2NSTA

Crystal structure of pectin methylesterase d178a mutant in complex with hexasaccharide ii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
b'ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQATLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2nstA00
4XONA 1IA5A 2O17A 1JRGA 5C1EA 1OGOX 4NK6A 3KRGA 3T9GA 3ZPPA 2O0VA 4XLCA 1O8DA 2X6XA 3GQ8A 1OOCA 3JURA 4OZZA 3VMWA 3ZSCA 2PECA 4XM3A 2PYGA 5AMVA 3WWGA 4XOTA 2X3HA 2PYHA 4XL9A 4YELA 1JTAA 1BN8A 4W8TA 4XN3A 4W8QA 1CZFA 1PE9A 1QJVA 4EW9A 2INVA 4Z03A 1KCCA 1O88A 3FY3A 1O8HA 2VBEA 3VSVA 4MXNA 4XKWA 2X6YA 2NT9A 3B90A 4AVZA 3SUCA 1BHEA 1KTWA 4YEJA 2QX3A 1O8EA 4XN0A 1O8MA 4NK8A 2VBMA 4OJ5A 1XG2A 2EWEA 2BSPA 4OJOA 4XKVA 4Z06A 1IDJA 2NT6A 4U4BA 3UW0A 4XLEA 4U49A 1HG8A 4XLHA 1IB4A 4PMHA 4I84A 1EE6A 2X6WA 4YZ0A 4XQFA 1KCDA 4Z05A 3GQAA 2X85A 4URRA 4OJLA 4W8SA 2NSPA 3GQ7A 4C2LA 1H80A 1QCXA 1O8LA 2NTQA 4YZXA 1RMGA 1O8KA 3VMVA 1O8GA 4OJ6A 4XMYA 4XNFA 1RU4A 1PXZA 5C1CA 3B4NA 1GQ8A 2INUA 1DBOA 2ODLA 4XLAA 1OGMX 2NTPA 1O8IA 1DBGA 1AIRA 4YZAA 2NTBA 2NZMA 1VBLA 4W8RA 2IQ7A 3B8YA 4MR0A 4XR6A 4OZYA 1O8JA 4XORA 2VBKA 4XOPA 2Z8GA 3GQ9A 2VJIA 4XLFA 1X0CA 4YZQA 1IDKA 2O04A 2NSTA 2UVEA 2UVFA 1K5CA 2QXZA 2VJJA 3EQOA 1PLUA 3VSTA 3VSUA 2QY1A 3EQNA 1OFMA 1WMRA 2O1DA 1RWRA 4HWVA 1NHCA 2O0WA 1O8FA 3GRHA 4OJPA 1OFLA 3LMWA
chains in the Genus database with same CATH superfamily
1QRCA 3NB2A 2XT2A 4XONA 1IA5A 2BM4A 1JRGA 2O17A 2QYUA 5C1EA 1OGOX 2G0YA 4NK6A 3KRGA 3T9GA 2F3LA 3ZPPA 1EZGA 2O0VA 1LLWA 1O8DA 2VFQA 2X6XA 1OOCA 3GQ8A 3JURA 3N6ZA 4OZZA 3RIQA 3VMWA 2PECA 4XM3A 2PYGA 5AMVA 3WWGA 3PSSA 4XOTA 2X3HA 1TYXA 2PYHA 1OFDA 4XL9A 3H09A 1JTAA 1BN8A 3P4GA 4W8TA 4XN3A 4YELA 1K4ZA 4W8QA 1CZFA 1PE9A 1QQ1A 1QJVA 3LJYA 2W7ZA 4EW9A 3TH0A 2INVA 3SY2A 4V02C 4Z03A 1O88A 1TYVA 3BH6B 1KCCA 1QRBA 2XTWA 3FY3A 1O8HA 2VBEA 3VSVA 2XTYA 3PETA 4MXNA 4XKWA 4YCQA 2X6YA 2V5IA 2NT9A 2BM5A 3B90A 4AVZA 3SUCA 2O6WA 1BHEA 1KTWA 1TYUA 3DU1X 4YEJA 5JMCB 2XTXA 2QX3A 1O8EA 4XN0A 1QA3A 1O8MA 3SQVA 4NK8A 2VBMA 2VFMA 4OJ5A 2XT4A 1XG2A 2EWEA 2BSPA 1L1IA 4OJOA 4XKVA 4Z06A 1IDJA 2NT6A 4U4BA 3UW0A 4XLEA 4U49A 1HG8A 4XLHA 1IB4A 4PMHA 4I84A 3N90A 3NAWA 1EE6A 1WXRA 2X6WA 1EA0A 4YZ0A 4XQFA 1KCDA 1K8FA 4Z05A 4YDTA 1LLZA 3GQAA 2X85A 2YUHA 4URRA 4OJLA 2B0RA 4W8SA 2NSPA 3GQ7A 4C2LA 1H80A 1QCXA 1O8LA 2NTQA 4YZXA 1RMGA 2VFNA 1O8KA 3VMVA 2BM6A 1TYWA 1O8GA 4OJ6A 4XMYA 4XNFA 1RU4A 3LYCA 1PXZA 5C1CA 3B4NA 1GQ8A 2INUA 2BM7A 2J8KA 4OPWA 3ML3A 1LM1A 1TSPA 2VFOA 1DBOA 3JX8A 2ODLA 5DNSA 4XLAA 1OGMX 2NTPA 1O8IA 1DBGA 2QZAA 4JRAC 2IOUG 4XLCA 4YC5A 2J8IA 1AIRA 4OM9A 2NTBA 4YZAA 3SZEA 2NZMA 1VBLA 4W8RA 2IQ7A 3B8YA 4MR0A 4XR6A 4OZYA 1O8JA 4XORA 2VBKA 3PSZA 4XOPA 3BH7B 1DABA 2Z8GA 3GQ9A 2VJIA 4XLFA 3AK5A 1X0CA 4YZQA 1IDKA 1KQ5A 2O04A 4KH3A 3SYJA 3ZSCA 2NSTA 2UVEA 2UVFA 2XC1A 1OFEA 1K5CA 2QXZA 2VJJA 3EQOA 1PLUA 3VSTA 1QA1A 3VSUA 2QY1A 1QA2A 3EQNA 5JLVC 1OFMA 1WMRA 2O1DA 1RWRA 1HF2A 4HWVA 1NHCA 2O0WA 1O8FA 2VFPA 3GRHA 4OJPA 1OFLA 4YEIA 2BX6A 4YFOA 1CLWA 3LMWA
chains in the Genus database with same CATH topology
4XONA 1IA5A 2O17A 1JRGA 5C1EA 1OGOX 4NK6A 3KRGA 3T9GA 3ZPPA 2O0VA 4XLCA 1O8DA 2X6XA 3GQ8A 1OOCA 3JURA 4OZZA 3VMWA 3ZSCA 2PECA 4XM3A 2PYGA 5AMVA 3WWGA 4XOTA 2X3HA 2PYHA 4XL9A 4YELA 1JTAA 1BN8A 4W8TA 4XN3A 4W8QA 1CZFA 1PE9A 1QJVA 4EW9A 2INVA 4Z03A 1KCCA 1O88A 3FY3A 1O8HA 2VBEA 3VSVA 4MXNA 4XKWA 2X6YA 2NT9A 3B90A 4AVZA 3SUCA 1BHEA 1KTWA 4YEJA 2QX3A 1O8EA 4XN0A 1O8MA 4NK8A 2VBMA 4OJ5A 1XG2A 2EWEA 2BSPA 4OJOA 4XKVA 4Z06A 1IDJA 2NT6A 4U4BA 3UW0A 4XLEA 4U49A 1HG8A 4XLHA 1IB4A 4PMHA 4I84A 1EE6A 2X6WA 4YZ0A 4XQFA 1KCDA 4Z05A 3GQAA 2X85A 4URRA 4OJLA 4W8SA 2NSPA 3GQ7A 4C2LA 1H80A 1QCXA 1O8LA 2NTQA 4YZXA 1RMGA 1O8KA 3VMVA 1O8GA 4OJ6A 4XMYA 4XNFA 1RU4A 1PXZA 5C1CA 3B4NA 1GQ8A 2INUA 1DBOA 2ODLA 4XLAA 1OGMX 2NTPA 1O8IA 1DBGA 1AIRA 4YZAA 2NTBA 2NZMA 1VBLA 4W8RA 2IQ7A 3B8YA 4MR0A 4XR6A 4OZYA 1O8JA 4XORA 2VBKA 4XOPA 2Z8GA 3GQ9A 2VJIA 4XLFA 1X0CA 4YZQA 1IDKA 2O04A 2NSTA 2UVEA 2UVFA 1K5CA 2QXZA 2VJJA 3EQOA 1PLUA 3VSTA 3VSUA 2QY1A 3EQNA 1OFMA 1WMRA 2O1DA 1RWRA 4HWVA 1NHCA 2O0WA 1O8FA 3GRHA 4OJPA 1OFLA 3LMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XON A;  1IA5 A;  2O17 A;  1JRG A;  5C1E A;  1OGO X;  4NK6 A;  3KRG A;  3T9G A;  3ZPP A;  2O0V A;  4XLC A;  1O8D A;  2X6X A;  3GQ8 A;  1OOC A;  3JUR A;  4OZZ A;  3VMW A;  3ZSC A;  2PEC A;  4XM3 A;  2PYG A;  5AMV A;  3WWG A;  4XOT A;  2X3H A;  2PYH A;  4XL9 A;  4YEL A;  1JTA A;  1BN8 A;  4W8T A;  4XN3 A;  4W8Q A;  1CZF A;  1PE9 A;  1QJV A;  4EW9 A;  2INV A;  4Z03 A;  1KCC A;  1O88 A;  3FY3 A;  1O8H A;  2VBE A;  3VSV A;  4MXN A;  4XKW A;  2X6Y A;  2NT9 A;  3B90 A;  4AVZ A;  3SUC A;  1BHE A;  1KTW A;  4YEJ A;  2QX3 A;  1O8E A;  4XN0 A;  1O8M A;  4NK8 A;  2VBM A;  4OJ5 A;  1XG2 A;  2EWE A;  2BSP A;  4OJO A;  4XKV A;  4Z06 A;  1IDJ A;  2NT6 A;  4U4B A;  3UW0 A;  4XLE A;  4U49 A;  1HG8 A;  4XLH A;  1IB4 A;  4PMH A;  4I84 A;  1EE6 A;  2X6W A;  4YZ0 A;  4XQF A;  1KCD A;  4Z05 A;  3GQA A;  2X85 A;  4URR A;  4OJL A;  4W8S A;  2NSP A;  3GQ7 A;  4C2L A;  1H80 A;  1QCX A;  1O8L A;  2NTQ A;  4YZX A;  1RMG A;  1O8K A;  3VMV A;  1O8G A;  4OJ6 A;  4XMY A;  4XNF A;  1RU4 A;  1PXZ A;  5C1C A;  3B4N A;  1GQ8 A;  2INU A;  1DBO A;  2ODL A;  4XLA A;  1OGM X;  2NTP A;  1O8I A;  1DBG A;  1AIR A;  4YZA A;  2NTB A;  2NZM A;  1VBL A;  4W8R A;  2IQ7 A;  3B8Y A;  4MR0 A;  4XR6 A;  4OZY A;  1O8J A;  4XOR A;  2VBK A;  4XOP A;  2Z8G A;  3GQ9 A;  2VJI A;  4XLF A;  1X0C A;  4YZQ A;  1IDK A;  2O04 A;  2NST A;  2UVE A;  2UVF A;  1K5C A;  2QXZ A;  2VJJ A;  3EQO A;  1PLU A;  3VST A;  3VSU A;  2QY1 A;  3EQN A;  1OFM A;  1WMR A;  2O1D A;  1RWR A;  4HWV A;  1NHC A;  2O0W A;  1O8F A;  3GRH A;  4OJP A;  1OFL A;  3LMW A; 
#chains in the Genus database with same CATH topology
 1QRC A;  3NB2 A;  2XT2 A;  4XON A;  1IA5 A;  2BM4 A;  1JRG A;  2O17 A;  2QYU A;  5C1E A;  1OGO X;  2G0Y A;  4NK6 A;  3KRG A;  3T9G A;  2F3L A;  3ZPP A;  1EZG A;  2O0V A;  1LLW A;  1O8D A;  2VFQ A;  2X6X A;  1OOC A;  3GQ8 A;  3JUR A;  3N6Z A;  4OZZ A;  3RIQ A;  3VMW A;  2PEC A;  4XM3 A;  2PYG A;  5AMV A;  3WWG A;  3PSS A;  4XOT A;  2X3H A;  1TYX A;  2PYH A;  1OFD A;  4XL9 A;  3H09 A;  1JTA A;  1BN8 A;  3P4G A;  4W8T A;  4XN3 A;  4YEL A;  1K4Z A;  4W8Q A;  1CZF A;  1PE9 A;  1QQ1 A;  1QJV A;  3LJY A;  2W7Z A;  4EW9 A;  3TH0 A;  2INV A;  3SY2 A;  4V02 C;  4Z03 A;  1O88 A;  1TYV A;  3BH6 B;  1KCC A;  1QRB A;  2XTW A;  3FY3 A;  1O8H A;  2VBE A;  3VSV A;  2XTY A;  3PET A;  4MXN A;  4XKW A;  4YCQ A;  2X6Y A;  2V5I A;  2NT9 A;  2BM5 A;  3B90 A;  4AVZ A;  3SUC A;  2O6W A;  1BHE A;  1KTW A;  1TYU A;  3DU1 X;  4YEJ A;  5JMC B;  2XTX A;  2QX3 A;  1O8E A;  4XN0 A;  1QA3 A;  1O8M A;  3SQV A;  4NK8 A;  2VBM A;  2VFM A;  4OJ5 A;  2XT4 A;  1XG2 A;  2EWE A;  2BSP A;  1L1I A;  4OJO A;  4XKV A;  4Z06 A;  1IDJ A;  2NT6 A;  4U4B A;  3UW0 A;  4XLE A;  4U49 A;  1HG8 A;  4XLH A;  1IB4 A;  4PMH A;  4I84 A;  3N90 A;  3NAW A;  1EE6 A;  1WXR A;  2X6W A;  1EA0 A;  4YZ0 A;  4XQF A;  1KCD A;  1K8F A;  4Z05 A;  4YDT A;  1LLZ A;  3GQA A;  2X85 A;  2YUH A;  4URR A;  4OJL A;  2B0R A;  4W8S A;  2NSP A;  3GQ7 A;  4C2L A;  1H80 A;  1QCX A;  1O8L A;  2NTQ A;  4YZX A;  1RMG A;  2VFN A;  1O8K A;  3VMV A;  2BM6 A;  1TYW A;  1O8G A;  4OJ6 A;  4XMY A;  4XNF A;  1RU4 A;  3LYC A;  1PXZ A;  5C1C A;  3B4N A;  1GQ8 A;  2INU A;  2BM7 A;  2J8K A;  4OPW A;  3ML3 A;  1LM1 A;  1TSP A;  2VFO A;  1DBO A;  3JX8 A;  2ODL A;  5DNS A;  4XLA A;  1OGM X;  2NTP A;  1O8I A;  1DBG A;  2QZA A;  4JRA C;  2IOU G;  4XLC A;  4YC5 A;  2J8I A;  1AIR A;  4OM9 A;  2NTB A;  4YZA A;  3SZE A;  2NZM A;  1VBL A;  4W8R A;  2IQ7 A;  3B8Y A;  4MR0 A;  4XR6 A;  4OZY A;  1O8J A;  4XOR A;  2VBK A;  3PSZ A;  4XOP A;  3BH7 B;  1DAB A;  2Z8G A;  3GQ9 A;  2VJI A;  4XLF A;  3AK5 A;  1X0C A;  4YZQ A;  1IDK A;  1KQ5 A;  2O04 A;  4KH3 A;  3SYJ A;  3ZSC A;  2NST A;  2UVE A;  2UVF A;  2XC1 A;  1OFE A;  1K5C A;  2QXZ A;  2VJJ A;  3EQO A;  1PLU A;  3VST A;  1QA1 A;  3VSU A;  2QY1 A;  1QA2 A;  3EQN A;  5JLV C;  1OFM A;  1WMR A;  2O1D A;  1RWR A;  1HF2 A;  4HWV A;  1NHC A;  2O0W A;  1O8F A;  2VFP A;  3GRH A;  4OJP A;  1OFL A;  4YEI A;  2BX6 A;  4YFO A;  1CLW A;  3LMW A; 
#chains in the Genus database with same CATH homology
 4XON A;  1IA5 A;  2O17 A;  1JRG A;  5C1E A;  1OGO X;  4NK6 A;  3KRG A;  3T9G A;  3ZPP A;  2O0V A;  4XLC A;  1O8D A;  2X6X A;  3GQ8 A;  1OOC A;  3JUR A;  4OZZ A;  3VMW A;  3ZSC A;  2PEC A;  4XM3 A;  2PYG A;  5AMV A;  3WWG A;  4XOT A;  2X3H A;  2PYH A;  4XL9 A;  4YEL A;  1JTA A;  1BN8 A;  4W8T A;  4XN3 A;  4W8Q A;  1CZF A;  1PE9 A;  1QJV A;  4EW9 A;  2INV A;  4Z03 A;  1KCC A;  1O88 A;  3FY3 A;  1O8H A;  2VBE A;  3VSV A;  4MXN A;  4XKW A;  2X6Y A;  2NT9 A;  3B90 A;  4AVZ A;  3SUC A;  1BHE A;  1KTW A;  4YEJ A;  2QX3 A;  1O8E A;  4XN0 A;  1O8M A;  4NK8 A;  2VBM A;  4OJ5 A;  1XG2 A;  2EWE A;  2BSP A;  4OJO A;  4XKV A;  4Z06 A;  1IDJ A;  2NT6 A;  4U4B A;  3UW0 A;  4XLE A;  4U49 A;  1HG8 A;  4XLH A;  1IB4 A;  4PMH A;  4I84 A;  1EE6 A;  2X6W A;  4YZ0 A;  4XQF A;  1KCD A;  4Z05 A;  3GQA A;  2X85 A;  4URR A;  4OJL A;  4W8S A;  2NSP A;  3GQ7 A;  4C2L A;  1H80 A;  1QCX A;  1O8L A;  2NTQ A;  4YZX A;  1RMG A;  1O8K A;  3VMV A;  1O8G A;  4OJ6 A;  4XMY A;  4XNF A;  1RU4 A;  1PXZ A;  5C1C A;  3B4N A;  1GQ8 A;  2INU A;  1DBO A;  2ODL A;  4XLA A;  1OGM X;  2NTP A;  1O8I A;  1DBG A;  1AIR A;  4YZA A;  2NTB A;  2NZM A;  1VBL A;  4W8R A;  2IQ7 A;  3B8Y A;  4MR0 A;  4XR6 A;  4OZY A;  1O8J A;  4XOR A;  2VBK A;  4XOP A;  2Z8G A;  3GQ9 A;  2VJI A;  4XLF A;  1X0C A;  4YZQ A;  1IDK A;  2O04 A;  2NST A;  2UVE A;  2UVF A;  1K5C A;  2QXZ A;  2VJJ A;  3EQO A;  1PLU A;  3VST A;  3VSU A;  2QY1 A;  3EQN A;  1OFM A;  1WMR A;  2O1D A;  1RWR A;  4HWV A;  1NHC A;  2O0W A;  1O8F A;  3GRH A;  4OJP A;  1OFL A;  3LMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...