2NSTA

Crystal structure of pectin methylesterase d178a mutant in complex with hexasaccharide ii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQATLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2nstA00
2NZMA 2O04A 4MXNA 2VBMA 5AMVA 1O88A 1KCDA 4OJOA 4XL9A 2X3HA 4HWVA 4OJLA 4XLFA 4AVZA 4NK6A 4W8SA 4XLCA 1RWRA 1K5CA 4I84A 2QXZA 4XORA 1RU4A 3GRHA 4XLHA 4XONA 1IDJA 2O0VA 3VMWA 1IA5A 4PMHA 1JRGA 1OFMA 3EQOA 3KRGA 1O8GA 2X6WA 2X6XA 4YZQA 1RMGA 2INUA 1IB4A 2NTPA 2BSPA 1WMRA 2EWEA 2Z8GA 4OJ6A 4XN3A 2INVA 3GQAA 3SUCA 1EE6A 1OFLA 2VJJA 3WWGA 2NTQA 1GQ8A 1OGMX 1O8DA 1QJVA 3ZPPA 4U4BA 4XQFA 3FY3A 3B90A 1OGOX 4OJPA 3VSVA 3VSUA 3UW0A 4W8RA 1NHCA 4OZYA 2NSPA 2VJIA 1DBOA 3JURA 1HG8A 3LMWA 1JTAA 1BHEA 2QX3A 4XNFA 2NTBA 1PLUA 4OZZA 1H80A 2QY1A 4Z05A 1IDKA 4EW9A 3T9GA 2NT9A 4Z06A 4YEJA 2O17A 4YZXA 4U49A 4XM3A 3B4NA 1O8MA 4W8QA 1PE9A 4XKVA 3GQ9A 2PYHA 4YELA 2NSTA 4XLEA 3GQ8A 2X85A 4C2LA 1O8HA 1VBLA 2O0WA 4Z03A 2IQ7A 2VBKA 3ZSCA 1O8FA 2VBEA 1O8IA 5C1CA 4MR0A 3GQ7A 1QCXA 1O8EA 2ODLA 4W8TA 4XMYA 4URRA 3VSTA 2PYGA 3B8YA 4XN0A 4OJ5A 4XOPA 4YZ0A 2UVEA 2X6YA 1KCCA 4XOTA 1O8JA 4XLAA 1O8LA 2UVFA 2PECA 1O8KA 1AIRA 2O1DA 1KTWA 1BN8A 1CZFA 1DBGA 3EQNA 1XG2A 1PXZA 2NT6A 4NK8A 4XKWA 4XR6A 1OOCA 4YZAA 5C1EA 3VMVA 1X0CA
chains in the Genus database with same CATH superfamily
2J8KA 2NZMA 2O04A 3PETA 2F3LA 4JRAC 2VFPA 4YC5A 1QA1A 4MXNA 2VBMA 5AMVA 1O88A 1KCDA 2BM4A 2XC1A 4OJOA 2BM7A 4XL9A 2X3HA 4HWVA 4OJLA 4XLFA 3LJYA 4AVZA 4NK6A 4W8SA 1OFEA 4XLCA 1RWRA 1K5CA 4I84A 5JLVC 1DABA 2QXZA 2YUHA 1RU4A 4XORA 3GRHA 4XLHA 4XONA 4YDTA 1IDJA 2O0VA 4OPWA 3VMWA 1IA5A 4PMHA 1JRGA 1OFMA 3EQOA 4OM9A 3KRGA 1O8GA 1QRCA 2B0RA 1TYWA 2X6WA 2X6XA 1RMGA 4YZQA 2INUA 1IB4A 2O6WA 2NTPA 2BSPA 1WMRA 2EWEA 2Z8GA 4OJ6A 1CLWA 4YEIA 4XN3A 1LLZA 2INVA 3GQAA 1OFDA 3SUCA 3H09A 1EE6A 2XTWA 2XT2A 1OFLA 2VJJA 3WWGA 2NTQA 3BH7B 2BM6A 1GQ8A 1OGMX 1EA0A 2VFQA 3PSZA 5DNSA 1O8DA 1QJVA 3ML3A 1L1IA 3ZPPA 4U4BA 4XQFA 3FY3A 3B90A 3PSSA 1OGOX 1HF2A 1KQ5A 3N6ZA 4OJPA 3VSVA 3DU1X 3VSUA 3UW0A 4W8RA 2XTYA 1NHCA 3JX8A 3NB2A 2NSPA 4OZYA 2VJIA 2VFOA 1DBOA 4YCQA 3JURA 1HG8A 3LMWA 1JTAA 1BHEA 2QX3A 1LM1A 4XNFA 2NTBA 1PLUA 1WXRA 2BX6A 4OZZA 1H80A 2QY1A 4Z05A 1TSPA 1IDKA 2QYUA 1TYVA 4EW9A 3T9GA 2NT9A 2XT4A 2BM5A 4Z06A 4YEJA 3N90A 2O17A 4YZXA 1LLWA 4U49A 4XM3A 3B4NA 2QZAA 1O8MA 2VFNA 1PE9A 4W8QA 4XKVA 3GQ9A 2PYHA 2W7ZA 4YELA 2NSTA 2XTXA 4XLEA 3GQ8A 2X85A 3SY2A 4C2LA 3AK5A 1O8HA 1VBLA 2O0WA 4Z03A 2IQ7A 2VBKA 3ZSCA 3BH6B 1O8FA 2VBEA 1O8IA 3SQVA 2J8IA 5C1CA 4MR0A 3GQ7A 3SZEA 1QA3A 1QCXA 1O8EA 2ODLA 4W8TA 4XMYA 1EZGA 1K4ZA 4URRA 3RIQA 3VSTA 1QRBA 2PYGA 3B8YA 4XN0A 4KH3A 4OJ5A 4XOPA 3NAWA 4YZ0A 4YFOA 2UVEA 2X6YA 3SYJA 1KCCA 1TYUA 2IOUG 1K8FA 3P4GA 2G0YA 4XOTA 1O8JA 4XLAA 1TYXA 2V5IA 5JMCB 3LYCA 1O8LA 2UVFA 4V02C 2PECA 1O8KA 1AIRA 2O1DA 1KTWA 2VFMA 1BN8A 1CZFA 1DBGA 3TH0A 3EQNA 1XG2A 1PXZA 2NT6A 4NK8A 4XKWA 4XR6A 1OOCA 4YZAA 5C1EA 3VMVA 1QA2A 1QQ1A 1X0CA
chains in the Genus database with same CATH topology
2NZMA 2O04A 4MXNA 2VBMA 5AMVA 1O88A 1KCDA 4OJOA 4XL9A 2X3HA 4HWVA 4OJLA 4XLFA 4AVZA 4NK6A 4W8SA 4XLCA 1RWRA 1K5CA 4I84A 2QXZA 4XORA 1RU4A 3GRHA 4XLHA 4XONA 1IDJA 2O0VA 3VMWA 1IA5A 4PMHA 1JRGA 1OFMA 3EQOA 3KRGA 1O8GA 2X6WA 2X6XA 4YZQA 1RMGA 2INUA 1IB4A 2NTPA 2BSPA 1WMRA 2EWEA 2Z8GA 4OJ6A 4XN3A 2INVA 3GQAA 3SUCA 1EE6A 1OFLA 2VJJA 3WWGA 2NTQA 1GQ8A 1OGMX 1O8DA 1QJVA 3ZPPA 4U4BA 4XQFA 3FY3A 3B90A 1OGOX 4OJPA 3VSVA 3VSUA 3UW0A 4W8RA 1NHCA 4OZYA 2NSPA 2VJIA 1DBOA 3JURA 1HG8A 3LMWA 1JTAA 1BHEA 2QX3A 4XNFA 2NTBA 1PLUA 4OZZA 1H80A 2QY1A 4Z05A 1IDKA 4EW9A 3T9GA 2NT9A 4Z06A 4YEJA 2O17A 4YZXA 4U49A 4XM3A 3B4NA 1O8MA 4W8QA 1PE9A 4XKVA 3GQ9A 2PYHA 4YELA 2NSTA 4XLEA 3GQ8A 2X85A 4C2LA 1O8HA 1VBLA 2O0WA 4Z03A 2IQ7A 2VBKA 3ZSCA 1O8FA 2VBEA 1O8IA 5C1CA 4MR0A 3GQ7A 1QCXA 1O8EA 2ODLA 4W8TA 4XMYA 4URRA 3VSTA 2PYGA 3B8YA 4XN0A 4OJ5A 4XOPA 4YZ0A 2UVEA 2X6YA 1KCCA 4XOTA 1O8JA 4XLAA 1O8LA 2UVFA 2PECA 1O8KA 1AIRA 2O1DA 1KTWA 1BN8A 1CZFA 1DBGA 3EQNA 1XG2A 1PXZA 2NT6A 4NK8A 4XKWA 4XR6A 1OOCA 4YZAA 5C1EA 3VMVA 1X0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZM A;  2O04 A;  4MXN A;  2VBM A;  5AMV A;  1O88 A;  1KCD A;  4OJO A;  4XL9 A;  2X3H A;  4HWV A;  4OJL A;  4XLF A;  4AVZ A;  4NK6 A;  4W8S A;  4XLC A;  1RWR A;  1K5C A;  4I84 A;  2QXZ A;  4XOR A;  1RU4 A;  3GRH A;  4XLH A;  4XON A;  1IDJ A;  2O0V A;  3VMW A;  1IA5 A;  4PMH A;  1JRG A;  1OFM A;  3EQO A;  3KRG A;  1O8G A;  2X6W A;  2X6X A;  4YZQ A;  1RMG A;  2INU A;  1IB4 A;  2NTP A;  2BSP A;  1WMR A;  2EWE A;  2Z8G A;  4OJ6 A;  4XN3 A;  2INV A;  3GQA A;  3SUC A;  1EE6 A;  1OFL A;  2VJJ A;  3WWG A;  2NTQ A;  1GQ8 A;  1OGM X;  1O8D A;  1QJV A;  3ZPP A;  4U4B A;  4XQF A;  3FY3 A;  3B90 A;  1OGO X;  4OJP A;  3VSV A;  3VSU A;  3UW0 A;  4W8R A;  1NHC A;  4OZY A;  2NSP A;  2VJI A;  1DBO A;  3JUR A;  1HG8 A;  3LMW A;  1JTA A;  1BHE A;  2QX3 A;  4XNF A;  2NTB A;  1PLU A;  4OZZ A;  1H80 A;  2QY1 A;  4Z05 A;  1IDK A;  4EW9 A;  3T9G A;  2NT9 A;  4Z06 A;  4YEJ A;  2O17 A;  4YZX A;  4U49 A;  4XM3 A;  3B4N A;  1O8M A;  4W8Q A;  1PE9 A;  4XKV A;  3GQ9 A;  2PYH A;  4YEL A;  2NST A;  4XLE A;  3GQ8 A;  2X85 A;  4C2L A;  1O8H A;  1VBL A;  2O0W A;  4Z03 A;  2IQ7 A;  2VBK A;  3ZSC A;  1O8F A;  2VBE A;  1O8I A;  5C1C A;  4MR0 A;  3GQ7 A;  1QCX A;  1O8E A;  2ODL A;  4W8T A;  4XMY A;  4URR A;  3VST A;  2PYG A;  3B8Y A;  4XN0 A;  4OJ5 A;  4XOP A;  4YZ0 A;  2UVE A;  2X6Y A;  1KCC A;  4XOT A;  1O8J A;  4XLA A;  1O8L A;  2UVF A;  2PEC A;  1O8K A;  1AIR A;  2O1D A;  1KTW A;  1BN8 A;  1CZF A;  1DBG A;  3EQN A;  1XG2 A;  1PXZ A;  2NT6 A;  4NK8 A;  4XKW A;  4XR6 A;  1OOC A;  4YZA A;  5C1E A;  3VMV A;  1X0C A; 
#chains in the Genus database with same CATH topology
 2J8K A;  2NZM A;  2O04 A;  3PET A;  2F3L A;  4JRA C;  2VFP A;  4YC5 A;  1QA1 A;  4MXN A;  2VBM A;  5AMV A;  1O88 A;  1KCD A;  2BM4 A;  2XC1 A;  4OJO A;  2BM7 A;  4XL9 A;  2X3H A;  4HWV A;  4OJL A;  4XLF A;  3LJY A;  4AVZ A;  4NK6 A;  4W8S A;  1OFE A;  4XLC A;  1RWR A;  1K5C A;  4I84 A;  5JLV C;  1DAB A;  2QXZ A;  2YUH A;  1RU4 A;  4XOR A;  3GRH A;  4XLH A;  4XON A;  4YDT A;  1IDJ A;  2O0V A;  4OPW A;  3VMW A;  1IA5 A;  4PMH A;  1JRG A;  1OFM A;  3EQO A;  4OM9 A;  3KRG A;  1O8G A;  1QRC A;  2B0R A;  1TYW A;  2X6W A;  2X6X A;  1RMG A;  4YZQ A;  2INU A;  1IB4 A;  2O6W A;  2NTP A;  2BSP A;  1WMR A;  2EWE A;  2Z8G A;  4OJ6 A;  1CLW A;  4YEI A;  4XN3 A;  1LLZ A;  2INV A;  3GQA A;  1OFD A;  3SUC A;  3H09 A;  1EE6 A;  2XTW A;  2XT2 A;  1OFL A;  2VJJ A;  3WWG A;  2NTQ A;  3BH7 B;  2BM6 A;  1GQ8 A;  1OGM X;  1EA0 A;  2VFQ A;  3PSZ A;  5DNS A;  1O8D A;  1QJV A;  3ML3 A;  1L1I A;  3ZPP A;  4U4B A;  4XQF A;  3FY3 A;  3B90 A;  3PSS A;  1OGO X;  1HF2 A;  1KQ5 A;  3N6Z A;  4OJP A;  3VSV A;  3DU1 X;  3VSU A;  3UW0 A;  4W8R A;  2XTY A;  1NHC A;  3JX8 A;  3NB2 A;  2NSP A;  4OZY A;  2VJI A;  2VFO A;  1DBO A;  4YCQ A;  3JUR A;  1HG8 A;  3LMW A;  1JTA A;  1BHE A;  2QX3 A;  1LM1 A;  4XNF A;  2NTB A;  1PLU A;  1WXR A;  2BX6 A;  4OZZ A;  1H80 A;  2QY1 A;  4Z05 A;  1TSP A;  1IDK A;  2QYU A;  1TYV A;  4EW9 A;  3T9G A;  2NT9 A;  2XT4 A;  2BM5 A;  4Z06 A;  4YEJ A;  3N90 A;  2O17 A;  4YZX A;  1LLW A;  4U49 A;  4XM3 A;  3B4N A;  2QZA A;  1O8M A;  2VFN A;  1PE9 A;  4W8Q A;  4XKV A;  3GQ9 A;  2PYH A;  2W7Z A;  4YEL A;  2NST A;  2XTX A;  4XLE A;  3GQ8 A;  2X85 A;  3SY2 A;  4C2L A;  3AK5 A;  1O8H A;  1VBL A;  2O0W A;  4Z03 A;  2IQ7 A;  2VBK A;  3ZSC A;  3BH6 B;  1O8F A;  2VBE A;  1O8I A;  3SQV A;  2J8I A;  5C1C A;  4MR0 A;  3GQ7 A;  3SZE A;  1QA3 A;  1QCX A;  1O8E A;  2ODL A;  4W8T A;  4XMY A;  1EZG A;  1K4Z A;  4URR A;  3RIQ A;  3VST A;  1QRB A;  2PYG A;  3B8Y A;  4XN0 A;  4KH3 A;  4OJ5 A;  4XOP A;  3NAW A;  4YZ0 A;  4YFO A;  2UVE A;  2X6Y A;  3SYJ A;  1KCC A;  1TYU A;  2IOU G;  1K8F A;  3P4G A;  2G0Y A;  4XOT A;  1O8J A;  4XLA A;  1TYX A;  2V5I A;  5JMC B;  3LYC A;  1O8L A;  2UVF A;  4V02 C;  2PEC A;  1O8K A;  1AIR A;  2O1D A;  1KTW A;  2VFM A;  1BN8 A;  1CZF A;  1DBG A;  3TH0 A;  3EQN A;  1XG2 A;  1PXZ A;  2NT6 A;  4NK8 A;  4XKW A;  4XR6 A;  1OOC A;  4YZA A;  5C1E A;  3VMV A;  1QA2 A;  1QQ1 A;  1X0C A; 
#chains in the Genus database with same CATH homology
 2NZM A;  2O04 A;  4MXN A;  2VBM A;  5AMV A;  1O88 A;  1KCD A;  4OJO A;  4XL9 A;  2X3H A;  4HWV A;  4OJL A;  4XLF A;  4AVZ A;  4NK6 A;  4W8S A;  4XLC A;  1RWR A;  1K5C A;  4I84 A;  2QXZ A;  4XOR A;  1RU4 A;  3GRH A;  4XLH A;  4XON A;  1IDJ A;  2O0V A;  3VMW A;  1IA5 A;  4PMH A;  1JRG A;  1OFM A;  3EQO A;  3KRG A;  1O8G A;  2X6W A;  2X6X A;  4YZQ A;  1RMG A;  2INU A;  1IB4 A;  2NTP A;  2BSP A;  1WMR A;  2EWE A;  2Z8G A;  4OJ6 A;  4XN3 A;  2INV A;  3GQA A;  3SUC A;  1EE6 A;  1OFL A;  2VJJ A;  3WWG A;  2NTQ A;  1GQ8 A;  1OGM X;  1O8D A;  1QJV A;  3ZPP A;  4U4B A;  4XQF A;  3FY3 A;  3B90 A;  1OGO X;  4OJP A;  3VSV A;  3VSU A;  3UW0 A;  4W8R A;  1NHC A;  4OZY A;  2NSP A;  2VJI A;  1DBO A;  3JUR A;  1HG8 A;  3LMW A;  1JTA A;  1BHE A;  2QX3 A;  4XNF A;  2NTB A;  1PLU A;  4OZZ A;  1H80 A;  2QY1 A;  4Z05 A;  1IDK A;  4EW9 A;  3T9G A;  2NT9 A;  4Z06 A;  4YEJ A;  2O17 A;  4YZX A;  4U49 A;  4XM3 A;  3B4N A;  1O8M A;  4W8Q A;  1PE9 A;  4XKV A;  3GQ9 A;  2PYH A;  4YEL A;  2NST A;  4XLE A;  3GQ8 A;  2X85 A;  4C2L A;  1O8H A;  1VBL A;  2O0W A;  4Z03 A;  2IQ7 A;  2VBK A;  3ZSC A;  1O8F A;  2VBE A;  1O8I A;  5C1C A;  4MR0 A;  3GQ7 A;  1QCX A;  1O8E A;  2ODL A;  4W8T A;  4XMY A;  4URR A;  3VST A;  2PYG A;  3B8Y A;  4XN0 A;  4OJ5 A;  4XOP A;  4YZ0 A;  2UVE A;  2X6Y A;  1KCC A;  4XOT A;  1O8J A;  4XLA A;  1O8L A;  2UVF A;  2PEC A;  1O8K A;  1AIR A;  2O1D A;  1KTW A;  1BN8 A;  1CZF A;  1DBG A;  3EQN A;  1XG2 A;  1PXZ A;  2NT6 A;  4NK8 A;  4XKW A;  4XR6 A;  1OOC A;  4YZA A;  5C1E A;  3VMV A;  1X0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...