1OGO X;  2IQ7 A;  2NT6 A;  1IB4 A;  2PYH A;  5AMV A;  1O8E A;  4U49 A;  1O8G A;  2X85 A;  4MXN A;  2VBK A;  4I84 A;  1KCD A;  2O0W A;  2PYG A;  2INU A;  2EWE A;  3EQO A;  2VJJ A;  2O17 A;  3VST A;  1O8M A;  3GQ8 A;  4MR0 A;  1O8K A;  3B90 A;  3GQ9 A;  2X3H A;  4AVZ A;  4URR A;  2NSP A;  4OJO A;  4OJL A;  1K5C A;  2NZM A;  1DBG A;  4Z06 A;  4XQF A;  4XNF A;  2ODL A;  3SUC A;  1RWR A;  4W8Q A;  1QJV A;  4W8T A;  4XKV A;  4XOR A;  4NK8 A;  4XR6 A;  4OZY A;  1WMR A;  2X6X A;  2INV A;  4XN0 A;  1BN8 A;  1X0C A;  1O8D A;  4HWV A;  1O8H A;  4Z03 A;  3WWG A;  1VBL A;  2O1D A;  4XMY A;  1O88 A;  3GQA A;  4YZX A;  1O8J A;  1EE6 A;  4XM3 A;  3VMV A;  1DBO A;  2UVF A;  1JRG A;  2QX3 A;  4W8R A;  1CZF A;  1IDJ A;  2Z8G A;  2QXZ A;  3FY3 A;  3ZPP A;  4W8S A;  5C1E A;  1NHC A;  1PLU A;  5C1C A;  1PE9 A;  1QCX A;  1HG8 A;  3JUR A;  1GQ8 A;  2VJI A;  2QY1 A;  1H80 A;  1RMG A;  4OJP A;  4Z05 A;  1PXZ A;  4YEJ A;  1IA5 A;  1KTW A;  4YEL A;  1O8L A;  2O04 A;  2NT9 A; 
#chains in the Genus database with same CATH topology
 3B8Y A;  3PET A;  4YFO A;  2V5I A;  2QZA A;  1OFL A;  4C2L A;  4YZ0 A;  4PMH A;  2W7Z A;  3PSS A;  2NST A;  1KQ5 A;  1OGM X;  2NTQ A;  4OZZ A;  3SZE A;  4OJ6 A;  4YEI A;  4XL9 A;  1JTA A;  1L1I A;  2VBE A;  4V02 C;  1OFM A;  3VSV A;  1LLZ A;  3GRH A;  1IDK A;  1K4Z A;  1QQ1 A;  1XG2 A;  2YUH A;  3PSZ A;  3LMW A;  1TYV A;  4XKW A;  4XN3 A;  1KCC A;  4XOP A;  3UW0 A;  3VSU A;  1RU4 A;  2X6W A;  2XTX A;  4YDT A;  3KRG A;  2BSP A;  2J8I A;  1AIR A;  2QYU A;  2NTB A;  4OM9 A;  1BHE A;  3EQN A;  4XLA A;  4XLF A;  4XLH A;  2VBM A;  2BX6 A;  3T9G A;  2XTW A;  3P4G A;  4XLE A;  4OPW A;  1O8I A;  3H09 A;  1TYU A;  1O8F A;  2NTP A;  2O0V A;  4EW9 A;  2UVE A;  2VFN A;  2X6Y A;  3JX8 A;  1OOC A;  5DNS A;  5JLV C;  4XON A;  3VMW A;  4OJ5 A;  1EA0 A;  3GQ7 A;  1QRB A;  3B4N A;  4YZA A;  1TYX A;  4YZQ A;  3ZSC A;  2XT4 A;  2XT2 A;  1LM1 A;  1TSP A;  2PEC A;  4NK6 A;  4XOT A;  2BM7 A;  1QA1 A;  4U4B A;  2F3L A;  4XLC A;  1OGO X;  2IQ7 A;  2NT6 A;  1IB4 A;  2PYH A;  5AMV A;  3AK5 A;  1O8E A;  4U49 A;  1EZG A;  1O8G A;  1QA2 A;  1QA3 A;  2X85 A;  3ML3 A;  4MXN A;  2VBK A;  4I84 A;  1KCD A;  2B0R A;  2O0W A;  2PYG A;  2INU A;  2EWE A;  3EQO A;  3N6Z A;  2VJJ A;  2J8K A;  2O17 A;  3VST A;  1LLW A;  2IOU G;  3SYJ A;  1O8M A;  4KH3 A;  1CLW A;  3LJY A;  3GQ8 A;  2VFM A;  4YC5 A;  2G0Y A;  2XC1 A;  4MR0 A;  1O8K A;  3B90 A;  3GQ9 A;  2X3H A;  1OFE A;  4AVZ A;  4URR A;  2NSP A;  3DU1 X;  2VFO A;  4OJL A;  4OJO A;  1K5C A;  2NZM A;  1DBG A;  3SY2 A;  4Z06 A;  4XQF A;  4XNF A;  2ODL A;  3SUC A;  1RWR A;  3BH7 B;  4W8Q A;  1QJV A;  4W8T A;  4XKV A;  4XOR A;  4NK8 A;  2BM6 A;  3BH6 B;  1OFD A;  3N90 A;  4XR6 A;  1TYW A;  3TH0 A;  4OZY A;  1WMR A;  2X6X A;  2INV A;  4XN0 A;  1BN8 A;  1X0C A;  1O8D A;  4HWV A;  1O8H A;  3NAW A;  2BM5 A;  4JRA C;  4YCQ A;  4Z03 A;  2VFP A;  3WWG A;  1QRC A;  1VBL A;  5JMC B;  2O1D A;  4XMY A;  1O88 A;  3GQA A;  4YZX A;  1O8J A;  1EE6 A;  3LYC A;  2O6W A;  4XM3 A;  3VMV A;  3NB2 A;  1DBO A;  2UVF A;  2XTY A;  1JRG A;  2QX3 A;  2VFQ A;  4W8R A;  1CZF A;  1IDJ A;  1K8F A;  2BM4 A;  2Z8G A;  2QXZ A;  1DAB A;  1HF2 A;  3FY3 A;  3ZPP A;  4W8S A;  5C1E A;  1NHC A;  1PLU A;  5C1C A;  1PE9 A;  1WXR A;  1QCX A;  1HG8 A;  3JUR A;  1GQ8 A;  2VJI A;  2QY1 A;  1H80 A;  1RMG A;  4OJP A;  4Z05 A;  3SQV A;  1PXZ A;  4YEJ A;  1IA5 A;  1KTW A;  4YEL A;  3RIQ A;  1O8L A;  2O04 A;  2NT9 A; 
#chains in the Genus database with same CATH homology
 3B8Y A;  1OFL A;  4C2L A;  4YZ0 A;  4PMH A;  2NST A;  1OGM X;  2NTQ A;  4OZZ A;  4OJ6 A;  4XL9 A;  1JTA A;  2VBE A;  3VSV A;  1OFM A;  3GRH A;  1IDK A;  1XG2 A;  4XKW A;  1KCC A;  3LMW A;  4XN3 A;  4XOP A;  3UW0 A;  3VSU A;  1RU4 A;  2X6W A;  3KRG A;  2BSP A;  1AIR A;  2NTB A;  4XLF A;  1BHE A;  3EQN A;  4XLA A;  4XLH A;  2VBM A;  3T9G A;  4XLE A;  1O8I A;  1O8F A;  2NTP A;  2O0V A;  4EW9 A;  2UVE A;  2X6Y A;  1OOC A;  4XON A;  3VMW A;  4OJ5 A;  3GQ7 A;  3B4N A;  4YZA A;  4YZQ A;  3ZSC A;  4NK6 A;  2PEC A;  4XOT A;  4U4B A;  4XLC A;  1OGO X;  2IQ7 A;  2NT6 A;  1IB4 A;  2PYH A;  5AMV A;  1O8E A;  4U49 A;  1O8G A;  2X85 A;  4MXN A;  2VBK A;  4I84 A;  1KCD A;  2O0W A;  2PYG A;  2INU A;  2EWE A;  3EQO A;  2VJJ A;  2O17 A;  3VST A;  1O8M A;  3GQ8 A;  4MR0 A;  1O8K A;  3B90 A;  3GQ9 A;  2X3H A;  4AVZ A;  4URR A;  2NSP A;  4OJO A;  4OJL A;  1K5C A;  2NZM A;  1DBG A;  4Z06 A;  4XQF A;  4XNF A;  2ODL A;  3SUC A;  1RWR A;  4W8Q A;  1QJV A;  4W8T A;  4XKV A;  4XOR A;  4NK8 A;  4XR6 A;  4OZY A;  1WMR A;  2X6X A;  2INV A;  4XN0 A;  1BN8 A;  1X0C A;  1O8D A;  4HWV A;  1O8H A;  4Z03 A;  3WWG A;  1VBL A;  2O1D A;  4XMY A;  1O88 A;  3GQA A;  4YZX A;  1O8J A;  1EE6 A;  4XM3 A;  3VMV A;  1DBO A;  2UVF A;  1JRG A;  2QX3 A;  4W8R A;  1CZF A;  1IDJ A;  2Z8G A;  2QXZ A;  3FY3 A;  3ZPP A;  4W8S A;  5C1E A;  1NHC A;  1PLU A;  5C1C A;  1PE9 A;  1QCX A;  1HG8 A;  3JUR A;  1GQ8 A;  2VJI A;  2QY1 A;  1H80 A;  1RMG A;  4OJP A;  4Z05 A;  1PXZ A;  4YEJ A;  1IA5 A;  1KTW A;  4YEL A;  1O8L A;  2O04 A;  2NT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...