4XL9A

Tailspike protein mutant d339a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xl9A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xl9A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xl9A02
1OGMX 2NTPA 2O0VA 4OJ5A 4XKVA 4XQFA 3B90A 4OZYA 2PYHA 2O17A 4PMHA 4Z03A 3SUCA 2NSPA 4U49A 1PE9A 2INUA 4XONA 1BN8A 4XN3A 1EE6A 1RWRA 4OZZA 3B4NA 4YZXA 1QCXA 1O8KA 3VSTA 4NK8A 4XL9A 1AIRA 2QXZA 1IA5A 4XKWA 1O8HA 2NSTA 3VSVA 4XLHA 3VMWA 4XLAA 3B8YA 1IB4A 2VJJA 4MR0A 2ODLA 4OJPA 3GQ8A 2X3HA 1JTAA 1O88A 2NTQA 2VBKA 1X0CA 2O04A 1HG8A 2INVA 3ZSCA 1K5CA 2X6XA 4U4BA 2BSPA 1NHCA 2UVEA 2PYGA 3VMVA 1KCCA 2NZMA 1KTWA 4W8QA 4W8SA 1WMRA 2UVFA 2O0WA 2VBMA 4NK6A 1RU4A 4XMYA 4W8RA 4XOTA 1PXZA 1OGOX 1O8DA 1BHEA 5C1EA 2QY1A 3GRHA 5AMVA 2IQ7A 3FY3A 4I84A 3GQAA 1PLUA 2VJIA 4YZAA 4XLFA 1O8IA 1IDKA 4XN0A 1DBGA 4AVZA 2X85A 1RMGA 3EQOA 4YZ0A 1VBLA 1O8LA 4OJOA 3WWGA 4XM3A 1KCDA 4XR6A 3EQNA 2NTBA 4XORA 1JRGA 2PECA 3VSUA 1O8MA 2QX3A 1CZFA 1O8JA 1XG2A 3KRGA 1O8GA 1GQ8A 4YELA 1OFLA 2NT9A 2O1DA 4XNFA 1OFMA 4Z06A 4URRA 1OOCA 3LMWA 4Z05A 3JURA 1O8FA 4YEJA 1IDJA 3GQ9A 3T9GA 2X6WA 2Z8GA 4YZQA 2VBEA 4C2LA 2EWEA 1DBOA 2NT6A 5C1CA 3UW0A 4HWVA 1QJVA 4OJLA 4XLEA 4XOPA 3ZPPA 4XLCA 3GQ7A 2X6YA 4OJ6A 1O8EA 4W8TA 4EW9A 4MXNA 1H80A
chains in the Genus database with same CATH superfamily
5K5RA 2ISYA 3GWZA 4HIZA 4P25A 1DUXC 4QFMA 3FZVA 1R1UA 4RM0A 1Z9CA 2Y9ZA 4OZYA 2XSJC 1SFOJ 4CQJA 3WTUC 2DQLA 3L2QA 3I56I 2O6GE 2OQRA 5IYBJ 2W7ZA 3P9CA 5HODA 1PJ6A 3GLXA 1F9NA 2RQPA 3HGYA 3TBIA 4XN3A 1BN8A 1ETOA 2WJVA 1HQCA 1W1WE 1ZG1A 3BLYA 2DTZA 1U78A 2X51A 3AG3H 3ONUA 3RKWA 2LD5A 2M8EA 4ENKA 1VF9A 2DK8A 2XKPA 4L5IA 3TO9A 2CBXA 2X8KA 2VQCA 1XMAA 3TP0A 2VN2A 2WAQA 1KA8A 2HQNA 3RKQA 2PE3A 1EA0A 2QTLA 4RJLA 2ZXIA 1GXPA 2BMWA 3SEJA 2XAUA 3W5HA 4WX9A 3D26A 2BEOA 1OCZH 1S9HA 1T98A 1X3WB 2DIEA 3BCBA 3L1PA 3MKYB 5E3MA 1QA3A 2Z33A 3VODA 1P4AA 2D1HA 1D8JA 2F4IA 1QRBA 4BQAA 1B72A 4W8QA 3CMEI 1E64A 2K3FA 5LRSA 1A6QA 5FGMA 2VJ5A 1EA3A 2D1VA 3BTJA 4IKFA 2XGCA 4EMSA 3ROUA 1BHEA 2CW5A 1HW1A 2HXOA 1JKOC 2IS2A 5JMCB 2Y30A 1K4SA 3OEEA 2XKOA 2LKSA 1O3RA 1VLOA 4FCYA 4Y7NJ 4I02A 1BR4A 5BPIA 2YX7A 3U1DA 4S04A 1VI0A 1FIPA 2G7UA 2XAJA 2F5CA 3G1OA 3IAM2 1EP2B 3A8JA 4IW3B 5A8AA 1QVUA 1DBGA 3N90A 4EM1A 1Q7YD 2BGCA 1AU7A 3HOWJ 4IXAA 2F43A 2CW0F 1F43A 2PJRA 4HNVA 2ZZQA 1O7LA 1ETYA 2A6HF 1XMKA 4JBAA 1S7OA 5IYWA 2XRNA 1XG2A 1XFOA 3GFMA 4MQ9F 3CUQB 3SZGA 4BHPA 2Y69H 5HVQC 2E5NA 4UZEA 1WH7A 2NT9A 5J8FA 3E1YE 4X05A 1BLIA 2MC4A 3CCLI 4Y4RA 1TTYA 3E3VA 4ZV4A 1VQ4B 1TWFJ 1I7PA 2XAHA 3FMSA 2ADUA 1B9NA 2Y48A 4KIGA 4LK0F 5BOXA 4P1WA 2CJJA 3HAGA 5BSXA 2ZFWA 2QA4B 1B9MA 1BC8C 2FNPA 3BQJA 1WJEA 4LG0A 2XF5A 1O3SA 1AOYA 4W97A 2IS4A 4M9XA 3ZQLA 1Y0RA 2A07F 2ZBKA 4YFKF 3BDDA 3SZEA 4HW0A 4A3IJ 4U0YA 1JA1A 5A2QK 4M1KA 3W2GA 3AVTA 3MVPA 2HQ5A 4ESBA 4DQ2A 3NE5B 1ZQ3P 3LNNA 1ZLKA 3W5VA 2FMLA 2HDWA 1X3ZB 4A3JJ 2EINH 4A3MJ 3H3VK 2HVQA 3Q3SA 1S5LC 4XKVA 3RQIA 2DMTA 2GWRA 3HTUA 1IUYA 3B90A 2PYHA 2W85A 3ZQGA 3WTYC 4G7OF 1L3LA 4YAFA 2QVOA 2STWA 3UR3C 4RDLA 3FK6A 1BQEA 2V7FA 2LLKA 2EFQA 3KPHA 5DS9A 3ZBTA 3OKXA 1M1KD 3H9NA 3Q9VA 1Z05A 3PQKA 1QCXA 1RWRA 3BC9A 5LBQA 1GVHA 3ASOH 2JPCA 4JX5A 2OF7A 3SEZA 2GOMA 3ISXA 5F4MA 4B43A 3OIPA 1BW5A 3U21A 1YTYA 2DMNA 4HLYA 2L0KA 1COWA 1BPLA 1F20A 3ZUGA 1WTHD 1EXMA 2R7VA 1UHWA 5FRMA 2BM5A 5CVJA 4E6KG 3OYAA 2V7QA 2ZL5A 1G7TA 3Q38A 2NS0A 3ZZUA 2QN6A 3GVLA 4ENNA 1SC7A 5H5JA 1QHHD 4MYUA 4Y9RA 5LMZA 5IK2A 4WXCA 3BCAA 3ERED 1S6LA 4E4HA 1ON2A 5GADJ 2LF7A 5FKMA 3A1PA 2NAZA 2GXBA 2OU2A 4UV8A 4LBVA 1MBGA 3FHNA 2D45A 1GVJA 1ZG5A 2OBPA 2YWEA 1HSJA 3CMAB 1IF1A 4XK4A 1QZZA 3PNVA 1EFRA 3OYEA 2K9QA 4QHYA 2L7ZA 1MMGA 4UUTA 3HM5A 3TW6A 1XB2A 2WSSA 3OYLA 4PGOA 5H2FC 1HC8A 5IYCJ 3T56B 5FB2A 3GIRA 1VBLA 2BXYA 1UD3A 2GLOA 2LY1A 2ZKZA 4RD4A 1LDKB 2ESHA 5F0FA 1T2KA 1R4NB 2EJRA 1LB2A 3QU3A 3M8EA 2E60A 3WGIA 1YLFA 3R0JA 1WJ5A 4F93B 2OAZA 1CF7B 1CQTA 3GYHX 1MZBA 4OAYA 3GVKA 5DCMA 5IYPA 4YELA 4YIFA 2STTA 1GQ8A 1WDTA 4P26A 2R7WA 1TVCA 5HNFA 4PJ0C 1L1IA 5F1RA 3M7GA 3WE3A 1LEAA 2KKOA 1XGNA 5IPAA 5A88A 3FXKA 2M9HA 3K1PA 1V3FA 1HLVA 3A3BA 3DBRB 1FPQA 1SMYF 2CQXA 3EPZA 3FXQA 1H8EA 1OJLA 3CC7I 5DEQA 2XV4S 5TGTA 2R7ZJ 2NRAC 1EFCA 2ZTNA 3AVUA 3ULQB 2EFOA 1JJ2B 3ELKA 2W6JA 4H4KC 4I0BA 4OAZA 4KMFA 4I09A 3ZXSA 2VONA 1IN6A 2F5DA 4LLNA 3BG9A 1E17A 1IN8A 2VE9A 3S15J 2JSCA 3CC4I 1FOYA 2ZMEA 1K61A 5HLHA 3FXJA 2ZZEA 1U5TA 1IN5A 3F8MA 2C5BA 3T53B 3VR6A 3KP5A 1ONVA 1SFKA 1NG6A 1STZA 3BPXA 4A69C 4B4CA 4C2TA 4KIBA 1KONA 1SFEA 3B78A 3QFTA 3H9GA 4BHCA 3M07A 2QCOA 3DCFA 2V7WA 2W00A 3Q0VA 1J75A 3OYGA 4I7HA 5F0HA 1E3HA 4KICA 2XOKA 1BMFA 3KP4A 4A3FJ 1W0KA 3J7ZI 3MZYA 3OJXA 1ZHFA 5JVTA 2L7KA 2RREA 4NBSA 4LLGF 1NB9A 3F9KA 3NWTA 4IHSA 4XL9A 1QGZA 5CVVA 3E6DA 2DA5A 3JRAA 3CCRI 3QP5A 4I01A 3ZPLA 1XPXA 2CQQA 3PETA 4KT6A 4GXOA 3BR0A 2JIZA 4CGZA 3G6EB 5GAEJ 4RD3A 1Q86D 3FMRA 3K4JA 1G6NA 4FX0A 4A3DJ 4G1BA 2RQQA 1JTAA 2ZXHA 1Y0NA 5L46A 3QU6A 1UB9A 2INVA 2ICWG 4RB3C 5J35A 4BY1J 1D2EA 4KIFA 1R49A 2M4KA 1VF7A 1SKYB 1R4MB 3LSJA 3BZCA 2Q2EB 5EG0B 1DDGA 3IH4A 3PFYA 3WNBA 4DQKA 2JA5J 1TT5B 3BY2A 2ID3A 4QVAA 1S29A 1VQ6B 2GJRA 1LLWA 2NNNA 4KMUX 9ANTA 3P27A 1TWGJ 3DWLE 3I1FA 1PXZA 5TR9A 5LEJA 2O61A 3GRHA 5JI6A 3HHGA 2DT6A 3W6KB 4ETSA 2MD5A 4IHWA 2QQBA 2GXGA 2V1NA 2QBYA 2QDXA 2DAOA 3D5SC 2WR8A 3ZQIA 1T6YA 2VJIA 1LFPA 2VBWA 4YZAA 5KSWB 1QGAA 2K27A 2K40A 5F08A 2JJ7A 1YG2A 2VE8A 2FVGA 1UCRA 1Z3YA 4NCNA 2M0MA 4XM3A 2C4UA 3AGPA 1S72B 4AVPA 1KK3A 4BS9A 2G0YA 1JHFA 3VNUA 4FETA 4Q48A 1K4TA 2V1DA 3GZNB 2X1DA 1MMNA 2DOEA 3U2QA 5ILVA 1IRGA 4RGSA 4URRA 2ZC2A 4CXFA 2ZCWA 4CICA 3QYBA 3ZMTA 3K1MA 3PO3J 1I6HJ 2GBYA 2UXXA 5IP6A 5IOZA 1ZH5A 2K4JA 1S4MA 1ETKA 1QQIA 1LE8B 4XBFA 4J19A 1WKMA 1H85A 2L7MP 3OZVA 1R6RA 2K86A 2PLYA 2YR2A 1XTAA 3OYFA 3QYFA 1RIOH 4CCNA 1CQXA 3HDDA 4ZJZA 3BPVA 2Z6BD 1I18A 3EYYA 3JREA 3EUHA 1NDHA 2LDUA 2O03A 5D6FA 1P2FA 5TY0A 4DBRA 4UAJA 4JQFA 3R60A 1ZRDA 2JN6A 1OFDA 5E6TA 1SVOA 2EB7A 2K5CA 3F72A 4BJ5C 3IHUA 5E20A 3SLDA 1ETXA 2Y0SA 3A1YA 2GJKA 2LOOA 3OYBA 3GZ5A 1OYWA 3ASTA 2Z3YA 3HTSB 1Z1DA 3BT9A 4BKXA 5ICCA 3GTMJ 3FKIJ 1PDNC 1V0FA 4PJMA 4PMHA 1Z6RA 5IYRA 2WWYA 1ZR4A 2GREA 4A3LJ 3ZMDA 2P5KA 4F52A 3IWZA 5F4OA 2HZDA 1FT9A 4WWCA 3B4NA 3FXUA 1ZTRA 5JLXA 3QFRA 1R5GA 5KVRA 1K83J 3DEWA 3ISPA 2CK3A 3TO7A 1QBJA 2C2WA 3IKVA 3G4SI 1LDJA 4PCQA 4MR0A 2DA1A 1SAUA 5CQGA 4L9JA 2OYNA 2LKPA 1B2RA 1PP8F 3DPTA 3DTIA 5C3EJ 2W48A 5ED4A 2ZZGA 3A01B 1FX7A 4GO1A 3T8TA 4GYGA 4AUXA 1UD6A 2A68F 3VSKA 4EJOA 4U7DA 4OPOA 3LSGA 4YEIA 5DNSA 3IRQA 1TTTA 2HKXA 3F8BA 2G9WA 1LFBA 3W2HA 1DARA 1KK2A 3PM1A 5FKLA 3ZCOA 1ZGWA 1XC5A 4B09A 2MABA 4J0QA 1JUPA 4II3A 1ULYA 3RI4A 2BBYA 2BYVE 1D3YA 2ZB9A 2WAQN 3MQ0A 4HNUA 4C2MJ 5JVGF 1OGOX 2R7OA 1F4KA 2JA7J 3F6VA 4UB8C 1MBEA 3ECOA 4KYWA 4C2UA 4IHYA 2LY2A 4N9HA 4IPAA 2FA5A 3A03A 4M72A 2QQ9A 2XTYA 3JX8A 2DO7A 4C3HJ 3HOZJ 1I1SA 4EJVA 1FNDA 3MD2A 1ON1A 2CO5A 3H09A 1DU0A 2FU4A 2LBFA 1MMSA 2GPJA 5F6FA 2J8IA 4Z4SA 3H0DA 3F23A 4QSHA 2YUHA 2XSDC 2VBUA 3LAPA 2FBKA 5HZBA 4G6TB 4HZFA 5D8KB 3OEHA 2DA6A 1X1PA 5HS9A 3T1BA 4OM9A 1Z3XA 2CSOA 4L18B 5EJCA 3N6ZA 5M5WJ 5E3NA 3A35A 3TQNA 3H9QA 4RB2C 4E7ZA 5HS8A 3AFHA 2E2IJ 5CPRB 2HEOA 4Z2YA 3L9FA 1BJAA 3A4CA 4N4NB 4G94A 4M3FA 1YW8A 1ZN2A 1V5GA 4XRFA 3O8HA 1R5HA 1KU9A 2JMWA 4Z05A 2NYXA 3OL4A 2P7VB 2LR8A 5B1BH 3J81K 5HDKA 2HWVA 1BIBA 3GZ6A 2NVTJ 3KP2A 1D0XA 1LQ1A 1VJSA 1VQ7B 2V5IA 1EKEA 2BW3A 3CC2B 2BXZA 2R4GA 3WYAA 1I3AA 4ENJA 1WPCA 2WB1A 5DUIA 3W2WA 2R7SA 2DPDA 3CUOA 2LREA 2R7FA 1H8HA 4OJLA 1V5VA 3CUQC 5L3FA 1E3OC 1TLLA 3CJTB 4MEYF 4U87A 4M2LA 2NOGA 1LFUP 4ABZA 2WZNA 4JYKA 3OSFA 3DU5A 4M71A 1OR7C 1D1BA 4PFPA 3ZQQA 4LOCA 1FOXA 1MIJA 4N9IA 1LDDA 1KZLA 3FF5A 4W8TA 2EIMH 2OTLB 1DGRM 1RPWA 4QPQA 5CJ9A 1Y1VJ 3WG7H 4P2NA 2O5RA 1HSTA 3L2WA 1WHUA 2VOPA 4OPWA 1TZLA 2IPQX 3KETA 1WJAA 4DZPA 1ETQA 5A89A 3PSSA 3DU1X 3JRFA 3ZIAA 3VWBA 2F6CA 1DQUA 2OZUA 5HZAA 1XS9A 4U49A 1B8IB 3C1DA 2BGIA 4GRIA 3HOTA 3OYDA 1GO2A 3HL2A 1VQ4I 4KH3A 4YZXA 1WPKA 4ZTJA 2IW5A 3DEEA 4RDUA 5TRDA 3GTQJ 4IOAF 2QA4I 1JTXA 2RVCA 3GTGJ 4A6DA 3JRCA 3LSMA 3EQLF 1REPC 3V76A 3GTLJ 1JKPC 4BAYA 4RB1A 4UV9A 4EGYA 1WP6A 3CP2A 4HDUA 2R0QC 3FXOA 2DI3A 1X4OA 3BJ6A 2L9RA 1OCTC 4OIQF 4X7EA 1HG8A 2KVOA 4A5NA 5ICFA 4P9SA 2A05A 3PIPF 2VKDA 1Q1VA 2XNCA 1NJID 3L09A 5D5XB 2VT2A 2RC4A 2HYJA 1OFEA 2CV1A 2E5ZA 3JQRA 2QUFA 4OIOF 3JRHA 1BJKA 4WCGA 4EQQA 2VBMA 1QGPA 3ASNH 2BY0A 2WADA 3OYCA 1R36A 4EV0A 3DKWA 4JMQA 1W9XA 1V5EA 2Y0MA 3K4LA 4FX4A 3OE7A 2CQKA 3QQAA 3CDIA 4M6YA 2HDNB 4MEXF 2ZBUA 2VBYA 4CUGA 2EZHA 3IUOA 1S3JA 4G7XA 2HOSA 4M0LA 2JTVA 1P9QC 4MHGA 2VFPA 1H42A 3S14J 3PENA 3JRGA 5J3OA 4RGRA 4NBQA 3GX4X 2W1OA 5EYRA 5ERIA 2DCEA 3QPLA 2LFBA 1QVTA 3C18A 1GV2A 2HPMA 4OINF 5B6IA 2OJED 2NTBA 1W7PA 3CJQB 1JRGA 1OCRH 2ELJA 2PX9A 3A8IA 2RN7A 3B82A 1QZYA 1YHQB 2EV5A 3NRVA 5FJ8J 4HF1A 1KTVA 3GSIA 2HLDA 4Z4RA 4LIUA 3SFZA 1MRZA 3PIOF 3V4GA 1BI2A 1B4AA 1XGMA 3TDUC 4GQNA 1KC8D 3OOCA 1TNTA 4HX7A 5LFAA 2XGEA 4HQEA 5AIPA 2VBTA 4Z4VA 2XZLA 2VQHA 3KZIC 2P7CB 4PC6A 1Q81D 4I76A 2ZZFA 3BH4A 2VC0A 3S3NA 5FLMJ 2TCTA 3CMAI 3KL9A 5DCFA 4OOVA 2CMPA 2DYIA 4R71A 5D5WB 1WGXA 3HBLA 4F92B 1W5CC 1YFHA 3VB2A 2BVMA 1JTYA 4EM0B 4DGWB 3K7AJ 2WJYA 5D5UB 4UZFA 2L4AA 2XROA 5CLSA 3BTCA 1HF0A 5J8CA 4MXNA 4DOZA 2PN6A 2GQQA 5IY5H 1IHMA 2VB6A 2XPUA 4MFEA 3I59B 1ERDA 5D8LB 1G7CA 1ZM3A 3S3OA 2EZLA 1JT0A 1VQ9I 1IRFA 3I55I 1N06A 4QUZA 2FBIA 3RPUA 2IGMA 2O8KA 3W6VA 2ECCA 1XSXA 3W2IA 1HW5A 2NXNB 4M74A 3NARA 4RAYA 4XONA 1UZCA 3K4KA 3WTWC 4Z4WA 4E7HA 2FBHA 2ZFUA 3RSNA 4G7ZF 3OR1C 2EIXA 2HYGD 4LGWA 4BEHA 3LSKA 3FK7A 2VKEA 2IBDA 2QLZA 4RMNA 5E8IA 1K78A 4RD0A 1FYKA 1BR2A 1GVDA 2PMHA 1DDIA 5DD4A 2NPFA 3VPRA 1HXDA 4MGRA 4YFXF 1P7JA 2DCUA 4P1VA 1O88A 1FP1D 3LFKA 2JPBA 4IQJA 5J47A 2DDBA 3ZSCA 2OK7A 2GK7A 4RAGA 2VKVA 2K9LA 3DBHB 2JT1A 3I53A 2PYGA 1E79A 3TGNA 2VYQA 1KU2A 3NAWA 3SHFA 2F4OB 2B63J 2LY9A 1N77A 3S8PA 1U2RA 2JK3A 4LMYA 4N3NA 4PABA 4FHTA 5EEHA 1U3EM 2BY3A 2E7XA 2V9VA 1YX3A 1BW6A 3E7LA 2BV6A 2VXDA 1W0JA 1VQ8B 3QOEA 5HKKA 3LL7A 5FFZA 1N0UA 1OGJA 2E34A 4M4SA 3WTTC 1NK3P 3QYEA 4XSZF 2OZ6A 2Y9YA 3OOUA 3HUGA 3RPUD 1Z0XA 2QM3A 1KQ0A 3DV8A 3BZKA 4NDLA 1JGGA 1Z6TA 4N4OB 4JP0A 4KA4A 2NVQJ 4G6IA 4YZ0A 3PO2J 3GFLA 3G6EI 5BQTA 5KNLA 2IVMA 4UNOA 4PJJA 4AIHA 2FX0A 2XGXA 2R3SA 2KIQA 5BNGA 1VHOA 4M3GA 1CZFA 1S0UA 1HF2A 4BBRJ 3AVXA 2DA3A 2DODA 3CCVB 5C4XJ 3V7AA 2K7LA 4RS8A 5FLXK 5J3LA 1T8IA 1HOMA 3TL4X 1LUJB 5F64A 4OMZA 2CV0A 1P92A 3DKYA 1PUFB 4A93J 4RM2A 1GXQA 2A5WA 1ZGAA 4FQGA 1R5BA 1S7EA 5FLXZ 5J40A 3CZ6A 2PBIA 3KCCA 3P4GA 1N78A 2LTPA 4ANJA 1UG2A 2H8RA 1FWZA 1MABA 1X58A 4V2FA 4NQWB 1T5EA 4PFOA 3CCSB 1W0UA 2DFEA 1HKSA 3ZN1A 3MFKA 2NNYA 4E7LA 3JTGA 1YJWI 1G7SA 3VOEA 2FEZA 4X06A 4FASD 2WZPP 1T0FC 4BQNA 3KP6A 2P5LC 1FY7A 3R0AA 1S72I 5FO5A 3OYNA 4RD2A 3ZMSA 2DJNA 2O0VA 1XG1A 3SZPA 4XQFA 3W2VA 4PGHA 4QWQA 2LK2A 2XB0X 1Q82D 4P6VF 3UNGC 3CPXA 3QFCA 1UG0A 2PIAA 4CYCA 1DDNA 2V7XA 4ZGQB 1X3UA 3E20A 5LHGA 2VNJA 5K5QA 3VSTA 3I71A 1E3XA 1VNDA 2F4MB 1IA5A 1U8BA 3HOSA 3G2BA 3T51B 3VSVA 2A6TA 3BH7B 2EQRA 2Y0SN 1H0MA 2E1OA 1C0WA 4KKUA 3VMWA 1VFCA 3WXMA 1QX4A 1G3TA 1MDMB 4ESJA 2NVXJ 1M90D 2QWWA 2DN0A 1R71A 4HLXA 3CMYA 2KMUA 2XGJA 3S16J 2XDVA 4PAAA 1QUFA 3AVVA 3RY8A 1SANA 4QLCU 2EZIA 3CJNA 2R7RA 4OP7A 3A0HC 1ZRFA 3U9GA 3M8FA 2VFOA 4B3FX 3VMVA 1ELOA 2DOGA 3ABTA 4ASNA 2EZKA 2E1MB 2RDPA 4EEFG 2F1LA 4KKTA 3FXLA 4B4DA 4W8SA 2HNHA 3WQZA 3TEDA 3ONQA 1VLYA 2BM7A 2EIKH 5KAFC 1UHSA 4WZEA 3IH2A 2QENA 1TYXA 2FF4A 4UVBA 5LEKA 1O8DA 2Q1ZB 1JUSA 5DV5A 3HG9A 3PUNA 3ZMZA 3VYSB 2TRTA 3F0CA 2R5ZB 4ACAA 4HE5A 1A04A 1AWCA 1G3SA 1K6OA 3GQAA 3RYRA 1FIAA 1V55H 1ACIA 3VDXA 2JJ2A 2H94A 4RD6A 5M5XJ 5CDFA 2XT4A 4P12A 1FRNA 1J59A 3MMYB 1TWHJ 3S93A 3KLOA 2X85A 4P9UA 3VEPA 3GVAA 3QPSA 4HF0A 1RQRA 2GZWA 3SYTA 1KMHA 4X7DA 1O8LA 2KLOA 2OC6A 2ACJA 1UD4A 3H36A 4RA2A 2Q6OA 2VOOA 2EFGA 2Y2ZA 3ONYA 1J7KA 3LMMA 1WRJA 3CCMI 2DTRA 1QH0A 3JAMZ 1WI9A 1ZREA 3SJMA 3W2EA 2IAIA 4XLNF 2DA7A 3HPHA 3KYDB 1I8DA 1PJ5A 2RC5A 3G3ZA 5HLTA 3E6CC 3D5LA 2NOJB 4NC7A 2O1DA 1OFMA 4QVJA 1AKHA 2KQRA 2IGNA 3RCOA 1K9MD 3DEUA 2LG4A 4E70A 3PL8A 1SVMA 5AIQA 1XMXA 3CB4A 1YLOA 4RLZA 2JVGA 3CTAA 1XGSA 2VBXA 2BF4A 2MA3A 4UUSB 5FIUA 3T9GA 4B44A 1CNEA 4WK8F 4ON0A 1W0TA 3ABUA 3W2AA 1F60A 5AN9A 1RKTA 3I9V2 3SDBA 4R1HA 2ETHA 2YU9J 3D0SA 2R7QA 3LOCA 2FQ4A 2LC2A 3ERMA 4IHVA 1T95A 5GPAA 1QA6A 1XGOA 4PGGA 5BPDA 4TMVA 2TDXA 1R7JA 4LD5A 3WTXC 1FJLA 4OJ6A 3E1SA 2OBSA 2D5VA 1TBXA 3I0TA 5L3CA 3WGGA 4DYQA 1X1BA 1BM9A 4BBSJ 1XB4A 3RTRA 1OGMX 4NHJA 1U6GA 3DPLC 1YRNB 3QRFF 4BNCA 3FIWA 4Y33A 2F3LA 3O8GA 1IW7F 3WGHA 3NEUA 1NBMA 3DF8A 4FE4A 4BY7J 5FKOA 2R9VA 2WB1N 2BN4A 1OLTA 1E43A 4RDKA 2DEUA 1TQPA 2FSWA 1E3ZA 3FHZA 2CV2A 3CCUB 1O8KA 3MZHA 1YITB 1IV8A 5EGOA 2AO9A 3ZQCA 2CFOA 1EP3B 4AD9A 3H92A 3PNTA 5LGTA 2VNKA 2DY1A 2DT7B 2PG4A 2DMUA 2ME6A 4CO8A 1VQ7I 3V42A 3CC2I 4HEA2 1JJ8C 2X6OA 1IN7A 1RR7A 4BH9A 2FRHA 1S7AA 3MHPA 4C9YA 1FTTA 2R7TA 2BE5F 2ZXWH 3HIFA 5FRNA 1USSA 4LB6B 4DZJA 2O8XA 4YAUA 2QF7A 2QYOA 3P9IA 2EIJH 2H6CA 1K28D 5FA6A 4V2GA 1KK1A 5E8GA 4PC2A 2NVYJ 1FX0A 1FYLA 1WQ2A 1NHCA 3AK5A 4G6DA 2DXIA 2QEXI 4F55A 2OTLI 3S2HJ 1BA5A 3F8CA 3WHCA 3TOBA 5IT3A 1TQIA 1KYWA 4JK1X 2L7FP 2XHKA 2DU9A 1K4ZA 2X0LA 2KL4A 1WCMJ 3S17J 3S1MJ 2JDIA 3H1CA 5C1EA 2XF7A 3WU1B 4QIWN 1VQOB 5AMVA 1B72B 4L0ZB 4YDTA 3GMEA 1X2NA 2OTJB 2F1MA 3I64A 4HX8A 4BGDA 3KZZA 2IGOA 4P22A 4EATA 4G7WA 1J9ZA 3PUMA 1TC3C 1EH8A 2GAUA 1LVAA 4OJOA 3HOYJ 3LSIA 4BUPA 1JJ6C 1FNCA 2Z1DA 2ZSIB 3OWTA 2C77A 2XRLA 4Y7CA 4MYTA 2ZJ2A 2XPVA 1X1CA 4OU0A 2DERA 2EA4A 1YI2B 4CZCA 1I50J 1SAXA 3H5NA 5EDNA 5HDGA 5E3OA 2R5YA 4P3YA 4WXDA 4ZYGA 2IA2A 3LA2A 2XGDA 2CF4A 2Q6KA 2PJRB 3O6BB 3K9TA 1BN5A 2BY2A 4M9ZA 3X2QH 3MKWB 1E2XA 1MNMC 1TSPA 3ZPNA 1N25A 3A0BC 4TMXA 3OMYA 1SM4A 1E1RA 1KQ8A 2ID6A 1K73D 5HLGA 1A31A 5CYVA 1B1BA 4D7MA 1KU7A 2N8GA 1APLC 2D3NA 1Y0UA 2HCJB 5GAGJ 2XC1A 3MMPA 3K70C 4IX7A 1PVEA 3LFUA 3TP3A 3BC8A 1QPIA 1XE1A 1MH3A 1QA1A 1SD6A 5IOYA 5LGUA 2BM1A 3LQ6A 4L0YB 3IWFA 3FXRA 3EUHC 1JUMA 2W84A 4UVAA 4ASUA 2FE3A 1YJNB 3CLQA 5FROA 2UZKA 2YX4A 3ZC3A 4BL0B 2PJPA 1O8EA 4A5MA 3GO5A 1D5YA 4LG0B 2JVHA 3I4NJ 2UUZA 2X1EA 1BI1A 1HDPA 4B1RA 1KQ9A 4EW9A 1H80A 5DDGA 2B5OA 4HPQA 3ZBUA 3TH0A 4Z4YA 1QFYA 2O17A 4Z03A 2ZSHB 1LKXA 4FN5A 2VIXA 3RKXA 4HDVA 4BE1A 4R8HA 1YHQI 2HDDA 1FDRA 2NSPA 4DJAA 1RUNA 4RAZA 2OA4A 2VFNA 4H9GA 2HU9A 2J7KA 2QE7A 2L54A 3M1EA 2XB5A 4CHUA 2OCEA 3B02A 2E1BA 3GLLA 4XLAA 4DNTB 2IP2A 3SEQA 4YIRX 2O7OA 4U0WA 4X8IA 1HDDC 1ZUNB 3VMFA 1SD5A 2VKHA 4M3EA 1YE9A 5EZHA 4DYRA 3DTKA 4IJAA 4UB6C 1UMKA 1FOWA 2QGUA 3E5UA 4HSRA 1LJ9A 2QQ8A 1QPMA 2X9DA 3RIRA 1YJ9I 3CD6B 5CKTA 4Z4ZA 3HB9A 3OS1A 1V0EA 2VFMA 1K8AD 1OCOH 1CGPA 5B5EC 1KCCA 4RDJA 5LD2C 4RLQA 1MW7A 4ROXA 1DPRA 3J7AY 3GVJA 2CW8A 2UVFA 1ETVA 2YWGA 3SYJA 3B8HA 1O4XA 1DP3A 5KW9A 1T6XA 4XOTA 1BI3A 4PK4A 3R6JA 3Q3AA 4YAWA 4C0SA 2VODA 2M45A 3WTSC 4HF2A 2JQ7A 2IQ7A 1W5SA 2VBVA 1BL0A 2IS1A 2H8WA 1VQ5B 4F7ZA 1QVGB 1MJ9A 1U9OA 3MKZA 1VQKI 2C5HA 1IDKA 1GR1A 1TQMA 1Z67A 3HC7A 2CUJA 3M1CA 2IT0A 3N05A 5IYQA 1FMWA 3WWGA 1ZK8A 1EJ9A 3WTZA 4WZKA 2XAFA 3ZR8X 4KFCA 1EF4A 2YWFA 3ZQ7A 1UMQA 1QFZA 3B6CA 1HA8A 2XNDA 3VSUA 1V5FA 1O8MA 5GTIC 1FMVA 2HOAA 5J1RA 2WPDA 3HRTA 2YS9A 5ICGA 2J8KA 4B8XA 3K4BA 4ZGNB 3F6OA 1LVKA 2P4WA 3P26A 4WZTA 2VASA 4A3GJ 3K10A 1UJ8A 4P9FA 2K9NA 1MMDA 3KP3A 3ABMH 1DP7P 1FLIA 2DFFA 1GHCA 3WNDA 1IJEA 4FT8A 5DCMB 3K70D 2L9VA 3JURA 3KP7A 4JX6A 3VYTB 4E7IA 4RGXA 3OP1A 1S8NA 2MBFA 1G59A 2JSPA 3E0JB 2HDCA 4ZZLA 3JRBA 1HCRA 3REOA 3HJEA 1VQ8I 2EWEA 4D5FA 4PSWA 3AVWA 1UHMA 2Q6LA 4CCJA 3UW0A 3ML6A 4MQVA 3BG3A 3LAJA 3KIOA 1ENHA 3P5JA 3CCJB 4XOPA 1BR1A 2H6BA 1JE8A 1IXCA 4OWRB 5TV2A 2XEXA 1E3PA 4DIQA 1LPQA 3FKSA 4BPRA 6PAXA 4ZZDA 4LBZA 3KEQA 1QUEA 5BS6A 3E5XA 4IQ4A 4FK8A 1TWCJ 2DLLA 4J01A 2KIMA 2C4TA 2ZMEB 2VPLA 1UAAA 4PJLA 1DGWY 2GA1A 2L3DA 2P6TA 1U5TB 3CCVI 3SUCA 3K69A 3V8JA 2GM4A 4M9SA 3MWMA 4G1VA 2INUA 1FNNA 1P6RA 1RKWA 2JA2A 1T33A 3Q9SA 4Q47A 1I3QJ 5JR3A 1BOAA 1H9TA 1GDTA 1A6IA 3S2WA 5M3FJ 2VLAA 1AIRA 2V1XA 4Y17A 2QXZA 1J2XA 2QZ8A 3GFJA 1ITYA 5FLVA 4I98B 4AF6A 4F7DA 3V7SA 3RZOJ 1U8RA 3AGQA 4OJPA 4NC8A 1SFUA 1IXRC 3ZMVA 2L9NA 2W57A 3CLOA 2VBKA 2OPTA 1EZGA 3KE2A 4HA8A 2JA8J 3S1QJ 1D8TA 2KISA 3ZQFA 3LA3A 2ELHA 1VQLB 3HSRA 4RCZA 3SXYA 2PFBA 1DABA 3AAFA 3FISA 1YW9A 2LP0A 2VBZA 4U4BA 2CFXA 3BJAA 3CXCB 2AXLA 4D5CA 4W1UA 1M1EB 2RGVA 2EBIA 2JZYA 2NZMA 4IO9F 5FFXA 2DA4A 2NS7A 2FX3A 3RDIA 3OV8A 2R6HA 2QGGA 2LNBA 3M3YJ 2B7CA 2IS6A 5DS0A 1OMIA 1P4WA 1I39A 1IN4A 1WJBA 2QY1A 3VSLA 4YIIA 1FRQA 3FY3A 2F5EA 3CF2A 1HKTA 1H9GA 3G73A 1FBUA 4TKOB 1XSVA 1Z21A 2Q0OA 3F8NA 2FXAA 2CUEA 1RQPA 2ZNYA 4EJUA 2I5UA 3CJRB 2HS5A 2OQGA 3JCUC 2BM6A 4LLLA 3H3ZA 4MTDA 3WNCA 3AKZA 3OL3A 2E71A 3OS2A 1PKVA 3H94A 2E2JJ 4YCQA 1OYIA 3HZJA 3CUQA 3H0GJ 1XD7A 5J6XA 1T39A 4M6VA 2E1MC 2QBYB 3M4OJ 1UD8A 1KCDA 2BOLA 3RZDJ 3L2RA 2XUBA 3GEZA 2I1LA 3T8RA 2KIFA 2MGQA 4Z1MA 2UV1A 3TOAA 2XZOA 2HOEA 2W82A 1GV5A 5THXA 1SKQA 1W34A 4EM2A 4Z06A 1U2WA 4HBLA 4BJ6C 1GT0C 4D1QA 2BHZA 2XAGA 3ASSA 2IJLA 4LBYA 3WBJA 3BG6A 5CVRA 1GLNA 2AXTC 4CYDA 1KZHA 2H1LA 3HKZA 1H89C 2V7TA 4X07A 3CCQB 2P5VA 2A6EF 1TUIA 2Z8GA 1B6AA 1R1TA 4HG2A 3GTKJ 5GTHC 2R92J 2KPMA 3WU0A 3KLNA 1JI8A 3AG1H 1ZG3A 5F27A 1KK0A 5CQEA 4OPSA 2P3MA 2YWHA 2W6IA 1HVXA 2A69F 2DW4A 3DLLF 3A02A 4XICA 2R7DA 4IHXA 1OB2A 2KIUA 1O3QA 2JWTA 3I5UA 4BQQA 4U7BA 3SZTA 4LIVA 3W3CA 1ZM9A 3FPPA 4IL6C 3DDYA 1HKQA 4HYEA 5DM6F 3OYKA 3BR2A 2D3LA 2YUSA 3RQ4A 1Y8QB 1IG7A 2B7BA 4PC1A 3K0LA 2BM4A 2X53S 5HNHA 1KJZA 1MKMA 3T5XA 2VL8A 1EH7A 3DXJF 1MBHA 4Y15A 2ELKA 4MNUA 1PJ7A 2J5PA 3SJPA 1PUEE 1HBXG 4P96A 2MD0A 3ASQA 1UFMA 2HR3A 3PNYA 3GTJJ 4X7FA 3KZYA 4ZC3A 2HYFA 3OOPA 1BX0A 5L3BA 1O8HA 1D5VA 2VI6A 3B8YA 3O2PE 1YX5A 3EUKL 1MH4A 3PA2A 2JUCA 2DQRA 2Q8KA 3BQYA 1TLHB 5CVIA 4AC9A 5GP9A 2BY1A 1I1GA 2P6SA 3MAJA 1X0CA 3CMMA 1OKRA 3BR1A 4D9JA 1USTA 5JFRA 3UKGA 3WODF 1IO2A 2X3UA 5EZGA 4Y52J 4YRVA 2O0YA 3FBNB 4I0AA 3LVBA 1OB5A 2P8TA 4Y13A 1P4MA 1TW2A 5LGNA 4K1XA 3W6JB 3G71B 4EJWA 2KDOA 2WY7Q 3I4MJ 3BOQA 5FD5A 3LYCA 1BBYA 2M87A 2CU7A 4QPOA 4G7HF 4RPDA 1BX1A 2DYSH 2D74A 1MGTA 1Z91A 4P55A 2V9PA 4GGGA 3TMOA 5IP9J 5BSYA 3CCUI 2DFIA 4AWXB 4U0VA 4CCKA 1CF7A 3G4SB 1O8IA 2CGPA 3EQOA 2BGJA 2M7BA 5B66C 4ZYEA 1V4RA 4WF2A 5D6EA 2KZVA 2M7AA 3U1KA 1R9TJ 1X4PA 5FO1A 1QO0D 4I2OA 3JTHA 3HOUJ 4ITVA 4BYYA 4OOIA 3ASPA 1O8JA 1DPUA 2LBFB 2HZTA 2OCCH 3OYHA 3QPTA 4FTHA 3RPQA 3LJYA 3FKJA 1IC8A 2Z5UA 4Y3OA 3T0YA 1IZ1A 3Q5FA 2B9SA 3V8KA 2HXIA 4RCYA 4FXUA 3LO8A 3LMWA 1ZLJA 2KZGA 3ZN0A 3J81k 3JSPA 4BXXJ 2O3FA 4PC3A 3L00A 3PSIA 2RC6A 4FWTA 4NB5A 2HTJA 2KRFA 5F1JA 5IP7J 4JX4A 1G3YA 3SQVA 5K1YA 2IRFG 2XPWA 3OS0A 1VQOI 2PMZA 1BI0A 4M6XA 1G4DA 2E1RA 1WFXA 2VC1A 2EH3A 1VQPB 3HYIA 2OTJI 1QGYA 5GV8A 2W25A 2CG4A 2KJBA 5F4JA 2BW3B 3N4MA 4AYBA 1QFJA 3WG9A 2MC3A 5B1AH 2M3AA 2JRMA 2K9SA 4NUBA 2R7UA 4YALA 5LHIA 3BH6B 4B3XA 3PUFA 4E7JA 3WU2C 1LNWA 1YI2I 2HOTA 1I6XA 4Y9UA 2Z2SB 2LZJA 1VQ6I 4DYCA 1G2HA 3ZMUA 1NG7A 3LA7A 2Z99A 2V31A 2XT2A 3OW7A 3J7AO 1MMAA 1T08B 4B48A 2E35A 2W4SA 3QE2A 1PE9A 3C2BA 1OPCA 3L2CA 3K4MA 4KN7X 1PYVA 1U9NA 3C2GA 3HSFA 3U2RA 4KITB 3OFNA 3GCMA 4X1EA 3ECHA 3WY9A 3PJRA 5DN6A 2BZTA 2VJJA 3PSFA 2XF6A 1Y8RB 1VQNB 3BG7A 2RKHA 3HXLA 3MN2A 4C30A 1QA2A 5EG0A 2Q2EA 4O3MA 5ILUA 1EFTA 3ASRA 3U6KA 2ISZA 1YJNI 1TYUA 3QSYA 2MG4A 2ZITA 2M5WA 4XLPF 4HQMA 5H59A 3WHBA 5K7FA 5KAIC 4DNCA 1IAWA 4PZJA 2OUMA 3JR9A 2OBTA 2CWEA 1KYZA 4B3GA 5ICEA 4NK6A 2VUMJ 1RU4A 2W24A 1EP1B 1T56A 3QOPA 1IRZA 2VNIA 3QAHA 1YIJB 2IEKA 3EDPA 1N0VC 3AVYA 4BJTA 3FM5A 2BM0A 3ABKH 4L8JA 3AG2H 5JHUA 3MCAA 2AQEA 2COBA 3FM3A 1YX2A 1D0YA 3HEFA 3F8FA 4N0BA 5E1ZB 3HOXJ 1FZPB 2GJPA 2Q6IA 4I84A 3ZZTA 2EILH 2E1CA 3LQEA 1PLUA 1YIOA 4TT3A 5IT9K 4WQMA 2M4GA 2XASA 4XLFA 1K8FA 1QRCA 5EMNA 3PQJA 2VZLA 4AVZA 3ZQHA 1RMGA 1OCCH 1XX5A 1WJFA 3DTEA 2DFHA 3NQOA 4A6EA 4G12A 5IT9Z 1G3WA 3IH3A 4RLFA 1WOOA 1BIAA 3HOVJ 1MNDA 5GPCA 3EQNA 1X1DA 2GXAA 5J4YA 1T0FA 1R1VA 1GUUA 3N97A 4ZYHA 2CUZA 2RAEA 3CO7C 3FDYA 3CCEB 5CVUA 1LE8A 3CD6I 3E97A 4R79A 1FP2A 4LB5A 3I58A 1FC3A 1W7PB 4FE7A 5JLWA 2UWMA 3R6KA 2Z9OA 2IOUG 5A2QZ 1BOBA 3ZOBA 3A3GA 1QVFB 1H8AC 1IB0A 4A0XA 3LNQA 3COAC 1O7FA 3AL0B 4PJNA 3JAMK 3OR2C 1X2MA 2DETA 2QKLB 2GIZA 3BNWA 2VBEA 4YZQA 2MH2A 4UXNA 2AS5F 1E62A 3BTIA 1JB9A 1VQ5I 3OAAA 4XRMA 2QZAA 3FWEA 3Q6QA 3KYLA 4QV2A 3ZPPA 1OFCX 1K7AA 3VFZA 1TYVA 2VXZA 4YHBA 4ZCMA 1AA7A 2X6YA 2Y75A 4X0CA 3SLNA 1LLZA 2V26A 4J00A 2C78A 1N8RD 1N75A 2CS3A 2ZBVA 4N3GA 4ZYDA 4A0YA 2QSFX 3LWFA 2VQGA 4II2A 1HA3A 4OJ5A 2WV1A 1LM1A 1B59A 2L4MA 4IEJA 3OPOA 1DG1G 3W2FA 2HVSA 2BVNA 3LSRA 2H27A 1E63A 1TP4A 3CO6C 3PA1A 1FBSA 1L0OC 3BY6A 4GYIA 4OZZA 3CCYA 2M8GX 2EV0A 4U9UA 4NK8A 1XCVA 1X19A 4A2UA 2OK8A 2P81A 2K9MA 3WTVC 4CH7A 4UZUA 4L5JA 3CPWB 1POGA 3A01A 1IGNA 3LSHA 1OQYA 1RNLA 1D1NA 2RNJA 3EUAA 1OHHA 3VYRB 2LSOA 3KEYA 4BEHB 2DBBA 2ZMEC 4HRIA 2EFNA 3Q6RA 4UHTA 3H5AA 4M53A 5IYNA 1K78B 3WBKA 1I27A 1U5TC 3CCJI 1D1CA 1QZEA 4Q7JB 2MFZA 2K85A 5JHFA 4IF4A 4A3KJ 1UELB 1YW7A 5H6RA 1FYMA 1K5CA 3OYJA 4PDKA 2BHYA 4BACA 2MW8A 2UVEA 2WY8Q 4HNTA 2VPRA 4ZH4F 3A2KA 1F36A 2JA6J 3HRSA 5FO0A 1F1ZA 3BCDA 4X0GA 1VQ9B 4ZYAA 3KEOA 3I55B 1WMRA 2O0WA 4G6QA 4RPBA 1XQBA 2NS8A 4CDGA 3JU4A 4P6YA 1ZARA 4XMYA 2VBSA 1WSVA 3F21A 1Z7UA 3LQRA 4H0EA 4RD1A 3CESA 3H35A 2LH9A 5DYMA 1MBKA 1SD4A 1FBQA 5KK1A 4OOXA 4CCLA 3IL2A 3ESWB 1YOVB 3BQZA 3BZ6A 3ML3A 5GAHJ 5GV7A 3PSZA 2DYRH 4XKBA 5E1XA 2YSRA 1VQMB 4MLOA 1YS7A 1RR8C 1E1QA 2LKXA 1XN7A 3DPUA 5TJJA 3ZGKA 2FOKA 3C7JA 1WH5A 4XR6A 2FD5A 2KRHA 4HV5A 3HUGB 5K5OA 4ENMA 2XTWA 2E36A 2X1CA 2D9RA 1GAQA 1K79A 3KRGA 4AM3A 1VQLI 4A0ZA 1O8GA 3I56B 4BDYA 4O6JA 1WJDA 3TW7A 3W5UA 3D1NI 5KCMA 1JXSA 4L9TA 1JKQC 1WORA 1V54H 2FQ3A 2WAEA 3SFIA 3LSPA 1OB0A 4LBWA 3JRIA 2QTZA 4LITA 1NH3A 3FBIB 3QODA 4LC0A 5LLQA 4MTEA 1KQSB 2OBRA 3GFIA 1WWXA 2IA0A 3GTPJ 3SKBA 2ME0A 2GIVA 2G0EA 4IRHA 2C6YA 2PI0A 4WZLA 4V02C 3GUDA 4G8XA 1MBJA 5EF6A 2ZJPF 4O5VA 2XZPA 2BSAA 4Z4TA 4HOBA 2L01A 4L5EA 3C2HA 3O3KA 1Y1WJ 2ZL7A 3ES9A 2CQ7A 3TO6A 5HLIA 4CZZA 3PFIA 2E19A 5HS7A 4YXWA 1MBFA 3HPGA 1NTCA 1ZGJA 2ZNZA 3CP8A 2V9KA 1B8IA 2V6CA 3HKZN 3K1NA 3MCZA 3J80K 3CMEB 5DM7F 1KU3A 4DW6A 1MNEA 3S2DJ 2CUFA 1D0ZA 1TYWA 1T6SA 4A12A 4ZDLA 2WAFA 3I54A 2DK5A 2EFPA 4PUSA 1VHEA 2F4NA 2DOFA 3J80Z 3DFGA 1IDYA 5J1UA 5D4SA 3NWSA 4KJZA 2XVCA 4EH1A 4M73A 4ZCLA 5FKNA 3HHHA 3BCFA 3SDGA 2DPUA 4DK0A 1ZRCA 4D7NA 2J5OA 4HAMA 4BXUA 2IA1A 3K4CA 5D5VB 1KGSA 3CCQI 1SEUA 5DUKA 4XLHA 4CYCB 2RNGA 4UUVA 3NB2A 3K4NA 1RC9A 4IZZA 2LYCA 4Z4UA 1X1AA 1ZKGA 2M0CA 3BP8A 1Q9SA 2FNAA 1SMTA 3IRRA 1YO5C 1QQ1A 1RI7A 1OGIA 1YJWB 2O04A 1VZ0A 4CA0A 2LF8A 3KX2A 2CYYA 4PC7A 1PP7U 4KN4X 2V79A 2ZL6A 4IVNA 4GFBA 5DD8A 4WWVA 3CCLB 5LHHA 1GJRA 1WVRA 2FOWA 4P5OA 4L9NA 4RB0A 1R58A 2HFHA 3OYIA 2KRCA 1IXSB 2DDAA 1BC7C 1R23A 3G1LA 3BROA 3BWGA 4HV6A 4L9VA 1ZR2A 3DU6A 1Q1HA 1RETA 4HX4A 3A8KA 2Y31A 3BG5A 3IV5A 4KISA 2BX6A 3CQZJ 3S1NJ 4G9YA 1ZELA 2X0KA 2WBMA 3FJOA 2LRDA 2ZTGA 1I5ZA 1J0RA 3F3XA 2W7NA 1W87A 5EEGA 1IJWC 5H20A 1R22A 3Q0UA 1W5TA 1CLWA 4XKCA 2QKMB 1JKRC 1R5ID 4ACBA 1K6YA 1MD0A 2DJIA 3KYCB 1J09A 4BHBA 4S0HB 2CNDA 2VJ4A 2A61A 3HRUA 1WOPA 2KDZA 4UVCA 3HSEA 4XORA 2PECA 3SQNA 3Q0WA 2ESNA 3J7YJ 4BE0A 4B3AA 1AIPA 1G7RA 3FPKA 2FMYA 3KEWA 4AF7A 4Q4ZF 2V7VA 1JA0A 3AG4H 5C4JJ 1ZM2A 4IOCF 4XNFA 2KHMA 5FL7A 2K3PA 3MEXA 4X7CA 1OOCA 2PMUA 3M8JA 4OMYA 2JN9A 3V7CA 5DSZA 1WXRA 3G71I 2CRVA 2EV6A 1HZEA 2MLKA 3JSOA 3GQ9A 3CDLA 1AKHB 2OD5A 2CQNA 1ODDA 1F5TA 4TMTA 2HKOA 2P0WA 3OY9A 5L3DA 1NRKA 1Z77A 2X48A 5C1CA 1QJVA 4M3BA 2JUGA 3R61A 4GDFA 2NV4A 1WJCA 4AIDA 4G5GA 4OPVA 4YFOA 3I59A 4EJTA 3GQ7A 4X6AJ 4LFUA 1OYYA 2AQFA 3RJPA 4XRSG 4TN1A 1O57A 2COMA 5L3EA 3K6GA 3FX3A 3RKYA 3CCMB 3OZUA 1Z7LA 3ABLH 1TW3A 2GQFA 1TT0A 2O6WA 2L5QA 2D2WA 3IP4B 2LVSA 3BJOA 5JBQA 1WI3A 1N05A 3HGGA 2V7UA 4A3BJ 4YAOA 2NTPA 2FJ1A 2ECBA 3CDHA 5J1YA 2YPRA 3MZ8A 1RZ4A 1JHHA 4KT5C 4ESFA 1UD2A 1ZM4A 1FEXA 2E1NA 4I6ZA 4B47A 1WU8A 1LEBA 2M1BA 2PMZN 4IRGA 4YFNF 4RBOA 3GTOJ 2M5SA 2VT3A 5E1WA 1A35A 4BU2A 2DOAA 4Q5SF 3WE2A 1ZAOA 3TDZC 1EE6A 4XD7A 4DQLA 4ZCIA 2VQLA 5E3LA 1Y39A 4XKWA 2A3SA 4AYBN 5E17F 3E5QA 2NSTA 4DK1A 2Z16A 3IKTA 1W36C 1YQAA 5M5YJ 3OYMA 1ETWA 1IJFA 4HSTA 3HRMA 2L9SA 3NAUA 1U0JA 2HVRA 2E2HJ 1MJAA 5TISC 1FNMA 3ZZ0A 2ODLA 5EGOB 2X3HA 3Q39A 1FOKA 2XTXA 2HQAA 4XIDA 4GCVA 1VQPI 4MO7A 3CF5F 5C44J 5E18F 1WSUA 1H88C 3OZWA 4TSFA 4CCOA 2BSPA 1T38A 2NVUB 3V7RA 4C3JJ 2M2EA 4NC6A 1Y6IA 2V4DA 2I8DA 2OV7A 3VNVA 2M34A 1KTWA 1VTNC 2CH0A 2GK6A 2MLGA 5ILSA 1R5OA 2F5FA 1R5NA 4A3EJ 2H09A 2IXSA 2E7WA 3S1RJ 3B6AA 4XSXF 2O9LA 4WXHA 3VO2A 3QFSA 1Y56A 3M9AA 3CC7B 2AHOA 2R7XA 3GBGA 2M30A 4F91B 5H6QA 4LG3A 2VNHA 1MSFC 1G8XA 2HPIA 2CC2A 2MYSA 5IYDJ 4JOMA 2YU3A 2L02A 3H3UA 4AC0A 2HTSA 2K02A 2PLFA 1IV6A 2WC2A 4OIPF 3CCSI 1N07A 4BE2A 4JRAC 3CC4B 2BPOA 4AU7A 2GOXB 2V1UA 2IGKA 3CRZA 3K2AA 3P9KA 1ORKA 1RESA 4MIMA 3J81Z 2KT0A 4YC5A 1XDSA 2VFQA 2MH9A 1VQNI 5K7HA 4CSWA 4ZDPA 2QMUA 3ZRGA 2XIGA 3L7WA 1PUFA 2ZJQF 1QU3A 4M3DA 3SJZA 1E0EA 4BQOA 2HMAA 3BTLA 3OIOA 3JQQA 2QEXB 5DTDA 3R4KA 1N08A 2KJCA 5D4RA 2QYUA 3JRDA 3IC7A 4CCMA 4C3IJ 1TNSA 3R6SA 2JJ1A 2BVLA 3MKLA 4RGUA 5HDNA 5K7ZA 2R5YB 1KRHA 3G1MA 4NQWA 4KUMA 2BV3A 2V6EA 3CCRB 1SVLA 3B73A 3DQVC 1YIJI 2DMQA 1B23P 2KFDA 1W4MA 4DNRB 2RV8A 2CRGA 1JGSA 3QP6A 2AHQA 1P7IA 1SD7A 1FTZA 4KKSA 1DBOA 2NT6A 4RM3A 4EGZA 1RRJA 1EWYA 4TMWA 5FNZA 1OR7A 1TWAJ 4Z6YA 3F22A 1ZYRF 2ZJRF 3BR6A 4LJZF 4XLCA 3VYUB 2DA2A 4E7KA 3BY1A 4RAFA 5LRRA 2WYRA 3GF2A 5J4VA 1RUOA 1KD1D 5E79C 3V8LA 5F0CA 3E6MA 2UXNA 5FKKA 1HW2A 1W35A 1BJZA 4OOSA 5FD6A 4KNYA 4UY8I 3AL0C 3I3LA 5KHDA 4E0FA 1J5YA 2V4JC 3DBLB 3CCEI 4BDZA 3TKYA 2ZXJA 4DBQA 2PEXA 4AIKA 1W36D 1W2BB 1WZ2A 2ZO4A 3PVDA 3SY2A 1OCPA 1WSRA 1MDMA 5L3GA 4I99C 1QG0A 3RYPA 1NB0A 3LSTA 2F48A 2WA0A 1AMOA 1IB4A 5AONA 3ZP5A 4TV7A 1J9IA 3GQ8A 3GW2A 1YS6A 4D0PA 2WV0A 1YYVA 4ZDOA 2NTQA 2DMPA 4LK1F 3QWLA 3CW2A 1A8PA 5HOOA 3IAS2 4F3QA 4C43A 2HGCA 4U88A 2X6XA 3P7NA 1A5JA 5EEAA 5F04A 3BR5A 3JW4A 2QSGX 2EK5A 4V19K 3OJWA 3FMQA 4A3CJ 1FSHA 2A5YB 1D1AA 1MJBA 1NHAA 4K2EA 3I4PA 1IDZA 2R5ZA 1QRYA 1UD5A 1WOSA 3LQQA 3S32A 1EV7A 2FUG2 5JLVC 4P3IA 3VO1A 1IRXA 3RIQA 4MFDA 4W8RA 2MSYA 5HXBA 4ZTFA 1JT6A 4XRSA 2G7HA 1R00A 4QTRA 3EETA 1A36A 4S05A 5M3MJ 2H1KA 2KP6A 2B7EA 3OSGA 1T6ZA 4E7SA 1XDUA 2EA2A 2QSHX 3DLAA 2XNJA 1SFXA 4XN0A 1D8KA 3JQPA 3L2VA 1DU6A 2B0LA 4EVIA 1EH6A 2WTEA 4IRIA 2PMDA 3G05A 2B0RA 2EWNA 4BXFA 1MSEC 3BR3A 1QNTA 1Y0YA 2LMDA 1OISA 2QX3A 3KFWX 4IHTA 3U6BA 3FXMA 1AHDP 1YJ9B 3GQBA 4OIRF 2DT5A 3S3MA 1OFLA 2HI3A 4UUSA 1KQ5A 2X4HA 4YG2F 1O3TA 1JNYA 2K4BA 5B3SH 3L2UA 1XCBA 3OIQA 5BMZA 1GAWA 2JRTA 3C3WA 1CNFA 2F5VA 4AIJA 1FSEA 2L2OA 1O8FA 4HE6A 1P4XA 3E6BA 4YEJA 1YITI 1IDJA 3PUBA 1PJRA 2X6WA 3EYIA 2XC7A 2GA2A 2R93J 2EPFA 3DP7A 3OW2B 1XSDA 1TL8A 4C2LA 2XAQA 1W7PD 3QPHA 3GXOA 4TMZA 4NNJA 4HWVA 4KDPA 1QHGA 4XLEA 2PQ8A 1VQKB 2CW7A 3K2ZA 2I10A 1IUFA 2F2EA 3H5RA 1YRNA 2QQAA 1EFUA 1NK2P 1FNBA 1VQMI 2EFWA 4PSXA 3D5RC 3H9JA 4FISA 3DKXA 2HQRA
chains in the Genus database with same CATH topology
2CS3A 4HPQA 2O5RA 2VQGA 4II2A 3L2WA 4OJ5A 4HIZA 1TZLA 1WJAA 4OZYA 2O17A 2XSJC 3ZIAA 4Z03A 2ZSHB 3VWBA 1LKXA 3L2QA 2F6CA 2VIXA 1DQUA 4BE1A 3OPOA 2NSPA 4U49A 2HVSA 4GRIA 3HOTA 3OYDA 4DJAA 3TBIA 4XN3A 3HL2A 2WJVA 1BN8A 4YZXA 4OZZA 4ZTJA 3DEEA 2HU9A 3BLYA 2X51A 2QE7A 4NK8A 1X19A 4UZUA 2E1BA 2K9MA 4CH7A 2X8KA 2VQCA 3LSMA 4XLAA 3LSHA 4DNTB 2WAQA 3EUAA 3SEQA 1OHHA 3VYRB 3KEYA 4BEHB 4HRIA 2VKHA 2ZXIA 1YE9A 3H5AA 1WP6A 3CP2A 2XAUA 3DTKA 1X4OA 1D1CA 1S9HA 1HG8A 2KVOA 2MFZA 4HSRA 5JHFA 1UELB 2VKDA 1K5CA 2DIEA 3BCBA 3OYJA 5CKTA 3MKYB 4BACA 3OS1A 1V0EA 2UVEA 2WY8Q 4HNTA 2CV1A 3A2KA 1KCCA 2E5ZA 2F4IA 5LD2C 3BCDA 4RLQA 1MW7A 4W8QA 3GVJA 4X0GA 3J7AY 4ZYAA 2CW8A 1WMRA 2O0WA 2UVFA 2VBMA 2WADA 3OYCA 2VJ5A 1EA3A 3JU4A 1DP3A 4XMYA 4IKFA 4XOTA 4JMQA 4PK4A 1W9XA 1V5EA 1BHEA 3K4LA 3OE7A 2IS2A 2IQ7A 3CESA 3OEEA 3H35A 2LH9A 4CUGA 2IS1A 3IUOA 4G7XA 1P9QC 4CCLA 1BR4A 3MKZA 1IDKA 3IAM2 4XKBA 1DBGA 3HC7A 2CUJA 3M1CA 2W1OA 3N05A 4MLOA 2DCEA 1E1QA 1FMWA 3WWGA 2HPMA 3DPUA 3ZGKA 2F43A 3ZR8X 2PJRA 4XR6A 2KRHA 2ZZQA 3HUGB 1HA8A 2NTBA 2X1CA 3CJQB 2XNDA 1JRGA 1V5FA 1O8MA 3VSUA 2ELJA 1FMVA 1XG2A 3KRGA 2WPDA 3K4BA 3SZGA 5HVQC 1O8GA 2E5NA 1LVKA 4BDYA 2NT9A 1WJDA 1BLIA 2MC4A 4Y4RA 5KCMA 2VASA 2HLDA 3K10A 2WAEA 4LIUA 1OB0A 1MMDA 4LITA 4GQNA 3FBIB 3QODA 3K70D 3OOCA 3JURA 4P1WA 3VYTB 5LFAA 4E7IA 3HAGA 2XZLA 2VQHA 1G59A 2ZZFA 3BH4A 2JSPA 3E0JB 3S3NA 1WJEA 2CMPA 2EWEA 4PSWA 3UW0A 2XF5A 4CCJA 3C2HA 4F92B 4XOPA 2IS4A 1BR1A 2BVMA 4YXWA 3HPGA 4OWRB 4DGWB 2WJYA 4DIQA 3FKSA 3NE5B 4MXNA 3CP8A 4DOZA 2V9KA 3LNNA 4IQ4A 2HDWA 2VB6A 1ERDA 4J01A 2HVQA 3S3OA 4XKVA 2VPLA 3B90A 1UAAA 4PJLA 1MNEA 1DGWY 2PYHA 1D0ZA 2IGMA 4ZDLA 2WAFA 4PUSA 3SUCA 3UR3C 2INUA 2V7FA 4XONA 2JA2A 3K4KA 3NWSA 4KJZA 4E7HA 2ZFUA 3RSNA 1RWRA 3OR1C 3BCFA 4BEHA 1QCXA 3LSKA 4DK0A 3BC9A 2VLAA 4RMNA 1AIRA 2QXZA 3SEZA 1BR2A 2GOMA 3K4CA 4B43A 3OIPA 4XLHA 2RNGA 3K4NA 3U21A 4IZZA 4OJPA 2LYCA 4NC8A 1X1AA 1BPLA 1COWA 2L9NA 1WTHD 1O88A 2R7VA 2VBKA 5FRMA 4IQJA 4E6KG 3OYAA 2V7QA 1VZ0A 4CA0A 2O04A 3KX2A 4J00A 3ZSCA 2GK7A 3GVLA 4U4BA 2K9LA 4P5OA 1QHHD 2PYGA 1E79A 5IK2A 2NZMA 3OYIA 2KRCA 3BCAA 4E4HA 1N77A 3S8PA 2IS6A 3FHNA 3DU6A 1YX3A 1WJBA 2VXDA 3VSLA 1W0JA 3QOEA 4KISA 2QY1A 3FY3A 5HKKA 3CF2A 3PNVA 3OYEA 1ZELA 3LL7A 2WBMA 1MMGA 2LRDA 1EFRA 2ZTGA 1Z21A 4TKOB 2W7NA 2WSSA 3OYLA 3CJRB 3QYEA 3RPUD 3OOUA 4XKCA 2QKMB 3T56B 3AKZA 3OL3A 3OS2A 3H94A 1PKVA 1K6YA 4N4OB 4YZ0A 4G6IA 1UD3A 1VBLA 2DJIA 1UD8A 1J09A 2LY1A 2E1MC 2VJ4A 1LDKB 5KNLA 1KCDA 4PJJA 2BOLA 3L2RA 2E60A 4XORA 2PECA 1WJ5A 4F93B 1CZFA 4BE0A 3KEWA 4Z1MA 2UV1A 2XZOA 4OAYA 3GVKA 2W82A 1GQ8A 4YELA 4XNFA 2R7WA 2KHMA 5FL7A 5HNFA 4BJ6C 2K3PA 4Z06A 4D1QA 3TL4X 1OOCA 3M8JA 3BG6A 2CV0A 1GLNA 3DKYA 4RM2A 2A5WA 3HKZA 1HZEA 3GQ9A 3A3BA 3CZ6A 3EPZA 1H8EA 2Z8GA 4HG2A 1N78A 2ZTNA 5TGTA 4ANJA 2KPMA 2P0WA 3OY9A 2W6JA 1MABA 4H4KC 1JI8A 1NRKA 5C1CA 4OAZA 4NQWB 1QJVA 1T5EA 4PFOA 2JUGA 3ZXSA 5CQEA 1WJCA 2W6IA 1HVXA 4E7LA 3GQ7A 4FASD 2AQFA 1T0FC 2WZPP 4BQNA 3FPPA 4U7BA 4BQQA 2ZZEA 3K6GA 4LIVA 3W3CA 3T53B 3VR6A 1Z7LA 3DDYA 1SFKA 1NG6A 1TT0A 2L5QA 3OYNA 3IP4B 3OYKA 4C2TA 1KONA 2D3LA 3RQ4A 2NTPA 2O0VA 3H9GA 4XQFA 2X53S 5HNHA 3W2VA 1UD2A 2W00A 3OYGA 2VL8A 4B47A 2XOKA 3UNGC 1BMFA 1UG0A 2M5SA 1W0KA 2MD0A 4BU2A 2DOAA 1EE6A 2L7KA 2RREA 3PNYA 4XD7A 3F9KA 2VQLA 4ZC3A 3VSTA 3NWTA 1E3XA 4XL9A 1IA5A 4XKWA 3HOSA 3G2BA 1O8HA 4DK1A 2NSTA 2Z16A 1W36C 3OYMA 2A6TA 3T51B 3VMWA 3VSVA 3B8YA 4HSTA 4KKUA 2L9SA 4KT6A 1U0JA 2HVRA 2JIZA 1YX5A 3EUKL 2ODLA 3K4JA 2X3HA 1JTAA 2RQQA 2ZXHA 2HQAA 1X0CA 3CMMA 2KMUA 2XGJA 4D9JA 2INVA 2XDVA 4TSFA 4CCOA 2BSPA 2R7RA 2M4KA 1VF7A 4YRVA 1SKYB 3FBNB 2V4DA 1Y6IA 2I8DA 2OV7A 4B3FX 2Q2EB 3VMVA 3PFYA 1KTWA 2CH0A 2GK6A 2E1MB 2KDOA 2WY7Q 4KKTA 4W8SA 2GJRA 2IXSA 2HNHA 3WQZA 1VLYA 3ONQA 1Y56A 3DWLE 4QPOA 2R7XA 3GBGA 1O8DA 1PXZA 2Q1ZB 4F91B 4LG3A 3HG9A 3GRHA 1G8XA 2HPIA 3VYSB 2MYSA 4JOMA 3TMOA 2DT6A 2V1NA 3GQAA 3D5SC 3VDXA 2VJIA 1LFPA 4YZAA 2JJ2A 5CDFA 4BE2A 4CCKA 1O8IA 3MMYB 4AU7A 2GOXB 3S93A 2X85A 2IGKA 3EQOA 2M7BA 3SYTA 1KMHA 1O8LA 1Z3YA 2KLOA 2OC6A 1UD4A 2M0MA 4XM3A 2KZVA 2M7AA 3LMMA 4BS9A 1X4PA 4FETA 4CSWA 4ZDPA 4ITVA 1I8DA 3ZRGA 3HPHA 1O8JA 2LBFB 3OYHA 2X1DA 5HLTA 1MMNA 1QU3A 3D5LA 2NOJB 3FKJA 4NC7A 4Y3OA 2O1DA 1OFMA 1E0EA 2KQRA 2IGNA 3RCOA 4BQOA 4URRA 2LG4A 4FXUA 3PL8A 3QYBA 4CCMA 3LMWA 2JVGA 2JJ1A 2BVLA 2XZPA 2V6EA 3PSIA 3T9GA 3DQVC 4B44A 1R6RA 4DNRB 3W2AA 3OYFA 3QYFA 3I9V2 4CCNA 3SDBA 4ZJZA 3OS0A 2PMZA 2Z6BD 1I18A 4KKSA 1DBOA 2NT6A 4RM3A 1WFXA 2R7QA 2LC2A 1T95A 4XLCA 2BW3B 4DBRA 4JQFA 3VYUB 4E7KA 4AYBA 4OJ6A 2K5CA 4BJ5C 3E1SA 2Y0SA 3A1YA 2R7UA 2M3AA 1X1BA 4NUBA 2GJKA 2LOOA 3OYBA 3RTRA 4B3XA 4E7JA 1OGMX 3DPLC 3AL0C 3I3LA 5KHDA 4Y33A 1V0FA 2Z2SB 2LZJA 4PJMA 1NBMA 4PMHA 4E0FA 2V4JC 1NG7A 4BDZA 4DBQA 4F52A 2R9VA 2V31A 3OW7A 1MMAA 1W36D 1OLTA 2HZDA 4B48A 2W4SA 1E43A 1PE9A 1E3ZA 3B4NA 3K4MA 2CV2A 1O8KA 1PYVA 2CFOA 3C2GA 4KITB 2CK3A 3PNTA 3OFNA 2DT7B 2WA0A 1IB4A 3PJRA 5DN6A 3V42A 4HEA2 2VJJA 3PSFA 4MR0A 1SAUA 5CQGA 2XF6A 3GQ8A 4ZDOA 3BG7A 3HXLA 4C30A 4C9YA 2NTQA 2ZZGA 3DPTA 3DTIA 2R7TA 5FRNA 5HOOA 3IAS2 4F3QA 1UD6A 3VSKA 1K28D 2X6XA 3LSGA 1FX0A 1NHCA 2DXIA 4F55A 1D1AA 1UD5A 2OUMA 3S32A 4B3GA 2FUG2 3ZCOA 4NK6A 1RU4A 2KL4A 2MABA 1IRXA 4II3A 4W8RA 4BJTA 4HNUA 2JDIA 4L8JA 1OGOX 4ZTFA 2R7OA 5C1EA 2XF7A 2AQEA 5AMVA 1D0YA 4C2UA 2GJPA 4I84A 2LY2A 1PLUA 2KP6A 2F1MA 4TT3A 4BGDA 4E7SA 2IGOA 2M4GA 4XLFA 4EATA 4G7WA 3DLAA 4P22A 3MD2A 4XN0A 3L2VA 4AVZA 2LBFA 1RMGA 3G05A 3H0DA 4OJOA 1WJFA 3DTEA 3LSIA 4BUPA 2Z1DA 2ZSIB 3OWTA 4BXFA 4G6TB 4RLFA 1MNDA 3OEHA 3EQNA 1X1CA 1X1DA 2QX3A 4CZCA 3H5NA 2CUZA 1Z3XA 3GQBA 3S3MA 3FDYA 1OFLA 3A35A 4R79A 3H9QA 2PJRB 4E7ZA 3AFHA 5CPRB 3MKWB 3L2UA 2UWMA 3A4CA 3OIQA 4N4NB 3ZPNA 1V5GA 2F5VA 1BOBA 4Z05A 3A3GA 3OL4A 3OMYA 2L2OA 1O8FA 1E1RA 4YEJA 1IDJA 3PUBA 1PJRA 3AL0B 2X6WA 4PJNA 2XC7A 1D0XA 1VJSA 3OR2C 2BW3A 2QKLB 2R4GA 2D3NA 2VBEA 4YZQA 1WPCA 4C2LA 2WB1A 3W2WA 2R7SA 4NNJA 3K70C 3LFUA 4IX7A 2LREA 3BC8A 4HWVA 3OAAA 1H8HA 4OJLA 1QHGA 4XLEA 4U87A 3KYLA 3ZPPA 2CW7A 4ASUA 3EUHC 3H5RA 3DU5A 1OR7C 1D1BA 4PFPA 2VXZA 5FROA 3ZQQA 1AA7A 2X6YA 4BL0B 4PSXA 3D5RC 3H9JA 1KZLA 1O8EA 3DKXA 2JVHA 2V26A 2UUZA 1DGRM 2X1EA 4W8TA 4EW9A 4QPQA 1H80A 1N75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGM X;  2NTP A;  2O0V A;  4OJ5 A;  4XKV A;  4XQF A;  3B90 A;  4OZY A;  2PYH A;  2O17 A;  4PMH A;  4Z03 A;  3SUC A;  2NSP A;  4U49 A;  1PE9 A;  2INU A;  4XON A;  1BN8 A;  4XN3 A;  1EE6 A;  1RWR A;  4OZZ A;  3B4N A;  4YZX A;  1QCX A;  1O8K A;  3VST A;  4NK8 A;  4XL9 A;  1AIR A;  2QXZ A;  1IA5 A;  4XKW A;  1O8H A;  2NST A;  3VSV A;  4XLH A;  3VMW A;  4XLA A;  3B8Y A;  1IB4 A;  2VJJ A;  4MR0 A;  2ODL A;  4OJP A;  3GQ8 A;  2X3H A;  1JTA A;  1O88 A;  2NTQ A;  2VBK A;  1X0C A;  2O04 A;  1HG8 A;  2INV A;  3ZSC A;  1K5C A;  2X6X A;  4U4B A;  2BSP A;  1NHC A;  2UVE A;  2PYG A;  3VMV A;  1KCC A;  2NZM A;  1KTW A;  4W8Q A;  4W8S A;  1WMR A;  2UVF A;  2O0W A;  2VBM A;  4NK6 A;  1RU4 A;  4XMY A;  4W8R A;  4XOT A;  1PXZ A;  1OGO X;  1O8D A;  1BHE A;  5C1E A;  2QY1 A;  3GRH A;  5AMV A;  2IQ7 A;  3FY3 A;  4I84 A;  3GQA A;  1PLU A;  2VJI A;  4YZA A;  4XLF A;  1O8I A;  1IDK A;  4XN0 A;  1DBG A;  4AVZ A;  2X85 A;  1RMG A;  3EQO A;  4YZ0 A;  1VBL A;  1O8L A;  4OJO A;  3WWG A;  4XM3 A;  1KCD A;  4XR6 A;  3EQN A;  2NTB A;  4XOR A;  1JRG A;  2PEC A;  3VSU A;  1O8M A;  2QX3 A;  1CZF A;  1O8J A;  1XG2 A;  3KRG A;  1O8G A;  1GQ8 A;  4YEL A;  1OFL A;  2NT9 A;  2O1D A;  4XNF A;  1OFM A;  4Z06 A;  4URR A;  1OOC A;  3LMW A;  4Z05 A;  3JUR A;  1O8F A;  4YEJ A;  1IDJ A;  3GQ9 A;  3T9G A;  2X6W A;  2Z8G A;  4YZQ A;  2VBE A;  4C2L A;  2EWE A;  1DBO A;  2NT6 A;  5C1C A;  3UW0 A;  4HWV A;  1QJV A;  4OJL A;  4XLE A;  4XOP A;  3ZPP A;  4XLC A;  3GQ7 A;  2X6Y A;  4OJ6 A;  1O8E A;  4W8T A;  4EW9 A;  4MXN A;  1H80 A; 
#chains in the Genus database with same CATH topology
 5K5R A;  2ISY A;  3GWZ A;  4HIZ A;  4P25 A;  1DUX C;  4QFM A;  3FZV A;  1R1U A;  4RM0 A;  1Z9C A;  2Y9Z A;  4OZY A;  2XSJ C;  1SFO J;  4CQJ A;  3WTU C;  2DQL A;  3L2Q A;  3I56 I;  2O6G E;  2OQR A;  5IYB J;  2W7Z A;  3P9C A;  5HOD A;  1PJ6 A;  3GLX A;  1F9N A;  2RQP A;  3HGY A;  3TBI A;  4XN3 A;  1BN8 A;  1ETO A;  2WJV A;  1HQC A;  1W1W E;  1ZG1 A;  3BLY A;  2DTZ A;  1U78 A;  2X51 A;  3AG3 H;  3ONU A;  3RKW A;  2LD5 A;  2M8E A;  4ENK A;  1VF9 A;  2DK8 A;  2XKP A;  4L5I A;  3TO9 A;  2CBX A;  2X8K A;  2VQC A;  1XMA A;  3TP0 A;  2VN2 A;  2WAQ A;  1KA8 A;  2HQN A;  3RKQ A;  2PE3 A;  1EA0 A;  2QTL A;  4RJL A;  2ZXI A;  1GXP A;  2BMW A;  3SEJ A;  2XAU A;  3W5H A;  4WX9 A;  3D26 A;  2BEO A;  1OCZ H;  1S9H A;  1T98 A;  1X3W B;  2DIE A;  3BCB A;  3L1P A;  3MKY B;  5E3M A;  1QA3 A;  2Z33 A;  3VOD A;  1P4A A;  2D1H A;  1D8J A;  2F4I A;  1QRB A;  4BQA A;  1B72 A;  4W8Q A;  3CME I;  1E64 A;  2K3F A;  5LRS A;  1A6Q A;  5FGM A;  2VJ5 A;  1EA3 A;  2D1V A;  3BTJ A;  4IKF A;  2XGC A;  4EMS A;  3ROU A;  1BHE A;  2CW5 A;  1HW1 A;  2HXO A;  1JKO C;  2IS2 A;  5JMC B;  2Y30 A;  1K4S A;  3OEE A;  2XKO A;  2LKS A;  1O3R A;  1VLO A;  4FCY A;  4Y7N J;  4I02 A;  1BR4 A;  5BPI A;  2YX7 A;  3U1D A;  4S04 A;  1VI0 A;  1FIP A;  2G7U A;  2XAJ A;  2F5C A;  3G1O A;  3IAM 2;  1EP2 B;  3A8J A;  4IW3 B;  5A8A A;  1QVU A;  1DBG A;  3N90 A;  4EM1 A;  1Q7Y D;  2BGC A;  1AU7 A;  3HOW J;  4IXA A;  2F43 A;  2CW0 F;  1F43 A;  2PJR A;  4HNV A;  2ZZQ A;  1O7L A;  1ETY A;  2A6H F;  1XMK A;  4JBA A;  1S7O A;  5IYW A;  2XRN A;  1XG2 A;  1XFO A;  3GFM A;  4MQ9 F;  3CUQ B;  3SZG A;  4BHP A;  2Y69 H;  5HVQ C;  2E5N A;  4UZE A;  1WH7 A;  2NT9 A;  5J8F A;  3E1Y E;  4X05 A;  1BLI A;  2MC4 A;  3CCL I;  4Y4R A;  1TTY A;  3E3V A;  4ZV4 A;  1VQ4 B;  1TWF J;  1I7P A;  2XAH A;  3FMS A;  2ADU A;  1B9N A;  2Y48 A;  4KIG A;  4LK0 F;  5BOX A;  4P1W A;  2CJJ A;  3HAG A;  5BSX A;  2ZFW A;  2QA4 B;  1B9M A;  1BC8 C;  2FNP A;  3BQJ A;  1WJE A;  4LG0 A;  2XF5 A;  1O3S A;  1AOY A;  4W97 A;  2IS4 A;  4M9X A;  3ZQL A;  1Y0R A;  2A07 F;  2ZBK A;  4YFK F;  3BDD A;  3SZE A;  4HW0 A;  4A3I J;  4U0Y A;  1JA1 A;  5A2Q K;  4M1K A;  3W2G A;  3AVT A;  3MVP A;  2HQ5 A;  4ESB A;  4DQ2 A;  3NE5 B;  1ZQ3 P;  3LNN A;  1ZLK A;  3W5V A;  2FML A;  2HDW A;  1X3Z B;  4A3J J;  2EIN H;  4A3M J;  3H3V K;  2HVQ A;  3Q3S A;  1S5L C;  4XKV A;  3RQI A;  2DMT A;  2GWR A;  3HTU A;  1IUY A;  3B90 A;  2PYH A;  2W85 A;  3ZQG A;  3WTY C;  4G7O F;  1L3L A;  4YAF A;  2QVO A;  2STW A;  3UR3 C;  4RDL A;  3FK6 A;  1BQE A;  2V7F A;  2LLK A;  2EFQ A;  3KPH A;  5DS9 A;  3ZBT A;  3OKX A;  1M1K D;  3H9N A;  3Q9V A;  1Z05 A;  3PQK A;  1QCX A;  1RWR A;  3BC9 A;  5LBQ A;  1GVH A;  3ASO H;  2JPC A;  4JX5 A;  2OF7 A;  3SEZ A;  2GOM A;  3ISX A;  5F4M A;  4B43 A;  3OIP A;  1BW5 A;  3U21 A;  1YTY A;  2DMN A;  4HLY A;  2L0K A;  1COW A;  1BPL A;  1F20 A;  3ZUG A;  1WTH D;  1EXM A;  2R7V A;  1UHW A;  5FRM A;  2BM5 A;  5CVJ A;  4E6K G;  3OYA A;  2V7Q A;  2ZL5 A;  1G7T A;  3Q38 A;  2NS0 A;  3ZZU A;  2QN6 A;  3GVL A;  4ENN A;  1SC7 A;  5H5J A;  1QHH D;  4MYU A;  4Y9R A;  5LMZ A;  5IK2 A;  4WXC A;  3BCA A;  3ERE D;  1S6L A;  4E4H A;  1ON2 A;  5GAD J;  2LF7 A;  5FKM A;  3A1P A;  2NAZ A;  2GXB A;  2OU2 A;  4UV8 A;  4LBV A;  1MBG A;  3FHN A;  2D45 A;  1GVJ A;  1ZG5 A;  2OBP A;  2YWE A;  1HSJ A;  3CMA B;  1IF1 A;  4XK4 A;  1QZZ A;  3PNV A;  1EFR A;  3OYE A;  2K9Q A;  4QHY A;  2L7Z A;  1MMG A;  4UUT A;  3HM5 A;  3TW6 A;  1XB2 A;  2WSS A;  3OYL A;  4PGO A;  5H2F C;  1HC8 A;  5IYC J;  3T56 B;  5FB2 A;  3GIR A;  1VBL A;  2BXY A;  1UD3 A;  2GLO A;  2LY1 A;  2ZKZ A;  4RD4 A;  1LDK B;  2ESH A;  5F0F A;  1T2K A;  1R4N B;  2EJR A;  1LB2 A;  3QU3 A;  3M8E A;  2E60 A;  3WGI A;  1YLF A;  3R0J A;  1WJ5 A;  4F93 B;  2OAZ A;  1CF7 B;  1CQT A;  3GYH X;  1MZB A;  4OAY A;  3GVK A;  5DCM A;  5IYP A;  4YEL A;  4YIF A;  2STT A;  1GQ8 A;  1WDT A;  4P26 A;  2R7W A;  1TVC A;  5HNF A;  4PJ0 C;  1L1I A;  5F1R A;  3M7G A;  3WE3 A;  1LEA A;  2KKO A;  1XGN A;  5IPA A;  5A88 A;  3FXK A;  2M9H A;  3K1P A;  1V3F A;  1HLV A;  3A3B A;  3DBR B;  1FPQ A;  1SMY F;  2CQX A;  3EPZ A;  3FXQ A;  1H8E A;  1OJL A;  3CC7 I;  5DEQ A;  2XV4 S;  5TGT A;  2R7Z J;  2NRA C;  1EFC A;  2ZTN A;  3AVU A;  3ULQ B;  2EFO A;  1JJ2 B;  3ELK A;  2W6J A;  4H4K C;  4I0B A;  4OAZ A;  4KMF A;  4I09 A;  3ZXS A;  2VON A;  1IN6 A;  2F5D A;  4LLN A;  3BG9 A;  1E17 A;  1IN8 A;  2VE9 A;  3S15 J;  2JSC A;  3CC4 I;  1FOY A;  2ZME A;  1K61 A;  5HLH A;  3FXJ A;  2ZZE A;  1U5T A;  1IN5 A;  3F8M A;  2C5B A;  3T53 B;  3VR6 A;  3KP5 A;  1ONV A;  1SFK A;  1NG6 A;  1STZ A;  3BPX A;  4A69 C;  4B4C A;  4C2T A;  4KIB A;  1KON A;  1SFE A;  3B78 A;  3QFT A;  3H9G A;  4BHC A;  3M07 A;  2QCO A;  3DCF A;  2V7W A;  2W00 A;  3Q0V A;  1J75 A;  3OYG A;  4I7H A;  5F0H A;  1E3H A;  4KIC A;  2XOK A;  1BMF A;  3KP4 A;  4A3F J;  1W0K A;  3J7Z I;  3MZY A;  3OJX A;  1ZHF A;  5JVT A;  2L7K A;  2RRE A;  4NBS A;  4LLG F;  1NB9 A;  3F9K A;  3NWT A;  4IHS A;  4XL9 A;  1QGZ A;  5CVV A;  3E6D A;  2DA5 A;  3JRA A;  3CCR I;  3QP5 A;  4I01 A;  3ZPL A;  1XPX A;  2CQQ A;  3PET A;  4KT6 A;  4GXO A;  3BR0 A;  2JIZ A;  4CGZ A;  3G6E B;  5GAE J;  4RD3 A;  1Q86 D;  3FMR A;  3K4J A;  1G6N A;  4FX0 A;  4A3D J;  4G1B A;  2RQQ A;  1JTA A;  2ZXH A;  1Y0N A;  5L46 A;  3QU6 A;  1UB9 A;  2INV A;  2ICW G;  4RB3 C;  5J35 A;  4BY1 J;  1D2E A;  4KIF A;  1R49 A;  2M4K A;  1VF7 A;  1SKY B;  1R4M B;  3LSJ A;  3BZC A;  2Q2E B;  5EG0 B;  1DDG A;  3IH4 A;  3PFY A;  3WNB A;  4DQK A;  2JA5 J;  1TT5 B;  3BY2 A;  2ID3 A;  4QVA A;  1S29 A;  1VQ6 B;  2GJR A;  1LLW A;  2NNN A;  4KMU X;  9ANT A;  3P27 A;  1TWG J;  3DWL E;  3I1F A;  1PXZ A;  5TR9 A;  5LEJ A;  2O61 A;  3GRH A;  5JI6 A;  3HHG A;  2DT6 A;  3W6K B;  4ETS A;  2MD5 A;  4IHW A;  2QQB A;  2GXG A;  2V1N A;  2QBY A;  2QDX A;  2DAO A;  3D5S C;  2WR8 A;  3ZQI A;  1T6Y A;  2VJI A;  1LFP A;  2VBW A;  4YZA A;  5KSW B;  1QGA A;  2K27 A;  2K40 A;  5F08 A;  2JJ7 A;  1YG2 A;  2VE8 A;  2FVG A;  1UCR A;  1Z3Y A;  4NCN A;  2M0M A;  4XM3 A;  2C4U A;  3AGP A;  1S72 B;  4AVP A;  1KK3 A;  4BS9 A;  2G0Y A;  1JHF A;  3VNU A;  4FET A;  4Q48 A;  1K4T A;  2V1D A;  3GZN B;  2X1D A;  1MMN A;  2DOE A;  3U2Q A;  5ILV A;  1IRG A;  4RGS A;  4URR A;  2ZC2 A;  4CXF A;  2ZCW A;  4CIC A;  3QYB A;  3ZMT A;  3K1M A;  3PO3 J;  1I6H J;  2GBY A;  2UXX A;  5IP6 A;  5IOZ A;  1ZH5 A;  2K4J A;  1S4M A;  1ETK A;  1QQI A;  1LE8 B;  4XBF A;  4J19 A;  1WKM A;  1H85 A;  2L7M P;  3OZV A;  1R6R A;  2K86 A;  2PLY A;  2YR2 A;  1XTA A;  3OYF A;  3QYF A;  1RIO H;  4CCN A;  1CQX A;  3HDD A;  4ZJZ A;  3BPV A;  2Z6B D;  1I18 A;  3EYY A;  3JRE A;  3EUH A;  1NDH A;  2LDU A;  2O03 A;  5D6F A;  1P2F A;  5TY0 A;  4DBR A;  4UAJ A;  4JQF A;  3R60 A;  1ZRD A;  2JN6 A;  1OFD A;  5E6T A;  1SVO A;  2EB7 A;  2K5C A;  3F72 A;  4BJ5 C;  3IHU A;  5E20 A;  3SLD A;  1ETX A;  2Y0S A;  3A1Y A;  2GJK A;  2LOO A;  3OYB A;  3GZ5 A;  1OYW A;  3AST A;  2Z3Y A;  3HTS B;  1Z1D A;  3BT9 A;  4BKX A;  5ICC A;  3GTM J;  3FKI J;  1PDN C;  1V0F A;  4PJM A;  4PMH A;  1Z6R A;  5IYR A;  2WWY A;  1ZR4 A;  2GRE A;  4A3L J;  3ZMD A;  2P5K A;  4F52 A;  3IWZ A;  5F4O A;  2HZD A;  1FT9 A;  4WWC A;  3B4N A;  3FXU A;  1ZTR A;  5JLX A;  3QFR A;  1R5G A;  5KVR A;  1K83 J;  3DEW A;  3ISP A;  2CK3 A;  3TO7 A;  1QBJ A;  2C2W A;  3IKV A;  3G4S I;  1LDJ A;  4PCQ A;  4MR0 A;  2DA1 A;  1SAU A;  5CQG A;  4L9J A;  2OYN A;  2LKP A;  1B2R A;  1PP8 F;  3DPT A;  3DTI A;  5C3E J;  2W48 A;  5ED4 A;  2ZZG A;  3A01 B;  1FX7 A;  4GO1 A;  3T8T A;  4GYG A;  4AUX A;  1UD6 A;  2A68 F;  3VSK A;  4EJO A;  4U7D A;  4OPO A;  3LSG A;  4YEI A;  5DNS A;  3IRQ A;  1TTT A;  2HKX A;  3F8B A;  2G9W A;  1LFB A;  3W2H A;  1DAR A;  1KK2 A;  3PM1 A;  5FKL A;  3ZCO A;  1ZGW A;  1XC5 A;  4B09 A;  2MAB A;  4J0Q A;  1JUP A;  4II3 A;  1ULY A;  3RI4 A;  2BBY A;  2BYV E;  1D3Y A;  2ZB9 A;  2WAQ N;  3MQ0 A;  4HNU A;  4C2M J;  5JVG F;  1OGO X;  2R7O A;  1F4K A;  2JA7 J;  3F6V A;  4UB8 C;  1MBE A;  3ECO A;  4KYW A;  4C2U A;  4IHY A;  2LY2 A;  4N9H A;  4IPA A;  2FA5 A;  3A03 A;  4M72 A;  2QQ9 A;  2XTY A;  3JX8 A;  2DO7 A;  4C3H J;  3HOZ J;  1I1S A;  4EJV A;  1FND A;  3MD2 A;  1ON1 A;  2CO5 A;  3H09 A;  1DU0 A;  2FU4 A;  2LBF A;  1MMS A;  2GPJ A;  5F6F A;  2J8I A;  4Z4S A;  3H0D A;  3F23 A;  4QSH A;  2YUH A;  2XSD C;  2VBU A;  3LAP A;  2FBK A;  5HZB A;  4G6T B;  4HZF A;  5D8K B;  3OEH A;  2DA6 A;  1X1P A;  5HS9 A;  3T1B A;  4OM9 A;  1Z3X A;  2CSO A;  4L18 B;  5EJC A;  3N6Z A;  5M5W J;  5E3N A;  3A35 A;  3TQN A;  3H9Q A;  4RB2 C;  4E7Z A;  5HS8 A;  3AFH A;  2E2I J;  5CPR B;  2HEO A;  4Z2Y A;  3L9F A;  1BJA A;  3A4C A;  4N4N B;  4G94 A;  4M3F A;  1YW8 A;  1ZN2 A;  1V5G A;  4XRF A;  3O8H A;  1R5H A;  1KU9 A;  2JMW A;  4Z05 A;  2NYX A;  3OL4 A;  2P7V B;  2LR8 A;  5B1B H;  3J81 K;  5HDK A;  2HWV A;  1BIB A;  3GZ6 A;  2NVT J;  3KP2 A;  1D0X A;  1LQ1 A;  1VJS A;  1VQ7 B;  2V5I A;  1EKE A;  2BW3 A;  3CC2 B;  2BXZ A;  2R4G A;  3WYA A;  1I3A A;  4ENJ A;  1WPC A;  2WB1 A;  5DUI A;  3W2W A;  2R7S A;  2DPD A;  3CUO A;  2LRE A;  2R7F A;  1H8H A;  4OJL A;  1V5V A;  3CUQ C;  5L3F A;  1E3O C;  1TLL A;  3CJT B;  4MEY F;  4U87 A;  4M2L A;  2NOG A;  1LFU P;  4ABZ A;  2WZN A;  4JYK A;  3OSF A;  3DU5 A;  4M71 A;  1OR7 C;  1D1B A;  4PFP A;  3ZQQ A;  4LOC A;  1FOX A;  1MIJ A;  4N9I A;  1LDD A;  1KZL A;  3FF5 A;  4W8T A;  2EIM H;  2OTL B;  1DGR M;  1RPW A;  4QPQ A;  5CJ9 A;  1Y1V J;  3WG7 H;  4P2N A;  2O5R A;  1HST A;  3L2W A;  1WHU A;  2VOP A;  4OPW A;  1TZL A;  2IPQ X;  3KET A;  1WJA A;  4DZP A;  1ETQ A;  5A89 A;  3PSS A;  3DU1 X;  3JRF A;  3ZIA A;  3VWB A;  2F6C A;  1DQU A;  2OZU A;  5HZA A;  1XS9 A;  4U49 A;  1B8I B;  3C1D A;  2BGI A;  4GRI A;  3HOT A;  3OYD A;  1GO2 A;  3HL2 A;  1VQ4 I;  4KH3 A;  4YZX A;  1WPK A;  4ZTJ A;  2IW5 A;  3DEE A;  4RDU A;  5TRD A;  3GTQ J;  4IOA F;  2QA4 I;  1JTX A;  2RVC A;  3GTG J;  4A6D A;  3JRC A;  3LSM A;  3EQL F;  1REP C;  3V76 A;  3GTL J;  1JKP C;  4BAY A;  4RB1 A;  4UV9 A;  4EGY A;  1WP6 A;  3CP2 A;  4HDU A;  2R0Q C;  3FXO A;  2DI3 A;  1X4O A;  3BJ6 A;  2L9R A;  1OCT C;  4OIQ F;  4X7E A;  1HG8 A;  2KVO A;  4A5N A;  5ICF A;  4P9S A;  2A05 A;  3PIP F;  2VKD A;  1Q1V A;  2XNC A;  1NJI D;  3L09 A;  5D5X B;  2VT2 A;  2RC4 A;  2HYJ A;  1OFE A;  2CV1 A;  2E5Z A;  3JQR A;  2QUF A;  4OIO F;  3JRH A;  1BJK A;  4WCG A;  4EQQ A;  2VBM A;  1QGP A;  3ASN H;  2BY0 A;  2WAD A;  3OYC A;  1R36 A;  4EV0 A;  3DKW A;  4JMQ A;  1W9X A;  1V5E A;  2Y0M A;  3K4L A;  4FX4 A;  3OE7 A;  2CQK A;  3QQA A;  3CDI A;  4M6Y A;  2HDN B;  4MEX F;  2ZBU A;  2VBY A;  4CUG A;  2EZH A;  3IUO A;  1S3J A;  4G7X A;  2HOS A;  4M0L A;  2JTV A;  1P9Q C;  4MHG A;  2VFP A;  1H42 A;  3S14 J;  3PEN A;  3JRG A;  5J3O A;  4RGR A;  4NBQ A;  3GX4 X;  2W1O A;  5EYR A;  5ERI A;  2DCE A;  3QPL A;  2LFB A;  1QVT A;  3C18 A;  1GV2 A;  2HPM A;  4OIN F;  5B6I A;  2OJE D;  2NTB A;  1W7P A;  3CJQ B;  1JRG A;  1OCR H;  2ELJ A;  2PX9 A;  3A8I A;  2RN7 A;  3B82 A;  1QZY A;  1YHQ B;  2EV5 A;  3NRV A;  5FJ8 J;  4HF1 A;  1KTV A;  3GSI A;  2HLD A;  4Z4R A;  4LIU A;  3SFZ A;  1MRZ A;  3PIO F;  3V4G A;  1BI2 A;  1B4A A;  1XGM A;  3TDU C;  4GQN A;  1KC8 D;  3OOC A;  1TNT A;  4HX7 A;  5LFA A;  2XGE A;  4HQE A;  5AIP A;  2VBT A;  4Z4V A;  2XZL A;  2VQH A;  3KZI C;  2P7C B;  4PC6 A;  1Q81 D;  4I76 A;  2ZZF A;  3BH4 A;  2VC0 A;  3S3N A;  5FLM J;  2TCT A;  3CMA I;  3KL9 A;  5DCF A;  4OOV A;  2CMP A;  2DYI A;  4R71 A;  5D5W B;  1WGX A;  3HBL A;  4F92 B;  1W5C C;  1YFH A;  3VB2 A;  2BVM A;  1JTY A;  4EM0 B;  4DGW B;  3K7A J;  2WJY A;  5D5U B;  4UZF A;  2L4A A;  2XRO A;  5CLS A;  3BTC A;  1HF0 A;  5J8C A;  4MXN A;  4DOZ A;  2PN6 A;  2GQQ A;  5IY5 H;  1IHM A;  2VB6 A;  2XPU A;  4MFE A;  3I59 B;  1ERD A;  5D8L B;  1G7C A;  1ZM3 A;  3S3O A;  2EZL A;  1JT0 A;  1VQ9 I;  1IRF A;  3I55 I;  1N06 A;  4QUZ A;  2FBI A;  3RPU A;  2IGM A;  2O8K A;  3W6V A;  2ECC A;  1XSX A;  3W2I A;  1HW5 A;  2NXN B;  4M74 A;  3NAR A;  4RAY A;  4XON A;  1UZC A;  3K4K A;  3WTW C;  4Z4W A;  4E7H A;  2FBH A;  2ZFU A;  3RSN A;  4G7Z F;  3OR1 C;  2EIX A;  2HYG D;  4LGW A;  4BEH A;  3LSK A;  3FK7 A;  2VKE A;  2IBD A;  2QLZ A;  4RMN A;  5E8I A;  1K78 A;  4RD0 A;  1FYK A;  1BR2 A;  1GVD A;  2PMH A;  1DDI A;  5DD4 A;  2NPF A;  3VPR A;  1HXD A;  4MGR A;  4YFX F;  1P7J A;  2DCU A;  4P1V A;  1O88 A;  1FP1 D;  3LFK A;  2JPB A;  4IQJ A;  5J47 A;  2DDB A;  3ZSC A;  2OK7 A;  2GK7 A;  4RAG A;  2VKV A;  2K9L A;  3DBH B;  2JT1 A;  3I53 A;  2PYG A;  1E79 A;  3TGN A;  2VYQ A;  1KU2 A;  3NAW A;  3SHF A;  2F4O B;  2B63 J;  2LY9 A;  1N77 A;  3S8P A;  1U2R A;  2JK3 A;  4LMY A;  4N3N A;  4PAB A;  4FHT A;  5EEH A;  1U3E M;  2BY3 A;  2E7X A;  2V9V A;  1YX3 A;  1BW6 A;  3E7L A;  2BV6 A;  2VXD A;  1W0J A;  1VQ8 B;  3QOE A;  5HKK A;  3LL7 A;  5FFZ A;  1N0U A;  1OGJ A;  2E34 A;  4M4S A;  3WTT C;  1NK3 P;  3QYE A;  4XSZ F;  2OZ6 A;  2Y9Y A;  3OOU A;  3HUG A;  3RPU D;  1Z0X A;  2QM3 A;  1KQ0 A;  3DV8 A;  3BZK A;  4NDL A;  1JGG A;  1Z6T A;  4N4O B;  4JP0 A;  4KA4 A;  2NVQ J;  4G6I A;  4YZ0 A;  3PO2 J;  3GFL A;  3G6E I;  5BQT A;  5KNL A;  2IVM A;  4UNO A;  4PJJ A;  4AIH A;  2FX0 A;  2XGX A;  2R3S A;  2KIQ A;  5BNG A;  1VHO A;  4M3G A;  1CZF A;  1S0U A;  1HF2 A;  4BBR J;  3AVX A;  2DA3 A;  2DOD A;  3CCV B;  5C4X J;  3V7A A;  2K7L A;  4RS8 A;  5FLX K;  5J3L A;  1T8I A;  1HOM A;  3TL4 X;  1LUJ B;  5F64 A;  4OMZ A;  2CV0 A;  1P92 A;  3DKY A;  1PUF B;  4A93 J;  4RM2 A;  1GXQ A;  2A5W A;  1ZGA A;  4FQG A;  1R5B A;  1S7E A;  5FLX Z;  5J40 A;  3CZ6 A;  2PBI A;  3KCC A;  3P4G A;  1N78 A;  2LTP A;  4ANJ A;  1UG2 A;  2H8R A;  1FWZ A;  1MAB A;  1X58 A;  4V2F A;  4NQW B;  1T5E A;  4PFO A;  3CCS B;  1W0U A;  2DFE A;  1HKS A;  3ZN1 A;  3MFK A;  2NNY A;  4E7L A;  3JTG A;  1YJW I;  1G7S A;  3VOE A;  2FEZ A;  4X06 A;  4FAS D;  2WZP P;  1T0F C;  4BQN A;  3KP6 A;  2P5L C;  1FY7 A;  3R0A A;  1S72 I;  5FO5 A;  3OYN A;  4RD2 A;  3ZMS A;  2DJN A;  2O0V A;  1XG1 A;  3SZP A;  4XQF A;  3W2V A;  4PGH A;  4QWQ A;  2LK2 A;  2XB0 X;  1Q82 D;  4P6V F;  3UNG C;  3CPX A;  3QFC A;  1UG0 A;  2PIA A;  4CYC A;  1DDN A;  2V7X A;  4ZGQ B;  1X3U A;  3E20 A;  5LHG A;  2VNJ A;  5K5Q A;  3VST A;  3I71 A;  1E3X A;  1VND A;  2F4M B;  1IA5 A;  1U8B A;  3HOS A;  3G2B A;  3T51 B;  3VSV A;  2A6T A;  3BH7 B;  2EQR A;  2Y0S N;  1H0M A;  2E1O A;  1C0W A;  4KKU A;  3VMW A;  1VFC A;  3WXM A;  1QX4 A;  1G3T A;  1MDM B;  4ESJ A;  2NVX J;  1M90 D;  2QWW A;  2DN0 A;  1R71 A;  4HLX A;  3CMY A;  2KMU A;  2XGJ A;  3S16 J;  2XDV A;  4PAA A;  1QUF A;  3AVV A;  3RY8 A;  1SAN A;  4QLC U;  2EZI A;  3CJN A;  2R7R A;  4OP7 A;  3A0H C;  1ZRF A;  3U9G A;  3M8F A;  2VFO A;  4B3F X;  3VMV A;  1ELO A;  2DOG A;  3ABT A;  4ASN A;  2EZK A;  2E1M B;  2RDP A;  4EEF G;  2F1L A;  4KKT A;  3FXL A;  4B4D A;  4W8S A;  2HNH A;  3WQZ A;  3TED A;  3ONQ A;  1VLY A;  2BM7 A;  2EIK H;  5KAF C;  1UHS A;  4WZE A;  3IH2 A;  2QEN A;  1TYX A;  2FF4 A;  4UVB A;  5LEK A;  1O8D A;  2Q1Z B;  1JUS A;  5DV5 A;  3HG9 A;  3PUN A;  3ZMZ A;  3VYS B;  2TRT A;  3F0C A;  2R5Z B;  4ACA A;  4HE5 A;  1A04 A;  1AWC A;  1G3S A;  1K6O A;  3GQA A;  3RYR A;  1FIA A;  1V55 H;  1ACI A;  3VDX A;  2JJ2 A;  2H94 A;  4RD6 A;  5M5X J;  5CDF A;  2XT4 A;  4P12 A;  1FRN A;  1J59 A;  3MMY B;  1TWH J;  3S93 A;  3KLO A;  2X85 A;  4P9U A;  3VEP A;  3GVA A;  3QPS A;  4HF0 A;  1RQR A;  2GZW A;  3SYT A;  1KMH A;  4X7D A;  1O8L A;  2KLO A;  2OC6 A;  2ACJ A;  1UD4 A;  3H36 A;  4RA2 A;  2Q6O A;  2VOO A;  2EFG A;  2Y2Z A;  3ONY A;  1J7K A;  3LMM A;  1WRJ A;  3CCM I;  2DTR A;  1QH0 A;  3JAM Z;  1WI9 A;  1ZRE A;  3SJM A;  3W2E A;  2IAI A;  4XLN F;  2DA7 A;  3HPH A;  3KYD B;  1I8D A;  1PJ5 A;  2RC5 A;  3G3Z A;  5HLT A;  3E6C C;  3D5L A;  2NOJ B;  4NC7 A;  2O1D A;  1OFM A;  4QVJ A;  1AKH A;  2KQR A;  2IGN A;  3RCO A;  1K9M D;  3DEU A;  2LG4 A;  4E70 A;  3PL8 A;  1SVM A;  5AIQ A;  1XMX A;  3CB4 A;  1YLO A;  4RLZ A;  2JVG A;  3CTA A;  1XGS A;  2VBX A;  2BF4 A;  2MA3 A;  4UUS B;  5FIU A;  3T9G A;  4B44 A;  1CNE A;  4WK8 F;  4ON0 A;  1W0T A;  3ABU A;  3W2A A;  1F60 A;  5AN9 A;  1RKT A;  3I9V 2;  3SDB A;  4R1H A;  2ETH A;  2YU9 J;  3D0S A;  2R7Q A;  3LOC A;  2FQ4 A;  2LC2 A;  3ERM A;  4IHV A;  1T95 A;  5GPA A;  1QA6 A;  1XGO A;  4PGG A;  5BPD A;  4TMV A;  2TDX A;  1R7J A;  4LD5 A;  3WTX C;  1FJL A;  4OJ6 A;  3E1S A;  2OBS A;  2D5V A;  1TBX A;  3I0T A;  5L3C A;  3WGG A;  4DYQ A;  1X1B A;  1BM9 A;  4BBS J;  1XB4 A;  3RTR A;  1OGM X;  4NHJ A;  1U6G A;  3DPL C;  1YRN B;  3QRF F;  4BNC A;  3FIW A;  4Y33 A;  2F3L A;  3O8G A;  1IW7 F;  3WGH A;  3NEU A;  1NBM A;  3DF8 A;  4FE4 A;  4BY7 J;  5FKO A;  2R9V A;  2WB1 N;  2BN4 A;  1OLT A;  1E43 A;  4RDK A;  2DEU A;  1TQP A;  2FSW A;  1E3Z A;  3FHZ A;  2CV2 A;  3CCU B;  1O8K A;  3MZH A;  1YIT B;  1IV8 A;  5EGO A;  2AO9 A;  3ZQC A;  2CFO A;  1EP3 B;  4AD9 A;  3H92 A;  3PNT A;  5LGT A;  2VNK A;  2DY1 A;  2DT7 B;  2PG4 A;  2DMU A;  2ME6 A;  4CO8 A;  1VQ7 I;  3V42 A;  3CC2 I;  4HEA 2;  1JJ8 C;  2X6O A;  1IN7 A;  1RR7 A;  4BH9 A;  2FRH A;  1S7A A;  3MHP A;  4C9Y A;  1FTT A;  2R7T A;  2BE5 F;  2ZXW H;  3HIF A;  5FRN A;  1USS A;  4LB6 B;  4DZJ A;  2O8X A;  4YAU A;  2QF7 A;  2QYO A;  3P9I A;  2EIJ H;  2H6C A;  1K28 D;  5FA6 A;  4V2G A;  1KK1 A;  5E8G A;  4PC2 A;  2NVY J;  1FX0 A;  1FYL A;  1WQ2 A;  1NHC A;  3AK5 A;  4G6D A;  2DXI A;  2QEX I;  4F55 A;  2OTL I;  3S2H J;  1BA5 A;  3F8C A;  3WHC A;  3TOB A;  5IT3 A;  1TQI A;  1KYW A;  4JK1 X;  2L7F P;  2XHK A;  2DU9 A;  1K4Z A;  2X0L A;  2KL4 A;  1WCM J;  3S17 J;  3S1M J;  2JDI A;  3H1C A;  5C1E A;  2XF7 A;  3WU1 B;  4QIW N;  1VQO B;  5AMV A;  1B72 B;  4L0Z B;  4YDT A;  3GME A;  1X2N A;  2OTJ B;  2F1M A;  3I64 A;  4HX8 A;  4BGD A;  3KZZ A;  2IGO A;  4P22 A;  4EAT A;  4G7W A;  1J9Z A;  3PUM A;  1TC3 C;  1EH8 A;  2GAU A;  1LVA A;  4OJO A;  3HOY J;  3LSI A;  4BUP A;  1JJ6 C;  1FNC A;  2Z1D A;  2ZSI B;  3OWT A;  2C77 A;  2XRL A;  4Y7C A;  4MYT A;  2ZJ2 A;  2XPV A;  1X1C A;  4OU0 A;  2DER A;  2EA4 A;  1YI2 B;  4CZC A;  1I50 J;  1SAX A;  3H5N A;  5EDN A;  5HDG A;  5E3O A;  2R5Y A;  4P3Y A;  4WXD A;  4ZYG A;  2IA2 A;  3LA2 A;  2XGD A;  2CF4 A;  2Q6K A;  2PJR B;  3O6B B;  3K9T A;  1BN5 A;  2BY2 A;  4M9Z A;  3X2Q H;  3MKW B;  1E2X A;  1MNM C;  1TSP A;  3ZPN A;  1N25 A;  3A0B C;  4TMX A;  3OMY A;  1SM4 A;  1E1R A;  1KQ8 A;  2ID6 A;  1K73 D;  5HLG A;  1A31 A;  5CYV A;  1B1B A;  4D7M A;  1KU7 A;  2N8G A;  1APL C;  2D3N A;  1Y0U A;  2HCJ B;  5GAG J;  2XC1 A;  3MMP A;  3K70 C;  4IX7 A;  1PVE A;  3LFU A;  3TP3 A;  3BC8 A;  1QPI A;  1XE1 A;  1MH3 A;  1QA1 A;  1SD6 A;  5IOY A;  5LGU A;  2BM1 A;  3LQ6 A;  4L0Y B;  3IWF A;  3FXR A;  3EUH C;  1JUM A;  2W84 A;  4UVA A;  4ASU A;  2FE3 A;  1YJN B;  3CLQ A;  5FRO A;  2UZK A;  2YX4 A;  3ZC3 A;  4BL0 B;  2PJP A;  1O8E A;  4A5M A;  3GO5 A;  1D5Y A;  4LG0 B;  2JVH A;  3I4N J;  2UUZ A;  2X1E A;  1BI1 A;  1HDP A;  4B1R A;  1KQ9 A;  4EW9 A;  1H80 A;  5DDG A;  2B5O A;  4HPQ A;  3ZBU A;  3TH0 A;  4Z4Y A;  1QFY A;  2O17 A;  4Z03 A;  2ZSH B;  1LKX A;  4FN5 A;  2VIX A;  3RKX A;  4HDV A;  4BE1 A;  4R8H A;  1YHQ I;  2HDD A;  1FDR A;  2NSP A;  4DJA A;  1RUN A;  4RAZ A;  2OA4 A;  2VFN A;  4H9G A;  2HU9 A;  2J7K A;  2QE7 A;  2L54 A;  3M1E A;  2XB5 A;  4CHU A;  2OCE A;  3B02 A;  2E1B A;  3GLL A;  4XLA A;  4DNT B;  2IP2 A;  3SEQ A;  4YIR X;  2O7O A;  4U0W A;  4X8I A;  1HDD C;  1ZUN B;  3VMF A;  1SD5 A;  2VKH A;  4M3E A;  1YE9 A;  5EZH A;  4DYR A;  3DTK A;  4IJA A;  4UB6 C;  1UMK A;  1FOW A;  2QGU A;  3E5U A;  4HSR A;  1LJ9 A;  2QQ8 A;  1QPM A;  2X9D A;  3RIR A;  1YJ9 I;  3CD6 B;  5CKT A;  4Z4Z A;  3HB9 A;  3OS1 A;  1V0E A;  2VFM A;  1K8A D;  1OCO H;  1CGP A;  5B5E C;  1KCC A;  4RDJ A;  5LD2 C;  4RLQ A;  1MW7 A;  4ROX A;  1DPR A;  3J7A Y;  3GVJ A;  2CW8 A;  2UVF A;  1ETV A;  2YWG A;  3SYJ A;  3B8H A;  1O4X A;  1DP3 A;  5KW9 A;  1T6X A;  4XOT A;  1BI3 A;  4PK4 A;  3R6J A;  3Q3A A;  4YAW A;  4C0S A;  2VOD A;  2M45 A;  3WTS C;  4HF2 A;  2JQ7 A;  2IQ7 A;  1W5S A;  2VBV A;  1BL0 A;  2IS1 A;  2H8W A;  1VQ5 B;  4F7Z A;  1QVG B;  1MJ9 A;  1U9O A;  3MKZ A;  1VQK I;  2C5H A;  1IDK A;  1GR1 A;  1TQM A;  1Z67 A;  3HC7 A;  2CUJ A;  3M1C A;  2IT0 A;  3N05 A;  5IYQ A;  1FMW A;  3WWG A;  1ZK8 A;  1EJ9 A;  3WTZ A;  4WZK A;  2XAF A;  3ZR8 X;  4KFC A;  1EF4 A;  2YWF A;  3ZQ7 A;  1UMQ A;  1QFZ A;  3B6C A;  1HA8 A;  2XND A;  3VSU A;  1V5F A;  1O8M A;  5GTI C;  1FMV A;  2HOA A;  5J1R A;  2WPD A;  3HRT A;  2YS9 A;  5ICG A;  2J8K A;  4B8X A;  3K4B A;  4ZGN B;  3F6O A;  1LVK A;  2P4W A;  3P26 A;  4WZT A;  2VAS A;  4A3G J;  3K10 A;  1UJ8 A;  4P9F A;  2K9N A;  1MMD A;  3KP3 A;  3ABM H;  1DP7 P;  1FLI A;  2DFF A;  1GHC A;  3WND A;  1IJE A;  4FT8 A;  5DCM B;  3K70 D;  2L9V A;  3JUR A;  3KP7 A;  4JX6 A;  3VYT B;  4E7I A;  4RGX A;  3OP1 A;  1S8N A;  2MBF A;  1G59 A;  2JSP A;  3E0J B;  2HDC A;  4ZZL A;  3JRB A;  1HCR A;  3REO A;  3HJE A;  1VQ8 I;  2EWE A;  4D5F A;  4PSW A;  3AVW A;  1UHM A;  2Q6L A;  4CCJ A;  3UW0 A;  3ML6 A;  4MQV A;  3BG3 A;  3LAJ A;  3KIO A;  1ENH A;  3P5J A;  3CCJ B;  4XOP A;  1BR1 A;  2H6B A;  1JE8 A;  1IXC A;  4OWR B;  5TV2 A;  2XEX A;  1E3P A;  4DIQ A;  1LPQ A;  3FKS A;  4BPR A;  6PAX A;  4ZZD A;  4LBZ A;  3KEQ A;  1QUE A;  5BS6 A;  3E5X A;  4IQ4 A;  4FK8 A;  1TWC J;  2DLL A;  4J01 A;  2KIM A;  2C4T A;  2ZME B;  2VPL A;  1UAA A;  4PJL A;  1DGW Y;  2GA1 A;  2L3D A;  2P6T A;  1U5T B;  3CCV I;  3SUC A;  3K69 A;  3V8J A;  2GM4 A;  4M9S A;  3MWM A;  4G1V A;  2INU A;  1FNN A;  1P6R A;  1RKW A;  2JA2 A;  1T33 A;  3Q9S A;  4Q47 A;  1I3Q J;  5JR3 A;  1BOA A;  1H9T A;  1GDT A;  1A6I A;  3S2W A;  5M3F J;  2VLA A;  1AIR A;  2V1X A;  4Y17 A;  2QXZ A;  1J2X A;  2QZ8 A;  3GFJ A;  1ITY A;  5FLV A;  4I98 B;  4AF6 A;  4F7D A;  3V7S A;  3RZO J;  1U8R A;  3AGQ A;  4OJP A;  4NC8 A;  1SFU A;  1IXR C;  3ZMV A;  2L9N A;  2W57 A;  3CLO A;  2VBK A;  2OPT A;  1EZG A;  3KE2 A;  4HA8 A;  2JA8 J;  3S1Q J;  1D8T A;  2KIS A;  3ZQF A;  3LA3 A;  2ELH A;  1VQL B;  3HSR A;  4RCZ A;  3SXY A;  2PFB A;  1DAB A;  3AAF A;  3FIS A;  1YW9 A;  2LP0 A;  2VBZ A;  4U4B A;  2CFX A;  3BJA A;  3CXC B;  2AXL A;  4D5C A;  4W1U A;  1M1E B;  2RGV A;  2EBI A;  2JZY A;  2NZM A;  4IO9 F;  5FFX A;  2DA4 A;  2NS7 A;  2FX3 A;  3RDI A;  3OV8 A;  2R6H A;  2QGG A;  2LNB A;  3M3Y J;  2B7C A;  2IS6 A;  5DS0 A;  1OMI A;  1P4W A;  1I39 A;  1IN4 A;  1WJB A;  2QY1 A;  3VSL A;  4YII A;  1FRQ A;  3FY3 A;  2F5E A;  3CF2 A;  1HKT A;  1H9G A;  3G73 A;  1FBU A;  4TKO B;  1XSV A;  1Z21 A;  2Q0O A;  3F8N A;  2FXA A;  2CUE A;  1RQP A;  2ZNY A;  4EJU A;  2I5U A;  3CJR B;  2HS5 A;  2OQG A;  3JCU C;  2BM6 A;  4LLL A;  3H3Z A;  4MTD A;  3WNC A;  3AKZ A;  3OL3 A;  2E71 A;  3OS2 A;  1PKV A;  3H94 A;  2E2J J;  4YCQ A;  1OYI A;  3HZJ A;  3CUQ A;  3H0G J;  1XD7 A;  5J6X A;  1T39 A;  4M6V A;  2E1M C;  2QBY B;  3M4O J;  1UD8 A;  1KCD A;  2BOL A;  3RZD J;  3L2R A;  2XUB A;  3GEZ A;  2I1L A;  3T8R A;  2KIF A;  2MGQ A;  4Z1M A;  2UV1 A;  3TOA A;  2XZO A;  2HOE A;  2W82 A;  1GV5 A;  5THX A;  1SKQ A;  1W34 A;  4EM2 A;  4Z06 A;  1U2W A;  4HBL A;  4BJ6 C;  1GT0 C;  4D1Q A;  2BHZ A;  2XAG A;  3ASS A;  2IJL A;  4LBY A;  3WBJ A;  3BG6 A;  5CVR A;  1GLN A;  2AXT C;  4CYD A;  1KZH A;  2H1L A;  3HKZ A;  1H89 C;  2V7T A;  4X07 A;  3CCQ B;  2P5V A;  2A6E F;  1TUI A;  2Z8G A;  1B6A A;  1R1T A;  4HG2 A;  3GTK J;  5GTH C;  2R92 J;  2KPM A;  3WU0 A;  3KLN A;  1JI8 A;  3AG1 H;  1ZG3 A;  5F27 A;  1KK0 A;  5CQE A;  4OPS A;  2P3M A;  2YWH A;  2W6I A;  1HVX A;  2A69 F;  2DW4 A;  3DLL F;  3A02 A;  4XIC A;  2R7D A;  4IHX A;  1OB2 A;  2KIU A;  1O3Q A;  2JWT A;  3I5U A;  4BQQ A;  4U7B A;  3SZT A;  4LIV A;  3W3C A;  1ZM9 A;  3FPP A;  4IL6 C;  3DDY A;  1HKQ A;  4HYE A;  5DM6 F;  3OYK A;  3BR2 A;  2D3L A;  2YUS A;  3RQ4 A;  1Y8Q B;  1IG7 A;  2B7B A;  4PC1 A;  3K0L A;  2BM4 A;  2X53 S;  5HNH A;  1KJZ A;  1MKM A;  3T5X A;  2VL8 A;  1EH7 A;  3DXJ F;  1MBH A;  4Y15 A;  2ELK A;  4MNU A;  1PJ7 A;  2J5P A;  3SJP A;  1PUE E;  1HBX G;  4P96 A;  2MD0 A;  3ASQ A;  1UFM A;  2HR3 A;  3PNY A;  3GTJ J;  4X7F A;  3KZY A;  4ZC3 A;  2HYF A;  3OOP A;  1BX0 A;  5L3B A;  1O8H A;  1D5V A;  2VI6 A;  3B8Y A;  3O2P E;  1YX5 A;  3EUK L;  1MH4 A;  3PA2 A;  2JUC A;  2DQR A;  2Q8K A;  3BQY A;  1TLH B;  5CVI A;  4AC9 A;  5GP9 A;  2BY1 A;  1I1G A;  2P6S A;  3MAJ A;  1X0C A;  3CMM A;  1OKR A;  3BR1 A;  4D9J A;  1UST A;  5JFR A;  3UKG A;  3WOD F;  1IO2 A;  2X3U A;  5EZG A;  4Y52 J;  4YRV A;  2O0Y A;  3FBN B;  4I0A A;  3LVB A;  1OB5 A;  2P8T A;  4Y13 A;  1P4M A;  1TW2 A;  5LGN A;  4K1X A;  3W6J B;  3G71 B;  4EJW A;  2KDO A;  2WY7 Q;  3I4M J;  3BOQ A;  5FD5 A;  3LYC A;  1BBY A;  2M87 A;  2CU7 A;  4QPO A;  4G7H F;  4RPD A;  1BX1 A;  2DYS H;  2D74 A;  1MGT A;  1Z91 A;  4P55 A;  2V9P A;  4GGG A;  3TMO A;  5IP9 J;  5BSY A;  3CCU I;  2DFI A;  4AWX B;  4U0V A;  4CCK A;  1CF7 A;  3G4S B;  1O8I A;  2CGP A;  3EQO A;  2BGJ A;  2M7B A;  5B66 C;  4ZYE A;  1V4R A;  4WF2 A;  5D6E A;  2KZV A;  2M7A A;  3U1K A;  1R9T J;  1X4P A;  5FO1 A;  1QO0 D;  4I2O A;  3JTH A;  3HOU J;  4ITV A;  4BYY A;  4OOI A;  3ASP A;  1O8J A;  1DPU A;  2LBF B;  2HZT A;  2OCC H;  3OYH A;  3QPT A;  4FTH A;  3RPQ A;  3LJY A;  3FKJ A;  1IC8 A;  2Z5U A;  4Y3O A;  3T0Y A;  1IZ1 A;  3Q5F A;  2B9S A;  3V8K A;  2HXI A;  4RCY A;  4FXU A;  3LO8 A;  3LMW A;  1ZLJ A;  2KZG A;  3ZN0 A;  3J81 k;  3JSP A;  4BXX J;  2O3F A;  4PC3 A;  3L00 A;  3PSI A;  2RC6 A;  4FWT A;  4NB5 A;  2HTJ A;  2KRF A;  5F1J A;  5IP7 J;  4JX4 A;  1G3Y A;  3SQV A;  5K1Y A;  2IRF G;  2XPW A;  3OS0 A;  1VQO I;  2PMZ A;  1BI0 A;  4M6X A;  1G4D A;  2E1R A;  1WFX A;  2VC1 A;  2EH3 A;  1VQP B;  3HYI A;  2OTJ I;  1QGY A;  5GV8 A;  2W25 A;  2CG4 A;  2KJB A;  5F4J A;  2BW3 B;  3N4M A;  4AYB A;  1QFJ A;  3WG9 A;  2MC3 A;  5B1A H;  2M3A A;  2JRM A;  2K9S A;  4NUB A;  2R7U A;  4YAL A;  5LHI A;  3BH6 B;  4B3X A;  3PUF A;  4E7J A;  3WU2 C;  1LNW A;  1YI2 I;  2HOT A;  1I6X A;  4Y9U A;  2Z2S B;  2LZJ A;  1VQ6 I;  4DYC A;  1G2H A;  3ZMU A;  1NG7 A;  3LA7 A;  2Z99 A;  2V31 A;  2XT2 A;  3OW7 A;  3J7A O;  1MMA A;  1T08 B;  4B48 A;  2E35 A;  2W4S A;  3QE2 A;  1PE9 A;  3C2B A;  1OPC A;  3L2C A;  3K4M A;  4KN7 X;  1PYV A;  1U9N A;  3C2G A;  3HSF A;  3U2R A;  4KIT B;  3OFN A;  3GCM A;  4X1E A;  3ECH A;  3WY9 A;  3PJR A;  5DN6 A;  2BZT A;  2VJJ A;  3PSF A;  2XF6 A;  1Y8R B;  1VQN B;  3BG7 A;  2RKH A;  3HXL A;  3MN2 A;  4C30 A;  1QA2 A;  5EG0 A;  2Q2E A;  4O3M A;  5ILU A;  1EFT A;  3ASR A;  3U6K A;  2ISZ A;  1YJN I;  1TYU A;  3QSY A;  2MG4 A;  2ZIT A;  2M5W A;  4XLP F;  4HQM A;  5H59 A;  3WHB A;  5K7F A;  5KAI C;  4DNC A;  1IAW A;  4PZJ A;  2OUM A;  3JR9 A;  2OBT A;  2CWE A;  1KYZ A;  4B3G A;  5ICE A;  4NK6 A;  2VUM J;  1RU4 A;  2W24 A;  1EP1 B;  1T56 A;  3QOP A;  1IRZ A;  2VNI A;  3QAH A;  1YIJ B;  2IEK A;  3EDP A;  1N0V C;  3AVY A;  4BJT A;  3FM5 A;  2BM0 A;  3ABK H;  4L8J A;  3AG2 H;  5JHU A;  3MCA A;  2AQE A;  2COB A;  3FM3 A;  1YX2 A;  1D0Y A;  3HEF A;  3F8F A;  4N0B A;  5E1Z B;  3HOX J;  1FZP B;  2GJP A;  2Q6I A;  4I84 A;  3ZZT A;  2EIL H;  2E1C A;  3LQE A;  1PLU A;  1YIO A;  4TT3 A;  5IT9 K;  4WQM A;  2M4G A;  2XAS A;  4XLF A;  1K8F A;  1QRC A;  5EMN A;  3PQJ A;  2VZL A;  4AVZ A;  3ZQH A;  1RMG A;  1OCC H;  1XX5 A;  1WJF A;  3DTE A;  2DFH A;  3NQO A;  4A6E A;  4G12 A;  5IT9 Z;  1G3W A;  3IH3 A;  4RLF A;  1WOO A;  1BIA A;  3HOV J;  1MND A;  5GPC A;  3EQN A;  1X1D A;  2GXA A;  5J4Y A;  1T0F A;  1R1V A;  1GUU A;  3N97 A;  4ZYH A;  2CUZ A;  2RAE A;  3CO7 C;  3FDY A;  3CCE B;  5CVU A;  1LE8 A;  3CD6 I;  3E97 A;  4R79 A;  1FP2 A;  4LB5 A;  3I58 A;  1FC3 A;  1W7P B;  4FE7 A;  5JLW A;  2UWM A;  3R6K A;  2Z9O A;  2IOU G;  5A2Q Z;  1BOB A;  3ZOB A;  3A3G A;  1QVF B;  1H8A C;  1IB0 A;  4A0X A;  3LNQ A;  3COA C;  1O7F A;  3AL0 B;  4PJN A;  3JAM K;  3OR2 C;  1X2M A;  2DET A;  2QKL B;  2GIZ A;  3BNW A;  2VBE A;  4YZQ A;  2MH2 A;  4UXN A;  2AS5 F;  1E62 A;  3BTI A;  1JB9 A;  1VQ5 I;  3OAA A;  4XRM A;  2QZA A;  3FWE A;  3Q6Q A;  3KYL A;  4QV2 A;  3ZPP A;  1OFC X;  1K7A A;  3VFZ A;  1TYV A;  2VXZ A;  4YHB A;  4ZCM A;  1AA7 A;  2X6Y A;  2Y75 A;  4X0C A;  3SLN A;  1LLZ A;  2V26 A;  4J00 A;  2C78 A;  1N8R D;  1N75 A;  2CS3 A;  2ZBV A;  4N3G A;  4ZYD A;  4A0Y A;  2QSF X;  3LWF A;  2VQG A;  4II2 A;  1HA3 A;  4OJ5 A;  2WV1 A;  1LM1 A;  1B59 A;  2L4M A;  4IEJ A;  3OPO A;  1DG1 G;  3W2F A;  2HVS A;  2BVN A;  3LSR A;  2H27 A;  1E63 A;  1TP4 A;  3CO6 C;  3PA1 A;  1FBS A;  1L0O C;  3BY6 A;  4GYI A;  4OZZ A;  3CCY A;  2M8G X;  2EV0 A;  4U9U A;  4NK8 A;  1XCV A;  1X19 A;  4A2U A;  2OK8 A;  2P81 A;  2K9M A;  3WTV C;  4CH7 A;  4UZU A;  4L5J A;  3CPW B;  1POG A;  3A01 A;  1IGN A;  3LSH A;  1OQY A;  1RNL A;  1D1N A;  2RNJ A;  3EUA A;  1OHH A;  3VYR B;  2LSO A;  3KEY A;  4BEH B;  2DBB A;  2ZME C;  4HRI A;  2EFN A;  3Q6R A;  4UHT A;  3H5A A;  4M53 A;  5IYN A;  1K78 B;  3WBK A;  1I27 A;  1U5T C;  3CCJ I;  1D1C A;  1QZE A;  4Q7J B;  2MFZ A;  2K85 A;  5JHF A;  4IF4 A;  4A3K J;  1UEL B;  1YW7 A;  5H6R A;  1FYM A;  1K5C A;  3OYJ A;  4PDK A;  2BHY A;  4BAC A;  2MW8 A;  2UVE A;  2WY8 Q;  4HNT A;  2VPR A;  4ZH4 F;  3A2K A;  1F36 A;  2JA6 J;  3HRS A;  5FO0 A;  1F1Z A;  3BCD A;  4X0G A;  1VQ9 B;  4ZYA A;  3KEO A;  3I55 B;  1WMR A;  2O0W A;  4G6Q A;  4RPB A;  1XQB A;  2NS8 A;  4CDG A;  3JU4 A;  4P6Y A;  1ZAR A;  4XMY A;  2VBS A;  1WSV A;  3F21 A;  1Z7U A;  3LQR A;  4H0E A;  4RD1 A;  3CES A;  3H35 A;  2LH9 A;  5DYM A;  1MBK A;  1SD4 A;  1FBQ A;  5KK1 A;  4OOX A;  4CCL A;  3IL2 A;  3ESW B;  1YOV B;  3BQZ A;  3BZ6 A;  3ML3 A;  5GAH J;  5GV7 A;  3PSZ A;  2DYR H;  4XKB A;  5E1X A;  2YSR A;  1VQM B;  4MLO A;  1YS7 A;  1RR8 C;  1E1Q A;  2LKX A;  1XN7 A;  3DPU A;  5TJJ A;  3ZGK A;  2FOK A;  3C7J A;  1WH5 A;  4XR6 A;  2FD5 A;  2KRH A;  4HV5 A;  3HUG B;  5K5O A;  4ENM A;  2XTW A;  2E36 A;  2X1C A;  2D9R A;  1GAQ A;  1K79 A;  3KRG A;  4AM3 A;  1VQL I;  4A0Z A;  1O8G A;  3I56 B;  4BDY A;  4O6J A;  1WJD A;  3TW7 A;  3W5U A;  3D1N I;  5KCM A;  1JXS A;  4L9T A;  1JKQ C;  1WOR A;  1V54 H;  2FQ3 A;  2WAE A;  3SFI A;  3LSP A;  1OB0 A;  4LBW A;  3JRI A;  2QTZ A;  4LIT A;  1NH3 A;  3FBI B;  3QOD A;  4LC0 A;  5LLQ A;  4MTE A;  1KQS B;  2OBR A;  3GFI A;  1WWX A;  2IA0 A;  3GTP J;  3SKB A;  2ME0 A;  2GIV A;  2G0E A;  4IRH A;  2C6Y A;  2PI0 A;  4WZL A;  4V02 C;  3GUD A;  4G8X A;  1MBJ A;  5EF6 A;  2ZJP F;  4O5V A;  2XZP A;  2BSA A;  4Z4T A;  4HOB A;  2L01 A;  4L5E A;  3C2H A;  3O3K A;  1Y1W J;  2ZL7 A;  3ES9 A;  2CQ7 A;  3TO6 A;  5HLI A;  4CZZ A;  3PFI A;  2E19 A;  5HS7 A;  4YXW A;  1MBF A;  3HPG A;  1NTC A;  1ZGJ A;  2ZNZ A;  3CP8 A;  2V9K A;  1B8I A;  2V6C A;  3HKZ N;  3K1N A;  3MCZ A;  3J80 K;  3CME B;  5DM7 F;  1KU3 A;  4DW6 A;  1MNE A;  3S2D J;  2CUF A;  1D0Z A;  1TYW A;  1T6S A;  4A12 A;  4ZDL A;  2WAF A;  3I54 A;  2DK5 A;  2EFP A;  4PUS A;  1VHE A;  2F4N A;  2DOF A;  3J80 Z;  3DFG A;  1IDY A;  5J1U A;  5D4S A;  3NWS A;  4KJZ A;  2XVC A;  4EH1 A;  4M73 A;  4ZCL A;  5FKN A;  3HHH A;  3BCF A;  3SDG A;  2DPU A;  4DK0 A;  1ZRC A;  4D7N A;  2J5O A;  4HAM A;  4BXU A;  2IA1 A;  3K4C A;  5D5V B;  1KGS A;  3CCQ I;  1SEU A;  5DUK A;  4XLH A;  4CYC B;  2RNG A;  4UUV A;  3NB2 A;  3K4N A;  1RC9 A;  4IZZ A;  2LYC A;  4Z4U A;  1X1A A;  1ZKG A;  2M0C A;  3BP8 A;  1Q9S A;  2FNA A;  1SMT A;  3IRR A;  1YO5 C;  1QQ1 A;  1RI7 A;  1OGI A;  1YJW B;  2O04 A;  1VZ0 A;  4CA0 A;  2LF8 A;  3KX2 A;  2CYY A;  4PC7 A;  1PP7 U;  4KN4 X;  2V79 A;  2ZL6 A;  4IVN A;  4GFB A;  5DD8 A;  4WWV A;  3CCL B;  5LHH A;  1GJR A;  1WVR A;  2FOW A;  4P5O A;  4L9N A;  4RB0 A;  1R58 A;  2HFH A;  3OYI A;  2KRC A;  1IXS B;  2DDA A;  1BC7 C;  1R23 A;  3G1L A;  3BRO A;  3BWG A;  4HV6 A;  4L9V A;  1ZR2 A;  3DU6 A;  1Q1H A;  1RET A;  4HX4 A;  3A8K A;  2Y31 A;  3BG5 A;  3IV5 A;  4KIS A;  2BX6 A;  3CQZ J;  3S1N J;  4G9Y A;  1ZEL A;  2X0K A;  2WBM A;  3FJO A;  2LRD A;  2ZTG A;  1I5Z A;  1J0R A;  3F3X A;  2W7N A;  1W87 A;  5EEG A;  1IJW C;  5H20 A;  1R22 A;  3Q0U A;  1W5T A;  1CLW A;  4XKC A;  2QKM B;  1JKR C;  1R5I D;  4ACB A;  1K6Y A;  1MD0 A;  2DJI A;  3KYC B;  1J09 A;  4BHB A;  4S0H B;  2CND A;  2VJ4 A;  2A61 A;  3HRU A;  1WOP A;  2KDZ A;  4UVC A;  3HSE A;  4XOR A;  2PEC A;  3SQN A;  3Q0W A;  2ESN A;  3J7Y J;  4BE0 A;  4B3A A;  1AIP A;  1G7R A;  3FPK A;  2FMY A;  3KEW A;  4AF7 A;  4Q4Z F;  2V7V A;  1JA0 A;  3AG4 H;  5C4J J;  1ZM2 A;  4IOC F;  4XNF A;  2KHM A;  5FL7 A;  2K3P A;  3MEX A;  4X7C A;  1OOC A;  2PMU A;  3M8J A;  4OMY A;  2JN9 A;  3V7C A;  5DSZ A;  1WXR A;  3G71 I;  2CRV A;  2EV6 A;  1HZE A;  2MLK A;  3JSO A;  3GQ9 A;  3CDL A;  1AKH B;  2OD5 A;  2CQN A;  1ODD A;  1F5T A;  4TMT A;  2HKO A;  2P0W A;  3OY9 A;  5L3D A;  1NRK A;  1Z77 A;  2X48 A;  5C1C A;  1QJV A;  4M3B A;  2JUG A;  3R61 A;  4GDF A;  2NV4 A;  1WJC A;  4AID A;  4G5G A;  4OPV A;  4YFO A;  3I59 A;  4EJT A;  3GQ7 A;  4X6A J;  4LFU A;  1OYY A;  2AQF A;  3RJP A;  4XRS G;  4TN1 A;  1O57 A;  2COM A;  5L3E A;  3K6G A;  3FX3 A;  3RKY A;  3CCM B;  3OZU A;  1Z7L A;  3ABL H;  1TW3 A;  2GQF A;  1TT0 A;  2O6W A;  2L5Q A;  2D2W A;  3IP4 B;  2LVS A;  3BJO A;  5JBQ A;  1WI3 A;  1N05 A;  3HGG A;  2V7U A;  4A3B J;  4YAO A;  2NTP A;  2FJ1 A;  2ECB A;  3CDH A;  5J1Y A;  2YPR A;  3MZ8 A;  1RZ4 A;  1JHH A;  4KT5 C;  4ESF A;  1UD2 A;  1ZM4 A;  1FEX A;  2E1N A;  4I6Z A;  4B47 A;  1WU8 A;  1LEB A;  2M1B A;  2PMZ N;  4IRG A;  4YFN F;  4RBO A;  3GTO J;  2M5S A;  2VT3 A;  5E1W A;  1A35 A;  4BU2 A;  2DOA A;  4Q5S F;  3WE2 A;  1ZAO A;  3TDZ C;  1EE6 A;  4XD7 A;  4DQL A;  4ZCI A;  2VQL A;  5E3L A;  1Y39 A;  4XKW A;  2A3S A;  4AYB N;  5E17 F;  3E5Q A;  2NST A;  4DK1 A;  2Z16 A;  3IKT A;  1W36 C;  1YQA A;  5M5Y J;  3OYM A;  1ETW A;  1IJF A;  4HST A;  3HRM A;  2L9S A;  3NAU A;  1U0J A;  2HVR A;  2E2H J;  1MJA A;  5TIS C;  1FNM A;  3ZZ0 A;  2ODL A;  5EGO B;  2X3H A;  3Q39 A;  1FOK A;  2XTX A;  2HQA A;  4XID A;  4GCV A;  1VQP I;  4MO7 A;  3CF5 F;  5C44 J;  5E18 F;  1WSU A;  1H88 C;  3OZW A;  4TSF A;  4CCO A;  2BSP A;  1T38 A;  2NVU B;  3V7R A;  4C3J J;  2M2E A;  4NC6 A;  1Y6I A;  2V4D A;  2I8D A;  2OV7 A;  3VNV A;  2M34 A;  1KTW A;  1VTN C;  2CH0 A;  2GK6 A;  2MLG A;  5ILS A;  1R5O A;  2F5F A;  1R5N A;  4A3E J;  2H09 A;  2IXS A;  2E7W A;  3S1R J;  3B6A A;  4XSX F;  2O9L A;  4WXH A;  3VO2 A;  3QFS A;  1Y56 A;  3M9A A;  3CC7 B;  2AHO A;  2R7X A;  3GBG A;  2M30 A;  4F91 B;  5H6Q A;  4LG3 A;  2VNH A;  1MSF C;  1G8X A;  2HPI A;  2CC2 A;  2MYS A;  5IYD J;  4JOM A;  2YU3 A;  2L02 A;  3H3U A;  4AC0 A;  2HTS A;  2K02 A;  2PLF A;  1IV6 A;  2WC2 A;  4OIP F;  3CCS I;  1N07 A;  4BE2 A;  4JRA C;  3CC4 B;  2BPO A;  4AU7 A;  2GOX B;  2V1U A;  2IGK A;  3CRZ A;  3K2A A;  3P9K A;  1ORK A;  1RES A;  4MIM A;  3J81 Z;  2KT0 A;  4YC5 A;  1XDS A;  2VFQ A;  2MH9 A;  1VQN I;  5K7H A;  4CSW A;  4ZDP A;  2QMU A;  3ZRG A;  2XIG A;  3L7W A;  1PUF A;  2ZJQ F;  1QU3 A;  4M3D A;  3SJZ A;  1E0E A;  4BQO A;  2HMA A;  3BTL A;  3OIO A;  3JQQ A;  2QEX B;  5DTD A;  3R4K A;  1N08 A;  2KJC A;  5D4R A;  2QYU A;  3JRD A;  3IC7 A;  4CCM A;  4C3I J;  1TNS A;  3R6S A;  2JJ1 A;  2BVL A;  3MKL A;  4RGU A;  5HDN A;  5K7Z A;  2R5Y B;  1KRH A;  3G1M A;  4NQW A;  4KUM A;  2BV3 A;  2V6E A;  3CCR B;  1SVL A;  3B73 A;  3DQV C;  1YIJ I;  2DMQ A;  1B23 P;  2KFD A;  1W4M A;  4DNR B;  2RV8 A;  2CRG A;  1JGS A;  3QP6 A;  2AHQ A;  1P7I A;  1SD7 A;  1FTZ A;  4KKS A;  1DBO A;  2NT6 A;  4RM3 A;  4EGZ A;  1RRJ A;  1EWY A;  4TMW A;  5FNZ A;  1OR7 A;  1TWA J;  4Z6Y A;  3F22 A;  1ZYR F;  2ZJR F;  3BR6 A;  4LJZ F;  4XLC A;  3VYU B;  2DA2 A;  4E7K A;  3BY1 A;  4RAF A;  5LRR A;  2WYR A;  3GF2 A;  5J4V A;  1RUO A;  1KD1 D;  5E79 C;  3V8L A;  5F0C A;  3E6M A;  2UXN A;  5FKK A;  1HW2 A;  1W35 A;  1BJZ A;  4OOS A;  5FD6 A;  4KNY A;  4UY8 I;  3AL0 C;  3I3L A;  5KHD A;  4E0F A;  1J5Y A;  2V4J C;  3DBL B;  3CCE I;  4BDZ A;  3TKY A;  2ZXJ A;  4DBQ A;  2PEX A;  4AIK A;  1W36 D;  1W2B B;  1WZ2 A;  2ZO4 A;  3PVD A;  3SY2 A;  1OCP A;  1WSR A;  1MDM A;  5L3G A;  4I99 C;  1QG0 A;  3RYP A;  1NB0 A;  3LST A;  2F48 A;  2WA0 A;  1AMO A;  1IB4 A;  5AON A;  3ZP5 A;  4TV7 A;  1J9I A;  3GQ8 A;  3GW2 A;  1YS6 A;  4D0P A;  2WV0 A;  1YYV A;  4ZDO A;  2NTQ A;  2DMP A;  4LK1 F;  3QWL A;  3CW2 A;  1A8P A;  5HOO A;  3IAS 2;  4F3Q A;  4C43 A;  2HGC A;  4U88 A;  2X6X A;  3P7N A;  1A5J A;  5EEA A;  5F04 A;  3BR5 A;  3JW4 A;  2QSG X;  2EK5 A;  4V19 K;  3OJW A;  3FMQ A;  4A3C J;  1FSH A;  2A5Y B;  1D1A A;  1MJB A;  1NHA A;  4K2E A;  3I4P A;  1IDZ A;  2R5Z A;  1QRY A;  1UD5 A;  1WOS A;  3LQQ A;  3S32 A;  1EV7 A;  2FUG 2;  5JLV C;  4P3I A;  3VO1 A;  1IRX A;  3RIQ A;  4MFD A;  4W8R A;  2MSY A;  5HXB A;  4ZTF A;  1JT6 A;  4XRS A;  2G7H A;  1R00 A;  4QTR A;  3EET A;  1A36 A;  4S05 A;  5M3M J;  2H1K A;  2KP6 A;  2B7E A;  3OSG A;  1T6Z A;  4E7S A;  1XDU A;  2EA2 A;  2QSH X;  3DLA A;  2XNJ A;  1SFX A;  4XN0 A;  1D8K A;  3JQP A;  3L2V A;  1DU6 A;  2B0L A;  4EVI A;  1EH6 A;  2WTE A;  4IRI A;  2PMD A;  3G05 A;  2B0R A;  2EWN A;  4BXF A;  1MSE C;  3BR3 A;  1QNT A;  1Y0Y A;  2LMD A;  1OIS A;  2QX3 A;  3KFW X;  4IHT A;  3U6B A;  3FXM A;  1AHD P;  1YJ9 B;  3GQB A;  4OIR F;  2DT5 A;  3S3M A;  1OFL A;  2HI3 A;  4UUS A;  1KQ5 A;  2X4H A;  4YG2 F;  1O3T A;  1JNY A;  2K4B A;  5B3S H;  3L2U A;  1XCB A;  3OIQ A;  5BMZ A;  1GAW A;  2JRT A;  3C3W A;  1CNF A;  2F5V A;  4AIJ A;  1FSE A;  2L2O A;  1O8F A;  4HE6 A;  1P4X A;  3E6B A;  4YEJ A;  1YIT I;  1IDJ A;  3PUB A;  1PJR A;  2X6W A;  3EYI A;  2XC7 A;  2GA2 A;  2R93 J;  2EPF A;  3DP7 A;  3OW2 B;  1XSD A;  1TL8 A;  4C2L A;  2XAQ A;  1W7P D;  3QPH A;  3GXO A;  4TMZ A;  4NNJ A;  4HWV A;  4KDP A;  1QHG A;  4XLE A;  2PQ8 A;  1VQK B;  2CW7 A;  3K2Z A;  2I10 A;  1IUF A;  2F2E A;  3H5R A;  1YRN A;  2QQA A;  1EFU A;  1NK2 P;  1FNB A;  1VQM I;  2EFW A;  4PSX A;  3D5R C;  3H9J A;  4FIS A;  3DKX A;  2HQR A; 
#chains in the Genus database with same CATH homology
 2CS3 A;  4HPQ A;  2O5R A;  2VQG A;  4II2 A;  3L2W A;  4OJ5 A;  4HIZ A;  1TZL A;  1WJA A;  4OZY A;  2O17 A;  2XSJ C;  3ZIA A;  4Z03 A;  2ZSH B;  3VWB A;  1LKX A;  3L2Q A;  2F6C A;  2VIX A;  1DQU A;  4BE1 A;  3OPO A;  2NSP A;  4U49 A;  2HVS A;  4GRI A;  3HOT A;  3OYD A;  4DJA A;  3TBI A;  4XN3 A;  3HL2 A;  2WJV A;  1BN8 A;  4YZX A;  4OZZ A;  4ZTJ A;  3DEE A;  2HU9 A;  3BLY A;  2X51 A;  2QE7 A;  4NK8 A;  1X19 A;  4UZU A;  2E1B A;  2K9M A;  4CH7 A;  2X8K A;  2VQC A;  3LSM A;  4XLA A;  3LSH A;  4DNT B;  2WAQ A;  3EUA A;  3SEQ A;  1OHH A;  3VYR B;  3KEY A;  4BEH B;  4HRI A;  2VKH A;  2ZXI A;  1YE9 A;  3H5A A;  1WP6 A;  3CP2 A;  2XAU A;  3DTK A;  1X4O A;  1D1C A;  1S9H A;  1HG8 A;  2KVO A;  2MFZ A;  4HSR A;  5JHF A;  1UEL B;  2VKD A;  1K5C A;  2DIE A;  3BCB A;  3OYJ A;  5CKT A;  3MKY B;  4BAC A;  3OS1 A;  1V0E A;  2UVE A;  2WY8 Q;  4HNT A;  2CV1 A;  3A2K A;  1KCC A;  2E5Z A;  2F4I A;  5LD2 C;  3BCD A;  4RLQ A;  1MW7 A;  4W8Q A;  3GVJ A;  4X0G A;  3J7A Y;  4ZYA A;  2CW8 A;  1WMR A;  2O0W A;  2UVF A;  2VBM A;  2WAD A;  3OYC A;  2VJ5 A;  1EA3 A;  3JU4 A;  1DP3 A;  4XMY A;  4IKF A;  4XOT A;  4JMQ A;  4PK4 A;  1W9X A;  1V5E A;  1BHE A;  3K4L A;  3OE7 A;  2IS2 A;  2IQ7 A;  3CES A;  3OEE A;  3H35 A;  2LH9 A;  4CUG A;  2IS1 A;  3IUO A;  4G7X A;  1P9Q C;  4CCL A;  1BR4 A;  3MKZ A;  1IDK A;  3IAM 2;  4XKB A;  1DBG A;  3HC7 A;  2CUJ A;  3M1C A;  2W1O A;  3N05 A;  4MLO A;  2DCE A;  1E1Q A;  1FMW A;  3WWG A;  2HPM A;  3DPU A;  3ZGK A;  2F43 A;  3ZR8 X;  2PJR A;  4XR6 A;  2KRH A;  2ZZQ A;  3HUG B;  1HA8 A;  2NTB A;  2X1C A;  3CJQ B;  2XND A;  1JRG A;  1V5F A;  1O8M A;  3VSU A;  2ELJ A;  1FMV A;  1XG2 A;  3KRG A;  2WPD A;  3K4B A;  3SZG A;  5HVQ C;  1O8G A;  2E5N A;  1LVK A;  4BDY A;  2NT9 A;  1WJD A;  1BLI A;  2MC4 A;  4Y4R A;  5KCM A;  2VAS A;  2HLD A;  3K10 A;  2WAE A;  4LIU A;  1OB0 A;  1MMD A;  4LIT A;  4GQN A;  3FBI B;  3QOD A;  3K70 D;  3OOC A;  3JUR A;  4P1W A;  3VYT B;  5LFA A;  4E7I A;  3HAG A;  2XZL A;  2VQH A;  1G59 A;  2ZZF A;  3BH4 A;  2JSP A;  3E0J B;  3S3N A;  1WJE A;  2CMP A;  2EWE A;  4PSW A;  3UW0 A;  2XF5 A;  4CCJ A;  3C2H A;  4F92 B;  4XOP A;  2IS4 A;  1BR1 A;  2BVM A;  4YXW A;  3HPG A;  4OWR B;  4DGW B;  2WJY A;  4DIQ A;  3FKS A;  3NE5 B;  4MXN A;  3CP8 A;  4DOZ A;  2V9K A;  3LNN A;  4IQ4 A;  2HDW A;  2VB6 A;  1ERD A;  4J01 A;  2HVQ A;  3S3O A;  4XKV A;  2VPL A;  3B90 A;  1UAA A;  4PJL A;  1MNE A;  1DGW Y;  2PYH A;  1D0Z A;  2IGM A;  4ZDL A;  2WAF A;  4PUS A;  3SUC A;  3UR3 C;  2INU A;  2V7F A;  4XON A;  2JA2 A;  3K4K A;  3NWS A;  4KJZ A;  4E7H A;  2ZFU A;  3RSN A;  1RWR A;  3OR1 C;  3BCF A;  4BEH A;  1QCX A;  3LSK A;  4DK0 A;  3BC9 A;  2VLA A;  4RMN A;  1AIR A;  2QXZ A;  3SEZ A;  1BR2 A;  2GOM A;  3K4C A;  4B43 A;  3OIP A;  4XLH A;  2RNG A;  3K4N A;  3U21 A;  4IZZ A;  4OJP A;  2LYC A;  4NC8 A;  1X1A A;  1BPL A;  1COW A;  2L9N A;  1WTH D;  1O88 A;  2R7V A;  2VBK A;  5FRM A;  4IQJ A;  4E6K G;  3OYA A;  2V7Q A;  1VZ0 A;  4CA0 A;  2O04 A;  3KX2 A;  4J00 A;  3ZSC A;  2GK7 A;  3GVL A;  4U4B A;  2K9L A;  4P5O A;  1QHH D;  2PYG A;  1E79 A;  5IK2 A;  2NZM A;  3OYI A;  2KRC A;  3BCA A;  4E4H A;  1N77 A;  3S8P A;  2IS6 A;  3FHN A;  3DU6 A;  1YX3 A;  1WJB A;  2VXD A;  3VSL A;  1W0J A;  3QOE A;  4KIS A;  2QY1 A;  3FY3 A;  5HKK A;  3CF2 A;  3PNV A;  3OYE A;  1ZEL A;  3LL7 A;  2WBM A;  1MMG A;  2LRD A;  1EFR A;  2ZTG A;  1Z21 A;  4TKO B;  2W7N A;  2WSS A;  3OYL A;  3CJR B;  3QYE A;  3RPU D;  3OOU A;  4XKC A;  2QKM B;  3T56 B;  3AKZ A;  3OL3 A;  3OS2 A;  3H94 A;  1PKV A;  1K6Y A;  4N4O B;  4YZ0 A;  4G6I A;  1UD3 A;  1VBL A;  2DJI A;  1UD8 A;  1J09 A;  2LY1 A;  2E1M C;  2VJ4 A;  1LDK B;  5KNL A;  1KCD A;  4PJJ A;  2BOL A;  3L2R A;  2E60 A;  4XOR A;  2PEC A;  1WJ5 A;  4F93 B;  1CZF A;  4BE0 A;  3KEW A;  4Z1M A;  2UV1 A;  2XZO A;  4OAY A;  3GVK A;  2W82 A;  1GQ8 A;  4YEL A;  4XNF A;  2R7W A;  2KHM A;  5FL7 A;  5HNF A;  4BJ6 C;  2K3P A;  4Z06 A;  4D1Q A;  3TL4 X;  1OOC A;  3M8J A;  3BG6 A;  2CV0 A;  1GLN A;  3DKY A;  4RM2 A;  2A5W A;  3HKZ A;  1HZE A;  3GQ9 A;  3A3B A;  3CZ6 A;  3EPZ A;  1H8E A;  2Z8G A;  4HG2 A;  1N78 A;  2ZTN A;  5TGT A;  4ANJ A;  2KPM A;  2P0W A;  3OY9 A;  2W6J A;  1MAB A;  4H4K C;  1JI8 A;  1NRK A;  5C1C A;  4OAZ A;  4NQW B;  1QJV A;  1T5E A;  4PFO A;  2JUG A;  3ZXS A;  5CQE A;  1WJC A;  2W6I A;  1HVX A;  4E7L A;  3GQ7 A;  4FAS D;  2AQF A;  1T0F C;  2WZP P;  4BQN A;  3FPP A;  4U7B A;  4BQQ A;  2ZZE A;  3K6G A;  4LIV A;  3W3C A;  3T53 B;  3VR6 A;  1Z7L A;  3DDY A;  1SFK A;  1NG6 A;  1TT0 A;  2L5Q A;  3OYN A;  3IP4 B;  3OYK A;  4C2T A;  1KON A;  2D3L A;  3RQ4 A;  2NTP A;  2O0V A;  3H9G A;  4XQF A;  2X53 S;  5HNH A;  3W2V A;  1UD2 A;  2W00 A;  3OYG A;  2VL8 A;  4B47 A;  2XOK A;  3UNG C;  1BMF A;  1UG0 A;  2M5S A;  1W0K A;  2MD0 A;  4BU2 A;  2DOA A;  1EE6 A;  2L7K A;  2RRE A;  3PNY A;  4XD7 A;  3F9K A;  2VQL A;  4ZC3 A;  3VST A;  3NWT A;  1E3X A;  4XL9 A;  1IA5 A;  4XKW A;  3HOS A;  3G2B A;  1O8H A;  4DK1 A;  2NST A;  2Z16 A;  1W36 C;  3OYM A;  2A6T A;  3T51 B;  3VMW A;  3VSV A;  3B8Y A;  4HST A;  4KKU A;  2L9S A;  4KT6 A;  1U0J A;  2HVR A;  2JIZ A;  1YX5 A;  3EUK L;  2ODL A;  3K4J A;  2X3H A;  1JTA A;  2RQQ A;  2ZXH A;  2HQA A;  1X0C A;  3CMM A;  2KMU A;  2XGJ A;  4D9J A;  2INV A;  2XDV A;  4TSF A;  4CCO A;  2BSP A;  2R7R A;  2M4K A;  1VF7 A;  4YRV A;  1SKY B;  3FBN B;  2V4D A;  1Y6I A;  2I8D A;  2OV7 A;  4B3F X;  2Q2E B;  3VMV A;  3PFY A;  1KTW A;  2CH0 A;  2GK6 A;  2E1M B;  2KDO A;  2WY7 Q;  4KKT A;  4W8S A;  2GJR A;  2IXS A;  2HNH A;  3WQZ A;  1VLY A;  3ONQ A;  1Y56 A;  3DWL E;  4QPO A;  2R7X A;  3GBG A;  1O8D A;  1PXZ A;  2Q1Z B;  4F91 B;  4LG3 A;  3HG9 A;  3GRH A;  1G8X A;  2HPI A;  3VYS B;  2MYS A;  4JOM A;  3TMO A;  2DT6 A;  2V1N A;  3GQA A;  3D5S C;  3VDX A;  2VJI A;  1LFP A;  4YZA A;  2JJ2 A;  5CDF A;  4BE2 A;  4CCK A;  1O8I A;  3MMY B;  4AU7 A;  2GOX B;  3S93 A;  2X85 A;  2IGK A;  3EQO A;  2M7B A;  3SYT A;  1KMH A;  1O8L A;  1Z3Y A;  2KLO A;  2OC6 A;  1UD4 A;  2M0M A;  4XM3 A;  2KZV A;  2M7A A;  3LMM A;  4BS9 A;  1X4P A;  4FET A;  4CSW A;  4ZDP A;  4ITV A;  1I8D A;  3ZRG A;  3HPH A;  1O8J A;  2LBF B;  3OYH A;  2X1D A;  5HLT A;  1MMN A;  1QU3 A;  3D5L A;  2NOJ B;  3FKJ A;  4NC7 A;  4Y3O A;  2O1D A;  1OFM A;  1E0E A;  2KQR A;  2IGN A;  3RCO A;  4BQO A;  4URR A;  2LG4 A;  4FXU A;  3PL8 A;  3QYB A;  4CCM A;  3LMW A;  2JVG A;  2JJ1 A;  2BVL A;  2XZP A;  2V6E A;  3PSI A;  3T9G A;  3DQV C;  4B44 A;  1R6R A;  4DNR B;  3W2A A;  3OYF A;  3QYF A;  3I9V 2;  4CCN A;  3SDB A;  4ZJZ A;  3OS0 A;  2PMZ A;  2Z6B D;  1I18 A;  4KKS A;  1DBO A;  2NT6 A;  4RM3 A;  1WFX A;  2R7Q A;  2LC2 A;  1T95 A;  4XLC A;  2BW3 B;  4DBR A;  4JQF A;  3VYU B;  4E7K A;  4AYB A;  4OJ6 A;  2K5C A;  4BJ5 C;  3E1S A;  2Y0S A;  3A1Y A;  2R7U A;  2M3A A;  1X1B A;  4NUB A;  2GJK A;  2LOO A;  3OYB A;  3RTR A;  4B3X A;  4E7J A;  1OGM X;  3DPL C;  3AL0 C;  3I3L A;  5KHD A;  4Y33 A;  1V0F A;  2Z2S B;  2LZJ A;  4PJM A;  1NBM A;  4PMH A;  4E0F A;  2V4J C;  1NG7 A;  4BDZ A;  4DBQ A;  4F52 A;  2R9V A;  2V31 A;  3OW7 A;  1MMA A;  1W36 D;  1OLT A;  2HZD A;  4B48 A;  2W4S A;  1E43 A;  1PE9 A;  1E3Z A;  3B4N A;  3K4M A;  2CV2 A;  1O8K A;  1PYV A;  2CFO A;  3C2G A;  4KIT B;  2CK3 A;  3PNT A;  3OFN A;  2DT7 B;  2WA0 A;  1IB4 A;  3PJR A;  5DN6 A;  3V42 A;  4HEA 2;  2VJJ A;  3PSF A;  4MR0 A;  1SAU A;  5CQG A;  2XF6 A;  3GQ8 A;  4ZDO A;  3BG7 A;  3HXL A;  4C30 A;  4C9Y A;  2NTQ A;  2ZZG A;  3DPT A;  3DTI A;  2R7T A;  5FRN A;  5HOO A;  3IAS 2;  4F3Q A;  1UD6 A;  3VSK A;  1K28 D;  2X6X A;  3LSG A;  1FX0 A;  1NHC A;  2DXI A;  4F55 A;  1D1A A;  1UD5 A;  2OUM A;  3S32 A;  4B3G A;  2FUG 2;  3ZCO A;  4NK6 A;  1RU4 A;  2KL4 A;  2MAB A;  1IRX A;  4II3 A;  4W8R A;  4BJT A;  4HNU A;  2JDI A;  4L8J A;  1OGO X;  4ZTF A;  2R7O A;  5C1E A;  2XF7 A;  2AQE A;  5AMV A;  1D0Y A;  4C2U A;  2GJP A;  4I84 A;  2LY2 A;  1PLU A;  2KP6 A;  2F1M A;  4TT3 A;  4BGD A;  4E7S A;  2IGO A;  2M4G A;  4XLF A;  4EAT A;  4G7W A;  3DLA A;  4P22 A;  3MD2 A;  4XN0 A;  3L2V A;  4AVZ A;  2LBF A;  1RMG A;  3G05 A;  3H0D A;  4OJO A;  1WJF A;  3DTE A;  3LSI A;  4BUP A;  2Z1D A;  2ZSI B;  3OWT A;  4BXF A;  4G6T B;  4RLF A;  1MND A;  3OEH A;  3EQN A;  1X1C A;  1X1D A;  2QX3 A;  4CZC A;  3H5N A;  2CUZ A;  1Z3X A;  3GQB A;  3S3M A;  3FDY A;  1OFL A;  3A35 A;  4R79 A;  3H9Q A;  2PJR B;  4E7Z A;  3AFH A;  5CPR B;  3MKW B;  3L2U A;  2UWM A;  3A4C A;  3OIQ A;  4N4N B;  3ZPN A;  1V5G A;  2F5V A;  1BOB A;  4Z05 A;  3A3G A;  3OL4 A;  3OMY A;  2L2O A;  1O8F A;  1E1R A;  4YEJ A;  1IDJ A;  3PUB A;  1PJR A;  3AL0 B;  2X6W A;  4PJN A;  2XC7 A;  1D0X A;  1VJS A;  3OR2 C;  2BW3 A;  2QKL B;  2R4G A;  2D3N A;  2VBE A;  4YZQ A;  1WPC A;  4C2L A;  2WB1 A;  3W2W A;  2R7S A;  4NNJ A;  3K70 C;  3LFU A;  4IX7 A;  2LRE A;  3BC8 A;  4HWV A;  3OAA A;  1H8H A;  4OJL A;  1QHG A;  4XLE A;  4U87 A;  3KYL A;  3ZPP A;  2CW7 A;  4ASU A;  3EUH C;  3H5R A;  3DU5 A;  1OR7 C;  1D1B A;  4PFP A;  2VXZ A;  5FRO A;  3ZQQ A;  1AA7 A;  2X6Y A;  4BL0 B;  4PSX A;  3D5R C;  3H9J A;  1KZL A;  1O8E A;  3DKX A;  2JVH A;  2V26 A;  2UUZ A;  1DGR M;  2X1E A;  4W8T A;  4EW9 A;  4QPQ A;  1H80 A;  1N75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...