2NSTA

Crystal structure of pectin methylesterase d178a mutant in complex with hexasaccharide ii
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQATLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords Pectinesterase A
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2nstA00
1CZFA 4XLCA 3EQOA 1IB4A 1O8LA 4XM3A 1O8MA 1RU4A 3FY3A 2QX3A 3GRHA 2O17A 4OJLA 4XOTA 1PXZA 2X6XA 1GQ8A 2O04A 3ZSCA 1X0CA 1AIRA 2NT9A 2NZMA 3GQ7A 1KCDA 2NT6A 5C1CA 2QY1A 4U49A 1O8HA 2PYHA 4XQFA 4YEJA 3UW0A 3VMWA 3GQ8A 2X3HA 3EQNA 4NK8A 4OJOA 5C1EA 1DBOA 4YZXA 2VBEA 4OJ5A 2Z8GA 1JTAA 1O8EA 4Z05A 1O8IA 4XKWA 4XOPA 1O8JA 2X6WA 1BN8A 4YZAA 4OZZA 1OFMA 1EE6A 1O8KA 2NTPA 4YZ0A 4XLAA 3B4NA 1OGOX 2X85A 1O8FA 2IQ7A 1O8DA 2QXZA 4XORA 3WWGA 2O1DA 4Z03A 1XG2A 2VBMA 1QCXA 4MXNA 4MR0A 2O0VA 2VBKA 4YZQA 4YELA 2NSPA 3GQ9A 1O88A 1HG8A 4W8QA 1K5CA 3T9GA 4XN3A 2VJIA 4XL9A 4XMYA 3ZPPA 4EW9A 1OGMX 2EWEA 4OZYA 3SUCA 2O0WA 2NTBA 4XONA 2INUA 3VSTA 4W8RA 1IA5A 1VBLA 1NHCA 1RMGA 1WMRA 3JURA 1JRGA 4XKVA 1IDJA 1RWRA 1OOCA 2PYGA 4Z06A 4U4BA 4C2LA 4OJPA 4XLHA 1H80A 2BSPA 2PECA 3GQAA 3KRGA 2NTQA 4XR6A 1IDKA 4XLFA 4URRA 4I84A 4W8TA 3VSUA 1PE9A 4XN0A 4W8SA 3B8YA 4XNFA 1BHEA 1O8GA 2X6YA 2UVEA 1QJVA 1KTWA 1OFLA 3VSVA 4XLEA 2NSTA 2ODLA 3LMWA 3VMVA 2VJJA 4PMHA 2INVA 5AMVA 4OJ6A 3B90A 4HWVA 4AVZA 1DBGA 1KCCA 2UVFA 4NK6A 1PLUA
chains in the Genus database with same CATH superfamily
1QRCA 1CZFA 4YDTA 4XLCA 3EQOA 1IB4A 2YUHA 1O8LA 1QA2A 4XM3A 1K8FA 3NAWA 1L1IA 2O6WA 1O8MA 1TYWA 3AK5A 1RU4A 3FY3A 2QX3A 3GRHA 2BM4A 1LLWA 1HF2A 2O17A 2XT4A 4OJLA 4XOTA 1PXZA 2X6XA 1GQ8A 2O04A 3ZSCA 1X0CA 1AIRA 2NT9A 2NZMA 3GQ7A 2XTXA 1KCDA 1KQ5A 2NT6A 5C1CA 2XT2A 2QY1A 4KH3A 4U49A 2VFMA 1LM1A 3BH6B 1O8HA 2VFNA 2PYHA 4XQFA 4YEJA 3UW0A 2F3LA 3VMWA 1TSPA 3GQ8A 2X3HA 3EQNA 4NK8A 4OJOA 5C1EA 1DBOA 1DABA 4OM9A 4YZXA 2VBEA 2J8IA 1EZGA 4OJ5A 2Z8GA 3DU1X 1JTAA 1O8EA 4Z05A 1O8IA 4XKWA 4XOPA 1O8JA 1EA0A 2X6WA 3JX8A 1BN8A 1OFDA 4OZZA 1OFMA 3H09A 4YZAA 1EE6A 4YEIA 3LYCA 1QRBA 1O8KA 2NTPA 4YZ0A 2B0RA 3NB2A 4XLAA 3B4NA 1TYXA 2VFOA 1OGOX 2X85A 1O8FA 2IQ7A 5JMCB 1O8DA 2QXZA 4XORA 4YFOA 2O1DA 3WWGA 3RIQA 4Z03A 1XG2A 2VBMA 1QCXA 4MXNA 2J8KA 4MR0A 2O0VA 2VBKA 4YZQA 4YELA 2NSPA 3GQ9A 1O88A 1HG8A 3N90A 4W8QA 1K5CA 3T9GA 4XN3A 2VJIA 4XL9A 4XMYA 3ZPPA 4EW9A 1WXRA 4YC5A 1OGMX 1OFEA 2EWEA 4OZYA 3SUCA 2O0WA 2VFPA 2NTBA 4XONA 2BM7A 2INUA 2BM6A 3N6ZA 3PSSA 3VSTA 4W8RA 3LJYA 1VBLA 1IA5A 2BM5A 1RMGA 1NHCA 1K4ZA 1WMRA 3JURA 2VFQA 4OPWA 2XC1A 1JRGA 4XKVA 1IDJA 1RWRA 1OOCA 2PYGA 2QYUA 3P4GA 4U4BA 4Z06A 4C2LA 4OJPA 4XLHA 1H80A 2BSPA 2PECA 3SYJA 3GQAA 1QA3A 1CLWA 3KRGA 2NTQA 4XR6A 1IDKA 2IOUG 3PSZA 4XLFA 3SY2A 4YCQA 2XTWA 2G0YA 4I84A 4URRA 1TYVA 4W8TA 3VSUA 5JLVC 1QA1A 1PE9A 4XN0A 3SQVA 2W7ZA 3BH7B 4W8SA 2BX6A 3B8YA 4XNFA 1BHEA 1O8GA 2X6YA 4JRAC 3TH0A 1LLZA 5DNSA 2UVEA 1QJVA 1KTWA 1OFLA 3VSVA 4XLEA 3ML3A 2NSTA 2ODLA 2XTYA 3LMWA 3VMVA 2VJJA 3PETA 1QQ1A 1TYUA 2QZAA 2INVA 4PMHA 4V02C 5AMVA 4OJ6A 3B90A 4HWVA 4AVZA 1DBGA 1KCCA 2UVFA 3SZEA 4NK6A 2V5IA 1PLUA
chains in the Genus database with same CATH topology
1CZFA 4XLCA 3EQOA 1IB4A 1O8LA 4XM3A 1O8MA 1RU4A 3FY3A 2QX3A 3GRHA 2O17A 4OJLA 4XOTA 1PXZA 2X6XA 1GQ8A 2O04A 3ZSCA 1X0CA 1AIRA 2NT9A 2NZMA 3GQ7A 1KCDA 2NT6A 5C1CA 2QY1A 4U49A 1O8HA 2PYHA 4XQFA 4YEJA 3UW0A 3VMWA 3GQ8A 2X3HA 3EQNA 4NK8A 4OJOA 5C1EA 1DBOA 4YZXA 2VBEA 4OJ5A 2Z8GA 1JTAA 1O8EA 4Z05A 1O8IA 4XKWA 4XOPA 1O8JA 2X6WA 1BN8A 4YZAA 4OZZA 1OFMA 1EE6A 1O8KA 2NTPA 4YZ0A 4XLAA 3B4NA 1OGOX 2X85A 1O8FA 2IQ7A 1O8DA 2QXZA 4XORA 3WWGA 2O1DA 4Z03A 1XG2A 2VBMA 1QCXA 4MXNA 4MR0A 2O0VA 2VBKA 4YZQA 4YELA 2NSPA 3GQ9A 1O88A 1HG8A 4W8QA 1K5CA 3T9GA 4XN3A 2VJIA 4XL9A 4XMYA 3ZPPA 4EW9A 1OGMX 2EWEA 4OZYA 3SUCA 2O0WA 2NTBA 4XONA 2INUA 3VSTA 4W8RA 1IA5A 1VBLA 1NHCA 1RMGA 1WMRA 3JURA 1JRGA 4XKVA 1IDJA 1RWRA 1OOCA 2PYGA 4Z06A 4U4BA 4C2LA 4OJPA 4XLHA 1H80A 2BSPA 2PECA 3GQAA 3KRGA 2NTQA 4XR6A 1IDKA 4XLFA 4URRA 4I84A 4W8TA 3VSUA 1PE9A 4XN0A 4W8SA 3B8YA 4XNFA 1BHEA 1O8GA 2X6YA 2UVEA 1QJVA 1KTWA 1OFLA 3VSVA 4XLEA 2NSTA 2ODLA 3LMWA 3VMVA 2VJJA 4PMHA 2INVA 5AMVA 4OJ6A 3B90A 4HWVA 4AVZA 1DBGA 1KCCA 2UVFA 4NK6A 1PLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZF A;  4XLC A;  3EQO A;  1IB4 A;  1O8L A;  4XM3 A;  1O8M A;  1RU4 A;  3FY3 A;  2QX3 A;  3GRH A;  2O17 A;  4OJL A;  4XOT A;  1PXZ A;  2X6X A;  1GQ8 A;  2O04 A;  3ZSC A;  1X0C A;  1AIR A;  2NT9 A;  2NZM A;  3GQ7 A;  1KCD A;  2NT6 A;  5C1C A;  2QY1 A;  4U49 A;  1O8H A;  2PYH A;  4XQF A;  4YEJ A;  3UW0 A;  3VMW A;  3GQ8 A;  2X3H A;  3EQN A;  4NK8 A;  4OJO A;  5C1E A;  1DBO A;  4YZX A;  2VBE A;  4OJ5 A;  2Z8G A;  1JTA A;  1O8E A;  4Z05 A;  1O8I A;  4XKW A;  4XOP A;  1O8J A;  2X6W A;  1BN8 A;  4YZA A;  4OZZ A;  1OFM A;  1EE6 A;  1O8K A;  2NTP A;  4YZ0 A;  4XLA A;  3B4N A;  1OGO X;  2X85 A;  1O8F A;  2IQ7 A;  1O8D A;  2QXZ A;  4XOR A;  3WWG A;  2O1D A;  4Z03 A;  1XG2 A;  2VBM A;  1QCX A;  4MXN A;  4MR0 A;  2O0V A;  2VBK A;  4YZQ A;  4YEL A;  2NSP A;  3GQ9 A;  1O88 A;  1HG8 A;  4W8Q A;  1K5C A;  3T9G A;  4XN3 A;  2VJI A;  4XL9 A;  4XMY A;  3ZPP A;  4EW9 A;  1OGM X;  2EWE A;  4OZY A;  3SUC A;  2O0W A;  2NTB A;  4XON A;  2INU A;  3VST A;  4W8R A;  1IA5 A;  1VBL A;  1NHC A;  1RMG A;  1WMR A;  3JUR A;  1JRG A;  4XKV A;  1IDJ A;  1RWR A;  1OOC A;  2PYG A;  4Z06 A;  4U4B A;  4C2L A;  4OJP A;  4XLH A;  1H80 A;  2BSP A;  2PEC A;  3GQA A;  3KRG A;  2NTQ A;  4XR6 A;  1IDK A;  4XLF A;  4URR A;  4I84 A;  4W8T A;  3VSU A;  1PE9 A;  4XN0 A;  4W8S A;  3B8Y A;  4XNF A;  1BHE A;  1O8G A;  2X6Y A;  2UVE A;  1QJV A;  1KTW A;  1OFL A;  3VSV A;  4XLE A;  2NST A;  2ODL A;  3LMW A;  3VMV A;  2VJJ A;  4PMH A;  2INV A;  5AMV A;  4OJ6 A;  3B90 A;  4HWV A;  4AVZ A;  1DBG A;  1KCC A;  2UVF A;  4NK6 A;  1PLU A; 
#chains in the Genus database with same CATH topology
 1QRC A;  1CZF A;  4YDT A;  4XLC A;  3EQO A;  1IB4 A;  2YUH A;  1O8L A;  1QA2 A;  4XM3 A;  1K8F A;  3NAW A;  1L1I A;  2O6W A;  1O8M A;  1TYW A;  3AK5 A;  1RU4 A;  3FY3 A;  2QX3 A;  3GRH A;  2BM4 A;  1LLW A;  1HF2 A;  2O17 A;  2XT4 A;  4OJL A;  4XOT A;  1PXZ A;  2X6X A;  1GQ8 A;  2O04 A;  3ZSC A;  1X0C A;  1AIR A;  2NT9 A;  2NZM A;  3GQ7 A;  2XTX A;  1KCD A;  1KQ5 A;  2NT6 A;  5C1C A;  2XT2 A;  2QY1 A;  4KH3 A;  4U49 A;  2VFM A;  1LM1 A;  3BH6 B;  1O8H A;  2VFN A;  2PYH A;  4XQF A;  4YEJ A;  3UW0 A;  2F3L A;  3VMW A;  1TSP A;  3GQ8 A;  2X3H A;  3EQN A;  4NK8 A;  4OJO A;  5C1E A;  1DBO A;  1DAB A;  4OM9 A;  4YZX A;  2VBE A;  2J8I A;  1EZG A;  4OJ5 A;  2Z8G A;  3DU1 X;  1JTA A;  1O8E A;  4Z05 A;  1O8I A;  4XKW A;  4XOP A;  1O8J A;  1EA0 A;  2X6W A;  3JX8 A;  1BN8 A;  1OFD A;  4OZZ A;  1OFM A;  3H09 A;  4YZA A;  1EE6 A;  4YEI A;  3LYC A;  1QRB A;  1O8K A;  2NTP A;  4YZ0 A;  2B0R A;  3NB2 A;  4XLA A;  3B4N A;  1TYX A;  2VFO A;  1OGO X;  2X85 A;  1O8F A;  2IQ7 A;  5JMC B;  1O8D A;  2QXZ A;  4XOR A;  4YFO A;  2O1D A;  3WWG A;  3RIQ A;  4Z03 A;  1XG2 A;  2VBM A;  1QCX A;  4MXN A;  2J8K A;  4MR0 A;  2O0V A;  2VBK A;  4YZQ A;  4YEL A;  2NSP A;  3GQ9 A;  1O88 A;  1HG8 A;  3N90 A;  4W8Q A;  1K5C A;  3T9G A;  4XN3 A;  2VJI A;  4XL9 A;  4XMY A;  3ZPP A;  4EW9 A;  1WXR A;  4YC5 A;  1OGM X;  1OFE A;  2EWE A;  4OZY A;  3SUC A;  2O0W A;  2VFP A;  2NTB A;  4XON A;  2BM7 A;  2INU A;  2BM6 A;  3N6Z A;  3PSS A;  3VST A;  4W8R A;  3LJY A;  1VBL A;  1IA5 A;  2BM5 A;  1RMG A;  1NHC A;  1K4Z A;  1WMR A;  3JUR A;  2VFQ A;  4OPW A;  2XC1 A;  1JRG A;  4XKV A;  1IDJ A;  1RWR A;  1OOC A;  2PYG A;  2QYU A;  3P4G A;  4U4B A;  4Z06 A;  4C2L A;  4OJP A;  4XLH A;  1H80 A;  2BSP A;  2PEC A;  3SYJ A;  3GQA A;  1QA3 A;  1CLW A;  3KRG A;  2NTQ A;  4XR6 A;  1IDK A;  2IOU G;  3PSZ A;  4XLF A;  3SY2 A;  4YCQ A;  2XTW A;  2G0Y A;  4I84 A;  4URR A;  1TYV A;  4W8T A;  3VSU A;  5JLV C;  1QA1 A;  1PE9 A;  4XN0 A;  3SQV A;  2W7Z A;  3BH7 B;  4W8S A;  2BX6 A;  3B8Y A;  4XNF A;  1BHE A;  1O8G A;  2X6Y A;  4JRA C;  3TH0 A;  1LLZ A;  5DNS A;  2UVE A;  1QJV A;  1KTW A;  1OFL A;  3VSV A;  4XLE A;  3ML3 A;  2NST A;  2ODL A;  2XTY A;  3LMW A;  3VMV A;  2VJJ A;  3PET A;  1QQ1 A;  1TYU A;  2QZA A;  2INV A;  4PMH A;  4V02 C;  5AMV A;  4OJ6 A;  3B90 A;  4HWV A;  4AVZ A;  1DBG A;  1KCC A;  2UVF A;  3SZE A;  4NK6 A;  2V5I A;  1PLU A; 
#chains in the Genus database with same CATH homology
 1CZF A;  4XLC A;  3EQO A;  1IB4 A;  1O8L A;  4XM3 A;  1O8M A;  1RU4 A;  3FY3 A;  2QX3 A;  3GRH A;  2O17 A;  4OJL A;  4XOT A;  1PXZ A;  2X6X A;  1GQ8 A;  2O04 A;  3ZSC A;  1X0C A;  1AIR A;  2NT9 A;  2NZM A;  3GQ7 A;  1KCD A;  2NT6 A;  5C1C A;  2QY1 A;  4U49 A;  1O8H A;  2PYH A;  4XQF A;  4YEJ A;  3UW0 A;  3VMW A;  3GQ8 A;  2X3H A;  3EQN A;  4NK8 A;  4OJO A;  5C1E A;  1DBO A;  4YZX A;  2VBE A;  4OJ5 A;  2Z8G A;  1JTA A;  1O8E A;  4Z05 A;  1O8I A;  4XKW A;  4XOP A;  1O8J A;  2X6W A;  1BN8 A;  4YZA A;  4OZZ A;  1OFM A;  1EE6 A;  1O8K A;  2NTP A;  4YZ0 A;  4XLA A;  3B4N A;  1OGO X;  2X85 A;  1O8F A;  2IQ7 A;  1O8D A;  2QXZ A;  4XOR A;  3WWG A;  2O1D A;  4Z03 A;  1XG2 A;  2VBM A;  1QCX A;  4MXN A;  4MR0 A;  2O0V A;  2VBK A;  4YZQ A;  4YEL A;  2NSP A;  3GQ9 A;  1O88 A;  1HG8 A;  4W8Q A;  1K5C A;  3T9G A;  4XN3 A;  2VJI A;  4XL9 A;  4XMY A;  3ZPP A;  4EW9 A;  1OGM X;  2EWE A;  4OZY A;  3SUC A;  2O0W A;  2NTB A;  4XON A;  2INU A;  3VST A;  4W8R A;  1IA5 A;  1VBL A;  1NHC A;  1RMG A;  1WMR A;  3JUR A;  1JRG A;  4XKV A;  1IDJ A;  1RWR A;  1OOC A;  2PYG A;  4Z06 A;  4U4B A;  4C2L A;  4OJP A;  4XLH A;  1H80 A;  2BSP A;  2PEC A;  3GQA A;  3KRG A;  2NTQ A;  4XR6 A;  1IDK A;  4XLF A;  4URR A;  4I84 A;  4W8T A;  3VSU A;  1PE9 A;  4XN0 A;  4W8S A;  3B8Y A;  4XNF A;  1BHE A;  1O8G A;  2X6Y A;  2UVE A;  1QJV A;  1KTW A;  1OFL A;  3VSV A;  4XLE A;  2NST A;  2ODL A;  3LMW A;  3VMV A;  2VJJ A;  4PMH A;  2INV A;  5AMV A;  4OJ6 A;  3B90 A;  4HWV A;  4AVZ A;  1DBG A;  1KCC A;  2UVF A;  4NK6 A;  1PLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...