4EW9A

The liganded structure of c. bescii family 3 pectate lyase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
195
structure length
195
Chain Sequence
GTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and mode of action of Caldicellulosiruptor bescii family 3 pectate lyase in biomass deconstruction.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii
molecule tags Lyase
molecule keywords Pectate lyase
total genus 79
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4ew9A00
4XLCA 4XONA 3VSTA 3VSVA 5C1EA 3B4NA 1BN8A 3EQNA 4AVZA 2INVA 2PYHA 4OJOA 3ZSCA 1X0CA 4W8QA 2X6XA 4W8TA 3GQAA 2VBEA 3UW0A 2NZMA 1O8GA 4URRA 2NTBA 4XNFA 1AIRA 4XKVA 1O8IA 1O8LA 1GQ8A 1HG8A 3SUCA 1RMGA 3VSUA 2NSTA 4YZAA 4OZYA 4I84A 4XLHA 4YELA 1O8FA 4W8RA 3ZPPA 4OJPA 2X6YA 1QJVA 4XN0A 4XLFA 3GQ7A 2NSPA 4NK8A 1OGOX 1PXZA 2UVEA 2UVFA 2QX3A 2O1DA 1O8JA 2VJIA 4XORA 4Z03A 4Z05A 1IDJA 4XR6A 2Z8GA 4HWVA 1BHEA 4XLAA 4XN3A 4YZ0A 2NTPA 2PECA 3B90A 4OZZA 2PYGA 1PE9A 4YZQA 4C2LA 1EE6A 1PLUA 1KTWA 2X3HA 1IB4A 4XMYA 3GQ9A 4YZXA 3KRGA 3LMWA 3EQOA 4OJLA 4XQFA 1OFLA 4YEJA 2NT9A 1KCDA 4NK6A 4XOTA 2QXZA 2O17A 4EW9A 1OOCA 2IQ7A 2BSPA 3VMWA 1DBOA 4XM3A 1O8DA 3WWGA 3B8YA 2VBMA 1O8KA 1XG2A 1IDKA 2ODLA 3FY3A 1O8EA 2O0WA 4OJ5A 4XLEA 1OFMA 1O88A 2QY1A 2NT6A 4U4BA 2X6WA 4Z06A 1RWRA 1K5CA 1WMRA 4U49A 2VJJA 1VBLA 2O04A 1CZFA 1O8MA 4OJ6A 4PMHA 3T9GA 2X85A 3GQ8A 1JRGA 2NTQA 4MR0A 1IA5A 1H80A 2INUA 3JURA 4XKWA 1QCXA 2O0VA 1NHCA 1O8HA 3GRHA 3VMVA 4MXNA 1RU4A 4XL9A 2VBKA 5C1CA 5AMVA 2EWEA 1KCCA 1JTAA 4W8SA 4XOPA 1DBGA 1OGMX
chains in the Genus database with same CATH superfamily
3SQVA 4XLCA 4XONA 3VSTA 3VSVA 1DABA 5C1EA 3B4NA 4YDTA 1BN8A 3EQNA 4AVZA 2VFMA 2INVA 2PYHA 4OJOA 2BX6A 3ZSCA 1X0CA 1OFEA 3LJYA 2X6XA 4W8QA 4W8TA 2F3LA 3GQAA 2VBEA 3PSSA 3UW0A 2NZMA 1O8GA 2XTYA 2V5IA 4URRA 5JLVC 2VFQA 2NTBA 4XNFA 1AIRA 4XKVA 1O8IA 1O8LA 1GQ8A 1HG8A 3SUCA 1RMGA 3VSUA 2G0YA 2NSTA 4YEIA 2BM7A 4YZAA 1QA1A 4OZYA 4I84A 4XLHA 1K4ZA 4YELA 1O8FA 4W8RA 3P4GA 3ZPPA 2B0RA 1QRCA 4OJPA 2X6YA 4V02C 1QJVA 4XN0A 3TH0A 1LLWA 4XLFA 3GQ7A 2NSPA 2QZAA 4NK8A 1OGOX 1PXZA 2UVEA 2XTXA 3SYJA 4OPWA 1HF2A 2IOUG 2UVFA 1TYVA 3BH7B 2QX3A 1EA0A 2O1DA 1O8JA 2VJIA 4XORA 4Z03A 4Z05A 1IDJA 4JRAC 4XR6A 2BM6A 2Z8GA 4HWVA 1BHEA 4XLAA 1L1IA 4XN3A 4YZ0A 2NTPA 2PECA 3B90A 1TYXA 4OZZA 2PYGA 1OFDA 1PE9A 4YZQA 4C2LA 2J8IA 1EE6A 1PLUA 1KTWA 2O6WA 2X3HA 2XTWA 3RIQA 3NB2A 4XMYA 3GQ9A 1IB4A 4YZXA 3KRGA 3LMWA 1QA2A 4YFOA 4OM9A 3NAWA 3EQOA 4OJLA 4XQFA 1OFLA 4YEJA 2NT9A 1KCDA 4NK6A 4XOTA 2J8KA 2QXZA 1QA3A 2O17A 4EW9A 3AK5A 1OOCA 1QQ1A 2IQ7A 2VFNA 2VFPA 3PETA 2BSPA 3VMWA 1DBOA 4XM3A 1O8DA 3WWGA 2YUHA 2VBMA 3B8YA 3N90A 1O8KA 1XG2A 1IDKA 2ODLA 3FY3A 1O8EA 2O0WA 4OJ5A 2VFOA 4XLEA 1OFMA 2BM4A 1O88A 2BM5A 2QY1A 2NT6A 2XT2A 2X6WA 4U4BA 4YCQA 4Z06A 1RWRA 1K5CA 1WMRA 5JMCB 4U49A 1KQ5A 2VJJA 1VBLA 2QYUA 1LLZA 3ML3A 1K8FA 1TYUA 1CZFA 2O04A 1O8MA 4OJ6A 4PMHA 3BH6B 3SY2A 1TSPA 1LM1A 3T9GA 3N6ZA 2X85A 3LYCA 3GQ8A 4YC5A 1JRGA 2NTQA 4MR0A 1WXRA 1IA5A 1H80A 2INUA 3JX8A 2XC1A 3DU1X 3JURA 4XKWA 1TYWA 1QCXA 3PSZA 2O0VA 1NHCA 1QRBA 1O8HA 1CLWA 3H09A 3GRHA 3SZEA 3VMVA 4MXNA 1RU4A 4KH3A 4XL9A 2VBKA 2W7ZA 5C1CA 5DNSA 5AMVA 2EWEA 1KCCA 1JTAA 4W8SA 2XT4A 4XOPA 1DBGA 1OGMX 1EZGA
chains in the Genus database with same CATH topology
4XLCA 4XONA 3VSTA 3VSVA 5C1EA 3B4NA 1BN8A 3EQNA 4AVZA 2INVA 2PYHA 4OJOA 3ZSCA 1X0CA 4W8QA 2X6XA 4W8TA 3GQAA 2VBEA 3UW0A 2NZMA 1O8GA 4URRA 2NTBA 4XNFA 1AIRA 4XKVA 1O8IA 1O8LA 1GQ8A 1HG8A 3SUCA 1RMGA 3VSUA 2NSTA 4YZAA 4OZYA 4I84A 4XLHA 4YELA 1O8FA 4W8RA 3ZPPA 4OJPA 2X6YA 1QJVA 4XN0A 4XLFA 3GQ7A 2NSPA 4NK8A 1OGOX 1PXZA 2UVEA 2UVFA 2QX3A 2O1DA 1O8JA 2VJIA 4XORA 4Z03A 4Z05A 1IDJA 4XR6A 2Z8GA 4HWVA 1BHEA 4XLAA 4XN3A 4YZ0A 2NTPA 2PECA 3B90A 4OZZA 2PYGA 1PE9A 4YZQA 4C2LA 1EE6A 1PLUA 1KTWA 2X3HA 1IB4A 4XMYA 3GQ9A 4YZXA 3KRGA 3LMWA 3EQOA 4OJLA 4XQFA 1OFLA 4YEJA 2NT9A 1KCDA 4NK6A 4XOTA 2QXZA 2O17A 4EW9A 1OOCA 2IQ7A 2BSPA 3VMWA 1DBOA 4XM3A 1O8DA 3WWGA 3B8YA 2VBMA 1O8KA 1XG2A 1IDKA 2ODLA 3FY3A 1O8EA 2O0WA 4OJ5A 4XLEA 1OFMA 1O88A 2QY1A 2NT6A 4U4BA 2X6WA 4Z06A 1RWRA 1K5CA 1WMRA 4U49A 2VJJA 1VBLA 2O04A 1CZFA 1O8MA 4OJ6A 4PMHA 3T9GA 2X85A 3GQ8A 1JRGA 2NTQA 4MR0A 1IA5A 1H80A 2INUA 3JURA 4XKWA 1QCXA 2O0VA 1NHCA 1O8HA 3GRHA 3VMVA 4MXNA 1RU4A 4XL9A 2VBKA 5C1CA 5AMVA 2EWEA 1KCCA 1JTAA 4W8SA 4XOPA 1DBGA 1OGMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLC A;  4XON A;  3VST A;  3VSV A;  5C1E A;  3B4N A;  1BN8 A;  3EQN A;  4AVZ A;  2INV A;  2PYH A;  4OJO A;  3ZSC A;  1X0C A;  4W8Q A;  2X6X A;  4W8T A;  3GQA A;  2VBE A;  3UW0 A;  2NZM A;  1O8G A;  4URR A;  2NTB A;  4XNF A;  1AIR A;  4XKV A;  1O8I A;  1O8L A;  1GQ8 A;  1HG8 A;  3SUC A;  1RMG A;  3VSU A;  2NST A;  4YZA A;  4OZY A;  4I84 A;  4XLH A;  4YEL A;  1O8F A;  4W8R A;  3ZPP A;  4OJP A;  2X6Y A;  1QJV A;  4XN0 A;  4XLF A;  3GQ7 A;  2NSP A;  4NK8 A;  1OGO X;  1PXZ A;  2UVE A;  2UVF A;  2QX3 A;  2O1D A;  1O8J A;  2VJI A;  4XOR A;  4Z03 A;  4Z05 A;  1IDJ A;  4XR6 A;  2Z8G A;  4HWV A;  1BHE A;  4XLA A;  4XN3 A;  4YZ0 A;  2NTP A;  2PEC A;  3B90 A;  4OZZ A;  2PYG A;  1PE9 A;  4YZQ A;  4C2L A;  1EE6 A;  1PLU A;  1KTW A;  2X3H A;  1IB4 A;  4XMY A;  3GQ9 A;  4YZX A;  3KRG A;  3LMW A;  3EQO A;  4OJL A;  4XQF A;  1OFL A;  4YEJ A;  2NT9 A;  1KCD A;  4NK6 A;  4XOT A;  2QXZ A;  2O17 A;  4EW9 A;  1OOC A;  2IQ7 A;  2BSP A;  3VMW A;  1DBO A;  4XM3 A;  1O8D A;  3WWG A;  3B8Y A;  2VBM A;  1O8K A;  1XG2 A;  1IDK A;  2ODL A;  3FY3 A;  1O8E A;  2O0W A;  4OJ5 A;  4XLE A;  1OFM A;  1O88 A;  2QY1 A;  2NT6 A;  4U4B A;  2X6W A;  4Z06 A;  1RWR A;  1K5C A;  1WMR A;  4U49 A;  2VJJ A;  1VBL A;  2O04 A;  1CZF A;  1O8M A;  4OJ6 A;  4PMH A;  3T9G A;  2X85 A;  3GQ8 A;  1JRG A;  2NTQ A;  4MR0 A;  1IA5 A;  1H80 A;  2INU A;  3JUR A;  4XKW A;  1QCX A;  2O0V A;  1NHC A;  1O8H A;  3GRH A;  3VMV A;  4MXN A;  1RU4 A;  4XL9 A;  2VBK A;  5C1C A;  5AMV A;  2EWE A;  1KCC A;  1JTA A;  4W8S A;  4XOP A;  1DBG A;  1OGM X; 
#chains in the Genus database with same CATH topology
 3SQV A;  4XLC A;  4XON A;  3VST A;  3VSV A;  1DAB A;  5C1E A;  3B4N A;  4YDT A;  1BN8 A;  3EQN A;  4AVZ A;  2VFM A;  2INV A;  2PYH A;  4OJO A;  2BX6 A;  3ZSC A;  1X0C A;  1OFE A;  3LJY A;  2X6X A;  4W8Q A;  4W8T A;  2F3L A;  3GQA A;  2VBE A;  3PSS A;  3UW0 A;  2NZM A;  1O8G A;  2XTY A;  2V5I A;  4URR A;  5JLV C;  2VFQ A;  2NTB A;  4XNF A;  1AIR A;  4XKV A;  1O8I A;  1O8L A;  1GQ8 A;  1HG8 A;  3SUC A;  1RMG A;  3VSU A;  2G0Y A;  2NST A;  4YEI A;  2BM7 A;  4YZA A;  1QA1 A;  4OZY A;  4I84 A;  4XLH A;  1K4Z A;  4YEL A;  1O8F A;  4W8R A;  3P4G A;  3ZPP A;  2B0R A;  1QRC A;  4OJP A;  2X6Y A;  4V02 C;  1QJV A;  4XN0 A;  3TH0 A;  1LLW A;  4XLF A;  3GQ7 A;  2NSP A;  2QZA A;  4NK8 A;  1OGO X;  1PXZ A;  2UVE A;  2XTX A;  3SYJ A;  4OPW A;  1HF2 A;  2IOU G;  2UVF A;  1TYV A;  3BH7 B;  2QX3 A;  1EA0 A;  2O1D A;  1O8J A;  2VJI A;  4XOR A;  4Z03 A;  4Z05 A;  1IDJ A;  4JRA C;  4XR6 A;  2BM6 A;  2Z8G A;  4HWV A;  1BHE A;  4XLA A;  1L1I A;  4XN3 A;  4YZ0 A;  2NTP A;  2PEC A;  3B90 A;  1TYX A;  4OZZ A;  2PYG A;  1OFD A;  1PE9 A;  4YZQ A;  4C2L A;  2J8I A;  1EE6 A;  1PLU A;  1KTW A;  2O6W A;  2X3H A;  2XTW A;  3RIQ A;  3NB2 A;  4XMY A;  3GQ9 A;  1IB4 A;  4YZX A;  3KRG A;  3LMW A;  1QA2 A;  4YFO A;  4OM9 A;  3NAW A;  3EQO A;  4OJL A;  4XQF A;  1OFL A;  4YEJ A;  2NT9 A;  1KCD A;  4NK6 A;  4XOT A;  2J8K A;  2QXZ A;  1QA3 A;  2O17 A;  4EW9 A;  3AK5 A;  1OOC A;  1QQ1 A;  2IQ7 A;  2VFN A;  2VFP A;  3PET A;  2BSP A;  3VMW A;  1DBO A;  4XM3 A;  1O8D A;  3WWG A;  2YUH A;  2VBM A;  3B8Y A;  3N90 A;  1O8K A;  1XG2 A;  1IDK A;  2ODL A;  3FY3 A;  1O8E A;  2O0W A;  4OJ5 A;  2VFO A;  4XLE A;  1OFM A;  2BM4 A;  1O88 A;  2BM5 A;  2QY1 A;  2NT6 A;  2XT2 A;  2X6W A;  4U4B A;  4YCQ A;  4Z06 A;  1RWR A;  1K5C A;  1WMR A;  5JMC B;  4U49 A;  1KQ5 A;  2VJJ A;  1VBL A;  2QYU A;  1LLZ A;  3ML3 A;  1K8F A;  1TYU A;  1CZF A;  2O04 A;  1O8M A;  4OJ6 A;  4PMH A;  3BH6 B;  3SY2 A;  1TSP A;  1LM1 A;  3T9G A;  3N6Z A;  2X85 A;  3LYC A;  3GQ8 A;  4YC5 A;  1JRG A;  2NTQ A;  4MR0 A;  1WXR A;  1IA5 A;  1H80 A;  2INU A;  3JX8 A;  2XC1 A;  3DU1 X;  3JUR A;  4XKW A;  1TYW A;  1QCX A;  3PSZ A;  2O0V A;  1NHC A;  1QRB A;  1O8H A;  1CLW A;  3H09 A;  3GRH A;  3SZE A;  3VMV A;  4MXN A;  1RU4 A;  4KH3 A;  4XL9 A;  2VBK A;  2W7Z A;  5C1C A;  5DNS A;  5AMV A;  2EWE A;  1KCC A;  1JTA A;  4W8S A;  2XT4 A;  4XOP A;  1DBG A;  1OGM X;  1EZG A; 
#chains in the Genus database with same CATH homology
 4XLC A;  4XON A;  3VST A;  3VSV A;  5C1E A;  3B4N A;  1BN8 A;  3EQN A;  4AVZ A;  2INV A;  2PYH A;  4OJO A;  3ZSC A;  1X0C A;  4W8Q A;  2X6X A;  4W8T A;  3GQA A;  2VBE A;  3UW0 A;  2NZM A;  1O8G A;  4URR A;  2NTB A;  4XNF A;  1AIR A;  4XKV A;  1O8I A;  1O8L A;  1GQ8 A;  1HG8 A;  3SUC A;  1RMG A;  3VSU A;  2NST A;  4YZA A;  4OZY A;  4I84 A;  4XLH A;  4YEL A;  1O8F A;  4W8R A;  3ZPP A;  4OJP A;  2X6Y A;  1QJV A;  4XN0 A;  4XLF A;  3GQ7 A;  2NSP A;  4NK8 A;  1OGO X;  1PXZ A;  2UVE A;  2UVF A;  2QX3 A;  2O1D A;  1O8J A;  2VJI A;  4XOR A;  4Z03 A;  4Z05 A;  1IDJ A;  4XR6 A;  2Z8G A;  4HWV A;  1BHE A;  4XLA A;  4XN3 A;  4YZ0 A;  2NTP A;  2PEC A;  3B90 A;  4OZZ A;  2PYG A;  1PE9 A;  4YZQ A;  4C2L A;  1EE6 A;  1PLU A;  1KTW A;  2X3H A;  1IB4 A;  4XMY A;  3GQ9 A;  4YZX A;  3KRG A;  3LMW A;  3EQO A;  4OJL A;  4XQF A;  1OFL A;  4YEJ A;  2NT9 A;  1KCD A;  4NK6 A;  4XOT A;  2QXZ A;  2O17 A;  4EW9 A;  1OOC A;  2IQ7 A;  2BSP A;  3VMW A;  1DBO A;  4XM3 A;  1O8D A;  3WWG A;  3B8Y A;  2VBM A;  1O8K A;  1XG2 A;  1IDK A;  2ODL A;  3FY3 A;  1O8E A;  2O0W A;  4OJ5 A;  4XLE A;  1OFM A;  1O88 A;  2QY1 A;  2NT6 A;  4U4B A;  2X6W A;  4Z06 A;  1RWR A;  1K5C A;  1WMR A;  4U49 A;  2VJJ A;  1VBL A;  2O04 A;  1CZF A;  1O8M A;  4OJ6 A;  4PMH A;  3T9G A;  2X85 A;  3GQ8 A;  1JRG A;  2NTQ A;  4MR0 A;  1IA5 A;  1H80 A;  2INU A;  3JUR A;  4XKW A;  1QCX A;  2O0V A;  1NHC A;  1O8H A;  3GRH A;  3VMV A;  4MXN A;  1RU4 A;  4XL9 A;  2VBK A;  5C1C A;  5AMV A;  2EWE A;  1KCC A;  1JTA A;  4W8S A;  4XOP A;  1DBG A;  1OGM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...