4XL9A

Tailspike protein mutant d339a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xl9A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xl9A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xl9A02
4YZXA 2NT6A 4MR0A 2X3HA 5C1CA 2X6YA 3ZSCA 4W8QA 1PXZA 3WWGA 4XKWA 1O8FA 4XN0A 1DBOA 1O88A 3EQNA 2O0VA 4YZQA 1RU4A 4XKVA 4PMHA 4XLFA 1O8IA 2NT9A 1KTWA 4OJLA 1QCXA 3KRGA 2PYGA 1GQ8A 3VMWA 1NHCA 4U4BA 1O8JA 3GQAA 3LMWA 1IB4A 2O17A 4OJOA 1PLUA 2PECA 1OFLA 4AVZA 4OJ5A 1K5CA 3EQOA 3VSUA 4URRA 4XNFA 2INUA 2VBKA 4XN3A 4OZYA 1H80A 1O8MA 3VSVA 2NTPA 2NZMA 2O04A 2X85A 3GRHA 4XR6A 1O8LA 2INVA 5AMVA 4U49A 4XQFA 5C1EA 1OGMX 2PYHA 4OZZA 4XOTA 1EE6A 4XORA 3B8YA 2NSTA 2NSPA 1RMGA 4W8SA 2O0WA 4XMYA 1RWRA 1XG2A 4C2LA 2BSPA 4OJ6A 3VSTA 1O8DA 4MXNA 3B90A 2QXZA 2UVFA 1DBGA 4XM3A 1WMRA 1BN8A 2X6WA 3ZPPA 4XLHA 2VJJA 2QX3A 2UVEA 1QJVA 1JTAA 4NK6A 3VMVA 4W8TA 4XLEA 4EW9A 2VJIA 4XONA 2QY1A 1PE9A 1JRGA 3GQ9A 1KCCA 1IDKA 1X0CA 2EWEA 4YELA 2NTQA 4W8RA 1OOCA 3GQ8A 4YZAA 1BHEA 3SUCA 1IDJA 4NK8A 1HG8A 2IQ7A 4Z03A 4YZ0A 2O1DA 1VBLA 1IA5A 1OGOX 3B4NA 4I84A 1O8KA 4Z06A 4YEJA 3JURA 1CZFA 4XLAA 2ODLA 2NTBA 3GQ7A 2X6XA 4HWVA 2VBEA 4XL9A 4XOPA 2Z8GA 1O8GA 3T9GA 1AIRA 2VBMA 3FY3A 1O8HA 4Z05A 4XLCA 1OFMA 3UW0A 1KCDA 4OJPA 1O8EA
chains in the Genus database with same CATH superfamily
5ICEA 2P4WA 5C4JJ 3GLLA 1YS6A 2NPFA 1U8BA 3U2RA 3EUKL 4XKWA 2QEXI 4XN0A 1BX0A 5E1XA 1BIBA 5JR3A 4J0QA 1ZLJA 1WJDA 5HDKA 1E3XA 1FBUA 1VQ7I 3LA2A 2RC4A 2PYGA 3M9AA 1P9QC 4RLZA 1WPKA 2K9LA 4Z1MA 1D0ZA 2E35A 1G3WA 4RLQA 3PENA 5IT9K 1OFLA 2PLFA 2E7WA 4BXUA 1QZEA 1VHOA 2IBDA 2K9NA 4URRA 2Y0SA 3HOVJ 2FF4A 4RPDA 3S2WA 1WHUA 3VSVA 2NTPA 2NZMA 2HLDA 2DFFA 2J5OA 1T38A 4D7NA 3OW7A 2XB0X 3JQRA 2V9KA 2X85A 4OIRF 2DCEA 4XR6A 5CVIA 4V02C 5J1RA 2ZFUA 4ESFA 5J4YA 3LAJA 2BF4A 5D5WB 4N3NA 3AVWA 5DD4A 3S2DJ 2BSAA 1HC8A 3ESWB 3PNTA 4RA2A 5TR9A 2J7KA 2COMA 3OYHA 3ONYA 2ETHA 2YR2A 3N05A 3MD2A 2CRVA 5HDNA 1HKTA 2M87A 3I64A 1BMFA 3M7GA 3O2PE 5F64A 3OYFA 3BQYA 1ZUNB 4BAYA 4LG0B 1OB0A 1IXSB 3PUMA 1MSFC 4P96A 1HQCA 2A68F 2GIZA 2YX4A 3IAM2 1RKWA 2F3LA 5E1ZB 5D5VB 4EM1A 1J7KA 1UMQA 1MH3A 2MD5A 3I4MJ 4NQWB 2X6WA 2VE8A 1H89C 3FMRA 4WZKA 1WJBA 1I8DA 4C3JJ 4IHWA 1P2FA 4PCQA 2F4MB 3T56B 4BL0B 2JA6J 4HV6A 2HKOA 3B6CA 4I01A 4FE7A 4LB6B 4OMZA 4IKFA 3RQ4A 5JBQA 2I5UA 2XF5A 5E6TA 1DARA 2XROA 2NNYA 4IZZA 1MNEA 3WTZA 4A5MA 4DGWB 1Y0UA 3J7AO 2ZBUA 1K4SA 2KISA 3JRAA 3QFCA 3SJMA 2QMUA 4W8RA 4OAZA 2M45A 4BGDA 5EG0B 3I59B 3W2HA 1X2MA 4IHVA 1O3RA 1X2NA 2YWFA 4QLCU 3GX4X 2Y0SN 3W3CA 1KK3A 4BJTA 1KTVA 1FBSA 1ORKA 5D4RA 1W35A 1HKSA 2IRFG 4EJOA 1SMTA 1M1EB 5DTDA 3HTSB 4KKTA 3AVXA 2CYYA 3MZYA 5HVQC 2BGIA 4CYDA 2HFHA 4EJVA 4RGUA 4E7SA 5E18F 3FX3A 1T39A 1O8GA 3HOZJ 2V1DA 3BH6B 1ZN2A 2GAUA 2JK3A 2LLKA 2ZL6A 4UZFA 3DF8A 4X6AJ 1WJFA 4P55A 4XLCA 3H9JA 4IX7A 2JA7J 1JKPC 1D8TA 1LLZA 2DN0A 3ZQ7A 2QN6A 4Y3OA 3B6AA 4GO1A 5KK1A 1AU7A 4I2OA 4YZXA 3SZGA 4IOAF 1B72B 1U6GA 2VBZA 3AG2H 1PUFA 4EGYA 3R6KA 3AAFA 2V5IA 4D9JA 1Q81D 1LVKA 1GLNA 3W2FA 1KTWA 2RREA 3S1RJ 2XUBA 5K7FA 2DOAA 2ME6A 1X1AA 3HSFA 5E17F 1D2EA 3C18A 3KPHA 2VFMA 4CH7A 4HDVA 3P26A 4E0FA 4FWTA 4CYCB 3A8KA 4Q48A 1BBYA 1K6OA 4C2TA 3OFNA 1EV7A 2IGNA 1ELOA 1HCRA 1V55H 3ZMZA 4Y4RA 2ZJRF 2XAQA 4W97A 1W9XA 4HX8A 4G1BA 2IVMA 3UNGC 3OWTA 3OZVA 1R4NB 1WJAA 4QSHA 1VQNI 1XE1A 2PYHA 2JSPA 4XORA 2KT0A 2OJED 2E1NA 3LL7A 4UV9A 2M2EA 4Q7JB 2NSPA 4YIRX 4YAOA 2BV3A 1XG2A 1XGNA 3PL8A 4RLFA 1ZRCA 3NAWA 5CQGA 1BPLA 3VSTA 3LOCA 1TQIA 3RYRA 4E7IA 2VL8A 1OCOH 1BA5A 3WQZA 2UVFA 2HYGD 3BR6A 2HQRA 1BX1A 4XM3A 1USSA 2EILH 1Y39A 1W36D 1YW7A 2DA4A 1BR4A 1JJ8C 4N9HA 3HOTA 1HBXG 3PA2A 1TTTA 3SZPA 1N8RD 3QU6A 4XLHA 5LEKA 5A2QZ 1IJFA 3CDLA 4W1UA 4B3GA 2X9DA 2UVEA 1S0UA 3OR2C 1XB2A 1MJBA 1XDSA 3HZJA 4PZJA 3V8LA 4ZYGA 4G9YA 3WTVC 2QWWA 3L2RA 3ZQCA 4LLNA 4BXXJ 4F52A 1SC7A 3LO8A 1Z1DA 3H35A 3GQ9A 4N9IA 3OIOA 5EMNA 3AK5A 1OFCX 1FSHA 3BJ6A 5JLVC 1OOCA 1F5TA 1W2BB 1E62A 3T0YA 2OF7A 2CFXA 3BR5A 3H3ZA 2YWEA 4QV2A 2MH2A 1VBLA 3IHUA 1FOWA 1U5TA 4XSZF 4ZDPA 2I10A 2E2JJ 4RCZA 2LY2A 5F1RA 1VQ4I 1WOPA 2OCCH 2A61A 3DPUA 4HV5A 2NTBA 4MEXF 2D3NA 4I6ZA 4KMUX 4DJAA 4RDJA 5IP6A 3K7AJ 4AU7A 3BTLA 1QNTA 1SD5A 3PNYA 1FNNA 4I0AA 2ADUA 2KDOA 4LD5A 3G05A 3H9NA 2DEUA 1MMNA 2Y2ZA 5FRNA 3CPXA 4M1KA 4MTDA 2QF7A 3RKWA 1KMHA 4BQQA 4ZGQB 5FGMA 3FKIJ 1VQ4B 3ECHA 3UW0A 3SQNA 5B1BH 4RBOA 3IRRA 2JA8J 2Y48A 4UXNA 5C1CA 5TRDA 1FEXA 2WYRA 1K83J 3JX8A 3NB2A 3ABLH 5D8KB 3CCJB 3COAC 4AF6A 1R1TA 4LLLA 1Y0RA 4E7HA 1W7PB 2OCEA 5DYMA 4XLFA 3CMYA 2ZNZA 5FKOA 2Z2SB 3BROA 4X06A 3KRGA 4XRSG 2GOXB 4PFPA 4TT3A 3W5HA 4Z4UA 1FX7A 5LBQA 5EDNA 1Z21A 2DFHA 1S7AA 3RIRA 3HGYA 1WI9A 5DM7F 1WOSA 3E7LA 4JX6A 1RR7A 1TQPA 4PFOA 2HDCA 1WU8A 2E1RA 2EZKA 1IAWA 1S5LC 5L3BA 1Y0NA 4LBVA 3D5RC 3Q3AA 2ESHA 2QGGA 3ZQGA 4BYYA 1BC8C 2EINH 1R5NA 2TRTA 5KCMA 4Z4YA 5J40A 3M1EA 1MDMA 1D1BA 2CQ7A 1YIJI 4X7FA 4YHBA 5K5OA 5DCMB 2XT2A 5C1EA 1H8AC 2VI6A 1RRJA 2ZC2A 1NB0A 2GK6A 1HKQA 4MHGA 3GZNB 1N0UA 4U87A 1LUJB 2H6CA 3RCOA 3NWTA 4C2LA 3S8PA 2R93J 1TWGJ 1COWA 2V1XA 4IW3B 5L3EA 2LY9A 2O8XA 2Z1DA 4AC9A 2DODA 4WX9A 2IP2A 4HSTA 1E79A 3OZWA 4ASUA 4M3BA 2X8KA 3LSIA 4G6DA 3N97A 3ZPPA 3H0GJ 4BS9A 3BG7A 1R6RA 3GYHX 5EEAA 4YIIA 1SD7A 3J81k 3PIOF 3F8CA 1G3SA 5EF6A 4UHTA 4H0EA 1D0XA 2QLZA 4NNJA 1TL8A 1R5GA 2VQLA 3G4SI 4XONA 1X1BA 4UVAA 2WB1N 4F3QA 3P7NA 1R71A 2ZSHB 2ECCA 4IQ4A 3S93A 4LK0F 2R9VA 1QVFB 3WGHA 4C2UA 1SMYF 1OKRA 4YZAA 1JI8A 1Q9SA 5LFAA 2QUFA 1TYXA 4YZ0A 3BG5A 2O1DA 3J80Z 1IA5A 4KT5C 1I6XA 1JTXA 3HIFA 2ELJA 3OYNA 3G4SB 4HZFA 1YHQI 2W7NA 4FXUA 2VOOA 5FKMA 2R92J 3A4CA 3F6OA 3ZBTA 3NQOA 2DA6A 2ZXWH 4UVBA 4XIDA 2DFEA 4G12A 5B5EC 3CF5F 3PA1A 5DUIA 2YWHA 3DEEA 1WSRA 1PP7U 1N08A 2QYUA 3SQVA 2MW8A 4M73A 4BJ6C 5IYWA 1AWCA 1Z77A 5FFXA 1STZA 1YHQB 4D5CA 2HVQA 5F27A 4R71A 2UZKA 3A03A 2GLOA 3Q0VA 3U1KA 2FX3A 4Z4WA 5CQEA 2W1OA 1V54H 3T51B 4WXDA 5KAFC 2GK7A 1JA0A 4GQNA 2ZMEB 3L2CA 2X3HA 1U2WA 1LB2A 3I58A 3V7RA 1PDNC 4RD3A 5FLMJ 1IRXA 2JTVA 1I7PA 1T0FC 1R49A 3VWBA 4CCOA 4KKSA 2ME0A 2O0VA 3ELKA 2A6EF 3GZ6A 3HHGA 2JN6A 5JFRA 3LMMA 2PMHA 2H1LA 3PUBA 4WCGA 4OJLA 3HPGA 2EV6A 3EUHC 3ZN0A 5M5WJ 1HLVA 2O61A 3B73A 1KJZA 1PLUA 1TWFJ 2XAGA 2Z99A 3TP0A 4HLYA 3U2QA 5IK2A 3ZBUA 2LRDA 2A5YB 2HCJB 2OK8A 2QZAA 1ETWA 1UHWA 2BHZA 2WC2A 4DBQA 4ITVA 4OAYA 2G0EA 1GJRA 1NRKA 1VLOA 3ZQFA 4DIQA 5LHIA 2CGPA 4IJAA 3JSPA 1ZGWA 1OCTC 1DPRA 3D5LA 3PO3J 1OLTA 1ZARA 3LSTA 3HRSA 3GRHA 1B59A 2KIMA 4UZEA 2X6OA 3DKWA 4XQFA 1EFRA 5BSYA 3F72A 1K4TA 2O6WA 1VQKB 9ANTA 2A07F 2IS6A 3WY9A 2EFGA 1G3TA 4WZTA 2VPRA 4MTEA 3VFZA 2E36A 2ELKA 2F5CA 2EFPA 2BVMA 3FIWA 1FOXA 1EP3B 3LSJA 1IB0A 4MXNA 2K02A 2GM4A 2DMUA 1S9HA 5E3LA 4RB3C 2NAZA 5JMCB 2IA2A 1BJKA 5TV2A 1EH6A 2COBA 4U0YA 2MD0A 2ISZA 1E17A 3S3OA 1J75A 2OK7A 1K8AD 1IDZA 5LGUA 1JXSA 1KA8A 1J0RA 2QZ8A 5HZBA 2JPBA 3SEQA 3ZCOA 2P5VA 2VKVA 1IF1A 1CF7B 2P81A 1LNWA 3ASNH 3BP8A 1JT0A 4RM0A 4A3MJ 4IHXA 4X7EA 4XD7A 1PE9A 1MBJA 3G71I 1S72I 3H0DA 1UB9A 3OOCA 2B7BA 2F5FA 4U0WA 3ZQIA 2CS3A 1DDIA 3T8RA 2M9HA 4ZYDA 1BHEA 5E1WA 2R5YB 5C4XJ 2R7SA 3ZN1A 2DOGA 3WBKA 2IS4A 1UFMA 2JRMA 3OPOA 3IP4B 1Z0XA 4PC1A 4P3IA 4C3HJ 1FTZA 1ETKA 3ZP5A 5ICGA 4LJZF 4GDFA 3VYSB 1S72B 3QYEA 5JLXA 4EJWA 1VQMI 2Z6BD 2VFPA 2A6TA 3CESA 2IT0A 1X58A 1BW6A 3FHNA 2Q6OA 1D8KA 2RNJA 1U78A 1ZM9A 3VPRA 2VBMA 1E64A 3F21A 3LQEA 3FY3A 3H5RA 1QFZA 3CJTB 3B82A 3OS2A 2X0LA 1G59A 4RDUA 2BMWA 2VYQA 3HEFA 3FBIB 1VQMB 5D4SA 5J4VA 2X6YA 3IWZA 2WAEA 1ETVA 4I76A 3ULQB 3WWGA 2C2WA 2ZKZA 2X4HA 1V5EA 4YRVA 2AQEA 1SAUA 1D0YA 3BR2A 1FC3A 1O8IA 4I98B 1IXRC 1BJAA 1L0OC 1FOKA 1FOYA 1QCXA 1O7LA 5IYQA 2BSPA 1NHCA 1IO2A 2WY7Q 4KUMA 4KKUA 4RD2A 2WZPP 3WNBA 3DPTA 3FJOA 3LMWA 2ECBA 4PGHA 4ABZA 4CGZA 4U9UA 4NBQA 2XF6A 3A3GA 3SZEA 1P7IA 4P9FA 3ROUA 2XASA 3K70C 4ENMA 1WPCA 2VODA 3K4KA 3SYTA 1LE8B 1IV8A 2L9NA 1FMWA 3BCBA 1UCRA 1R5OA 4X0GA 4M2LA 2V9VA 2H6BA 2Q2EB 4RGRA 4RAGA 3SJZA 3GUDA 3CCMB 1E0EA 2F1LA 2DQRA 4J19A 3CMEI 4F91B 2Q1ZB 3CUQA 3SXYA 4OIPF 5GPAA 1LVAA 1O57A 2OTJI 4JP0A 2N8GA 2ZFWA 3QODA 4A0ZA 2IA0A 1XSDA 1P4WA 2L7ZA 3W5UA 2K86A 4OOVA 2JVGA 2BBYA 2WWYA 2V7XA 4JMQA 5HLTA 3S2HJ 2JDIA 2DT7B 1ZELA 1F20A 1R58A 3QYFA 4G7OF 1LLWA 3F8NA 4IPAA 3OEHA 4XMYA 4A3KJ 3H09A 2DPDA 5HNHA 1Y56A 5L3CA 3CMEB 4JX4A 5A88A 2F4OB 5FLXZ 3RI4A 4OJ6A 2M8GX 2XAUA 3IH4A 4M6VA 2OTJB 2DA7A 5LHGA 2STTA 5GV8A 1DBGA 3K4JA 1OHHA 3WE3A 2ZJ2A 3N6ZA 3I59A 5CLSA 1P7JA 5GAHJ 3WXMA 2MGQA 2YU3A 5J8FA 2DT6A 2FD5A 4HSRA 1R4MB 1RETA 2JN9A 4NC7A 2XZLA 1YJ9I 2QE7A 5LLQA 1Q1HA 4XBFA 2ZMEC 2KQRA 1MKMA 2CUJA 2ZO4A 3KLNA 3FKJA 2XNJA 3HDDA 3QOEA 4DQ2A 3HOUJ 4JQFA 2M4GA 2QCOA 3SLDA 4V2GA 5D5UB 3GFLA 3LA7A 2UWMA 3TBIA 4CO8A 4FTHA 1YJ9B 4G6QA 1KONA 1X3ZB 2FNPA 2L9VA 1SD6A 3CW2A 4BDYA 2E1OA 5E3NA 2WJVA 3E6BA 3CQZJ 4Z4RA 2CJJA 1NG6A 5FKLA 3U6BA 1XQBA 2FOKA 3G73A 3GF2A 2KJBA 3VYTB 1KK2A 4A3GJ 1JUSA 2PN6A 3KP3A 3OJXA 1Z7UA 2VBYA 3FMQA 4IHYA 2E71A 2R7TA 4XRMA 4UUTA 3HL2A 3NRVA 1LFBA 1WJ5A 3LVBA 1HW5A 2ZSIB 3ABUA 5IYBJ 5LGTA 4L0YB 2QSGX 2NS0A 2HPIA 4CYCA 2CQNA 3RTRA 2DO7A 2JIZA 4V19K 4M3EA 1OCCH 3CCEB 3MZHA 2E19A 1JNYA 1RQPA 2CV0A 1X3UA 1VNDA 4JK1X 2CUEA 4PMHA 2W85A 4HG2A 1MBFA 1O3SA 2ZXHA 4K1XA 3GTOJ 2ZXIA 2JUGA 3V7CA 5FL7A 3GQAA 2CW8A 3FDYA 3FF5A 4TV7A 3ONQA 3ZQHA 3CMAI 4N3GA 3DLLF 5FB2A 1X4OA 2IEKA 4X7CA 3KP5A 1OYIA 2RV8A 1V5GA 4I09A 3TKYA 1YITI 4N4NB 2BN4A 3BTIA 4FX0A 4YALA 4UB6C 4C3IJ 1TTYA 1T0FA 3QP6A 4BY1J 4RS8A 3ZPLA 1E3OC 2XPWA 2EV0A 3HUGB 5L3GA 2CO5A 2EFOA 3A1YA 3PNVA 5J3OA 3GXOA 2QDXA 2L54A 3EUHA 4TSFA 4O6JA 2KJCA 5FA6A 3CMAB 2K9QA 2INVA 2VJ4A 1G4DA 1WDTA 1WWXA 1YITB 5HKKA 2XKPA 2XGXA 1RC9A 4OZZA 4HQEA 2UXXA 4XOTA 2DMQA 1TQMA 1Z6TA 2VIXA 2XGEA 3E6MA 4OPSA 3S32A 3CCLI 1EWYA 3OIPA 4P2NA 2KHMA 1P4XA 2FBHA 3B02A 4NHJA 1GDTA 5H6QA 3SHFA 5EGOB 4KNYA 1FNDA 2LKSA 2PLYA 4ASNA 1QO0D 5H5JA 2BW3B 5FROA 3GTPJ 2QTLA 2XIGA 3WGIA 1XG1A 5FFZA 2O03A 4CCKA 4A3IJ 1KU3A 3S17J 4WF2A 3CCLB 3CO6C 1UD8A 4P22A 1SKQA 3VOEA 2NVQJ 3K6GA 4AIHA 3H3UA 1QA3A 3I4PA 2L0KA 2W7ZA 1FYKA 2DXIA 2V4JC 4KIFA 1ZR4A 4BDZA 3QFTA 3GEZA 3MCZA 4M74A 2RKHA 3BDDA 3CB4A 2ZCWA 3BCFA 3ASSA 5IT3A 5ED4A 2QKLB 4D1QA 3S15J 2BXZA 1ZRFA 3JAMK 1Q86D 2HOSA 4P9SA 1JHHA 2FX0A 1T6SA 2PIAA 5GV7A 1PJ7A 1S8NA 1QRCA 1IDYA 4DNCA 3VYUB 2CH0A 3OW2B 4ZDLA 2XVCA 5DV5A 3Q6RA 2GJPA 1ZGJA 3AKZA 3LSMA 5F0CA 3ZMUA 2QVOA 4K2EA 4P6YA 2XGCA 1G6NA 3W2AA 1IN5A 4RAYA 5FKNA 1W7PA 3C1DA 2L7MP 4GCVA 5IYCJ 3ASPA 3LFKA 3K4BA 3HGGA 3CDHA 1YRNB 1K9MD 4MYUA 4B3FX 1O3TA 1AIRA 3SDBA 3FM3A 1MJ9A 5DSZA 4M3GA 3BH7B 1CQTA 4Z05A 5HS9A 1ZH5A 3GQBA 2F1MA 2IPQX 4RM3A 1KCDA 4YFNF 3CXCB 1X1PA 4HAMA 3OYLA 4EVIA 2XRNA 1KQ5A 5L46A 3NARA 4M3DA 3DV8A 1KQ8A 1UZCA 2XDVA 4AUXA 3BCDA 3ISXA 2VT2A 1OQYA 1S6LA 2OBTA 4X1EA 2YUHA 4EJTA 1USTA 1A6IA 3QPSA 2WY8Q 3HOWJ 3HTUA 3RZOJ 3NE5B 4Y33A 5IYPA 1PYVA 1SEUA 4G7WA 1T8IA 3JW4A 4F7DA 3ASRA 1MBGA 1GHCA 1DP7P 4G7ZF 2X51A 3PSZA 1QRYA 4AVZA 5A2QK 1QVTA 5ILVA 2W84A 2IW5A 1ZGAA 2FNAA 2LKXA 4XNFA 4TMTA 4X07A 2Q0OA 3IWFA 3EUAA 4MLOA 2V7TA 2CC2A 1MZBA 4Z4TA 3GTKJ 4YEIA 2PFBA 5ILSA 3DU6A 4U88A 3K1MA 3ABTA 1TYWA 3LAPA 3W2WA 3JAMZ 3HKZA 1X19A 5GADJ 2IOUG 1K6YA 3HSEA 1MBHA 1SFXA 4WWVA 2JVHA 1S29A 1YE9A 4B8XA 2LK2A 2F6CA 2CQXA 3W6JB 5GAGJ 4UUSA 2Z9OA 1E3ZA 5F4OA 3OL3A 4HE6A 2HDWA 2OUMA 4LG3A 5CJ9A 5IPAA 1QQ1A 3HPHA 1ZRDA 4OPWA 2XV4S 1UD6A 2W82A 4PJ0C 2A5WA 1LFUP 3OYAA 2K9SA 1HW1A 2M0MA 2M1BA 4YFXF 1WMRA 3S1QJ 5HNFA 4E7LA 1Z05A 4AD9A 3A0BC 3MEXA 1JUPA 2O6GE 5BS6A 1FIAA 3E97A 2YX7A 2HYJA 3KZYA 4JX5A 2PEXA 1F4KA 1WJCA 3Q5FA 2DK8A 1EFCA 1XCVA 2XAFA 4QFMA 4XLEA 1H9GA 4L5IA 3GSIA 2NOJB 1UD5A 1WCMJ 1KCCA 2K9MA 1N0VC 1I3QJ 2XTYA 3M8EA 2OZUA 1UAAA 2KZVA 5TGTA 5BOXA 1MIJA 5B3SH 1F43A 3PFIA 4U0VA 3W2VA 3OEEA 2D9RA 4ACBA 5DNSA 2H8RA 3CF2A 2ZTNA 3AG1H 1WSVA 1E3HA 4KA4A 4UNOA 3FPKA 4GFBA 4DZPA 1OGJA 3JURA 2MG4A 1FPQA 1ZG5A 2X48A 2NOGA 1FIPA 3SYJA 3ASQA 1R22A 5TISC 2E2IJ 4AM3A 4BH9A 3I5UA 1D3YA 4CCLA 2OQRA 3FXOA 3PIPF 1UD3A 1KK0A 4TMXA 4KDPA 2J8KA 5KVRA 1RI7A 2X1CA 4Q47A 3LQ6A 2L4MA 1ON2A 2AQFA 3MWMA 3WTYC 4ESBA 2OC6A 4X05A 4RGSA 2RQPA 2MLKA 2MC3A 3BJAA 2BPOA 1K79A 2ZZQA 4PGOA 5K5RA 3DWLE 1H8EA 4W8QA 3GVJA 4R79A 1HVXA 4N0BA 1MNMC 2DETA 4CUGA 1SANA 4D0PA 1PVEA 4GYGA 3RZDJ 3EQLF 4ZYAA 1XCBA 4Z4VA 2XTXA 4DZJA 1POGA 2F43A 3TQNA 4OMYA 1SD4A 3V8KA 4AC0A 3L2VA 5KHDA 2CW7A 3BC8A 1E63A 1GQ8A 4XSXF 4FASD 1IB4A 5E8IA 2XSDC 4OJOA 2DA5A 3CCJI 2OV7A 2KIUA 1G7TA 2LH9A 4KJZA 5HDGA 3LSRA 2V1UA 1JT6A 2EV5A 3BQZA 4PSWA 1AOYA 3BZ6A 1TVCA 2DW4A 2GA2A 2O0YA 3EETA 2VLAA 3K4CA 2VOPA 5FO1A 2W4SA 1R1UA 2Z3YA 3LSGA 4AWXB 5HOOA 2O3FA 2PI0A 3VDXA 1V0FA 2PE3A 4NBSA 2XC1A 4ESJA 2IGKA 1VLYA 3LWFA 3AVTA 1K7AA 2V7WA 2QQAA 4DYRA 2ZTGA 5A8AA 1B23P 1YIOA 2JA2A 3OYJA 2L4AA 3ZMSA 4NUBA 5BPIA 2R6HA 1SVOA 2F5EA 2WBMA 2F4IA 2EZLA 3B8YA 1CF7A 2EK5A 2KRHA 2WAFA 2R7QA 2ZITA 2VT3A 5F1JA 1SFUA 3J80K 5J8CA 2HQAA 3S14J 4C30A 4A3EJ 4LIUA 2X1DA 1CNFA 2LOOA 4HYEA 4KIGA 1IJEA 2FQ3A 1DG1G 1XSVA 4DNRB 1UMKA 4Y15A 3S1MJ 3TH0A 1YJNI 4TN1A 1NTCA 3FK6A 4RAFA 2HOAA 2LR8A 2V79A 2VBVA 1I27A 3LQQA 1OMIA 1TLHB 2K7LA 1QPIA 4QVAA 4DQKA 1BJZA 5LEJA 4HLXA 1FLIA 1O3QA 1W0KA 1FP1D 3GFMA 3R4KA 2FMYA 3E5QA 3FXMA 1T6XA 3S3NA 3AVVA 2BM7A 1EA0A 2FEZA 1E3PA 2VFQA 1JRGA 1YJNB 2DOFA 4XKCA 1RQRA 3EPZA 4OM9A 3VMFA 1VF7A 1QGZA 3C7JA 2VZLA 3UR3C 4D5FA 2EB7A 5F08A 5GTHC 3E20A 1ZG1A 4TMZA 5B1AH 1J59A 2EA4A 1J5YA 1BI1A 3GVAA 4B48A 3V4GA 5D5XB 4IL6C 3OYMA 1ODDA 1GVJA 4EQQA 4B47A 4E7JA 2F4NA 3GTQJ 4Z06A 5JVTA 1TWHJ 3FHZA 3SLNA 5B66C 4PSXA 5JI6A 1IG7A 2FA5A 1R5ID 1QGAA 4RCYA 5TJJA 1QUEA 1TW2A 2BY1A 2VQGA 3P9CA 2OU2A 1Z6RA 3HOSA 4HE5A 4E7KA 2QSHX 2HI3A 3QU3A 3E5XA 3I3LA 2V7VA 2L01A 1S3JA 3I53A 4HNVA 4S0HB 3DKXA 4A0YA 3G6EI 1ZQ3P 3HOYJ 1VQOI 2M4KA 3F8MA 4HBLA 5M3FJ 2JZYA 4OWRB 4P12A 2FBIA 2JRTA 2JPCA 4A3LJ 3BC9A 2DMNA 4WZLA 4BU2A 4L9VA 4PJLA 2GWRA 2KLOA 3O8GA 1PUFB 1LEBA 2CNDA 1LE8A 3KEWA 2ID6A 1YW8A 4DQLA 3ZMDA 5F0FA 1HDDC 1Q82D 3KX2A 2LYCA 2EFQA 3F22A 1RIOH 2QTZA 4IHSA 5EZGA 3G6EB 3E5UA 1VQOB 1RU4A 4A6EA 1LPQA 5EJCA 3SZTA 3Q39A 2BM6A 1ZM3A 1WZ2A 4P26A 4I7HA 3KZIC 3OYEA 2K27A 4XRSA 2Q6LA 4KN7X 4O3MA 3CCVI 4L8JA 1MBEA 4Z4SA 1OFDA 2O17A 3KP7A 4LB5A 2C78A 2H8WA 3VYRB 1CGPA 1XC5A 4EATA 1K5CA 4ZV4A 3EQOA 2DCUA 1IHMA 4UY8I 3K1PA 4BHPA 2DPUA 2QBYB 1H42A 2VBKA 2HEOA 1I1GA 5HLGA 3GVLA 4P25A 3CPWB 1H80A 2WADA 3IRQA 2GIVA 2K3PA 2KDZA 5JVGF 1T08B 3TGNA 4UV8A 4TMVA 3CCVB 3KP2A 3AVYA 1WORA 2E1MB 1FWZA 2EPFA 1X3WB 3GFJA 4BHCA 4WXHA 2CW5A 5K7ZA 1TNTA 3IAS2 5FJ8J 3LFUA 1AA7A 2XB5A 3WU0A 3WTSC 3H94A 2Z5UA 4ZH4F 3G2BA 3WTUC 1AHDP 3Q9SA 4QWQA 4WK8F 2AXTC 2L9SA 4BHBA 4I99C 3Q38A 1K78B 3MVPA 3BQJA 4LC0A 1UJ8A 4BACA 3GTGJ 2UV1A 2HZDA 1VQKI 3DCFA 2VPLA 4F92B 1BOAA 3SFZA 1AKHA 1Z91A 2YPRA 1YW9A 3IKTA 2KPMA 4Z4ZA 4ETSA 2R7WA 3DDYA 3I4NJ 1VZ0A 2MA3A 5LGNA 3OYDA 3GVKA 5IY5H 1H8HA 5FLVA 3ZZ0A 1TC3C 2H1KA 2XAJA 2A6HF 1WGXA 3HXLA 2RGVA 4PJMA 5CPRB 1GV5A 2VONA 1JTAA 4Y13A 2PJPA 1P92A 2MSYA 3VMVA 1IN4A 3CLQA 1A31A 3CC4I 2WAQA 4PC6A 4RD0A 5HZAA 3RIQA 5J6XA 3CCQI 5M3MJ 2DLLA 3OOPA 3RPUD 1IDKA 3OV8A 3NWSA 4IVNA 1Y8QB 2CK3A 4KICA 2BY2A 1VQLI 4Y7NJ 3CCUI 1TT5B 1OGIA 4F55A 2BM0A 1U5TB 4EM2A 3GWZA 3CC4B 4LBZA 4CA0A 3TL4X 1CLWA 3PJRA 3BPVA 5E3MA 3JQQA 2L7KA 1RZ4A 3CCQB 1MMAA 4C43A 4BUPA 3KYLA 3B4NA 2DT5A 4L9TA 4G6TB 1QGPA 1VJSA 3JRGA 2W24A 4M4SA 1ZTRA 1XGSA 3WHCA 5J1YA 2VKHA 3OSFA 2X3UA 4X0CA 3CCUB 1VQLB 1PJRA 2MC4A 1HSTA 2KRCA 3CJNA 1D1CA 4XOPA 3DBHB 2Z8GA 2V7FA 1XMAA 1WH5A 5ERIA 2OQGA 2W57A 3A0HC 3QPTA 3C2GA 4ENJA 2FMLA 1RR8C 1JKRC 1MD0A 4IQJA 3W5VA 1KQ9A 1TBXA 1QVGB 1FMVA 4PC2A 2VFNA 4DNTB 3ZPNA 5GAEJ 1Z3XA 4BBRJ 1JKQC 5IOZA 1B8IA 1FNBA 5B6IA 2OAZA 3CTAA 3P5JA 2C6YA 3KE2A 3QPLA 2HS5A 2ZZGA 3HUGA 1ZM2A 1YS7A 2P5LC 3KEQA 2M7AA 2LD5A 1WJEA 3WTTC 1U8RA 4XK4A 5FLXK 2E1BA 1S4MA 4B09A 1JGGA 4ZZDA 4NC6A 4ZJZA 1IZ1A 3HJEA 2F2EA 1WFXA 3BJOA 3G1LA 1GAQA 4U4BA 2WAQN 4WWCA 1E1QA 3R6SA 3ISPA 2DYRH 3L2WA 1H9TA 4I02A 5HS8A 3QE2A 1U2RA 2NS8A 4QPOA 1PUEE 4DK1A 2FSWA 2EZHA 4UVCA 5CVJA 1B9NA 2HVRA 5FIUA 3SEJA 1HF2A 1YQAA 2D5VA 3VB2A 2DJIA 1RPWA 5CYVA 3TOAA 4ZCLA 2BW3A 1BM9A 1RESA 4E70A 4BE2A 1F1ZA 2HNHA 1ZAOA 1XFOA 1JHFA 5GTIC 1G7SA 2LNBA 4BQOA 5JHFA 3JREA 3WU1B 2NVTJ 2LFBA 2HPMA 4OOIA 1XDUA 2X53S 3DLAA 2XPUA 2P3MA 4YFOA 2HXIA 1EZGA 4KN4X 2GREA 1I50J 3Q9VA 2ESNA 1VQPI 3PVDA 2BHYA 5AN9A 1ENHA 1WSUA 1X4PA 3CCMI 3F0CA 2PG4A 1WQ2A 1IW7F 3UKGA 2W6IA 1O8DA 1UHMA 1X1DA 3OL4A 2E7XA 1W7PD 4LG0A 4KMFA 1FRNA 1LDJA 3L2UA 2HTSA 1VQPB 2VNIA 4IRGA 4I0BA 1UELB 1MRZA 4FE4A 2DDAA 2BY0A 1KC8D 2NVXJ 1D1AA 3ZR8X 4NQWA 1WKMA 1A5JA 4YC5A 2IGMA 4W8TA 3I9V2 4BQAA 4A3DJ 3WNCA 2ACJA 3K4MA 1K4ZA 3CP8A 2KIQA 2WZNA 4RGXA 4CCMA 2C5BA 5H2FC 3OYGA 5EZHA 4YELA 1K8FA 2G7UA 2XKOA 4GGGA 1Q1VA 3TDUC 1JUMA 5IYNA 4NB5A 2VB6A 3GTJJ 4NK8A 1OPCA 1N77A 4MQ9F 1NHAA 4H9GA 1MABA 2ID3A 1YX5A 3BG9A 1DDNA 1JKOC 3GCMA 4OOXA 5EG0A 2VNJA 5BSXA 2ZXJA 3BOQA 2ELHA 1Z3YA 2K4JA 4U7BA 1EFUA 1GVHA 4NCNA 3L09A 2RN7A 3GQ7A 2PX9A 3HG9A 2JUCA 5CVVA 1VFCA 1QG0A 4BY7J 1X1CA 3JRBA 4RB2C 4MGRA 2WV1A 3E6CC 1IN6A 2C5HA 4II3A 3H3VK 2E1MC 3LJYA 3L1PA 3RPQA 3F6VA 2HOEA 4B43A 3ERMA 2ZBKA 1HA3A 4WXCA 2P7CB 2EBIA 4ZYEA 2B5OA 1MJAA 3CZ6A 1JJ6C 1KRHA 5ICCA 3JRHA 3BY6A 3REOA 2QQ9A 4Q4ZF 2IA1A 4L5EA 2HWVA 1SKYB 2ZL7A 5J1UA 3ZIAA 3IL2A 4YFKF 4OPOA 4A0XA 3OOUA 1B72A 4HQMA 3L2QA 2JQ7A 1JA1A 2RC5A 1DBOA 1TP4A 3ZOBA 1BOBA 4BQNA 3N4MA 1BQEA 1QFJA 5THXA 2NT9A 1L1IA 3V7AA 1RNLA 2P7VB 4QTRA 4FCYA 3BTCA 1OYYA 2DK5A 4BEHB 3OR1C 2JJ1A 3CCEI 3MMYB 4KIBA 3VR6A 2IS1A 3EYIA 3R6JA 1DDGA 1QH0A 1YX3A 2KIFA 4GXOA 4CZZA 1FSEA 1D1NA 3VSUA 1ZHFA 3J81K 2I1LA 3CDIA 3PO2J 3NEUA 2D74A 2HVSA 2TDXA 4XN3A 3PUFA 2Q8KA 2B9SA 4OIOF 2RQQA 3BT9A 3MKWB 2LREA 2AO9A 4L9NA 1D5YA 2BGJA 1DPUA 2P8TA 1IGNA 5K7HA 3OS1A 4M53A 2KZGA 3RPUA 2CV2A 2WSSA 3BG6A 3G3ZA 3R61A 2V26A 3QFSA 5M5YJ 1U5TC 1B6AA 1IN8A 4QPQA 2J8IA 4YDTA 4FHTA 3GLXA 4N4OB 1OB2A 1KU7A 1XMXA 2GZWA 3K69A 1ZM4A 1RMGA 4BJ5C 2RVCA 4JYKA 3TW6A 2BE5F 1WTHD 2D3LA 2QQ8A 1P4AA 1QA1A 5DUKA 1OR7C 3RYPA 2R5ZB 2QA4B 2BY3A 1IV6A 2XPVA 3HYIA 2R7XA 1AIPA 1WVRA 4ZTFA 2XGDA 4TKOB 3TOBA 1U0JA 2DA3A 3MZ8A 2ZZFA 3OE7A 1I1SA 4E4HA 4Y9RA 3A01B 3PSIA 2UUZA 4YAFA 3MKYB 3H36A 5CKTA 5F4MA 3K2ZA 1DABA 2YWGA 4M0LA 1KYZA 3HC7A 4CZCA 5DDGA 2Y9ZA 1VQ5I 2YU9J 3J7ZI 1QZZA 4AF7A 3P9IA 1SM4A 1T2KA 3KYCB 5DS9A 5EEHA 4PAAA 4ZGNB 1XPXA 2M8EA 3ES9A 2YS9A 4OOSA 1FYLA 1P6RA 2DYSH 4A2UA 4Z2YA 2WPDA 5DS0A 3A3BA 1T33A 2Z16A 1VTNC 1V5VA 3SUCA 4P5OA 1VQ5B 5FNZA 3QWLA 4RJLA 1SFKA 4YXWA 2UXNA 4R1HA 3FXQA 4BBSJ 3HOXJ 1F36A 2K5CA 3H9QA 3H92A 3QYBA 4G6IA 3P27A 1TLLA 2NVYJ 3GBGA 4ZTJA 4EJUA 2ODLA 3K0LA 1OCRH 1I3AA 3FBNB 3J81Z 2G0YA 3MFKA 4DK0A 1IUFA 4PUSA 1IRGA 3ZZTA 3VEPA 3U9GA 1N75A 2XC7A 5FO0A 2EQRA 3VODA 1JE8A 1Y1WJ 2E60A 3JSOA 2BVNA 2QEXB 4M3FA 1QA6A 1VQ9I 3HAGA 1IRZA 1Y0YA 3R0JA 1HSJA 3ECOA 5DD8A 3PUNA 3DXJF 5HXBA 1EH8A 1VQ7B 4OJPA 3I71A 5H20A 1MGTA 1UG0A 2VN2A 3H5NA 3EDPA 1V3FA 3C3WA 1IXCA 3TO6A 1YG2A 3M07A 2GJKA 4XKVA 3IH3A 1VQ9B 3DU1X 2LVSA 3VO1A 4G94A 1BIAA 1ZR2A 1ACIA 3LYCA 4A3FJ 2ZB9A 2PQ8A 4OP7A 1QVUA 4YAUA 1O8JA 3OIQA 1G2HA 1FNCA 4FN5A 3SJPA 2DIEA 1JTYA 3P9KA 1Y1VJ 3TMOA 2DMTA 4LOCA 1OCZH 4PC3A 4ROXA 1UG2A 4GRIA 3S16J 3F3XA 4HPQA 4B1RA 4A3BJ 4OZYA 3T53B 1E2XA 3CUQB 3W2IA 2FXAA 2STWA 1QBJA 3AGPA 5A89A 3HBLA 3PQKA 3AFHA 3HSRA 2GJRA 4HF0A 3I55I 1K28D 2CBXA 1XMKA 1ERDA 1O8LA 5AMVA 4MEYF 2V4DA 3U6KA 2JJ7A 5E20A 2J5PA 2M3AA 2RC6A 1EE6A 3AGQA 4ZCIA 2XNDA 1EF4A 3VNUA 1XGOA 1WXRA 5DCMA 3SFIA 2FOWA 4RM2A 3K1NA 4S04A 4W8SA 2O0WA 1TWCJ 2GXAA 1XN7A 3EYYA 4II2A 2FRHA 2HZTA 2K3FA 3BR1A 2DYIA 2W6JA 3I55B 4DOZA 2PJRB 1APLC 1YOVB 2XZPA 3ONUA 4HNTA 2K4BA 1KYWA 5IT9Z 1EH7A 4DW6A 2R7RA 1KQ0A 2QX3A 3GFIA 5KW9A 1U9OA 2EH3A 3O8HA 4AVPA 1GV2A 2Y30A 4OU0A 3OYKA 2PMDA 1QRBA 1T6YA 1WRJA 3CC7I 2R7DA 3L7WA 1O7FA 1NK3P 4L5JA 1B9MA 2R7FA 1WH7A 3TO7A 3VNVA 3H5AA 1SAXA 1CNEA 4O5VA 1TSPA 3JR9A 3H1CA 2GXGA 2NTQA 1LDDA 1SVMA 3KEOA 5DCFA 3OSGA 2WTEA 4CSWA 1WOOA 2HGCA 3PETA 4HA8A 1AMOA 1W36C 3SEZA 3MCAA 4FX4A 5AONA 2IQ7A 1NH3A 4B44A 3DEWA 1FJLA 4Z03A 2VQCA 2CUZA 3CC7B 2V31A 2FE3A 2HXOA 4HX4A 2HYFA 3IKVA 4KT6A 5ILUA 1NDHA 2VBTA 4FK8A 1O8KA 2WV0A 2RAEA 2R0QC 1A35A 1NBMA 5LMZA 2DJNA 5LRSA 1J09A 2Q6IA 3MQ0A 3KETA 1F60A 2HQ5A 1NB9A 1UD2A 2VBEA 3CMMA 4ZDOA 3BR3A 4P1VA 5KNLA 2VKEA 2ZNYA 4WQMA 3RKYA 3ML6A 4M9SA 3CLOA 3AVUA 1V4RA 5EEGA 5GPCA 3S3MA 2IJLA 2VE9A 6PAXA 1JJ2B 5HODA 2BM4A 4S05A 4RD6A 4UZUA 2GXBA 2CV1A 1R9TJ 2LY1A 2MBFA 3BR0A 4L0ZB 2GQFA 1TYVA 3TDZC 2VC0A 1O8EA 2HOTA 2NT6A 4MR0A 4KISA 2QBYA 3BWGA 1VI0A 3PFYA 5IP7J 1FX0A 4P6VF 2V1NA 1PXZA 1T6ZA 1M1KD 3KLOA 1OJLA 2ZMEA 4YIFA 3T5XA 4ENNA 5IP9J 1BN5A 2BOLA 1BR1A 2LP0A 2LBFB 4QHYA 2G7HA 4MQVA 1XX5A 1Y8RB 2LTPA 3Q3SA 4LGWA 3ZQQA 5BNGA 2P0WA 1ITYA 2M5SA 4KH3A 2EA2A 3HKZN 2V7UA 1YI2I 1IC8A 3BG3A 1B2RA 2XEXA 4A12A 2QQBA 2C4TA 1MMGA 2BM1A 2KP6A 4M9ZA 2CQQA 1N06A 1TW3A 5D8LB 2QM3A 1ETXA 3TP3A 1K78A 2INUA 5LHHA 1MW7A 3E0JB 1VQNB 1N05A 5CVRA 5DEQA 2F5VA 3QAHA 3MN2A 4EV0A 1VF9A 2M7BA 1QFYA 2O04A 2OPTA 2YSRA 1D8JA 3FPPA 2CRGA 3ML3A 2R3SA 1PKVA 1YI2B 1GVDA 1R5BA 2C4UA 1NJID 3BY2A 5F04A 1G8XA 2DOEA 5IYDJ 4HF1A 3MHPA 1R1VA 3DTIA 3K4LA 3LQRA 3KEYA 4RD4A 3B78A 4HOBA 1RUNA 4Y52J 2E5ZA 4PK4A 4UB8C 1XSXA 1W5CC 3CO7C 1PJ5A 1OCPA 3U1DA 3C2BA 2VBXA 1WP6A 1ETYA 1KZHA 1H0MA 3VMWA 3BZCA 4A3CJ 1HZEA 2HKXA 4DYCA 3F23A 1JGSA 2WR8A 3O3KA 2QXZA 4PDKA 2HDNB 2A3SA 1Z7LA 2HDDA 1G3YA 4B3AA 1A36A 2LZJA 4YAWA 4FETA 2LMDA 2PMUA 3LSPA 2D45A 1IRFA 1TT0A 4IRIA 3ZMVA 2VXDA 4DBRA 3Q0UA 2XOKA 4OIQF 2VJJA 3CCYA 2VNKA 4EH1A 1QJVA 4EMSA 3KFWX 4CICA 4A6DA 1W0TA 3LSHA 4QIWN 3MKZA 1FDRA 2K85A 3SDGA 4HF2A 1DP3A 3TW7A 2Y9YA 2VJIA 3A8JA 1KU9A 3HRTA 3BPXA 2R7VA 2QY1A 1OR7A 4LLGF 2GOMA 2ICWG 2ZZEA 4BPRA 1DGRM 3BCAA 3CJRB 4XLNF 4IXAA 2OBRA 3ZC3A 3X2QH 3GQ8A 1LFPA 4XICA 1Z67A 5K5QA 3L00A 1U9NA 2XNCA 3CCSI 1N78A 3OAAA 1HF0A 3H9GA 1RKTA 4RMNA 3ZMTA 2E2HJ 2R5YA 2EZIA 5F4JA 2IGOA 2XTWA 3T1BA 3AG4H 2X0KA 4HEA2 4R8HA 3A35A 4LK1F 1J9ZA 2M0CA 2XF7A 2WB1A 3G1MA 1HA8A 3FM5A 3ZRGA 5E3OA 1EFTA 1MSEC 3OKXA 2X6XA 3DTKA 4G7XA 3CUQC 3A02A 3CCSB 4Y7CA 3SKBA 3V8JA 1BW5A 3F9KA 1CQXA 3W2GA 1KQSB 1EP1B 1O8HA 4YCQA 2O8KA 3ZGKA 1Z9CA 3MAJA 3AL0B 2BX6A 5DN6A 3K4NA 3CRZA 4UUVA 1UD4A 1R5HA 2GQQA 2HTJA 1A8PA 4FT8A 2EIKH 1BL0A 3O6BB 2QSFX 2W48A 4JBAA 1DUXC 4BE0A 2KRFA 4RDLA 4MO7A 1O8FA 4JRAC 1HOMA 2LC2A 2LG4A 3E3VA 1QHHD 2GBYA 3W6VA 4X7DA 1R36A 3E1SA 4BE1A 4P3YA 2CSOA 3HHHA 2XSJC 3CJQB 1GR1A 4AIJA 1N07A 5D6FA 3WG7H 2PECA 2QYOA 5K1YA 3SY2A 4Q5SF 2CMPA 3W2EA 1QPMA 4L9JA 4B4CA 3CCRI 4IO9F 3WGGA 3GTMJ 1YIJB 4WZEA 3FMSA 3JTHA 5L3FA 3LSKA 3S1NJ 3DBRB 1YTYA 4FISA 3PSSA 2B7EA 3LA3A 2VKDA 4IHTA 3D26A 2HQNA 1TNSA 2OTLI 5BQTA 1T98A 5F6FA 2Q2EA 4LBWA 3CCRB 1SVLA 3TO9A 2ISYA 4UUSB 2BGCA 2CG4A 3FXLA 1O4XA 1BI3A 1TUIA 1ZG3A 2CW0F 3OS0A 3DTEA 2XGJA 2WA0A 3JRDA 5IOYA 1Y6IA 2IS2A 1RWRA 1L3LA 2IXSA 2FJ1A 3E6DA 2OTLB 1NG7A 4GYIA 1RUOA 2AXLA 2AHQA 2BM5A 3FXRA 1BI2A 1LKXA 5C3EJ 3FKSA 1YLFA 2XZOA 2FU4A 2GA1A 3KP6A 4M72A 1I5ZA 3IC7A 3M4OJ 1BN8A 2O7OA 3FXUA 3BLYA 2R7ZJ 4LFUA 3IH2A 2QGUA 1W5SA 3F8FA 4J00A 1FBQA 1VQ8I 3DKYA 2O5RA 1FNMA 3E1YE 5CDFA 4ON0A 1DU0A 4NK6A 2L7FP 2R4GA 4EEFG 2VC1A 3RDIA 4RB1A 1KGSA 3QSYA 3WHBA 2DBBA 1GAWA 2V7QA 4P9UA 3K2AA 3DP7A 1EXMA 4CHUA 1G7RA 4EGZA 1E43A 5CVUA 3VSKA 1VQ8B 2NVUB 2A69F 3OYCA 2MYSA 4MNUA 4BNCA 2L2OA 4EM0B 2MLGA 2B0RA 1H88C 4E6KG 4C2MJ 3QRFF 2DAOA 1REPC 3JTGA 2NRAC 4AYBA 2MABA 1QGYA 1YLOA 3ZUGA 3FXJA 4BXFA 3IV5A 3TEDA 4I84A 2PBIA 3WTXC 4YEJA 3Q0WA 5M5XJ 1CZFA 4LMYA 3A8IA 1KZLA 4G1VA 3HRMA 3OYIA 3NAUA 2V6EA 2MFZA 3G1OA 3WU2C 1G7CA 1ZKGA 4QUZA 2YUSA 3HRUA 2CU7A 2ZBVA 1PP8F 1QU3A 3J7YJ 2BV6A 1FYMA 2JMWA 2EIXA 4HX7A 2QKMB 4Y17A 2X1EA 3CUOA 1PJ6A 1FY7A 1IJWC 2NS7A 3FISA 4RB0A 2HU9A 4BEHA 1Q7YD 2DQLA 5FD6A 1OFMA 1FP2A 4KITB 1D5VA 4PJNA 5LD2C 2V6CA 2BYVE 2LF7A 3Q6QA 3A2KA 1DQUA 2P5KA 2R7UA 5ICFA 3D1NI 4M6YA 3CD6I 3GZ5A 2GPJA 3CC2I 2JT1A 1K73D 5D6EA 3OMYA 2M34A 3AG3H 1ZREA 5F0HA 1O88A 2XT4A 3EQNA 4A69C 4J01A 3WNDA 2F48A 4HRIA 3KP4A 2M30A 2R7OA 4F93B 4XLPF 2ZJQF 5AIPA 2RNGA 2BEOA 3CD6B 4E7ZA 3OYBA 2LKPA 3GW2A 3QP5A 1B4AA 4ANJA 4HDUA 3CC2B 4OJ5A 1XS9A 2E5NA 1BR2A 2HMAA 5J3LA 4ZZLA 4P1WA 2K40A 4A3JJ 1UHSA 1NK2P 5BPDA 3WYAA 3FWEA 2R5ZA 2O9LA 4H4KC 1HW2A 1MMSA 1R00A 1I39A 1O8MA 4CDGA 3D5SC 2B7CA 4AYBN 2OBPA 3ERED 3A01A 3VSLA 3WG9A 1KK1A 1V0EA 1LDKB 5KSWB 1OGMX 1GXQA 4HW0A 2CWEA 1GO2A 3MKLA 4CXFA 2KKOA 3BZKA 2NSTA 1LEAA 3V42A 5FD5A 1XD7A 2VXZA 4A5NA 1J9IA 1A04A 1A6QA 2HR3A 1DU6A 3N90A 3RKQA 3JU4A 2VFOA 2DY1A 2XAHA 4PC7A 3PSFA 2AS5F 3ZQLA 3B90A 1B1BA 1XB4A 2H09A 3QQAA 2VASA 5EGOA 1GT0C 4KYWA 3BH4A 3RQIA 1MDMB 4LBYA 1T56A 2L02A 4UAJA 3G71B 1ZYRF 3J7AY 2DTZA 3HM5A 1GXPA 4F7ZA 2OYNA 4B4DA 3GTLJ 2L3DA 3DQVC 4AIDA 2CF4A 1SFOJ 1M90D 2OA4A 3AL0C 4RDKA 1I18A 2D1HA 3K10A 3FZVA 1W0UA 3R60A 3D0SA 4ZC3A 3BTJA 3LNQA 2XRLA 4EW9A 5HLIA 2FQ4A 2KL4A 4G7HF 1H85A 4KFCA 4JOMA 1KD1D 4Z6YA 1XTAA 1U3EM 1WI3A 2G9WA 1X0CA 2EWEA 2DFIA 1ON1A 1XGMA 2VBUA 3QOPA 4C0SA 5KAIC 2WJYA 1V5FA 4M71A 1HG8A 1TWAJ 2F5DA 5LRRA 1OISA 3KYDB 2P6SA 4DYQA 1FT9A 1QQIA 1W1WE 2LDUA 5C44J 1P4MA 4HNUA 1W34A 5IYRA 2DERA 1LM1A 4ZYHA 4CCJA 2NYXA 3KIOA 1ZK8A 3FK7A 5FKKA 1VQ6I 4HIZA 2FUG2 2Y75A 2Y69H 3DBLB 2C77A 3JCUC 5FO5A 1TYUA 4IEJA 2VUMJ 4OINF 1KU2A 2Y31A 2BVLA 2EWNA 1S7EA 3U21A 5J35A 4PABA 4MIMA 4HWVA 2PMZA 3JQPA 2D2WA 5H6RA 5BMZA 4RPBA 1JB9A 2QENA 1SFEA 1VHEA 2B0LA 3I1FA 1OYWA 1BLIA 3VO2A 1T5EA 1VQ6B 2LSOA 1YRNA 2H27A 1EP2B 2EIMH 2VJ5A 1MH4A 3T8TA 1QA2A 2L5QA 5HS7A 1J2XA 3F8BA 3LNNA 3I56I 4G5GA 5EYRA 1QUFA 2JSCA 3ZSCA 4A93J 3HB9A 2EFWA 1W0JA 2W25A 2VQHA 4LIVA 4V2FA 2FBKA 3RKXA 2DTRA 2KFDA 4YZQA 2MH9A 2JJ2A 3RJPA 3PM1A 3B8HA 2E34A 3DFGA 5AIQA 3A1PA 4ZCMA 2BZTA 1IUYA 4IOCF 3M1CA 3I56B 2EFNA 1FTTA 1S7OA 3QFRA 1EA3A 2DMPA 1T95A 4C9YA 2VBSA 2V9PA 1LQ1A 1ETOA 1LJ9A 4LITA 3W6KB 3I0TA 2PJRA 2NXNB 4BKXA 3K70D 4RAZA 2Z33A 4NDLA 5J47A 2W00A 3FXKA 4Y9UA 2VNHA 4OPVA 3CP2A 3K9TA 1C0WA 4X8IA 1HDPA 3R0AA 4U49A 3OP1A 3WE2A 4ENKA 3V7SA 3WODF 1N25A 4D7MA 1DGWY 2DU9A 1YX2A 3GIRA 1EJ9A 3RSNA 2H94A 1GUUA 1E1RA 3DPLC 5HLHA 4G8XA 2PMZN 3KCCA 2AHOA 5L3DA 3GO5A 1YJWI 4NC8A 2TCTA 3PQJA 2L9RA 1YFHA 3DU5A 1AKHB 2FVGA 2DI3A 3MMPA 4IF4A 1F9NA 3BY1A 1MBKA 4ACAA 4XKBA 5JLWA 4U7DA 4M6XA 3JRCA 1FZPB 2EJRA 2M5WA 2IAIA 2DDBA 2D1VA 3JRFA 2VBWA 4QVJA 1R7JA 1I6HJ 2I8DA 4AIKA 4XRFA 1ONVA 2ZJPF 4M9XA 3ASOH 1BC7C 1IN7A 4RD1A 3V76A 3ASTA 5TY0A 2KMUA 3JRIA 2XHKA 5DM6F 4B3XA 3M3YJ 1YJWB 2QA4I 2DA2A 2LF8A 3QPHA 1W4MA 3OY9A 5FRMA 3BNWA 3M8JA 1W5TA 3RY8A 3ABMH 2KVOA 1ETQA 1ULYA 1ZLKA 5E79C 3ZZUA 1YYVA 1K61A 1IDJA 4MFEA 4PGGA 1YO5C 1MNDA 3OJWA 1W87A 4FQGA 3WBJA 5GP9A 1HXDA 2JWTA 2NNNA 3L9FA 2A05A 2P6TA 3ABKH 1R23A 4L18B 1OGOX 4CCNA 5JHUA 2B63J 3KZZA 2CFOA 2JA5J 3DEUA 1EKEA 4CQJA 5E8GA 2Q6KA 3M8FA 2OZ6A 4XLAA 1QX4A 1BI0A 1OB5A 2CQKA 2BXYA 2DA1A 4IRHA 4MYTA 1QHGA 3KL9A 5H59A 1FRQA 4MFDA 1TZLA 1QZYA 2OD5A 3GMEA 3I54A 4YG2F 4XL9A 3ZXSA 4TMWA 2LBFA 3T9GA 1MMDA 2CUFA 2Y0MA 3C2HA 1OFEA 2ZL5A 2EIJH 2E1CA 3WTWC 2NV4A 1B8IB 3OZUA 2RDPA 3IUOA 3P4GA 4PJJA 2OBSA
chains in the Genus database with same CATH topology
3BC9A 4BU2A 4PJLA 2NT6A 2KLOA 4KISA 3KEWA 4MR0A 2X6YA 3PFYA 2WAEA 3KX2A 2LYCA 2V1NA 1FX0A 1PXZA 3WWGA 3EUKL 4XKWA 1V5EA 4XN0A 4YRVA 2AQEA 1SAUA 1D0YA 1RU4A 1WJDA 2BOLA 1O8IA 1BR1A 1E3XA 2LBFB 1QCXA 2PYGA 3VMWA 1P9QC 3ZQQA 2K9LA 2P0WA 3OYEA 1D0ZA 2WY7Q 2M5SA 4L8JA 4Z1MA 4KKUA 2WZPP 2O17A 3LMWA 3DPTA 4RLQA 1OFLA 3VYRB 1MMGA 2XF6A 3A3GA 2KP6A 4EATA 3K70C 3EQOA 1WPCA 1K5CA 4URRA 2Y0SA 3K4KA 3SYTA 2L9NA 2INUA 1FMWA 1MW7A 3BCBA 3E0JB 2VBKA 4X0GA 1H80A 2F5VA 3GVLA 3VSVA 2NTPA 2Q2EB 2M7BA 2WADA 2HLDA 3OW7A 3FPPA 2K3PA 2O04A 1E0EA 2NZMA 2V9KA 2X85A 1PKVA 2DCEA 4XR6A 4F91B 2Q1ZB 2E1MB 2ZFUA 1G8XA 3QODA 3DTIA 3K4LA 3KEYA 3IAS2 3PNTA 2JVGA 3LFUA 4JMQA 1AA7A 2E5ZA 4PK4A 3OYHA 3H94A 3N05A 5HLTA 3G2BA 2JDIA 2DT7B 1ZELA 3MD2A 3QYFA 3OEHA 2L9SA 4XMYA 1BMFA 3OYFA 1WP6A 5HNHA 1Y56A 1OB0A 4OJ6A 1HZEA 4BACA 2UV1A 2HZDA 2XAUA 3IAM2 2VPLA 2QXZA 4F92B 1DBGA 1Z7LA 3K4JA 1OHHA 2KPMA 2R7WA 2LZJA 4FETA 4NQWB 3DDYA 2X6WA 1TT0A 1VZ0A 3OYDA 2VXDA 4DBRA 1H8HA 3GVKA 1WJBA 2XOKA 2DT6A 4HSRA 2VJJA 3HXLA 1I8DA 5CPRB 4PJMA 1QJVA 4NC7A 2XZLA 1JTAA 3VMVA 2QE7A 3LSHA 3MKZA 2WAQA 1DP3A 3T56B 4BL0B 2KQRA 2CUJA 4IKFA 2VJIA 3FKJA 3RQ4A 2R7VA 2QY1A 2XF5A 3QOEA 2GOMA 3RPUD 4IZZA 1IDKA 2ZZEA 1DGRM 1MNEA 2M4GA 3BCAA 3CJRB 3NWSA 4JQFA 4DGWB 3ZSCA 4W8RA 3GQ8A 2CK3A 4OAZA 1LFPA 2UWMA 3TBIA 4BGDA 4F55A 1N78A 1KONA 3OAAA 4CA0A 3TL4X 3H9GA 4RMNA 3PJRA 3W3CA 4BDYA 4BJTA 2WJVA 2L7KA 2IGOA 1MMAA 3B4NA 4BUPA 3KYLA 4G6TB 1NG6A 1VJSA 4HEA2 3A35A 2XF7A 3VYTB 4KKTA 2WB1A 2VKHA 3ZRGA 1HA8A 2X6XA 3DTKA 1PJRA 2MC4A 5HVQC 4G7XA 2KRCA 1D1CA 4XOPA 2Z8GA 1O8GA 2V7FA 4E7SA 2R7TA 3HL2A 3F9KA 3C2GA 4IQJA 1WJ5A 1O8HA 1FMVA 3ZGKA 1WJFA 4XLCA 4IX7A 3H9JA 3AL0B 5DN6A 2ZSIB 3K4NA 4Y3OA 1UD4A 4DNTB 3ZPNA 1Z3XA 4YZXA 2HPIA 3SZGA 3RTRA 2JIZA 2ZZGA 4BE0A 2M7AA 1O8FA 2CV0A 1WJEA 4D9JA 2E1BA 4PMHA 2LC2A 1LVKA 4HG2A 1GLNA 2LG4A 1KTWA 2RREA 1QHHD 2ZXHA 4ZJZA 3E1SA 1WFXA 2ZXIA 2JUGA 4BE1A 5FL7A 2DOAA 2XSJC 4U4BA 1E1QA 3CJQB 1X1AA 2CW8A 3FDYA 3GQAA 3ONQA 3L2WA 2PECA 1X4OA 2CMPA 1V5GA 4QPOA 4DK1A 4N4NB 4CH7A 2HVRA 4E0FA 3LSKA 3OFNA 4C2TA 2DJIA 2IGNA 2BW3A 2VKDA 3HUGB 4BE2A 2HNHA 4Y4RA 3A1YA 3PNVA 4BQOA 5JHFA 1W9XA 4TSFA 2HPMA 2INVA 2VJ4A 3UNGC 2X53S 3DLAA 3OWTA 1WJAA 5HKKA 2PYHA 4OZZA 4XOTA 2JSPA 4XORA 3OS0A 2VIXA 3DTEA 3LL7A 2XGJA 2NSPA 1X4PA 2WA0A 1Y6IA 3S32A 2IS2A 3OIPA 1RWRA 2KHMA 4RLFA 3PL8A 2IXSA 1XG2A 1NG7A 2W6IA 5CQGA 1BPLA 3VSTA 1O8DA 4E7IA 2VL8A 3WQZA 2UVFA 1X1DA 2BW3B 5FROA 1LKXA 3OL4A 3FKSA 2XZOA 4XM3A 3L2UA 1W36D 4CCKA 1BR4A 1BN8A 3BLYA 3HOTA 1UELB 4J00A 4XLHA 1D1AA 2O5RA 3DKYA 3ZR8X 1UD8A 4P22A 4B3GA 2UVEA 5CDFA 3OR2C 4NK6A 3K6GA 2R4GA 2IGMA 4W8TA 3I9V2 3K4MA 3L2RA 3CP8A 2DXIA 2V4JC 4CCMA 4F52A 2V7QA 3H35A 4BDZA 3GQ9A 3OYGA 4YELA 1E43A 3VSKA 1OOCA 2QKLB 4D1QA 2VB6A 3OYCA 2MYSA 4NK8A 2L2OA 1N77A 4E6KG 1MABA 1YX5A 4AYBA 1VBLA 2MABA 3VYUB 2CH0A 4ZDLA 4BXFA 4I84A 4ZDPA 4YEJA 2GJPA 2LY2A 3AKZA 3LSMA 4U7BA 1Z3YA 1CZFA 1KZLA 3DPUA 3OYIA 2NTBA 2V6EA 2MFZA 3W2AA 3GQ7A 3HG9A 2D3NA 4DJAA 1X1CA 4AU7A 3PNYA 3K4BA 1QU3A 3G05A 2KDOA 4B3FX 4II3A 2QKMB 1AIRA 1MMNA 2E1MC 2X1EA 3SDBA 5FRNA 4Z05A 4BEHA 2HU9A 4B43A 1KMHA 1OFMA 4BQQA 3GQBA 2F1MA 4KITB 4RM3A 3UW0A 1KCDA 4PJNA 5LD2C 3CZ6A 3OYLA 3A2KA 1DQUA 2R7UA 5C1CA 1SKYB 2XDVA 3BCDA 3ZIAA 3OMYA 3OOUA 1DBOA 3L2QA 1O88A 3EQNA 4E7HA 3NE5B 1BOBA 4BQNA 4J01A 2WY8Q 4XLFA 2NT9A 4Y33A 4HRIA 2Z2SB 3KRGA 1PYVA 2R7OA 4F93B 4G7WA 2GOXB 4PFPA 4TT3A 2RNGA 4BEHB 3OR1C 2JJ1A 3MMYB 1Z21A 2X51A 3VR6A 4E7ZA 2IS1A 3OYBA 4ANJA 4AVZA 1YX3A 4OJ5A 2E5NA 1BR2A 3VSUA 4PFOA 4P1WA 4XNFA 2HVSA 4XN3A 3EUAA 3D5RC 2RQQA 4MLOA 3MKWB 2LREA 4H4KC 1O8MA 5KCMA 3D5SC 3OS1A 1D1BA 2CV2A 3DU6A 2WSSA 3BG6A 3VSLA 2V26A 1NHCA 5C1EA 1V0EA 3W2WA 1LDKB 3HKZA 1X19A 1OGMX 4QPQA 1K6YA 2GK6A 2JVHA 4N4OB 2NSTA 1YE9A 3BCFA 4U87A 2F6CA 3V42A 1RMGA 2VXZA 3RCOA 4BJ5C 1E3ZA 3NWTA 4C2LA 3OL3A 3S8PA 1WTHD 2HDWA 2D3LA 1COWA 3JU4A 2OUMA 4LG3A 2Z1DA 3HPHA 3PSFA 1OR7C 3B90A 1UD6A 2W82A 2A5WA 4HSTA 2R7XA 3OYAA 1E79A 4ZTFA 2VASA 2M0MA 1U0JA 2ZZFA 2X8KA 3LSIA 3BH4A 3OE7A 4E4HA 5HNFA 4ASUA 1WMRA 4E7LA 3PSIA 2UUZA 3ZPPA 3J7AY 3MKYB 4BS9A 5CKTA 3BG7A 1R6RA 3DQVC 1I18A 3AL0C 3K10A 3HC7A 1WJCA 4CZCA 4ZC3A 1D0XA 4NNJA 4XLEA 2VQLA 4EW9A 2KL4A 4XONA 1X1BA 2NOJB 4JOMA 4F3QA 1UD5A 1KCCA 2K9MA 2ZSHB 1X0CA 2EWEA 4IQ4A 3S93A 1UAAA 2R9VA 2WPDA 2KZVA 5TGTA 4C2UA 4YZAA 3A3BA 1JI8A 2Z16A 5LFAA 2WJYA 1V5FA 3SUCA 4P5OA 1HG8A 3W2VA 3OEEA 4YZ0A 1SFKA 3CF2A 2ZTNA 2O1DA 4YXWA 4HNUA 1IA5A 2ELJA 4CCJA 3OYNA 2W7NA 4HIZA 2FUG2 4FXUA 2K5CA 3A4CA 3H9QA 3QYBA 4G6IA 3JURA 3GBGA 4ZTJA 2ODLA 3FBNB 2BVLA 3U21A 4DK0A 4HWVA 3DEEA 2PMZA 4PUSA 4CCLA 1UD3A 1N75A 2XC7A 4BJ6C 2E60A 1BLIA 1T5EA 2X1CA 2HVQA 3HAGA 5CQEA 2W1OA 2VJ5A 2AQFA 3T51B 2OC6A 2L5QA 4OJPA 2GK7A 4GQNA 2ZZQA 3LNNA 2X3HA 1IRXA 1UG0A 3DWLE 1H8EA 4R79A 3H5NA 1T0FC 1HVXA 1W0JA 2VQHA 3GVJA 4W8QA 4LIVA 3VWBA 4CCOA 4CUGA 4KKSA 2O0VA 2GJKA 2JJ2A 4YZQA 4XKVA 4ZYAA 3LMMA 3PUBA 2F43A 4OJLA 3HPGA 3EUHC 1GQ8A 3L2VA 5KHDA 2CW7A 3BC8A 4FASD 3M1CA 1O8JA 1IB4A 4OJOA 3OIQA 1PLUA 2OV7A 1EA3A 2LH9A 1T95A 4C9YA 2LRDA 2DIEA 5IK2A 4KJZA 3TMOA 4LITA 4PSWA 4DBQA 4ITVA 4OAYA 1NRKA 4GRIA 2VLAA 4HPQA 3K4CA 4OZYA 2W4SA 3LSGA 4DIQA 2PJRA 4TKOB 5HOOA 3K70D 1V0FA 3VDXA 3T53B 3D5LA 2IGKA 1VLYA 1OLTA 2W00A 3AFHA 2GJRA 3GRHA 3CP2A 1O8LA 1K28D 2ZTGA 1ERDA 5AMVA 2JA2A 3OYJA 2V4DA 4XQFA 4NUBA 1EFRA 4U49A 2M3AA 1DGWY 2WBMA 2IS6A 2F4IA 1EE6A 3B8YA 2XNDA 2KRHA 2WAFA 2R7QA 3RSNA 4RM2A 1E1RA 2HQAA 3DPLC 4W8SA 2O0WA 4C30A 4LIUA 2X1DA 4NC8A 2BSPA 2BVMA 2LOOA 3DU5A 4II2A 2W6JA 4MXNA 4DOZA 1S9HA 2PJRB 4XKBA 4DNRB 2XZPA 4HNTA 2MD0A 3S3OA 2I8DA 2R7RA 2KMUA 3SEQA 3ZCOA 2QX3A 4B3XA 1W0KA 3OYKA 3OY9A 5FRMA 3M8JA 3S3NA 4XD7A 1PE9A 2KVOA 1JRGA 4XKCA 3H5AA 3H0DA 3OOCA 3EPZA 1VF7A 2NTQA 3UR3C 2CS3A 4CSWA 1BHEA 1W36C 3SEZA 1IDJA 1MNDA 2R7SA 2IQ7A 4B48A 4B44A 4Z03A 2VQCA 2CUZA 3OYMA 2IS4A 3OPOA 3IP4B 4B47A 4E7JA 2V31A 1OGOX 4CCNA 2CFOA 4KT6A 1O8KA 4Z06A 3VYSB 4PSXA 3QYEA 4XLAA 1NBMA 1J09A 1QHGA 2Z6BD 2A6TA 2VQGA 1TZLA 3CESA 3HOSA 4E7KA 1UD2A 4XL9A 3CMMA 4ZDOA 3ZXSA 3FHNA 2VBEA 5KNLA 2LBFA 3T9GA 3I3LA 1MMDA 3C2HA 2VBMA 3DKXA 3FY3A 3H5RA 3S3MA 2M4KA 3OS2A 4UZUA 1G59A 4OWRB 2CV1A 2LY1A 3IUOA 4PJJA 3FBIB 1O8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZX A;  2NT6 A;  4MR0 A;  2X3H A;  5C1C A;  2X6Y A;  3ZSC A;  4W8Q A;  1PXZ A;  3WWG A;  4XKW A;  1O8F A;  4XN0 A;  1DBO A;  1O88 A;  3EQN A;  2O0V A;  4YZQ A;  1RU4 A;  4XKV A;  4PMH A;  4XLF A;  1O8I A;  2NT9 A;  1KTW A;  4OJL A;  1QCX A;  3KRG A;  2PYG A;  1GQ8 A;  3VMW A;  1NHC A;  4U4B A;  1O8J A;  3GQA A;  3LMW A;  1IB4 A;  2O17 A;  4OJO A;  1PLU A;  2PEC A;  1OFL A;  4AVZ A;  4OJ5 A;  1K5C A;  3EQO A;  3VSU A;  4URR A;  4XNF A;  2INU A;  2VBK A;  4XN3 A;  4OZY A;  1H80 A;  1O8M A;  3VSV A;  2NTP A;  2NZM A;  2O04 A;  2X85 A;  3GRH A;  4XR6 A;  1O8L A;  2INV A;  5AMV A;  4U49 A;  4XQF A;  5C1E A;  1OGM X;  2PYH A;  4OZZ A;  4XOT A;  1EE6 A;  4XOR A;  3B8Y A;  2NST A;  2NSP A;  1RMG A;  4W8S A;  2O0W A;  4XMY A;  1RWR A;  1XG2 A;  4C2L A;  2BSP A;  4OJ6 A;  3VST A;  1O8D A;  4MXN A;  3B90 A;  2QXZ A;  2UVF A;  1DBG A;  4XM3 A;  1WMR A;  1BN8 A;  2X6W A;  3ZPP A;  4XLH A;  2VJJ A;  2QX3 A;  2UVE A;  1QJV A;  1JTA A;  4NK6 A;  3VMV A;  4W8T A;  4XLE A;  4EW9 A;  2VJI A;  4XON A;  2QY1 A;  1PE9 A;  1JRG A;  3GQ9 A;  1KCC A;  1IDK A;  1X0C A;  2EWE A;  4YEL A;  2NTQ A;  4W8R A;  1OOC A;  3GQ8 A;  4YZA A;  1BHE A;  3SUC A;  1IDJ A;  4NK8 A;  1HG8 A;  2IQ7 A;  4Z03 A;  4YZ0 A;  2O1D A;  1VBL A;  1IA5 A;  1OGO X;  3B4N A;  4I84 A;  1O8K A;  4Z06 A;  4YEJ A;  3JUR A;  1CZF A;  4XLA A;  2ODL A;  2NTB A;  3GQ7 A;  2X6X A;  4HWV A;  2VBE A;  4XL9 A;  4XOP A;  2Z8G A;  1O8G A;  3T9G A;  1AIR A;  2VBM A;  3FY3 A;  1O8H A;  4Z05 A;  4XLC A;  1OFM A;  3UW0 A;  1KCD A;  4OJP A;  1O8E A; 
#chains in the Genus database with same CATH topology
 5ICE A;  2P4W A;  5C4J J;  3GLL A;  1YS6 A;  2NPF A;  1U8B A;  3U2R A;  3EUK L;  4XKW A;  2QEX I;  4XN0 A;  1BX0 A;  5E1X A;  1BIB A;  5JR3 A;  4J0Q A;  1ZLJ A;  1WJD A;  5HDK A;  1E3X A;  1FBU A;  1VQ7 I;  3LA2 A;  2RC4 A;  2PYG A;  3M9A A;  1P9Q C;  4RLZ A;  1WPK A;  2K9L A;  4Z1M A;  1D0Z A;  2E35 A;  1G3W A;  4RLQ A;  3PEN A;  5IT9 K;  1OFL A;  2PLF A;  2E7W A;  4BXU A;  1QZE A;  1VHO A;  2IBD A;  2K9N A;  4URR A;  2Y0S A;  3HOV J;  2FF4 A;  4RPD A;  3S2W A;  1WHU A;  3VSV A;  2NTP A;  2NZM A;  2HLD A;  2DFF A;  2J5O A;  1T38 A;  4D7N A;  3OW7 A;  2XB0 X;  3JQR A;  2V9K A;  2X85 A;  4OIR F;  2DCE A;  4XR6 A;  5CVI A;  4V02 C;  5J1R A;  2ZFU A;  4ESF A;  5J4Y A;  3LAJ A;  2BF4 A;  5D5W B;  4N3N A;  3AVW A;  5DD4 A;  3S2D J;  2BSA A;  1HC8 A;  3ESW B;  3PNT A;  4RA2 A;  5TR9 A;  2J7K A;  2COM A;  3OYH A;  3ONY A;  2ETH A;  2YR2 A;  3N05 A;  3MD2 A;  2CRV A;  5HDN A;  1HKT A;  2M87 A;  3I64 A;  1BMF A;  3M7G A;  3O2P E;  5F64 A;  3OYF A;  3BQY A;  1ZUN B;  4BAY A;  4LG0 B;  1OB0 A;  1IXS B;  3PUM A;  1MSF C;  4P96 A;  1HQC A;  2A68 F;  2GIZ A;  2YX4 A;  3IAM 2;  1RKW A;  2F3L A;  5E1Z B;  5D5V B;  4EM1 A;  1J7K A;  1UMQ A;  1MH3 A;  2MD5 A;  3I4M J;  4NQW B;  2X6W A;  2VE8 A;  1H89 C;  3FMR A;  4WZK A;  1WJB A;  1I8D A;  4C3J J;  4IHW A;  1P2F A;  4PCQ A;  2F4M B;  3T56 B;  4BL0 B;  2JA6 J;  4HV6 A;  2HKO A;  3B6C A;  4I01 A;  4FE7 A;  4LB6 B;  4OMZ A;  4IKF A;  3RQ4 A;  5JBQ A;  2I5U A;  2XF5 A;  5E6T A;  1DAR A;  2XRO A;  2NNY A;  4IZZ A;  1MNE A;  3WTZ A;  4A5M A;  4DGW B;  1Y0U A;  3J7A O;  2ZBU A;  1K4S A;  2KIS A;  3JRA A;  3QFC A;  3SJM A;  2QMU A;  4W8R A;  4OAZ A;  2M45 A;  4BGD A;  5EG0 B;  3I59 B;  3W2H A;  1X2M A;  4IHV A;  1O3R A;  1X2N A;  2YWF A;  4QLC U;  3GX4 X;  2Y0S N;  3W3C A;  1KK3 A;  4BJT A;  1KTV A;  1FBS A;  1ORK A;  5D4R A;  1W35 A;  1HKS A;  2IRF G;  4EJO A;  1SMT A;  1M1E B;  5DTD A;  3HTS B;  4KKT A;  3AVX A;  2CYY A;  3MZY A;  5HVQ C;  2BGI A;  4CYD A;  2HFH A;  4EJV A;  4RGU A;  4E7S A;  5E18 F;  3FX3 A;  1T39 A;  1O8G A;  3HOZ J;  2V1D A;  3BH6 B;  1ZN2 A;  2GAU A;  2JK3 A;  2LLK A;  2ZL6 A;  4UZF A;  3DF8 A;  4X6A J;  1WJF A;  4P55 A;  4XLC A;  3H9J A;  4IX7 A;  2JA7 J;  1JKP C;  1D8T A;  1LLZ A;  2DN0 A;  3ZQ7 A;  2QN6 A;  4Y3O A;  3B6A A;  4GO1 A;  5KK1 A;  1AU7 A;  4I2O A;  4YZX A;  3SZG A;  4IOA F;  1B72 B;  1U6G A;  2VBZ A;  3AG2 H;  1PUF A;  4EGY A;  3R6K A;  3AAF A;  2V5I A;  4D9J A;  1Q81 D;  1LVK A;  1GLN A;  3W2F A;  1KTW A;  2RRE A;  3S1R J;  2XUB A;  5K7F A;  2DOA A;  2ME6 A;  1X1A A;  3HSF A;  5E17 F;  1D2E A;  3C18 A;  3KPH A;  2VFM A;  4CH7 A;  4HDV A;  3P26 A;  4E0F A;  4FWT A;  4CYC B;  3A8K A;  4Q48 A;  1BBY A;  1K6O A;  4C2T A;  3OFN A;  1EV7 A;  2IGN A;  1ELO A;  1HCR A;  1V55 H;  3ZMZ A;  4Y4R A;  2ZJR F;  2XAQ A;  4W97 A;  1W9X A;  4HX8 A;  4G1B A;  2IVM A;  3UNG C;  3OWT A;  3OZV A;  1R4N B;  1WJA A;  4QSH A;  1VQN I;  1XE1 A;  2PYH A;  2JSP A;  4XOR A;  2KT0 A;  2OJE D;  2E1N A;  3LL7 A;  4UV9 A;  2M2E A;  4Q7J B;  2NSP A;  4YIR X;  4YAO A;  2BV3 A;  1XG2 A;  1XGN A;  3PL8 A;  4RLF A;  1ZRC A;  3NAW A;  5CQG A;  1BPL A;  3VST A;  3LOC A;  1TQI A;  3RYR A;  4E7I A;  2VL8 A;  1OCO H;  1BA5 A;  3WQZ A;  2UVF A;  2HYG D;  3BR6 A;  2HQR A;  1BX1 A;  4XM3 A;  1USS A;  2EIL H;  1Y39 A;  1W36 D;  1YW7 A;  2DA4 A;  1BR4 A;  1JJ8 C;  4N9H A;  3HOT A;  1HBX G;  3PA2 A;  1TTT A;  3SZP A;  1N8R D;  3QU6 A;  4XLH A;  5LEK A;  5A2Q Z;  1IJF A;  3CDL A;  4W1U A;  4B3G A;  2X9D A;  2UVE A;  1S0U A;  3OR2 C;  1XB2 A;  1MJB A;  1XDS A;  3HZJ A;  4PZJ A;  3V8L A;  4ZYG A;  4G9Y A;  3WTV C;  2QWW A;  3L2R A;  3ZQC A;  4LLN A;  4BXX J;  4F52 A;  1SC7 A;  3LO8 A;  1Z1D A;  3H35 A;  3GQ9 A;  4N9I A;  3OIO A;  5EMN A;  3AK5 A;  1OFC X;  1FSH A;  3BJ6 A;  5JLV C;  1OOC A;  1F5T A;  1W2B B;  1E62 A;  3T0Y A;  2OF7 A;  2CFX A;  3BR5 A;  3H3Z A;  2YWE A;  4QV2 A;  2MH2 A;  1VBL A;  3IHU A;  1FOW A;  1U5T A;  4XSZ F;  4ZDP A;  2I10 A;  2E2J J;  4RCZ A;  2LY2 A;  5F1R A;  1VQ4 I;  1WOP A;  2OCC H;  2A61 A;  3DPU A;  4HV5 A;  2NTB A;  4MEX F;  2D3N A;  4I6Z A;  4KMU X;  4DJA A;  4RDJ A;  5IP6 A;  3K7A J;  4AU7 A;  3BTL A;  1QNT A;  1SD5 A;  3PNY A;  1FNN A;  4I0A A;  2ADU A;  2KDO A;  4LD5 A;  3G05 A;  3H9N A;  2DEU A;  1MMN A;  2Y2Z A;  5FRN A;  3CPX A;  4M1K A;  4MTD A;  2QF7 A;  3RKW A;  1KMH A;  4BQQ A;  4ZGQ B;  5FGM A;  3FKI J;  1VQ4 B;  3ECH A;  3UW0 A;  3SQN A;  5B1B H;  4RBO A;  3IRR A;  2JA8 J;  2Y48 A;  4UXN A;  5C1C A;  5TRD A;  1FEX A;  2WYR A;  1K83 J;  3JX8 A;  3NB2 A;  3ABL H;  5D8K B;  3CCJ B;  3COA C;  4AF6 A;  1R1T A;  4LLL A;  1Y0R A;  4E7H A;  1W7P B;  2OCE A;  5DYM A;  4XLF A;  3CMY A;  2ZNZ A;  5FKO A;  2Z2S B;  3BRO A;  4X06 A;  3KRG A;  4XRS G;  2GOX B;  4PFP A;  4TT3 A;  3W5H A;  4Z4U A;  1FX7 A;  5LBQ A;  5EDN A;  1Z21 A;  2DFH A;  1S7A A;  3RIR A;  3HGY A;  1WI9 A;  5DM7 F;  1WOS A;  3E7L A;  4JX6 A;  1RR7 A;  1TQP A;  4PFO A;  2HDC A;  1WU8 A;  2E1R A;  2EZK A;  1IAW A;  1S5L C;  5L3B A;  1Y0N A;  4LBV A;  3D5R C;  3Q3A A;  2ESH A;  2QGG A;  3ZQG A;  4BYY A;  1BC8 C;  2EIN H;  1R5N A;  2TRT A;  5KCM A;  4Z4Y A;  5J40 A;  3M1E A;  1MDM A;  1D1B A;  2CQ7 A;  1YIJ I;  4X7F A;  4YHB A;  5K5O A;  5DCM B;  2XT2 A;  5C1E A;  1H8A C;  2VI6 A;  1RRJ A;  2ZC2 A;  1NB0 A;  2GK6 A;  1HKQ A;  4MHG A;  3GZN B;  1N0U A;  4U87 A;  1LUJ B;  2H6C A;  3RCO A;  3NWT A;  4C2L A;  3S8P A;  2R93 J;  1TWG J;  1COW A;  2V1X A;  4IW3 B;  5L3E A;  2LY9 A;  2O8X A;  2Z1D A;  4AC9 A;  2DOD A;  4WX9 A;  2IP2 A;  4HST A;  1E79 A;  3OZW A;  4ASU A;  4M3B A;  2X8K A;  3LSI A;  4G6D A;  3N97 A;  3ZPP A;  3H0G J;  4BS9 A;  3BG7 A;  1R6R A;  3GYH X;  5EEA A;  4YII A;  1SD7 A;  3J81 k;  3PIO F;  3F8C A;  1G3S A;  5EF6 A;  4UHT A;  4H0E A;  1D0X A;  2QLZ A;  4NNJ A;  1TL8 A;  1R5G A;  2VQL A;  3G4S I;  4XON A;  1X1B A;  4UVA A;  2WB1 N;  4F3Q A;  3P7N A;  1R71 A;  2ZSH B;  2ECC A;  4IQ4 A;  3S93 A;  4LK0 F;  2R9V A;  1QVF B;  3WGH A;  4C2U A;  1SMY F;  1OKR A;  4YZA A;  1JI8 A;  1Q9S A;  5LFA A;  2QUF A;  1TYX A;  4YZ0 A;  3BG5 A;  2O1D A;  3J80 Z;  1IA5 A;  4KT5 C;  1I6X A;  1JTX A;  3HIF A;  2ELJ A;  3OYN A;  3G4S B;  4HZF A;  1YHQ I;  2W7N A;  4FXU A;  2VOO A;  5FKM A;  2R92 J;  3A4C A;  3F6O A;  3ZBT A;  3NQO A;  2DA6 A;  2ZXW H;  4UVB A;  4XID A;  2DFE A;  4G12 A;  5B5E C;  3CF5 F;  3PA1 A;  5DUI A;  2YWH A;  3DEE A;  1WSR A;  1PP7 U;  1N08 A;  2QYU A;  3SQV A;  2MW8 A;  4M73 A;  4BJ6 C;  5IYW A;  1AWC A;  1Z77 A;  5FFX A;  1STZ A;  1YHQ B;  4D5C A;  2HVQ A;  5F27 A;  4R71 A;  2UZK A;  3A03 A;  2GLO A;  3Q0V A;  3U1K A;  2FX3 A;  4Z4W A;  5CQE A;  2W1O A;  1V54 H;  3T51 B;  4WXD A;  5KAF C;  2GK7 A;  1JA0 A;  4GQN A;  2ZME B;  3L2C A;  2X3H A;  1U2W A;  1LB2 A;  3I58 A;  3V7R A;  1PDN C;  4RD3 A;  5FLM J;  1IRX A;  2JTV A;  1I7P A;  1T0F C;  1R49 A;  3VWB A;  4CCO A;  4KKS A;  2ME0 A;  2O0V A;  3ELK A;  2A6E F;  3GZ6 A;  3HHG A;  2JN6 A;  5JFR A;  3LMM A;  2PMH A;  2H1L A;  3PUB A;  4WCG A;  4OJL A;  3HPG A;  2EV6 A;  3EUH C;  3ZN0 A;  5M5W J;  1HLV A;  2O61 A;  3B73 A;  1KJZ A;  1PLU A;  1TWF J;  2XAG A;  2Z99 A;  3TP0 A;  4HLY A;  3U2Q A;  5IK2 A;  3ZBU A;  2LRD A;  2A5Y B;  2HCJ B;  2OK8 A;  2QZA A;  1ETW A;  1UHW A;  2BHZ A;  2WC2 A;  4DBQ A;  4ITV A;  4OAY A;  2G0E A;  1GJR A;  1NRK A;  1VLO A;  3ZQF A;  4DIQ A;  5LHI A;  2CGP A;  4IJA A;  3JSP A;  1ZGW A;  1OCT C;  1DPR A;  3D5L A;  3PO3 J;  1OLT A;  1ZAR A;  3LST A;  3HRS A;  3GRH A;  1B59 A;  2KIM A;  4UZE A;  2X6O A;  3DKW A;  4XQF A;  1EFR A;  5BSY A;  3F72 A;  1K4T A;  2O6W A;  1VQK B;  9ANT A;  2A07 F;  2IS6 A;  3WY9 A;  2EFG A;  1G3T A;  4WZT A;  2VPR A;  4MTE A;  3VFZ A;  2E36 A;  2ELK A;  2F5C A;  2EFP A;  2BVM A;  3FIW A;  1FOX A;  1EP3 B;  3LSJ A;  1IB0 A;  4MXN A;  2K02 A;  2GM4 A;  2DMU A;  1S9H A;  5E3L A;  4RB3 C;  2NAZ A;  5JMC B;  2IA2 A;  1BJK A;  5TV2 A;  1EH6 A;  2COB A;  4U0Y A;  2MD0 A;  2ISZ A;  1E17 A;  3S3O A;  1J75 A;  2OK7 A;  1K8A D;  1IDZ A;  5LGU A;  1JXS A;  1KA8 A;  1J0R A;  2QZ8 A;  5HZB A;  2JPB A;  3SEQ A;  3ZCO A;  2P5V A;  2VKV A;  1IF1 A;  1CF7 B;  2P81 A;  1LNW A;  3ASN H;  3BP8 A;  1JT0 A;  4RM0 A;  4A3M J;  4IHX A;  4X7E A;  4XD7 A;  1PE9 A;  1MBJ A;  3G71 I;  1S72 I;  3H0D A;  1UB9 A;  3OOC A;  2B7B A;  2F5F A;  4U0W A;  3ZQI A;  2CS3 A;  1DDI A;  3T8R A;  2M9H A;  4ZYD A;  1BHE A;  5E1W A;  2R5Y B;  5C4X J;  2R7S A;  3ZN1 A;  2DOG A;  3WBK A;  2IS4 A;  1UFM A;  2JRM A;  3OPO A;  3IP4 B;  1Z0X A;  4PC1 A;  4P3I A;  4C3H J;  1FTZ A;  1ETK A;  3ZP5 A;  5ICG A;  4LJZ F;  4GDF A;  3VYS B;  1S72 B;  3QYE A;  5JLX A;  4EJW A;  1VQM I;  2Z6B D;  2VFP A;  2A6T A;  3CES A;  2IT0 A;  1X58 A;  1BW6 A;  3FHN A;  2Q6O A;  1D8K A;  2RNJ A;  1U78 A;  1ZM9 A;  3VPR A;  2VBM A;  1E64 A;  3F21 A;  3LQE A;  3FY3 A;  3H5R A;  1QFZ A;  3CJT B;  3B82 A;  3OS2 A;  2X0L A;  1G59 A;  4RDU A;  2BMW A;  2VYQ A;  3HEF A;  3FBI B;  1VQM B;  5D4S A;  5J4V A;  2X6Y A;  3IWZ A;  2WAE A;  1ETV A;  4I76 A;  3ULQ B;  3WWG A;  2C2W A;  2ZKZ A;  2X4H A;  1V5E A;  4YRV A;  2AQE A;  1SAU A;  1D0Y A;  3BR2 A;  1FC3 A;  1O8I A;  4I98 B;  1IXR C;  1BJA A;  1L0O C;  1FOK A;  1FOY A;  1QCX A;  1O7L A;  5IYQ A;  2BSP A;  1NHC A;  1IO2 A;  2WY7 Q;  4KUM A;  4KKU A;  4RD2 A;  2WZP P;  3WNB A;  3DPT A;  3FJO A;  3LMW A;  2ECB A;  4PGH A;  4ABZ A;  4CGZ A;  4U9U A;  4NBQ A;  2XF6 A;  3A3G A;  3SZE A;  1P7I A;  4P9F A;  3ROU A;  2XAS A;  3K70 C;  4ENM A;  1WPC A;  2VOD A;  3K4K A;  3SYT A;  1LE8 B;  1IV8 A;  2L9N A;  1FMW A;  3BCB A;  1UCR A;  1R5O A;  4X0G A;  4M2L A;  2V9V A;  2H6B A;  2Q2E B;  4RGR A;  4RAG A;  3SJZ A;  3GUD A;  3CCM B;  1E0E A;  2F1L A;  2DQR A;  4J19 A;  3CME I;  4F91 B;  2Q1Z B;  3CUQ A;  3SXY A;  4OIP F;  5GPA A;  1LVA A;  1O57 A;  2OTJ I;  4JP0 A;  2N8G A;  2ZFW A;  3QOD A;  4A0Z A;  2IA0 A;  1XSD A;  1P4W A;  2L7Z A;  3W5U A;  2K86 A;  4OOV A;  2JVG A;  2BBY A;  2WWY A;  2V7X A;  4JMQ A;  5HLT A;  3S2H J;  2JDI A;  2DT7 B;  1ZEL A;  1F20 A;  1R58 A;  3QYF A;  4G7O F;  1LLW A;  3F8N A;  4IPA A;  3OEH A;  4XMY A;  4A3K J;  3H09 A;  2DPD A;  5HNH A;  1Y56 A;  5L3C A;  3CME B;  4JX4 A;  5A88 A;  2F4O B;  5FLX Z;  3RI4 A;  4OJ6 A;  2M8G X;  2XAU A;  3IH4 A;  4M6V A;  2OTJ B;  2DA7 A;  5LHG A;  2STT A;  5GV8 A;  1DBG A;  3K4J A;  1OHH A;  3WE3 A;  2ZJ2 A;  3N6Z A;  3I59 A;  5CLS A;  1P7J A;  5GAH J;  3WXM A;  2MGQ A;  2YU3 A;  5J8F A;  2DT6 A;  2FD5 A;  4HSR A;  1R4M B;  1RET A;  2JN9 A;  4NC7 A;  2XZL A;  1YJ9 I;  2QE7 A;  5LLQ A;  1Q1H A;  4XBF A;  2ZME C;  2KQR A;  1MKM A;  2CUJ A;  2ZO4 A;  3KLN A;  3FKJ A;  2XNJ A;  3HDD A;  3QOE A;  4DQ2 A;  3HOU J;  4JQF A;  2M4G A;  2QCO A;  3SLD A;  4V2G A;  5D5U B;  3GFL A;  3LA7 A;  2UWM A;  3TBI A;  4CO8 A;  4FTH A;  1YJ9 B;  4G6Q A;  1KON A;  1X3Z B;  2FNP A;  2L9V A;  1SD6 A;  3CW2 A;  4BDY A;  2E1O A;  5E3N A;  2WJV A;  3E6B A;  3CQZ J;  4Z4R A;  2CJJ A;  1NG6 A;  5FKL A;  3U6B A;  1XQB A;  2FOK A;  3G73 A;  3GF2 A;  2KJB A;  3VYT B;  1KK2 A;  4A3G J;  1JUS A;  2PN6 A;  3KP3 A;  3OJX A;  1Z7U A;  2VBY A;  3FMQ A;  4IHY A;  2E71 A;  2R7T A;  4XRM A;  4UUT A;  3HL2 A;  3NRV A;  1LFB A;  1WJ5 A;  3LVB A;  1HW5 A;  2ZSI B;  3ABU A;  5IYB J;  5LGT A;  4L0Y B;  2QSG X;  2NS0 A;  2HPI A;  4CYC A;  2CQN A;  3RTR A;  2DO7 A;  2JIZ A;  4V19 K;  4M3E A;  1OCC H;  3CCE B;  3MZH A;  2E19 A;  1JNY A;  1RQP A;  2CV0 A;  1X3U A;  1VND A;  4JK1 X;  2CUE A;  4PMH A;  2W85 A;  4HG2 A;  1MBF A;  1O3S A;  2ZXH A;  4K1X A;  3GTO J;  2ZXI A;  2JUG A;  3V7C A;  5FL7 A;  3GQA A;  2CW8 A;  3FDY A;  3FF5 A;  4TV7 A;  3ONQ A;  3ZQH A;  3CMA I;  4N3G A;  3DLL F;  5FB2 A;  1X4O A;  2IEK A;  4X7C A;  3KP5 A;  1OYI A;  2RV8 A;  1V5G A;  4I09 A;  3TKY A;  1YIT I;  4N4N B;  2BN4 A;  3BTI A;  4FX0 A;  4YAL A;  4UB6 C;  4C3I J;  1TTY A;  1T0F A;  3QP6 A;  4BY1 J;  4RS8 A;  3ZPL A;  1E3O C;  2XPW A;  2EV0 A;  3HUG B;  5L3G A;  2CO5 A;  2EFO A;  3A1Y A;  3PNV A;  5J3O A;  3GXO A;  2QDX A;  2L54 A;  3EUH A;  4TSF A;  4O6J A;  2KJC A;  5FA6 A;  3CMA B;  2K9Q A;  2INV A;  2VJ4 A;  1G4D A;  1WDT A;  1WWX A;  1YIT B;  5HKK A;  2XKP A;  2XGX A;  1RC9 A;  4OZZ A;  4HQE A;  2UXX A;  4XOT A;  2DMQ A;  1TQM A;  1Z6T A;  2VIX A;  2XGE A;  3E6M A;  4OPS A;  3S32 A;  3CCL I;  1EWY A;  3OIP A;  4P2N A;  2KHM A;  1P4X A;  2FBH A;  3B02 A;  4NHJ A;  1GDT A;  5H6Q A;  3SHF A;  5EGO B;  4KNY A;  1FND A;  2LKS A;  2PLY A;  4ASN A;  1QO0 D;  5H5J A;  2BW3 B;  5FRO A;  3GTP J;  2QTL A;  2XIG A;  3WGI A;  1XG1 A;  5FFZ A;  2O03 A;  4CCK A;  4A3I J;  1KU3 A;  3S17 J;  4WF2 A;  3CCL B;  3CO6 C;  1UD8 A;  4P22 A;  1SKQ A;  3VOE A;  2NVQ J;  3K6G A;  4AIH A;  3H3U A;  1QA3 A;  3I4P A;  2L0K A;  2W7Z A;  1FYK A;  2DXI A;  2V4J C;  4KIF A;  1ZR4 A;  4BDZ A;  3QFT A;  3GEZ A;  3MCZ A;  4M74 A;  2RKH A;  3BDD A;  3CB4 A;  2ZCW A;  3BCF A;  3ASS A;  5IT3 A;  5ED4 A;  2QKL B;  4D1Q A;  3S15 J;  2BXZ A;  1ZRF A;  3JAM K;  1Q86 D;  2HOS A;  4P9S A;  1JHH A;  2FX0 A;  1T6S A;  2PIA A;  5GV7 A;  1PJ7 A;  1S8N A;  1QRC A;  1IDY A;  4DNC A;  3VYU B;  2CH0 A;  3OW2 B;  4ZDL A;  2XVC A;  5DV5 A;  3Q6R A;  2GJP A;  1ZGJ A;  3AKZ A;  3LSM A;  5F0C A;  3ZMU A;  2QVO A;  4K2E A;  4P6Y A;  2XGC A;  1G6N A;  3W2A A;  1IN5 A;  4RAY A;  5FKN A;  1W7P A;  3C1D A;  2L7M P;  4GCV A;  5IYC J;  3ASP A;  3LFK A;  3K4B A;  3HGG A;  3CDH A;  1YRN B;  1K9M D;  4MYU A;  4B3F X;  1O3T A;  1AIR A;  3SDB A;  3FM3 A;  1MJ9 A;  5DSZ A;  4M3G A;  3BH7 B;  1CQT A;  4Z05 A;  5HS9 A;  1ZH5 A;  3GQB A;  2F1M A;  2IPQ X;  4RM3 A;  1KCD A;  4YFN F;  3CXC B;  1X1P A;  4HAM A;  3OYL A;  4EVI A;  2XRN A;  1KQ5 A;  5L46 A;  3NAR A;  4M3D A;  3DV8 A;  1KQ8 A;  1UZC A;  2XDV A;  4AUX A;  3BCD A;  3ISX A;  2VT2 A;  1OQY A;  1S6L A;  2OBT A;  4X1E A;  2YUH A;  4EJT A;  1UST A;  1A6I A;  3QPS A;  2WY8 Q;  3HOW J;  3HTU A;  3RZO J;  3NE5 B;  4Y33 A;  5IYP A;  1PYV A;  1SEU A;  4G7W A;  1T8I A;  3JW4 A;  4F7D A;  3ASR A;  1MBG A;  1GHC A;  1DP7 P;  4G7Z F;  2X51 A;  3PSZ A;  1QRY A;  4AVZ A;  5A2Q K;  1QVT A;  5ILV A;  2W84 A;  2IW5 A;  1ZGA A;  2FNA A;  2LKX A;  4XNF A;  4TMT A;  4X07 A;  2Q0O A;  3IWF A;  3EUA A;  4MLO A;  2V7T A;  2CC2 A;  1MZB A;  4Z4T A;  3GTK J;  4YEI A;  2PFB A;  5ILS A;  3DU6 A;  4U88 A;  3K1M A;  3ABT A;  1TYW A;  3LAP A;  3W2W A;  3JAM Z;  3HKZ A;  1X19 A;  5GAD J;  2IOU G;  1K6Y A;  3HSE A;  1MBH A;  1SFX A;  4WWV A;  2JVH A;  1S29 A;  1YE9 A;  4B8X A;  2LK2 A;  2F6C A;  2CQX A;  3W6J B;  5GAG J;  4UUS A;  2Z9O A;  1E3Z A;  5F4O A;  3OL3 A;  4HE6 A;  2HDW A;  2OUM A;  4LG3 A;  5CJ9 A;  5IPA A;  1QQ1 A;  3HPH A;  1ZRD A;  4OPW A;  2XV4 S;  1UD6 A;  2W82 A;  4PJ0 C;  2A5W A;  1LFU P;  3OYA A;  2K9S A;  1HW1 A;  2M0M A;  2M1B A;  4YFX F;  1WMR A;  3S1Q J;  5HNF A;  4E7L A;  1Z05 A;  4AD9 A;  3A0B C;  3MEX A;  1JUP A;  2O6G E;  5BS6 A;  1FIA A;  3E97 A;  2YX7 A;  2HYJ A;  3KZY A;  4JX5 A;  2PEX A;  1F4K A;  1WJC A;  3Q5F A;  2DK8 A;  1EFC A;  1XCV A;  2XAF A;  4QFM A;  4XLE A;  1H9G A;  4L5I A;  3GSI A;  2NOJ B;  1UD5 A;  1WCM J;  1KCC A;  2K9M A;  1N0V C;  1I3Q J;  2XTY A;  3M8E A;  2OZU A;  1UAA A;  2KZV A;  5TGT A;  5BOX A;  1MIJ A;  5B3S H;  1F43 A;  3PFI A;  4U0V A;  3W2V A;  3OEE A;  2D9R A;  4ACB A;  5DNS A;  2H8R A;  3CF2 A;  2ZTN A;  3AG1 H;  1WSV A;  1E3H A;  4KA4 A;  4UNO A;  3FPK A;  4GFB A;  4DZP A;  1OGJ A;  3JUR A;  2MG4 A;  1FPQ A;  1ZG5 A;  2X48 A;  2NOG A;  1FIP A;  3SYJ A;  3ASQ A;  1R22 A;  5TIS C;  2E2I J;  4AM3 A;  4BH9 A;  3I5U A;  1D3Y A;  4CCL A;  2OQR A;  3FXO A;  3PIP F;  1UD3 A;  1KK0 A;  4TMX A;  4KDP A;  2J8K A;  5KVR A;  1RI7 A;  2X1C A;  4Q47 A;  3LQ6 A;  2L4M A;  1ON2 A;  2AQF A;  3MWM A;  3WTY C;  4ESB A;  2OC6 A;  4X05 A;  4RGS A;  2RQP A;  2MLK A;  2MC3 A;  3BJA A;  2BPO A;  1K79 A;  2ZZQ A;  4PGO A;  5K5R A;  3DWL E;  1H8E A;  4W8Q A;  3GVJ A;  4R79 A;  1HVX A;  4N0B A;  1MNM C;  2DET A;  4CUG A;  1SAN A;  4D0P A;  1PVE A;  4GYG A;  3RZD J;  3EQL F;  4ZYA A;  1XCB A;  4Z4V A;  2XTX A;  4DZJ A;  1POG A;  2F43 A;  3TQN A;  4OMY A;  1SD4 A;  3V8K A;  4AC0 A;  3L2V A;  5KHD A;  2CW7 A;  3BC8 A;  1E63 A;  1GQ8 A;  4XSX F;  4FAS D;  1IB4 A;  5E8I A;  2XSD C;  4OJO A;  2DA5 A;  3CCJ I;  2OV7 A;  2KIU A;  1G7T A;  2LH9 A;  4KJZ A;  5HDG A;  3LSR A;  2V1U A;  1JT6 A;  2EV5 A;  3BQZ A;  4PSW A;  1AOY A;  3BZ6 A;  1TVC A;  2DW4 A;  2GA2 A;  2O0Y A;  3EET A;  2VLA A;  3K4C A;  2VOP A;  5FO1 A;  2W4S A;  1R1U A;  2Z3Y A;  3LSG A;  4AWX B;  5HOO A;  2O3F A;  2PI0 A;  3VDX A;  1V0F A;  2PE3 A;  4NBS A;  2XC1 A;  4ESJ A;  2IGK A;  1VLY A;  3LWF A;  3AVT A;  1K7A A;  2V7W A;  2QQA A;  4DYR A;  2ZTG A;  5A8A A;  1B23 P;  1YIO A;  2JA2 A;  3OYJ A;  2L4A A;  3ZMS A;  4NUB A;  5BPI A;  2R6H A;  1SVO A;  2F5E A;  2WBM A;  2F4I A;  2EZL A;  3B8Y A;  1CF7 A;  2EK5 A;  2KRH A;  2WAF A;  2R7Q A;  2ZIT A;  2VT3 A;  5F1J A;  1SFU A;  3J80 K;  5J8C A;  2HQA A;  3S14 J;  4C30 A;  4A3E J;  4LIU A;  2X1D A;  1CNF A;  2LOO A;  4HYE A;  4KIG A;  1IJE A;  2FQ3 A;  1DG1 G;  1XSV A;  4DNR B;  1UMK A;  4Y15 A;  3S1M J;  3TH0 A;  1YJN I;  4TN1 A;  1NTC A;  3FK6 A;  4RAF A;  2HOA A;  2LR8 A;  2V79 A;  2VBV A;  1I27 A;  3LQQ A;  1OMI A;  1TLH B;  2K7L A;  1QPI A;  4QVA A;  4DQK A;  1BJZ A;  5LEJ A;  4HLX A;  1FLI A;  1O3Q A;  1W0K A;  1FP1 D;  3GFM A;  3R4K A;  2FMY A;  3E5Q A;  3FXM A;  1T6X A;  3S3N A;  3AVV A;  2BM7 A;  1EA0 A;  2FEZ A;  1E3P A;  2VFQ A;  1JRG A;  1YJN B;  2DOF A;  4XKC A;  1RQR A;  3EPZ A;  4OM9 A;  3VMF A;  1VF7 A;  1QGZ A;  3C7J A;  2VZL A;  3UR3 C;  4D5F A;  2EB7 A;  5F08 A;  5GTH C;  3E20 A;  1ZG1 A;  4TMZ A;  5B1A H;  1J59 A;  2EA4 A;  1J5Y A;  1BI1 A;  3GVA A;  4B48 A;  3V4G A;  5D5X B;  4IL6 C;  3OYM A;  1ODD A;  1GVJ A;  4EQQ A;  4B47 A;  4E7J A;  2F4N A;  3GTQ J;  4Z06 A;  5JVT A;  1TWH J;  3FHZ A;  3SLN A;  5B66 C;  4PSX A;  5JI6 A;  1IG7 A;  2FA5 A;  1R5I D;  1QGA A;  4RCY A;  5TJJ A;  1QUE A;  1TW2 A;  2BY1 A;  2VQG A;  3P9C A;  2OU2 A;  1Z6R A;  3HOS A;  4HE5 A;  4E7K A;  2QSH X;  2HI3 A;  3QU3 A;  3E5X A;  3I3L A;  2V7V A;  2L01 A;  1S3J A;  3I53 A;  4HNV A;  4S0H B;  3DKX A;  4A0Y A;  3G6E I;  1ZQ3 P;  3HOY J;  1VQO I;  2M4K A;  3F8M A;  4HBL A;  5M3F J;  2JZY A;  4OWR B;  4P12 A;  2FBI A;  2JRT A;  2JPC A;  4A3L J;  3BC9 A;  2DMN A;  4WZL A;  4BU2 A;  4L9V A;  4PJL A;  2GWR A;  2KLO A;  3O8G A;  1PUF B;  1LEB A;  2CND A;  1LE8 A;  3KEW A;  2ID6 A;  1YW8 A;  4DQL A;  3ZMD A;  5F0F A;  1HDD C;  1Q82 D;  3KX2 A;  2LYC A;  2EFQ A;  3F22 A;  1RIO H;  2QTZ A;  4IHS A;  5EZG A;  3G6E B;  3E5U A;  1VQO B;  1RU4 A;  4A6E A;  1LPQ A;  5EJC A;  3SZT A;  3Q39 A;  2BM6 A;  1ZM3 A;  1WZ2 A;  4P26 A;  4I7H A;  3KZI C;  3OYE A;  2K27 A;  4XRS A;  2Q6L A;  4KN7 X;  4O3M A;  3CCV I;  4L8J A;  1MBE A;  4Z4S A;  1OFD A;  2O17 A;  3KP7 A;  4LB5 A;  2C78 A;  2H8W A;  3VYR B;  1CGP A;  1XC5 A;  4EAT A;  1K5C A;  4ZV4 A;  3EQO A;  2DCU A;  1IHM A;  4UY8 I;  3K1P A;  4BHP A;  2DPU A;  2QBY B;  1H42 A;  2VBK A;  2HEO A;  1I1G A;  5HLG A;  3GVL A;  4P25 A;  3CPW B;  1H80 A;  2WAD A;  3IRQ A;  2GIV A;  2K3P A;  2KDZ A;  5JVG F;  1T08 B;  3TGN A;  4UV8 A;  4TMV A;  3CCV B;  3KP2 A;  3AVY A;  1WOR A;  2E1M B;  1FWZ A;  2EPF A;  1X3W B;  3GFJ A;  4BHC A;  4WXH A;  2CW5 A;  5K7Z A;  1TNT A;  3IAS 2;  5FJ8 J;  3LFU A;  1AA7 A;  2XB5 A;  3WU0 A;  3WTS C;  3H94 A;  2Z5U A;  4ZH4 F;  3G2B A;  3WTU C;  1AHD P;  3Q9S A;  4QWQ A;  4WK8 F;  2AXT C;  2L9S A;  4BHB A;  4I99 C;  3Q38 A;  1K78 B;  3MVP A;  3BQJ A;  4LC0 A;  1UJ8 A;  4BAC A;  3GTG J;  2UV1 A;  2HZD A;  1VQK I;  3DCF A;  2VPL A;  4F92 B;  1BOA A;  3SFZ A;  1AKH A;  1Z91 A;  2YPR A;  1YW9 A;  3IKT A;  2KPM A;  4Z4Z A;  4ETS A;  2R7W A;  3DDY A;  3I4N J;  1VZ0 A;  2MA3 A;  5LGN A;  3OYD A;  3GVK A;  5IY5 H;  1H8H A;  5FLV A;  3ZZ0 A;  1TC3 C;  2H1K A;  2XAJ A;  2A6H F;  1WGX A;  3HXL A;  2RGV A;  4PJM A;  5CPR B;  1GV5 A;  2VON A;  1JTA A;  4Y13 A;  2PJP A;  1P92 A;  2MSY A;  3VMV A;  1IN4 A;  3CLQ A;  1A31 A;  3CC4 I;  2WAQ A;  4PC6 A;  4RD0 A;  5HZA A;  3RIQ A;  5J6X A;  3CCQ I;  5M3M J;  2DLL A;  3OOP A;  3RPU D;  1IDK A;  3OV8 A;  3NWS A;  4IVN A;  1Y8Q B;  2CK3 A;  4KIC A;  2BY2 A;  1VQL I;  4Y7N J;  3CCU I;  1TT5 B;  1OGI A;  4F55 A;  2BM0 A;  1U5T B;  4EM2 A;  3GWZ A;  3CC4 B;  4LBZ A;  4CA0 A;  3TL4 X;  1CLW A;  3PJR A;  3BPV A;  5E3M A;  3JQQ A;  2L7K A;  1RZ4 A;  3CCQ B;  1MMA A;  4C43 A;  4BUP A;  3KYL A;  3B4N A;  2DT5 A;  4L9T A;  4G6T B;  1QGP A;  1VJS A;  3JRG A;  2W24 A;  4M4S A;  1ZTR A;  1XGS A;  3WHC A;  5J1Y A;  2VKH A;  3OSF A;  2X3U A;  4X0C A;  3CCU B;  1VQL B;  1PJR A;  2MC4 A;  1HST A;  2KRC A;  3CJN A;  1D1C A;  4XOP A;  3DBH B;  2Z8G A;  2V7F A;  1XMA A;  1WH5 A;  5ERI A;  2OQG A;  2W57 A;  3A0H C;  3QPT A;  3C2G A;  4ENJ A;  2FML A;  1RR8 C;  1JKR C;  1MD0 A;  4IQJ A;  3W5V A;  1KQ9 A;  1TBX A;  1QVG B;  1FMV A;  4PC2 A;  2VFN A;  4DNT B;  3ZPN A;  5GAE J;  1Z3X A;  4BBR J;  1JKQ C;  5IOZ A;  1B8I A;  1FNB A;  5B6I A;  2OAZ A;  3CTA A;  3P5J A;  2C6Y A;  3KE2 A;  3QPL A;  2HS5 A;  2ZZG A;  3HUG A;  1ZM2 A;  1YS7 A;  2P5L C;  3KEQ A;  2M7A A;  2LD5 A;  1WJE A;  3WTT C;  1U8R A;  4XK4 A;  5FLX K;  2E1B A;  1S4M A;  4B09 A;  1JGG A;  4ZZD A;  4NC6 A;  4ZJZ A;  1IZ1 A;  3HJE A;  2F2E A;  1WFX A;  3BJO A;  3G1L A;  1GAQ A;  4U4B A;  2WAQ N;  4WWC A;  1E1Q A;  3R6S A;  3ISP A;  2DYR H;  3L2W A;  1H9T A;  4I02 A;  5HS8 A;  3QE2 A;  1U2R A;  2NS8 A;  4QPO A;  1PUE E;  4DK1 A;  2FSW A;  2EZH A;  4UVC A;  5CVJ A;  1B9N A;  2HVR A;  5FIU A;  3SEJ A;  1HF2 A;  1YQA A;  2D5V A;  3VB2 A;  2DJI A;  1RPW A;  5CYV A;  3TOA A;  4ZCL A;  2BW3 A;  1BM9 A;  1RES A;  4E70 A;  4BE2 A;  1F1Z A;  2HNH A;  1ZAO A;  1XFO A;  1JHF A;  5GTI C;  1G7S A;  2LNB A;  4BQO A;  5JHF A;  3JRE A;  3WU1 B;  2NVT J;  2LFB A;  2HPM A;  4OOI A;  1XDU A;  2X53 S;  3DLA A;  2XPU A;  2P3M A;  4YFO A;  2HXI A;  1EZG A;  4KN4 X;  2GRE A;  1I50 J;  3Q9V A;  2ESN A;  1VQP I;  3PVD A;  2BHY A;  5AN9 A;  1ENH A;  1WSU A;  1X4P A;  3CCM I;  3F0C A;  2PG4 A;  1WQ2 A;  1IW7 F;  3UKG A;  2W6I A;  1O8D A;  1UHM A;  1X1D A;  3OL4 A;  2E7X A;  1W7P D;  4LG0 A;  4KMF A;  1FRN A;  1LDJ A;  3L2U A;  2HTS A;  1VQP B;  2VNI A;  4IRG A;  4I0B A;  1UEL B;  1MRZ A;  4FE4 A;  2DDA A;  2BY0 A;  1KC8 D;  2NVX J;  1D1A A;  3ZR8 X;  4NQW A;  1WKM A;  1A5J A;  4YC5 A;  2IGM A;  4W8T A;  3I9V 2;  4BQA A;  4A3D J;  3WNC A;  2ACJ A;  3K4M A;  1K4Z A;  3CP8 A;  2KIQ A;  2WZN A;  4RGX A;  4CCM A;  2C5B A;  5H2F C;  3OYG A;  5EZH A;  4YEL A;  1K8F A;  2G7U A;  2XKO A;  4GGG A;  1Q1V A;  3TDU C;  1JUM A;  5IYN A;  4NB5 A;  2VB6 A;  3GTJ J;  4NK8 A;  1OPC A;  1N77 A;  4MQ9 F;  1NHA A;  4H9G A;  1MAB A;  2ID3 A;  1YX5 A;  3BG9 A;  1DDN A;  1JKO C;  3GCM A;  4OOX A;  5EG0 A;  2VNJ A;  5BSX A;  2ZXJ A;  3BOQ A;  2ELH A;  1Z3Y A;  2K4J A;  4U7B A;  1EFU A;  1GVH A;  4NCN A;  3L09 A;  2RN7 A;  3GQ7 A;  2PX9 A;  3HG9 A;  2JUC A;  5CVV A;  1VFC A;  1QG0 A;  4BY7 J;  1X1C A;  3JRB A;  4RB2 C;  4MGR A;  2WV1 A;  3E6C C;  1IN6 A;  2C5H A;  4II3 A;  3H3V K;  2E1M C;  3LJY A;  3L1P A;  3RPQ A;  3F6V A;  2HOE A;  4B43 A;  3ERM A;  2ZBK A;  1HA3 A;  4WXC A;  2P7C B;  2EBI A;  4ZYE A;  2B5O A;  1MJA A;  3CZ6 A;  1JJ6 C;  1KRH A;  5ICC A;  3JRH A;  3BY6 A;  3REO A;  2QQ9 A;  4Q4Z F;  2IA1 A;  4L5E A;  2HWV A;  1SKY B;  2ZL7 A;  5J1U A;  3ZIA A;  3IL2 A;  4YFK F;  4OPO A;  4A0X A;  3OOU A;  1B72 A;  4HQM A;  3L2Q A;  2JQ7 A;  1JA1 A;  2RC5 A;  1DBO A;  1TP4 A;  3ZOB A;  1BOB A;  4BQN A;  3N4M A;  1BQE A;  1QFJ A;  5THX A;  2NT9 A;  1L1I A;  3V7A A;  1RNL A;  2P7V B;  4QTR A;  4FCY A;  3BTC A;  1OYY A;  2DK5 A;  4BEH B;  3OR1 C;  2JJ1 A;  3CCE I;  3MMY B;  4KIB A;  3VR6 A;  2IS1 A;  3EYI A;  3R6J A;  1DDG A;  1QH0 A;  1YX3 A;  2KIF A;  4GXO A;  4CZZ A;  1FSE A;  1D1N A;  3VSU A;  1ZHF A;  3J81 K;  2I1L A;  3CDI A;  3PO2 J;  3NEU A;  2D74 A;  2HVS A;  2TDX A;  4XN3 A;  3PUF A;  2Q8K A;  2B9S A;  4OIO F;  2RQQ A;  3BT9 A;  3MKW B;  2LRE A;  2AO9 A;  4L9N A;  1D5Y A;  2BGJ A;  1DPU A;  2P8T A;  1IGN A;  5K7H A;  3OS1 A;  4M53 A;  2KZG A;  3RPU A;  2CV2 A;  2WSS A;  3BG6 A;  3G3Z A;  3R61 A;  2V26 A;  3QFS A;  5M5Y J;  1U5T C;  1B6A A;  1IN8 A;  4QPQ A;  2J8I A;  4YDT A;  4FHT A;  3GLX A;  4N4O B;  1OB2 A;  1KU7 A;  1XMX A;  2GZW A;  3K69 A;  1ZM4 A;  1RMG A;  4BJ5 C;  2RVC A;  4JYK A;  3TW6 A;  2BE5 F;  1WTH D;  2D3L A;  2QQ8 A;  1P4A A;  1QA1 A;  5DUK A;  1OR7 C;  3RYP A;  2R5Z B;  2QA4 B;  2BY3 A;  1IV6 A;  2XPV A;  3HYI A;  2R7X A;  1AIP A;  1WVR A;  4ZTF A;  2XGD A;  4TKO B;  3TOB A;  1U0J A;  2DA3 A;  3MZ8 A;  2ZZF A;  3OE7 A;  1I1S A;  4E4H A;  4Y9R A;  3A01 B;  3PSI A;  2UUZ A;  4YAF A;  3MKY B;  3H36 A;  5CKT A;  5F4M A;  3K2Z A;  1DAB A;  2YWG A;  4M0L A;  1KYZ A;  3HC7 A;  4CZC A;  5DDG A;  2Y9Z A;  1VQ5 I;  2YU9 J;  3J7Z I;  1QZZ A;  4AF7 A;  3P9I A;  1SM4 A;  1T2K A;  3KYC B;  5DS9 A;  5EEH A;  4PAA A;  4ZGN B;  1XPX A;  2M8E A;  3ES9 A;  2YS9 A;  4OOS A;  1FYL A;  1P6R A;  2DYS H;  4A2U A;  4Z2Y A;  2WPD A;  5DS0 A;  3A3B A;  1T33 A;  2Z16 A;  1VTN C;  1V5V A;  3SUC A;  4P5O A;  1VQ5 B;  5FNZ A;  3QWL A;  4RJL A;  1SFK A;  4YXW A;  2UXN A;  4R1H A;  3FXQ A;  4BBS J;  3HOX J;  1F36 A;  2K5C A;  3H9Q A;  3H92 A;  3QYB A;  4G6I A;  3P27 A;  1TLL A;  2NVY J;  3GBG A;  4ZTJ A;  4EJU A;  2ODL A;  3K0L A;  1OCR H;  1I3A A;  3FBN B;  3J81 Z;  2G0Y A;  3MFK A;  4DK0 A;  1IUF A;  4PUS A;  1IRG A;  3ZZT A;  3VEP A;  3U9G A;  1N75 A;  2XC7 A;  5FO0 A;  2EQR A;  3VOD A;  1JE8 A;  1Y1W J;  2E60 A;  3JSO A;  2BVN A;  2QEX B;  4M3F A;  1QA6 A;  1VQ9 I;  3HAG A;  1IRZ A;  1Y0Y A;  3R0J A;  1HSJ A;  3ECO A;  5DD8 A;  3PUN A;  3DXJ F;  5HXB A;  1EH8 A;  1VQ7 B;  4OJP A;  3I71 A;  5H20 A;  1MGT A;  1UG0 A;  2VN2 A;  3H5N A;  3EDP A;  1V3F A;  3C3W A;  1IXC A;  3TO6 A;  1YG2 A;  3M07 A;  2GJK A;  4XKV A;  3IH3 A;  1VQ9 B;  3DU1 X;  2LVS A;  3VO1 A;  4G94 A;  1BIA A;  1ZR2 A;  1ACI A;  3LYC A;  4A3F J;  2ZB9 A;  2PQ8 A;  4OP7 A;  1QVU A;  4YAU A;  1O8J A;  3OIQ A;  1G2H A;  1FNC A;  4FN5 A;  3SJP A;  2DIE A;  1JTY A;  3P9K A;  1Y1V J;  3TMO A;  2DMT A;  4LOC A;  1OCZ H;  4PC3 A;  4ROX A;  1UG2 A;  4GRI A;  3S16 J;  3F3X A;  4HPQ A;  4B1R A;  4A3B J;  4OZY A;  3T53 B;  1E2X A;  3CUQ B;  3W2I A;  2FXA A;  2STW A;  1QBJ A;  3AGP A;  5A89 A;  3HBL A;  3PQK A;  3AFH A;  3HSR A;  2GJR A;  4HF0 A;  3I55 I;  1K28 D;  2CBX A;  1XMK A;  1ERD A;  1O8L A;  5AMV A;  4MEY F;  2V4D A;  3U6K A;  2JJ7 A;  5E20 A;  2J5P A;  2M3A A;  2RC6 A;  1EE6 A;  3AGQ A;  4ZCI A;  2XND A;  1EF4 A;  3VNU A;  1XGO A;  1WXR A;  5DCM A;  3SFI A;  2FOW A;  4RM2 A;  3K1N A;  4S04 A;  4W8S A;  2O0W A;  1TWC J;  2GXA A;  1XN7 A;  3EYY A;  4II2 A;  2FRH A;  2HZT A;  2K3F A;  3BR1 A;  2DYI A;  2W6J A;  3I55 B;  4DOZ A;  2PJR B;  1APL C;  1YOV B;  2XZP A;  3ONU A;  4HNT A;  2K4B A;  1KYW A;  5IT9 Z;  1EH7 A;  4DW6 A;  2R7R A;  1KQ0 A;  2QX3 A;  3GFI A;  5KW9 A;  1U9O A;  2EH3 A;  3O8H A;  4AVP A;  1GV2 A;  2Y30 A;  4OU0 A;  3OYK A;  2PMD A;  1QRB A;  1T6Y A;  1WRJ A;  3CC7 I;  2R7D A;  3L7W A;  1O7F A;  1NK3 P;  4L5J A;  1B9M A;  2R7F A;  1WH7 A;  3TO7 A;  3VNV A;  3H5A A;  1SAX A;  1CNE A;  4O5V A;  1TSP A;  3JR9 A;  3H1C A;  2GXG A;  2NTQ A;  1LDD A;  1SVM A;  3KEO A;  5DCF A;  3OSG A;  2WTE A;  4CSW A;  1WOO A;  2HGC A;  3PET A;  4HA8 A;  1AMO A;  1W36 C;  3SEZ A;  3MCA A;  4FX4 A;  5AON A;  2IQ7 A;  1NH3 A;  4B44 A;  3DEW A;  1FJL A;  4Z03 A;  2VQC A;  2CUZ A;  3CC7 B;  2V31 A;  2FE3 A;  2HXO A;  4HX4 A;  2HYF A;  3IKV A;  4KT6 A;  5ILU A;  1NDH A;  2VBT A;  4FK8 A;  1O8K A;  2WV0 A;  2RAE A;  2R0Q C;  1A35 A;  1NBM A;  5LMZ A;  2DJN A;  5LRS A;  1J09 A;  2Q6I A;  3MQ0 A;  3KET A;  1F60 A;  2HQ5 A;  1NB9 A;  1UD2 A;  2VBE A;  3CMM A;  4ZDO A;  3BR3 A;  4P1V A;  5KNL A;  2VKE A;  2ZNY A;  4WQM A;  3RKY A;  3ML6 A;  4M9S A;  3CLO A;  3AVU A;  1V4R A;  5EEG A;  5GPC A;  3S3M A;  2IJL A;  2VE9 A;  6PAX A;  1JJ2 B;  5HOD A;  2BM4 A;  4S05 A;  4RD6 A;  4UZU A;  2GXB A;  2CV1 A;  1R9T J;  2LY1 A;  2MBF A;  3BR0 A;  4L0Z B;  2GQF A;  1TYV A;  3TDZ C;  2VC0 A;  1O8E A;  2HOT A;  2NT6 A;  4MR0 A;  4KIS A;  2QBY A;  3BWG A;  1VI0 A;  3PFY A;  5IP7 J;  1FX0 A;  4P6V F;  2V1N A;  1PXZ A;  1T6Z A;  1M1K D;  3KLO A;  1OJL A;  2ZME A;  4YIF A;  3T5X A;  4ENN A;  5IP9 J;  1BN5 A;  2BOL A;  1BR1 A;  2LP0 A;  2LBF B;  4QHY A;  2G7H A;  4MQV A;  1XX5 A;  1Y8R B;  2LTP A;  3Q3S A;  4LGW A;  3ZQQ A;  5BNG A;  2P0W A;  1ITY A;  2M5S A;  4KH3 A;  2EA2 A;  3HKZ N;  2V7U A;  1YI2 I;  1IC8 A;  3BG3 A;  1B2R A;  2XEX A;  4A12 A;  2QQB A;  2C4T A;  1MMG A;  2BM1 A;  2KP6 A;  4M9Z A;  2CQQ A;  1N06 A;  1TW3 A;  5D8L B;  2QM3 A;  1ETX A;  3TP3 A;  1K78 A;  2INU A;  5LHH A;  1MW7 A;  3E0J B;  1VQN B;  1N05 A;  5CVR A;  5DEQ A;  2F5V A;  3QAH A;  3MN2 A;  4EV0 A;  1VF9 A;  2M7B A;  1QFY A;  2O04 A;  2OPT A;  2YSR A;  1D8J A;  3FPP A;  2CRG A;  3ML3 A;  2R3S A;  1PKV A;  1YI2 B;  1GVD A;  1R5B A;  2C4U A;  1NJI D;  3BY2 A;  5F04 A;  1G8X A;  2DOE A;  5IYD J;  4HF1 A;  3MHP A;  1R1V A;  3DTI A;  3K4L A;  3LQR A;  3KEY A;  4RD4 A;  3B78 A;  4HOB A;  1RUN A;  4Y52 J;  2E5Z A;  4PK4 A;  4UB8 C;  1XSX A;  1W5C C;  3CO7 C;  1PJ5 A;  1OCP A;  3U1D A;  3C2B A;  2VBX A;  1WP6 A;  1ETY A;  1KZH A;  1H0M A;  3VMW A;  3BZC A;  4A3C J;  1HZE A;  2HKX A;  4DYC A;  3F23 A;  1JGS A;  2WR8 A;  3O3K A;  2QXZ A;  4PDK A;  2HDN B;  2A3S A;  1Z7L A;  2HDD A;  1G3Y A;  4B3A A;  1A36 A;  2LZJ A;  4YAW A;  4FET A;  2LMD A;  2PMU A;  3LSP A;  2D45 A;  1IRF A;  1TT0 A;  4IRI A;  3ZMV A;  2VXD A;  4DBR A;  3Q0U A;  2XOK A;  4OIQ F;  2VJJ A;  3CCY A;  2VNK A;  4EH1 A;  1QJV A;  4EMS A;  3KFW X;  4CIC A;  4A6D A;  1W0T A;  3LSH A;  4QIW N;  3MKZ A;  1FDR A;  2K85 A;  3SDG A;  4HF2 A;  1DP3 A;  3TW7 A;  2Y9Y A;  2VJI A;  3A8J A;  1KU9 A;  3HRT A;  3BPX A;  2R7V A;  2QY1 A;  1OR7 A;  4LLG F;  2GOM A;  2ICW G;  2ZZE A;  4BPR A;  1DGR M;  3BCA A;  3CJR B;  4XLN F;  4IXA A;  2OBR A;  3ZC3 A;  3X2Q H;  3GQ8 A;  1LFP A;  4XIC A;  1Z67 A;  5K5Q A;  3L00 A;  1U9N A;  2XNC A;  3CCS I;  1N78 A;  3OAA A;  1HF0 A;  3H9G A;  1RKT A;  4RMN A;  3ZMT A;  2E2H J;  2R5Y A;  2EZI A;  5F4J A;  2IGO A;  2XTW A;  3T1B A;  3AG4 H;  2X0K A;  4HEA 2;  4R8H A;  3A35 A;  4LK1 F;  1J9Z A;  2M0C A;  2XF7 A;  2WB1 A;  3G1M A;  1HA8 A;  3FM5 A;  3ZRG A;  5E3O A;  1EFT A;  1MSE C;  3OKX A;  2X6X A;  3DTK A;  4G7X A;  3CUQ C;  3A02 A;  3CCS B;  4Y7C A;  3SKB A;  3V8J A;  1BW5 A;  3F9K A;  1CQX A;  3W2G A;  1KQS B;  1EP1 B;  1O8H A;  4YCQ A;  2O8K A;  3ZGK A;  1Z9C A;  3MAJ A;  3AL0 B;  2BX6 A;  5DN6 A;  3K4N A;  3CRZ A;  4UUV A;  1UD4 A;  1R5H A;  2GQQ A;  2HTJ A;  1A8P A;  4FT8 A;  2EIK H;  1BL0 A;  3O6B B;  2QSF X;  2W48 A;  4JBA A;  1DUX C;  4BE0 A;  2KRF A;  4RDL A;  4MO7 A;  1O8F A;  4JRA C;  1HOM A;  2LC2 A;  2LG4 A;  3E3V A;  1QHH D;  2GBY A;  3W6V A;  4X7D A;  1R36 A;  3E1S A;  4BE1 A;  4P3Y A;  2CSO A;  3HHH A;  2XSJ C;  3CJQ B;  1GR1 A;  4AIJ A;  1N07 A;  5D6F A;  3WG7 H;  2PEC A;  2QYO A;  5K1Y A;  3SY2 A;  4Q5S F;  2CMP A;  3W2E A;  1QPM A;  4L9J A;  4B4C A;  3CCR I;  4IO9 F;  3WGG A;  3GTM J;  1YIJ B;  4WZE A;  3FMS A;  3JTH A;  5L3F A;  3LSK A;  3S1N J;  3DBR B;  1YTY A;  4FIS A;  3PSS A;  2B7E A;  3LA3 A;  2VKD A;  4IHT A;  3D26 A;  2HQN A;  1TNS A;  2OTL I;  5BQT A;  1T98 A;  5F6F A;  2Q2E A;  4LBW A;  3CCR B;  1SVL A;  3TO9 A;  2ISY A;  4UUS B;  2BGC A;  2CG4 A;  3FXL A;  1O4X A;  1BI3 A;  1TUI A;  1ZG3 A;  2CW0 F;  3OS0 A;  3DTE A;  2XGJ A;  2WA0 A;  3JRD A;  5IOY A;  1Y6I A;  2IS2 A;  1RWR A;  1L3L A;  2IXS A;  2FJ1 A;  3E6D A;  2OTL B;  1NG7 A;  4GYI A;  1RUO A;  2AXL A;  2AHQ A;  2BM5 A;  3FXR A;  1BI2 A;  1LKX A;  5C3E J;  3FKS A;  1YLF A;  2XZO A;  2FU4 A;  2GA1 A;  3KP6 A;  4M72 A;  1I5Z A;  3IC7 A;  3M4O J;  1BN8 A;  2O7O A;  3FXU A;  3BLY A;  2R7Z J;  4LFU A;  3IH2 A;  2QGU A;  1W5S A;  3F8F A;  4J00 A;  1FBQ A;  1VQ8 I;  3DKY A;  2O5R A;  1FNM A;  3E1Y E;  5CDF A;  4ON0 A;  1DU0 A;  4NK6 A;  2L7F P;  2R4G A;  4EEF G;  2VC1 A;  3RDI A;  4RB1 A;  1KGS A;  3QSY A;  3WHB A;  2DBB A;  1GAW A;  2V7Q A;  4P9U A;  3K2A A;  3DP7 A;  1EXM A;  4CHU A;  1G7R A;  4EGZ A;  1E43 A;  5CVU A;  3VSK A;  1VQ8 B;  2NVU B;  2A69 F;  3OYC A;  2MYS A;  4MNU A;  4BNC A;  2L2O A;  4EM0 B;  2MLG A;  2B0R A;  1H88 C;  4E6K G;  4C2M J;  3QRF F;  2DAO A;  1REP C;  3JTG A;  2NRA C;  4AYB A;  2MAB A;  1QGY A;  1YLO A;  3ZUG A;  3FXJ A;  4BXF A;  3IV5 A;  3TED A;  4I84 A;  2PBI A;  3WTX C;  4YEJ A;  3Q0W A;  5M5X J;  1CZF A;  4LMY A;  3A8I A;  1KZL A;  4G1V A;  3HRM A;  3OYI A;  3NAU A;  2V6E A;  2MFZ A;  3G1O A;  3WU2 C;  1G7C A;  1ZKG A;  4QUZ A;  2YUS A;  3HRU A;  2CU7 A;  2ZBV A;  1PP8 F;  1QU3 A;  3J7Y J;  2BV6 A;  1FYM A;  2JMW A;  2EIX A;  4HX7 A;  2QKM B;  4Y17 A;  2X1E A;  3CUO A;  1PJ6 A;  1FY7 A;  1IJW C;  2NS7 A;  3FIS A;  4RB0 A;  2HU9 A;  4BEH A;  1Q7Y D;  2DQL A;  5FD6 A;  1OFM A;  1FP2 A;  4KIT B;  1D5V A;  4PJN A;  5LD2 C;  2V6C A;  2BYV E;  2LF7 A;  3Q6Q A;  3A2K A;  1DQU A;  2P5K A;  2R7U A;  5ICF A;  3D1N I;  4M6Y A;  3CD6 I;  3GZ5 A;  2GPJ A;  3CC2 I;  2JT1 A;  1K73 D;  5D6E A;  3OMY A;  2M34 A;  3AG3 H;  1ZRE A;  5F0H A;  1O88 A;  2XT4 A;  3EQN A;  4A69 C;  4J01 A;  3WND A;  2F48 A;  4HRI A;  3KP4 A;  2M30 A;  2R7O A;  4F93 B;  4XLP F;  2ZJQ F;  5AIP A;  2RNG A;  2BEO A;  3CD6 B;  4E7Z A;  3OYB A;  2LKP A;  3GW2 A;  3QP5 A;  1B4A A;  4ANJ A;  4HDU A;  3CC2 B;  4OJ5 A;  1XS9 A;  2E5N A;  1BR2 A;  2HMA A;  5J3L A;  4ZZL A;  4P1W A;  2K40 A;  4A3J J;  1UHS A;  1NK2 P;  5BPD A;  3WYA A;  3FWE A;  2R5Z A;  2O9L A;  4H4K C;  1HW2 A;  1MMS A;  1R00 A;  1I39 A;  1O8M A;  4CDG A;  3D5S C;  2B7C A;  4AYB N;  2OBP A;  3ERE D;  3A01 A;  3VSL A;  3WG9 A;  1KK1 A;  1V0E A;  1LDK B;  5KSW B;  1OGM X;  1GXQ A;  4HW0 A;  2CWE A;  1GO2 A;  3MKL A;  4CXF A;  2KKO A;  3BZK A;  2NST A;  1LEA A;  3V42 A;  5FD5 A;  1XD7 A;  2VXZ A;  4A5N A;  1J9I A;  1A04 A;  1A6Q A;  2HR3 A;  1DU6 A;  3N90 A;  3RKQ A;  3JU4 A;  2VFO A;  2DY1 A;  2XAH A;  4PC7 A;  3PSF A;  2AS5 F;  3ZQL A;  3B90 A;  1B1B A;  1XB4 A;  2H09 A;  3QQA A;  2VAS A;  5EGO A;  1GT0 C;  4KYW A;  3BH4 A;  3RQI A;  1MDM B;  4LBY A;  1T56 A;  2L02 A;  4UAJ A;  3G71 B;  1ZYR F;  3J7A Y;  2DTZ A;  3HM5 A;  1GXP A;  4F7Z A;  2OYN A;  4B4D A;  3GTL J;  2L3D A;  3DQV C;  4AID A;  2CF4 A;  1SFO J;  1M90 D;  2OA4 A;  3AL0 C;  4RDK A;  1I18 A;  2D1H A;  3K10 A;  3FZV A;  1W0U A;  3R60 A;  3D0S A;  4ZC3 A;  3BTJ A;  3LNQ A;  2XRL A;  4EW9 A;  5HLI A;  2FQ4 A;  2KL4 A;  4G7H F;  1H85 A;  4KFC A;  4JOM A;  1KD1 D;  4Z6Y A;  1XTA A;  1U3E M;  1WI3 A;  2G9W A;  1X0C A;  2EWE A;  2DFI A;  1ON1 A;  1XGM A;  2VBU A;  3QOP A;  4C0S A;  5KAI C;  2WJY A;  1V5F A;  4M71 A;  1HG8 A;  1TWA J;  2F5D A;  5LRR A;  1OIS A;  3KYD B;  2P6S A;  4DYQ A;  1FT9 A;  1QQI A;  1W1W E;  2LDU A;  5C44 J;  1P4M A;  4HNU A;  1W34 A;  5IYR A;  2DER A;  1LM1 A;  4ZYH A;  4CCJ A;  2NYX A;  3KIO A;  1ZK8 A;  3FK7 A;  5FKK A;  1VQ6 I;  4HIZ A;  2FUG 2;  2Y75 A;  2Y69 H;  3DBL B;  2C77 A;  3JCU C;  5FO5 A;  1TYU A;  4IEJ A;  2VUM J;  4OIN F;  1KU2 A;  2Y31 A;  2BVL A;  2EWN A;  1S7E A;  3U21 A;  5J35 A;  4PAB A;  4MIM A;  4HWV A;  2PMZ A;  3JQP A;  2D2W A;  5H6R A;  5BMZ A;  4RPB A;  1JB9 A;  2QEN A;  1SFE A;  1VHE A;  2B0L A;  3I1F A;  1OYW A;  1BLI A;  3VO2 A;  1T5E A;  1VQ6 B;  2LSO A;  1YRN A;  2H27 A;  1EP2 B;  2EIM H;  2VJ5 A;  1MH4 A;  3T8T A;  1QA2 A;  2L5Q A;  5HS7 A;  1J2X A;  3F8B A;  3LNN A;  3I56 I;  4G5G A;  5EYR A;  1QUF A;  2JSC A;  3ZSC A;  4A93 J;  3HB9 A;  2EFW A;  1W0J A;  2W25 A;  2VQH A;  4LIV A;  4V2F A;  2FBK A;  3RKX A;  2DTR A;  2KFD A;  4YZQ A;  2MH9 A;  2JJ2 A;  3RJP A;  3PM1 A;  3B8H A;  2E34 A;  3DFG A;  5AIQ A;  3A1P A;  4ZCM A;  2BZT A;  1IUY A;  4IOC F;  3M1C A;  3I56 B;  2EFN A;  1FTT A;  1S7O A;  3QFR A;  1EA3 A;  2DMP A;  1T95 A;  4C9Y A;  2VBS A;  2V9P A;  1LQ1 A;  1ETO A;  1LJ9 A;  4LIT A;  3W6K B;  3I0T A;  2PJR A;  2NXN B;  4BKX A;  3K70 D;  4RAZ A;  2Z33 A;  4NDL A;  5J47 A;  2W00 A;  3FXK A;  4Y9U A;  2VNH A;  4OPV A;  3CP2 A;  3K9T A;  1C0W A;  4X8I A;  1HDP A;  3R0A A;  4U49 A;  3OP1 A;  3WE2 A;  4ENK A;  3V7S A;  3WOD F;  1N25 A;  4D7M A;  1DGW Y;  2DU9 A;  1YX2 A;  3GIR A;  1EJ9 A;  3RSN A;  2H94 A;  1GUU A;  1E1R A;  3DPL C;  5HLH A;  4G8X A;  2PMZ N;  3KCC A;  2AHO A;  5L3D A;  3GO5 A;  1YJW I;  4NC8 A;  2TCT A;  3PQJ A;  2L9R A;  1YFH A;  3DU5 A;  1AKH B;  2FVG A;  2DI3 A;  3MMP A;  4IF4 A;  1F9N A;  3BY1 A;  1MBK A;  4ACA A;  4XKB A;  5JLW A;  4U7D A;  4M6X A;  3JRC A;  1FZP B;  2EJR A;  2M5W A;  2IAI A;  2DDB A;  2D1V A;  3JRF A;  2VBW A;  4QVJ A;  1R7J A;  1I6H J;  2I8D A;  4AIK A;  4XRF A;  1ONV A;  2ZJP F;  4M9X A;  3ASO H;  1BC7 C;  1IN7 A;  4RD1 A;  3V76 A;  3AST A;  5TY0 A;  2KMU A;  3JRI A;  2XHK A;  5DM6 F;  4B3X A;  3M3Y J;  1YJW B;  2QA4 I;  2DA2 A;  2LF8 A;  3QPH A;  1W4M A;  3OY9 A;  5FRM A;  3BNW A;  3M8J A;  1W5T A;  3RY8 A;  3ABM H;  2KVO A;  1ETQ A;  1ULY A;  1ZLK A;  5E79 C;  3ZZU A;  1YYV A;  1K61 A;  1IDJ A;  4MFE A;  4PGG A;  1YO5 C;  1MND A;  3OJW A;  1W87 A;  4FQG A;  3WBJ A;  5GP9 A;  1HXD A;  2JWT A;  2NNN A;  3L9F A;  2A05 A;  2P6T A;  3ABK H;  1R23 A;  4L18 B;  1OGO X;  4CCN A;  5JHU A;  2B63 J;  3KZZ A;  2CFO A;  2JA5 J;  3DEU A;  1EKE A;  4CQJ A;  5E8G A;  2Q6K A;  3M8F A;  2OZ6 A;  4XLA A;  1QX4 A;  1BI0 A;  1OB5 A;  2CQK A;  2BXY A;  2DA1 A;  4IRH A;  4MYT A;  1QHG A;  3KL9 A;  5H59 A;  1FRQ A;  4MFD A;  1TZL A;  1QZY A;  2OD5 A;  3GME A;  3I54 A;  4YG2 F;  4XL9 A;  3ZXS A;  4TMW A;  2LBF A;  3T9G A;  1MMD A;  2CUF A;  2Y0M A;  3C2H A;  1OFE A;  2ZL5 A;  2EIJ H;  2E1C A;  3WTW C;  2NV4 A;  1B8I B;  3OZU A;  2RDP A;  3IUO A;  3P4G A;  4PJJ A;  2OBS A; 
#chains in the Genus database with same CATH homology
 3BC9 A;  4BU2 A;  4PJL A;  2NT6 A;  2KLO A;  4KIS A;  3KEW A;  4MR0 A;  2X6Y A;  3PFY A;  2WAE A;  3KX2 A;  2LYC A;  2V1N A;  1FX0 A;  1PXZ A;  3WWG A;  3EUK L;  4XKW A;  1V5E A;  4XN0 A;  4YRV A;  2AQE A;  1SAU A;  1D0Y A;  1RU4 A;  1WJD A;  2BOL A;  1O8I A;  1BR1 A;  1E3X A;  2LBF B;  1QCX A;  2PYG A;  3VMW A;  1P9Q C;  3ZQQ A;  2K9L A;  2P0W A;  3OYE A;  1D0Z A;  2WY7 Q;  2M5S A;  4L8J A;  4Z1M A;  4KKU A;  2WZP P;  2O17 A;  3LMW A;  3DPT A;  4RLQ A;  1OFL A;  3VYR B;  1MMG A;  2XF6 A;  3A3G A;  2KP6 A;  4EAT A;  3K70 C;  3EQO A;  1WPC A;  1K5C A;  4URR A;  2Y0S A;  3K4K A;  3SYT A;  2L9N A;  2INU A;  1FMW A;  1MW7 A;  3BCB A;  3E0J B;  2VBK A;  4X0G A;  1H80 A;  2F5V A;  3GVL A;  3VSV A;  2NTP A;  2Q2E B;  2M7B A;  2WAD A;  2HLD A;  3OW7 A;  3FPP A;  2K3P A;  2O04 A;  1E0E A;  2NZM A;  2V9K A;  2X85 A;  1PKV A;  2DCE A;  4XR6 A;  4F91 B;  2Q1Z B;  2E1M B;  2ZFU A;  1G8X A;  3QOD A;  3DTI A;  3K4L A;  3KEY A;  3IAS 2;  3PNT A;  2JVG A;  3LFU A;  4JMQ A;  1AA7 A;  2E5Z A;  4PK4 A;  3OYH A;  3H94 A;  3N05 A;  5HLT A;  3G2B A;  2JDI A;  2DT7 B;  1ZEL A;  3MD2 A;  3QYF A;  3OEH A;  2L9S A;  4XMY A;  1BMF A;  3OYF A;  1WP6 A;  5HNH A;  1Y56 A;  1OB0 A;  4OJ6 A;  1HZE A;  4BAC A;  2UV1 A;  2HZD A;  2XAU A;  3IAM 2;  2VPL A;  2QXZ A;  4F92 B;  1DBG A;  1Z7L A;  3K4J A;  1OHH A;  2KPM A;  2R7W A;  2LZJ A;  4FET A;  4NQW B;  3DDY A;  2X6W A;  1TT0 A;  1VZ0 A;  3OYD A;  2VXD A;  4DBR A;  1H8H A;  3GVK A;  1WJB A;  2XOK A;  2DT6 A;  4HSR A;  2VJJ A;  3HXL A;  1I8D A;  5CPR B;  4PJM A;  1QJV A;  4NC7 A;  2XZL A;  1JTA A;  3VMV A;  2QE7 A;  3LSH A;  3MKZ A;  2WAQ A;  1DP3 A;  3T56 B;  4BL0 B;  2KQR A;  2CUJ A;  4IKF A;  2VJI A;  3FKJ A;  3RQ4 A;  2R7V A;  2QY1 A;  2XF5 A;  3QOE A;  2GOM A;  3RPU D;  4IZZ A;  1IDK A;  2ZZE A;  1DGR M;  1MNE A;  2M4G A;  3BCA A;  3CJR B;  3NWS A;  4JQF A;  4DGW B;  3ZSC A;  4W8R A;  3GQ8 A;  2CK3 A;  4OAZ A;  1LFP A;  2UWM A;  3TBI A;  4BGD A;  4F55 A;  1N78 A;  1KON A;  3OAA A;  4CA0 A;  3TL4 X;  3H9G A;  4RMN A;  3PJR A;  3W3C A;  4BDY A;  4BJT A;  2WJV A;  2L7K A;  2IGO A;  1MMA A;  3B4N A;  4BUP A;  3KYL A;  4G6T B;  1NG6 A;  1VJS A;  4HEA 2;  3A35 A;  2XF7 A;  3VYT B;  4KKT A;  2WB1 A;  2VKH A;  3ZRG A;  1HA8 A;  2X6X A;  3DTK A;  1PJR A;  2MC4 A;  5HVQ C;  4G7X A;  2KRC A;  1D1C A;  4XOP A;  2Z8G A;  1O8G A;  2V7F A;  4E7S A;  2R7T A;  3HL2 A;  3F9K A;  3C2G A;  4IQJ A;  1WJ5 A;  1O8H A;  1FMV A;  3ZGK A;  1WJF A;  4XLC A;  4IX7 A;  3H9J A;  3AL0 B;  5DN6 A;  2ZSI B;  3K4N A;  4Y3O A;  1UD4 A;  4DNT B;  3ZPN A;  1Z3X A;  4YZX A;  2HPI A;  3SZG A;  3RTR A;  2JIZ A;  2ZZG A;  4BE0 A;  2M7A A;  1O8F A;  2CV0 A;  1WJE A;  4D9J A;  2E1B A;  4PMH A;  2LC2 A;  1LVK A;  4HG2 A;  1GLN A;  2LG4 A;  1KTW A;  2RRE A;  1QHH D;  2ZXH A;  4ZJZ A;  3E1S A;  1WFX A;  2ZXI A;  2JUG A;  4BE1 A;  5FL7 A;  2DOA A;  2XSJ C;  4U4B A;  1E1Q A;  3CJQ B;  1X1A A;  2CW8 A;  3FDY A;  3GQA A;  3ONQ A;  3L2W A;  2PEC A;  1X4O A;  2CMP A;  1V5G A;  4QPO A;  4DK1 A;  4N4N B;  4CH7 A;  2HVR A;  4E0F A;  3LSK A;  3OFN A;  4C2T A;  2DJI A;  2IGN A;  2BW3 A;  2VKD A;  3HUG B;  4BE2 A;  2HNH A;  4Y4R A;  3A1Y A;  3PNV A;  4BQO A;  5JHF A;  1W9X A;  4TSF A;  2HPM A;  2INV A;  2VJ4 A;  3UNG C;  2X53 S;  3DLA A;  3OWT A;  1WJA A;  5HKK A;  2PYH A;  4OZZ A;  4XOT A;  2JSP A;  4XOR A;  3OS0 A;  2VIX A;  3DTE A;  3LL7 A;  2XGJ A;  2NSP A;  1X4P A;  2WA0 A;  1Y6I A;  3S32 A;  2IS2 A;  3OIP A;  1RWR A;  2KHM A;  4RLF A;  3PL8 A;  2IXS A;  1XG2 A;  1NG7 A;  2W6I A;  5CQG A;  1BPL A;  3VST A;  1O8D A;  4E7I A;  2VL8 A;  3WQZ A;  2UVF A;  1X1D A;  2BW3 B;  5FRO A;  1LKX A;  3OL4 A;  3FKS A;  2XZO A;  4XM3 A;  3L2U A;  1W36 D;  4CCK A;  1BR4 A;  1BN8 A;  3BLY A;  3HOT A;  1UEL B;  4J00 A;  4XLH A;  1D1A A;  2O5R A;  3DKY A;  3ZR8 X;  1UD8 A;  4P22 A;  4B3G A;  2UVE A;  5CDF A;  3OR2 C;  4NK6 A;  3K6G A;  2R4G A;  2IGM A;  4W8T A;  3I9V 2;  3K4M A;  3L2R A;  3CP8 A;  2DXI A;  2V4J C;  4CCM A;  4F52 A;  2V7Q A;  3H35 A;  4BDZ A;  3GQ9 A;  3OYG A;  4YEL A;  1E43 A;  3VSK A;  1OOC A;  2QKL B;  4D1Q A;  2VB6 A;  3OYC A;  2MYS A;  4NK8 A;  2L2O A;  1N77 A;  4E6K G;  1MAB A;  1YX5 A;  4AYB A;  1VBL A;  2MAB A;  3VYU B;  2CH0 A;  4ZDL A;  4BXF A;  4I84 A;  4ZDP A;  4YEJ A;  2GJP A;  2LY2 A;  3AKZ A;  3LSM A;  4U7B A;  1Z3Y A;  1CZF A;  1KZL A;  3DPU A;  3OYI A;  2NTB A;  2V6E A;  2MFZ A;  3W2A A;  3GQ7 A;  3HG9 A;  2D3N A;  4DJA A;  1X1C A;  4AU7 A;  3PNY A;  3K4B A;  1QU3 A;  3G05 A;  2KDO A;  4B3F X;  4II3 A;  2QKM B;  1AIR A;  1MMN A;  2E1M C;  2X1E A;  3SDB A;  5FRN A;  4Z05 A;  4BEH A;  2HU9 A;  4B43 A;  1KMH A;  1OFM A;  4BQQ A;  3GQB A;  2F1M A;  4KIT B;  4RM3 A;  3UW0 A;  1KCD A;  4PJN A;  5LD2 C;  3CZ6 A;  3OYL A;  3A2K A;  1DQU A;  2R7U A;  5C1C A;  1SKY B;  2XDV A;  3BCD A;  3ZIA A;  3OMY A;  3OOU A;  1DBO A;  3L2Q A;  1O88 A;  3EQN A;  4E7H A;  3NE5 B;  1BOB A;  4BQN A;  4J01 A;  2WY8 Q;  4XLF A;  2NT9 A;  4Y33 A;  4HRI A;  2Z2S B;  3KRG A;  1PYV A;  2R7O A;  4F93 B;  4G7W A;  2GOX B;  4PFP A;  4TT3 A;  2RNG A;  4BEH B;  3OR1 C;  2JJ1 A;  3MMY B;  1Z21 A;  2X51 A;  3VR6 A;  4E7Z A;  2IS1 A;  3OYB A;  4ANJ A;  4AVZ A;  1YX3 A;  4OJ5 A;  2E5N A;  1BR2 A;  3VSU A;  4PFO A;  4P1W A;  4XNF A;  2HVS A;  4XN3 A;  3EUA A;  3D5R C;  2RQQ A;  4MLO A;  3MKW B;  2LRE A;  4H4K C;  1O8M A;  5KCM A;  3D5S C;  3OS1 A;  1D1B A;  2CV2 A;  3DU6 A;  2WSS A;  3BG6 A;  3VSL A;  2V26 A;  1NHC A;  5C1E A;  1V0E A;  3W2W A;  1LDK B;  3HKZ A;  1X19 A;  1OGM X;  4QPQ A;  1K6Y A;  2GK6 A;  2JVH A;  4N4O B;  2NST A;  1YE9 A;  3BCF A;  4U87 A;  2F6C A;  3V42 A;  1RMG A;  2VXZ A;  3RCO A;  4BJ5 C;  1E3Z A;  3NWT A;  4C2L A;  3OL3 A;  3S8P A;  1WTH D;  2HDW A;  2D3L A;  1COW A;  3JU4 A;  2OUM A;  4LG3 A;  2Z1D A;  3HPH A;  3PSF A;  1OR7 C;  3B90 A;  1UD6 A;  2W82 A;  2A5W A;  4HST A;  2R7X A;  3OYA A;  1E79 A;  4ZTF A;  2VAS A;  2M0M A;  1U0J A;  2ZZF A;  2X8K A;  3LSI A;  3BH4 A;  3OE7 A;  4E4H A;  5HNF A;  4ASU A;  1WMR A;  4E7L A;  3PSI A;  2UUZ A;  3ZPP A;  3J7A Y;  3MKY B;  4BS9 A;  5CKT A;  3BG7 A;  1R6R A;  3DQV C;  1I18 A;  3AL0 C;  3K10 A;  3HC7 A;  1WJC A;  4CZC A;  4ZC3 A;  1D0X A;  4NNJ A;  4XLE A;  2VQL A;  4EW9 A;  2KL4 A;  4XON A;  1X1B A;  2NOJ B;  4JOM A;  4F3Q A;  1UD5 A;  1KCC A;  2K9M A;  2ZSH B;  1X0C A;  2EWE A;  4IQ4 A;  3S93 A;  1UAA A;  2R9V A;  2WPD A;  2KZV A;  5TGT A;  4C2U A;  4YZA A;  3A3B A;  1JI8 A;  2Z16 A;  5LFA A;  2WJY A;  1V5F A;  3SUC A;  4P5O A;  1HG8 A;  3W2V A;  3OEE A;  4YZ0 A;  1SFK A;  3CF2 A;  2ZTN A;  2O1D A;  4YXW A;  4HNU A;  1IA5 A;  2ELJ A;  4CCJ A;  3OYN A;  2W7N A;  4HIZ A;  2FUG 2;  4FXU A;  2K5C A;  3A4C A;  3H9Q A;  3QYB A;  4G6I A;  3JUR A;  3GBG A;  4ZTJ A;  2ODL A;  3FBN B;  2BVL A;  3U21 A;  4DK0 A;  4HWV A;  3DEE A;  2PMZ A;  4PUS A;  4CCL A;  1UD3 A;  1N75 A;  2XC7 A;  4BJ6 C;  2E60 A;  1BLI A;  1T5E A;  2X1C A;  2HVQ A;  3HAG A;  5CQE A;  2W1O A;  2VJ5 A;  2AQF A;  3T51 B;  2OC6 A;  2L5Q A;  4OJP A;  2GK7 A;  4GQN A;  2ZZQ A;  3LNN A;  2X3H A;  1IRX A;  1UG0 A;  3DWL E;  1H8E A;  4R79 A;  3H5N A;  1T0F C;  1HVX A;  1W0J A;  2VQH A;  3GVJ A;  4W8Q A;  4LIV A;  3VWB A;  4CCO A;  4CUG A;  4KKS A;  2O0V A;  2GJK A;  2JJ2 A;  4YZQ A;  4XKV A;  4ZYA A;  3LMM A;  3PUB A;  2F43 A;  4OJL A;  3HPG A;  3EUH C;  1GQ8 A;  3L2V A;  5KHD A;  2CW7 A;  3BC8 A;  4FAS D;  3M1C A;  1O8J A;  1IB4 A;  4OJO A;  3OIQ A;  1PLU A;  2OV7 A;  1EA3 A;  2LH9 A;  1T95 A;  4C9Y A;  2LRD A;  2DIE A;  5IK2 A;  4KJZ A;  3TMO A;  4LIT A;  4PSW A;  4DBQ A;  4ITV A;  4OAY A;  1NRK A;  4GRI A;  2VLA A;  4HPQ A;  3K4C A;  4OZY A;  2W4S A;  3LSG A;  4DIQ A;  2PJR A;  4TKO B;  5HOO A;  3K70 D;  1V0F A;  3VDX A;  3T53 B;  3D5L A;  2IGK A;  1VLY A;  1OLT A;  2W00 A;  3AFH A;  2GJR A;  3GRH A;  3CP2 A;  1O8L A;  1K28 D;  2ZTG A;  1ERD A;  5AMV A;  2JA2 A;  3OYJ A;  2V4D A;  4XQF A;  4NUB A;  1EFR A;  4U49 A;  2M3A A;  1DGW Y;  2WBM A;  2IS6 A;  2F4I A;  1EE6 A;  3B8Y A;  2XND A;  2KRH A;  2WAF A;  2R7Q A;  3RSN A;  4RM2 A;  1E1R A;  2HQA A;  3DPL C;  4W8S A;  2O0W A;  4C30 A;  4LIU A;  2X1D A;  4NC8 A;  2BSP A;  2BVM A;  2LOO A;  3DU5 A;  4II2 A;  2W6J A;  4MXN A;  4DOZ A;  1S9H A;  2PJR B;  4XKB A;  4DNR B;  2XZP A;  4HNT A;  2MD0 A;  3S3O A;  2I8D A;  2R7R A;  2KMU A;  3SEQ A;  3ZCO A;  2QX3 A;  4B3X A;  1W0K A;  3OYK A;  3OY9 A;  5FRM A;  3M8J A;  3S3N A;  4XD7 A;  1PE9 A;  2KVO A;  1JRG A;  4XKC A;  3H5A A;  3H0D A;  3OOC A;  3EPZ A;  1VF7 A;  2NTQ A;  3UR3 C;  2CS3 A;  4CSW A;  1BHE A;  1W36 C;  3SEZ A;  1IDJ A;  1MND A;  2R7S A;  2IQ7 A;  4B48 A;  4B44 A;  4Z03 A;  2VQC A;  2CUZ A;  3OYM A;  2IS4 A;  3OPO A;  3IP4 B;  4B47 A;  4E7J A;  2V31 A;  1OGO X;  4CCN A;  2CFO A;  4KT6 A;  1O8K A;  4Z06 A;  3VYS B;  4PSX A;  3QYE A;  4XLA A;  1NBM A;  1J09 A;  1QHG A;  2Z6B D;  2A6T A;  2VQG A;  1TZL A;  3CES A;  3HOS A;  4E7K A;  1UD2 A;  4XL9 A;  3CMM A;  4ZDO A;  3ZXS A;  3FHN A;  2VBE A;  5KNL A;  2LBF A;  3T9G A;  3I3L A;  1MMD A;  3C2H A;  2VBM A;  3DKX A;  3FY3 A;  3H5R A;  3S3M A;  2M4K A;  3OS2 A;  4UZU A;  1G59 A;  4OWR B;  2CV1 A;  2LY1 A;  3IUO A;  4PJJ A;  3FBI B;  1O8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...