4EW9A

The liganded structure of c. bescii family 3 pectate lyase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
195
structure length
195
Chain Sequence
GTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Pectate lyase
publication title The structure and mode of action of Caldicellulosiruptor bescii family 3 pectate lyase in biomass deconstruction.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii
total genus 79
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4ew9A00
2NT6A 2O04A 4YZ0A 1O8IA 4I84A 3ZPPA 2NTQA 2X6WA 4XN0A 2UVEA 2X3HA 3B8YA 4XONA 4XKWA 1JTAA 2NTPA 4OJLA 4XLEA 3FY3A 4XLHA 4W8SA 1RMGA 4NK6A 2O0VA 1HG8A 4OJPA 2VBEA 2X6XA 3VSUA 1BHEA 4U49A 1OFLA 1O8EA 1DBGA 4MXNA 1O8DA 1IDKA 3VSVA 4XKVA 1GQ8A 3EQOA 4YZQA 3GQ9A 2VJJA 5C1CA 4PMHA 5AMVA 4Z03A 2PECA 2PYGA 3JURA 2EWEA 2BSPA 1H80A 2NSTA 4YZAA 4Z06A 1WMRA 1IA5A 3B90A 1DBOA 4MR0A 2INVA 3VMVA 1O8HA 1RWRA 3EQNA 1KCCA 1PLUA 1AIRA 1O8FA 1QCXA 4XM3A 4U4BA 2NTBA 2Z8GA 4XOTA 1OGMX 1NHCA 1OOCA 1QJVA 4AVZA 3LMWA 4OZZA 1KTWA 2UVFA 3GQ8A 2VBMA 3UW0A 1OGOX 1OFMA 1RU4A 4XQFA 2ODLA 4C2LA 2QXZA 4W8TA 2INUA 1IB4A 4XMYA 2QY1A 4W8RA 4XORA 1KCDA 3VMWA 1O88A 4XLFA 1XG2A 4YEJA 3WWGA 3ZSCA 2QX3A 3B4NA 3VSTA 4XN3A 4NK8A 3SUCA 2X6YA 4HWVA 2NZMA 4YELA 1CZFA 1JRGA 1IDJA 2NSPA 2NT9A 1X0CA 2VJIA 1PXZA 2X85A 4URRA 4Z05A 1O8MA 4XL9A 3T9GA 2PYHA 4YZXA 3GQAA 1O8LA 2O1DA 3GQ7A 4OJ5A 1EE6A 1PE9A 4W8QA 4OZYA 1O8KA 4XR6A 4EW9A 1O8GA 1VBLA 2IQ7A 4XLAA 4OJOA 4XOPA 4XNFA 4XLCA 1BN8A 5C1EA 1O8JA 2O17A 2O0WA 2VBKA 1K5CA 4OJ6A 3GRHA 3KRGA
chains in the Genus database with same CATH superfamily
2NT6A 2O04A 4YZ0A 1O8IA 1TSPA 4I84A 3ZPPA 2NTQA 2X6WA 4XN0A 2UVEA 2XTXA 1KQ5A 2X3HA 3B8YA 4XONA 4XKWA 1JTAA 2YUHA 3SYJA 2VFQA 2NTPA 3N6ZA 3NB2A 4OJLA 1EZGA 4OM9A 4XLEA 3FY3A 4XLHA 2IOUG 4W8SA 1RMGA 4NK6A 4JRAC 2O0VA 1QA2A 1HG8A 4OJPA 3AK5A 2VBEA 2X6XA 3VSUA 1BHEA 4U49A 3DU1X 1OFLA 2VFMA 1O8EA 1DBGA 3BH6B 4MXNA 1O8DA 3P4GA 1IDKA 1TYXA 3VSVA 4XKVA 1GQ8A 3EQOA 3LYCA 4YZQA 3GQ9A 2O6WA 2VJJA 5C1CA 4PMHA 5AMVA 4Z03A 3RIQA 2XT2A 1LLWA 2G0YA 2PECA 2PYGA 3N90A 2VFNA 3JURA 3H09A 2EWEA 2BSPA 4YCQA 1H80A 2NSTA 4YZAA 2BM4A 1WMRA 2XTWA 4Z06A 1QQ1A 1IA5A 3B90A 1DBOA 4MR0A 2INVA 3VMVA 1O8HA 1RWRA 3EQNA 1KCCA 1PLUA 1AIRA 1O8FA 1QCXA 2W7ZA 3PSSA 4XM3A 1QRBA 4U4BA 2NTBA 2Z8GA 1L1IA 4XOTA 1OGMX 1NHCA 1QA3A 3SZEA 2J8IA 1QRCA 1OOCA 1QJVA 2XTYA 4V02C 1OFEA 3SQVA 4AVZA 3LMWA 3TH0A 4OZZA 2VFOA 1KTWA 1K8FA 2UVFA 4KH3A 3GQ8A 2VBMA 3LJYA 3SY2A 3UW0A 2BM6A 1OFDA 1OGOX 1OFMA 1RU4A 2F3LA 4XQFA 2ODLA 4C2LA 2QXZA 4W8TA 2BM7A 2INUA 1LLZA 4XMYA 1IB4A 2QY1A 2VFPA 4W8RA 4XORA 1HF2A 1KCDA 3BH7B 3VMWA 1O88A 4XLFA 2J8KA 3NAWA 5JLVC 1XG2A 1CLWA 4YEJA 2XC1A 4YEIA 3WWGA 3ZSCA 2QX3A 1TYWA 3B4NA 2QYUA 3VSTA 1EA0A 2B0RA 3JX8A 4NK8A 4XN3A 1DABA 3SUCA 2X6YA 4HWVA 4YFOA 1TYVA 2BX6A 2NZMA 1CZFA 4OPWA 4YELA 1JRGA 1IDJA 4YDTA 2NSPA 2NT9A 1X0CA 3PSZA 5JMCB 2VJIA 1PXZA 2X85A 4URRA 4Z05A 3PETA 1QA1A 1O8MA 2XT4A 5DNSA 4XL9A 3T9GA 2BM5A 1LM1A 2PYHA 4YZXA 3GQAA 1O8LA 2O1DA 3GQ7A 4OJ5A 1EE6A 1PE9A 4W8QA 4OZYA 1O8KA 4XR6A 4EW9A 1O8GA 3ML3A 1VBLA 2IQ7A 4XLAA 4OJOA 4XOPA 4XNFA 4XLCA 1BN8A 1K4ZA 4YC5A 1TYUA 5C1EA 1O8JA 2V5IA 2O17A 2O0WA 2VBKA 1K5CA 1WXRA 4OJ6A 2QZAA 3GRHA 3KRGA
chains in the Genus database with same CATH topology
2NT6A 2O04A 4YZ0A 1O8IA 4I84A 3ZPPA 2NTQA 2X6WA 4XN0A 2UVEA 2X3HA 3B8YA 4XONA 4XKWA 1JTAA 2NTPA 4OJLA 4XLEA 3FY3A 4XLHA 4W8SA 1RMGA 4NK6A 2O0VA 1HG8A 4OJPA 2VBEA 2X6XA 3VSUA 1BHEA 4U49A 1OFLA 1O8EA 1DBGA 4MXNA 1O8DA 1IDKA 3VSVA 4XKVA 1GQ8A 3EQOA 4YZQA 3GQ9A 2VJJA 5C1CA 4PMHA 5AMVA 4Z03A 2PECA 2PYGA 3JURA 2EWEA 2BSPA 1H80A 2NSTA 4YZAA 4Z06A 1WMRA 1IA5A 3B90A 1DBOA 4MR0A 2INVA 3VMVA 1O8HA 1RWRA 3EQNA 1KCCA 1PLUA 1AIRA 1O8FA 1QCXA 4XM3A 4U4BA 2NTBA 2Z8GA 4XOTA 1OGMX 1NHCA 1OOCA 1QJVA 4AVZA 3LMWA 4OZZA 1KTWA 2UVFA 3GQ8A 2VBMA 3UW0A 1OGOX 1OFMA 1RU4A 4XQFA 2ODLA 4C2LA 2QXZA 4W8TA 2INUA 1IB4A 4XMYA 2QY1A 4W8RA 4XORA 1KCDA 3VMWA 1O88A 4XLFA 1XG2A 4YEJA 3WWGA 3ZSCA 2QX3A 3B4NA 3VSTA 4XN3A 4NK8A 3SUCA 2X6YA 4HWVA 2NZMA 4YELA 1CZFA 1JRGA 1IDJA 2NSPA 2NT9A 1X0CA 2VJIA 1PXZA 2X85A 4URRA 4Z05A 1O8MA 4XL9A 3T9GA 2PYHA 4YZXA 3GQAA 1O8LA 2O1DA 3GQ7A 4OJ5A 1EE6A 1PE9A 4W8QA 4OZYA 1O8KA 4XR6A 4EW9A 1O8GA 1VBLA 2IQ7A 4XLAA 4OJOA 4XOPA 4XNFA 4XLCA 1BN8A 5C1EA 1O8JA 2O17A 2O0WA 2VBKA 1K5CA 4OJ6A 3GRHA 3KRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NT6 A;  2O04 A;  4YZ0 A;  1O8I A;  4I84 A;  3ZPP A;  2NTQ A;  2X6W A;  4XN0 A;  2UVE A;  2X3H A;  3B8Y A;  4XON A;  4XKW A;  1JTA A;  2NTP A;  4OJL A;  4XLE A;  3FY3 A;  4XLH A;  4W8S A;  1RMG A;  4NK6 A;  2O0V A;  1HG8 A;  4OJP A;  2VBE A;  2X6X A;  3VSU A;  1BHE A;  4U49 A;  1OFL A;  1O8E A;  1DBG A;  4MXN A;  1O8D A;  1IDK A;  3VSV A;  4XKV A;  1GQ8 A;  3EQO A;  4YZQ A;  3GQ9 A;  2VJJ A;  5C1C A;  4PMH A;  5AMV A;  4Z03 A;  2PEC A;  2PYG A;  3JUR A;  2EWE A;  2BSP A;  1H80 A;  2NST A;  4YZA A;  4Z06 A;  1WMR A;  1IA5 A;  3B90 A;  1DBO A;  4MR0 A;  2INV A;  3VMV A;  1O8H A;  1RWR A;  3EQN A;  1KCC A;  1PLU A;  1AIR A;  1O8F A;  1QCX A;  4XM3 A;  4U4B A;  2NTB A;  2Z8G A;  4XOT A;  1OGM X;  1NHC A;  1OOC A;  1QJV A;  4AVZ A;  3LMW A;  4OZZ A;  1KTW A;  2UVF A;  3GQ8 A;  2VBM A;  3UW0 A;  1OGO X;  1OFM A;  1RU4 A;  4XQF A;  2ODL A;  4C2L A;  2QXZ A;  4W8T A;  2INU A;  1IB4 A;  4XMY A;  2QY1 A;  4W8R A;  4XOR A;  1KCD A;  3VMW A;  1O88 A;  4XLF A;  1XG2 A;  4YEJ A;  3WWG A;  3ZSC A;  2QX3 A;  3B4N A;  3VST A;  4XN3 A;  4NK8 A;  3SUC A;  2X6Y A;  4HWV A;  2NZM A;  4YEL A;  1CZF A;  1JRG A;  1IDJ A;  2NSP A;  2NT9 A;  1X0C A;  2VJI A;  1PXZ A;  2X85 A;  4URR A;  4Z05 A;  1O8M A;  4XL9 A;  3T9G A;  2PYH A;  4YZX A;  3GQA A;  1O8L A;  2O1D A;  3GQ7 A;  4OJ5 A;  1EE6 A;  1PE9 A;  4W8Q A;  4OZY A;  1O8K A;  4XR6 A;  4EW9 A;  1O8G A;  1VBL A;  2IQ7 A;  4XLA A;  4OJO A;  4XOP A;  4XNF A;  4XLC A;  1BN8 A;  5C1E A;  1O8J A;  2O17 A;  2O0W A;  2VBK A;  1K5C A;  4OJ6 A;  3GRH A;  3KRG A; 
#chains in the Genus database with same CATH topology
 2NT6 A;  2O04 A;  4YZ0 A;  1O8I A;  1TSP A;  4I84 A;  3ZPP A;  2NTQ A;  2X6W A;  4XN0 A;  2UVE A;  2XTX A;  1KQ5 A;  2X3H A;  3B8Y A;  4XON A;  4XKW A;  1JTA A;  2YUH A;  3SYJ A;  2VFQ A;  2NTP A;  3N6Z A;  3NB2 A;  4OJL A;  1EZG A;  4OM9 A;  4XLE A;  3FY3 A;  4XLH A;  2IOU G;  4W8S A;  1RMG A;  4NK6 A;  4JRA C;  2O0V A;  1QA2 A;  1HG8 A;  4OJP A;  3AK5 A;  2VBE A;  2X6X A;  3VSU A;  1BHE A;  4U49 A;  3DU1 X;  1OFL A;  2VFM A;  1O8E A;  1DBG A;  3BH6 B;  4MXN A;  1O8D A;  3P4G A;  1IDK A;  1TYX A;  3VSV A;  4XKV A;  1GQ8 A;  3EQO A;  3LYC A;  4YZQ A;  3GQ9 A;  2O6W A;  2VJJ A;  5C1C A;  4PMH A;  5AMV A;  4Z03 A;  3RIQ A;  2XT2 A;  1LLW A;  2G0Y A;  2PEC A;  2PYG A;  3N90 A;  2VFN A;  3JUR A;  3H09 A;  2EWE A;  2BSP A;  4YCQ A;  1H80 A;  2NST A;  4YZA A;  2BM4 A;  1WMR A;  2XTW A;  4Z06 A;  1QQ1 A;  1IA5 A;  3B90 A;  1DBO A;  4MR0 A;  2INV A;  3VMV A;  1O8H A;  1RWR A;  3EQN A;  1KCC A;  1PLU A;  1AIR A;  1O8F A;  1QCX A;  2W7Z A;  3PSS A;  4XM3 A;  1QRB A;  4U4B A;  2NTB A;  2Z8G A;  1L1I A;  4XOT A;  1OGM X;  1NHC A;  1QA3 A;  3SZE A;  2J8I A;  1QRC A;  1OOC A;  1QJV A;  2XTY A;  4V02 C;  1OFE A;  3SQV A;  4AVZ A;  3LMW A;  3TH0 A;  4OZZ A;  2VFO A;  1KTW A;  1K8F A;  2UVF A;  4KH3 A;  3GQ8 A;  2VBM A;  3LJY A;  3SY2 A;  3UW0 A;  2BM6 A;  1OFD A;  1OGO X;  1OFM A;  1RU4 A;  2F3L A;  4XQF A;  2ODL A;  4C2L A;  2QXZ A;  4W8T A;  2BM7 A;  2INU A;  1LLZ A;  4XMY A;  1IB4 A;  2QY1 A;  2VFP A;  4W8R A;  4XOR A;  1HF2 A;  1KCD A;  3BH7 B;  3VMW A;  1O88 A;  4XLF A;  2J8K A;  3NAW A;  5JLV C;  1XG2 A;  1CLW A;  4YEJ A;  2XC1 A;  4YEI A;  3WWG A;  3ZSC A;  2QX3 A;  1TYW A;  3B4N A;  2QYU A;  3VST A;  1EA0 A;  2B0R A;  3JX8 A;  4NK8 A;  4XN3 A;  1DAB A;  3SUC A;  2X6Y A;  4HWV A;  4YFO A;  1TYV A;  2BX6 A;  2NZM A;  1CZF A;  4OPW A;  4YEL A;  1JRG A;  1IDJ A;  4YDT A;  2NSP A;  2NT9 A;  1X0C A;  3PSZ A;  5JMC B;  2VJI A;  1PXZ A;  2X85 A;  4URR A;  4Z05 A;  3PET A;  1QA1 A;  1O8M A;  2XT4 A;  5DNS A;  4XL9 A;  3T9G A;  2BM5 A;  1LM1 A;  2PYH A;  4YZX A;  3GQA A;  1O8L A;  2O1D A;  3GQ7 A;  4OJ5 A;  1EE6 A;  1PE9 A;  4W8Q A;  4OZY A;  1O8K A;  4XR6 A;  4EW9 A;  1O8G A;  3ML3 A;  1VBL A;  2IQ7 A;  4XLA A;  4OJO A;  4XOP A;  4XNF A;  4XLC A;  1BN8 A;  1K4Z A;  4YC5 A;  1TYU A;  5C1E A;  1O8J A;  2V5I A;  2O17 A;  2O0W A;  2VBK A;  1K5C A;  1WXR A;  4OJ6 A;  2QZA A;  3GRH A;  3KRG A; 
#chains in the Genus database with same CATH homology
 2NT6 A;  2O04 A;  4YZ0 A;  1O8I A;  4I84 A;  3ZPP A;  2NTQ A;  2X6W A;  4XN0 A;  2UVE A;  2X3H A;  3B8Y A;  4XON A;  4XKW A;  1JTA A;  2NTP A;  4OJL A;  4XLE A;  3FY3 A;  4XLH A;  4W8S A;  1RMG A;  4NK6 A;  2O0V A;  1HG8 A;  4OJP A;  2VBE A;  2X6X A;  3VSU A;  1BHE A;  4U49 A;  1OFL A;  1O8E A;  1DBG A;  4MXN A;  1O8D A;  1IDK A;  3VSV A;  4XKV A;  1GQ8 A;  3EQO A;  4YZQ A;  3GQ9 A;  2VJJ A;  5C1C A;  4PMH A;  5AMV A;  4Z03 A;  2PEC A;  2PYG A;  3JUR A;  2EWE A;  2BSP A;  1H80 A;  2NST A;  4YZA A;  4Z06 A;  1WMR A;  1IA5 A;  3B90 A;  1DBO A;  4MR0 A;  2INV A;  3VMV A;  1O8H A;  1RWR A;  3EQN A;  1KCC A;  1PLU A;  1AIR A;  1O8F A;  1QCX A;  4XM3 A;  4U4B A;  2NTB A;  2Z8G A;  4XOT A;  1OGM X;  1NHC A;  1OOC A;  1QJV A;  4AVZ A;  3LMW A;  4OZZ A;  1KTW A;  2UVF A;  3GQ8 A;  2VBM A;  3UW0 A;  1OGO X;  1OFM A;  1RU4 A;  4XQF A;  2ODL A;  4C2L A;  2QXZ A;  4W8T A;  2INU A;  1IB4 A;  4XMY A;  2QY1 A;  4W8R A;  4XOR A;  1KCD A;  3VMW A;  1O88 A;  4XLF A;  1XG2 A;  4YEJ A;  3WWG A;  3ZSC A;  2QX3 A;  3B4N A;  3VST A;  4XN3 A;  4NK8 A;  3SUC A;  2X6Y A;  4HWV A;  2NZM A;  4YEL A;  1CZF A;  1JRG A;  1IDJ A;  2NSP A;  2NT9 A;  1X0C A;  2VJI A;  1PXZ A;  2X85 A;  4URR A;  4Z05 A;  1O8M A;  4XL9 A;  3T9G A;  2PYH A;  4YZX A;  3GQA A;  1O8L A;  2O1D A;  3GQ7 A;  4OJ5 A;  1EE6 A;  1PE9 A;  4W8Q A;  4OZY A;  1O8K A;  4XR6 A;  4EW9 A;  1O8G A;  1VBL A;  2IQ7 A;  4XLA A;  4OJO A;  4XOP A;  4XNF A;  4XLC A;  1BN8 A;  5C1E A;  1O8J A;  2O17 A;  2O0W A;  2VBK A;  1K5C A;  4OJ6 A;  3GRH A;  3KRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...