4XL9A

Tailspike protein mutant d339a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xl9A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xl9A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xl9A02
1CZFA 1O88A 2ODLA 1O8LA 4XOPA 4I84A 1O8DA 2EWEA 2NT6A 3GQ9A 4Z05A 4MR0A 2X85A 4YEJA 2UVEA 4NK8A 4Z03A 4YZQA 1PLUA 2VJJA 2X6YA 3JURA 4XR6A 4XL9A 4URRA 4AVZA 2X6WA 4W8SA 4XOTA 1H80A 2PECA 1BN8A 4MXNA 4NK6A 1IDKA 1OFMA 2Z8GA 1KCDA 1RWRA 3GQAA 4XORA 2PYHA 2NSTA 4OJPA 1BHEA 4YZXA 3T9GA 4XMYA 1JTAA 2NTPA 3WWGA 1KTWA 4OJ5A 4HWVA 2O17A 2QY1A 3EQOA 5AMVA 4C2LA 4XN3A 1XG2A 1KCCA 3B8YA 4XM3A 1PXZA 4XLAA 4YELA 3GQ8A 1PE9A 1IDJA 2X3HA 3B90A 1O8JA 4OZYA 2IQ7A 2INVA 2O1DA 1OGMX 2QXZA 3SUCA 1OGOX 1OFLA 2NZMA 4XONA 4OJ6A 3VMWA 4YZ0A 4Z06A 1AIRA 4XLHA 3VSTA 2O04A 1RU4A 4XLCA 2NT9A 2NTQA 1X0CA 3VSUA 1O8IA 4EW9A 1QCXA 5C1EA 3GQ7A 5C1CA 4OZZA 3KRGA 2VBKA 1DBOA 2NTBA 1NHCA 4OJLA 2X6XA 1O8GA 2UVFA 4XNFA 2QX3A 1VBLA 1GQ8A 3FY3A 3ZPPA 3LMWA 2NSPA 4XQFA 1QJVA 3B4NA 4W8QA 4XKVA 4YZAA 4XLFA 4XN0A 4U4BA 1K5CA 1OOCA 4W8RA 1DBGA 4U49A 2INUA 1JRGA 2BSPA 4XLEA 4XKWA 3VSVA 3GRHA 1HG8A 3VMVA 1O8HA 3EQNA 1O8FA 1IA5A 1WMRA 2VBMA 1O8KA 2O0WA 3ZSCA 4W8TA 4PMHA 2VBEA 4OJOA 2O0VA 1IB4A 1O8EA 1EE6A 3UW0A 2VJIA 1RMGA 1O8MA 2PYGA
chains in the Genus database with same CATH superfamily
2F3LA 3PSZA 2ZMEB 1JHHA 2V4DA 2IT0A 1T6XA 1BI0A 3PIOF 3DXJF 1OCZH 1ERDA 2Y0MA 2JZYA 3MN2A 2CUJA 4HG2A 3JTGA 1O8DA 4B43A 1LE8B 4KUMA 4IHYA 1FNBA 1R5OA 2XHKA 3OIPA 3TMOA 3U6KA 1D1BA 2DA6A 2E7WA 3I54A 1W34A 3TP3A 2LOOA 5JLXA 4YAUA 4IKFA 2W24A 3RJPA 3OEEA 1XCBA 3CCUB 3GZ6A 1EFTA 4KJZA 5IYRA 1W5TA 1T98A 1XSXA 4KT6A 1GO2A 1VQMB 5DS0A 3F6OA 5LEKA 3OFNA 3GXOA 1S9HA 1G59A 4CGZA 5LEJA 1TQMA 3Q0WA 4RB0A 2Z8GA 1X4OA 2WY7Q 2BM6A 2L02A 2IS4A 5E1ZB 1S7AA 1F36A 2GZWA 4BHPA 2EIKH 3ASOH 4PAAA 3LQRA 1HCRA 2K4JA 1IC8A 2IEKA 4CZZA 2V4JC 1YLOA 4AF7A 4HWVA 3MZ8A 4NQWB 1PJ7A 3H09A 2EK5A 1KU2A 2R7VA 2L9VA 5GV7A 1E64A 1V5FA 2A6HF 3L2RA 1WFXA 2NVXJ 1IJFA 2WBMA 1W0UA 2M5WA 2L9SA 4XLAA 1N8RD 1J7KA 1IO2A 1W9XA 2C4TA 4G6DA 1MW7A 2CV1A 2MA3A 4B09A 1E0EA 1SMYF 4Q47A 2DA7A 4C2UA 2WAQA 1A04A 2LYCA 2DW4A 1KONA 3J80K 3VB2A 4CCJA 4N3GA 1QGZA 1J5YA 3B73A 4OOIA 1HSJA 1TQIA 2BY0A 2RNJA 1POGA 2LSOA 2GREA 3L7WA 4RB3C 2W7NA 4XRSG 1JKQC 4G6IA 2JUGA 1BX1A 1BC7C 3FKIJ 3DEEA 2YUSA 1UD3A 3ZPLA 5HZBA 2L7FP 1V0FA 1I50J 4OJLA 2MLGA 2PN6A 3BTIA 3L2VA 1YTYA 2NVTJ 2V7XA 2BGJA 2IP2A 5CPRB 1FNMA 3PL8A 4HSRA 4N0BA 4M3FA 4PK4A 3EYIA 2Z99A 5JLVC 1YFHA 2FU4A 3SJPA 1T0FA 3E5QA 1MJAA 1K61A 4P55A 2ZZFA 1LM1A 3GF2A 2DEUA 4BEHA 3IKTA 5EEAA 1ZM2A 3B4NA 3BQJA 1JNYA 5K5QA 4QFMA 3EUHA 5HNHA 2ZZQA 1J09A 3V8KA 3CCQB 3ESWB 5JR3A 4HE5A 2LDUA 5EF6A 1BR1A 1YLFA 2BHZA 4PJLA 2GXBA 2LF8A 2W00A 1HDDC 2V1UA 2INUA 5HDGA 1R49A 1Y6IA 3J80Z 4QUZA 4AD9A 2FBIA 1BR4A 3KFWX 3KZZA 3ZQ7A 4FCYA 1W7PD 2HVSA 3E5XA 4ZJZA 2E2JJ 1G6NA 2E5ZA 3S8PA 1T0FC 2EIXA 4GQNA 3SZTA 1NHAA 4ZTJA 3AAFA 5IYQA 3ZBUA 3AVWA 1MH3A 3EUHC 3NB2A 1YIJI 2XKPA 4DNCA 2P6SA 4MGRA 1MABA 4PC2A 3VNUA 5IYDJ 4ZGQB 2GJKA 1E3HA 2WSSA 4KICA 4RD2A 2P81A 1R5ID 1UB9A 2X3UA 2OZUA 3V7RA 2G0YA 3TDUC 2P4WA 1ZARA 3SDBA 4ENNA 1SM4A 1X3WB 4Z4YA 1FNDA 4Z2YA 2LBFA 3S16J 2CS3A 1QZZA 2YX7A 3DPUA 1YRNA 4KDPA 4CCNA 1HF2A 3CCJI 2EFNA 4P5OA 4C3HJ 2QDXA 3JURA 2CRGA 3F22A 1ULYA 3WU2C 2PMHA 3PNTA 4B1RA 2K40A 2VKEA 3HOTA 4OOSA 5M5YJ 3H3UA 3VSKA 4Q5SF 4XOTA 1PKVA 2L7MP 3Q6RA 3ZUGA 4M74A 3OW2B 1IDKA 2HR3A 3K10A 4IXAA 1T6ZA 5A2QZ 4LK1F 1XGSA 2DT7B 2NSTA 2STTA 4YZXA 2E2IJ 3A0BC 3P9CA 4YFNF 4X05A 3LMWA 4A6EA 4D5CA 1ACIA 4X06A 5H59A 3BCAA 3RKWA 4LIUA 4C9YA 1YQAA 5HKKA 1XE1A 3R0AA 2QEXI 3EQOA 3TO6A 4DW6A 2XZOA 5GAHJ 1FIPA 2HCJB 1SC7A 2JA7J 1SANA 2DOAA 1CF7A 3VO1A 3WTTC 2HWVA 1VQ8B 1Q86D 5HOOA 2XASA 3U9GA 3TW6A 2VFNA 3KLOA 3L2UA 1LE8A 1GVDA 1WJBA 3QYEA 2RNGA 3PETA 2I10A 3A03A 2V7VA 4E7LA 5IOZA 5LHGA 4N3NA 5FD6A 5F0FA 1A35A 3BLYA 2JWTA 4YFKF 5J3OA 3JRHA 3CO7C 1R22A 1HBXG 4M53A 3MKLA 1H88C 4IHTA 1FIAA 4Y7CA 3DTKA 2DCUA 4X1EA 1G3TA 1RU4A 4JYKA 3FK7A 3R61A 4DNRB 2XPVA 1JA0A 1Y0RA 2IS6A 4RD1A 1R6RA 2CQQA 3ASTA 3KEWA 1X19A 2J8IA 2BV3A 5LLQA 1QVUA 3ZZTA 2ADUA 4BJ6C 9ANTA 3TO9A 3LYCA 2Z5UA 2C5BA 1XC5A 4E7IA 1ZGWA 5FRMA 1BL0A 4F91B 1IUFA 4LB5A 2PQ8A 2QMUA 3ZPPA 4PC6A 3W2IA 1MKMA 1WI9A 4TMXA 3CC2B 3ML3A 2FQ3A 1VQPI 2EIMH 2V1XA 1GXQA 2F5FA 2ZNZA 4PC7A 1YG2A 4DQKA 2M34A 3BJOA 2ZCWA 2DTZA 4W1UA 3ISPA 3EETA 5F0HA 1T39A 3DWLE 1WPKA 4XLPF 1TLLA 2ME6A 1JI8A 1GLNA 1XDSA 1X58A 1Z77A 2QCOA 2D45A 2XOKA 1O8FA 2BY3A 1IA5A 2ELHA 2P7VB 3A4CA 1N78A 3ABMH 6PAXA 3H1CA 1A6IA 2ZXJA 2BBYA 2QQ9A 1O8EA 2VIXA 1WXRA 4H9GA 5K5OA 3UW0A 3H5AA 4MLOA 3OAAA 2K5CA 1ZRDA 2CV2A 4OAZA 4HSTA 3KX2A 1RETA 2FMLA 4A3LJ 3I9V2 1TWHJ 2O61A 1TWFJ 2E7XA 3M7GA 3PSFA 3SJMA 1O88A 3I4NJ 1WWXA 1E1RA 2HKXA 3ERED 2JA6J 4M3BA 4XD7A 3JRDA 3T51B 2C4UA 1F43A 2NV4A 1Z1DA 2OA4A 3ZQLA 4AVPA 1MSFC 3JQQA 5KK1A 4LOCA 5FLMJ 2XUBA 3GFJA 2FOWA 1AKHB 3GTLJ 5J6XA 4Z03A 4LGWA 2WA0A 1U3EM 1QQ1A 1DG1G 4RLFA 4FISA 2F4IA 4B8XA 4L8JA 1WH5A 1I6HJ 4URRA 1HW5A 4XSXF 4RGRA 3JTHA 5CVJA 1SAXA 4CHUA 4RCYA 3D5RC 4RPBA 4PJ0C 4ENKA 1A8PA 2OZ6A 1KK2A 1P6RA 2OCCH 1BN8A 3U21A 2KIUA 3N6ZA 4BYYA 3MWMA 4UV9A 1JGGA 2A3SA 4PGOA 1JT6A 4AM3A 3RPQA 2YSRA 1LDDA 1XMKA 5DEQA 5H5JA 5B3SH 3VR6A 1DGWY 3PUBA 5K7FA 5LGUA 1P4MA 3OYAA 3BY2A 3DKWA 4FASD 4ZYDA 1D2EA 4TKOB 3H3VK 2CW5A 3QSYA 2F2EA 2ZBKA 2Q2EA 4B4CA 4CCOA 3OOUA 4DK1A 4O6JA 2BM4A 1TUIA 2B7CA 1R9TJ 4P22A 5HNFA 3WTUC 1NG6A 3TO7A 1ZN2A 3BC9A 3QPHA 3KP3A 3AVXA 1Z21A 4U88A 5FGMA 3GBGA 3ZP5A 1FYMA 4CICA 4G7OF 1PE9A 3F6VA 2MGQA 1N05A 4M4SA 4ZYAA 4F3QA 1D8TA 1EXMA 4QPOA 3IAS2 1QUEA 3HBLA 1G2HA 4Y52J 4E70A 3BPXA 2D9RA 1S8NA 1TWAJ 1VQ9B 4QVAA 1XDUA 4P25A 4M9SA 2DDAA 1W0KA 4YAWA 1TNSA 1YIOA 4D9JA 4EM2A 3S93A 3SZEA 3V42A 1Y8QB 3O8HA 1BI2A 2E36A 2B7EA 4LLNA 4MYUA 1XSDA 4A3JJ 3MMYB 3R0JA 3DBLB 2R6HA 1YOVB 3ZC3A 4LG0B 3ECHA 2M5SA 2EILH 2W84A 1ODDA 4P12A 4ZV4A 4MTDA 2OD5A 5ICFA 3N97A 4A3EJ 4HX8A 1U6GA 2L0KA 3L2QA 3S3NA 1VQ7B 4P6VF 3KE2A 2J5PA 4ANJA 1GQ8A 4A69C 2OK7A 3TOBA 1B1BA 3F21A 1JTXA 3V7SA 5D6EA 1BLIA 1VNDA 5GPCA 2JN9A 5IYCJ 4N9HA 3OJWA 4MFDA 1VQMI 3FMRA 3GLLA 4I0BA 1Y56A 3WTWC 4BXXJ 2NVYJ 1XN7A 5L3BA 5FFXA 1RNLA 4M3GA 5F04A 1ZR4A 3WHCA 4LBYA 2MBFA 2JRTA 4HW0A 4I76A 1YJNB 2A6TA 3ISXA 2HU9A 3ABUA 3FXUA 3FMSA 1Z3YA 3U1KA 1VHOA 2VBVA 4P3YA 1BMFA 4ZZLA 3BH7B 3VMVA 2E60A 2HS5A 4IF4A 5AONA 4Z4RA 2GM4A 2COBA 2O0WA 3CPXA 2IGOA 1T56A 3KIOA 2HDWA 1YX2A 1XMXA 4E7HA 1IB4A 1R1TA 3VYRB 1BM9A 1GVJA 1WJFA 1QA2A 1O8MA 2Z1DA 1SKYB 2PYGA 2ZFWA 2W85A 2EV6A 2HTSA 2MLKA 3JX8A 4QTRA 2M7BA 2HYGD 3ECOA 2HEOA 2VXDA 4P96A 5IY5H 2YS9A 5CVRA 3KYLA 1X1PA 2PI0A 4MEXF 1OCOH 4N4OB 2DFHA 2VC1A 2CFOA 1H8EA 2QUFA 3K4CA 3CW2A 3HUGA 4MR0A 2HGCA 1W36D 1Y8RB 1UMKA 1VQLB 2NS7A 4KNYA 2JA2A 3H9NA 2R9VA 3AG4H 3TP0A 4A3FJ 2AS5F 2LH9A 4AU7A 2O8KA 2X6WA 1NB0A 2R7XA 3RKYA 2YWGA 1Q82D 4MNUA 2NPFA 3HRUA 2PJRB 2DOGA 4MXNA 5J47A 1YI2I 2YU3A 2DLLA 3VPRA 4YHBA 3WQZA 2ID3A 3ZBTA 2JT1A 3JRFA 5B66C 4IO9F 1BHEA 3KZYA 4A3GJ 1FX0A 1F9NA 4KIFA 5JI6A 4Y17A 4DIQA 1CLWA 1QFZA 1WU8A 2JJ7A 3LSTA 2VBUA 5F1RA 2L4MA 3CCQI 1LPQA 2GA1A 4LMYA 3WTZA 1B9MA 1N0UA 5L46A 1NTCA 1SFKA 3ZMTA 5AIPA 1O3QA 4YAFA 1QPMA 3DF8A 1WHUA 1PJRA 3NWSA 1P7IA 3OYIA 3AGPA 2JRMA 1UMQA 2GA2A 1WJCA 3NEUA 1B4AA 1O8JA 1WJ5A 2COMA 1E63A 4OZYA 2P8TA 2JVGA 2INVA 1AKHA 1BIAA 3E20A 4AIHA 3VWBA 3MVPA 2V26A 2Z16A 2XTXA 3FKSA 2IA0A 4X7FA 1QGPA 3CF2A 5EEGA 2BGCA 4YZ0A 2DOFA 5LBQA 1XQBA 2DQRA 1MJBA 5GTIC 2CW0F 1P2FA 3TBIA 4ZH4F 4UB8C 2UUZA 3AVVA 1W35A 3NWTA 3AVUA 1JKRC 2O3FA 1WQ2A 1STZA 1FP2A 2R3SA 3HSRA 1DDGA 1K79A 1EH8A 4OIRF 5FNZA 3UR3C 4PC1A 2UVFA 4FN5A 2RAEA 2WV0A 3WU1B 3ZZUA 3LQQA 2V1NA 5DCMB 1DDNA 4DQLA 1S6LA 1QZEA 1WCMJ 2EA4A 1NDHA 1FC3A 2E5NA 4UUSB 4LBVA 4YFXF 1FJLA 2I5UA 4XN0A 3HB9A 4A3KJ 1FYKA 1LNWA 5CQEA 4CQJA 3W5VA 4DZJA 3CJNA 2BPOA 4DYRA 4XLEA 4WZKA 2CNDA 2AQEA 2F43A 5EGOA 3H9QA 5DM6F 4GGGA 4HEA2 2KFDA 1J0RA 1M1EB 4ZCLA 2VBMA 4RJLA 1Q1VA 4ESFA 4B48A 1ETWA 2E1CA 3HZJA 4G7ZF 2ISZA 2WZNA 3FHNA 4OP7A 2YUHA 1DQUA 3DBRB 3PVDA 1QPIA 3F0CA 3ZQFA 1CNEA 3FMQA 1Q1HA 3V4GA 3A2KA 1W0JA 3VNVA 1U8BA 4RM2A 3N90A 2B7BA 4KISA 5J8CA 2Y31A 1VQ8I 4LG0A 1Z6TA 3QPSA 2HNHA 3HOZJ 1P4XA 2WB1N 3CTAA 4XOPA 1AMOA 3OEHA 1JUPA 2W48A 1HZEA 2VBXA 1HVXA 3AVYA 3OYGA 3DU5A 3PENA 1KQSB 2WAEA 3WGIA 4TV7A 2HVRA 1JUMA 2FBKA 1VQOI 2E1MB 1IN8A 4EMSA 2D1HA 1A6QA 4GCVA 2BY2A 3S15J 3HOWJ 3M8JA 1OB2A 1VQ5B 1G8XA 1D1AA 2BVMA 4BE0A 4QLCU 2NXNB 1DU0A 4NC8A 1H85A 1OB5A 2H27A 3SLDA 4JMQA 3OYMA 2HFHA 1WTHD 3BDDA 2VFQA 5HVQC 3LNQA 2PLFA 1G7CA 3VSLA 1E43A 3BZCA 3QFCA 2BXYA 2PJPA 1BJKA 3O3KA 4II3A 1QA6A 5F4OA 5B6IA 3K6GA 2YR2A 2H09A 3Q5FA 1KZHA 1LFBA 1F4KA 2ETHA 2D74A 1OYYA 2JK3A 2OYNA 1Q9SA 5F08A 4P26A 4R71A 2BX6A 1ZG1A 3CC2I 1ETQA 1QX4A 3HTSB 3QOPA 4JX5A 3A3BA 1MNEA 1X1AA 5ILUA 3GFIA 3UKGA 4CYCB 3GQ8A 2G0EA 3W5UA 4G12A 3WBKA 2XT2A 4BDYA 3E6CC 4FHTA 2CQNA 4BPRA 2CGPA 1TSPA 2VQLA 5J40A 1EFUA 2R7QA 1G7SA 1OLTA 2IGMA 2ZB9A 1PDNC 1ZM3A 3E6BA 2QTLA 5LRSA 3K2AA 3RDIA 4XIDA 2V79A 3ZXSA 3FXQA 2Z3YA 4M2LA 3NAUA 4OU0A 5C44J 2A07F 2O0YA 4ZDOA 3IH2A 3FF5A 1YJ9B 3FZVA 2EIJH 2GOMA 4Y9RA 1XB4A 2PFBA 1MNMC 2PJRA 3QRFF 1MSEC 3KYCB 1HW1A 3J7ZI 2BYVE 1BX0A 1DBOA 2A5WA 5D5WB 3HGYA 3SZGA 1FLIA 4HF2A 2X53S 3JRBA 3S2HJ 2GWRA 2BMWA 4XNFA 2QX3A 3OS1A 3QFTA 3H3ZA 4L9VA 4MYTA 3G2BA 2IA2A 2XF7A 3BROA 2FF4A 3S1MJ 3RY8A 1YO5C 1YJWB 5IP9J 2JN6A 1OR7A 1WPCA 1CGPA 2VJ4A 4F7ZA 4YZAA 4A3DJ 5KW9A 1EKEA 1JHFA 3BG6A 3SDGA 4F7DA 2Z2SB 2B0RA 2X4HA 3DU6A 3LOCA 5BMZA 2VBYA 3GTPJ 4UV8A 2LG4A 4U9UA 1WMRA 2VBWA 2DXIA 3BH4A 4HOBA 4HZFA 3ZOBA 3ZSCA 1BC8C 3WTXC 4HRIA 3C2GA 3V8LA 3Q0UA 5DM7F 3W3CA 1LEAA 2DPUA 4UZEA 1OR7C 3RZDJ 2BXZA 2HZDA 2NS0A 4NB5A 2GXAA 1F20A 1EA0A 2VQCA 3H0DA 1XG1A 2MG4A 2QSHX 4G6QA 2V7TA 2V31A 4HLXA 2KISA 3OW7A 2DMTA 3BWGA 4UVCA 1O8LA 1PVEA 1H42A 4FWTA 3G05A 2L54A 3FIWA 2LC2A 2Q6OA 3FX3A 4BXUA 3ZMDA 1WKMA 2LTPA 1BI3A 3DTIA 4BY1J 4XICA 1VQ9I 5DCMA 3GVLA 2Z33A 4HBLA 3LSHA 5JHUA 2QGGA 4BAYA 3IH4A 3CDHA 1USTA 3JCUC 5D4RA 1WH7A 2R0QC 1E79A 2H94A 3WGGA 1NRKA 4UUVA 4B3FX 2VNKA 3C18A 5B1BH 1FOKA 2ECCA 1F60A 2F5CA 1I18A 5H6QA 4NBQA 3C2BA 3DEUA 2MABA 3G1LA 2J5OA 3QP5A 5H6RA 1SVLA 1WJAA 3AGQA 1VQ7I 3ASSA 3CB4A 4B3GA 3FWEA 3SKBA 4B47A 3ONQA 2KIQA 3BTJA 2GLOA 1KTWA 3K2ZA 3WWGA 3OYDA 2LFBA 3FISA 3BPVA 2EZHA 2Q6KA 3JRCA 3Q38A 1Y1WJ 4A93J 2C5HA 2EZLA 2FOKA 1FEXA 3HYIA 2XGDA 3C7JA 3KEQA 1KQ8A 4LBZA 2OPTA 4M3EA 2DFIA 3WE2A 1AHDP 3CPWB 5AIQA 2BV6A 3SYTA 2P3MA 3GFMA 1R1VA 3OYBA 1TC3C 1YJNI 1IRFA 4IHXA 3CJQB 3ZPNA 4FQGA 4PDKA 2ESNA 2UZKA 1KQ0A 4C3IJ 4E6KG 4O3MA 2IPQX 4C3JJ 3OS0A 2X51A 2JA8J 3HOUJ 2DK8A 3M8EA 2QXZA 3HAGA 2NNYA 2AXTC 2YU9J 4X0GA 2CW8A 3EDPA 3J7AY 1K4ZA 4C2TA 1JGSA 1IJWC 2L9NA 1BIBA 2HQNA 4OINF 4NBSA 3G4SB 3HGGA 4Z06A 3R4KA 4YIRX 5EZHA 2NT9A 1Z7LA 2M9HA 4DNTB 1OCCH 4ZTFA 3LSGA 2IS1A 3KYDB 1NJID 3LAJA 3H94A 2ZBVA 3OS2A 2NTBA 2XTWA 4NUBA 1ZHFA 3W2VA 3T1BA 1QFYA 3OSGA 2ZTGA 1Z7UA 4L5IA 4PFOA 4ZYGA 4M73A 1LLWA 2MC3A 3KEOA 2CFXA 2NVQJ 3NARA 1K78B 4GO1A 1G3YA 5GPAA 2QE7A 1UD4A 3CLQA 1YX3A 2DMNA 2I1LA 1R71A 3TDZC 3A01B 1WJEA 2QYOA 2HVQA 3GWZA 4I02A 2DFEA 4BQNA 1R00A 1W87A 4RM0A 5EG0A 1WRJA 1TBXA 3BJAA 2OJED 4A3MJ 4XRMA 1EP2B 2X1EA 5CJ9A 2JDIA 3MFKA 3ZQHA 3PFIA 1U5TB 1D0YA 3F8BA 3OJXA 2OTJB 4LD5A 5EJCA 4EJWA 5K7ZA 1L3LA 1E3XA 4FK8A 3K1NA 1ON1A 3A8IA 1S4MA 2DYSH 4OPSA 1ZH5A 5CQGA 4HNUA 3CMEB 4NDLA 2XB0X 1HOMA 3Q0VA 5D8KB 4YEIA 3W6VA 1KD1D 3GTGJ 1ZR2A 1ITYA 2OBSA 3SJZA 5GP9A 3SY2A 1O3RA 2DMUA 1S7OA 1YS7A 4I98B 4YFOA 4YEJA 2A61A 1QRBA 4BU2A 3CMAI 3CUQB 4LLGF 5FO5A 3CJTB 1XPXA 4A6DA 4U7DA 1YS6A 4F93B 3MEXA 1IN4A 3G3ZA 5A2QK 4EJOA 2CQXA 3JQRA 3RKXA 3A8JA 1FT9A 1FBSA 1T95A 5CYVA 4L5EA 1S29A 1TP4A 3FM3A 2HPMA 2FVGA 2RC6A 4NK6A 3A02A 4BJTA 3F8CA 3T9GA 3WYAA 1TWCJ 2KLOA 2QBYA 3GTOJ 5F6FA 1K28D 4TMVA 4OJ5A 1H8AC 1ZKGA 5TJJA 3IC7A 1IV8A 2LR8A 2HDNB 4C2LA 3BR1A 2QZ8A 1JJ6C 1I27A 2M45A 4BDZA 4QHYA 3S2WA 2RC5A 1KCCA 3KP2A 3H5RA 4XM3A 4G1BA 2CU7A 2XAHA 3RIRA 2KL4A 3LL7A 3AFHA 3L1PA 1RUOA 1IDZA 3OL4A 3ONYA 4IZZA 1X1BA 2VXZA 4HDVA 2BHYA 3P9IA 3CCRB 4KH3A 3HRTA 4G9YA 4E7KA 3LQ6A 3VFZA 3SUCA 3GW2A 1K6YA 4C30A 2H6CA 4BQOA 3JREA 4IVNA 4P6YA 3IRQA 3G6EB 4M6XA 3VSTA 1Q7YD 3NRVA 4P9FA 1J59A 1FSHA 3WG9A 2RV8A 3BR6A 2Q8KA 3H9JA 3RQIA 1MBKA 2VBKA 3PNVA 2L01A 4RDKA 3DFGA 2ZMEA 2XEXA 3PA2A 3GYHX 2KRFA 5E8IA 3I59B 4X7CA 1NHCA 2XGJA 1R58A 2FNAA 1O7LA 3LWFA 3LSMA 3MD2A 3ELKA 5GV8A 2V7QA 2RC4A 2C78A 1VQ6B 2LKPA 2B0LA 3F8NA 1VQ5I 2QQAA 3H36A 3COAC 2DO7A 4N9IA 3OYHA 1K6OA 3PO3J 1J9IA 3BY1A 1OCPA 5J1YA 3RPUA 4KT5C 2D1VA 3B82A 5EMNA 1Z3XA 2M8GX 3IKVA 3KP5A 1X2NA 2ZMEC 4CUGA 2DU9A 1FY7A 3S1RJ 1XS9A 4B44A 4ASNA 2R7ZJ 1QVFB 2F1LA 2AQFA 3IP4B 4HA8A 2GJPA 3GTJJ 4RPDA 2LLKA 2K7LA 1RC9A 2L2OA 4PMHA 4PJNA 4I6ZA 3A3GA 3P27A 2Y69H 2Q6IA 1RPWA 1TQPA 3LSKA 3K7AJ 1KTVA 4KIGA 2KJBA 5TISC 4YAOA 1DUXC 4NQWA 2W7ZA 1ON2A 2VODA 2VBZA 1D0ZA 4OMYA 3JRAA 2K9LA 3I55B 2J8KA 5BPIA 4S0HB 2OQGA 1KC8D 3GRHA 2XPUA 1B9NA 3CZ6A 4E7SA 5E17F 3V7CA 1S0UA 2XZPA 2EWEA 2TDXA 5CLSA 4Z05A 2CWEA 1K78A 1Y0YA 2D3NA 2ZJRF 3ZMZA 5E20A 2Q0OA 4NK8A 5L3FA 3IV5A 3ASNH 3CQZJ 5CVUA 3LA7A 3GLXA 3LSPA 1P9QC 3E1YE 5GTHC 1YJ9I 2OF7A 2Y30A 3BG9A 3BG7A 3A01A 1D5VA 4AVZA 4E0FA 4CCKA 1XGMA 3OYNA 5ERIA 4IRIA 2OU2A 3L2CA 4W8SA 2OQRA 4A3CJ 3OZVA 1TWGJ 3VMFA 3CDIA 3E0JB 5J8FA 3MKYB 1OFMA 3L09A 1K4TA 2ICWG 4CZCA 4X7EA 2GBYA 3WTSC 2HLDA 1IW7F 3L00A 1N07A 1BPLA 1N25A 3WE3A 3HG9A 1YJWI 1G7RA 4F52A 1W5CC 4XK4A 5FKLA 2IW5A 4IHVA 1MMAA 3M8FA 3WNDA 4IQ4A 1DPUA 4PZJA 2UWMA 1TVCA 1JJ2B 1XG2A 1KQ5A 5FL7A 3B6CA 5JLWA 5CKTA 4J00A 3PA1A 2XB5A 4X8IA 4BKXA 3TOAA 2FBHA 3AK5A 1K83J 3OWTA 3SQVA 1RQPA 1UHWA 5LMZA 4TSFA 3OPOA 2DIEA 3IL2A 1EWYA 1FX7A 5A8AA 2JQ7A 1KQ9A 2ISYA 4ZCIA 1TW2A 4KKUA 2LY2A 4V19K 2QQ8A 4Z4ZA 3JAMZ 3L9FA 3F3XA 3VOEA 1W1WE 4XLHA 3RZOJ 1P4WA 4UZFA 1YHQB 1SD5A 2VQGA 2E71A 3K4KA 4FXUA 4BS9A 2GQFA 1OYWA 4OZZA 1WI3A 4CXFA 5LHIA 2BM5A 1HKSA 3I4PA 3OYKA 4CDGA 4LIVA 2EV5A 5F1JA 1ZM4A 5AN9A 2FRHA 4GYGA 3OIOA 1XB2A 3QOEA 4Y13A 4TMWA 1UD2A 1BW6A 2R7FA 2CUZA 1BOAA 3EUKL 2ZJPF 2TCTA 4EGYA 3M4OJ 2W57A 3NAWA 2M0MA 5FROA 2JJ1A 1P92A 4K2EA 2DA4A 4MIMA 5IYPA 1LKXA 4KFCA 2C77A 2XSDC 4LITA 2HKOA 1NG7A 1TLHB 2LF7A 3TW7A 1MJ9A 5IPAA 4BACA 1UAAA 3P4GA 4YC5A 1VQKB 4AIJA 3W5HA 4P1VA 2CQKA 4FX4A 1FOXA 4Z4WA 1ETVA 2CMPA 2KPMA 1SMTA 2VT3A 4GYIA 4HV5A 4B3AA 1U78A 1SEUA 2XV4S 1VQNB 1UD8A 2ID6A 2KRHA 2DY1A 4TMTA 2F48A 4ITVA 5LGTA 5E1WA 2LY1A 4G7WA 1KYWA 1S72B 1V0EA 1KK0A 4Z4SA 2FUG2 2VASA 1FBQA 2QWWA 3GFLA 1GUUA 2V6EA 3ASQA 3CCUI 3QPLA 4W97A 3CJRB 2ODLA 3T5XA 2XZLA 5KNLA 3I59A 1QO0D 1FNCA 2JSCA 1ZGAA 5EZGA 5BOXA 3CCMB 1I39A 3BC8A 2LVSA 3PUFA 4KYWA 5ICGA 2QLZA 3QYBA 1QHGA 3HRMA 3PFYA 3E6MA 3ERMA 3PSIA 3CF5F 2X85A 2P5VA 1R4MB 1W4MA 1Z9CA 1U2RA 3T53B 4BHCA 2Q6LA 4PSWA 1VF9A 2L5QA 1W7PB 2WTEA 3G4SI 1KK1A 2ZSIB 4XL9A 2K3PA 4KA4A 1FYLA 4I2OA 3K4JA 4Y33A 1UD5A 4GXOA 2FD5A 1YE9A 3WTVC 2K9NA 1K9MD 2G7UA 1KCDA 1ZM9A 2KDOA 2OAZA 3HTUA 1B8IB 3E97A 1APLC 2W1OA 4Z4UA 2LY9A 4FX0A 4LK0F 1GHCA 4QV2A 5A89A 4X07A 1OKRA 5HODA 1K8FA 1HKQA 3U2QA 2XSJC 2QSGX 2OC6A 3LFUA 5F27A 5BSYA 4LB6B 3QP6A 5IYBJ 4D0PA 1H8HA 2VOOA 1SVMA 4I0AA 2VFPA 2X6OA 3ZMSA 1GAQA 3MHPA 5FFZA 1UHSA 1R7JA 5E18F 4YELA 2R5YB 5L3EA 2VN2A 2R92J 2HQRA 3BCDA 5FLVA 2H8RA 2PEXA 4I7HA 3SLNA 4F92B 2OTJI 2NZMA 2TRTA 5TY0A 4Q7JB 3O8GA 3AG2H 3MMPA 2EPFA 2QGUA 1DABA 2CO5A 5C3EJ 4Y15A 1O8IA 5C1EA 1U0JA 1BJAA 5FLXK 1OPCA 1A5JA 1SFEA 3ZN1A 1TT5B 3FXJA 1WORA 3QQAA 1U8RA 2RVCA 3AG3H 1DU6A 1AA7A 3ZQGA 3WXMA 1ZLJA 2FNPA 4L0ZB 2R7SA 2EINH 4NNJA 2X8KA 2ZL5A 5HDKA 1YITB 2HYFA 3E7LA 4CYDA 4WX9A 4RD3A 4ETSA 4KIBA 4CO8A 2OK8A 4YXWA 2G7HA 3TH0A 1AOYA 5K7HA 2LD5A 1H89C 3W2AA 1OCRH 2W82A 2KHMA 3BG3A 3ES9A 5HLHA 2JVHA 2V7FA 1E3OC 4UUTA 4OPWA 3QAHA 3M1EA 2K27A 5D6FA 2NAZA 3GVAA 5K1YA 1R5HA 4L9NA 3SHFA 4OJOA 2VE8A 1U9OA 2EFOA 3O6BB 4HAMA 3EQLF 3KP6A 5FLXZ 3MZHA 5KAIC 4B4DA 2NYXA 3ML6A 1RMGA 2I8DA 3ZZ0A 5IK2A 4AUXA 1ZRFA 2OTLB 5DSZA 1W5SA 2VPRA 1C0WA 2BM1A 5FA6A 1HKTA 5DTDA 2MYSA 4J01A 1O4XA 2R4GA 3OMYA 1LUJB 2VFMA 2R93J 3CCRI 1O3TA 1HXDA 4LJZF 3ASRA 1UELB 5JBQA 2EA2A 1KU9A 4MO7A 5D5XB 2BN4A 3GIRA 5ICEA 1G4DA 3DLLF 2NS8A 2VJJA 4BH9A 1FWZA 3BTLA 2YWEA 2P5KA 3G6EI 2EFPA 2A5YB 3I71A 1KA8A 1E62A 1EH7A 4EQQA 2PG4A 5KVRA 1JB9A 1M90D 4WWVA 2VL8A 3LFKA 2E1RA 2M4KA 2ELJA 5H20A 3DLAA 5E3NA 1MH4A 3BG5A 3SFIA 3FBIB 4RB1A 2A68F 1FNNA 5ILSA 3DEWA 1SD4A 2EQRA 2DI3A 3HRSA 1EJ9A 4M71A 1ETKA 1WOSA 2F5VA 2VUMJ 3G1MA 3K4BA 1VQ6I 2IJLA 3U1DA 1NK3P 2HMAA 1IXSB 4H4KC 4EATA 2CW7A 2B9SA 3CCEB 1VQ4B 2F4NA 3CC4B 2WJYA 1LJ9A 1QVTA 4U0WA 4JRAC 3LSRA 3RI4A 2HOTA 3CCLB 2HI3A 2ZZEA 3E1SA 1Z67A 4Y4RA 1RR8C 3UNGC 3ASPA 2LNBA 3I56B 3RYRA 1QUFA 3A1PA 1QG0A 2DAOA 2KIFA 4UXNA 5IT3A 2X3HA 3B90A 2R7UA 4NC7A 2OBPA 1OGIA 4Z4TA 2QEXB 2H6BA 2O1DA 2XAFA 1EV7A 3CRZA 1OGOX 3FM5A 1S5LC 1YW7A 2W4SA 4XONA 1W7PA 5GAGJ 2RKHA 3REOA 4MTEA 2C2WA 5L3CA 4Q4ZF 1ZRCA 2Z6BD 2JTVA 4XLCA 3W2HA 5IOYA 3S3OA 4BJ5C 3GQ7A 4CSWA 3I55I 1FOWA 4HNTA 3LSJA 3OZWA 2QZAA 2M4GA 5LFAA 4S05A 5FD5A 3FXRA 1EH6A 2UXXA 3ZQCA 2X9DA 3H9GA 2ELKA 3PIPF 1IRZA 1TTTA 1V4RA 2V1DA 1QU3A 1D8JA 1T38A 2BM7A 2EZIA 1L0OC 2M1BA 3O2PE 3QU3A 2D5VA 4PUSA 4XKCA 3CP2A 2Q1ZB 4XKBA 2JSPA 2VBTA 4RDJA 4XBFA 5M3MJ 3VYTB 1GAWA 2R7WA 1UG2A 2DMQA 1HLVA 3B78A 5F4MA 5BS6A 3CD6B 3OZUA 1TT0A 3ABTA 3H35A 4D7MA 2R5YA 3PJRA 1OOCA 4I99C 4W8RA 1QQIA 1V3FA 4BBSJ 2R7TA 4YIFA 2QKLB 4EEFG 2CH0A 2F4MB 1TZLA 2K3FA 2ZO4A 5C4JJ 1RI7A 2CC2A 2Y0SA 1BR2A 4U0YA 4IHSA 2DT5A 5IYNA 1O8HA 1N08A 4UHTA 2VBEA 1EA3A 2HXIA 2J7KA 3EYYA 1KZLA 2LK2A 2FA5A 3PQJA 2VKDA 2FJ1A 1EE6A 4M6YA 4YIIA 1HW2A 1I3AA 2W6JA 1I3QJ 3BQZA 3DKYA 4WXCA 1BA5A 2BM0A 2A69F 3KPHA 4P9SA 3ZR8X 4HF1A 1QA1A 2FMYA 3HXLA 4ZZDA 5TRDA 4FE4A 4EM1A 2AXLA 4PJMA 2XC7A 1X3ZB 4JX4A 2R7OA 3D0SA 3HOYJ 1UD6A 1MBHA 4ENMA 2XIGA 3BR2A 4DGWB 5D5UB 3MZYA 1F5TA 1EF4A 2QYUA 2XNJA 4YZQA 3AG1H 1E17A 3PO2J 3QYFA 1HA8A 4IEJA 1DPRA 1BJZA 4WXHA 3S3MA 4QWQA 2GIVA 4ESBA 4EVIA 1FTTA 4YCQA 3HDDA 2JA5J 5D5VB 2ZNYA 3OYCA 4OIOF 3CO6C 4WZEA 3QFRA 1IGNA 1H80A 3KP4A 2NOJB 1VLYA 2VJ5A 3DPTA 4M6VA 4RA2A 3B02A 4OOXA 4X7DA 3HL2A 1RWRA 4HF0A 4ZYHA 1REPC 3BR3A 3G71B 4R8HA 3DTEA 4RBOA 1GV5A 3GQBA 3HIFA 4QSHA 4ROXA 3OY9A 2XGXA 3DU1X 2CQ7A 4IPAA 4M9ZA 4MEYF 5FO0A 2BVNA 5A88A 3IH3A 2NOGA 5AMVA 2MC4A 4JOMA 4G7XA 4J0QA 3KCCA 1USSA 4L18B 5GAEJ 2EZKA 4G8XA 5E79C 1V5VA 1WVRA 2VKHA 1SFOJ 3I4MJ 3B8YA 1G3WA 3BZ6A 1PXZA 4BUPA 4UUSA 2XRNA 1IHMA 3TQNA 3BZKA 4A2UA 3MKWB 1JE8A 3WODF 1O7FA 1VQKI 1FP1D 3F8MA 4P1WA 2L3DA 2LBFB 1WSVA 1EP3B 2ESHA 1WJDA 2QVOA 3OV8A 1VQNI 2VOPA 4AF6A 3S32A 3HHGA 1S3JA 1LVKA 4BQQA 2IOUG 1KU7A 2K9SA 2HTJA 1SAUA 2E34A 4CH7A 1E1QA 3GTQJ 5J35A 2KKOA 2HOAA 1IN7A 4D7NA 4ACAA 2ZJ2A 1MMNA 5IYWA 4OM9A 1DGRM 1D0XA 5DCFA 5GADJ 1HDPA 5C4XJ 3F9KA 1V5EA 3TKYA 1FRNA 3ZQIA 5LD2C 1OMIA 2BVLA 3SZPA 3CCMI 1ZG5A 2AO9A 5IT9K 2L7KA 1R4NB 1XSVA 3FXMA 3KEYA 3NE5B 3A1YA 3S1QJ 3SQNA 5D4SA 1VF7A 4KITB 1VJSA 4FTHA 3R6SA 1QJVA 2K4BA 1ZTRA 5KHDA 3GMEA 2STWA 2VNIA 1IF1A 1CF7B 4OIQF 1IAWA 1F1ZA 4UVBA 1E3PA 4LC0A 2R7RA 3RSNA 2VE9A 4N4NB 3N05A 1DBGA 3F23A 4ESJA 3DV8A 1HA3A 3IRRA 1AIPA 4TT3A 3CUOA 3OP1A 2QM3A 4R79A 1CNFA 5TV2A 3HJEA 1WSUA 4ZC3A 4AIDA 2O6GE 1I8DA 1B59A 3RCOA 3FHZA 1PJ5A 3N4MA 1OISA 3GTKJ 3S1NJ 2WY8Q 2X1DA 1T2KA 3CC7B 1T8IA 3FJOA 1V54H 3V8JA 3C3WA 1IB0A 2E1MC 3DCFA 1WSRA 5HS7A 3LAPA 1N06A 3ZRGA 3HPGA 2VNHA 1E2XA 3GUDA 1VQLI 3BT9A 5IT9Z 1CZFA 5LHHA 2VYQA 2QN6A 5FKMA 2RQPA 2HDDA 3OKXA 4FT8A 4L0YB 3VDXA 4CYCA 4PFPA 2X48A 1X4PA 2YWFA 1IV6A 3PQKA 1ONVA 5HLIA 3WY9A 4M72A 4YDTA 3WGHA 4RAYA 1RIOH 2UVEA 2EFGA 1KYZA 2Y9ZA 1MBEA 4UZUA 3BY6A 2YPRA 5HLTA 1TYVA 2DDBA 2DETA 3OYJA 4IHWA 1MMSA 1K4SA 1KK3A 3D5SC 1N75A 2VFOA 3FXLA 1GXPA 2X1CA 3GQAA 1IXCA 1IJEA 3R60A 5CDFA 1MBJA 1YW9A 4RLQA 4XRFA 5HS9A 3ZN0A 4OJPA 2ZL6A 4YG2F 4LG3A 2LRDA 1I1SA 1NB9A 1QRYA 4GFBA 1Q81D 1SVOA 3MQ0A 1YYVA 3VEPA 1V5GA 1KJZA 1B2RA 1YITI 3HOVJ 2CF4A 1ETOA 5FB2A 4AIKA 2F5DA 1YI2B 1BI1A 1XX5A 3ZMUA 5J4YA 4V02C 2JMWA 4JX6A 5BQTA 1J9ZA 4ZYEA 1WOOA 1P7JA 3WNBA 2W25A 1W0TA 1X2MA 2L4AA 2ZZGA 2QA4B 2LMDA 1MDMB 3LNNA 3PSSA 3JSOA 4RCZA 4IL6C 4HNVA 2ZBUA 2XNCA 2WYRA 3TGNA 1TL8A 1OFLA 1BQEA 2VZLA 3CCYA 4WZTA 1I6XA 2DPDA 2DA3A 3FKJA 4UB6C 1UFMA 1AIRA 2OTLI 3CMMA 2O04A 1G3SA 1OGJA 4GDFA 3DQVC 2GQQA 3S2DJ 2DCEA 1QCXA 4X6AJ 5ICCA 1ZLKA 4NHJA 2IAIA 2E1OA 1RESA 5E3OA 1RKWA 5F64A 2KQRA 2L9RA 2Y75A 1P4AA 2V9VA 1KMHA 3PUMA 4ASUA 3CCSB 1OYIA 4A3IJ 1VBLA 2GIZA 2Q2EB 3H5NA 4E7ZA 3K70C 2UXNA 4Y3OA 2HQ5A 2JPBA 2C6YA 4RDLA 1TYWA 2ZXWH 1GR1A 2X0KA 1XGOA 1TTYA 2XPWA 4UNOA 2IXSA 2V7UA 2GPJA 2P7CB 1EFCA 2AHOA 1K8AD 2JJ2A 1HSTA 3TL4X 1K5CA 1VLOA 5FRNA 3JRGA 4A5NA 4XRSA 2KZGA 3IAM2 1WDTA 3B8HA 2IA1A 1OJLA 2DA5A 3G1OA 1JKPC 2QTZA 4K1XA 1K73D 3IUOA 5DDGA 1XCVA 3GSIA 3WHBA 3SXYA 5K5RA 3RKQA 1PP8F 3CCEI 4OPOA 1QFJA 3OYFA 3CC4I 1VQ4I 1PP7U 2IS2A 1B23P 4BE2A 3E6DA 4I09A 2XAUA 1LEBA 3I53A 1W36C 3CCLI 3T56B 4AYBN 1MRZA 1HF0A 3I56I 2DMPA 3M3YJ 2QF7A 2BGIA 1ETYA 1EFRA 2VKVA 1FZPB 1IZ1A 1IRGA 3P26A 3PUNA 1X1DA 4FETA 1WZ2A 2KJCA 3J7YJ 1I7PA 4HYEA 3I0TA 2GOXB 1FRQA 4C43A 1MMDA 5ED4A 2MH9A 3MAJA 5M5XJ 4QVJA 3NQOA 5CVIA 2BEOA 3BJ6A 3HOSA 1FPQA 2LKSA 4EM0B 3F8FA 1ENHA 5B5EC 1QGAA 2RDPA 2ZC2A 4PGGA 3LO8A 2E2HJ 1NK2P 1OCTC 4AC0A 1O3SA 3A8KA 1IN5A 3K4NA 2XF6A 4AWXB 1PUFB 1EZGA 1VQOB 2DA2A 2O03A 2E35A 3BP8A 4WF2A 1RUNA 4EH1A 3FK6A 5TGTA 2BSAA 1VFCA 3R6JA 4M0LA 2VLAA 1H0MA 1QRCA 3ABKH 4HQMA 2CUEA 3HSFA 4HX4A 2MFZA 4ENJA 2XROA 3CCVB 1ZGJA 2M30A 3CD6I 4BBRJ 4A3BJ 2IVMA 2ME0A 3WG7H 1QZYA 4IRGA 4JBAA 1GJRA 3OL3A 4RLZA 5EYRA 1U9NA 2DBBA 4A5MA 3GTMJ 1D1CA 2PMZN 1KRHA 3VO2A 3ZGKA 1T33A 1TNTA 2XDVA 3HUGB 3CMYA 3ULQB 2IQ7A 2FQ4A 3JAMK 5L3DA 4DZPA 3HKZN 3RTRA 3X2QH 3P5JA 1LFPA 4PJJA 3S17J 3RYPA 4AC9A 2O6WA 3OSFA 4RD0A 3VMWA 1U5TA 1LVAA 2HDCA 3CDLA 2MW8A 2BE5F 2IRFG 3VODA 2DTRA 2DJNA 1OFEA 4U7BA 3QODA 1J2XA 2LP0A 1OFCX 2GXGA 4IOAF 4UVAA 1LLZA 3DDYA 2MD0A 1W2BB 1SFXA 1XD7A 2CYYA 4RGXA 4RAGA 1JT0A 1QNTA 5DV5A 1D1NA 2W6IA 3DBHB 1IRXA 4PCQA 2GAUA 5CVVA 3QU6A 1U5TC 2ZXHA 3CUQA 4ON0A 5IP7J 5E8GA 2XNDA 5THXA 5FKOA 4PSXA 3MCZA 5FO1A 3GCMA 5KSWB 1H9TA 4A0ZA 2OBTA 2AHQA 4AYBA 3KZIC 2KMUA 4PGHA 1UHMA 3DPLC 4DK0A 4Z6YA 4P9UA 2HQAA 4I01A 4QIWN 1QHHD 4HV6A 1MDMA 2DK5A 1TW3A 1Y39A 1DP3A 2JIZA 3G71I 1OFDA 1HQCA 3CXCB 1X3UA 1T08B 4W8TA 5F4JA 2DN0A 2DJIA 2PX9A 4M3DA 4CA0A 3W6JB 3CUQC 2VJIA 4O5VA 1JUSA 1LDJA 4UY8I 4ZCMA 4Z4VA 3I58A 2XT4A 1ETXA 1L1IA 2BY1A 2WAFA 3W2GA 2OV7A 2QKMB 2VT2A 3QWLA 4KMFA 1MMGA 2CK3A 4IW3B 2M8EA 4I84A 3IHUA 4OOVA 2VB6A 3M1CA 1EP1B 1N0VC 2NT6A 3QPTA 1BN5A 3K1MA 2XF5A 2KIMA 4BE1A 1MGTA 2CJJA 2CBXA 1H9GA 2E19A 5J1UA 4MFEA 3F72A 1PLUA 3JU4A 1KU3A 3Q9SA 2ZFUA 2FSWA 2BF4A 4X0CA 3J81k 4XR6A 2H1KA 1NH3A 1R36A 2XKOA 1SKQA 4KMUX 5BNGA 5EGOB 4HLYA 1JXSA 1O57A 2EBIA 1VHEA 3V76A 4ACBA 3JRIA 2BW3B 2K9QA 2KT0A 3Q3SA 2VNJA 3ONUA 2PECA 2EH3A 2PMZA 4Y7NJ 3LJYA 4XORA 3C1DA 2PYHA 3W2FA 1MZBA 2XAJA 4WCGA 1KGSA 2DYRH 2P0WA 2ZL7A 4XMYA 4HE6A 5FIUA 3BTCA 1JTAA 1MNDA 2NTPA 3HEFA 2UV1A 3AL0B 2PLYA 3HKZA 4J19A 2OBRA 2FXAA 4EJTA 2O17A 2QY1A 4MQ9F 2F6CA 2KZVA 3H0GJ 3A0HC 5LGNA 3OOCA 3LA3A 4XN3A 1R5BA 4BY7J 4IRHA 3Q39A 5L3GA 3R6KA 2K85A 2L7ZA 4C2MJ 1IDJA 3W6KB 5DNSA 2PBIA 2NNNA 3HM5A 1GT0C 3E5UA 4V2FA 4V2GA 4L9TA 1VZ0A 3A35A 5FKKA 2WPDA 4A12A 3SFZA 4WK8F 3CC7I 2QENA 5HS8A 3T8RA 5JFRA 5FJ8J 2OCEA 2XTYA 3K70D 2KRCA 4G1VA 4KKTA 1X0CA 5FKNA 4JQFA 2CV0A 1A31A 3S14J 1SD6A 3KP7A 5E1XA 1Z6RA 1FDRA 1PUFA 3P7NA 3U2RA 2VC0A 4RDUA 4Z1MA 2IBDA 2DA1A 4OAYA 3FPKA 2GK6A 1HC8A 1X1CA 1U2WA 1WP6A 4ZGNB 2RGVA 1O8GA 4U87A 3E3VA 2G9WA 4RAZA 5BPDA 1Z0XA 4MQVA 2A6EF 4MHGA 4RGSA 4ABZA 2MD5A 4BL0B 4E4HA 5IP6A 3P9KA 4TN1A 5DD4A 5E6TA 3Q6QA 2JUCA 4DYQA 1N77A 4D5FA 2GJRA 3BH6B 1I5ZA 2HXOA 2WR8A 2F1MA 4U49A 1GV2A 1ZYRF 5EEHA 2EFWA 3CMEI 2O5RA 3OOPA 3VSVA 3K69A 3VYUB 1YW8A 2A05A 2K86A 1FOYA 1I1GA 4EGZA 3LA2A 4IOCF 2F4OB 1QGYA 4WWCA 2P5LC 2O0VA 2WADA 4EJVA 4BQAA 4ZDPA 4M1KA 5DD8A 2K9MA 3BNWA 3WNCA 2DQLA 4KKSA 3K9TA 2HYJA 2XVCA 2XGCA 2MSYA 2JPCA 3HPHA 2FE3A 4R1HA 3BR0A 2KDZA 3Q9VA 4FE7A 2WC2A 2QA4I 3I64A 2HOSA 3CP8A 4UAJA 3BQYA 2KP6A 3DKXA 4ZDLA 2K02A 1BBYA 1LB2A 2M2EA 1PUEE 1JJ8C 3RPUD 1CQTA 2VI6A 1DP7P 4RD6A 4HQEA 5DYMA 1UCRA 2RQQA 1FBUA 5M3FJ 1IN6A 3BCFA 5ILVA 4TMZA 1XTAA 3RQ4A 2PMUA 1B72B 2DOEA 4G7HF 2QSFX 1YX5A 1T6YA 3CMAB 4E7JA 2DODA 2CG4A 3HHHA 4L5JA 2R5ZB 3CCSI 2ZTNA 2NSPA 1ZREA 2Y0SN 1FMVA 2MH2A 5JHFA 3IWZA 2XC1A 3MKZA 3LMMA 1S7EA 3CLOA 3J81K 4DQ2A 4G5GA 3RIQA 3FBNB 2XRLA 3OR2C 2V6CA 2Y48A 1UJ8A 1RKTA 3SEZA 2IGNA 1LDKB 2Y9YA 4CCMA 4HDUA 3K0LA 5J1RA 1YIJB 1O8KA 1Z05A 2EV0A 2RN7A 4DYCA 1BW5A 2FEZA 2CSOA 1QVGB 1R1UA 2V9KA 1JA1A 3GVKA 3K1PA 1BOBA 3OIQA 5DUKA 1A36A 4Q48A 3PM1A 1Y1VJ 1AWCA 2IGKA 3H92A 2DYIA 1OGMX 4C0SA 2E1NA 4II2A 4RS8A 3L2WA 5E3LA 3ZMVA 2B5OA 2VQHA 3CCJB 1QBJA 1QH0A 4IJAA 4OJ6A 3PNYA 1ZELA 3LSIA 5M5WJ 4OPVA 1UZCA 3W2WA 3WBJA 1R23A 3HSEA 3VSUA 4D1QA 1TYUA 3GO5A 4G6TB 4YRVA 2BW3A 1JKOC 1DDIA 2M87A 4XSZF 1ZG3A 3KRGA 2B63J 2GK7A 1XGNA 2HOEA 4RAFA 3J81Z 2XGEA 2DT6A 4B3XA 2ECBA 2X6XA 2LREA 4LBWA 4JP0A 3K4MA 1FSEA 5LRRA 3I1FA 3FY3A 5HLGA 1MD0A 2O7OA 4P2NA 2H8WA 2Y2ZA 3B6AA 2ZXIA 4NC6A 3CESA 2H1LA 4XLFA 3JW4A 2ZITA 5F0CA 4QPQA 5J3LA 3ZQQA 1RQRA 5H2FC 3HC7A 1GDTA 4JK1X 2RREA 4GRIA 2F5EA 3G73A 2X0LA 3SYJA 1DARA 2EFQA 3FXOA 3TEDA 3KL9A 1PYVA 4CCLA 4BNCA 3AL0C 3LQEA 1B8IA 2PE3A 3AVTA 3GZNB 2YX4A 3V7AA 1MBGA 1OHHA 3CCVI 3J7AO 2O8XA 4OMZA 1IUYA 5DN6A 1IG7A 3MCAA 2R7DA 2ZJQF 3K4LA 2D2WA 2P6TA 3I3LA 4LLLA 4M9XA 4DBRA 5EDNA 4HPQA 4YALA 2DERA 1M1KD 1LQ1A 3I5UA 4HX7A 4DOZA 2EWNA 2WV1A 3D1NI 1Z91A 3ZIAA 5BSXA 4KN4X 2XAGA 1PJ6A 1CQXA 3GQ9A 1WOPA 1WGXA 5JVTA 4F55A 4OIPF 4Y9UA 1J75A 4A0XA 2M3AA 1D8KA 3KETA 3ROUA 3BCBA 1ZAOA 2X6YA 3KLNA 4DJAA 3GVJA 4WZLA 1LFUP 2D3LA 2V7WA 5EG0B 2NRAC 2CUFA 4BGDA 3JQPA 1VQPB 2KVOA 1ORKA 1TYXA 4RD4A 1XMAA 3WU0A 3W2EA 1ZK8A 3JR9A 1R5GA 2FX0A 2QQBA 1RR7A 4RMNA 5E3MA 3JSPA 2VPLA 4IX7A 1VI0A 2YWHA 1D3YA 5KCMA 2LKXA 1VTNC 2VBSA 3D26A 1COWA 5JMCB 3BR5A 2NVUB 2FX3A 4BEHB 1UG0A 2N8GA 4RB2C 4RGUA 1G7TA 1Y0UA 4NCNA 5DS9A 1V55H 3M07A 1OB0A 1QA3A 1RZ4A 1ZQ3P 2OUMA 4BHBA 3GEZA 3VYSB 3M9AA 1ELOA 2WJVA 4XLNF 1RRJA 4HIZA 1YHQI 1JTYA 2HPIA 3BOQA 2CRVA 4L9JA 1ZUNB 2DFFA 1MIJA 1T5EA 5HDNA 2ACJA 3FDYA 3QE2A 2ZSHB 3T8TA 1Y0NA 3ABLH 4H0EA 1AU7A 2ZKZA 5J4VA 3FXKA 2BZTA 4A0YA 1D5YA 1B72A 2NTQA 4PC3A 2WB1A 4EW9A 4WXDA 5B1AH 2V9PA 3OR1C 5C1CA 4OWRB 5JVGF 3DP7A 4P3IA 3HOXJ 2QBYB 2R5ZA 1R5NA 2WWYA 1K7AA 3T0YA 1FMWA 3IWFA 4PABA 2WAQN 3GZ5A 3D5LA 3SEQA 3U6BA 3Q3AA 1B6AA 2EB7A 5DUIA 4XQFA 1YRNB 4EJUA 5KAFC 4XKVA 2XAQA 4W8QA 1E3ZA 1OQYA 3OE7A 3GX4X 2EJRA 2PMDA 1SFUA 3OYLA 2BOLA 4KN7X 4U4BA 3OYEA 2PIAA 1T6SA 5TR9A 1JRGA 2BSPA 1IDYA 4XKWA 4IQJA 3WTYC 1S72I 2M0CA 2E1BA 1FTZA 3EPZA 3AKZA 5HXBA 1HG8A 2M7AA 1GVHA 3FPPA 3EQNA 1IXRC 3QFSA 2O9LA 1SD7A 3ZCOA 4WQMA 1NBMA 4EV0A 3EUAA 4G94A 1MBFA 3C2HA 4LFUA 4RM3A 5D8LB 4U0VA 2V5IA 4BXFA 2VONA 3LVBA 2Z9OA 5HZAA 2WZPP 1XFOA 3SEJA 4DBQA 2LZJA 4S04A 2HZTA
chains in the Genus database with same CATH topology
2FUG2 2VASA 1W36C 4KISA 2V6EA 3T56B 2V4DA 3CJRB 2ODLA 2XZLA 5KNLA 1EFRA 2HNHA 1ERDA 4HG2A 2CUJA 4XOPA 3OEHA 3BC8A 1X1DA 4B43A 4FETA 1HZEA 1O8DA 1HVXA 3OIPA 3DU5A 3QYBA 3TMOA 1QHGA 2WAEA 3PFYA 1D1BA 3PSIA 3OYGA 2X85A 2GOXB 2HVRA 1MMDA 2E1MB 2LOOA 3T53B 4IKFA 3OEEA 4PSWA 3M8JA 2L5QA 3HOSA 4KJZA 2ZSIB 1G8XA 1D1AA 2K3PA 4XL9A 2BVMA 4KT6A 3K4JA 4Y33A 4BE0A 1UD5A 3OFNA 4NC8A 1S9HA 1G59A 4JMQA 1YE9A 3OYMA 1WTHD 5HVQC 3K4NA 1X4OA 2WY7Q 2XF6A 2Z8GA 1KCDA 2KDOA 3VSLA 2IS4A 2W1OA 1E43A 4II3A 5TGTA 3K6GA 2VLAA 2XSJC 2OC6A 2V4JC 3LFUA 4HWVA 4NQWB 2MFZA 1H8HA 2R7VA 1V5FA 3L2RA 1WFXA 3OL3A 3A3BA 1MNEA 2WBMA 1X1AA 2L9SA 1D1CA 4XLAA 4YELA 3GQ8A 1W9XA 2CV1A 1MW7A 3ZGKA 4BDYA 3BCDA 2XDVA 3HUGB 1E0EA 2IQ7A 2VQLA 2R7QA 1OLTA 2IGMA 2LYCA 2WAQA 1KONA 3RTRA 4F92B 1LFPA 4PJJA 3ZXSA 4CCJA 2NZMA 3VMWA 4ZDOA 2GOMA 3QODA 4U7BA 1O8IA 5C1EA 2W7NA 1U0JA 4G6IA 2PJRA 2JUGA 1UD3A 3DEEA 1DBOA 3DDYA 2A5WA 2MD0A 1V0FA 4OJLA 3L2VA 3SZGA 2X53S 5CPRB 3PL8A 4HSRA 4PK4A 1AA7A 2W6IA 4XNFA 2QX3A 3OS1A 1IRXA 3LMWA 2NSPA 3G2BA 2R7SA 2XF7A 2ZZFA 4BEHA 4NNJA 3B4NA 2ZXHA 2X8KA 1WPCA 5HNHA 2XNDA 2ZZQA 1J09A 2VJ4A 4YZAA 3BG6A 4PSXA 4YXWA 1BR1A 2Z2SB 4PJLA 4AYBA 2W00A 2INUA 2KMUA 3DU6A 1Y6IA 3DPLC 4DK0A 3W2AA 2W82A 2HQAA 2KHMA 1DP3A 1BR4A 1QHHD 2JIZA 2LG4A 2JVHA 2V7FA 2HVSA 1WMRA 2DXIA 4ZJZA 3BH4A 3ZSCA 4W8TA 2E5ZA 3S8PA 1T0FC 4GQNA 4OJOA 4HRIA 4ZTJA 3C2GA 2DJIA 4CA0A 3W3CA 1OR7C 3EUHC 2VJIA 1RMGA 2I8DA 2HZDA 5IK2A 1MABA 2VQCA 3H0DA 2GJKA 2V31A 2WAFA 2WSSA 2OV7A 2QKMB 3OW7A 1O8LA 1MMGA 2CK3A 3G05A 2MYSA 4J01A 4I84A 2LC2A 2VB6A 3M1CA 3SDBA 2R4GA 3OMYA 2NT6A 2LBFA 3DTIA 2CS3A 2XF5A 3DPUA 1UELB 4BE1A 4CCNA 3GVLA 4P5OA 3LSHA 1PLUA 2VJJA 3JU4A 3JURA 2ZFUA 4XR6A 1NRKA 3PNTA 1E79A 2VL8A 3HOTA 4B3FX 3VSKA 2M4KA 2ELJA 4XOTA 3DLAA 1PKVA 2BW3B 1I18A 2PECA 3FBIB 2PMZA 1IDKA 2MABA 3K10A 4XORA 1WJAA 2PYHA 2DT7B 2NSTA 4YZXA 4B3GA 2P0WA 4XMYA 1JTAA 4B47A 3ONQA 2NTPA 1MNDA 2F5VA 1KTWA 3WWGA 2UV1A 3OYDA 3BCAA 3AL0B 3HKZA 3K4BA 4LIUA 4C9YA 5HKKA 2O17A 4H4KC 4EATA 2CW7A 2QY1A 3EQOA 2F6CA 2WJYA 2KZVA 3OOCA 2XZOA 4XN3A 2DOAA 2ZZEA 3E1SA 4Y4RA 3SYTA 3UNGC 5HOOA 3OYBA 3L2UA 1WJBA 3CJQB 3QYEA 3ZPNA 1IDJA 2X3HA 2RNGA 3B90A 4E6KG 2R7UA 4NC7A 4E7LA 3OS0A 2O1DA 2X51A 2QXZA 3BLYA 3HAGA 1OGOX 4X0GA 1VZ0A 2CW8A 2W4SA 4XONA 3A35A 2WPDA 3J7AY 4C2TA 2L9NA 3DTKA 4Z06A 2Z6BD 3K70D 1RU4A 2KRCA 4XLCA 4KKTA 2NT9A 1Z7LA 1X0CA 4DNRB 4JQFA 2CV0A 3S3OA 4BJ5C 4ZTFA 3LSGA 2IS1A 4CSWA 2IS6A 4DNTB 3GQ7A 1R6RA 3H94A 3KEWA 4HNTA 1X19A 3OS2A 4Z1MA 2NTBA 2M4GA 4BJ6C 4OAYA 5LFAA 2GK6A 4NUBA 1X1CA 3H9GA 3W2VA 4E7IA 1WP6A 2W6JA 1QU3A 4PFOA 4U87A 5FRMA 2ZTGA 1O8GA 4F91B 4PUSA 4XKCA 3ZPPA 3CP2A 2Q1ZB 4XKBA 2JSPA 4BL0B 4E4HA 3VYTB 2QE7A 2R7WA 1UD4A 1YX3A 2GJRA 1N77A 3H35A 1TT0A 1WJEA 3PJRA 2HVQA 4BQNA 2F1MA 1OOCA 4U49A 2R7TA 4W8RA 2QKLB 2O5RA 2CH0A 3GRHA 1TZLA 3DWLE 3VSVA 3VYUB 2Y0SA 1BR2A 1JI8A 2X1EA 1GLNA 2JDIA 1O8HA 2XOKA 1O8FA 1IA5A 3A4CA 1N78A 1D0YA 1EA3A 2VBEA 1E3XA 2O0VA 2WADA 1KZLA 2VIXA 1O8EA 4ZDPA 2VKDA 1EE6A 3UW0A 3H5AA 2K9MA 4MLOA 2K5CA 5CQGA 2CV2A 4OAZA 3DKYA 4HSTA 3KX2A 4HNUA 3OAAA 4KKSA 3I9V2 3PSFA 3ZR8X 1O88A 1E1RA 3HXLA 3HPHA 4XD7A 3T51B 4PJMA 2XC7A 2R7OA 3CP8A 1UD6A 2KP6A 3DKXA 4ZDLA 4YEJA 4BU2A 4DGWB 3RPUD 4Z03A 4YZQA 2WA0A 1HA8A 3QYFA 2RQQA 4F93B 4RLFA 3S3MA 4L8JA 2F4IA 4URRA 3BCFA 3OYCA 3D5RC 3RQ4A 1T95A 1H80A 2HPMA 3U21A 1BN8A 2NOJB 4NK6A 1VLYA 2VJ5A 3DPTA 1YX5A 4BJTA 1RWRA 3HL2A 4E7JA 3T9GA 3DTEA 2ZTNA 2KLOA 3GQBA 3OY9A 3VR6A 1DGWY 1FMVA 3PUBA 5JHFA 1K28D 3OYAA 4TKOB 4FASD 4OJ5A 3MKZA 3LMMA 5AMVA 2MC4A 4JOMA 4G7XA 3FBNB 4CCOA 3OR2C 4C2LA 3OOUA 4DK1A 3SEZA 4BDZA 4P22A 2IGNA 1LDKB 4CCMA 5HNFA 1KCCA 1NG6A 2VKHA 3B8YA 3H5RA 4XM3A 3BC9A 1PXZA 4BUPA 1Z21A 3GBGA 2KL4A 3LL7A 3AFHA 1PE9A 3MKWB 2V9KA 3OL4A 4P1WA 3GVKA 2LBFB 1BOBA 3OIQA 4IZZA 1X1BA 2VXZA 4ZYAA 4F3QA 4QPOA 3IAS2 2IGKA 1WJDA 1OGMX 4E7KA 4II2A 3L2WA 3SUCA 3S32A 1K6YA 1LVKA 2VQHA 4C30A 4BQOA 4BQQA 4OJ6A 3PNYA 1W0KA 1SAUA 4D9JA 1ZELA 3LSIA 4CH7A 1E1QA 3S93A 3W2WA 3VSTA 3V42A 3VSUA 4D1QA 1MMNA 4G6TB 4YRVA 2BW3A 1DGRM 1D0XA 3H9JA 3KRGA 3F9KA 1V5EA 3PNVA 3MMYB 2VBKA 5LD2C 2BVLA 2GK7A 1NHCA 2M5SA 2DT6A 2L7KA 2X6XA 3KEYA 4B3XA 3NE5B 2XGJA 3S3NA 3L2QA 3A1YA 3MD2A 3LSMA 2LREA 1VF7A 3K4MA 4ANJA 4KITB 1GQ8A 3FY3A 2V7QA 1VJSA 1QJVA 1BLIA 5KHDA 2ZXIA 3OYHA 3CESA 4XLFA 2R7RA 4QPQA 3ZQQA 1Y56A 3RSNA 1Z3XA 3HC7A 3N05A 4N4NB 1DBGA 2RREA 4GRIA 4CUGA 2A6TA 4B44A 2HU9A 4TT3A 1Z3YA 3VMVA 2AQFA 1BMFA 3IP4B 1PYVA 2E60A 4CCLA 4R79A 3AL0C 2GJPA 4ZC3A 1O8KA 1I8DA 3RCOA 2O0WA 2IGOA 2L2OA 4PMHA 2HDWA 4PJNA 2WY8Q 2X1DA 3A3GA 4E7HA 1OHHA 1IB4A 3VYRB 3LSKA 1WJFA 2E1MC 1O8MA 2Z1DA 5DN6A 1SKYB 2PYGA 3ZRGA 3HPGA 3K4LA 1D0ZA 1CZFA 3I3LA 2M7BA 4DBRA 2K9LA 4HPQA 2VXDA 3KYLA 3VDXA 4DOZA 4E7SA 3CZ6A 4N4OB 4PFPA 2XZPA 2EWEA 1X4PA 2CFOA 3ZIAA 3GQ9A 1H8EA 4Z05A 3K4CA 2D3NA 4MR0A 4F55A 2UVEA 4NK8A 1W36D 2M3AA 3BCBA 4UZUA 2JA2A 2X6YA 1P9QC 4DJAA 2R9VA 5HLTA 3GVJA 2LH9A 3BG7A 4AU7A 2D3LA 3OYJA 4AVZA 4E0FA 4CCKA 2X6WA 4BGDA 3OYNA 4W8SA 3D5SC 1N75A 2R7XA 2KVOA 2PJRB 4MXNA 3E0JB 3MKYB 1OFMA 2X1CA 3WQZA 3GQAA 4CZCA 5CDFA 4RLQA 1BHEA 4OJPA 4RMNA 1FX0A 2HLDA 4LG3A 2LRDA 2VPLA 4IX7A 4DIQA 5KCMA 1BPLA 3HG9A 4F52A 1COWA 1MMAA 1V5GA 4IQ4A 4BEHB 1UG0A 2UWMA 1XG2A 5FL7A 5CKTA 4J00A 1SFKA 1OB0A 2OUMA 3VYSB 1PJRA 3NWSA 3OYIA 2WJVA 1WJCA 3OWTA 4HIZA 2ZZGA 1WJ5A 2HPIA 1O8JA 4OZYA 2JVGA 3LNNA 2INVA 1T5EA 4TSFA 3OPOA 2DIEA 3FDYA 3VWBA 2ZSHB 2V26A 1OFLA 2Z16A 3FKSA 4KKUA 2LY2A 3CF2A 4YZ0A 3FKJA 1AIRA 4XLHA 3CMMA 2O04A 3TBIA 2UUZA 2NTQA 3DQVC 2WB1A 3NWTA 2DCEA 2VQGA 1QCXA 3K4KA 3OR1C 4FXUA 4BS9A 4EW9A 5C1CA 4OZZA 4OWRB 3OYKA 1FMWA 2KQRA 3UR3C 4LIVA 1KMHA 2UVFA 4ASUA 1VBLA 2Q2EB 4E7ZA 3H5NA 3D5LA 3QOEA 4Y3OA 3SEQA 3K70C 1UD2A 2CUZA 4XQFA 2V1NA 3EUKL 4W8QA 4XKVA 2IXSA 1E3ZA 2E5NA 2M0MA 5FROA 3OE7A 2JJ1A 4XN0A 3OYLA 2BOLA 2JJ2A 4U4BA 5CQEA 1LKXA 3TL4X 3OYEA 1K5CA 5FRNA 1JRGA 2BSPA 4XLEA 4LITA 4XKWA 1NG7A 2AQEA 3IAM2 4BACA 1UAAA 4IQJA 2E1BA 3H9QA 2F43A 3EPZA 4HEA2 3AKZA 1HG8A 2M7AA 3FPPA 3EQNA 2CMPA 2KPMA 3ZCOA 3IUOA 2VBMA 1NBMA 3EUAA 3C2HA 4RM3A 4B48A 1UD8A 2KRHA 3FHNA 3OYFA 1DQUA 4BXFA 4ITVA 2LY1A 2IS2A 4G7WA 3A2KA 1W0JA 4BE2A 2WZPP 4RM2A 1V0EA 4DBQA 2LZJA 2XAUA 4C2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZF A;  1O88 A;  2ODL A;  1O8L A;  4XOP A;  4I84 A;  1O8D A;  2EWE A;  2NT6 A;  3GQ9 A;  4Z05 A;  4MR0 A;  2X85 A;  4YEJ A;  2UVE A;  4NK8 A;  4Z03 A;  4YZQ A;  1PLU A;  2VJJ A;  2X6Y A;  3JUR A;  4XR6 A;  4XL9 A;  4URR A;  4AVZ A;  2X6W A;  4W8S A;  4XOT A;  1H80 A;  2PEC A;  1BN8 A;  4MXN A;  4NK6 A;  1IDK A;  1OFM A;  2Z8G A;  1KCD A;  1RWR A;  3GQA A;  4XOR A;  2PYH A;  2NST A;  4OJP A;  1BHE A;  4YZX A;  3T9G A;  4XMY A;  1JTA A;  2NTP A;  3WWG A;  1KTW A;  4OJ5 A;  4HWV A;  2O17 A;  2QY1 A;  3EQO A;  5AMV A;  4C2L A;  4XN3 A;  1XG2 A;  1KCC A;  3B8Y A;  4XM3 A;  1PXZ A;  4XLA A;  4YEL A;  3GQ8 A;  1PE9 A;  1IDJ A;  2X3H A;  3B90 A;  1O8J A;  4OZY A;  2IQ7 A;  2INV A;  2O1D A;  1OGM X;  2QXZ A;  3SUC A;  1OGO X;  1OFL A;  2NZM A;  4XON A;  4OJ6 A;  3VMW A;  4YZ0 A;  4Z06 A;  1AIR A;  4XLH A;  3VST A;  2O04 A;  1RU4 A;  4XLC A;  2NT9 A;  2NTQ A;  1X0C A;  3VSU A;  1O8I A;  4EW9 A;  1QCX A;  5C1E A;  3GQ7 A;  5C1C A;  4OZZ A;  3KRG A;  2VBK A;  1DBO A;  2NTB A;  1NHC A;  4OJL A;  2X6X A;  1O8G A;  2UVF A;  4XNF A;  2QX3 A;  1VBL A;  1GQ8 A;  3FY3 A;  3ZPP A;  3LMW A;  2NSP A;  4XQF A;  1QJV A;  3B4N A;  4W8Q A;  4XKV A;  4YZA A;  4XLF A;  4XN0 A;  4U4B A;  1K5C A;  1OOC A;  4W8R A;  1DBG A;  4U49 A;  2INU A;  1JRG A;  2BSP A;  4XLE A;  4XKW A;  3VSV A;  3GRH A;  1HG8 A;  3VMV A;  1O8H A;  3EQN A;  1O8F A;  1IA5 A;  1WMR A;  2VBM A;  1O8K A;  2O0W A;  3ZSC A;  4W8T A;  4PMH A;  2VBE A;  4OJO A;  2O0V A;  1IB4 A;  1O8E A;  1EE6 A;  3UW0 A;  2VJI A;  1RMG A;  1O8M A;  2PYG A; 
#chains in the Genus database with same CATH topology
 2F3L A;  3PSZ A;  2ZME B;  1JHH A;  2V4D A;  2IT0 A;  1T6X A;  1BI0 A;  3PIO F;  3DXJ F;  1OCZ H;  1ERD A;  2Y0M A;  2JZY A;  3MN2 A;  2CUJ A;  4HG2 A;  3JTG A;  1O8D A;  4B43 A;  1LE8 B;  4KUM A;  4IHY A;  1FNB A;  1R5O A;  2XHK A;  3OIP A;  3TMO A;  3U6K A;  1D1B A;  2DA6 A;  2E7W A;  3I54 A;  1W34 A;  3TP3 A;  2LOO A;  5JLX A;  4YAU A;  4IKF A;  2W24 A;  3RJP A;  3OEE A;  1XCB A;  3CCU B;  3GZ6 A;  1EFT A;  4KJZ A;  5IYR A;  1W5T A;  1T98 A;  1XSX A;  4KT6 A;  1GO2 A;  1VQM B;  5DS0 A;  3F6O A;  5LEK A;  3OFN A;  3GXO A;  1S9H A;  1G59 A;  4CGZ A;  5LEJ A;  1TQM A;  3Q0W A;  4RB0 A;  2Z8G A;  1X4O A;  2WY7 Q;  2BM6 A;  2L02 A;  2IS4 A;  5E1Z B;  1S7A A;  1F36 A;  2GZW A;  4BHP A;  2EIK H;  3ASO H;  4PAA A;  3LQR A;  1HCR A;  2K4J A;  1IC8 A;  2IEK A;  4CZZ A;  2V4J C;  1YLO A;  4AF7 A;  4HWV A;  3MZ8 A;  4NQW B;  1PJ7 A;  3H09 A;  2EK5 A;  1KU2 A;  2R7V A;  2L9V A;  5GV7 A;  1E64 A;  1V5F A;  2A6H F;  3L2R A;  1WFX A;  2NVX J;  1IJF A;  2WBM A;  1W0U A;  2M5W A;  2L9S A;  4XLA A;  1N8R D;  1J7K A;  1IO2 A;  1W9X A;  2C4T A;  4G6D A;  1MW7 A;  2CV1 A;  2MA3 A;  4B09 A;  1E0E A;  1SMY F;  4Q47 A;  2DA7 A;  4C2U A;  2WAQ A;  1A04 A;  2LYC A;  2DW4 A;  1KON A;  3J80 K;  3VB2 A;  4CCJ A;  4N3G A;  1QGZ A;  1J5Y A;  3B73 A;  4OOI A;  1HSJ A;  1TQI A;  2BY0 A;  2RNJ A;  1POG A;  2LSO A;  2GRE A;  3L7W A;  4RB3 C;  2W7N A;  4XRS G;  1JKQ C;  4G6I A;  2JUG A;  1BX1 A;  1BC7 C;  3FKI J;  3DEE A;  2YUS A;  1UD3 A;  3ZPL A;  5HZB A;  2L7F P;  1V0F A;  1I50 J;  4OJL A;  2MLG A;  2PN6 A;  3BTI A;  3L2V A;  1YTY A;  2NVT J;  2V7X A;  2BGJ A;  2IP2 A;  5CPR B;  1FNM A;  3PL8 A;  4HSR A;  4N0B A;  4M3F A;  4PK4 A;  3EYI A;  2Z99 A;  5JLV C;  1YFH A;  2FU4 A;  3SJP A;  1T0F A;  3E5Q A;  1MJA A;  1K61 A;  4P55 A;  2ZZF A;  1LM1 A;  3GF2 A;  2DEU A;  4BEH A;  3IKT A;  5EEA A;  1ZM2 A;  3B4N A;  3BQJ A;  1JNY A;  5K5Q A;  4QFM A;  3EUH A;  5HNH A;  2ZZQ A;  1J09 A;  3V8K A;  3CCQ B;  3ESW B;  5JR3 A;  4HE5 A;  2LDU A;  5EF6 A;  1BR1 A;  1YLF A;  2BHZ A;  4PJL A;  2GXB A;  2LF8 A;  2W00 A;  1HDD C;  2V1U A;  2INU A;  5HDG A;  1R49 A;  1Y6I A;  3J80 Z;  4QUZ A;  4AD9 A;  2FBI A;  1BR4 A;  3KFW X;  3KZZ A;  3ZQ7 A;  4FCY A;  1W7P D;  2HVS A;  3E5X A;  4ZJZ A;  2E2J J;  1G6N A;  2E5Z A;  3S8P A;  1T0F C;  2EIX A;  4GQN A;  3SZT A;  1NHA A;  4ZTJ A;  3AAF A;  5IYQ A;  3ZBU A;  3AVW A;  1MH3 A;  3EUH C;  3NB2 A;  1YIJ I;  2XKP A;  4DNC A;  2P6S A;  4MGR A;  1MAB A;  4PC2 A;  3VNU A;  5IYD J;  4ZGQ B;  2GJK A;  1E3H A;  2WSS A;  4KIC A;  4RD2 A;  2P81 A;  1R5I D;  1UB9 A;  2X3U A;  2OZU A;  3V7R A;  2G0Y A;  3TDU C;  2P4W A;  1ZAR A;  3SDB A;  4ENN A;  1SM4 A;  1X3W B;  4Z4Y A;  1FND A;  4Z2Y A;  2LBF A;  3S16 J;  2CS3 A;  1QZZ A;  2YX7 A;  3DPU A;  1YRN A;  4KDP A;  4CCN A;  1HF2 A;  3CCJ I;  2EFN A;  4P5O A;  4C3H J;  2QDX A;  3JUR A;  2CRG A;  3F22 A;  1ULY A;  3WU2 C;  2PMH A;  3PNT A;  4B1R A;  2K40 A;  2VKE A;  3HOT A;  4OOS A;  5M5Y J;  3H3U A;  3VSK A;  4Q5S F;  4XOT A;  1PKV A;  2L7M P;  3Q6R A;  3ZUG A;  4M74 A;  3OW2 B;  1IDK A;  2HR3 A;  3K10 A;  4IXA A;  1T6Z A;  5A2Q Z;  4LK1 F;  1XGS A;  2DT7 B;  2NST A;  2STT A;  4YZX A;  2E2I J;  3A0B C;  3P9C A;  4YFN F;  4X05 A;  3LMW A;  4A6E A;  4D5C A;  1ACI A;  4X06 A;  5H59 A;  3BCA A;  3RKW A;  4LIU A;  4C9Y A;  1YQA A;  5HKK A;  1XE1 A;  3R0A A;  2QEX I;  3EQO A;  3TO6 A;  4DW6 A;  2XZO A;  5GAH J;  1FIP A;  2HCJ B;  1SC7 A;  2JA7 J;  1SAN A;  2DOA A;  1CF7 A;  3VO1 A;  3WTT C;  2HWV A;  1VQ8 B;  1Q86 D;  5HOO A;  2XAS A;  3U9G A;  3TW6 A;  2VFN A;  3KLO A;  3L2U A;  1LE8 A;  1GVD A;  1WJB A;  3QYE A;  2RNG A;  3PET A;  2I10 A;  3A03 A;  2V7V A;  4E7L A;  5IOZ A;  5LHG A;  4N3N A;  5FD6 A;  5F0F A;  1A35 A;  3BLY A;  2JWT A;  4YFK F;  5J3O A;  3JRH A;  3CO7 C;  1R22 A;  1HBX G;  4M53 A;  3MKL A;  1H88 C;  4IHT A;  1FIA A;  4Y7C A;  3DTK A;  2DCU A;  4X1E A;  1G3T A;  1RU4 A;  4JYK A;  3FK7 A;  3R61 A;  4DNR B;  2XPV A;  1JA0 A;  1Y0R A;  2IS6 A;  4RD1 A;  1R6R A;  2CQQ A;  3AST A;  3KEW A;  1X19 A;  2J8I A;  2BV3 A;  5LLQ A;  1QVU A;  3ZZT A;  2ADU A;  4BJ6 C;  9ANT A;  3TO9 A;  3LYC A;  2Z5U A;  2C5B A;  1XC5 A;  4E7I A;  1ZGW A;  5FRM A;  1BL0 A;  4F91 B;  1IUF A;  4LB5 A;  2PQ8 A;  2QMU A;  3ZPP A;  4PC6 A;  3W2I A;  1MKM A;  1WI9 A;  4TMX A;  3CC2 B;  3ML3 A;  2FQ3 A;  1VQP I;  2EIM H;  2V1X A;  1GXQ A;  2F5F A;  2ZNZ A;  4PC7 A;  1YG2 A;  4DQK A;  2M34 A;  3BJO A;  2ZCW A;  2DTZ A;  4W1U A;  3ISP A;  3EET A;  5F0H A;  1T39 A;  3DWL E;  1WPK A;  4XLP F;  1TLL A;  2ME6 A;  1JI8 A;  1GLN A;  1XDS A;  1X58 A;  1Z77 A;  2QCO A;  2D45 A;  2XOK A;  1O8F A;  2BY3 A;  1IA5 A;  2ELH A;  2P7V B;  3A4C A;  1N78 A;  3ABM H;  6PAX A;  3H1C A;  1A6I A;  2ZXJ A;  2BBY A;  2QQ9 A;  1O8E A;  2VIX A;  1WXR A;  4H9G A;  5K5O A;  3UW0 A;  3H5A A;  4MLO A;  3OAA A;  2K5C A;  1ZRD A;  2CV2 A;  4OAZ A;  4HST A;  3KX2 A;  1RET A;  2FML A;  4A3L J;  3I9V 2;  1TWH J;  2O61 A;  1TWF J;  2E7X A;  3M7G A;  3PSF A;  3SJM A;  1O88 A;  3I4N J;  1WWX A;  1E1R A;  2HKX A;  3ERE D;  2JA6 J;  4M3B A;  4XD7 A;  3JRD A;  3T51 B;  2C4U A;  1F43 A;  2NV4 A;  1Z1D A;  2OA4 A;  3ZQL A;  4AVP A;  1MSF C;  3JQQ A;  5KK1 A;  4LOC A;  5FLM J;  2XUB A;  3GFJ A;  2FOW A;  1AKH B;  3GTL J;  5J6X A;  4Z03 A;  4LGW A;  2WA0 A;  1U3E M;  1QQ1 A;  1DG1 G;  4RLF A;  4FIS A;  2F4I A;  4B8X A;  4L8J A;  1WH5 A;  1I6H J;  4URR A;  1HW5 A;  4XSX F;  4RGR A;  3JTH A;  5CVJ A;  1SAX A;  4CHU A;  4RCY A;  3D5R C;  4RPB A;  4PJ0 C;  4ENK A;  1A8P A;  2OZ6 A;  1KK2 A;  1P6R A;  2OCC H;  1BN8 A;  3U21 A;  2KIU A;  3N6Z A;  4BYY A;  3MWM A;  4UV9 A;  1JGG A;  2A3S A;  4PGO A;  1JT6 A;  4AM3 A;  3RPQ A;  2YSR A;  1LDD A;  1XMK A;  5DEQ A;  5H5J A;  5B3S H;  3VR6 A;  1DGW Y;  3PUB A;  5K7F A;  5LGU A;  1P4M A;  3OYA A;  3BY2 A;  3DKW A;  4FAS D;  4ZYD A;  1D2E A;  4TKO B;  3H3V K;  2CW5 A;  3QSY A;  2F2E A;  2ZBK A;  2Q2E A;  4B4C A;  4CCO A;  3OOU A;  4DK1 A;  4O6J A;  2BM4 A;  1TUI A;  2B7C A;  1R9T J;  4P22 A;  5HNF A;  3WTU C;  1NG6 A;  3TO7 A;  1ZN2 A;  3BC9 A;  3QPH A;  3KP3 A;  3AVX A;  1Z21 A;  4U88 A;  5FGM A;  3GBG A;  3ZP5 A;  1FYM A;  4CIC A;  4G7O F;  1PE9 A;  3F6V A;  2MGQ A;  1N05 A;  4M4S A;  4ZYA A;  4F3Q A;  1D8T A;  1EXM A;  4QPO A;  3IAS 2;  1QUE A;  3HBL A;  1G2H A;  4Y52 J;  4E70 A;  3BPX A;  2D9R A;  1S8N A;  1TWA J;  1VQ9 B;  4QVA A;  1XDU A;  4P25 A;  4M9S A;  2DDA A;  1W0K A;  4YAW A;  1TNS A;  1YIO A;  4D9J A;  4EM2 A;  3S93 A;  3SZE A;  3V42 A;  1Y8Q B;  3O8H A;  1BI2 A;  2E36 A;  2B7E A;  4LLN A;  4MYU A;  1XSD A;  4A3J J;  3MMY B;  3R0J A;  3DBL B;  2R6H A;  1YOV B;  3ZC3 A;  4LG0 B;  3ECH A;  2M5S A;  2EIL H;  2W84 A;  1ODD A;  4P12 A;  4ZV4 A;  4MTD A;  2OD5 A;  5ICF A;  3N97 A;  4A3E J;  4HX8 A;  1U6G A;  2L0K A;  3L2Q A;  3S3N A;  1VQ7 B;  4P6V F;  3KE2 A;  2J5P A;  4ANJ A;  1GQ8 A;  4A69 C;  2OK7 A;  3TOB A;  1B1B A;  3F21 A;  1JTX A;  3V7S A;  5D6E A;  1BLI A;  1VND A;  5GPC A;  2JN9 A;  5IYC J;  4N9H A;  3OJW A;  4MFD A;  1VQM I;  3FMR A;  3GLL A;  4I0B A;  1Y56 A;  3WTW C;  4BXX J;  2NVY J;  1XN7 A;  5L3B A;  5FFX A;  1RNL A;  4M3G A;  5F04 A;  1ZR4 A;  3WHC A;  4LBY A;  2MBF A;  2JRT A;  4HW0 A;  4I76 A;  1YJN B;  2A6T A;  3ISX A;  2HU9 A;  3ABU A;  3FXU A;  3FMS A;  1Z3Y A;  3U1K A;  1VHO A;  2VBV A;  4P3Y A;  1BMF A;  4ZZL A;  3BH7 B;  3VMV A;  2E60 A;  2HS5 A;  4IF4 A;  5AON A;  4Z4R A;  2GM4 A;  2COB A;  2O0W A;  3CPX A;  2IGO A;  1T56 A;  3KIO A;  2HDW A;  1YX2 A;  1XMX A;  4E7H A;  1IB4 A;  1R1T A;  3VYR B;  1BM9 A;  1GVJ A;  1WJF A;  1QA2 A;  1O8M A;  2Z1D A;  1SKY B;  2PYG A;  2ZFW A;  2W85 A;  2EV6 A;  2HTS A;  2MLK A;  3JX8 A;  4QTR A;  2M7B A;  2HYG D;  3ECO A;  2HEO A;  2VXD A;  4P96 A;  5IY5 H;  2YS9 A;  5CVR A;  3KYL A;  1X1P A;  2PI0 A;  4MEX F;  1OCO H;  4N4O B;  2DFH A;  2VC1 A;  2CFO A;  1H8E A;  2QUF A;  3K4C A;  3CW2 A;  3HUG A;  4MR0 A;  2HGC A;  1W36 D;  1Y8R B;  1UMK A;  1VQL B;  2NS7 A;  4KNY A;  2JA2 A;  3H9N A;  2R9V A;  3AG4 H;  3TP0 A;  4A3F J;  2AS5 F;  2LH9 A;  4AU7 A;  2O8K A;  2X6W A;  1NB0 A;  2R7X A;  3RKY A;  2YWG A;  1Q82 D;  4MNU A;  2NPF A;  3HRU A;  2PJR B;  2DOG A;  4MXN A;  5J47 A;  1YI2 I;  2YU3 A;  2DLL A;  3VPR A;  4YHB A;  3WQZ A;  2ID3 A;  3ZBT A;  2JT1 A;  3JRF A;  5B66 C;  4IO9 F;  1BHE A;  3KZY A;  4A3G J;  1FX0 A;  1F9N A;  4KIF A;  5JI6 A;  4Y17 A;  4DIQ A;  1CLW A;  1QFZ A;  1WU8 A;  2JJ7 A;  3LST A;  2VBU A;  5F1R A;  2L4M A;  3CCQ I;  1LPQ A;  2GA1 A;  4LMY A;  3WTZ A;  1B9M A;  1N0U A;  5L46 A;  1NTC A;  1SFK A;  3ZMT A;  5AIP A;  1O3Q A;  4YAF A;  1QPM A;  3DF8 A;  1WHU A;  1PJR A;  3NWS A;  1P7I A;  3OYI A;  3AGP A;  2JRM A;  1UMQ A;  2GA2 A;  1WJC A;  3NEU A;  1B4A A;  1O8J A;  1WJ5 A;  2COM A;  1E63 A;  4OZY A;  2P8T A;  2JVG A;  2INV A;  1AKH A;  1BIA A;  3E20 A;  4AIH A;  3VWB A;  3MVP A;  2V26 A;  2Z16 A;  2XTX A;  3FKS A;  2IA0 A;  4X7F A;  1QGP A;  3CF2 A;  5EEG A;  2BGC A;  4YZ0 A;  2DOF A;  5LBQ A;  1XQB A;  2DQR A;  1MJB A;  5GTI C;  2CW0 F;  1P2F A;  3TBI A;  4ZH4 F;  4UB8 C;  2UUZ A;  3AVV A;  1W35 A;  3NWT A;  3AVU A;  1JKR C;  2O3F A;  1WQ2 A;  1STZ A;  1FP2 A;  2R3S A;  3HSR A;  1DDG A;  1K79 A;  1EH8 A;  4OIR F;  5FNZ A;  3UR3 C;  4PC1 A;  2UVF A;  4FN5 A;  2RAE A;  2WV0 A;  3WU1 B;  3ZZU A;  3LQQ A;  2V1N A;  5DCM B;  1DDN A;  4DQL A;  1S6L A;  1QZE A;  1WCM J;  2EA4 A;  1NDH A;  1FC3 A;  2E5N A;  4UUS B;  4LBV A;  4YFX F;  1FJL A;  2I5U A;  4XN0 A;  3HB9 A;  4A3K J;  1FYK A;  1LNW A;  5CQE A;  4CQJ A;  3W5V A;  4DZJ A;  3CJN A;  2BPO A;  4DYR A;  4XLE A;  4WZK A;  2CND A;  2AQE A;  2F43 A;  5EGO A;  3H9Q A;  5DM6 F;  4GGG A;  4HEA 2;  2KFD A;  1J0R A;  1M1E B;  4ZCL A;  2VBM A;  4RJL A;  1Q1V A;  4ESF A;  4B48 A;  1ETW A;  2E1C A;  3HZJ A;  4G7Z F;  2ISZ A;  2WZN A;  3FHN A;  4OP7 A;  2YUH A;  1DQU A;  3DBR B;  3PVD A;  1QPI A;  3F0C A;  3ZQF A;  1CNE A;  3FMQ A;  1Q1H A;  3V4G A;  3A2K A;  1W0J A;  3VNV A;  1U8B A;  4RM2 A;  3N90 A;  2B7B A;  4KIS A;  5J8C A;  2Y31 A;  1VQ8 I;  4LG0 A;  1Z6T A;  3QPS A;  2HNH A;  3HOZ J;  1P4X A;  2WB1 N;  3CTA A;  4XOP A;  1AMO A;  3OEH A;  1JUP A;  2W48 A;  1HZE A;  2VBX A;  1HVX A;  3AVY A;  3OYG A;  3DU5 A;  3PEN A;  1KQS B;  2WAE A;  3WGI A;  4TV7 A;  2HVR A;  1JUM A;  2FBK A;  1VQO I;  2E1M B;  1IN8 A;  4EMS A;  2D1H A;  1A6Q A;  4GCV A;  2BY2 A;  3S15 J;  3HOW J;  3M8J A;  1OB2 A;  1VQ5 B;  1G8X A;  1D1A A;  2BVM A;  4BE0 A;  4QLC U;  2NXN B;  1DU0 A;  4NC8 A;  1H85 A;  1OB5 A;  2H27 A;  3SLD A;  4JMQ A;  3OYM A;  2HFH A;  1WTH D;  3BDD A;  2VFQ A;  5HVQ C;  3LNQ A;  2PLF A;  1G7C A;  3VSL A;  1E43 A;  3BZC A;  3QFC A;  2BXY A;  2PJP A;  1BJK A;  3O3K A;  4II3 A;  1QA6 A;  5F4O A;  5B6I A;  3K6G A;  2YR2 A;  2H09 A;  3Q5F A;  1KZH A;  1LFB A;  1F4K A;  2ETH A;  2D74 A;  1OYY A;  2JK3 A;  2OYN A;  1Q9S A;  5F08 A;  4P26 A;  4R71 A;  2BX6 A;  1ZG1 A;  3CC2 I;  1ETQ A;  1QX4 A;  3HTS B;  3QOP A;  4JX5 A;  3A3B A;  1MNE A;  1X1A A;  5ILU A;  3GFI A;  3UKG A;  4CYC B;  3GQ8 A;  2G0E A;  3W5U A;  4G12 A;  3WBK A;  2XT2 A;  4BDY A;  3E6C C;  4FHT A;  2CQN A;  4BPR A;  2CGP A;  1TSP A;  2VQL A;  5J40 A;  1EFU A;  2R7Q A;  1G7S A;  1OLT A;  2IGM A;  2ZB9 A;  1PDN C;  1ZM3 A;  3E6B A;  2QTL A;  5LRS A;  3K2A A;  3RDI A;  4XID A;  2V79 A;  3ZXS A;  3FXQ A;  2Z3Y A;  4M2L A;  3NAU A;  4OU0 A;  5C44 J;  2A07 F;  2O0Y A;  4ZDO A;  3IH2 A;  3FF5 A;  1YJ9 B;  3FZV A;  2EIJ H;  2GOM A;  4Y9R A;  1XB4 A;  2PFB A;  1MNM C;  2PJR A;  3QRF F;  1MSE C;  3KYC B;  1HW1 A;  3J7Z I;  2BYV E;  1BX0 A;  1DBO A;  2A5W A;  5D5W B;  3HGY A;  3SZG A;  1FLI A;  4HF2 A;  2X53 S;  3JRB A;  3S2H J;  2GWR A;  2BMW A;  4XNF A;  2QX3 A;  3OS1 A;  3QFT A;  3H3Z A;  4L9V A;  4MYT A;  3G2B A;  2IA2 A;  2XF7 A;  3BRO A;  2FF4 A;  3S1M J;  3RY8 A;  1YO5 C;  1YJW B;  5IP9 J;  2JN6 A;  1OR7 A;  1WPC A;  1CGP A;  2VJ4 A;  4F7Z A;  4YZA A;  4A3D J;  5KW9 A;  1EKE A;  1JHF A;  3BG6 A;  3SDG A;  4F7D A;  2Z2S B;  2B0R A;  2X4H A;  3DU6 A;  3LOC A;  5BMZ A;  2VBY A;  3GTP J;  4UV8 A;  2LG4 A;  4U9U A;  1WMR A;  2VBW A;  2DXI A;  3BH4 A;  4HOB A;  4HZF A;  3ZOB A;  3ZSC A;  1BC8 C;  3WTX C;  4HRI A;  3C2G A;  3V8L A;  3Q0U A;  5DM7 F;  3W3C A;  1LEA A;  2DPU A;  4UZE A;  1OR7 C;  3RZD J;  2BXZ A;  2HZD A;  2NS0 A;  4NB5 A;  2GXA A;  1F20 A;  1EA0 A;  2VQC A;  3H0D A;  1XG1 A;  2MG4 A;  2QSH X;  4G6Q A;  2V7T A;  2V31 A;  4HLX A;  2KIS A;  3OW7 A;  2DMT A;  3BWG A;  4UVC A;  1O8L A;  1PVE A;  1H42 A;  4FWT A;  3G05 A;  2L54 A;  3FIW A;  2LC2 A;  2Q6O A;  3FX3 A;  4BXU A;  3ZMD A;  1WKM A;  2LTP A;  1BI3 A;  3DTI A;  4BY1 J;  4XIC A;  1VQ9 I;  5DCM A;  3GVL A;  2Z33 A;  4HBL A;  3LSH A;  5JHU A;  2QGG A;  4BAY A;  3IH4 A;  3CDH A;  1UST A;  3JCU C;  5D4R A;  1WH7 A;  2R0Q C;  1E79 A;  2H94 A;  3WGG A;  1NRK A;  4UUV A;  4B3F X;  2VNK A;  3C18 A;  5B1B H;  1FOK A;  2ECC A;  1F60 A;  2F5C A;  1I18 A;  5H6Q A;  4NBQ A;  3C2B A;  3DEU A;  2MAB A;  3G1L A;  2J5O A;  3QP5 A;  5H6R A;  1SVL A;  1WJA A;  3AGQ A;  1VQ7 I;  3ASS A;  3CB4 A;  4B3G A;  3FWE A;  3SKB A;  4B47 A;  3ONQ A;  2KIQ A;  3BTJ A;  2GLO A;  1KTW A;  3K2Z A;  3WWG A;  3OYD A;  2LFB A;  3FIS A;  3BPV A;  2EZH A;  2Q6K A;  3JRC A;  3Q38 A;  1Y1W J;  4A93 J;  2C5H A;  2EZL A;  2FOK A;  1FEX A;  3HYI A;  2XGD A;  3C7J A;  3KEQ A;  1KQ8 A;  4LBZ A;  2OPT A;  4M3E A;  2DFI A;  3WE2 A;  1AHD P;  3CPW B;  5AIQ A;  2BV6 A;  3SYT A;  2P3M A;  3GFM A;  1R1V A;  3OYB A;  1TC3 C;  1YJN I;  1IRF A;  4IHX A;  3CJQ B;  3ZPN A;  4FQG A;  4PDK A;  2ESN A;  2UZK A;  1KQ0 A;  4C3I J;  4E6K G;  4O3M A;  2IPQ X;  4C3J J;  3OS0 A;  2X51 A;  2JA8 J;  3HOU J;  2DK8 A;  3M8E A;  2QXZ A;  3HAG A;  2NNY A;  2AXT C;  2YU9 J;  4X0G A;  2CW8 A;  3EDP A;  3J7A Y;  1K4Z A;  4C2T A;  1JGS A;  1IJW C;  2L9N A;  1BIB A;  2HQN A;  4OIN F;  4NBS A;  3G4S B;  3HGG A;  4Z06 A;  3R4K A;  4YIR X;  5EZH A;  2NT9 A;  1Z7L A;  2M9H A;  4DNT B;  1OCC H;  4ZTF A;  3LSG A;  2IS1 A;  3KYD B;  1NJI D;  3LAJ A;  3H94 A;  2ZBV A;  3OS2 A;  2NTB A;  2XTW A;  4NUB A;  1ZHF A;  3W2V A;  3T1B A;  1QFY A;  3OSG A;  2ZTG A;  1Z7U A;  4L5I A;  4PFO A;  4ZYG A;  4M73 A;  1LLW A;  2MC3 A;  3KEO A;  2CFX A;  2NVQ J;  3NAR A;  1K78 B;  4GO1 A;  1G3Y A;  5GPA A;  2QE7 A;  1UD4 A;  3CLQ A;  1YX3 A;  2DMN A;  2I1L A;  1R71 A;  3TDZ C;  3A01 B;  1WJE A;  2QYO A;  2HVQ A;  3GWZ A;  4I02 A;  2DFE A;  4BQN A;  1R00 A;  1W87 A;  4RM0 A;  5EG0 A;  1WRJ A;  1TBX A;  3BJA A;  2OJE D;  4A3M J;  4XRM A;  1EP2 B;  2X1E A;  5CJ9 A;  2JDI A;  3MFK A;  3ZQH A;  3PFI A;  1U5T B;  1D0Y A;  3F8B A;  3OJX A;  2OTJ B;  4LD5 A;  5EJC A;  4EJW A;  5K7Z A;  1L3L A;  1E3X A;  4FK8 A;  3K1N A;  1ON1 A;  3A8I A;  1S4M A;  2DYS H;  4OPS A;  1ZH5 A;  5CQG A;  4HNU A;  3CME B;  4NDL A;  2XB0 X;  1HOM A;  3Q0V A;  5D8K B;  4YEI A;  3W6V A;  1KD1 D;  3GTG J;  1ZR2 A;  1ITY A;  2OBS A;  3SJZ A;  5GP9 A;  3SY2 A;  1O3R A;  2DMU A;  1S7O A;  1YS7 A;  4I98 B;  4YFO A;  4YEJ A;  2A61 A;  1QRB A;  4BU2 A;  3CMA I;  3CUQ B;  4LLG F;  5FO5 A;  3CJT B;  1XPX A;  4A6D A;  4U7D A;  1YS6 A;  4F93 B;  3MEX A;  1IN4 A;  3G3Z A;  5A2Q K;  4EJO A;  2CQX A;  3JQR A;  3RKX A;  3A8J A;  1FT9 A;  1FBS A;  1T95 A;  5CYV A;  4L5E A;  1S29 A;  1TP4 A;  3FM3 A;  2HPM A;  2FVG A;  2RC6 A;  4NK6 A;  3A02 A;  4BJT A;  3F8C A;  3T9G A;  3WYA A;  1TWC J;  2KLO A;  2QBY A;  3GTO J;  5F6F A;  1K28 D;  4TMV A;  4OJ5 A;  1H8A C;  1ZKG A;  5TJJ A;  3IC7 A;  1IV8 A;  2LR8 A;  2HDN B;  4C2L A;  3BR1 A;  2QZ8 A;  1JJ6 C;  1I27 A;  2M45 A;  4BDZ A;  4QHY A;  3S2W A;  2RC5 A;  1KCC A;  3KP2 A;  3H5R A;  4XM3 A;  4G1B A;  2CU7 A;  2XAH A;  3RIR A;  2KL4 A;  3LL7 A;  3AFH A;  3L1P A;  1RUO A;  1IDZ A;  3OL4 A;  3ONY A;  4IZZ A;  1X1B A;  2VXZ A;  4HDV A;  2BHY A;  3P9I A;  3CCR B;  4KH3 A;  3HRT A;  4G9Y A;  4E7K A;  3LQ6 A;  3VFZ A;  3SUC A;  3GW2 A;  1K6Y A;  4C30 A;  2H6C A;  4BQO A;  3JRE A;  4IVN A;  4P6Y A;  3IRQ A;  3G6E B;  4M6X A;  3VST A;  1Q7Y D;  3NRV A;  4P9F A;  1J59 A;  1FSH A;  3WG9 A;  2RV8 A;  3BR6 A;  2Q8K A;  3H9J A;  3RQI A;  1MBK A;  2VBK A;  3PNV A;  2L01 A;  4RDK A;  3DFG A;  2ZME A;  2XEX A;  3PA2 A;  3GYH X;  2KRF A;  5E8I A;  3I59 B;  4X7C A;  1NHC A;  2XGJ A;  1R58 A;  2FNA A;  1O7L A;  3LWF A;  3LSM A;  3MD2 A;  3ELK A;  5GV8 A;  2V7Q A;  2RC4 A;  2C78 A;  1VQ6 B;  2LKP A;  2B0L A;  3F8N A;  1VQ5 I;  2QQA A;  3H36 A;  3COA C;  2DO7 A;  4N9I A;  3OYH A;  1K6O A;  3PO3 J;  1J9I A;  3BY1 A;  1OCP A;  5J1Y A;  3RPU A;  4KT5 C;  2D1V A;  3B82 A;  5EMN A;  1Z3X A;  2M8G X;  3IKV A;  3KP5 A;  1X2N A;  2ZME C;  4CUG A;  2DU9 A;  1FY7 A;  3S1R J;  1XS9 A;  4B44 A;  4ASN A;  2R7Z J;  1QVF B;  2F1L A;  2AQF A;  3IP4 B;  4HA8 A;  2GJP A;  3GTJ J;  4RPD A;  2LLK A;  2K7L A;  1RC9 A;  2L2O A;  4PMH A;  4PJN A;  4I6Z A;  3A3G A;  3P27 A;  2Y69 H;  2Q6I A;  1RPW A;  1TQP A;  3LSK A;  3K7A J;  1KTV A;  4KIG A;  2KJB A;  5TIS C;  4YAO A;  1DUX C;  4NQW A;  2W7Z A;  1ON2 A;  2VOD A;  2VBZ A;  1D0Z A;  4OMY A;  3JRA A;  2K9L A;  3I55 B;  2J8K A;  5BPI A;  4S0H B;  2OQG A;  1KC8 D;  3GRH A;  2XPU A;  1B9N A;  3CZ6 A;  4E7S A;  5E17 F;  3V7C A;  1S0U A;  2XZP A;  2EWE A;  2TDX A;  5CLS A;  4Z05 A;  2CWE A;  1K78 A;  1Y0Y A;  2D3N A;  2ZJR F;  3ZMZ A;  5E20 A;  2Q0O A;  4NK8 A;  5L3F A;  3IV5 A;  3ASN H;  3CQZ J;  5CVU A;  3LA7 A;  3GLX A;  3LSP A;  1P9Q C;  3E1Y E;  5GTH C;  1YJ9 I;  2OF7 A;  2Y30 A;  3BG9 A;  3BG7 A;  3A01 A;  1D5V A;  4AVZ A;  4E0F A;  4CCK A;  1XGM A;  3OYN A;  5ERI A;  4IRI A;  2OU2 A;  3L2C A;  4W8S A;  2OQR A;  4A3C J;  3OZV A;  1TWG J;  3VMF A;  3CDI A;  3E0J B;  5J8F A;  3MKY B;  1OFM A;  3L09 A;  1K4T A;  2ICW G;  4CZC A;  4X7E A;  2GBY A;  3WTS C;  2HLD A;  1IW7 F;  3L00 A;  1N07 A;  1BPL A;  1N25 A;  3WE3 A;  3HG9 A;  1YJW I;  1G7R A;  4F52 A;  1W5C C;  4XK4 A;  5FKL A;  2IW5 A;  4IHV A;  1MMA A;  3M8F A;  3WND A;  4IQ4 A;  1DPU A;  4PZJ A;  2UWM A;  1TVC A;  1JJ2 B;  1XG2 A;  1KQ5 A;  5FL7 A;  3B6C A;  5JLW A;  5CKT A;  4J00 A;  3PA1 A;  2XB5 A;  4X8I A;  4BKX A;  3TOA A;  2FBH A;  3AK5 A;  1K83 J;  3OWT A;  3SQV A;  1RQP A;  1UHW A;  5LMZ A;  4TSF A;  3OPO A;  2DIE A;  3IL2 A;  1EWY A;  1FX7 A;  5A8A A;  2JQ7 A;  1KQ9 A;  2ISY A;  4ZCI A;  1TW2 A;  4KKU A;  2LY2 A;  4V19 K;  2QQ8 A;  4Z4Z A;  3JAM Z;  3L9F A;  3F3X A;  3VOE A;  1W1W E;  4XLH A;  3RZO J;  1P4W A;  4UZF A;  1YHQ B;  1SD5 A;  2VQG A;  2E71 A;  3K4K A;  4FXU A;  4BS9 A;  2GQF A;  1OYW A;  4OZZ A;  1WI3 A;  4CXF A;  5LHI A;  2BM5 A;  1HKS A;  3I4P A;  3OYK A;  4CDG A;  4LIV A;  2EV5 A;  5F1J A;  1ZM4 A;  5AN9 A;  2FRH A;  4GYG A;  3OIO A;  1XB2 A;  3QOE A;  4Y13 A;  4TMW A;  1UD2 A;  1BW6 A;  2R7F A;  2CUZ A;  1BOA A;  3EUK L;  2ZJP F;  2TCT A;  4EGY A;  3M4O J;  2W57 A;  3NAW A;  2M0M A;  5FRO A;  2JJ1 A;  1P92 A;  4K2E A;  2DA4 A;  4MIM A;  5IYP A;  1LKX A;  4KFC A;  2C77 A;  2XSD C;  4LIT A;  2HKO A;  1NG7 A;  1TLH B;  2LF7 A;  3TW7 A;  1MJ9 A;  5IPA A;  4BAC A;  1UAA A;  3P4G A;  4YC5 A;  1VQK B;  4AIJ A;  3W5H A;  4P1V A;  2CQK A;  4FX4 A;  1FOX A;  4Z4W A;  1ETV A;  2CMP A;  2KPM A;  1SMT A;  2VT3 A;  4GYI A;  4HV5 A;  4B3A A;  1U78 A;  1SEU A;  2XV4 S;  1VQN B;  1UD8 A;  2ID6 A;  2KRH A;  2DY1 A;  4TMT A;  2F48 A;  4ITV A;  5LGT A;  5E1W A;  2LY1 A;  4G7W A;  1KYW A;  1S72 B;  1V0E A;  1KK0 A;  4Z4S A;  2FUG 2;  2VAS A;  1FBQ A;  2QWW A;  3GFL A;  1GUU A;  2V6E A;  3ASQ A;  3CCU I;  3QPL A;  4W97 A;  3CJR B;  2ODL A;  3T5X A;  2XZL A;  5KNL A;  3I59 A;  1QO0 D;  1FNC A;  2JSC A;  1ZGA A;  5EZG A;  5BOX A;  3CCM B;  1I39 A;  3BC8 A;  2LVS A;  3PUF A;  4KYW A;  5ICG A;  2QLZ A;  3QYB A;  1QHG A;  3HRM A;  3PFY A;  3E6M A;  3ERM A;  3PSI A;  3CF5 F;  2X85 A;  2P5V A;  1R4M B;  1W4M A;  1Z9C A;  1U2R A;  3T53 B;  4BHC A;  2Q6L A;  4PSW A;  1VF9 A;  2L5Q A;  1W7P B;  2WTE A;  3G4S I;  1KK1 A;  2ZSI B;  4XL9 A;  2K3P A;  4KA4 A;  1FYL A;  4I2O A;  3K4J A;  4Y33 A;  1UD5 A;  4GXO A;  2FD5 A;  1YE9 A;  3WTV C;  2K9N A;  1K9M D;  2G7U A;  1KCD A;  1ZM9 A;  2KDO A;  2OAZ A;  3HTU A;  1B8I B;  3E97 A;  1APL C;  2W1O A;  4Z4U A;  2LY9 A;  4FX0 A;  4LK0 F;  1GHC A;  4QV2 A;  5A89 A;  4X07 A;  1OKR A;  5HOD A;  1K8F A;  1HKQ A;  3U2Q A;  2XSJ C;  2QSG X;  2OC6 A;  3LFU A;  5F27 A;  5BSY A;  4LB6 B;  3QP6 A;  5IYB J;  4D0P A;  1H8H A;  2VOO A;  1SVM A;  4I0A A;  2VFP A;  2X6O A;  3ZMS A;  1GAQ A;  3MHP A;  5FFZ A;  1UHS A;  1R7J A;  5E18 F;  4YEL A;  2R5Y B;  5L3E A;  2VN2 A;  2R92 J;  2HQR A;  3BCD A;  5FLV A;  2H8R A;  2PEX A;  4I7H A;  3SLN A;  4F92 B;  2OTJ I;  2NZM A;  2TRT A;  5TY0 A;  4Q7J B;  3O8G A;  3AG2 H;  3MMP A;  2EPF A;  2QGU A;  1DAB A;  2CO5 A;  5C3E J;  4Y15 A;  1O8I A;  5C1E A;  1U0J A;  1BJA A;  5FLX K;  1OPC A;  1A5J A;  1SFE A;  3ZN1 A;  1TT5 B;  3FXJ A;  1WOR A;  3QQA A;  1U8R A;  2RVC A;  3AG3 H;  1DU6 A;  1AA7 A;  3ZQG A;  3WXM A;  1ZLJ A;  2FNP A;  4L0Z B;  2R7S A;  2EIN H;  4NNJ A;  2X8K A;  2ZL5 A;  5HDK A;  1YIT B;  2HYF A;  3E7L A;  4CYD A;  4WX9 A;  4RD3 A;  4ETS A;  4KIB A;  4CO8 A;  2OK8 A;  4YXW A;  2G7H A;  3TH0 A;  1AOY A;  5K7H A;  2LD5 A;  1H89 C;  3W2A A;  1OCR H;  2W82 A;  2KHM A;  3BG3 A;  3ES9 A;  5HLH A;  2JVH A;  2V7F A;  1E3O C;  4UUT A;  4OPW A;  3QAH A;  3M1E A;  2K27 A;  5D6F A;  2NAZ A;  3GVA A;  5K1Y A;  1R5H A;  4L9N A;  3SHF A;  4OJO A;  2VE8 A;  1U9O A;  2EFO A;  3O6B B;  4HAM A;  3EQL F;  3KP6 A;  5FLX Z;  3MZH A;  5KAI C;  4B4D A;  2NYX A;  3ML6 A;  1RMG A;  2I8D A;  3ZZ0 A;  5IK2 A;  4AUX A;  1ZRF A;  2OTL B;  5DSZ A;  1W5S A;  2VPR A;  1C0W A;  2BM1 A;  5FA6 A;  1HKT A;  5DTD A;  2MYS A;  4J01 A;  1O4X A;  2R4G A;  3OMY A;  1LUJ B;  2VFM A;  2R93 J;  3CCR I;  1O3T A;  1HXD A;  4LJZ F;  3ASR A;  1UEL B;  5JBQ A;  2EA2 A;  1KU9 A;  4MO7 A;  5D5X B;  2BN4 A;  3GIR A;  5ICE A;  1G4D A;  3DLL F;  2NS8 A;  2VJJ A;  4BH9 A;  1FWZ A;  3BTL A;  2YWE A;  2P5K A;  3G6E I;  2EFP A;  2A5Y B;  3I71 A;  1KA8 A;  1E62 A;  1EH7 A;  4EQQ A;  2PG4 A;  5KVR A;  1JB9 A;  1M90 D;  4WWV A;  2VL8 A;  3LFK A;  2E1R A;  2M4K A;  2ELJ A;  5H20 A;  3DLA A;  5E3N A;  1MH4 A;  3BG5 A;  3SFI A;  3FBI B;  4RB1 A;  2A68 F;  1FNN A;  5ILS A;  3DEW A;  1SD4 A;  2EQR A;  2DI3 A;  3HRS A;  1EJ9 A;  4M71 A;  1ETK A;  1WOS A;  2F5V A;  2VUM J;  3G1M A;  3K4B A;  1VQ6 I;  2IJL A;  3U1D A;  1NK3 P;  2HMA A;  1IXS B;  4H4K C;  4EAT A;  2CW7 A;  2B9S A;  3CCE B;  1VQ4 B;  2F4N A;  3CC4 B;  2WJY A;  1LJ9 A;  1QVT A;  4U0W A;  4JRA C;  3LSR A;  3RI4 A;  2HOT A;  3CCL B;  2HI3 A;  2ZZE A;  3E1S A;  1Z67 A;  4Y4R A;  1RR8 C;  3UNG C;  3ASP A;  2LNB A;  3I56 B;  3RYR A;  1QUF A;  3A1P A;  1QG0 A;  2DAO A;  2KIF A;  4UXN A;  5IT3 A;  2X3H A;  3B90 A;  2R7U A;  4NC7 A;  2OBP A;  1OGI A;  4Z4T A;  2QEX B;  2H6B A;  2O1D A;  2XAF A;  1EV7 A;  3CRZ A;  1OGO X;  3FM5 A;  1S5L C;  1YW7 A;  2W4S A;  4XON A;  1W7P A;  5GAG J;  2RKH A;  3REO A;  4MTE A;  2C2W A;  5L3C A;  4Q4Z F;  1ZRC A;  2Z6B D;  2JTV A;  4XLC A;  3W2H A;  5IOY A;  3S3O A;  4BJ5 C;  3GQ7 A;  4CSW A;  3I55 I;  1FOW A;  4HNT A;  3LSJ A;  3OZW A;  2QZA A;  2M4G A;  5LFA A;  4S05 A;  5FD5 A;  3FXR A;  1EH6 A;  2UXX A;  3ZQC A;  2X9D A;  3H9G A;  2ELK A;  3PIP F;  1IRZ A;  1TTT A;  1V4R A;  2V1D A;  1QU3 A;  1D8J A;  1T38 A;  2BM7 A;  2EZI A;  1L0O C;  2M1B A;  3O2P E;  3QU3 A;  2D5V A;  4PUS A;  4XKC A;  3CP2 A;  2Q1Z B;  4XKB A;  2JSP A;  2VBT A;  4RDJ A;  4XBF A;  5M3M J;  3VYT B;  1GAW A;  2R7W A;  1UG2 A;  2DMQ A;  1HLV A;  3B78 A;  5F4M A;  5BS6 A;  3CD6 B;  3OZU A;  1TT0 A;  3ABT A;  3H35 A;  4D7M A;  2R5Y A;  3PJR A;  1OOC A;  4I99 C;  4W8R A;  1QQI A;  1V3F A;  4BBS J;  2R7T A;  4YIF A;  2QKL B;  4EEF G;  2CH0 A;  2F4M B;  1TZL A;  2K3F A;  2ZO4 A;  5C4J J;  1RI7 A;  2CC2 A;  2Y0S A;  1BR2 A;  4U0Y A;  4IHS A;  2DT5 A;  5IYN A;  1O8H A;  1N08 A;  4UHT A;  2VBE A;  1EA3 A;  2HXI A;  2J7K A;  3EYY A;  1KZL A;  2LK2 A;  2FA5 A;  3PQJ A;  2VKD A;  2FJ1 A;  1EE6 A;  4M6Y A;  4YII A;  1HW2 A;  1I3A A;  2W6J A;  1I3Q J;  3BQZ A;  3DKY A;  4WXC A;  1BA5 A;  2BM0 A;  2A69 F;  3KPH A;  4P9S A;  3ZR8 X;  4HF1 A;  1QA1 A;  2FMY A;  3HXL A;  4ZZD A;  5TRD A;  4FE4 A;  4EM1 A;  2AXL A;  4PJM A;  2XC7 A;  1X3Z B;  4JX4 A;  2R7O A;  3D0S A;  3HOY J;  1UD6 A;  1MBH A;  4ENM A;  2XIG A;  3BR2 A;  4DGW B;  5D5U B;  3MZY A;  1F5T A;  1EF4 A;  2QYU A;  2XNJ A;  4YZQ A;  3AG1 H;  1E17 A;  3PO2 J;  3QYF A;  1HA8 A;  4IEJ A;  1DPR A;  1BJZ A;  4WXH A;  3S3M A;  4QWQ A;  2GIV A;  4ESB A;  4EVI A;  1FTT A;  4YCQ A;  3HDD A;  2JA5 J;  5D5V B;  2ZNY A;  3OYC A;  4OIO F;  3CO6 C;  4WZE A;  3QFR A;  1IGN A;  1H80 A;  3KP4 A;  2NOJ B;  1VLY A;  2VJ5 A;  3DPT A;  4M6V A;  4RA2 A;  3B02 A;  4OOX A;  4X7D A;  3HL2 A;  1RWR A;  4HF0 A;  4ZYH A;  1REP C;  3BR3 A;  3G71 B;  4R8H A;  3DTE A;  4RBO A;  1GV5 A;  3GQB A;  3HIF A;  4QSH A;  4ROX A;  3OY9 A;  2XGX A;  3DU1 X;  2CQ7 A;  4IPA A;  4M9Z A;  4MEY F;  5FO0 A;  2BVN A;  5A88 A;  3IH3 A;  2NOG A;  5AMV A;  2MC4 A;  4JOM A;  4G7X A;  4J0Q A;  3KCC A;  1USS A;  4L18 B;  5GAE J;  2EZK A;  4G8X A;  5E79 C;  1V5V A;  1WVR A;  2VKH A;  1SFO J;  3I4M J;  3B8Y A;  1G3W A;  3BZ6 A;  1PXZ A;  4BUP A;  4UUS A;  2XRN A;  1IHM A;  3TQN A;  3BZK A;  4A2U A;  3MKW B;  1JE8 A;  3WOD F;  1O7F A;  1VQK I;  1FP1 D;  3F8M A;  4P1W A;  2L3D A;  2LBF B;  1WSV A;  1EP3 B;  2ESH A;  1WJD A;  2QVO A;  3OV8 A;  1VQN I;  2VOP A;  4AF6 A;  3S32 A;  3HHG A;  1S3J A;  1LVK A;  4BQQ A;  2IOU G;  1KU7 A;  2K9S A;  2HTJ A;  1SAU A;  2E34 A;  4CH7 A;  1E1Q A;  3GTQ J;  5J35 A;  2KKO A;  2HOA A;  1IN7 A;  4D7N A;  4ACA A;  2ZJ2 A;  1MMN A;  5IYW A;  4OM9 A;  1DGR M;  1D0X A;  5DCF A;  5GAD J;  1HDP A;  5C4X J;  3F9K A;  1V5E A;  3TKY A;  1FRN A;  3ZQI A;  5LD2 C;  1OMI A;  2BVL A;  3SZP A;  3CCM I;  1ZG5 A;  2AO9 A;  5IT9 K;  2L7K A;  1R4N B;  1XSV A;  3FXM A;  3KEY A;  3NE5 B;  3A1Y A;  3S1Q J;  3SQN A;  5D4S A;  1VF7 A;  4KIT B;  1VJS A;  4FTH A;  3R6S A;  1QJV A;  2K4B A;  1ZTR A;  5KHD A;  3GME A;  2STW A;  2VNI A;  1IF1 A;  1CF7 B;  4OIQ F;  1IAW A;  1F1Z A;  4UVB A;  1E3P A;  4LC0 A;  2R7R A;  3RSN A;  2VE9 A;  4N4N B;  3N05 A;  1DBG A;  3F23 A;  4ESJ A;  3DV8 A;  1HA3 A;  3IRR A;  1AIP A;  4TT3 A;  3CUO A;  3OP1 A;  2QM3 A;  4R79 A;  1CNF A;  5TV2 A;  3HJE A;  1WSU A;  4ZC3 A;  4AID A;  2O6G E;  1I8D A;  1B59 A;  3RCO A;  3FHZ A;  1PJ5 A;  3N4M A;  1OIS A;  3GTK J;  3S1N J;  2WY8 Q;  2X1D A;  1T2K A;  3CC7 B;  1T8I A;  3FJO A;  1V54 H;  3V8J A;  3C3W A;  1IB0 A;  2E1M C;  3DCF A;  1WSR A;  5HS7 A;  3LAP A;  1N06 A;  3ZRG A;  3HPG A;  2VNH A;  1E2X A;  3GUD A;  1VQL I;  3BT9 A;  5IT9 Z;  1CZF A;  5LHH A;  2VYQ A;  2QN6 A;  5FKM A;  2RQP A;  2HDD A;  3OKX A;  4FT8 A;  4L0Y B;  3VDX A;  4CYC A;  4PFP A;  2X48 A;  1X4P A;  2YWF A;  1IV6 A;  3PQK A;  1ONV A;  5HLI A;  3WY9 A;  4M72 A;  4YDT A;  3WGH A;  4RAY A;  1RIO H;  2UVE A;  2EFG A;  1KYZ A;  2Y9Z A;  1MBE A;  4UZU A;  3BY6 A;  2YPR A;  5HLT A;  1TYV A;  2DDB A;  2DET A;  3OYJ A;  4IHW A;  1MMS A;  1K4S A;  1KK3 A;  3D5S C;  1N75 A;  2VFO A;  3FXL A;  1GXP A;  2X1C A;  3GQA A;  1IXC A;  1IJE A;  3R60 A;  5CDF A;  1MBJ A;  1YW9 A;  4RLQ A;  4XRF A;  5HS9 A;  3ZN0 A;  4OJP A;  2ZL6 A;  4YG2 F;  4LG3 A;  2LRD A;  1I1S A;  1NB9 A;  1QRY A;  4GFB A;  1Q81 D;  1SVO A;  3MQ0 A;  1YYV A;  3VEP A;  1V5G A;  1KJZ A;  1B2R A;  1YIT I;  3HOV J;  2CF4 A;  1ETO A;  5FB2 A;  4AIK A;  2F5D A;  1YI2 B;  1BI1 A;  1XX5 A;  3ZMU A;  5J4Y A;  4V02 C;  2JMW A;  4JX6 A;  5BQT A;  1J9Z A;  4ZYE A;  1WOO A;  1P7J A;  3WNB A;  2W25 A;  1W0T A;  1X2M A;  2L4A A;  2ZZG A;  2QA4 B;  2LMD A;  1MDM B;  3LNN A;  3PSS A;  3JSO A;  4RCZ A;  4IL6 C;  4HNV A;  2ZBU A;  2XNC A;  2WYR A;  3TGN A;  1TL8 A;  1OFL A;  1BQE A;  2VZL A;  3CCY A;  4WZT A;  1I6X A;  2DPD A;  2DA3 A;  3FKJ A;  4UB6 C;  1UFM A;  1AIR A;  2OTL I;  3CMM A;  2O04 A;  1G3S A;  1OGJ A;  4GDF A;  3DQV C;  2GQQ A;  3S2D J;  2DCE A;  1QCX A;  4X6A J;  5ICC A;  1ZLK A;  4NHJ A;  2IAI A;  2E1O A;  1RES A;  5E3O A;  1RKW A;  5F64 A;  2KQR A;  2L9R A;  2Y75 A;  1P4A A;  2V9V A;  1KMH A;  3PUM A;  4ASU A;  3CCS B;  1OYI A;  4A3I J;  1VBL A;  2GIZ A;  2Q2E B;  3H5N A;  4E7Z A;  3K70 C;  2UXN A;  4Y3O A;  2HQ5 A;  2JPB A;  2C6Y A;  4RDL A;  1TYW A;  2ZXW H;  1GR1 A;  2X0K A;  1XGO A;  1TTY A;  2XPW A;  4UNO A;  2IXS A;  2V7U A;  2GPJ A;  2P7C B;  1EFC A;  2AHO A;  1K8A D;  2JJ2 A;  1HST A;  3TL4 X;  1K5C A;  1VLO A;  5FRN A;  3JRG A;  4A5N A;  4XRS A;  2KZG A;  3IAM 2;  1WDT A;  3B8H A;  2IA1 A;  1OJL A;  2DA5 A;  3G1O A;  1JKP C;  2QTZ A;  4K1X A;  1K73 D;  3IUO A;  5DDG A;  1XCV A;  3GSI A;  3WHB A;  3SXY A;  5K5R A;  3RKQ A;  1PP8 F;  3CCE I;  4OPO A;  1QFJ A;  3OYF A;  3CC4 I;  1VQ4 I;  1PP7 U;  2IS2 A;  1B23 P;  4BE2 A;  3E6D A;  4I09 A;  2XAU A;  1LEB A;  3I53 A;  1W36 C;  3CCL I;  3T56 B;  4AYB N;  1MRZ A;  1HF0 A;  3I56 I;  2DMP A;  3M3Y J;  2QF7 A;  2BGI A;  1ETY A;  1EFR A;  2VKV A;  1FZP B;  1IZ1 A;  1IRG A;  3P26 A;  3PUN A;  1X1D A;  4FET A;  1WZ2 A;  2KJC A;  3J7Y J;  1I7P A;  4HYE A;  3I0T A;  2GOX B;  1FRQ A;  4C43 A;  1MMD A;  5ED4 A;  2MH9 A;  3MAJ A;  5M5X J;  4QVJ A;  3NQO A;  5CVI A;  2BEO A;  3BJ6 A;  3HOS A;  1FPQ A;  2LKS A;  4EM0 B;  3F8F A;  1ENH A;  5B5E C;  1QGA A;  2RDP A;  2ZC2 A;  4PGG A;  3LO8 A;  2E2H J;  1NK2 P;  1OCT C;  4AC0 A;  1O3S A;  3A8K A;  1IN5 A;  3K4N A;  2XF6 A;  4AWX B;  1PUF B;  1EZG A;  1VQO B;  2DA2 A;  2O03 A;  2E35 A;  3BP8 A;  4WF2 A;  1RUN A;  4EH1 A;  3FK6 A;  5TGT A;  2BSA A;  1VFC A;  3R6J A;  4M0L A;  2VLA A;  1H0M A;  1QRC A;  3ABK H;  4HQM A;  2CUE A;  3HSF A;  4HX4 A;  2MFZ A;  4ENJ A;  2XRO A;  3CCV B;  1ZGJ A;  2M30 A;  3CD6 I;  4BBR J;  4A3B J;  2IVM A;  2ME0 A;  3WG7 H;  1QZY A;  4IRG A;  4JBA A;  1GJR A;  3OL3 A;  4RLZ A;  5EYR A;  1U9N A;  2DBB A;  4A5M A;  3GTM J;  1D1C A;  2PMZ N;  1KRH A;  3VO2 A;  3ZGK A;  1T33 A;  1TNT A;  2XDV A;  3HUG B;  3CMY A;  3ULQ B;  2IQ7 A;  2FQ4 A;  3JAM K;  5L3D A;  4DZP A;  3HKZ N;  3RTR A;  3X2Q H;  3P5J A;  1LFP A;  4PJJ A;  3S17 J;  3RYP A;  4AC9 A;  2O6W A;  3OSF A;  4RD0 A;  3VMW A;  1U5T A;  1LVA A;  2HDC A;  3CDL A;  2MW8 A;  2BE5 F;  2IRF G;  3VOD A;  2DTR A;  2DJN A;  1OFE A;  4U7B A;  3QOD A;  1J2X A;  2LP0 A;  1OFC X;  2GXG A;  4IOA F;  4UVA A;  1LLZ A;  3DDY A;  2MD0 A;  1W2B B;  1SFX A;  1XD7 A;  2CYY A;  4RGX A;  4RAG A;  1JT0 A;  1QNT A;  5DV5 A;  1D1N A;  2W6I A;  3DBH B;  1IRX A;  4PCQ A;  2GAU A;  5CVV A;  3QU6 A;  1U5T C;  2ZXH A;  3CUQ A;  4ON0 A;  5IP7 J;  5E8G A;  2XND A;  5THX A;  5FKO A;  4PSX A;  3MCZ A;  5FO1 A;  3GCM A;  5KSW B;  1H9T A;  4A0Z A;  2OBT A;  2AHQ A;  4AYB A;  3KZI C;  2KMU A;  4PGH A;  1UHM A;  3DPL C;  4DK0 A;  4Z6Y A;  4P9U A;  2HQA A;  4I01 A;  4QIW N;  1QHH D;  4HV6 A;  1MDM A;  2DK5 A;  1TW3 A;  1Y39 A;  1DP3 A;  2JIZ A;  3G71 I;  1OFD A;  1HQC A;  3CXC B;  1X3U A;  1T08 B;  4W8T A;  5F4J A;  2DN0 A;  2DJI A;  2PX9 A;  4M3D A;  4CA0 A;  3W6J B;  3CUQ C;  2VJI A;  4O5V A;  1JUS A;  1LDJ A;  4UY8 I;  4ZCM A;  4Z4V A;  3I58 A;  2XT4 A;  1ETX A;  1L1I A;  2BY1 A;  2WAF A;  3W2G A;  2OV7 A;  2QKM B;  2VT2 A;  3QWL A;  4KMF A;  1MMG A;  2CK3 A;  4IW3 B;  2M8E A;  4I84 A;  3IHU A;  4OOV A;  2VB6 A;  3M1C A;  1EP1 B;  1N0V C;  2NT6 A;  3QPT A;  1BN5 A;  3K1M A;  2XF5 A;  2KIM A;  4BE1 A;  1MGT A;  2CJJ A;  2CBX A;  1H9G A;  2E19 A;  5J1U A;  4MFE A;  3F72 A;  1PLU A;  3JU4 A;  1KU3 A;  3Q9S A;  2ZFU A;  2FSW A;  2BF4 A;  4X0C A;  3J81 k;  4XR6 A;  2H1K A;  1NH3 A;  1R36 A;  2XKO A;  1SKQ A;  4KMU X;  5BNG A;  5EGO B;  4HLY A;  1JXS A;  1O57 A;  2EBI A;  1VHE A;  3V76 A;  4ACB A;  3JRI A;  2BW3 B;  2K9Q A;  2KT0 A;  3Q3S A;  2VNJ A;  3ONU A;  2PEC A;  2EH3 A;  2PMZ A;  4Y7N J;  3LJY A;  4XOR A;  3C1D A;  2PYH A;  3W2F A;  1MZB A;  2XAJ A;  4WCG A;  1KGS A;  2DYR H;  2P0W A;  2ZL7 A;  4XMY A;  4HE6 A;  5FIU A;  3BTC A;  1JTA A;  1MND A;  2NTP A;  3HEF A;  2UV1 A;  3AL0 B;  2PLY A;  3HKZ A;  4J19 A;  2OBR A;  2FXA A;  4EJT A;  2O17 A;  2QY1 A;  4MQ9 F;  2F6C A;  2KZV A;  3H0G J;  3A0H C;  5LGN A;  3OOC A;  3LA3 A;  4XN3 A;  1R5B A;  4BY7 J;  4IRH A;  3Q39 A;  5L3G A;  3R6K A;  2K85 A;  2L7Z A;  4C2M J;  1IDJ A;  3W6K B;  5DNS A;  2PBI A;  2NNN A;  3HM5 A;  1GT0 C;  3E5U A;  4V2F A;  4V2G A;  4L9T A;  1VZ0 A;  3A35 A;  5FKK A;  2WPD A;  4A12 A;  3SFZ A;  4WK8 F;  3CC7 I;  2QEN A;  5HS8 A;  3T8R A;  5JFR A;  5FJ8 J;  2OCE A;  2XTY A;  3K70 D;  2KRC A;  4G1V A;  4KKT A;  1X0C A;  5FKN A;  4JQF A;  2CV0 A;  1A31 A;  3S14 J;  1SD6 A;  3KP7 A;  5E1X A;  1Z6R A;  1FDR A;  1PUF A;  3P7N A;  3U2R A;  2VC0 A;  4RDU A;  4Z1M A;  2IBD A;  2DA1 A;  4OAY A;  3FPK A;  2GK6 A;  1HC8 A;  1X1C A;  1U2W A;  1WP6 A;  4ZGN B;  2RGV A;  1O8G A;  4U87 A;  3E3V A;  2G9W A;  4RAZ A;  5BPD A;  1Z0X A;  4MQV A;  2A6E F;  4MHG A;  4RGS A;  4ABZ A;  2MD5 A;  4BL0 B;  4E4H A;  5IP6 A;  3P9K A;  4TN1 A;  5DD4 A;  5E6T A;  3Q6Q A;  2JUC A;  4DYQ A;  1N77 A;  4D5F A;  2GJR A;  3BH6 B;  1I5Z A;  2HXO A;  2WR8 A;  2F1M A;  4U49 A;  1GV2 A;  1ZYR F;  5EEH A;  2EFW A;  3CME I;  2O5R A;  3OOP A;  3VSV A;  3K69 A;  3VYU B;  1YW8 A;  2A05 A;  2K86 A;  1FOY A;  1I1G A;  4EGZ A;  3LA2 A;  4IOC F;  2F4O B;  1QGY A;  4WWC A;  2P5L C;  2O0V A;  2WAD A;  4EJV A;  4BQA A;  4ZDP A;  4M1K A;  5DD8 A;  2K9M A;  3BNW A;  3WNC A;  2DQL A;  4KKS A;  3K9T A;  2HYJ A;  2XVC A;  2XGC A;  2MSY A;  2JPC A;  3HPH A;  2FE3 A;  4R1H A;  3BR0 A;  2KDZ A;  3Q9V A;  4FE7 A;  2WC2 A;  2QA4 I;  3I64 A;  2HOS A;  3CP8 A;  4UAJ A;  3BQY A;  2KP6 A;  3DKX A;  4ZDL A;  2K02 A;  1BBY A;  1LB2 A;  2M2E A;  1PUE E;  1JJ8 C;  3RPU D;  1CQT A;  2VI6 A;  1DP7 P;  4RD6 A;  4HQE A;  5DYM A;  1UCR A;  2RQQ A;  1FBU A;  5M3F J;  1IN6 A;  3BCF A;  5ILV A;  4TMZ A;  1XTA A;  3RQ4 A;  2PMU A;  1B72 B;  2DOE A;  4G7H F;  2QSF X;  1YX5 A;  1T6Y A;  3CMA B;  4E7J A;  2DOD A;  2CG4 A;  3HHH A;  4L5J A;  2R5Z B;  3CCS I;  2ZTN A;  2NSP A;  1ZRE A;  2Y0S N;  1FMV A;  2MH2 A;  5JHF A;  3IWZ A;  2XC1 A;  3MKZ A;  3LMM A;  1S7E A;  3CLO A;  3J81 K;  4DQ2 A;  4G5G A;  3RIQ A;  3FBN B;  2XRL A;  3OR2 C;  2V6C A;  2Y48 A;  1UJ8 A;  1RKT A;  3SEZ A;  2IGN A;  1LDK B;  2Y9Y A;  4CCM A;  4HDU A;  3K0L A;  5J1R A;  1YIJ B;  1O8K A;  1Z05 A;  2EV0 A;  2RN7 A;  4DYC A;  1BW5 A;  2FEZ A;  2CSO A;  1QVG B;  1R1U A;  2V9K A;  1JA1 A;  3GVK A;  3K1P A;  1BOB A;  3OIQ A;  5DUK A;  1A36 A;  4Q48 A;  3PM1 A;  1Y1V J;  1AWC A;  2IGK A;  3H92 A;  2DYI A;  1OGM X;  4C0S A;  2E1N A;  4II2 A;  4RS8 A;  3L2W A;  5E3L A;  3ZMV A;  2B5O A;  2VQH A;  3CCJ B;  1QBJ A;  1QH0 A;  4IJA A;  4OJ6 A;  3PNY A;  1ZEL A;  3LSI A;  5M5W J;  4OPV A;  1UZC A;  3W2W A;  3WBJ A;  1R23 A;  3HSE A;  3VSU A;  4D1Q A;  1TYU A;  3GO5 A;  4G6T B;  4YRV A;  2BW3 A;  1JKO C;  1DDI A;  2M87 A;  4XSZ F;  1ZG3 A;  3KRG A;  2B63 J;  2GK7 A;  1XGN A;  2HOE A;  4RAF A;  3J81 Z;  2XGE A;  2DT6 A;  4B3X A;  2ECB A;  2X6X A;  2LRE A;  4LBW A;  4JP0 A;  3K4M A;  1FSE A;  5LRR A;  3I1F A;  3FY3 A;  5HLG A;  1MD0 A;  2O7O A;  4P2N A;  2H8W A;  2Y2Z A;  3B6A A;  2ZXI A;  4NC6 A;  3CES A;  2H1L A;  4XLF A;  3JW4 A;  2ZIT A;  5F0C A;  4QPQ A;  5J3L A;  3ZQQ A;  1RQR A;  5H2F C;  3HC7 A;  1GDT A;  4JK1 X;  2RRE A;  4GRI A;  2F5E A;  3G73 A;  2X0L A;  3SYJ A;  1DAR A;  2EFQ A;  3FXO A;  3TED A;  3KL9 A;  1PYV A;  4CCL A;  4BNC A;  3AL0 C;  3LQE A;  1B8I A;  2PE3 A;  3AVT A;  3GZN B;  2YX4 A;  3V7A A;  1MBG A;  1OHH A;  3CCV I;  3J7A O;  2O8X A;  4OMZ A;  1IUY A;  5DN6 A;  1IG7 A;  3MCA A;  2R7D A;  2ZJQ F;  3K4L A;  2D2W A;  2P6T A;  3I3L A;  4LLL A;  4M9X A;  4DBR A;  5EDN A;  4HPQ A;  4YAL A;  2DER A;  1M1K D;  1LQ1 A;  3I5U A;  4HX7 A;  4DOZ A;  2EWN A;  2WV1 A;  3D1N I;  1Z91 A;  3ZIA A;  5BSX A;  4KN4 X;  2XAG A;  1PJ6 A;  1CQX A;  3GQ9 A;  1WOP A;  1WGX A;  5JVT A;  4F55 A;  4OIP F;  4Y9U A;  1J75 A;  4A0X A;  2M3A A;  1D8K A;  3KET A;  3ROU A;  3BCB A;  1ZAO A;  2X6Y A;  3KLN A;  4DJA A;  3GVJ A;  4WZL A;  1LFU P;  2D3L A;  2V7W A;  5EG0 B;  2NRA C;  2CUF A;  4BGD A;  3JQP A;  1VQP B;  2KVO A;  1ORK A;  1TYX A;  4RD4 A;  1XMA A;  3WU0 A;  3W2E A;  1ZK8 A;  3JR9 A;  1R5G A;  2FX0 A;  2QQB A;  1RR7 A;  4RMN A;  5E3M A;  3JSP A;  2VPL A;  4IX7 A;  1VI0 A;  2YWH A;  1D3Y A;  5KCM A;  2LKX A;  1VTN C;  2VBS A;  3D26 A;  1COW A;  5JMC B;  3BR5 A;  2NVU B;  2FX3 A;  4BEH B;  1UG0 A;  2N8G A;  4RB2 C;  4RGU A;  1G7T A;  1Y0U A;  4NCN A;  5DS9 A;  1V55 H;  3M07 A;  1OB0 A;  1QA3 A;  1RZ4 A;  1ZQ3 P;  2OUM A;  4BHB A;  3GEZ A;  3VYS B;  3M9A A;  1ELO A;  2WJV A;  4XLN F;  1RRJ A;  4HIZ A;  1YHQ I;  1JTY A;  2HPI A;  3BOQ A;  2CRV A;  4L9J A;  1ZUN B;  2DFF A;  1MIJ A;  1T5E A;  5HDN A;  2ACJ A;  3FDY A;  3QE2 A;  2ZSH B;  3T8T A;  1Y0N A;  3ABL H;  4H0E A;  1AU7 A;  2ZKZ A;  5J4V A;  3FXK A;  2BZT A;  4A0Y A;  1D5Y A;  1B72 A;  2NTQ A;  4PC3 A;  2WB1 A;  4EW9 A;  4WXD A;  5B1A H;  2V9P A;  3OR1 C;  5C1C A;  4OWR B;  5JVG F;  3DP7 A;  4P3I A;  3HOX J;  2QBY B;  2R5Z A;  1R5N A;  2WWY A;  1K7A A;  3T0Y A;  1FMW A;  3IWF A;  4PAB A;  2WAQ N;  3GZ5 A;  3D5L A;  3SEQ A;  3U6B A;  3Q3A A;  1B6A A;  2EB7 A;  5DUI A;  4XQF A;  1YRN B;  4EJU A;  5KAF C;  4XKV A;  2XAQ A;  4W8Q A;  1E3Z A;  1OQY A;  3OE7 A;  3GX4 X;  2EJR A;  2PMD A;  1SFU A;  3OYL A;  2BOL A;  4KN7 X;  4U4B A;  3OYE A;  2PIA A;  1T6S A;  5TR9 A;  1JRG A;  2BSP A;  1IDY A;  4XKW A;  4IQJ A;  3WTY C;  1S72 I;  2M0C A;  2E1B A;  1FTZ A;  3EPZ A;  3AKZ A;  5HXB A;  1HG8 A;  2M7A A;  1GVH A;  3FPP A;  3EQN A;  1IXR C;  3QFS A;  2O9L A;  1SD7 A;  3ZCO A;  4WQM A;  1NBM A;  4EV0 A;  3EUA A;  4G94 A;  1MBF A;  3C2H A;  4LFU A;  4RM3 A;  5D8L B;  4U0V A;  2V5I A;  4BXF A;  2VON A;  3LVB A;  2Z9O A;  5HZA A;  2WZP P;  1XFO A;  3SEJ A;  4DBQ A;  2LZJ A;  4S04 A;  2HZT A; 
#chains in the Genus database with same CATH homology
 2FUG 2;  2VAS A;  1W36 C;  4KIS A;  2V6E A;  3T56 B;  2V4D A;  3CJR B;  2ODL A;  2XZL A;  5KNL A;  1EFR A;  2HNH A;  1ERD A;  4HG2 A;  2CUJ A;  4XOP A;  3OEH A;  3BC8 A;  1X1D A;  4B43 A;  4FET A;  1HZE A;  1O8D A;  1HVX A;  3OIP A;  3DU5 A;  3QYB A;  3TMO A;  1QHG A;  2WAE A;  3PFY A;  1D1B A;  3PSI A;  3OYG A;  2X85 A;  2GOX B;  2HVR A;  1MMD A;  2E1M B;  2LOO A;  3T53 B;  4IKF A;  3OEE A;  4PSW A;  3M8J A;  2L5Q A;  3HOS A;  4KJZ A;  2ZSI B;  1G8X A;  1D1A A;  2K3P A;  4XL9 A;  2BVM A;  4KT6 A;  3K4J A;  4Y33 A;  4BE0 A;  1UD5 A;  3OFN A;  4NC8 A;  1S9H A;  1G59 A;  4JMQ A;  1YE9 A;  3OYM A;  1WTH D;  5HVQ C;  3K4N A;  1X4O A;  2WY7 Q;  2XF6 A;  2Z8G A;  1KCD A;  2KDO A;  3VSL A;  2IS4 A;  2W1O A;  1E43 A;  4II3 A;  5TGT A;  3K6G A;  2VLA A;  2XSJ C;  2OC6 A;  2V4J C;  3LFU A;  4HWV A;  4NQW B;  2MFZ A;  1H8H A;  2R7V A;  1V5F A;  3L2R A;  1WFX A;  3OL3 A;  3A3B A;  1MNE A;  2WBM A;  1X1A A;  2L9S A;  1D1C A;  4XLA A;  4YEL A;  3GQ8 A;  1W9X A;  2CV1 A;  1MW7 A;  3ZGK A;  4BDY A;  3BCD A;  2XDV A;  3HUG B;  1E0E A;  2IQ7 A;  2VQL A;  2R7Q A;  1OLT A;  2IGM A;  2LYC A;  2WAQ A;  1KON A;  3RTR A;  4F92 B;  1LFP A;  4PJJ A;  3ZXS A;  4CCJ A;  2NZM A;  3VMW A;  4ZDO A;  2GOM A;  3QOD A;  4U7B A;  1O8I A;  5C1E A;  2W7N A;  1U0J A;  4G6I A;  2PJR A;  2JUG A;  1UD3 A;  3DEE A;  1DBO A;  3DDY A;  2A5W A;  2MD0 A;  1V0F A;  4OJL A;  3L2V A;  3SZG A;  2X53 S;  5CPR B;  3PL8 A;  4HSR A;  4PK4 A;  1AA7 A;  2W6I A;  4XNF A;  2QX3 A;  3OS1 A;  1IRX A;  3LMW A;  2NSP A;  3G2B A;  2R7S A;  2XF7 A;  2ZZF A;  4BEH A;  4NNJ A;  3B4N A;  2ZXH A;  2X8K A;  1WPC A;  5HNH A;  2XND A;  2ZZQ A;  1J09 A;  2VJ4 A;  4YZA A;  3BG6 A;  4PSX A;  4YXW A;  1BR1 A;  2Z2S B;  4PJL A;  4AYB A;  2W00 A;  2INU A;  2KMU A;  3DU6 A;  1Y6I A;  3DPL C;  4DK0 A;  3W2A A;  2W82 A;  2HQA A;  2KHM A;  1DP3 A;  1BR4 A;  1QHH D;  2JIZ A;  2LG4 A;  2JVH A;  2V7F A;  2HVS A;  1WMR A;  2DXI A;  4ZJZ A;  3BH4 A;  3ZSC A;  4W8T A;  2E5Z A;  3S8P A;  1T0F C;  4GQN A;  4OJO A;  4HRI A;  4ZTJ A;  3C2G A;  2DJI A;  4CA0 A;  3W3C A;  1OR7 C;  3EUH C;  2VJI A;  1RMG A;  2I8D A;  2HZD A;  5IK2 A;  1MAB A;  2VQC A;  3H0D A;  2GJK A;  2V31 A;  2WAF A;  2WSS A;  2OV7 A;  2QKM B;  3OW7 A;  1O8L A;  1MMG A;  2CK3 A;  3G05 A;  2MYS A;  4J01 A;  4I84 A;  2LC2 A;  2VB6 A;  3M1C A;  3SDB A;  2R4G A;  3OMY A;  2NT6 A;  2LBF A;  3DTI A;  2CS3 A;  2XF5 A;  3DPU A;  1UEL B;  4BE1 A;  4CCN A;  3GVL A;  4P5O A;  3LSH A;  1PLU A;  2VJJ A;  3JU4 A;  3JUR A;  2ZFU A;  4XR6 A;  1NRK A;  3PNT A;  1E79 A;  2VL8 A;  3HOT A;  4B3F X;  3VSK A;  2M4K A;  2ELJ A;  4XOT A;  3DLA A;  1PKV A;  2BW3 B;  1I18 A;  2PEC A;  3FBI B;  2PMZ A;  1IDK A;  2MAB A;  3K10 A;  4XOR A;  1WJA A;  2PYH A;  2DT7 B;  2NST A;  4YZX A;  4B3G A;  2P0W A;  4XMY A;  1JTA A;  4B47 A;  3ONQ A;  2NTP A;  1MND A;  2F5V A;  1KTW A;  3WWG A;  2UV1 A;  3OYD A;  3BCA A;  3AL0 B;  3HKZ A;  3K4B A;  4LIU A;  4C9Y A;  5HKK A;  2O17 A;  4H4K C;  4EAT A;  2CW7 A;  2QY1 A;  3EQO A;  2F6C A;  2WJY A;  2KZV A;  3OOC A;  2XZO A;  4XN3 A;  2DOA A;  2ZZE A;  3E1S A;  4Y4R A;  3SYT A;  3UNG C;  5HOO A;  3OYB A;  3L2U A;  1WJB A;  3CJQ B;  3QYE A;  3ZPN A;  1IDJ A;  2X3H A;  2RNG A;  3B90 A;  4E6K G;  2R7U A;  4NC7 A;  4E7L A;  3OS0 A;  2O1D A;  2X51 A;  2QXZ A;  3BLY A;  3HAG A;  1OGO X;  4X0G A;  1VZ0 A;  2CW8 A;  2W4S A;  4XON A;  3A35 A;  2WPD A;  3J7A Y;  4C2T A;  2L9N A;  3DTK A;  4Z06 A;  2Z6B D;  3K70 D;  1RU4 A;  2KRC A;  4XLC A;  4KKT A;  2NT9 A;  1Z7L A;  1X0C A;  4DNR B;  4JQF A;  2CV0 A;  3S3O A;  4BJ5 C;  4ZTF A;  3LSG A;  2IS1 A;  4CSW A;  2IS6 A;  4DNT B;  3GQ7 A;  1R6R A;  3H94 A;  3KEW A;  4HNT A;  1X19 A;  3OS2 A;  4Z1M A;  2NTB A;  2M4G A;  4BJ6 C;  4OAY A;  5LFA A;  2GK6 A;  4NUB A;  1X1C A;  3H9G A;  3W2V A;  4E7I A;  1WP6 A;  2W6J A;  1QU3 A;  4PFO A;  4U87 A;  5FRM A;  2ZTG A;  1O8G A;  4F91 B;  4PUS A;  4XKC A;  3ZPP A;  3CP2 A;  2Q1Z B;  4XKB A;  2JSP A;  4BL0 B;  4E4H A;  3VYT B;  2QE7 A;  2R7W A;  1UD4 A;  1YX3 A;  2GJR A;  1N77 A;  3H35 A;  1TT0 A;  1WJE A;  3PJR A;  2HVQ A;  4BQN A;  2F1M A;  1OOC A;  4U49 A;  2R7T A;  4W8R A;  2QKL B;  2O5R A;  2CH0 A;  3GRH A;  1TZL A;  3DWL E;  3VSV A;  3VYU B;  2Y0S A;  1BR2 A;  1JI8 A;  2X1E A;  1GLN A;  2JDI A;  1O8H A;  2XOK A;  1O8F A;  1IA5 A;  3A4C A;  1N78 A;  1D0Y A;  1EA3 A;  2VBE A;  1E3X A;  2O0V A;  2WAD A;  1KZL A;  2VIX A;  1O8E A;  4ZDP A;  2VKD A;  1EE6 A;  3UW0 A;  3H5A A;  2K9M A;  4MLO A;  2K5C A;  5CQG A;  2CV2 A;  4OAZ A;  3DKY A;  4HST A;  3KX2 A;  4HNU A;  3OAA A;  4KKS A;  3I9V 2;  3PSF A;  3ZR8 X;  1O88 A;  1E1R A;  3HXL A;  3HPH A;  4XD7 A;  3T51 B;  4PJM A;  2XC7 A;  2R7O A;  3CP8 A;  1UD6 A;  2KP6 A;  3DKX A;  4ZDL A;  4YEJ A;  4BU2 A;  4DGW B;  3RPU D;  4Z03 A;  4YZQ A;  2WA0 A;  1HA8 A;  3QYF A;  2RQQ A;  4F93 B;  4RLF A;  3S3M A;  4L8J A;  2F4I A;  4URR A;  3BCF A;  3OYC A;  3D5R C;  3RQ4 A;  1T95 A;  1H80 A;  2HPM A;  3U21 A;  1BN8 A;  2NOJ B;  4NK6 A;  1VLY A;  2VJ5 A;  3DPT A;  1YX5 A;  4BJT A;  1RWR A;  3HL2 A;  4E7J A;  3T9G A;  3DTE A;  2ZTN A;  2KLO A;  3GQB A;  3OY9 A;  3VR6 A;  1DGW Y;  1FMV A;  3PUB A;  5JHF A;  1K28 D;  3OYA A;  4TKO B;  4FAS D;  4OJ5 A;  3MKZ A;  3LMM A;  5AMV A;  2MC4 A;  4JOM A;  4G7X A;  3FBN B;  4CCO A;  3OR2 C;  4C2L A;  3OOU A;  4DK1 A;  3SEZ A;  4BDZ A;  4P22 A;  2IGN A;  1LDK B;  4CCM A;  5HNF A;  1KCC A;  1NG6 A;  2VKH A;  3B8Y A;  3H5R A;  4XM3 A;  3BC9 A;  1PXZ A;  4BUP A;  1Z21 A;  3GBG A;  2KL4 A;  3LL7 A;  3AFH A;  1PE9 A;  3MKW B;  2V9K A;  3OL4 A;  4P1W A;  3GVK A;  2LBF B;  1BOB A;  3OIQ A;  4IZZ A;  1X1B A;  2VXZ A;  4ZYA A;  4F3Q A;  4QPO A;  3IAS 2;  2IGK A;  1WJD A;  1OGM X;  4E7K A;  4II2 A;  3L2W A;  3SUC A;  3S32 A;  1K6Y A;  1LVK A;  2VQH A;  4C30 A;  4BQO A;  4BQQ A;  4OJ6 A;  3PNY A;  1W0K A;  1SAU A;  4D9J A;  1ZEL A;  3LSI A;  4CH7 A;  1E1Q A;  3S93 A;  3W2W A;  3VST A;  3V42 A;  3VSU A;  4D1Q A;  1MMN A;  4G6T B;  4YRV A;  2BW3 A;  1DGR M;  1D0X A;  3H9J A;  3KRG A;  3F9K A;  1V5E A;  3PNV A;  3MMY B;  2VBK A;  5LD2 C;  2BVL A;  2GK7 A;  1NHC A;  2M5S A;  2DT6 A;  2L7K A;  2X6X A;  3KEY A;  4B3X A;  3NE5 B;  2XGJ A;  3S3N A;  3L2Q A;  3A1Y A;  3MD2 A;  3LSM A;  2LRE A;  1VF7 A;  3K4M A;  4ANJ A;  4KIT B;  1GQ8 A;  3FY3 A;  2V7Q A;  1VJS A;  1QJV A;  1BLI A;  5KHD A;  2ZXI A;  3OYH A;  3CES A;  4XLF A;  2R7R A;  4QPQ A;  3ZQQ A;  1Y56 A;  3RSN A;  1Z3X A;  3HC7 A;  3N05 A;  4N4N B;  1DBG A;  2RRE A;  4GRI A;  4CUG A;  2A6T A;  4B44 A;  2HU9 A;  4TT3 A;  1Z3Y A;  3VMV A;  2AQF A;  1BMF A;  3IP4 B;  1PYV A;  2E60 A;  4CCL A;  4R79 A;  3AL0 C;  2GJP A;  4ZC3 A;  1O8K A;  1I8D A;  3RCO A;  2O0W A;  2IGO A;  2L2O A;  4PMH A;  2HDW A;  4PJN A;  2WY8 Q;  2X1D A;  3A3G A;  4E7H A;  1OHH A;  1IB4 A;  3VYR B;  3LSK A;  1WJF A;  2E1M C;  1O8M A;  2Z1D A;  5DN6 A;  1SKY B;  2PYG A;  3ZRG A;  3HPG A;  3K4L A;  1D0Z A;  1CZF A;  3I3L A;  2M7B A;  4DBR A;  2K9L A;  4HPQ A;  2VXD A;  3KYL A;  3VDX A;  4DOZ A;  4E7S A;  3CZ6 A;  4N4O B;  4PFP A;  2XZP A;  2EWE A;  1X4P A;  2CFO A;  3ZIA A;  3GQ9 A;  1H8E A;  4Z05 A;  3K4C A;  2D3N A;  4MR0 A;  4F55 A;  2UVE A;  4NK8 A;  1W36 D;  2M3A A;  3BCB A;  4UZU A;  2JA2 A;  2X6Y A;  1P9Q C;  4DJA A;  2R9V A;  5HLT A;  3GVJ A;  2LH9 A;  3BG7 A;  4AU7 A;  2D3L A;  3OYJ A;  4AVZ A;  4E0F A;  4CCK A;  2X6W A;  4BGD A;  3OYN A;  4W8S A;  3D5S C;  1N75 A;  2R7X A;  2KVO A;  2PJR B;  4MXN A;  3E0J B;  3MKY B;  1OFM A;  2X1C A;  3WQZ A;  3GQA A;  4CZC A;  5CDF A;  4RLQ A;  1BHE A;  4OJP A;  4RMN A;  1FX0 A;  2HLD A;  4LG3 A;  2LRD A;  2VPL A;  4IX7 A;  4DIQ A;  5KCM A;  1BPL A;  3HG9 A;  4F52 A;  1COW A;  1MMA A;  1V5G A;  4IQ4 A;  4BEH B;  1UG0 A;  2UWM A;  1XG2 A;  5FL7 A;  5CKT A;  4J00 A;  1SFK A;  1OB0 A;  2OUM A;  3VYS B;  1PJR A;  3NWS A;  3OYI A;  2WJV A;  1WJC A;  3OWT A;  4HIZ A;  2ZZG A;  1WJ5 A;  2HPI A;  1O8J A;  4OZY A;  2JVG A;  3LNN A;  2INV A;  1T5E A;  4TSF A;  3OPO A;  2DIE A;  3FDY A;  3VWB A;  2ZSH B;  2V26 A;  1OFL A;  2Z16 A;  3FKS A;  4KKU A;  2LY2 A;  3CF2 A;  4YZ0 A;  3FKJ A;  1AIR A;  4XLH A;  3CMM A;  2O04 A;  3TBI A;  2UUZ A;  2NTQ A;  3DQV C;  2WB1 A;  3NWT A;  2DCE A;  2VQG A;  1QCX A;  3K4K A;  3OR1 C;  4FXU A;  4BS9 A;  4EW9 A;  5C1C A;  4OZZ A;  4OWR B;  3OYK A;  1FMW A;  2KQR A;  3UR3 C;  4LIV A;  1KMH A;  2UVF A;  4ASU A;  1VBL A;  2Q2E B;  4E7Z A;  3H5N A;  3D5L A;  3QOE A;  4Y3O A;  3SEQ A;  3K70 C;  1UD2 A;  2CUZ A;  4XQF A;  2V1N A;  3EUK L;  4W8Q A;  4XKV A;  2IXS A;  1E3Z A;  2E5N A;  2M0M A;  5FRO A;  3OE7 A;  2JJ1 A;  4XN0 A;  3OYL A;  2BOL A;  2JJ2 A;  4U4B A;  5CQE A;  1LKX A;  3TL4 X;  3OYE A;  1K5C A;  5FRN A;  1JRG A;  2BSP A;  4XLE A;  4LIT A;  4XKW A;  1NG7 A;  2AQE A;  3IAM 2;  4BAC A;  1UAA A;  4IQJ A;  2E1B A;  3H9Q A;  2F43 A;  3EPZ A;  4HEA 2;  3AKZ A;  1HG8 A;  2M7A A;  3FPP A;  3EQN A;  2CMP A;  2KPM A;  3ZCO A;  3IUO A;  2VBM A;  1NBM A;  3EUA A;  3C2H A;  4RM3 A;  4B48 A;  1UD8 A;  2KRH A;  3FHN A;  3OYF A;  1DQU A;  4BXF A;  4ITV A;  2LY1 A;  2IS2 A;  4G7W A;  3A2K A;  1W0J A;  4BE2 A;  2WZP P;  4RM2 A;  1V0E A;  4DBQ A;  2LZJ A;  2XAU A;  4C2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...