4XL9A

Tailspike protein mutant d339a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
b'QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xl9A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xl9A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xl9A02
2VBEA 3VMVA 1RU4A 2X85A 3ZPPA 2X6WA 1CZFA 2NT6A 1H80A 2NTBA 4OJOA 4XN0A 4XLHA 2PYHA 2VBMA 5AMVA 1GQ8A 1JTAA 4EW9A 2PYGA 4MXNA 3VSTA 4XR6A 4OJ6A 3JURA 1JRGA 2UVEA 1O8FA 4OZZA 3GQ9A 1O8JA 4XLCA 1IB4A 3KRGA 4NK6A 2X3HA 4YEJA 2QY1A 4W8SA 4XL9A 4XNFA 3B4NA 2INUA 1O8MA 1OFLA 3SUCA 3UW0A 1WMRA 1BHEA 2NTPA 1OOCA 4I84A 2X6YA 4Z06A 3VSUA 1QCXA 4XN3A 4URRA 1KCDA 3ZSCA 3WWGA 2VJIA 2NZMA 2IQ7A 4U4BA 1KTWA 4XKVA 2INVA 4MR0A 4XLFA 4HWVA 4OZYA 2EWEA 1O8GA 1PLUA 4AVZA 3VMWA 1IDKA 4YZ0A 2O1DA 1K5CA 2NSPA 2UVFA 2VJJA 1RWRA 1NHCA 4YZQA 4XONA 4OJPA 3VSVA 4PMHA 4YZAA 4C2LA 4XLAA 4U49A 1OGMX 2BSPA 2VBKA 4XQFA 2NSTA 3B90A 1QJVA 3LMWA 2O0WA 5C1CA 1O88A 1VBLA 1X0CA 4XKWA 1PE9A 1EE6A 4XOTA 5C1EA 1RMGA 1O8EA 2QX3A 1O8HA 3B8YA 2PECA 4Z03A 2QXZA 1O8LA 1AIRA 1IDJA 3GRHA 3EQOA 1DBOA 4OJLA 4W8TA 3GQAA 3FY3A 4OJ5A 2X6XA 2O04A 4XMYA 1DBGA 2O0VA 3GQ7A 1PXZA 4W8RA 2O17A 4XLEA 1O8KA 2ODLA 1BN8A 4XM3A 1KCCA 3EQNA 2NTQA 4W8QA 3GQ8A 1OFMA 1O8IA 1O8DA 1OGOX 4XORA 3T9GA 4Z05A 1HG8A 4YELA 1IA5A 4YZXA 2Z8GA 2NT9A 1XG2A 4NK8A 4XOPA
chains in the Genus database with same CATH superfamily
3X2QH 2VBEA 3GIRA 2WC2A 5E8GA 1IV8A 4EH1A 1H80A 2QDXA 1HW5A 3CMMA 3JRFA 1N0UA 2LVSA 3TO6A 2QSGX 2EIKH 3RPQA 4KKUA 3LYCA 3E3VA 4RMNA 3RIRA 4ZCLA 3VSTA 3F0CA 1HDPA 5CVVA 4D5FA 2CGPA 3EQLF 4U9UA 3TDZC 2L4MA 3GQ9A 2HOTA 4DK0A 3F8MA 3GVAA 2DTRA 3SHFA 3PUNA 3PSSA 1LFUP 4OM9A 1UG2A 2EIJH 2ELJA 5KVRA 2AO9A 1T56A 4YEJA 3CCSB 3I59B 2QM3A 1ZUNB 4BBRJ 4E7ZA 3H3UA 4Z4ZA 1OCOH 2XSJC 3VO2A 3K2AA 5E79C 3BTIA 3GFLA 5FNZA 3ABLH 3BLYA 3AFHA 1B72B 1WFXA 2W85A 4HV5A 4DNCA 3DPLC 5GV7A 4PJ0C 2XVCA 4U4BA 2CWEA 4XRSA 4UXNA 4UHTA 2O6GE 3ZPLA 1WJDA 1QU3A 4YFOA 3CJRB 3E6DA 2EWEA 3OKXA 2W7ZA 4HQEA 1WOOA 3W2VA 3F6VA 1YHQB 1O3TA 1VQNI 3CD6I 1Y0RA 2XNCA 1ETKA 3GW2A 3A0BC 1YS6A 5M5WJ 1IUYA 3SDBA 1O3SA 4OJPA 3CCJI 1SFXA 4FWTA 4G6IA 3WQZA 1O57A 3LFUA 3D5SC 1HOMA 3CESA 1FWZA 3LAPA 2VFMA 2DXIA 2ZJRF 3HC7A 3WG9A 1F9NA 4OAYA 2H8WA 5KCMA 4CZZA 2JA2A 5HVQC 1KYZA 2FBHA 2LKSA 3SEQA 2XAQA 4B3XA 2VKVA 3QPHA 4AWXB 3GZ6A 3OW2B 4I99C 4ZDOA 3VDXA 3CDLA 2F4IA 1H9GA 2M0MA 1W0TA 2EIMH 3WGIA 4EJWA 3JRIA 2FQ4A 2E2IJ 3GSIA 3W2FA 1SKYB 1O8LA 1UZCA 3D5LA 1D0XA 2HOAA 3ZOBA 1BL0A 2XKPA 1V5GA 1QVGB 5IYPA 2WZNA 2DI3A 2KDZA 1SD4A 3CUQC 4BE1A 4Z1MA 4IOAF 2LKXA 4WF2A 1JT6A 4G7WA 4P6YA 3H92A 4A0XA 1ZLJA 2DBBA 1OYYA 5CVJA 2M8GX 3RKWA 4X7EA 2VI6A 3A2KA 4BBSJ 3AAFA 4LFUA 2YWGA 4CCLA 3BG3A 1ODDA 2LD5A 3FPKA 4Z4VA 1W5TA 4HYEA 3S2DJ 2QTZA 4Y7NJ 3AG1H 3IH3A 1Z6TA 1V54H 1EF4A 4M0LA 2KRHA 2OPTA 3H5AA 1B72A 2DEUA 4BJTA 4ASNA 2STTA 1KK3A 4KT6A 2G7HA 4I09A 4G6TB 4CICA 3G05A 1WPCA 4GGGA 1REPC 4QTRA 1R5BA 1ETQA 1TW2A 4EJOA 3P5JA 1Y0UA 3TL4X 4ESFA 2IS1A 1I1SA 2KT0A 1E1QA 3OIQA 1QVFB 2K3FA 1HKSA 2C4UA 1DDGA 2RQPA 2E1MB 3FBIB 5LBQA 5LGUA 4RB1A 3KRGA 2B7CA 4CO8A 1XS9A 2ISZA 4TSFA 4PC2A 1OFLA 4L18B 3BWGA 4RLQA 4QHYA 2EZIA 3P9IA 3UR3C 1PUFB 5F0CA 2L5QA 3KYDB 1GVDA 2X6YA 3M8EA 5H6RA 1OQYA 1JXSA 2BBYA 1ON1A 1RQPA 5FKMA 3HDDA 4XKCA 4X7FA 3JW4A 2IT0A 4WQMA 3WYAA 1HQCA 1I6HJ 4PZJA 2EV0A 4BY1J 3I1FA 5LMZA 2WA0A 4IHXA 2OJED 1W36D 2FX3A 2FOWA 5LD2C 1ONVA 1Z0XA 4FE4A 4ZJZA 4PFOA 4Y15A 1B4AA 2X53S 1ZM3A 2NOGA 3IUOA 1IXCA 3LWFA 3LSJA 4KKSA 3ABTA 4PC3A 3VO1A 2R5YB 3IWFA 3RJPA 3TOAA 2W7NA 1YO5C 3DBHB 2UVFA 1KYWA 3TO9A 3GTJJ 2NV4A 4RB2C 2WZPP 3A8KA 1JA0A 2HKOA 2XSDC 1FX7A 1Y56A 3DLAA 2DA6A 1YTYA 1K7AA 2W00A 4OAZA 3S1MJ 1X3UA 5A2QZ 5LRRA 5ICCA 1VZ0A 3CC7B 3GTQJ 2JZYA 3E0JB 3B90A 3GWZA 3CO6C 2DDAA 2DO7A 2XTXA 4F3QA 3H5NA 4DQ2A 2XZPA 2DAOA 1UJ8A 5K5OA 2CW5A 1EE6A 5C1EA 1XDUA 2F5EA 1J7KA 1WRJA 2RNGA 1U2WA 1IDZA 4S0HB 2QSHX 3AVTA 4MIMA 1HA8A 1YITI 5CDFA 1Q86D 1AIRA 1OB2A 3QP5A 2LP0A 1XMAA 1X19A 3SQNA 4WZTA 2LSOA 4EEFG 1QRYA 1RQRA 1TUIA 3FM3A 1MMDA 2BXYA 2P7VB 4RS8A 2DOGA 2GJKA 3OPOA 2BN4A 1VQ9I 4X05A 4O5VA 4YAFA 2HDCA 3NRVA 1GVHA 5JVTA 3CCMB 3WGHA 2JQ7A 4BQOA 1KK0A 3A03A 3B73A 3Q3SA 4Z4TA 1GR1A 5JHFA 4I2OA 2QQBA 4RAFA 3CZ6A 2J8IA 3R61A 4DW6A 1MJAA 1ETVA 2V31A 1PUFA 1UCRA 3CMYA 4ENNA 3H0DA 1F20A 4RD6A 2XTWA 5FJ8J 1WU8A 1RU4A 1P4WA 3HOWJ 3PSIA 1HVXA 2VZLA 1LE8A 2A61A 1R5HA 3DBLB 2M87A 4Y33A 3WODF 2ICWG 1U5TB 1ZYRF 2JRTA 4Q4ZF 3TKYA 4TMVA 4PAAA 2K7LA 3HXLA 3V7RA 2FQ3A 4LBVA 1WJEA 3PIPF 4M6YA 3R60A 4P96A 3DV8A 1IAWA 1O8JA 3QWLA 2PBIA 1FNDA 2R5YA 2QY1A 3LSIA 2Q2EB 4UUTA 1Z7LA 5FLMJ 1G7SA 2WJVA 4EV0A 3LVBA 3K4KA 3MZHA 1S9HA 2K4BA 5HLGA 1OFCX 4YFXF 2Q1ZB 1BIAA 3CB4A 1Z77A 1VQNB 3CD6B 4RAYA 4B4DA 3SY2A 3CCVI 1VFCA 1FMVA 2VBWA 1SMYF 3ZN0A 5ILUA 5EGOA 2H8RA 1EFTA 1QFZA 2GK6A 3OP1A 1LDJA 3JREA 1R22A 3CW2A 3CCJB 1B59A 2M4KA 2N8GA 5EZGA 3A01A 1FX0A 3LSPA 2M5SA 2ZMEA 1FC3A 4N3NA 4HWVA 4OZYA 4CCNA 2HMAA 3LQEA 1HZEA 1BC7C 4KN4X 3BZ6A 2B5OA 2W6IA 1WHUA 4TT3A 2ZBKA 4KN7X 4LBYA 1YW7A 4LB5A 5GAHJ 2A07F 2E1CA 1K4ZA 1OCPA 2E60A 4YXWA 1HA3A 5E3OA 2L3DA 1BJKA 2QUFA 2GLOA 4YEIA 3W2WA 1V5EA 1FYMA 4G6QA 3FX3A 3SLNA 1U78A 2XAHA 1M90D 2UXNA 5AIPA 1ZAOA 3WTWC 2VFNA 4PMHA 3KEYA 2YWEA 4AD9A 3LJYA 1ZM9A 2MD5A 4X6AJ 5FLVA 3LA3A 5HZAA 3DEEA 2PMZN 2D3LA 1IJFA 2BVMA 2L0KA 2AXTC 1UHWA 4ENKA 1RMGA 2CRGA 1TYWA 1FOKA 3B8YA 4GQNA 2R0QC 2RKHA 1EWYA 2WAFA 2BM1A 2HTJA 2VFPA 1BBYA 3TOBA 1SVMA 2DOFA 4LLNA 1DQUA 1FOWA 3RZOJ 2D74A 2ZO4A 1JHHA 1HCRA 4EJUA 1YJNB 1E3PA 3ES9A 2F4NA 4D7NA 3OSGA 2ZBVA 2VFOA 1IV6A 4BS9A 3BTCA 4XKBA 3SJZA 3LMMA 1KQ8A 4AC0A 2QMUA 1RNLA 4EM1A 1Q9SA 1X1PA 1YX2A 3GCMA 3L09A 4GXOA 3HIFA 1EP3B 2OBSA 4JBAA 3ZR8X 2H27A 1Y0YA 5J4VA 1SVOA 2A05A 2QEXI 1CGPA 2BM5A 3ONQA 2BMWA 1QA2A 2YU9J 3GZ5A 4BE0A 4PGHA 5JFRA 3T9GA 3ZQLA 3HOVJ 5ED4A 3CLOA 1JUPA 3ELKA 3T5XA 5HXBA 1KQ9A 4DIQA 3NQOA 5TJJA 1IA5A 2V5IA 2O03A 2F48A 1UELB 3OOUA 3TW6A 3ZMVA 3FWEA 4B43A 3OS2A 2FD5A 3E97A 4G94A 1S0UA 4NK8A 2R9VA 3BOQA 2Y9ZA 2V7TA 2ZZGA 2DJNA 4M3BA 2KIQA 2H1KA 2B7EA 3G2BA 3V76A 2OD5A 2Z9OA 3W5UA 2R7QA 3DU6A 3K4NA 3T8RA 1RUOA 4L5JA 3Q9VA 1MBGA 1H89C 4C2UA 2PMHA 2ZXJA 3OOPA 5IT3A 1WSVA 3LSHA 3C7JA 1TTTA 5HS8A 3CQZJ 1YE9A 4XLCA 2FXAA 4RGUA 1G8XA 3A4CA 2L2OA 5FD6A 3BZCA 3ULQB 2XF6A 3E5QA 1MDMB 3JQQA 4UV8A 1OFDA 3AG2H 4JX4A 5A88A 3UW0A 2HCJB 2ZZFA 3I55I 1EA3A 2D9RA 1Q82D 3SJMA 5DN6A 2FSWA 4NBQA 1X1DA 4PC7A 3ZQGA 1G6NA 4A3FJ 4KH3A 3BP8A 3VSUA 3BJOA 4E0FA 4AIKA 2Q8KA 1QCXA 2QENA 3QE2A 1XGMA 2P5LC 5D5WB 3H35A 3L2VA 2KFDA 1EKEA 2EV5A 2D1VA 3FBNB 3PA1A 4P1VA 5J3LA 1YX5A 2LR8A 2MH2A 4I7HA 4BQQA 3HOZJ 1LUJB 1ZM4A 3H5RA 5D4SA 1D5YA 4RCYA 3EPZA 3J7ZI 4QPQA 2RC5A 2JPCA 1B6AA 2H6CA 1WI3A 3KFWX 3JQRA 3SXYA 1KQSB 5C44J 1TWAJ 5DCMB 1W7PB 3S2HJ 3OYHA 5F4OA 4PUSA 1STZA 1B2RA 3VODA 1CQTA 2RQQA 3SZTA 1JJ8C 1NB9A 4Y17A 2XF7A 1LEBA 1K6OA 1X4PA 3RTRA 1WH7A 5ILVA 3VFZA 4C3JJ 3ML6A 2ZXHA 1E3HA 1AMOA 5D8LB 4M3GA 1H88C 4IW3B 3CDHA 3SJPA 3CJNA 2OBRA 1YITB 2JN6A 3QP6A 3Q0WA 1QZZA 2V1UA 1WXRA 4GCVA 1P4MA 2PMUA 4DYQA 3ZMSA 1VBLA 1QX4A 1VQ9B 5DYMA 1BW6A 5BQTA 4WWVA 3ZMTA 2OC6A 3T51B 2V1NA 3T1BA 1P7IA 3BQZA 3SLDA 3H09A 1W34A 5GAEJ 4HV6A 5FIUA 2CU7A 3ABUA 2DJIA 3U9GA 3KEQA 2C4TA 3HB9A 4ZGQB 3AVVA 2YR2A 4AM3A 1JI8A 2FEZA 3GQBA 4OJLA 4LLLA 3OOCA 3TP3A 3Q6RA 2C78A 1K73D 1Z3YA 1AHDP 4BPRA 2ZSHB 4LLGF 1SC7A 3E6MA 1TSPA 4XLEA 3BG6A 3Q38A 4G7XA 1ORKA 3G71I 2F5CA 3WBKA 3CO7C 4CYCB 1SD5A 3FISA 2M5WA 2PI0A 4YALA 3OL4A 4ZTJA 3WGGA 4P3YA 4NB5A 2DT6A 2DMPA 4Q5SF 1D5VA 2ZXIA 2UZKA 3MCAA 2VBYA 5D6FA 4MTEA 2X48A 3IWZA 4F55A 1SFOJ 1QVUA 1HW1A 2HQNA 5AMVA 1SFUA 2BYVE 2L9SA 3ZQHA 3PUFA 4EVIA 5LHIA 4CDGA 5J40A 2DCUA 4OWRB 1XMKA 3ISXA 1ZG5A 2AXLA 1V4RA 2DK5A 2FBIA 3HM5A 3W6JB 1IN7A 2X6OA 2UWMA 2YWHA 3CCVB 1K83J 2VJ5A 1W7PA 2WAEA 5DCMA 2UVEA 2J5PA 3SDGA 2HYJA 3ERMA 2BGJA 4A3KJ 4S04A 5EJCA 4XD7A 2DCEA 3GVKA 2O8KA 4BEHB 4FTHA 3CRZA 2HPMA 5K5RA 2R5ZA 1O3QA 3BY6A 1S4MA 1GUUA 4GFBA 1X1CA 4P55A 1VHEA 1TWHJ 3F8NA 5GP9A 3TEDA 4IJAA 3BQJA 2F4OB 4N4NB 1KCDA 2Y2ZA 1XSDA 3IRRA 2BY1A 2IQ7A 3MKWB 1MMAA 1OB0A 5H2FC 1E0EA 4CCKA 1MZBA 1E17A 3BPVA 3CCQI 4HNVA 2CMPA 3KLNA 4XLFA 2XEXA 1P2FA 3HRSA 2ZTGA 2YX4A 3HGYA 3ZBUA 2CW7A 5FROA 2PIAA 3P7NA 2D2WA 1UMQA 2GXGA 2DYIA 1W7PD 4YZ0A 2MLKA 5J1YA 5IYCJ 1J75A 2FF4A 1BIBA 4U0YA 2R7UA 3QPTA 1TVCA 1OFEA 3ZQQA 2ADUA 5LFAA 2OTLI 2MLGA 1IXRC 1FRNA 3FPPA 4BACA 3W6KB 4JOMA 4AYBA 2W4SA 3L9FA 3PSZA 1DU6A 4Y3OA 3QYBA 2NVYJ 1KJZA 4Q7JB 1U6GA 2BSPA 1A04A 2V9PA 3U2RA 4LBWA 4V02C 5HS7A 2OBTA 2FJ1A 5FO5A 2JTVA 1KC8D 2VUMJ 1D0ZA 3P9KA 2Q0OA 2DMQA 3CCRI 4LITA 1R1UA 2J7KA 3CMAI 4C43A 2MSYA 1I39A 3WE2A 1O8EA 1LVAA 2LTPA 1DARA 2Y48A 2VKHA 4A6EA 4PC1A 1NG6A 2Y69H 4TMXA 4ZYDA 4AIDA 1NK3P 3R6SA 3AVYA 4BY7J 1J5YA 2O61A 2GQQA 4Z03A 2CQQA 2FBKA 1B8IB 2W82A 2QEXB 2M2EA 3GRHA 4HNTA 1H85A 4F91B 5F0FA 4OJ5A 4W8TA 1W0JA 3TH0A 4YAOA 2HOEA 1ZGAA 1BI1A 1XPXA 2XPVA 4PABA 4L9JA 1W5CC 4R1HA 5GTHC 2ID3A 3G1MA 2HKXA 4ITVA 3BNWA 2EA4A 1P9QC 1P7JA 3VEPA 4M3DA 2F1LA 3VYUB 2MABA 2V26A 2YX7A 3N05A 1IN5A 5D5VB 4MQVA 3DLLF 3F72A 2CUZA 2V7FA 1VQ6I 2V6EA 3PENA 5DEQA 1VQ7I 4MHGA 4B8XA 2RV8A 3N4MA 4LB6B 1A35A 2DFFA 1XDSA 4Z4UA 3PJRA 1ZHFA 1Z6RA 3LO8A 1XGOA 5J1UA 2WJYA 3TP0A 5IPAA 2LRDA 4M74A 3OV8A 3OYAA 1ZG1A 3FXRA 3BY1A 5A89A 4NHJA 4XR6A 2DOEA 1BLIA 1WCMJ 4AU7A 2EIXA 1LLZA 3I53A 4M71A 1Y39A 3ZUGA 2G9WA 4A69C 4BNCA 1T0FC 1IB4A 3K4LA 2R7ZJ 2X3HA 2ZB9A 1ZR2A 3VSLA 2P6TA 1UD2A 4DBQA 5D6EA 2WPDA 3MKLA 4A0ZA 4U0VA 1JUSA 2CUJA 3K2ZA 1T33A 1UFMA 4IVNA 2XC7A 1GDTA 1YRNB 4ZTFA 3W5HA 5CKTA 3BC8A 3G1LA 4NDLA 4NC6A 2DT7B 1YIOA 2JVHA 1X3WB 5L3FA 1XB4A 2J5OA 2HQ5A 1R4NB 3CCMI 3V7CA 5L3DA 3BT9A 3FM5A 1J59A 3TGNA 2VJIA 1MBJA 5F0HA 1K4SA 2HDDA 3A8JA 3CCLI 1VLYA 2Z99A 1OR7A 3E1YE 4DK1A 3IV5A 3ZPNA 1XCBA 1ZN2A 1OMIA 1YJ9I 3FKSA 3HL2A 1VQOI 1XX5A 2PMZA 3GXOA 1K61A 3FMQA 3JCUC 5FO0A 2HGCA 5J8CA 2Y9YA 5EG0B 2XT4A 2M4GA 3BR6A 2EBIA 4C2TA 2KIFA 4K1XA 1JKOC 3OAAA 4RDKA 3CDIA 4AUXA 2MGQA 3MKZA 5ICGA 1QVTA 1UMKA 2IJLA 3EDPA 1GAWA 2ME6A 3RKXA 4AVPA 5ICEA 1S72I 5F27A 3KP3A 4RA2A 1WSUA 3R6KA 4P9SA 1FP1D 5CVIA 1MABA 3Q39A 3PNTA 3UNGC 3VYSB 3CUQA 4ZH4F 1KZLA 1ULYA 1GXPA 1D8KA 1RESA 1ZARA 4KMUX 1T6SA 2K9LA 3QYFA 1KRHA 3G71B 1XB2A 2VOPA 2I5UA 2F2EA 1VJSA 4OIQF 4OOXA 3K1NA 1BI2A 4IX7A 2IS2A 1TZLA 3F6OA 4CYDA 1RZ4A 3G73A 3AVWA 1DABA 2Z5UA 4MFEA 2DOAA 1VQ8I 5H6QA 1EFUA 1TTYA 3BTJA 2FRHA 2M3AA 2J8KA 1EH6A 4ESJA 3OEHA 2X6XA 1NJID 4UUSA 2VBUA 2V9VA 2O8XA 2PJRB 2GXAA 1IN8A 3U1KA 4YRVA 4ROXA 4KIBA 1CF7B 3S3NA 1RKTA 2VKEA 2WAQA 1BR4A 2BM0A 3ASOH 2MYSA 4P2NA 1OKRA 2LBFB 1KQ0A 1V55H 3TDUC 1P4AA 4ON0A 4P22A 4A3JJ 1FYKA 2XRLA 3MQ0A 2D45A 5KAIC 2KLOA 3WNDA 2QBYA 5LEKA 4ENMA 4PCQA 1I3AA 1R4MB 4IKFA 3ASQA 3ML3A 3DTKA 3K6GA 2VNIA 1XG2A 3ECOA 4WZEA 5FA6A 5HODA 1S3JA 1OJLA 1W0UA 2DA1A 3HOUJ 3JSPA 4XLHA 4RGXA 3J7YJ 2R7XA 2CNDA 5DD4A 1IZ1A 1I1GA 1MJBA 3OS0A 1U3EM 1QGAA 3EETA 1PJ7A 4AF6A 3CJQB 3VSKA 2GXBA 3A3BA 2OBPA 3KX2A 1MW7A 2A69F 3I59A 1TLLA 2B7BA 2GM4A 5BSXA 2VC0A 2WY7Q 3CCQB 2PE3A 5FKNA 4GYIA 4B1RA 1EP1B 1JA1A 3KP4A 3MVPA 2EQRA 1IB0A 1YJNI 3LL7A 1WMRA 4I01A 2R93J 3H9QA 3A35A 3F21A 4IRIA 2M7AA 2Y31A 4S05A 5K5QA 3JAMK 1WZ2A 2DA5A 1AKHB 3DF8A 2C77A 3KP2A 1BM9A 4YG2F 2DFEA 2E1OA 2XGEA 2OTLB 1VQPI 3CUOA 2L7FP 2XF5A 3BCBA 5FLXZ 3WXMA 3OYJA 1KTWA 4IHYA 3OFNA 4NBSA 4RD4A 2XC1A 1L0OC 4BJ5C 1V5FA 4P12A 2BVNA 1RKWA 2IBDA 3C3WA 3QPLA 4HF1A 3I58A 1YOVB 3CCRB 4OPVA 1KU9A 4RDUA 3CMAB 3JRGA 1E3XA 3HOXJ 4M72A 5M5YJ 2VJ4A 1EXMA 2PJRA 3AVUA 4X8IA 1BC8C 1Y8RB 3ROUA 3VSVA 1CF7A 1KGSA 2QZ8A 5K1YA 2JUGA 1LVKA 3NAWA 4ZDPA 4K2EA 3GUDA 4B44A 1OGMX 2LBFA 2TDXA 1CNEA 3Q6QA 3QFSA 4JYKA 2FVGA 4EATA 3MN2A 2R7WA 5C1CA 5K7HA 1VTNC 1X0CA 5C4XJ 2DQLA 4ZZDA 3FXKA 3VYRB 3Q9SA 2E2HJ 4IHSA 2EFWA 1D1BA 2B9SA 3W3CA 2WSSA 1A6QA 4Z4WA 1T38A 1MBKA 4Y13A 1KU3A 1K4TA 1H0MA 3K69A 2CV0A 1KMHA 3OJWA 1XTAA 4HA8A 2PX9A 1VQ6B 2HYFA 4PK4A 4I98B 2E5NA 2RDPA 4E7SA 1VQ7B 3ZN1A 2HQAA 2DMTA 1K8FA 1HSJA 1WI9A 1ZRFA 4ZCIA 1A8PA 2LY2A 2HYGD 4M6VA 3JX8A 2KJBA 3GQ7A 4WXHA 4W8RA 4QVJA 2JJ7A 1G7TA 5GTIC 2GREA 2K27A 5J35A 3KPHA 4FQGA 4U7DA 4WWCA 4N4OB 5KAFC 5F4MA 3OYIA 2X51A 4J19A 2BZTA 3FK6A 3ISPA 4BHPA 2R7FA 4FXUA 1JTXA 4G12A 4E7LA 3LFKA 4N9HA 2OA4A 5E1WA 5JLVC 1W35A 2B0LA 3S14J 1XSXA 2BV3A 1DU0A 3IH4A 5IYQA 1D8JA 1AKHA 3BH7B 2LFBA 2IGNA 2EFOA 1UHSA 1RRJA 4F92B 1WOSA 1QPIA 2VBSA 1I18A 1XGSA 2L7KA 3WU0A 3GLXA 5HZBA 3I56I 4NCNA 3MAJA 4MFDA 4MEYF 4HE5A 1Y6IA 4RJLA 4G7ZF 1T6XA 2AQFA 4DOZA 2VBXA 2CW0F 5BMZA 1IN6A 2XHKA 3CCLB 2W6JA 2V79A 4NK6A 1VQ4I 1WJAA 2G0EA 1V0EA 4E7KA 1UD5A 3QFCA 2DERA 3AGPA 3K0LA 2XIGA 3G1OA 3UKGA 1YJ9B 2NNYA 3SUCA 1VQOB 5LEJA 3WY9A 1SD7A 2VB6A 1HF2A 1JKQC 1ETYA 5DDGA 1ZQ3P 2LOOA 3NE5B 2QZAA 2B0RA 1SMTA 1HSTA 3QU3A 5M3MJ 4OMZA 3VPRA 3J80Z 1QZEA 4OINF 3BH4A 3H1CA 4KA4A 1Q1VA 2X4HA 1IJEA 4FX4A 3OEEA 4NC7A 1S72B 1TQIA 2GIZA 2NXNB 2D3NA 4UNOA 3KP7A 1J9IA 4G9YA 1AU7A 2RREA 4RGRA 3HRTA 2IA0A 4W97A 1F5TA 3QFRA 1FNMA 5B1AH 2O7OA 3T0YA 3ZXSA 1QFYA 2IGOA 4I76A 4KNYA 1GAQA 3GFMA 2VBZA 1X1BA 1AWCA 3GEZA 3NEUA 3W2AA 1I8DA 2KDOA 2BV6A 1EFRA 1EV7A 5EMNA 4YZAA 1E62A 4EGYA 2IGMA 3RIQA 1VQ8B 3FKIJ 1VQKI 6PAXA 2V7QA 4X7CA 4YFNF 2XGCA 1QJVA 5E3LA 1W0KA 4HX7A 2LF8A 2LY9A 4IQ4A 4YIFA 4P6VF 3BC9A 3SFZA 4EMSA 3WTXC 2JJ1A 2JUCA 1S7OA 2Y30A 2XGDA 1N06A 3CF5F 4OOVA 1X58A 1SEUA 1S5LC 2GWRA 3PQKA 1K8AD 3N97A 5HLIA 4C9YA 3K1PA 1VQMI 1U0JA 4RDJA 2Q6LA 3QAHA 3SEJA 3MZYA 2Q6KA 4IZZA 5BPIA 1DBOA 4PSXA 3NB2A 4TV7A 3K4MA 3E6BA 2JVGA 2HNHA 3FHZA 3RYRA 3AGQA 2FNAA 4XMYA 5L3EA 4BQNA 3T53B 4B3GA 1PXZA 2CG4A 2CF4A 2W24A 3MWMA 5DUKA 2OAZA 1FSEA 1H8HA 3U2QA 1LFBA 3GF2A 1YW8A 2MFZA 3WE3A 5GAGJ 1R23A 1MSEC 2R7TA 3EQNA 4W8QA 1P4XA 3QQAA 1TW3A 4ESBA 1UD3A 1OISA 1HF0A 1XC5A 5HOOA 3H94A 3ZP5A 3M4OJ 4YDTA 2GBYA 2VQHA 1LB2A 2HLDA 1NRKA 2VNJA 2XAJA 4FISA 3CC2I 1VQLI 1GVJA 1K78B 4LD5A 4UZFA 3ONUA 2CUEA 3IAS2 4HDVA 4KISA 4L5IA 5IT9Z 3TBIA 2R4GA 1CZFA 2FU4A 1OCTC 1WVRA 1U5TA 4HBLA 2COMA 1WJCA 4XBFA 2JDIA 2KZGA 2P81A 1W1WE 4G1BA 3W5VA 3WBJA 1GQ8A 5DS9A 4MQ9F 4OP7A 5EEGA 2BY3A 4MNUA 1XMXA 2HDNB 4UZEA 4OZZA 4P9FA 3MZ8A 2WYRA 1VQPB 2VODA 3ASTA 3FXLA 2Q2EA 3AKZA 5DM6F 3GTPJ 2HWVA 3NAUA 2F1MA 2E5ZA 4P26A 3ASRA 4JX6A 4I02A 4IF4A 2V7VA 4UB6C 5BOXA 1GLNA 5HS9A 2EZLA 2R7RA 3S17J 2EFGA 4I84A 1R36A 1FOYA 1JUMA 4GDFA 4MYUA 3AG3H 3FXOA 4A5NA 4RD3A 2ZMEC 2AHOA 1NBMA 3DWLE 1IUFA 3HUGB 3R0JA 4YAWA 5L3BA 1VF7A 3EUAA 4Z2YA 1B1BA 2JPBA 2VBVA 1IRFA 1PDNC 2DQRA 5E20A 4DYCA 2DETA 4CHUA 4YFKF 1LEAA 4Z4YA 1TWGJ 4QFMA 1T39A 2FA5A 2XZLA 2ECBA 2W48A 2O1DA 2L4AA 3LQ6A 3GLLA 4EGZA 1FZPB 3F8CA 3COAC 1DPRA 5DM7F 1R71A 2BM6A 3T56B 5IOZA 2E36A 3BG9A 4LG0B 2DW4A 3C2HA 3RYPA 2NAZA 4A3CJ 2XAGA 1D1AA 1BQEA 3HG9A 1OPCA 1ZKGA 3K4BA 3JRBA 4PDKA 4Y9RA 3U6BA 1WJFA 2OZ6A 1BX1A 2VN2A 4FK8A 5A2QK 3WNBA 2O0WA 2VE8A 3QOPA 3WTYC 2E19A 2QVOA 2E1BA 2HFHA 3OR1C 3MKYB 1M1KD 2MBFA 4LK1F 4HF0A 1K78A 1U9OA 1O8HA 2JA5J 1USSA 1NK2P 2EZHA 1F1ZA 4BQAA 4X06A 2HEOA 2W1OA 3V7SA 2HQRA 1W2BB 4MEXF 3A0HC 3S1RJ 4HE6A 3EQOA 4BDZA 1I7PA 2AHQA 4OIOF 5DTDA 3L2WA 2WB1N 3BR2A 3VNVA 2CSOA 4A93J 3PUBA 2CK3A 4G1VA 2K9QA 3WTTC 4HOBA 4TMWA 5KHDA 2O17A 4LIVA 1UD8A 3I4MJ 4RLZA 4MGRA 2VPLA 1BN8A 4XM3A 2F5FA 5JI6A 1QGZA 3OJXA 3CC4I 5DNSA 3ZMDA 1WDTA 4L8JA 1S6LA 3FXMA 2LNBA 4JK1X 1K79A 4KDPA 4BXXJ 3GZNB 1Z21A 5LRSA 3I56B 4JRAC 1B23P 3M8FA 2VIXA 2P5KA 1VNDA 3H0GJ 2I1LA 3DPUA 1HG8A 3RQ4A 1VQ4B 1Q1HA 3OIPA 3MHPA 3O8GA 5F1JA 2CH0A 1TL8A 3HUGA 2KRCA 1QPMA 3DKXA 3J81k 2E35A 1HKTA 1JHFA 2XKOA 4M4SA 2P5VA 3OZVA 4RLFA 2ELKA 3HSEA 2XGXA 3QYEA 2BSAA 5IY5H 1BJZA 3FIWA 3JTGA 4WXDA 2GOMA 3J80K 4F52A 4RD1A 1BMFA 1FPQA 3LSMA 3HHHA 1DGRM 5L3GA 2IA2A 2RAEA 3ABKH 5LHHA 2ZJPF 2D5VA 5GPCA 1O7FA 3M7GA 1MDMA 2CV1A 3B6CA 4BU2A 3B82A 3JSOA 1ZK8A 4BUPA 2OTJI 1F60A 4UAJA 4FASD 2ZNYA 1OOCA 3G4SI 2XV4S 3IC7A 3FJOA 4LC0A 4QVAA 5LGTA 4B48A 4M9SA 1XD7A 1MMSA 3HEFA 2GIVA 1FIAA 2VLAA 3IHUA 2NS0A 4L0ZB 2JRMA 1D8TA 3E6CC 1WKMA 1ETWA 2O9LA 1VQKB 1QH0A 3PFYA 1MNMC 4CUGA 4L9TA 1OYIA 1FBUA 3B02A 3EUHC 4L5EA 2Z6BD 1FRQA 2ME0A 4NQWB 5EF6A 2CFOA 1GJRA 4BDYA 4G6DA 3K10A 1FMWA 5ICFA 2ECCA 1DG1G 3K70D 4P25A 3D26A 1OB5A 1CLWA 4UVCA 4A3LJ 1QHGA 3ASPA 1VQMB 3B6AA 2BM4A 1N8RD 3JRAA 2V7UA 4Z4SA 2QYUA 1V5VA 4FE7A 4GYGA 4HSTA 5TGTA 2ESNA 2JT1A 4KJZA 4YAUA 2MG4A 1D3YA 3M1EA 3K70C 1TT0A 3M9AA 4WCGA 1U8BA 4RCZA 1VQ5I 1N77A 5TY0A 5IYNA 1YLOA 5AONA 2JJ2A 5DV5A 1I50J 4D5CA 5BS6A 1H9TA 4V19K 2DIEA 3RI4A 2E1RA 4HQMA 4OIRF 3FXJA 1YIJI 3BR1A 2NNNA 2MC3A 3HPGA 2YSRA 4YHBA 2QXZA 2L7ZA 5B5EC 3AK5A 3OWTA 1GT0C 1OCZH 2CBXA 3GVLA 2PLFA 2V1DA 3BG7A 3CC2B 1VQLB 1J2XA 3FY3A 3ZMUA 4EM2A 3IH2A 4QUZA 1KONA 1LQ1A 2CS3A 3HJEA 3RQIA 1GHCA 2YUHA 5IT9K 2EJRA 2W25A 2HVRA 1NTCA 4HX8A 4KIGA 3CXCB 5CVUA 1XFOA 2DA2A 1DGWY 2W84A 5E3MA 1USTA 3HTUA 1FOXA 2OU2A 4CYCA 3VB2A 1G3TA 4EQQA 3VR6A 2O5RA 5EZHA 1LFPA 4KUMA 1EH8A 4CCOA 4EM0B 1Y1WJ 3Q0VA 2VQGA 1T95A 2HXIA 3PFIA 1M1EB 1WTHD 4D1QA 3BR3A 4L9VA 1IC8A 3A8IA 4A3IJ 1ZRDA 3P4GA 2P0WA 3IP4B 1ELOA 2A6HF 4N0BA 4Z05A 2CRVA 2M9HA 1T0FA 4YELA 3SZGA 2LG4A 1JGGA 1X3ZB 2DPUA 2VBTA 4IO9F 5B3SH 2C6YA 3W2EA 2JA6J 3S3MA 1CNFA 2X85A 2TCTA 3SEZA 1ZGJA 2PEXA 2X6WA 2NTBA 3ZPPA 3HSRA 5ILSA 2PJPA 4FETA 3OYKA 2VT2A 3I0TA 2WWYA 1N08A 2M0CA 1V0FA 2PYGA 3BZKA 3VWBA 3QOEA 1T08B 2BOLA 4A12A 2QGUA 3FDYA 1K9MD 4CZCA 4P1WA 4RAGA 3KETA 3AL0B 2W57A 1R7JA 3F22A 2HI3A 2KMUA 3RCOA 4BEHA 1RR8C 4XNFA 4N3GA 1TNTA 1E63A 4RPBA 2NSTA 1QG0A 3J81Z 2ZNZA 2QLZA 2L9VA 5AIQA 3NWSA 4PFPA 1P6RA 2L01A 2RNJA 2CC2A 5IYBJ 1MSFC 4UB8C 2EV6A 2K5CA 1ZGWA 5BSYA 5CQEA 4U88A 1KU7A 1FSHA 3ZQ7A 1L3LA 2VNKA 2I8DA 4YIRX 2R7OA 4URRA 2VYQA 2XPUA 3WTUC 4OPWA 3OR2C 1GXQA 2XAUA 4A3EJ 1RETA 2NYXA 3O6BB 4LBZA 2F3LA 2R6HA 2JN9A 1SFKA 2OQRA 2EZKA 3SYTA 2INVA 5J8FA 2X9DA 3HOYJ 3CF2A 4PC6A 5IK2A 1PJRA 1YW9A 2V9KA 5JHUA 5FKKA 2GA2A 5HNHA 3IRQA 2QTLA 3M07A 3OW7A 2XZOA 1PVEA 1GO2A 5FKLA 4DZPA 1KQ5A 2WV1A 1PJ6A 1SKQA 5DCFA 2F43A 3J7AY 2NOJB 4MYTA 3MD2A 1NHCA 4HRIA 3H9JA 4ZYGA 2IRFG 3DPTA 5JR3A 3JRHA 2ZC2A 4QV2A 2L9RA 3L00A 4C2LA 4F7ZA 3B8HA 1MIJA 2P6SA 1QNTA 1JGSA 2DT5A 3ESWB 5HLTA 1OGJA 2VQLA 2ZZQA 2FX0A 3CCEB 1LDKB 2PQ8A 2Y75A 3KP5A 5F4JA 2DLLA 2X0LA 3QPSA 5D5UB 4ZYAA 1FEXA 3PL8A 1Z9CA 5HDNA 2KL4A 1OCCH 3KCCA 5GPAA 1UD6A 3PNYA 4CGZA 3CC4B 2JMWA 5LGNA 4CSWA 2QWWA 2VKDA 3BQYA 3DXJF 1B8IA 2C5BA 5FL7A 4X0CA 2PECA 3S32A 4C30A 2Y0SN 3WU2C 2BXZA 3N90A 3QU6A 5K7ZA 5E8IA 3CCUI 2PMDA 1APLC 1QGYA 2O0VA 1X2MA 3PNVA 5JLWA 1IJWC 2MH9A 1BOAA 2UUZA 1QA6A 3CPWB 2ODLA 1KCCA 4BL0B 4E6KG 2NTQA 3ZZ0A 4OU0A 2IXSA 5IP7J 1C0WA 1OFMA 3GQ8A 1VI0A 4JQFA 1UB9A 2DA4A 1D0YA 4U7BA 1S29A 4RBOA 3Q0UA 2Z33A 2VONA 2XB5A 2A5WA 2Z8GA 2DA7A 1QHHD 2DMNA 2K86A 5JMCB 4XOPA 1BN5A 4HG2A 2KPMA 2XGJA 2OTJB 3CJTB 1NH3A 3RKYA 1VLOA 3PETA 5J6XA 4XN0A 2LC2A 5CJ9A 3S1NJ 2PYHA 1N0VC 3G4SB 3FZVA 1BX0A 1I3QJ 2HU9A 5GADJ 3GFIA 1I5ZA 1RUNA 3PVDA 1IDYA 2M1BA 5H59A 3U6KA 3AVXA 3N6ZA 1IXSB 3O3KA 3D5RC 4BYYA 2KKOA 2PN6A 2HZDA 4XK4A 1WH5A 2XUBA 5GV8A 3W2IA 2STWA 1WJBA 1ETOA 3PSFA 1YRNA 3VOEA 4ETSA 1E43A 2PFBA 3GVJA 3ZZTA 1JTYA 2BHYA 4KICA 1QGPA 3GMEA 1G59A 1RC9A 1W4MA 2NTPA 2K4JA 5C3EJ 4B3FX 3WNCA 2DTZA 3CMEB 4U87A 1OR7C 1SFEA 1N25A 4IRHA 2H94A 4Z06A 2KRFA 4QIWN 1S8NA 2ZKZA 3SKBA 3DKYA 4LJZF 3LNQA 1RR7A 3AL0C 1R5OA 3R6JA 5B6IA 1JJ2B 4OIPF 4RGSA 1TP4A 2ZFUA 3KYCB 4P9UA 1BPLA 2EA2A 1A5JA 3OMYA 3JR9A 4MR0A 2BVLA 3EUKL 2VXDA 4JMQA 1MH4A 1WPKA 3PIOF 1N78A 4UZUA 2RC6A 4E7JA 1YI2I 1F36A 3ASSA 3HOTA 1BI0A 2F4MB 3FXQA 4AVZA 4R8HA 2XB0X 1X1AA 4BXUA 3ZQCA 5EG0A 2BY0A 3I4PA 2E2JJ 4UUVA 4ZGNB 1VQ5B 2NSPA 4CA0A 1FBQA 2DA3A 4L0YB 4KIFA 4WZLA 2BY2A 1X4OA 1W9XA 3TMOA 1YIJB 3LSRA 1A36A 4BH9A 2JA8J 2IS4A 4XSXF 4MO7A 1IHMA 4ANJA 2WB1A 3L1PA 3R4KA 1V3FA 3D0SA 1JKPC 2GJRA 1KK2A 4CCJA 4JX5A 2FMYA 2RVCA 1FNCA 4GO1A 4PSWA 4Y9UA 4ZZLA 2QA4I 1HLVA 1R5ID 3H3VK 3QSYA 1O88A 2FNPA 3CLQA 3DTIA 2OZUA 4B09A 3ABMH 4Y4RA 2OCCH 4CXFA 4HAMA 3M8JA 3OY9A 1T6YA 3E1SA 4HNUA 4BXFA 2BPOA 4QSHA 5LLQA 1FTTA 4BGDA 2CQ7A 4RM0A 2XNDA 4O3MA 1PP8F 1TLHB 3RSNA 1S7EA 2GOXB 2ZBUA 5M3FJ 3F9KA 2EPFA 4X1EA 2L9NA 2CUFA 1L1IA 4IHTA 2L54A 5CVRA 2V4JC 4YC5A 3S2WA 3HPHA 4A5MA 4ABZA 1FDRA 2DK8A 1UAAA 1O8KA 1G7CA 1ITYA 2A5YB 1YJWI 1Q81D 2KP6A 2EFQA 1K28D 2GAUA 4A3GJ 3LQQA 2Z1DA 4M6XA 1WSRA 2X1CA 3V4GA 1ZTRA 2M45A 1QUFA 1ZM2A 4P3IA 1AA7A 5KW9A 5F64A 4A0YA 2JSPA 3IKTA 3SZPA 5IYDJ 3OIOA 2VNHA 1P92A 2ETHA 3L2UA 2NT9A 3J81K 2V1XA 1PKVA 1X2NA 2QGGA 4DGWB 5BNGA 2BE5F 1BR1A 4HLXA 4FT8A 2OK7A 1I27A 3R0AA 3KL9A 3V8JA 5JLXA 2ZJQF 2ACJA 4ACAA 3SFIA 1LE8B 1JTAA 4MXNA 4FHTA 4Q47A 1MRZA 2KISA 2X1DA 5EDNA 3ZC3A 4OMYA 1FIPA 3FKJA 3WHBA 1J0RA 1XE1A 1O8FA 1WOPA 2AQEA 4A3MJ 4OJ6A 2GZWA 1FJLA 3L2RA 1BOBA 2K9NA 2ZL7A 4M1KA 1QA1A 2QSFX 4XL9A 1BR2A 1R6RA 2Z3YA 1HDDC 2E7WA 4G8XA 3ZCOA 3GTGJ 3W2GA 2INUA 5BPDA 4ZCMA 4RD0A 4EJVA 1POGA 1W36C 3TW7A 3G6EI 1UG0A 3I3LA 2BEOA 1OGIA 3L7WA 1YS7A 4HW0A 2EFNA 2QQAA 3OL3A 3P27A 5HKKA 2NZMA 1FNNA 5K7FA 5EGOB 1R00A 3K9TA 2CO5A 4ZV4A 3DQVC 3KP6A 3I71A 4XKVA 4FCYA 3A01B 5HLHA 4HZFA 4CQJA 2IOUG 1Y1VJ 1O7LA 4DZJA 2P4WA 3A02A 2ZMEB 3DTEA 5CPRB 1BI3A 4D7MA 1T8IA 5TISC 1HW2A 1CQXA 2Q6IA 1Z1DA 1U2RA 3V8KA 1PLUA 2VASA 3M1CA 4H0EA 3ASNH 4UVBA 5D8KB 4UY8I 3C2GA 1K5CA 5FD5A 2VOOA 2HS5A 1RWRA 1RI7A 2RC4A 4AYBN 5HNFA 1Y8QB 3PA2A 5A8AA 4CH7A 4PJJA 1EFCA 2XTYA 1OYWA 2DFHA 5E3NA 1IN4A 2NVUB 5LHGA 4XLAA 1H8AC 3VMFA 3HYIA 4EJTA 2VBKA 1UHMA 3OYNA 2UXXA 4L9NA 5FB2A 3CP2A 4Z4RA 3CCUB 2NS7A 1DP7P 1J9ZA 5E1XA 1ZR4A 2EB7A 4DNTB 2L7MP 1ZG3A 2ZSIB 3TQNA 2KQRA 4XOTA 2IW5A 1ZLKA 2NVTJ 3BY2A 1QA3A 1IRGA 4XLNF 4ZYHA 3NARA 5TV2A 1JE8A 3A3GA 3HAGA 1HKQA 3OYMA 2TRTA 1PYVA 3LA2A 2F5DA 3BR5A 3GTLJ 2V4DA 3ZBTA 3DU1X 1G2HA 5C4JJ 3ERED 2QN6A 5TR9A 4KMFA 1QO0D 1TNSA 3KZIC 1TC3C 2NS8A 3BTLA 1H42A 1SM4A 1VHOA 3KEWA 3C1DA 1Z67A 2WY8Q 4QLCU 1ZREA 3BR0A 3FK7A 2O04A 3HKZN 3J7AO 3HZJA 3FMSA 4OOIA 3OYGA 3GTOJ 3BDDA 1FT9A 2ZZEA 4XRMA 1A6IA 2QYOA 2V7WA 1KA8A 1ENHA 1MBEA 4W1UA 4NUBA 4RB3C 5FFZA 4I0BA 2IS6A 3IKVA 3WU1B 3JRCA 5J4YA 1U8RA 1RIOH 4XORA 2DFIA 2VPRA 4E7HA 2HZTA 2HPIA 4I6ZA 3F3XA 2K9SA 2VQCA 3LQRA 2HOSA 4KFCA 5DSZA 4YZXA 1N07A 2LDUA 3BG5A 4AIHA 4IHWA 5FGMA 3GTMJ 4X07A 2IPQX 4DQLA 2WADA 1AIPA 3FXUA 4LIUA 4WZKA 1LM1A 3LA7A 3VMVA 3F8FA 1E64A 4MTDA 4MLOA 4OJOA 1FP2A 2E1MC 4IEJA 2QE7A 4XLPF 1JKRC 4TMTA 1Q7YD 1WGXA 4EW9A 1Z7UA 3OYEA 3G3ZA 5IP6A 2EH3A 2LH9A 2R7DA 1ZRCA 4BAYA 2NVQJ 1K6YA 4HPQA 2OUMA 4M3FA 1JRGA 4BHBA 1IG7A 2QCOA 1NB0A 2E71A 4PJLA 1T2KA 1T98A 3ECHA 3IAM2 3OS1A 3DKWA 2A3SA 2KZVA 5JVGF 1DPUA 3ONYA 2FOKA 1EZGA 2DYRH 2JWTA 4V2FA 3Q3AA 5J47A 1YI2B 2DMUA 1PJ5A 1FLIA 3QODA 3HGGA 5M5XJ 2RGVA 3K4CA 1R1VA 2KIUA 4RM2A 2YPRA 2ZFWA 3OYDA 3ZRGA 3JU4A 2IGKA 2DN0A 4XN3A 5E1ZB 5B66C 1MMNA 3KLOA 5FRMA 1E1RA 3LAJA 1DDNA 2K3PA 1E3ZA 2XT2A 1B9MA 1D1CA 1DUXC 4C0SA 2ESHA 1IRZA 2QKLB 4M2LA 1BW5A 2DYSH 3GO5A 1NHAA 3I4NJ 4AF7A 5F6FA 5FLXK 4Z6YA 3MMYB 4QWQA 4KITB 2EK5A 4LGWA 2EWNA 2XNJA 2QA4B 1FBSA 5H20A 1IDKA 2GK7A 1KD1D 2E1NA 2NRAC 3S16J 2VJJA 4B4CA 1QQ1A 4Y52J 2YWFA 1WJ5A 1YLFA 2L02A 2LREA 3H36A 1KK1A 2C2WA 2ZTNA 4KKTA 4YZQA 1S7AA 2Y0SA 4UVAA 4ZC3A 4ASUA 1D1NA 2BF4A 2C5HA 2ZXWH 3V7AA 3LOCA 4U49A 4E4HA 2WBMA 3C2BA 3LSGA 5DD8A 4XQFA 1EA0A 3LMWA 4F7DA 1TWCJ 4WX9A 1LPQA 3OZUA 1KU2A 5KSWB 3D1NI 1TQPA 4XKWA 3LSKA 1PE9A 1N05A 3EYIA 3BCAA 3WHCA 2QX3A 1QZYA 2K02A 3OYFA 2EILH 2IP2A 2CYYA 1YJWB 2BGIA 5D4RA 4U0WA 1R9TJ 2QQ9A 1A31A 5E6TA 3Q5FA 4IHVA 1IDJA 2AS5F 3DFGA 2ISYA 1R49A 2XASA 1G3YA 3FMRA 4N9IA 1WQ2A 2K85A 5E18F 4ENJA 3W6VA 1G3WA 5FO1A 5D5XB 2WAQN 1JJ6C 3B78A 5HDGA 1XGNA 4UV9A 2QQ8A 2P3MA 1XN7A 3I5UA 1GV5A 4RAZA 1YYVA 4NNJA 3RDIA 3SQVA 2I10A 1R1TA 3OYBA 1TQMA 4O6JA 5IYWA 3BPXA 5AN9A 1R58A 4II3A 1XSVA 3RZDJ 3RY8A 1O8IA 1O8DA 4OPSA 1JT0A 1OGOX 1YX3A 1R5GA 5FKOA 3L2QA 3S8PA 1O4XA 3VNUA 2OV7A 3H3ZA 4TN1A 3OYLA 3I64A 1JNYA 5L46A 1U5TC 3V42A 3U21A 3S1QJ 1IW7F 4BJ6C 4IOCF 3OYCA 2XRNA 1AOYA 3IL2A 2JK3A 2K9MA 3F8BA 1MBHA 3EYYA 3T8TA 4HEA2 2DY1A 3CCEI 3PO2J 3VYTB 2VBMA 1YG2A 3G6EB 4XRSG 2O6WA 4ZYEA 2R3SA 2JA7J 1TYXA 4Q48A 3JURA 2LZJA 4E70A 3RPUA 1OHHA 2ID6A 2ELHA 2OK8A 3BJ6A 4HLYA 4RPDA 2Q6OA 2M8EA 4JP0A 4A6DA 1VF9A 2ZITA 3OSFA 1MJ9A 1XG1A 2O0YA 3DCFA 4PGOA 3MMPA 1QBJA 2Z2SB 3H9NA 1BHEA 2LK2A 1E2XA 2K40A 3EUHA 4WK8F 2R5ZB 4PGGA 1QRCA 4XIDA 3F23A 1HC8A 2CFXA 5HDKA 4PJNA 4E7IA 3JRDA 3GFJA 1G4DA 3MCZA 4A3BJ 2JSCA 1IGNA 4X7DA 4HSRA 3REOA 2ZJ2A 2NPFA 3ZSCA 4KT5C 4OOSA 4IPAA 1FY7A 1G7RA 3CCSI 1TT5B 1JB9A 3QFTA 4M73A 2X0KA 3CTAA 4J00A 4BKXA 1DDIA 2BW3B 2FMLA 3O2PE 3HBLA 4G7HF 2XOKA 3OZWA 2CJJA 3W2HA 1YQAA 4C3IJ 3M3YJ 1O8GA 1LNWA 2QKMB 1ETXA 2IEKA 4P5OA 1WP6A 1PP7U 3VMWA 3RPUD 3BH6B 2IVMA 2OYNA 1SAUA 1SVLA 1ERDA 1OCRH 1EH7A 2VXZA 3C18A 3ZMZA 3DEWA 5EYRA 5ERIA 4LG0A 5CQGA 2P7CB 4DNRB 2MW8A 4XONA 5KNLA 1GV2A 1Z91A 3WTSC 2HDWA 2KHMA 4XRFA 4M53A 5EEAA 3WTZA 3PM1A 3QRFF 1KZHA 3KYLA 4D9JA 3TO7A 4M9ZA 1QUEA 3ZQIA 1W87A 2PG4A 2DODA 1Z05A 1YHQI 2JIZA 4DBRA 2A68F 3L2CA 1MNDA 3HHGA 1FYLA 3ZQFA 5F1RA 3HTSB 3CMEI 2LY1A 2HXOA 1N75A 5F08A 3U1DA 4F93B 3HRUA 2GQFA 2D1HA 1J09A 4HIZA 3FHNA 2VFQA 1R5NA 4BE2A 2X8KA 4FN5A 3E5UA 2ZL5A 1FTZA 3GX4X 4I0AA 4Y7CA 4IXAA 2H1LA 1DP3A 1F4KA 3JQPA 2CQNA 3FF5A 3CPXA 2UV1A 2ZCWA 2ZL6A 1Y0NA 3PQJA 4G5GA 1ON2A 1FNBA 4OPOA 3A1YA 4IL6C 3WG7H 5IOYA 2R7VA 1E79A 1LLWA 3GBGA 4D0PA 2Z16A 1IO2A 3CP8A 3BCDA 5IYRA 2FE3A 5B1BH 1EP2B 1Z3XA 2COBA 3KE2A 4HDUA 4GRIA 5EEHA 4DYRA 4R79A 1I6XA 3DP7A 5CLSA 2WR8A 1SAXA 3CCYA 3RKQA 1QFJA 2BM7A 5TRDA 3E20A 1HBXG 5CYVA 2NT6A 1COWA 4V2GA 1BJAA 4G7OF 1IF1A 1MH3A 2E34A 2H09A 2H6BA 2HVSA 1BA5A 1F43A 4DQKA 4ACBA 2B63J 2BW3A 4YIIA 1O3RA 1SANA 1QRBA 3ZGKA 1TWFJ 1E3OC 1TBXA 4J0QA 4R71A 2GJPA 3O8HA 5L3CA 4H4KC 4W8SA 3B4NA 1MNEA 3KZYA 4NC8A 2PLYA 3P26A 1O8MA 1TYVA 2DU9A 5IP9J 3JAMZ 2YU3A 1WWXA 5J3OA 2LF7A 4BHCA 4WXCA 4J01A 5J1RA 1TYUA 2O3FA 4TKOB 2LKPA 3MEXA 2LLKA 4KYWA 1D2EA 4FX0A 3ZIAA 2QF7A 2R92J 4TMZA 2Y0MA 3WWGA 2XPWA 2GPJA 3V8LA 1OLTA 4C3HJ 3HRMA 1MKMA 2DPDA 4ZDLA 4RM3A 2HR3A 2WTEA 2A6EF 1EJ9A 3PO3J 3KIOA 3MFKA 2HTSA 1NG7A 3JTHA 1MGTA 4NQWA 3KZZA 1XQBA 3S93A 3BJAA 2P8TA 2MC4A 1LKXA 2VT3A 4C2MJ 1ZH5A 3H9GA 5JBQA 2G7UA 4XSZF 4LG3A 3S3OA 2F6CA 4A3DJ 3OE7A 2RN7A 2E7XA 3P9CA 2VL8A 3SZEA 2NVXJ 2G0YA 4IRGA 3I54A 4M3EA 2VE9A 1PUEE 3E7LA 2DDBA 3LSTA 2EFPA 2GA1A 4CCMA 2WV0A 4LOCA 3DEUA 3HKZA 4QPOA 1ACIA 4HX4A 5DUIA 1YFHA 2LMDA 2LYCA 1KTVA 2BHZA 2CW8A 3PUMA 2V7XA 3DU5A 2X3UA 3K1MA 3NWTA 5KK1A 4LMYA 2FUG2 2MA3A 3CUQB 4DJAA 2OF7A 4H9GA 2BGCA 1LDDA 3K4JA 3ZZUA 1B9NA 4AC9A 2A6TA 2V6CA 3HSFA 3A1PA 3BCFA 3WTVC 5F04A 2OQGA 4A2UA 2XDVA 2CQXA 2CV2A 4HF2A 2KVOA 3LNNA 2VC1A 4X0GA 3CC7I 1WORA 1MBFA 3GQAA 4AIJA 2HVQA 5E17F 3I55B 4II2A 4M9XA 3DBRB 4XICA 4IQJA 2IA1A 1ZELA 3KEOA 4UUSB 3GTKJ 1MMGA 2M30A 1UD4A 4RDLA 1DBGA 5THXA 2KIMA 2XROA 2EINH 3AG4H 4PJMA 2YS9A 2X1EA 3BROA 3S15J 2R7SA 3DDYA 2KJCA 2M7BA 3E5XA 1T5EA 1H8EA 4RB0A 1W5SA 3HOSA 1U9NA 2YUSA 1RPWA 1G3SA 9ANTA 2XAFA 2QBYB 2F5VA 1LJ9A 3GYHX 4YCQA 4B3AA 5FFXA 1XCVA 1IRXA 2OCEA 1HXDA 4LK0F 5FRNA 2BX6A 3I9V2 4RD2A 2M34A 1QQIA 4B47A 2MD0A 5H5JA 1MD0A 1SD6A 1T6ZA 2IAIA 1NDHA 5DS0A 3K7AJ 2CQKA 3SYJA
chains in the Genus database with same CATH topology
2VBEA 4DGWB 1BR1A 4F55A 3TBIA 2R4GA 1CZFA 1H80A 5AMVA 2L9SA 3CMMA 2JDIA 1WJCA 1GQ8A 1JTAA 4OWRB 4KKUA 4MXNA 3VSTA 4RMNA 2X1DA 2UWMA 4OJ6A 3FKJA 2WAEA 2VJ5A 1O8FA 2UVEA 2AQEA 3GQ9A 4OZZA 4DK0A 3L2RA 2ELJA 3AKZA 1BOBA 4YEJA 2F1MA 2E5ZA 4XL9A 1BR2A 1R6RA 2DCEA 4E7ZA 3ZCOA 3GVKA 4XD7A 2INUA 4BEHB 2HPMA 2XSJC 1GLNA 2R7RA 4I84A 1W36C 1X1CA 3BLYA 1UG0A 3I3LA 3AFHA 1NBMA 3DWLE 4N4NB 1KCDA 1WFXA 3HUGB 3OL3A 3DPLC 5HKKA 1VF7A 2IQ7A 2NZMA 3EUAA 3MKWB 4U4BA 1MMAA 1OB0A 1E0EA 4CCKA 3DQVC 4XKVA 1WJDA 2CMPA 4XLFA 1QU3A 3CJRB 2ZTGA 2EWEA 3DTEA 2CW7A 5CPRB 5FROA 1PLUA 3W2VA 2VASA 4YZ0A 2XZLA 3M1CA 2O1DA 1K5CA 3C2GA 2R7UA 1RWRA 5HNFA 3ZQQA 5LFAA 4CH7A 4PJJA 3T56B 3FPPA 3SDBA 4BACA 4OJPA 4JOMA 3C2HA 2W4SA 4AYBA 4G6IA 3WQZA 1D1AA 4Y3OA 3QYBA 3HG9A 3K4BA 3LFUA 3D5SC 4XLAA 2BSPA 3CESA 2VBKA 2DXIA 1WJFA 3OYNA 3HC7A 3CP2A 4OAYA 2O0WA 1D0ZA 5KCMA 5HVQC 2JA2A 2E1BA 4LITA 4DNTB 3OR1C 3MKYB 2ZSIB 2KQRA 4XOTA 1O8EA 3SEQA 4B3XA 1O8HA 2VKHA 4ZDOA 1NG6A 3A3GA 3VDXA 3HAGA 2F4IA 2M0MA 3OYMA 2V4DA 1PYVA 4Z03A 1O8LA 2W1OA 1SKYB 2W82A 3D5LA 1D0XA 3GRHA 4HNTA 3EQOA 4BDZA 4F91B 3KEWA 1V5GA 4OJ5A 1W0JA 4W8TA 3L2WA 2WY8Q 2O04A 3PUBA 4BE1A 2CK3A 4Z1MA 5KHDA 4G7WA 2O17A 3OYGA 4LIVA 1UD8A 2ZZEA 2VPLA 1BN8A 4ITVA 4XM3A 3A2KA 1P9QC 4CCLA 4NUBA 4L8JA 3VYUB 2MABA 2V26A 3N05A 2IS6A 1Z21A 2CUZA 2V7FA 4XORA 2V6EA 2VIXA 4E7HA 2HPIA 2VQCA 1HG8A 3DPUA 3RQ4A 4YZXA 3PJRA 3OIPA 2KRHA 2WADA 3H5AA 2CH0A 4LIUA 3VMVA 2WJYA 2KRCA 3DKXA 4BJTA 4OJOA 2LRDA 4MLOA 2E1MC 4KT6A 3OYAA 2QE7A 4G6TB 4RLFA 4EW9A 3OYEA 3QYEA 4XR6A 3G05A 2LH9A 1WPCA 1BLIA 2GOMA 1K6YA 4AU7A 4HPQA 2OUMA 4F52A 3TL4X 2IS1A 1BMFA 1E1QA 3LSMA 1JRGA 3OIQA 1DGRM 1T0FC 2CV1A 4PJLA 2E1MB 3FBIB 3K4LA 3KRGA 1IB4A 2X3HA 3VSLA 1UD2A 4BU2A 4DBQA 4KISA 3IAM2 3OS1A 2WPDA 2KZVA 4TSFA 1OFLA 2CUJA 4RLQA 4BUPA 2XC7A 4FASD 4ZTFA 3UR3C 1OOCA 3QODA 2L5QA 3BC8A 5CKTA 2X6YA 3K4CA 4B48A 2DT7B 2JVHA 4RM2A 3OYDA 3ZRGA 3JU4A 2IGKA 4XN3A 5FRMA 1E3ZA 1MMNA 1E1RA 4XKCA 2K3PA 2VJIA 2VLAA 1D1CA 1VLYA 2QKLB 4DK1A 3ZPNA 2WA0A 3PFYA 3FKSA 1W36D 3MMYB 4CUGA 3HL2A 4KITB 2PMZA 3EUHC 5LD2C 2Z6BD 4ZJZA 4PFOA 2X53S 4NQWB 1IDKA 3IUOA 4KKSA 2GK7A 2CFOA 2W7NA 2UVFA 4BDYA 2M4GA 2VJJA 3K10A 1FMWA 1WJ5A 2LREA 2WZPP 4YZQA 4KKTA 2ZTNA 3K70D 4C2TA 1Y56A 2Y0SA 1QHGA 3DLAA 4ZC3A 3OAAA 3MKZA 2W00A 4OAZA 4ASUA 4U49A 4E4HA 1VZ0A 2WBMA 3LSGA 4XQFA 3E0JB 4HSTA 5TGTA 3B90A 3LMWA 1MABA 3PNTA 4KJZA 3UNGC 3VYSB 4F3QA 3H5NA 4XKWA 1TT0A 3LSKA 3K70C 1KZLA 2XZPA 1EE6A 1N77A 2K9LA 3QYFA 1PE9A 5C1EA 3BCAA 2QX3A 2JJ2A 3OYFA 2RNGA 2DIEA 1VJSA 4IX7A 2IS2A 3HPGA 1HA8A 1TZLA 2QXZA 5CDFA 1AIRA 2DOAA 3OWTA 1IDJA 3GVLA 2M3AA 3BG7A 1X19A 3OEHA 3FY3A 2X6XA 1KONA 1MMDA 2CS3A 2PJRB 2GJKA 3OPOA 4YRVA 2HVRA 4NNJA 3S3NA 2WAQA 1BR4A 1DGWY 2MYSA 2LBFB 4P22A 4BQOA 3OYBA 3VR6A 2O5RA 1LFPA 4II3A 5JHFA 2KLOA 4CCOA 2VQGA 1O8IA 1T95A 1O8DA 3CZ6A 1OGOX 1WTHD 4D1QA 1YX3A 2V31A 3L2QA 3S8PA 2P0WA 2OV7A 3IP4B 3OYLA 4Z05A 4IKFA 3V42A 3DTKA 4YELA 3K6GA 3SZGA 2LG4A 3U21A 4BJ6C 3OYCA 3H0DA 1XG2A 3S3MA 1RU4A 2K9MA 2X85A 3SEZA 3ZPPA 2X6WA 3PSIA 4HEA2 1HVXA 2NTBA 3VYTB 4XLHA 2VBMA 4FETA 4Y33A 3OYKA 2R7XA 1V0FA 2PYGA 3VWBA 3HXLA 3QOEA 3OS0A 2BOLA 3CJQB 3JURA 3VSKA 2LZJA 1WJEA 3A3BA 3FDYA 1OHHA 1O8JA 4CZCA 3KX2A 1MW7A 4P1WA 3AL0B 3RCOA 2KMUA 2WY7Q 4BEHA 3LSIA 2Q2EB 4XNFA 2QY1A 1Z7LA 2WJVA 3K4KA 1S9HA 3LL7A 1WMRA 2Z2SB 1BHEA 3H9QA 3A35A 2M7AA 2Q1ZB 3NWSA 4PFPA 4PJNA 2K5CA 4E7IA 5CQEA 1FMVA 4URRA 4HSRA 2I8DA 3ZSCA 2R7OA 2GK6A 3OR2C 2XF5A 2XAUA 3BCBA 3OYJA 1KTWA 2M4KA 3OFNA 1FX0A 1SFKA 3SYTA 4J00A 2INVA 2M5SA 2BW3B 2XOKA 5IK2A 3CF2A 4BJ5C 4HWVA 4OZYA 1PJRA 4CCNA 2V9KA 1V5FA 1HZEA 1O8GA 5HNHA 3OW7A 2QKMB 4P5OA 2W6IA 1WP6A 2XZOA 4TT3A 3VMWA 3RPUD 1SAUA 2F43A 3J7AY 2E60A 2NOJB 1ERDA 1E3XA 4YXWA 3MD2A 1NHCA 4HRIA 3H9JA 3W2WA 2VXZA 1V5EA 2VJ4A 2PJRA 4DNRB 5CQGA 3DPTA 4XONA 5KNLA 3VSVA 2HDWA 2JUGA 1LVKA 4PMHA 4C2LA 2KHMA 3KEYA 4ZDPA 4B44A 1OGMX 2LBFA 3KYLA 5HLTA 2VQLA 2ZZQA 4D9JA 1LDKB 4EATA 2R7WA 5C1CA 1X0CA 4ZYAA 3DEEA 3PL8A 2D3LA 2JIZA 2BVMA 3VYRB 1RMGA 4DBRA 1D1BA 3W3CA 2KL4A 3B8YA 1MNDA 2WSSA 1UD6A 3PNYA 4GQNA 2WAFA 4CSWA 2CV0A 2VKDA 1KMHA 5FL7A 2PECA 2LY1A 1N75A 3S32A 4F93B 1DQUA 4C30A 4PK4A 1J09A 4HIZA 2E5NA 3FHNA 4E7SA 2HQAA 4BE2A 2X8KA 2LY2A 4BS9A 2O0VA 1DP3A 3GQ7A 4XKBA 4W8RA 3PNVA 3LMMA 2UV1A 2UUZA 2ODLA 4N4OB 1KCCA 3OYIA 2X51A 3A1YA 4BL0B 4E6KG 2R7VA 1E79A 2NTQA 3GBGA 2Z16A 4FXUA 3CP8A 2IXSA 3BCDA 1OFMA 3GQ8A 3ZR8X 4E7LA 1Z3XA 4JQFA 3ONQA 1D0YA 4U7BA 4GRIA 4R79A 4BE0A 3T9GA 1IA5A 4DIQA 2A5WA 2Z8GA 4B43A 1QHHD 1UELB 3OOUA 3OS2A 4NK8A 2IGNA 4XOPA 4HG2A 2KPMA 2R9VA 2XGJA 2ZZGA 4F92B 2NT6A 3G2BA 2LC2A 4XN0A 1COWA 2PYHA 1I18A 2L7KA 2HVSA 2R7QA 3DU6A 2HU9A 3K4NA 2BW3A 1Y6IA 4C2UA 2AQFA 4DOZA 3LSHA 3ZGKA 3D5RC 1YE9A 4XLCA 2GJPA 2HZDA 1G8XA 3A4CA 2L2OA 2W6JA 4H4KC 1WJBA 4NK6A 1WJAA 1V0EA 2XF6A 3PSFA 4E7KA 4W8SA 3B4NA 1MNEA 1E43A 1UD5A 4NC8A 3GVJA 1O8MA 3SUCA 3UW0A 1G59A 2NTPA 2ZZFA 1EA3A 4B3FX 4J01A 5DN6A 4U87A 1OR7C 4TKOB 1X1DA 4Z06A 3VSUA 2VB6A 4E0FA 3ZIAA 1QCXA 2LOOA 3NE5B 3DKYA 3H35A 3L2VA 3AL0C 3WWGA 3FBNB 1YX5A 1OLTA 2ZFUA 4BQQA 3BH4A 3H5RA 4ZDLA 1BPLA 4RM3A 3EPZA 3OMYA 4QPQA 4MR0A 2BVLA 3EUKL 2VXDA 3OEEA 4NC7A 4JMQA 1N78A 1NG7A 2D3NA 4UZUA 4E7JA 3S93A 3OYHA 3HOTA 4PUSA 4AVZA 2RREA 1X1AA 2MC4A 1LKXA 2RQQA 3ZXSA 2NSPA 3H9GA 2XF7A 3S3OA 4LG3A 2IGOA 2F6CA 4CA0A 3OE7A 1X4PA 3RTRA 1X1BA 3W2AA 2VL8A 1I8DA 1X4OA 2ZXHA 2KDOA 1W9XA 3TMOA 1EFRA 4YZAA 2IS4A 2IGMA 4CCMA 4ANJA 2WB1A 3HKZA 4QPOA 2GJRA 2V7QA 4CCJA 2NSTA 2LYCA 4PSWA 1QJVA 1W0KA 2CW8A 3DU5A 4IQ4A 1O88A 3NWTA 1VBLA 3DTIA 3BC9A 2FUG2 4Y4RA 4DJAA 2JJ1A 2OC6A 3K4JA 3M8JA 3T51B 2V1NA 3OY9A 2A6TA 3E1SA 4HNUA 3BCFA 4BXFA 2XDVA 4C9YA 1U0JA 2DJIA 2CV2A 4BGDA 2KVOA 2XNDA 3LNNA 4IZZA 1JI8A 3RSNA 4X0GA 2GOXB 3GQBA 1DBOA 4PSXA 4OJLA 3GQAA 3F9KA 2HVQA 3OOCA 3K4MA 2L9NA 2JVGA 2HNHA 4II2A 4IQJA 1Z3YA 4XMYA 1ZELA 1DBGA 2V4JC 1MMGA 3HPHA 4BQNA 1UD4A 3T53B 4B3GA 1PXZA 2ZSHB 1H8HA 4PJMA 4XLEA 1UAAA 1O8KA 2MFZA 2X1EA 3BG6A 4G7XA 3DDYA 2R7SA 2R7TA 3EQNA 4W8QA 2KP6A 2M7BA 1K28D 1UD3A 1T5EA 1H8EA 5HOOA 3OL4A 4ZTJA 3H94A 2Z1DA 3HOSA 2VQHA 2X1CA 2DT6A 2HLDA 1NRKA 1AA7A 2F5VA 2JSPA 1IRXA 5FRNA 3I9V2 4B47A 2MD0A 2ZXIA 3L2UA 2NT9A 3IAS2 1PKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBE A;  3VMV A;  1RU4 A;  2X85 A;  3ZPP A;  2X6W A;  1CZF A;  2NT6 A;  1H80 A;  2NTB A;  4OJO A;  4XN0 A;  4XLH A;  2PYH A;  2VBM A;  5AMV A;  1GQ8 A;  1JTA A;  4EW9 A;  2PYG A;  4MXN A;  3VST A;  4XR6 A;  4OJ6 A;  3JUR A;  1JRG A;  2UVE A;  1O8F A;  4OZZ A;  3GQ9 A;  1O8J A;  4XLC A;  1IB4 A;  3KRG A;  4NK6 A;  2X3H A;  4YEJ A;  2QY1 A;  4W8S A;  4XL9 A;  4XNF A;  3B4N A;  2INU A;  1O8M A;  1OFL A;  3SUC A;  3UW0 A;  1WMR A;  1BHE A;  2NTP A;  1OOC A;  4I84 A;  2X6Y A;  4Z06 A;  3VSU A;  1QCX A;  4XN3 A;  4URR A;  1KCD A;  3ZSC A;  3WWG A;  2VJI A;  2NZM A;  2IQ7 A;  4U4B A;  1KTW A;  4XKV A;  2INV A;  4MR0 A;  4XLF A;  4HWV A;  4OZY A;  2EWE A;  1O8G A;  1PLU A;  4AVZ A;  3VMW A;  1IDK A;  4YZ0 A;  2O1D A;  1K5C A;  2NSP A;  2UVF A;  2VJJ A;  1RWR A;  1NHC A;  4YZQ A;  4XON A;  4OJP A;  3VSV A;  4PMH A;  4YZA A;  4C2L A;  4XLA A;  4U49 A;  1OGM X;  2BSP A;  2VBK A;  4XQF A;  2NST A;  3B90 A;  1QJV A;  3LMW A;  2O0W A;  5C1C A;  1O88 A;  1VBL A;  1X0C A;  4XKW A;  1PE9 A;  1EE6 A;  4XOT A;  5C1E A;  1RMG A;  1O8E A;  2QX3 A;  1O8H A;  3B8Y A;  2PEC A;  4Z03 A;  2QXZ A;  1O8L A;  1AIR A;  1IDJ A;  3GRH A;  3EQO A;  1DBO A;  4OJL A;  4W8T A;  3GQA A;  3FY3 A;  4OJ5 A;  2X6X A;  2O04 A;  4XMY A;  1DBG A;  2O0V A;  3GQ7 A;  1PXZ A;  4W8R A;  2O17 A;  4XLE A;  1O8K A;  2ODL A;  1BN8 A;  4XM3 A;  1KCC A;  3EQN A;  2NTQ A;  4W8Q A;  3GQ8 A;  1OFM A;  1O8I A;  1O8D A;  1OGO X;  4XOR A;  3T9G A;  4Z05 A;  1HG8 A;  4YEL A;  1IA5 A;  4YZX A;  2Z8G A;  2NT9 A;  1XG2 A;  4NK8 A;  4XOP A; 
#chains in the Genus database with same CATH topology
 3X2Q H;  2VBE A;  3GIR A;  2WC2 A;  5E8G A;  1IV8 A;  4EH1 A;  1H80 A;  2QDX A;  1HW5 A;  3CMM A;  3JRF A;  1N0U A;  2LVS A;  3TO6 A;  2QSG X;  2EIK H;  3RPQ A;  4KKU A;  3LYC A;  3E3V A;  4RMN A;  3RIR A;  4ZCL A;  3VST A;  3F0C A;  1HDP A;  5CVV A;  4D5F A;  2CGP A;  3EQL F;  4U9U A;  3TDZ C;  2L4M A;  3GQ9 A;  2HOT A;  4DK0 A;  3F8M A;  3GVA A;  2DTR A;  3SHF A;  3PUN A;  3PSS A;  1LFU P;  4OM9 A;  1UG2 A;  2EIJ H;  2ELJ A;  5KVR A;  2AO9 A;  1T56 A;  4YEJ A;  3CCS B;  3I59 B;  2QM3 A;  1ZUN B;  4BBR J;  4E7Z A;  3H3U A;  4Z4Z A;  1OCO H;  2XSJ C;  3VO2 A;  3K2A A;  5E79 C;  3BTI A;  3GFL A;  5FNZ A;  3ABL H;  3BLY A;  3AFH A;  1B72 B;  1WFX A;  2W85 A;  4HV5 A;  4DNC A;  3DPL C;  5GV7 A;  4PJ0 C;  2XVC A;  4U4B A;  2CWE A;  4XRS A;  4UXN A;  4UHT A;  2O6G E;  3ZPL A;  1WJD A;  1QU3 A;  4YFO A;  3CJR B;  3E6D A;  2EWE A;  3OKX A;  2W7Z A;  4HQE A;  1WOO A;  3W2V A;  3F6V A;  1YHQ B;  1O3T A;  1VQN I;  3CD6 I;  1Y0R A;  2XNC A;  1ETK A;  3GW2 A;  3A0B C;  1YS6 A;  5M5W J;  1IUY A;  3SDB A;  1O3S A;  4OJP A;  3CCJ I;  1SFX A;  4FWT A;  4G6I A;  3WQZ A;  1O57 A;  3LFU A;  3D5S C;  1HOM A;  3CES A;  1FWZ A;  3LAP A;  2VFM A;  2DXI A;  2ZJR F;  3HC7 A;  3WG9 A;  1F9N A;  4OAY A;  2H8W A;  5KCM A;  4CZZ A;  2JA2 A;  5HVQ C;  1KYZ A;  2FBH A;  2LKS A;  3SEQ A;  2XAQ A;  4B3X A;  2VKV A;  3QPH A;  4AWX B;  3GZ6 A;  3OW2 B;  4I99 C;  4ZDO A;  3VDX A;  3CDL A;  2F4I A;  1H9G A;  2M0M A;  1W0T A;  2EIM H;  3WGI A;  4EJW A;  3JRI A;  2FQ4 A;  2E2I J;  3GSI A;  3W2F A;  1SKY B;  1O8L A;  1UZC A;  3D5L A;  1D0X A;  2HOA A;  3ZOB A;  1BL0 A;  2XKP A;  1V5G A;  1QVG B;  5IYP A;  2WZN A;  2DI3 A;  2KDZ A;  1SD4 A;  3CUQ C;  4BE1 A;  4Z1M A;  4IOA F;  2LKX A;  4WF2 A;  1JT6 A;  4G7W A;  4P6Y A;  3H92 A;  4A0X A;  1ZLJ A;  2DBB A;  1OYY A;  5CVJ A;  2M8G X;  3RKW A;  4X7E A;  2VI6 A;  3A2K A;  4BBS J;  3AAF A;  4LFU A;  2YWG A;  4CCL A;  3BG3 A;  1ODD A;  2LD5 A;  3FPK A;  4Z4V A;  1W5T A;  4HYE A;  3S2D J;  2QTZ A;  4Y7N J;  3AG1 H;  3IH3 A;  1Z6T A;  1V54 H;  1EF4 A;  4M0L A;  2KRH A;  2OPT A;  3H5A A;  1B72 A;  2DEU A;  4BJT A;  4ASN A;  2STT A;  1KK3 A;  4KT6 A;  2G7H A;  4I09 A;  4G6T B;  4CIC A;  3G05 A;  1WPC A;  4GGG A;  1REP C;  4QTR A;  1R5B A;  1ETQ A;  1TW2 A;  4EJO A;  3P5J A;  1Y0U A;  3TL4 X;  4ESF A;  2IS1 A;  1I1S A;  2KT0 A;  1E1Q A;  3OIQ A;  1QVF B;  2K3F A;  1HKS A;  2C4U A;  1DDG A;  2RQP A;  2E1M B;  3FBI B;  5LBQ A;  5LGU A;  4RB1 A;  3KRG A;  2B7C A;  4CO8 A;  1XS9 A;  2ISZ A;  4TSF A;  4PC2 A;  1OFL A;  4L18 B;  3BWG A;  4RLQ A;  4QHY A;  2EZI A;  3P9I A;  3UR3 C;  1PUF B;  5F0C A;  2L5Q A;  3KYD B;  1GVD A;  2X6Y A;  3M8E A;  5H6R A;  1OQY A;  1JXS A;  2BBY A;  1ON1 A;  1RQP A;  5FKM A;  3HDD A;  4XKC A;  4X7F A;  3JW4 A;  2IT0 A;  4WQM A;  3WYA A;  1HQC A;  1I6H J;  4PZJ A;  2EV0 A;  4BY1 J;  3I1F A;  5LMZ A;  2WA0 A;  4IHX A;  2OJE D;  1W36 D;  2FX3 A;  2FOW A;  5LD2 C;  1ONV A;  1Z0X A;  4FE4 A;  4ZJZ A;  4PFO A;  4Y15 A;  1B4A A;  2X53 S;  1ZM3 A;  2NOG A;  3IUO A;  1IXC A;  3LWF A;  3LSJ A;  4KKS A;  3ABT A;  4PC3 A;  3VO1 A;  2R5Y B;  3IWF A;  3RJP A;  3TOA A;  2W7N A;  1YO5 C;  3DBH B;  2UVF A;  1KYW A;  3TO9 A;  3GTJ J;  2NV4 A;  4RB2 C;  2WZP P;  3A8K A;  1JA0 A;  2HKO A;  2XSD C;  1FX7 A;  1Y56 A;  3DLA A;  2DA6 A;  1YTY A;  1K7A A;  2W00 A;  4OAZ A;  3S1M J;  1X3U A;  5A2Q Z;  5LRR A;  5ICC A;  1VZ0 A;  3CC7 B;  3GTQ J;  2JZY A;  3E0J B;  3B90 A;  3GWZ A;  3CO6 C;  2DDA A;  2DO7 A;  2XTX A;  4F3Q A;  3H5N A;  4DQ2 A;  2XZP A;  2DAO A;  1UJ8 A;  5K5O A;  2CW5 A;  1EE6 A;  5C1E A;  1XDU A;  2F5E A;  1J7K A;  1WRJ A;  2RNG A;  1U2W A;  1IDZ A;  4S0H B;  2QSH X;  3AVT A;  4MIM A;  1HA8 A;  1YIT I;  5CDF A;  1Q86 D;  1AIR A;  1OB2 A;  3QP5 A;  2LP0 A;  1XMA A;  1X19 A;  3SQN A;  4WZT A;  2LSO A;  4EEF G;  1QRY A;  1RQR A;  1TUI A;  3FM3 A;  1MMD A;  2BXY A;  2P7V B;  4RS8 A;  2DOG A;  2GJK A;  3OPO A;  2BN4 A;  1VQ9 I;  4X05 A;  4O5V A;  4YAF A;  2HDC A;  3NRV A;  1GVH A;  5JVT A;  3CCM B;  3WGH A;  2JQ7 A;  4BQO A;  1KK0 A;  3A03 A;  3B73 A;  3Q3S A;  4Z4T A;  1GR1 A;  5JHF A;  4I2O A;  2QQB A;  4RAF A;  3CZ6 A;  2J8I A;  3R61 A;  4DW6 A;  1MJA A;  1ETV A;  2V31 A;  1PUF A;  1UCR A;  3CMY A;  4ENN A;  3H0D A;  1F20 A;  4RD6 A;  2XTW A;  5FJ8 J;  1WU8 A;  1RU4 A;  1P4W A;  3HOW J;  3PSI A;  1HVX A;  2VZL A;  1LE8 A;  2A61 A;  1R5H A;  3DBL B;  2M87 A;  4Y33 A;  3WOD F;  2ICW G;  1U5T B;  1ZYR F;  2JRT A;  4Q4Z F;  3TKY A;  4TMV A;  4PAA A;  2K7L A;  3HXL A;  3V7R A;  2FQ3 A;  4LBV A;  1WJE A;  3PIP F;  4M6Y A;  3R60 A;  4P96 A;  3DV8 A;  1IAW A;  1O8J A;  3QWL A;  2PBI A;  1FND A;  2R5Y A;  2QY1 A;  3LSI A;  2Q2E B;  4UUT A;  1Z7L A;  5FLM J;  1G7S A;  2WJV A;  4EV0 A;  3LVB A;  3K4K A;  3MZH A;  1S9H A;  2K4B A;  5HLG A;  1OFC X;  4YFX F;  2Q1Z B;  1BIA A;  3CB4 A;  1Z77 A;  1VQN B;  3CD6 B;  4RAY A;  4B4D A;  3SY2 A;  3CCV I;  1VFC A;  1FMV A;  2VBW A;  1SMY F;  3ZN0 A;  5ILU A;  5EGO A;  2H8R A;  1EFT A;  1QFZ A;  2GK6 A;  3OP1 A;  1LDJ A;  3JRE A;  1R22 A;  3CW2 A;  3CCJ B;  1B59 A;  2M4K A;  2N8G A;  5EZG A;  3A01 A;  1FX0 A;  3LSP A;  2M5S A;  2ZME A;  1FC3 A;  4N3N A;  4HWV A;  4OZY A;  4CCN A;  2HMA A;  3LQE A;  1HZE A;  1BC7 C;  4KN4 X;  3BZ6 A;  2B5O A;  2W6I A;  1WHU A;  4TT3 A;  2ZBK A;  4KN7 X;  4LBY A;  1YW7 A;  4LB5 A;  5GAH J;  2A07 F;  2E1C A;  1K4Z A;  1OCP A;  2E60 A;  4YXW A;  1HA3 A;  5E3O A;  2L3D A;  1BJK A;  2QUF A;  2GLO A;  4YEI A;  3W2W A;  1V5E A;  1FYM A;  4G6Q A;  3FX3 A;  3SLN A;  1U78 A;  2XAH A;  1M90 D;  2UXN A;  5AIP A;  1ZAO A;  3WTW C;  2VFN A;  4PMH A;  3KEY A;  2YWE A;  4AD9 A;  3LJY A;  1ZM9 A;  2MD5 A;  4X6A J;  5FLV A;  3LA3 A;  5HZA A;  3DEE A;  2PMZ N;  2D3L A;  1IJF A;  2BVM A;  2L0K A;  2AXT C;  1UHW A;  4ENK A;  1RMG A;  2CRG A;  1TYW A;  1FOK A;  3B8Y A;  4GQN A;  2R0Q C;  2RKH A;  1EWY A;  2WAF A;  2BM1 A;  2HTJ A;  2VFP A;  1BBY A;  3TOB A;  1SVM A;  2DOF A;  4LLN A;  1DQU A;  1FOW A;  3RZO J;  2D74 A;  2ZO4 A;  1JHH A;  1HCR A;  4EJU A;  1YJN B;  1E3P A;  3ES9 A;  2F4N A;  4D7N A;  3OSG A;  2ZBV A;  2VFO A;  1IV6 A;  4BS9 A;  3BTC A;  4XKB A;  3SJZ A;  3LMM A;  1KQ8 A;  4AC0 A;  2QMU A;  1RNL A;  4EM1 A;  1Q9S A;  1X1P A;  1YX2 A;  3GCM A;  3L09 A;  4GXO A;  3HIF A;  1EP3 B;  2OBS A;  4JBA A;  3ZR8 X;  2H27 A;  1Y0Y A;  5J4V A;  1SVO A;  2A05 A;  2QEX I;  1CGP A;  2BM5 A;  3ONQ A;  2BMW A;  1QA2 A;  2YU9 J;  3GZ5 A;  4BE0 A;  4PGH A;  5JFR A;  3T9G A;  3ZQL A;  3HOV J;  5ED4 A;  3CLO A;  1JUP A;  3ELK A;  3T5X A;  5HXB A;  1KQ9 A;  4DIQ A;  3NQO A;  5TJJ A;  1IA5 A;  2V5I A;  2O03 A;  2F48 A;  1UEL B;  3OOU A;  3TW6 A;  3ZMV A;  3FWE A;  4B43 A;  3OS2 A;  2FD5 A;  3E97 A;  4G94 A;  1S0U A;  4NK8 A;  2R9V A;  3BOQ A;  2Y9Z A;  2V7T A;  2ZZG A;  2DJN A;  4M3B A;  2KIQ A;  2H1K A;  2B7E A;  3G2B A;  3V76 A;  2OD5 A;  2Z9O A;  3W5U A;  2R7Q A;  3DU6 A;  3K4N A;  3T8R A;  1RUO A;  4L5J A;  3Q9V A;  1MBG A;  1H89 C;  4C2U A;  2PMH A;  2ZXJ A;  3OOP A;  5IT3 A;  1WSV A;  3LSH A;  3C7J A;  1TTT A;  5HS8 A;  3CQZ J;  1YE9 A;  4XLC A;  2FXA A;  4RGU A;  1G8X A;  3A4C A;  2L2O A;  5FD6 A;  3BZC A;  3ULQ B;  2XF6 A;  3E5Q A;  1MDM B;  3JQQ A;  4UV8 A;  1OFD A;  3AG2 H;  4JX4 A;  5A88 A;  3UW0 A;  2HCJ B;  2ZZF A;  3I55 I;  1EA3 A;  2D9R A;  1Q82 D;  3SJM A;  5DN6 A;  2FSW A;  4NBQ A;  1X1D A;  4PC7 A;  3ZQG A;  1G6N A;  4A3F J;  4KH3 A;  3BP8 A;  3VSU A;  3BJO A;  4E0F A;  4AIK A;  2Q8K A;  1QCX A;  2QEN A;  3QE2 A;  1XGM A;  2P5L C;  5D5W B;  3H35 A;  3L2V A;  2KFD A;  1EKE A;  2EV5 A;  2D1V A;  3FBN B;  3PA1 A;  4P1V A;  5J3L A;  1YX5 A;  2LR8 A;  2MH2 A;  4I7H A;  4BQQ A;  3HOZ J;  1LUJ B;  1ZM4 A;  3H5R A;  5D4S A;  1D5Y A;  4RCY A;  3EPZ A;  3J7Z I;  4QPQ A;  2RC5 A;  2JPC A;  1B6A A;  2H6C A;  1WI3 A;  3KFW X;  3JQR A;  3SXY A;  1KQS B;  5C44 J;  1TWA J;  5DCM B;  1W7P B;  3S2H J;  3OYH A;  5F4O A;  4PUS A;  1STZ A;  1B2R A;  3VOD A;  1CQT A;  2RQQ A;  3SZT A;  1JJ8 C;  1NB9 A;  4Y17 A;  2XF7 A;  1LEB A;  1K6O A;  1X4P A;  3RTR A;  1WH7 A;  5ILV A;  3VFZ A;  4C3J J;  3ML6 A;  2ZXH A;  1E3H A;  1AMO A;  5D8L B;  4M3G A;  1H88 C;  4IW3 B;  3CDH A;  3SJP A;  3CJN A;  2OBR A;  1YIT B;  2JN6 A;  3QP6 A;  3Q0W A;  1QZZ A;  2V1U A;  1WXR A;  4GCV A;  1P4M A;  2PMU A;  4DYQ A;  3ZMS A;  1VBL A;  1QX4 A;  1VQ9 B;  5DYM A;  1BW6 A;  5BQT A;  4WWV A;  3ZMT A;  2OC6 A;  3T51 B;  2V1N A;  3T1B A;  1P7I A;  3BQZ A;  3SLD A;  3H09 A;  1W34 A;  5GAE J;  4HV6 A;  5FIU A;  2CU7 A;  3ABU A;  2DJI A;  3U9G A;  3KEQ A;  2C4T A;  3HB9 A;  4ZGQ B;  3AVV A;  2YR2 A;  4AM3 A;  1JI8 A;  2FEZ A;  3GQB A;  4OJL A;  4LLL A;  3OOC A;  3TP3 A;  3Q6R A;  2C78 A;  1K73 D;  1Z3Y A;  1AHD P;  4BPR A;  2ZSH B;  4LLG F;  1SC7 A;  3E6M A;  1TSP A;  4XLE A;  3BG6 A;  3Q38 A;  4G7X A;  1ORK A;  3G71 I;  2F5C A;  3WBK A;  3CO7 C;  4CYC B;  1SD5 A;  3FIS A;  2M5W A;  2PI0 A;  4YAL A;  3OL4 A;  4ZTJ A;  3WGG A;  4P3Y A;  4NB5 A;  2DT6 A;  2DMP A;  4Q5S F;  1D5V A;  2ZXI A;  2UZK A;  3MCA A;  2VBY A;  5D6F A;  4MTE A;  2X48 A;  3IWZ A;  4F55 A;  1SFO J;  1QVU A;  1HW1 A;  2HQN A;  5AMV A;  1SFU A;  2BYV E;  2L9S A;  3ZQH A;  3PUF A;  4EVI A;  5LHI A;  4CDG A;  5J40 A;  2DCU A;  4OWR B;  1XMK A;  3ISX A;  1ZG5 A;  2AXL A;  1V4R A;  2DK5 A;  2FBI A;  3HM5 A;  3W6J B;  1IN7 A;  2X6O A;  2UWM A;  2YWH A;  3CCV B;  1K83 J;  2VJ5 A;  1W7P A;  2WAE A;  5DCM A;  2UVE A;  2J5P A;  3SDG A;  2HYJ A;  3ERM A;  2BGJ A;  4A3K J;  4S04 A;  5EJC A;  4XD7 A;  2DCE A;  3GVK A;  2O8K A;  4BEH B;  4FTH A;  3CRZ A;  2HPM A;  5K5R A;  2R5Z A;  1O3Q A;  3BY6 A;  1S4M A;  1GUU A;  4GFB A;  1X1C A;  4P55 A;  1VHE A;  1TWH J;  3F8N A;  5GP9 A;  3TED A;  4IJA A;  3BQJ A;  2F4O B;  4N4N B;  1KCD A;  2Y2Z A;  1XSD A;  3IRR A;  2BY1 A;  2IQ7 A;  3MKW B;  1MMA A;  1OB0 A;  5H2F C;  1E0E A;  4CCK A;  1MZB A;  1E17 A;  3BPV A;  3CCQ I;  4HNV A;  2CMP A;  3KLN A;  4XLF A;  2XEX A;  1P2F A;  3HRS A;  2ZTG A;  2YX4 A;  3HGY A;  3ZBU A;  2CW7 A;  5FRO A;  2PIA A;  3P7N A;  2D2W A;  1UMQ A;  2GXG A;  2DYI A;  1W7P D;  4YZ0 A;  2MLK A;  5J1Y A;  5IYC J;  1J75 A;  2FF4 A;  1BIB A;  4U0Y A;  2R7U A;  3QPT A;  1TVC A;  1OFE A;  3ZQQ A;  2ADU A;  5LFA A;  2OTL I;  2MLG A;  1IXR C;  1FRN A;  3FPP A;  4BAC A;  3W6K B;  4JOM A;  4AYB A;  2W4S A;  3L9F A;  3PSZ A;  1DU6 A;  4Y3O A;  3QYB A;  2NVY J;  1KJZ A;  4Q7J B;  1U6G A;  2BSP A;  1A04 A;  2V9P A;  3U2R A;  4LBW A;  4V02 C;  5HS7 A;  2OBT A;  2FJ1 A;  5FO5 A;  2JTV A;  1KC8 D;  2VUM J;  1D0Z A;  3P9K A;  2Q0O A;  2DMQ A;  3CCR I;  4LIT A;  1R1U A;  2J7K A;  3CMA I;  4C43 A;  2MSY A;  1I39 A;  3WE2 A;  1O8E A;  1LVA A;  2LTP A;  1DAR A;  2Y48 A;  2VKH A;  4A6E A;  4PC1 A;  1NG6 A;  2Y69 H;  4TMX A;  4ZYD A;  4AID A;  1NK3 P;  3R6S A;  3AVY A;  4BY7 J;  1J5Y A;  2O61 A;  2GQQ A;  4Z03 A;  2CQQ A;  2FBK A;  1B8I B;  2W82 A;  2QEX B;  2M2E A;  3GRH A;  4HNT A;  1H85 A;  4F91 B;  5F0F A;  4OJ5 A;  4W8T A;  1W0J A;  3TH0 A;  4YAO A;  2HOE A;  1ZGA A;  1BI1 A;  1XPX A;  2XPV A;  4PAB A;  4L9J A;  1W5C C;  4R1H A;  5GTH C;  2ID3 A;  3G1M A;  2HKX A;  4ITV A;  3BNW A;  2EA4 A;  1P9Q C;  1P7J A;  3VEP A;  4M3D A;  2F1L A;  3VYU B;  2MAB A;  2V26 A;  2YX7 A;  3N05 A;  1IN5 A;  5D5V B;  4MQV A;  3DLL F;  3F72 A;  2CUZ A;  2V7F A;  1VQ6 I;  2V6E A;  3PEN A;  5DEQ A;  1VQ7 I;  4MHG A;  4B8X A;  2RV8 A;  3N4M A;  4LB6 B;  1A35 A;  2DFF A;  1XDS A;  4Z4U A;  3PJR A;  1ZHF A;  1Z6R A;  3LO8 A;  1XGO A;  5J1U A;  2WJY A;  3TP0 A;  5IPA A;  2LRD A;  4M74 A;  3OV8 A;  3OYA A;  1ZG1 A;  3FXR A;  3BY1 A;  5A89 A;  4NHJ A;  4XR6 A;  2DOE A;  1BLI A;  1WCM J;  4AU7 A;  2EIX A;  1LLZ A;  3I53 A;  4M71 A;  1Y39 A;  3ZUG A;  2G9W A;  4A69 C;  4BNC A;  1T0F C;  1IB4 A;  3K4L A;  2R7Z J;  2X3H A;  2ZB9 A;  1ZR2 A;  3VSL A;  2P6T A;  1UD2 A;  4DBQ A;  5D6E A;  2WPD A;  3MKL A;  4A0Z A;  4U0V A;  1JUS A;  2CUJ A;  3K2Z A;  1T33 A;  1UFM A;  4IVN A;  2XC7 A;  1GDT A;  1YRN B;  4ZTF A;  3W5H A;  5CKT A;  3BC8 A;  3G1L A;  4NDL A;  4NC6 A;  2DT7 B;  1YIO A;  2JVH A;  1X3W B;  5L3F A;  1XB4 A;  2J5O A;  2HQ5 A;  1R4N B;  3CCM I;  3V7C A;  5L3D A;  3BT9 A;  3FM5 A;  1J59 A;  3TGN A;  2VJI A;  1MBJ A;  5F0H A;  1K4S A;  2HDD A;  3A8J A;  3CCL I;  1VLY A;  2Z99 A;  1OR7 A;  3E1Y E;  4DK1 A;  3IV5 A;  3ZPN A;  1XCB A;  1ZN2 A;  1OMI A;  1YJ9 I;  3FKS A;  3HL2 A;  1VQO I;  1XX5 A;  2PMZ A;  3GXO A;  1K61 A;  3FMQ A;  3JCU C;  5FO0 A;  2HGC A;  5J8C A;  2Y9Y A;  5EG0 B;  2XT4 A;  2M4G A;  3BR6 A;  2EBI A;  4C2T A;  2KIF A;  4K1X A;  1JKO C;  3OAA A;  4RDK A;  3CDI A;  4AUX A;  2MGQ A;  3MKZ A;  5ICG A;  1QVT A;  1UMK A;  2IJL A;  3EDP A;  1GAW A;  2ME6 A;  3RKX A;  4AVP A;  5ICE A;  1S72 I;  5F27 A;  3KP3 A;  4RA2 A;  1WSU A;  3R6K A;  4P9S A;  1FP1 D;  5CVI A;  1MAB A;  3Q39 A;  3PNT A;  3UNG C;  3VYS B;  3CUQ A;  4ZH4 F;  1KZL A;  1ULY A;  1GXP A;  1D8K A;  1RES A;  1ZAR A;  4KMU X;  1T6S A;  2K9L A;  3QYF A;  1KRH A;  3G71 B;  1XB2 A;  2VOP A;  2I5U A;  2F2E A;  1VJS A;  4OIQ F;  4OOX A;  3K1N A;  1BI2 A;  4IX7 A;  2IS2 A;  1TZL A;  3F6O A;  4CYD A;  1RZ4 A;  3G73 A;  3AVW A;  1DAB A;  2Z5U A;  4MFE A;  2DOA A;  1VQ8 I;  5H6Q A;  1EFU A;  1TTY A;  3BTJ A;  2FRH A;  2M3A A;  2J8K A;  1EH6 A;  4ESJ A;  3OEH A;  2X6X A;  1NJI D;  4UUS A;  2VBU A;  2V9V A;  2O8X A;  2PJR B;  2GXA A;  1IN8 A;  3U1K A;  4YRV A;  4ROX A;  4KIB A;  1CF7 B;  3S3N A;  1RKT A;  2VKE A;  2WAQ A;  1BR4 A;  2BM0 A;  3ASO H;  2MYS A;  4P2N A;  1OKR A;  2LBF B;  1KQ0 A;  1V55 H;  3TDU C;  1P4A A;  4ON0 A;  4P22 A;  4A3J J;  1FYK A;  2XRL A;  3MQ0 A;  2D45 A;  5KAI C;  2KLO A;  3WND A;  2QBY A;  5LEK A;  4ENM A;  4PCQ A;  1I3A A;  1R4M B;  4IKF A;  3ASQ A;  3ML3 A;  3DTK A;  3K6G A;  2VNI A;  1XG2 A;  3ECO A;  4WZE A;  5FA6 A;  5HOD A;  1S3J A;  1OJL A;  1W0U A;  2DA1 A;  3HOU J;  3JSP A;  4XLH A;  4RGX A;  3J7Y J;  2R7X A;  2CND A;  5DD4 A;  1IZ1 A;  1I1G A;  1MJB A;  3OS0 A;  1U3E M;  1QGA A;  3EET A;  1PJ7 A;  4AF6 A;  3CJQ B;  3VSK A;  2GXB A;  3A3B A;  2OBP A;  3KX2 A;  1MW7 A;  2A69 F;  3I59 A;  1TLL A;  2B7B A;  2GM4 A;  5BSX A;  2VC0 A;  2WY7 Q;  3CCQ B;  2PE3 A;  5FKN A;  4GYI A;  4B1R A;  1EP1 B;  1JA1 A;  3KP4 A;  3MVP A;  2EQR A;  1IB0 A;  1YJN I;  3LL7 A;  1WMR A;  4I01 A;  2R93 J;  3H9Q A;  3A35 A;  3F21 A;  4IRI A;  2M7A A;  2Y31 A;  4S05 A;  5K5Q A;  3JAM K;  1WZ2 A;  2DA5 A;  1AKH B;  3DF8 A;  2C77 A;  3KP2 A;  1BM9 A;  4YG2 F;  2DFE A;  2E1O A;  2XGE A;  2OTL B;  1VQP I;  3CUO A;  2L7F P;  2XF5 A;  3BCB A;  5FLX Z;  3WXM A;  3OYJ A;  1KTW A;  4IHY A;  3OFN A;  4NBS A;  4RD4 A;  2XC1 A;  1L0O C;  4BJ5 C;  1V5F A;  4P12 A;  2BVN A;  1RKW A;  2IBD A;  3C3W A;  3QPL A;  4HF1 A;  3I58 A;  1YOV B;  3CCR B;  4OPV A;  1KU9 A;  4RDU A;  3CMA B;  3JRG A;  1E3X A;  3HOX J;  4M72 A;  5M5Y J;  2VJ4 A;  1EXM A;  2PJR A;  3AVU A;  4X8I A;  1BC8 C;  1Y8R B;  3ROU A;  3VSV A;  1CF7 A;  1KGS A;  2QZ8 A;  5K1Y A;  2JUG A;  1LVK A;  3NAW A;  4ZDP A;  4K2E A;  3GUD A;  4B44 A;  1OGM X;  2LBF A;  2TDX A;  1CNE A;  3Q6Q A;  3QFS A;  4JYK A;  2FVG A;  4EAT A;  3MN2 A;  2R7W A;  5C1C A;  5K7H A;  1VTN C;  1X0C A;  5C4X J;  2DQL A;  4ZZD A;  3FXK A;  3VYR B;  3Q9S A;  2E2H J;  4IHS A;  2EFW A;  1D1B A;  2B9S A;  3W3C A;  2WSS A;  1A6Q A;  4Z4W A;  1T38 A;  1MBK A;  4Y13 A;  1KU3 A;  1K4T A;  1H0M A;  3K69 A;  2CV0 A;  1KMH A;  3OJW A;  1XTA A;  4HA8 A;  2PX9 A;  1VQ6 B;  2HYF A;  4PK4 A;  4I98 B;  2E5N A;  2RDP A;  4E7S A;  1VQ7 B;  3ZN1 A;  2HQA A;  2DMT A;  1K8F A;  1HSJ A;  1WI9 A;  1ZRF A;  4ZCI A;  1A8P A;  2LY2 A;  2HYG D;  4M6V A;  3JX8 A;  2KJB A;  3GQ7 A;  4WXH A;  4W8R A;  4QVJ A;  2JJ7 A;  1G7T A;  5GTI C;  2GRE A;  2K27 A;  5J35 A;  3KPH A;  4FQG A;  4U7D A;  4WWC A;  4N4O B;  5KAF C;  5F4M A;  3OYI A;  2X51 A;  4J19 A;  2BZT A;  3FK6 A;  3ISP A;  4BHP A;  2R7F A;  4FXU A;  1JTX A;  4G12 A;  4E7L A;  3LFK A;  4N9H A;  2OA4 A;  5E1W A;  5JLV C;  1W35 A;  2B0L A;  3S14 J;  1XSX A;  2BV3 A;  1DU0 A;  3IH4 A;  5IYQ A;  1D8J A;  1AKH A;  3BH7 B;  2LFB A;  2IGN A;  2EFO A;  1UHS A;  1RRJ A;  4F92 B;  1WOS A;  1QPI A;  2VBS A;  1I18 A;  1XGS A;  2L7K A;  3WU0 A;  3GLX A;  5HZB A;  3I56 I;  4NCN A;  3MAJ A;  4MFD A;  4MEY F;  4HE5 A;  1Y6I A;  4RJL A;  4G7Z F;  1T6X A;  2AQF A;  4DOZ A;  2VBX A;  2CW0 F;  5BMZ A;  1IN6 A;  2XHK A;  3CCL B;  2W6J A;  2V79 A;  4NK6 A;  1VQ4 I;  1WJA A;  2G0E A;  1V0E A;  4E7K A;  1UD5 A;  3QFC A;  2DER A;  3AGP A;  3K0L A;  2XIG A;  3G1O A;  3UKG A;  1YJ9 B;  2NNY A;  3SUC A;  1VQO B;  5LEJ A;  3WY9 A;  1SD7 A;  2VB6 A;  1HF2 A;  1JKQ C;  1ETY A;  5DDG A;  1ZQ3 P;  2LOO A;  3NE5 B;  2QZA A;  2B0R A;  1SMT A;  1HST A;  3QU3 A;  5M3M J;  4OMZ A;  3VPR A;  3J80 Z;  1QZE A;  4OIN F;  3BH4 A;  3H1C A;  4KA4 A;  1Q1V A;  2X4H A;  1IJE A;  4FX4 A;  3OEE A;  4NC7 A;  1S72 B;  1TQI A;  2GIZ A;  2NXN B;  2D3N A;  4UNO A;  3KP7 A;  1J9I A;  4G9Y A;  1AU7 A;  2RRE A;  4RGR A;  3HRT A;  2IA0 A;  4W97 A;  1F5T A;  3QFR A;  1FNM A;  5B1A H;  2O7O A;  3T0Y A;  3ZXS A;  1QFY A;  2IGO A;  4I76 A;  4KNY A;  1GAQ A;  3GFM A;  2VBZ A;  1X1B A;  1AWC A;  3GEZ A;  3NEU A;  3W2A A;  1I8D A;  2KDO A;  2BV6 A;  1EFR A;  1EV7 A;  5EMN A;  4YZA A;  1E62 A;  4EGY A;  2IGM A;  3RIQ A;  1VQ8 B;  3FKI J;  1VQK I;  6PAX A;  2V7Q A;  4X7C A;  4YFN F;  2XGC A;  1QJV A;  5E3L A;  1W0K A;  4HX7 A;  2LF8 A;  2LY9 A;  4IQ4 A;  4YIF A;  4P6V F;  3BC9 A;  3SFZ A;  4EMS A;  3WTX C;  2JJ1 A;  2JUC A;  1S7O A;  2Y30 A;  2XGD A;  1N06 A;  3CF5 F;  4OOV A;  1X58 A;  1SEU A;  1S5L C;  2GWR A;  3PQK A;  1K8A D;  3N97 A;  5HLI A;  4C9Y A;  3K1P A;  1VQM I;  1U0J A;  4RDJ A;  2Q6L A;  3QAH A;  3SEJ A;  3MZY A;  2Q6K A;  4IZZ A;  5BPI A;  1DBO A;  4PSX A;  3NB2 A;  4TV7 A;  3K4M A;  3E6B A;  2JVG A;  2HNH A;  3FHZ A;  3RYR A;  3AGQ A;  2FNA A;  4XMY A;  5L3E A;  4BQN A;  3T53 B;  4B3G A;  1PXZ A;  2CG4 A;  2CF4 A;  2W24 A;  3MWM A;  5DUK A;  2OAZ A;  1FSE A;  1H8H A;  3U2Q A;  1LFB A;  3GF2 A;  1YW8 A;  2MFZ A;  3WE3 A;  5GAG J;  1R23 A;  1MSE C;  2R7T A;  3EQN A;  4W8Q A;  1P4X A;  3QQA A;  1TW3 A;  4ESB A;  1UD3 A;  1OIS A;  1HF0 A;  1XC5 A;  5HOO A;  3H94 A;  3ZP5 A;  3M4O J;  4YDT A;  2GBY A;  2VQH A;  1LB2 A;  2HLD A;  1NRK A;  2VNJ A;  2XAJ A;  4FIS A;  3CC2 I;  1VQL I;  1GVJ A;  1K78 B;  4LD5 A;  4UZF A;  3ONU A;  2CUE A;  3IAS 2;  4HDV A;  4KIS A;  4L5I A;  5IT9 Z;  3TBI A;  2R4G A;  1CZF A;  2FU4 A;  1OCT C;  1WVR A;  1U5T A;  4HBL A;  2COM A;  1WJC A;  4XBF A;  2JDI A;  2KZG A;  2P81 A;  1W1W E;  4G1B A;  3W5V A;  3WBJ A;  1GQ8 A;  5DS9 A;  4MQ9 F;  4OP7 A;  5EEG A;  2BY3 A;  4MNU A;  1XMX A;  2HDN B;  4UZE A;  4OZZ A;  4P9F A;  3MZ8 A;  2WYR A;  1VQP B;  2VOD A;  3AST A;  3FXL A;  2Q2E A;  3AKZ A;  5DM6 F;  3GTP J;  2HWV A;  3NAU A;  2F1M A;  2E5Z A;  4P26 A;  3ASR A;  4JX6 A;  4I02 A;  4IF4 A;  2V7V A;  4UB6 C;  5BOX A;  1GLN A;  5HS9 A;  2EZL A;  2R7R A;  3S17 J;  2EFG A;  4I84 A;  1R36 A;  1FOY A;  1JUM A;  4GDF A;  4MYU A;  3AG3 H;  3FXO A;  4A5N A;  4RD3 A;  2ZME C;  2AHO A;  1NBM A;  3DWL E;  1IUF A;  3HUG B;  3R0J A;  4YAW A;  5L3B A;  1VF7 A;  3EUA A;  4Z2Y A;  1B1B A;  2JPB A;  2VBV A;  1IRF A;  1PDN C;  2DQR A;  5E20 A;  4DYC A;  2DET A;  4CHU A;  4YFK F;  1LEA A;  4Z4Y A;  1TWG J;  4QFM A;  1T39 A;  2FA5 A;  2XZL A;  2ECB A;  2W48 A;  2O1D A;  2L4A A;  3LQ6 A;  3GLL A;  4EGZ A;  1FZP B;  3F8C A;  3COA C;  1DPR A;  5DM7 F;  1R71 A;  2BM6 A;  3T56 B;  5IOZ A;  2E36 A;  3BG9 A;  4LG0 B;  2DW4 A;  3C2H A;  3RYP A;  2NAZ A;  4A3C J;  2XAG A;  1D1A A;  1BQE A;  3HG9 A;  1OPC A;  1ZKG A;  3K4B A;  3JRB A;  4PDK A;  4Y9R A;  3U6B A;  1WJF A;  2OZ6 A;  1BX1 A;  2VN2 A;  4FK8 A;  5A2Q K;  3WNB A;  2O0W A;  2VE8 A;  3QOP A;  3WTY C;  2E19 A;  2QVO A;  2E1B A;  2HFH A;  3OR1 C;  3MKY B;  1M1K D;  2MBF A;  4LK1 F;  4HF0 A;  1K78 A;  1U9O A;  1O8H A;  2JA5 J;  1USS A;  1NK2 P;  2EZH A;  1F1Z A;  4BQA A;  4X06 A;  2HEO A;  2W1O A;  3V7S A;  2HQR A;  1W2B B;  4MEX F;  3A0H C;  3S1R J;  4HE6 A;  3EQO A;  4BDZ A;  1I7P A;  2AHQ A;  4OIO F;  5DTD A;  3L2W A;  2WB1 N;  3BR2 A;  3VNV A;  2CSO A;  4A93 J;  3PUB A;  2CK3 A;  4G1V A;  2K9Q A;  3WTT C;  4HOB A;  4TMW A;  5KHD A;  2O17 A;  4LIV A;  1UD8 A;  3I4M J;  4RLZ A;  4MGR A;  2VPL A;  1BN8 A;  4XM3 A;  2F5F A;  5JI6 A;  1QGZ A;  3OJX A;  3CC4 I;  5DNS A;  3ZMD A;  1WDT A;  4L8J A;  1S6L A;  3FXM A;  2LNB A;  4JK1 X;  1K79 A;  4KDP A;  4BXX J;  3GZN B;  1Z21 A;  5LRS A;  3I56 B;  4JRA C;  1B23 P;  3M8F A;  2VIX A;  2P5K A;  1VND A;  3H0G J;  2I1L A;  3DPU A;  1HG8 A;  3RQ4 A;  1VQ4 B;  1Q1H A;  3OIP A;  3MHP A;  3O8G A;  5F1J A;  2CH0 A;  1TL8 A;  3HUG A;  2KRC A;  1QPM A;  3DKX A;  3J81 k;  2E35 A;  1HKT A;  1JHF A;  2XKO A;  4M4S A;  2P5V A;  3OZV A;  4RLF A;  2ELK A;  3HSE A;  2XGX A;  3QYE A;  2BSA A;  5IY5 H;  1BJZ A;  3FIW A;  3JTG A;  4WXD A;  2GOM A;  3J80 K;  4F52 A;  4RD1 A;  1BMF A;  1FPQ A;  3LSM A;  3HHH A;  1DGR M;  5L3G A;  2IA2 A;  2RAE A;  3ABK H;  5LHH A;  2ZJP F;  2D5V A;  5GPC A;  1O7F A;  3M7G A;  1MDM A;  2CV1 A;  3B6C A;  4BU2 A;  3B82 A;  3JSO A;  1ZK8 A;  4BUP A;  2OTJ I;  1F60 A;  4UAJ A;  4FAS D;  2ZNY A;  1OOC A;  3G4S I;  2XV4 S;  3IC7 A;  3FJO A;  4LC0 A;  4QVA A;  5LGT A;  4B48 A;  4M9S A;  1XD7 A;  1MMS A;  3HEF A;  2GIV A;  1FIA A;  2VLA A;  3IHU A;  2NS0 A;  4L0Z B;  2JRM A;  1D8T A;  3E6C C;  1WKM A;  1ETW A;  2O9L A;  1VQK B;  1QH0 A;  3PFY A;  1MNM C;  4CUG A;  4L9T A;  1OYI A;  1FBU A;  3B02 A;  3EUH C;  4L5E A;  2Z6B D;  1FRQ A;  2ME0 A;  4NQW B;  5EF6 A;  2CFO A;  1GJR A;  4BDY A;  4G6D A;  3K10 A;  1FMW A;  5ICF A;  2ECC A;  1DG1 G;  3K70 D;  4P25 A;  3D26 A;  1OB5 A;  1CLW A;  4UVC A;  4A3L J;  1QHG A;  3ASP A;  1VQM B;  3B6A A;  2BM4 A;  1N8R D;  3JRA A;  2V7U A;  4Z4S A;  2QYU A;  1V5V A;  4FE7 A;  4GYG A;  4HST A;  5TGT A;  2ESN A;  2JT1 A;  4KJZ A;  4YAU A;  2MG4 A;  1D3Y A;  3M1E A;  3K70 C;  1TT0 A;  3M9A A;  4WCG A;  1U8B A;  4RCZ A;  1VQ5 I;  1N77 A;  5TY0 A;  5IYN A;  1YLO A;  5AON A;  2JJ2 A;  5DV5 A;  1I50 J;  4D5C A;  5BS6 A;  1H9T A;  4V19 K;  2DIE A;  3RI4 A;  2E1R A;  4HQM A;  4OIR F;  3FXJ A;  1YIJ I;  3BR1 A;  2NNN A;  2MC3 A;  3HPG A;  2YSR A;  4YHB A;  2QXZ A;  2L7Z A;  5B5E C;  3AK5 A;  3OWT A;  1GT0 C;  1OCZ H;  2CBX A;  3GVL A;  2PLF A;  2V1D A;  3BG7 A;  3CC2 B;  1VQL B;  1J2X A;  3FY3 A;  3ZMU A;  4EM2 A;  3IH2 A;  4QUZ A;  1KON A;  1LQ1 A;  2CS3 A;  3HJE A;  3RQI A;  1GHC A;  2YUH A;  5IT9 K;  2EJR A;  2W25 A;  2HVR A;  1NTC A;  4HX8 A;  4KIG A;  3CXC B;  5CVU A;  1XFO A;  2DA2 A;  1DGW Y;  2W84 A;  5E3M A;  1UST A;  3HTU A;  1FOX A;  2OU2 A;  4CYC A;  3VB2 A;  1G3T A;  4EQQ A;  3VR6 A;  2O5R A;  5EZH A;  1LFP A;  4KUM A;  1EH8 A;  4CCO A;  4EM0 B;  1Y1W J;  3Q0V A;  2VQG A;  1T95 A;  2HXI A;  3PFI A;  1M1E B;  1WTH D;  4D1Q A;  3BR3 A;  4L9V A;  1IC8 A;  3A8I A;  4A3I J;  1ZRD A;  3P4G A;  2P0W A;  3IP4 B;  1ELO A;  2A6H F;  4N0B A;  4Z05 A;  2CRV A;  2M9H A;  1T0F A;  4YEL A;  3SZG A;  2LG4 A;  1JGG A;  1X3Z B;  2DPU A;  2VBT A;  4IO9 F;  5B3S H;  2C6Y A;  3W2E A;  2JA6 J;  3S3M A;  1CNF A;  2X85 A;  2TCT A;  3SEZ A;  1ZGJ A;  2PEX A;  2X6W A;  2NTB A;  3ZPP A;  3HSR A;  5ILS A;  2PJP A;  4FET A;  3OYK A;  2VT2 A;  3I0T A;  2WWY A;  1N08 A;  2M0C A;  1V0F A;  2PYG A;  3BZK A;  3VWB A;  3QOE A;  1T08 B;  2BOL A;  4A12 A;  2QGU A;  3FDY A;  1K9M D;  4CZC A;  4P1W A;  4RAG A;  3KET A;  3AL0 B;  2W57 A;  1R7J A;  3F22 A;  2HI3 A;  2KMU A;  3RCO A;  4BEH A;  1RR8 C;  4XNF A;  4N3G A;  1TNT A;  1E63 A;  4RPB A;  2NST A;  1QG0 A;  3J81 Z;  2ZNZ A;  2QLZ A;  2L9V A;  5AIQ A;  3NWS A;  4PFP A;  1P6R A;  2L01 A;  2RNJ A;  2CC2 A;  5IYB J;  1MSF C;  4UB8 C;  2EV6 A;  2K5C A;  1ZGW A;  5BSY A;  5CQE A;  4U88 A;  1KU7 A;  1FSH A;  3ZQ7 A;  1L3L A;  2VNK A;  2I8D A;  4YIR X;  2R7O A;  4URR A;  2VYQ A;  2XPU A;  3WTU C;  4OPW A;  3OR2 C;  1GXQ A;  2XAU A;  4A3E J;  1RET A;  2NYX A;  3O6B B;  4LBZ A;  2F3L A;  2R6H A;  2JN9 A;  1SFK A;  2OQR A;  2EZK A;  3SYT A;  2INV A;  5J8F A;  2X9D A;  3HOY J;  3CF2 A;  4PC6 A;  5IK2 A;  1PJR A;  1YW9 A;  2V9K A;  5JHU A;  5FKK A;  2GA2 A;  5HNH A;  3IRQ A;  2QTL A;  3M07 A;  3OW7 A;  2XZO A;  1PVE A;  1GO2 A;  5FKL A;  4DZP A;  1KQ5 A;  2WV1 A;  1PJ6 A;  1SKQ A;  5DCF A;  2F43 A;  3J7A Y;  2NOJ B;  4MYT A;  3MD2 A;  1NHC A;  4HRI A;  3H9J A;  4ZYG A;  2IRF G;  3DPT A;  5JR3 A;  3JRH A;  2ZC2 A;  4QV2 A;  2L9R A;  3L00 A;  4C2L A;  4F7Z A;  3B8H A;  1MIJ A;  2P6S A;  1QNT A;  1JGS A;  2DT5 A;  3ESW B;  5HLT A;  1OGJ A;  2VQL A;  2ZZQ A;  2FX0 A;  3CCE B;  1LDK B;  2PQ8 A;  2Y75 A;  3KP5 A;  5F4J A;  2DLL A;  2X0L A;  3QPS A;  5D5U B;  4ZYA A;  1FEX A;  3PL8 A;  1Z9C A;  5HDN A;  2KL4 A;  1OCC H;  3KCC A;  5GPA A;  1UD6 A;  3PNY A;  4CGZ A;  3CC4 B;  2JMW A;  5LGN A;  4CSW A;  2QWW A;  2VKD A;  3BQY A;  3DXJ F;  1B8I A;  2C5B A;  5FL7 A;  4X0C A;  2PEC A;  3S32 A;  4C30 A;  2Y0S N;  3WU2 C;  2BXZ A;  3N90 A;  3QU6 A;  5K7Z A;  5E8I A;  3CCU I;  2PMD A;  1APL C;  1QGY A;  2O0V A;  1X2M A;  3PNV A;  5JLW A;  1IJW C;  2MH9 A;  1BOA A;  2UUZ A;  1QA6 A;  3CPW B;  2ODL A;  1KCC A;  4BL0 B;  4E6K G;  2NTQ A;  3ZZ0 A;  4OU0 A;  2IXS A;  5IP7 J;  1C0W A;  1OFM A;  3GQ8 A;  1VI0 A;  4JQF A;  1UB9 A;  2DA4 A;  1D0Y A;  4U7B A;  1S29 A;  4RBO A;  3Q0U A;  2Z33 A;  2VON A;  2XB5 A;  2A5W A;  2Z8G A;  2DA7 A;  1QHH D;  2DMN A;  2K86 A;  5JMC B;  4XOP A;  1BN5 A;  4HG2 A;  2KPM A;  2XGJ A;  2OTJ B;  3CJT B;  1NH3 A;  3RKY A;  1VLO A;  3PET A;  5J6X A;  4XN0 A;  2LC2 A;  5CJ9 A;  3S1N J;  2PYH A;  1N0V C;  3G4S B;  3FZV A;  1BX0 A;  1I3Q J;  2HU9 A;  5GAD J;  3GFI A;  1I5Z A;  1RUN A;  3PVD A;  1IDY A;  2M1B A;  5H59 A;  3U6K A;  3AVX A;  3N6Z A;  1IXS B;  3O3K A;  3D5R C;  4BYY A;  2KKO A;  2PN6 A;  2HZD A;  4XK4 A;  1WH5 A;  2XUB A;  5GV8 A;  3W2I A;  2STW A;  1WJB A;  1ETO A;  3PSF A;  1YRN A;  3VOE A;  4ETS A;  1E43 A;  2PFB A;  3GVJ A;  3ZZT A;  1JTY A;  2BHY A;  4KIC A;  1QGP A;  3GME A;  1G59 A;  1RC9 A;  1W4M A;  2NTP A;  2K4J A;  5C3E J;  4B3F X;  3WNC A;  2DTZ A;  3CME B;  4U87 A;  1OR7 C;  1SFE A;  1N25 A;  4IRH A;  2H94 A;  4Z06 A;  2KRF A;  4QIW N;  1S8N A;  2ZKZ A;  3SKB A;  3DKY A;  4LJZ F;  3LNQ A;  1RR7 A;  3AL0 C;  1R5O A;  3R6J A;  5B6I A;  1JJ2 B;  4OIP F;  4RGS A;  1TP4 A;  2ZFU A;  3KYC B;  4P9U A;  1BPL A;  2EA2 A;  1A5J A;  3OMY A;  3JR9 A;  4MR0 A;  2BVL A;  3EUK L;  2VXD A;  4JMQ A;  1MH4 A;  1WPK A;  3PIO F;  1N78 A;  4UZU A;  2RC6 A;  4E7J A;  1YI2 I;  1F36 A;  3ASS A;  3HOT A;  1BI0 A;  2F4M B;  3FXQ A;  4AVZ A;  4R8H A;  2XB0 X;  1X1A A;  4BXU A;  3ZQC A;  5EG0 A;  2BY0 A;  3I4P A;  2E2J J;  4UUV A;  4ZGN B;  1VQ5 B;  2NSP A;  4CA0 A;  1FBQ A;  2DA3 A;  4L0Y B;  4KIF A;  4WZL A;  2BY2 A;  1X4O A;  1W9X A;  3TMO A;  1YIJ B;  3LSR A;  1A36 A;  4BH9 A;  2JA8 J;  2IS4 A;  4XSX F;  4MO7 A;  1IHM A;  4ANJ A;  2WB1 A;  3L1P A;  3R4K A;  1V3F A;  3D0S A;  1JKP C;  2GJR A;  1KK2 A;  4CCJ A;  4JX5 A;  2FMY A;  2RVC A;  1FNC A;  4GO1 A;  4PSW A;  4Y9U A;  4ZZL A;  2QA4 I;  1HLV A;  1R5I D;  3H3V K;  3QSY A;  1O88 A;  2FNP A;  3CLQ A;  3DTI A;  2OZU A;  4B09 A;  3ABM H;  4Y4R A;  2OCC H;  4CXF A;  4HAM A;  3M8J A;  3OY9 A;  1T6Y A;  3E1S A;  4HNU A;  4BXF A;  2BPO A;  4QSH A;  5LLQ A;  1FTT A;  4BGD A;  2CQ7 A;  4RM0 A;  2XND A;  4O3M A;  1PP8 F;  1TLH B;  3RSN A;  1S7E A;  2GOX B;  2ZBU A;  5M3F J;  3F9K A;  2EPF A;  4X1E A;  2L9N A;  2CUF A;  1L1I A;  4IHT A;  2L54 A;  5CVR A;  2V4J C;  4YC5 A;  3S2W A;  3HPH A;  4A5M A;  4ABZ A;  1FDR A;  2DK8 A;  1UAA A;  1O8K A;  1G7C A;  1ITY A;  2A5Y B;  1YJW I;  1Q81 D;  2KP6 A;  2EFQ A;  1K28 D;  2GAU A;  4A3G J;  3LQQ A;  2Z1D A;  4M6X A;  1WSR A;  2X1C A;  3V4G A;  1ZTR A;  2M45 A;  1QUF A;  1ZM2 A;  4P3I A;  1AA7 A;  5KW9 A;  5F64 A;  4A0Y A;  2JSP A;  3IKT A;  3SZP A;  5IYD J;  3OIO A;  2VNH A;  1P92 A;  2ETH A;  3L2U A;  2NT9 A;  3J81 K;  2V1X A;  1PKV A;  1X2N A;  2QGG A;  4DGW B;  5BNG A;  2BE5 F;  1BR1 A;  4HLX A;  4FT8 A;  2OK7 A;  1I27 A;  3R0A A;  3KL9 A;  3V8J A;  5JLX A;  2ZJQ F;  2ACJ A;  4ACA A;  3SFI A;  1LE8 B;  1JTA A;  4MXN A;  4FHT A;  4Q47 A;  1MRZ A;  2KIS A;  2X1D A;  5EDN A;  3ZC3 A;  4OMY A;  1FIP A;  3FKJ A;  3WHB A;  1J0R A;  1XE1 A;  1O8F A;  1WOP A;  2AQE A;  4A3M J;  4OJ6 A;  2GZW A;  1FJL A;  3L2R A;  1BOB A;  2K9N A;  2ZL7 A;  4M1K A;  1QA1 A;  2QSF X;  4XL9 A;  1BR2 A;  1R6R A;  2Z3Y A;  1HDD C;  2E7W A;  4G8X A;  3ZCO A;  3GTG J;  3W2G A;  2INU A;  5BPD A;  4ZCM A;  4RD0 A;  4EJV A;  1POG A;  1W36 C;  3TW7 A;  3G6E I;  1UG0 A;  3I3L A;  2BEO A;  1OGI A;  3L7W A;  1YS7 A;  4HW0 A;  2EFN A;  2QQA A;  3OL3 A;  3P27 A;  5HKK A;  2NZM A;  1FNN A;  5K7F A;  5EGO B;  1R00 A;  3K9T A;  2CO5 A;  4ZV4 A;  3DQV C;  3KP6 A;  3I71 A;  4XKV A;  4FCY A;  3A01 B;  5HLH A;  4HZF A;  4CQJ A;  2IOU G;  1Y1V J;  1O7L A;  4DZJ A;  2P4W A;  3A02 A;  2ZME B;  3DTE A;  5CPR B;  1BI3 A;  4D7M A;  1T8I A;  5TIS C;  1HW2 A;  1CQX A;  2Q6I A;  1Z1D A;  1U2R A;  3V8K A;  1PLU A;  2VAS A;  3M1C A;  4H0E A;  3ASN H;  4UVB A;  5D8K B;  4UY8 I;  3C2G A;  1K5C A;  5FD5 A;  2VOO A;  2HS5 A;  1RWR A;  1RI7 A;  2RC4 A;  4AYB N;  5HNF A;  1Y8Q B;  3PA2 A;  5A8A A;  4CH7 A;  4PJJ A;  1EFC A;  2XTY A;  1OYW A;  2DFH A;  5E3N A;  1IN4 A;  2NVU B;  5LHG A;  4XLA A;  1H8A C;  3VMF A;  3HYI A;  4EJT A;  2VBK A;  1UHM A;  3OYN A;  2UXX A;  4L9N A;  5FB2 A;  3CP2 A;  4Z4R A;  3CCU B;  2NS7 A;  1DP7 P;  1J9Z A;  5E1X A;  1ZR4 A;  2EB7 A;  4DNT B;  2L7M P;  1ZG3 A;  2ZSI B;  3TQN A;  2KQR A;  4XOT A;  2IW5 A;  1ZLK A;  2NVT J;  3BY2 A;  1QA3 A;  1IRG A;  4XLN F;  4ZYH A;  3NAR A;  5TV2 A;  1JE8 A;  3A3G A;  3HAG A;  1HKQ A;  3OYM A;  2TRT A;  1PYV A;  3LA2 A;  2F5D A;  3BR5 A;  3GTL J;  2V4D A;  3ZBT A;  3DU1 X;  1G2H A;  5C4J J;  3ERE D;  2QN6 A;  5TR9 A;  4KMF A;  1QO0 D;  1TNS A;  3KZI C;  1TC3 C;  2NS8 A;  3BTL A;  1H42 A;  1SM4 A;  1VHO A;  3KEW A;  3C1D A;  1Z67 A;  2WY8 Q;  4QLC U;  1ZRE A;  3BR0 A;  3FK7 A;  2O04 A;  3HKZ N;  3J7A O;  3HZJ A;  3FMS A;  4OOI A;  3OYG A;  3GTO J;  3BDD A;  1FT9 A;  2ZZE A;  4XRM A;  1A6I A;  2QYO A;  2V7W A;  1KA8 A;  1ENH A;  1MBE A;  4W1U A;  4NUB A;  4RB3 C;  5FFZ A;  4I0B A;  2IS6 A;  3IKV A;  3WU1 B;  3JRC A;  5J4Y A;  1U8R A;  1RIO H;  4XOR A;  2DFI A;  2VPR A;  4E7H A;  2HZT A;  2HPI A;  4I6Z A;  3F3X A;  2K9S A;  2VQC A;  3LQR A;  2HOS A;  4KFC A;  5DSZ A;  4YZX A;  1N07 A;  2LDU A;  3BG5 A;  4AIH A;  4IHW A;  5FGM A;  3GTM J;  4X07 A;  2IPQ X;  4DQL A;  2WAD A;  1AIP A;  3FXU A;  4LIU A;  4WZK A;  1LM1 A;  3LA7 A;  3VMV A;  3F8F A;  1E64 A;  4MTD A;  4MLO A;  4OJO A;  1FP2 A;  2E1M C;  4IEJ A;  2QE7 A;  4XLP F;  1JKR C;  4TMT A;  1Q7Y D;  1WGX A;  4EW9 A;  1Z7U A;  3OYE A;  3G3Z A;  5IP6 A;  2EH3 A;  2LH9 A;  2R7D A;  1ZRC A;  4BAY A;  2NVQ J;  1K6Y A;  4HPQ A;  2OUM A;  4M3F A;  1JRG A;  4BHB A;  1IG7 A;  2QCO A;  1NB0 A;  2E71 A;  4PJL A;  1T2K A;  1T98 A;  3ECH A;  3IAM 2;  3OS1 A;  3DKW A;  2A3S A;  2KZV A;  5JVG F;  1DPU A;  3ONY A;  2FOK A;  1EZG A;  2DYR H;  2JWT A;  4V2F A;  3Q3A A;  5J47 A;  1YI2 B;  2DMU A;  1PJ5 A;  1FLI A;  3QOD A;  3HGG A;  5M5X J;  2RGV A;  3K4C A;  1R1V A;  2KIU A;  4RM2 A;  2YPR A;  2ZFW A;  3OYD A;  3ZRG A;  3JU4 A;  2IGK A;  2DN0 A;  4XN3 A;  5E1Z B;  5B66 C;  1MMN A;  3KLO A;  5FRM A;  1E1R A;  3LAJ A;  1DDN A;  2K3P A;  1E3Z A;  2XT2 A;  1B9M A;  1D1C A;  1DUX C;  4C0S A;  2ESH A;  1IRZ A;  2QKL B;  4M2L A;  1BW5 A;  2DYS H;  3GO5 A;  1NHA A;  3I4N J;  4AF7 A;  5F6F A;  5FLX K;  4Z6Y A;  3MMY B;  4QWQ A;  4KIT B;  2EK5 A;  4LGW A;  2EWN A;  2XNJ A;  2QA4 B;  1FBS A;  5H20 A;  1IDK A;  2GK7 A;  1KD1 D;  2E1N A;  2NRA C;  3S16 J;  2VJJ A;  4B4C A;  1QQ1 A;  4Y52 J;  2YWF A;  1WJ5 A;  1YLF A;  2L02 A;  2LRE A;  3H36 A;  1KK1 A;  2C2W A;  2ZTN A;  4KKT A;  4YZQ A;  1S7A A;  2Y0S A;  4UVA A;  4ZC3 A;  4ASU A;  1D1N A;  2BF4 A;  2C5H A;  2ZXW H;  3V7A A;  3LOC A;  4U49 A;  4E4H A;  2WBM A;  3C2B A;  3LSG A;  5DD8 A;  4XQF A;  1EA0 A;  3LMW A;  4F7D A;  1TWC J;  4WX9 A;  1LPQ A;  3OZU A;  1KU2 A;  5KSW B;  3D1N I;  1TQP A;  4XKW A;  3LSK A;  1PE9 A;  1N05 A;  3EYI A;  3BCA A;  3WHC A;  2QX3 A;  1QZY A;  2K02 A;  3OYF A;  2EIL H;  2IP2 A;  2CYY A;  1YJW B;  2BGI A;  5D4R A;  4U0W A;  1R9T J;  2QQ9 A;  1A31 A;  5E6T A;  3Q5F A;  4IHV A;  1IDJ A;  2AS5 F;  3DFG A;  2ISY A;  1R49 A;  2XAS A;  1G3Y A;  3FMR A;  4N9I A;  1WQ2 A;  2K85 A;  5E18 F;  4ENJ A;  3W6V A;  1G3W A;  5FO1 A;  5D5X B;  2WAQ N;  1JJ6 C;  3B78 A;  5HDG A;  1XGN A;  4UV9 A;  2QQ8 A;  2P3M A;  1XN7 A;  3I5U A;  1GV5 A;  4RAZ A;  1YYV A;  4NNJ A;  3RDI A;  3SQV A;  2I10 A;  1R1T A;  3OYB A;  1TQM A;  4O6J A;  5IYW A;  3BPX A;  5AN9 A;  1R58 A;  4II3 A;  1XSV A;  3RZD J;  3RY8 A;  1O8I A;  1O8D A;  4OPS A;  1JT0 A;  1OGO X;  1YX3 A;  1R5G A;  5FKO A;  3L2Q A;  3S8P A;  1O4X A;  3VNU A;  2OV7 A;  3H3Z A;  4TN1 A;  3OYL A;  3I64 A;  1JNY A;  5L46 A;  1U5T C;  3V42 A;  3U21 A;  3S1Q J;  1IW7 F;  4BJ6 C;  4IOC F;  3OYC A;  2XRN A;  1AOY A;  3IL2 A;  2JK3 A;  2K9M A;  3F8B A;  1MBH A;  3EYY A;  3T8T A;  4HEA 2;  2DY1 A;  3CCE I;  3PO2 J;  3VYT B;  2VBM A;  1YG2 A;  3G6E B;  4XRS G;  2O6W A;  4ZYE A;  2R3S A;  2JA7 J;  1TYX A;  4Q48 A;  3JUR A;  2LZJ A;  4E70 A;  3RPU A;  1OHH A;  2ID6 A;  2ELH A;  2OK8 A;  3BJ6 A;  4HLY A;  4RPD A;  2Q6O A;  2M8E A;  4JP0 A;  4A6D A;  1VF9 A;  2ZIT A;  3OSF A;  1MJ9 A;  1XG1 A;  2O0Y A;  3DCF A;  4PGO A;  3MMP A;  1QBJ A;  2Z2S B;  3H9N A;  1BHE A;  2LK2 A;  1E2X A;  2K40 A;  3EUH A;  4WK8 F;  2R5Z B;  4PGG A;  1QRC A;  4XID A;  3F23 A;  1HC8 A;  2CFX A;  5HDK A;  4PJN A;  4E7I A;  3JRD A;  3GFJ A;  1G4D A;  3MCZ A;  4A3B J;  2JSC A;  1IGN A;  4X7D A;  4HSR A;  3REO A;  2ZJ2 A;  2NPF A;  3ZSC A;  4KT5 C;  4OOS A;  4IPA A;  1FY7 A;  1G7R A;  3CCS I;  1TT5 B;  1JB9 A;  3QFT A;  4M73 A;  2X0K A;  3CTA A;  4J00 A;  4BKX A;  1DDI A;  2BW3 B;  2FML A;  3O2P E;  3HBL A;  4G7H F;  2XOK A;  3OZW A;  2CJJ A;  3W2H A;  1YQA A;  4C3I J;  3M3Y J;  1O8G A;  1LNW A;  2QKM B;  1ETX A;  2IEK A;  4P5O A;  1WP6 A;  1PP7 U;  3VMW A;  3RPU D;  3BH6 B;  2IVM A;  2OYN A;  1SAU A;  1SVL A;  1ERD A;  1OCR H;  1EH7 A;  2VXZ A;  3C18 A;  3ZMZ A;  3DEW A;  5EYR A;  5ERI A;  4LG0 A;  5CQG A;  2P7C B;  4DNR B;  2MW8 A;  4XON A;  5KNL A;  1GV2 A;  1Z91 A;  3WTS C;  2HDW A;  2KHM A;  4XRF A;  4M53 A;  5EEA A;  3WTZ A;  3PM1 A;  3QRF F;  1KZH A;  3KYL A;  4D9J A;  3TO7 A;  4M9Z A;  1QUE A;  3ZQI A;  1W87 A;  2PG4 A;  2DOD A;  1Z05 A;  1YHQ I;  2JIZ A;  4DBR A;  2A68 F;  3L2C A;  1MND A;  3HHG A;  1FYL A;  3ZQF A;  5F1R A;  3HTS B;  3CME I;  2LY1 A;  2HXO A;  1N75 A;  5F08 A;  3U1D A;  4F93 B;  3HRU A;  2GQF A;  2D1H A;  1J09 A;  4HIZ A;  3FHN A;  2VFQ A;  1R5N A;  4BE2 A;  2X8K A;  4FN5 A;  3E5U A;  2ZL5 A;  1FTZ A;  3GX4 X;  4I0A A;  4Y7C A;  4IXA A;  2H1L A;  1DP3 A;  1F4K A;  3JQP A;  2CQN A;  3FF5 A;  3CPX A;  2UV1 A;  2ZCW A;  2ZL6 A;  1Y0N A;  3PQJ A;  4G5G A;  1ON2 A;  1FNB A;  4OPO A;  3A1Y A;  4IL6 C;  3WG7 H;  5IOY A;  2R7V A;  1E79 A;  1LLW A;  3GBG A;  4D0P A;  2Z16 A;  1IO2 A;  3CP8 A;  3BCD A;  5IYR A;  2FE3 A;  5B1B H;  1EP2 B;  1Z3X A;  2COB A;  3KE2 A;  4HDU A;  4GRI A;  5EEH A;  4DYR A;  4R79 A;  1I6X A;  3DP7 A;  5CLS A;  2WR8 A;  1SAX A;  3CCY A;  3RKQ A;  1QFJ A;  2BM7 A;  5TRD A;  3E20 A;  1HBX G;  5CYV A;  2NT6 A;  1COW A;  4V2G A;  1BJA A;  4G7O F;  1IF1 A;  1MH3 A;  2E34 A;  2H09 A;  2H6B A;  2HVS A;  1BA5 A;  1F43 A;  4DQK A;  4ACB A;  2B63 J;  2BW3 A;  4YII A;  1O3R A;  1SAN A;  1QRB A;  3ZGK A;  1TWF J;  1E3O C;  1TBX A;  4J0Q A;  4R71 A;  2GJP A;  3O8H A;  5L3C A;  4H4K C;  4W8S A;  3B4N A;  1MNE A;  3KZY A;  4NC8 A;  2PLY A;  3P26 A;  1O8M A;  1TYV A;  2DU9 A;  5IP9 J;  3JAM Z;  2YU3 A;  1WWX A;  5J3O A;  2LF7 A;  4BHC A;  4WXC A;  4J01 A;  5J1R A;  1TYU A;  2O3F A;  4TKO B;  2LKP A;  3MEX A;  2LLK A;  4KYW A;  1D2E A;  4FX0 A;  3ZIA A;  2QF7 A;  2R92 J;  4TMZ A;  2Y0M A;  3WWG A;  2XPW A;  2GPJ A;  3V8L A;  1OLT A;  4C3H J;  3HRM A;  1MKM A;  2DPD A;  4ZDL A;  4RM3 A;  2HR3 A;  2WTE A;  2A6E F;  1EJ9 A;  3PO3 J;  3KIO A;  3MFK A;  2HTS A;  1NG7 A;  3JTH A;  1MGT A;  4NQW A;  3KZZ A;  1XQB A;  3S93 A;  3BJA A;  2P8T A;  2MC4 A;  1LKX A;  2VT3 A;  4C2M J;  1ZH5 A;  3H9G A;  5JBQ A;  2G7U A;  4XSZ F;  4LG3 A;  3S3O A;  2F6C A;  4A3D J;  3OE7 A;  2RN7 A;  2E7X A;  3P9C A;  2VL8 A;  3SZE A;  2NVX J;  2G0Y A;  4IRG A;  3I54 A;  4M3E A;  2VE9 A;  1PUE E;  3E7L A;  2DDB A;  3LST A;  2EFP A;  2GA1 A;  4CCM A;  2WV0 A;  4LOC A;  3DEU A;  3HKZ A;  4QPO A;  1ACI A;  4HX4 A;  5DUI A;  1YFH A;  2LMD A;  2LYC A;  1KTV A;  2BHZ A;  2CW8 A;  3PUM A;  2V7X A;  3DU5 A;  2X3U A;  3K1M A;  3NWT A;  5KK1 A;  4LMY A;  2FUG 2;  2MA3 A;  3CUQ B;  4DJA A;  2OF7 A;  4H9G A;  2BGC A;  1LDD A;  3K4J A;  3ZZU A;  1B9N A;  4AC9 A;  2A6T A;  2V6C A;  3HSF A;  3A1P A;  3BCF A;  3WTV C;  5F04 A;  2OQG A;  4A2U A;  2XDV A;  2CQX A;  2CV2 A;  4HF2 A;  2KVO A;  3LNN A;  2VC1 A;  4X0G A;  3CC7 I;  1WOR A;  1MBF A;  3GQA A;  4AIJ A;  2HVQ A;  5E17 F;  3I55 B;  4II2 A;  4M9X A;  3DBR B;  4XIC A;  4IQJ A;  2IA1 A;  1ZEL A;  3KEO A;  4UUS B;  3GTK J;  1MMG A;  2M30 A;  1UD4 A;  4RDL A;  1DBG A;  5THX A;  2KIM A;  2XRO A;  2EIN H;  3AG4 H;  4PJM A;  2YS9 A;  2X1E A;  3BRO A;  3S15 J;  2R7S A;  3DDY A;  2KJC A;  2M7B A;  3E5X A;  1T5E A;  1H8E A;  4RB0 A;  1W5S A;  3HOS A;  1U9N A;  2YUS A;  1RPW A;  1G3S A;  9ANT A;  2XAF A;  2QBY B;  2F5V A;  1LJ9 A;  3GYH X;  4YCQ A;  4B3A A;  5FFX A;  1XCV A;  1IRX A;  2OCE A;  1HXD A;  4LK0 F;  5FRN A;  2BX6 A;  3I9V 2;  4RD2 A;  2M34 A;  1QQI A;  4B47 A;  2MD0 A;  5H5J A;  1MD0 A;  1SD6 A;  1T6Z A;  2IAI A;  1NDH A;  5DS0 A;  3K7A J;  2CQK A;  3SYJ A; 
#chains in the Genus database with same CATH homology
 2VBE A;  4DGW B;  1BR1 A;  4F55 A;  3TBI A;  2R4G A;  1CZF A;  1H80 A;  5AMV A;  2L9S A;  3CMM A;  2JDI A;  1WJC A;  1GQ8 A;  1JTA A;  4OWR B;  4KKU A;  4MXN A;  3VST A;  4RMN A;  2X1D A;  2UWM A;  4OJ6 A;  3FKJ A;  2WAE A;  2VJ5 A;  1O8F A;  2UVE A;  2AQE A;  3GQ9 A;  4OZZ A;  4DK0 A;  3L2R A;  2ELJ A;  3AKZ A;  1BOB A;  4YEJ A;  2F1M A;  2E5Z A;  4XL9 A;  1BR2 A;  1R6R A;  2DCE A;  4E7Z A;  3ZCO A;  3GVK A;  4XD7 A;  2INU A;  4BEH B;  2HPM A;  2XSJ C;  1GLN A;  2R7R A;  4I84 A;  1W36 C;  1X1C A;  3BLY A;  1UG0 A;  3I3L A;  3AFH A;  1NBM A;  3DWL E;  4N4N B;  1KCD A;  1WFX A;  3HUG B;  3OL3 A;  3DPL C;  5HKK A;  1VF7 A;  2IQ7 A;  2NZM A;  3EUA A;  3MKW B;  4U4B A;  1MMA A;  1OB0 A;  1E0E A;  4CCK A;  3DQV C;  4XKV A;  1WJD A;  2CMP A;  4XLF A;  1QU3 A;  3CJR B;  2ZTG A;  2EWE A;  3DTE A;  2CW7 A;  5CPR B;  5FRO A;  1PLU A;  3W2V A;  2VAS A;  4YZ0 A;  2XZL A;  3M1C A;  2O1D A;  1K5C A;  3C2G A;  2R7U A;  1RWR A;  5HNF A;  3ZQQ A;  5LFA A;  4CH7 A;  4PJJ A;  3T56 B;  3FPP A;  3SDB A;  4BAC A;  4OJP A;  4JOM A;  3C2H A;  2W4S A;  4AYB A;  4G6I A;  3WQZ A;  1D1A A;  4Y3O A;  3QYB A;  3HG9 A;  3K4B A;  3LFU A;  3D5S C;  4XLA A;  2BSP A;  3CES A;  2VBK A;  2DXI A;  1WJF A;  3OYN A;  3HC7 A;  3CP2 A;  4OAY A;  2O0W A;  1D0Z A;  5KCM A;  5HVQ C;  2JA2 A;  2E1B A;  4LIT A;  4DNT B;  3OR1 C;  3MKY B;  2ZSI B;  2KQR A;  4XOT A;  1O8E A;  3SEQ A;  4B3X A;  1O8H A;  2VKH A;  4ZDO A;  1NG6 A;  3A3G A;  3VDX A;  3HAG A;  2F4I A;  2M0M A;  3OYM A;  2V4D A;  1PYV A;  4Z03 A;  1O8L A;  2W1O A;  1SKY B;  2W82 A;  3D5L A;  1D0X A;  3GRH A;  4HNT A;  3EQO A;  4BDZ A;  4F91 B;  3KEW A;  1V5G A;  4OJ5 A;  1W0J A;  4W8T A;  3L2W A;  2WY8 Q;  2O04 A;  3PUB A;  4BE1 A;  2CK3 A;  4Z1M A;  5KHD A;  4G7W A;  2O17 A;  3OYG A;  4LIV A;  1UD8 A;  2ZZE A;  2VPL A;  1BN8 A;  4ITV A;  4XM3 A;  3A2K A;  1P9Q C;  4CCL A;  4NUB A;  4L8J A;  3VYU B;  2MAB A;  2V26 A;  3N05 A;  2IS6 A;  1Z21 A;  2CUZ A;  2V7F A;  4XOR A;  2V6E A;  2VIX A;  4E7H A;  2HPI A;  2VQC A;  1HG8 A;  3DPU A;  3RQ4 A;  4YZX A;  3PJR A;  3OIP A;  2KRH A;  2WAD A;  3H5A A;  2CH0 A;  4LIU A;  3VMV A;  2WJY A;  2KRC A;  3DKX A;  4BJT A;  4OJO A;  2LRD A;  4MLO A;  2E1M C;  4KT6 A;  3OYA A;  2QE7 A;  4G6T B;  4RLF A;  4EW9 A;  3OYE A;  3QYE A;  4XR6 A;  3G05 A;  2LH9 A;  1WPC A;  1BLI A;  2GOM A;  1K6Y A;  4AU7 A;  4HPQ A;  2OUM A;  4F52 A;  3TL4 X;  2IS1 A;  1BMF A;  1E1Q A;  3LSM A;  1JRG A;  3OIQ A;  1DGR M;  1T0F C;  2CV1 A;  4PJL A;  2E1M B;  3FBI B;  3K4L A;  3KRG A;  1IB4 A;  2X3H A;  3VSL A;  1UD2 A;  4BU2 A;  4DBQ A;  4KIS A;  3IAM 2;  3OS1 A;  2WPD A;  2KZV A;  4TSF A;  1OFL A;  2CUJ A;  4RLQ A;  4BUP A;  2XC7 A;  4FAS D;  4ZTF A;  3UR3 C;  1OOC A;  3QOD A;  2L5Q A;  3BC8 A;  5CKT A;  2X6Y A;  3K4C A;  4B48 A;  2DT7 B;  2JVH A;  4RM2 A;  3OYD A;  3ZRG A;  3JU4 A;  2IGK A;  4XN3 A;  5FRM A;  1E3Z A;  1MMN A;  1E1R A;  4XKC A;  2K3P A;  2VJI A;  2VLA A;  1D1C A;  1VLY A;  2QKL B;  4DK1 A;  3ZPN A;  2WA0 A;  3PFY A;  3FKS A;  1W36 D;  3MMY B;  4CUG A;  3HL2 A;  4KIT B;  2PMZ A;  3EUH C;  5LD2 C;  2Z6B D;  4ZJZ A;  4PFO A;  2X53 S;  4NQW B;  1IDK A;  3IUO A;  4KKS A;  2GK7 A;  2CFO A;  2W7N A;  2UVF A;  4BDY A;  2M4G A;  2VJJ A;  3K10 A;  1FMW A;  1WJ5 A;  2LRE A;  2WZP P;  4YZQ A;  4KKT A;  2ZTN A;  3K70 D;  4C2T A;  1Y56 A;  2Y0S A;  1QHG A;  3DLA A;  4ZC3 A;  3OAA A;  3MKZ A;  2W00 A;  4OAZ A;  4ASU A;  4U49 A;  4E4H A;  1VZ0 A;  2WBM A;  3LSG A;  4XQF A;  3E0J B;  4HST A;  5TGT A;  3B90 A;  3LMW A;  1MAB A;  3PNT A;  4KJZ A;  3UNG C;  3VYS B;  4F3Q A;  3H5N A;  4XKW A;  1TT0 A;  3LSK A;  3K70 C;  1KZL A;  2XZP A;  1EE6 A;  1N77 A;  2K9L A;  3QYF A;  1PE9 A;  5C1E A;  3BCA A;  2QX3 A;  2JJ2 A;  3OYF A;  2RNG A;  2DIE A;  1VJS A;  4IX7 A;  2IS2 A;  3HPG A;  1HA8 A;  1TZL A;  2QXZ A;  5CDF A;  1AIR A;  2DOA A;  3OWT A;  1IDJ A;  3GVL A;  2M3A A;  3BG7 A;  1X19 A;  3OEH A;  3FY3 A;  2X6X A;  1KON A;  1MMD A;  2CS3 A;  2PJR B;  2GJK A;  3OPO A;  4YRV A;  2HVR A;  4NNJ A;  3S3N A;  2WAQ A;  1BR4 A;  1DGW Y;  2MYS A;  2LBF B;  4P22 A;  4BQO A;  3OYB A;  3VR6 A;  2O5R A;  1LFP A;  4II3 A;  5JHF A;  2KLO A;  4CCO A;  2VQG A;  1O8I A;  1T95 A;  1O8D A;  3CZ6 A;  1OGO X;  1WTH D;  4D1Q A;  1YX3 A;  2V31 A;  3L2Q A;  3S8P A;  2P0W A;  2OV7 A;  3IP4 B;  3OYL A;  4Z05 A;  4IKF A;  3V42 A;  3DTK A;  4YEL A;  3K6G A;  3SZG A;  2LG4 A;  3U21 A;  4BJ6 C;  3OYC A;  3H0D A;  1XG2 A;  3S3M A;  1RU4 A;  2K9M A;  2X85 A;  3SEZ A;  3ZPP A;  2X6W A;  3PSI A;  4HEA 2;  1HVX A;  2NTB A;  3VYT B;  4XLH A;  2VBM A;  4FET A;  4Y33 A;  3OYK A;  2R7X A;  1V0F A;  2PYG A;  3VWB A;  3HXL A;  3QOE A;  3OS0 A;  2BOL A;  3CJQ B;  3JUR A;  3VSK A;  2LZJ A;  1WJE A;  3A3B A;  3FDY A;  1OHH A;  1O8J A;  4CZC A;  3KX2 A;  1MW7 A;  4P1W A;  3AL0 B;  3RCO A;  2KMU A;  2WY7 Q;  4BEH A;  3LSI A;  2Q2E B;  4XNF A;  2QY1 A;  1Z7L A;  2WJV A;  3K4K A;  1S9H A;  3LL7 A;  1WMR A;  2Z2S B;  1BHE A;  3H9Q A;  3A35 A;  2M7A A;  2Q1Z B;  3NWS A;  4PFP A;  4PJN A;  2K5C A;  4E7I A;  5CQE A;  1FMV A;  4URR A;  4HSR A;  2I8D A;  3ZSC A;  2R7O A;  2GK6 A;  3OR2 C;  2XF5 A;  2XAU A;  3BCB A;  3OYJ A;  1KTW A;  2M4K A;  3OFN A;  1FX0 A;  1SFK A;  3SYT A;  4J00 A;  2INV A;  2M5S A;  2BW3 B;  2XOK A;  5IK2 A;  3CF2 A;  4BJ5 C;  4HWV A;  4OZY A;  1PJR A;  4CCN A;  2V9K A;  1V5F A;  1HZE A;  1O8G A;  5HNH A;  3OW7 A;  2QKM B;  4P5O A;  2W6I A;  1WP6 A;  2XZO A;  4TT3 A;  3VMW A;  3RPU D;  1SAU A;  2F43 A;  3J7A Y;  2E60 A;  2NOJ B;  1ERD A;  1E3X A;  4YXW A;  3MD2 A;  1NHC A;  4HRI A;  3H9J A;  3W2W A;  2VXZ A;  1V5E A;  2VJ4 A;  2PJR A;  4DNR B;  5CQG A;  3DPT A;  4XON A;  5KNL A;  3VSV A;  2HDW A;  2JUG A;  1LVK A;  4PMH A;  4C2L A;  2KHM A;  3KEY A;  4ZDP A;  4B44 A;  1OGM X;  2LBF A;  3KYL A;  5HLT A;  2VQL A;  2ZZQ A;  4D9J A;  1LDK B;  4EAT A;  2R7W A;  5C1C A;  1X0C A;  4ZYA A;  3DEE A;  3PL8 A;  2D3L A;  2JIZ A;  2BVM A;  3VYR B;  1RMG A;  4DBR A;  1D1B A;  3W3C A;  2KL4 A;  3B8Y A;  1MND A;  2WSS A;  1UD6 A;  3PNY A;  4GQN A;  2WAF A;  4CSW A;  2CV0 A;  2VKD A;  1KMH A;  5FL7 A;  2PEC A;  2LY1 A;  1N75 A;  3S32 A;  4F93 B;  1DQU A;  4C30 A;  4PK4 A;  1J09 A;  4HIZ A;  2E5N A;  3FHN A;  4E7S A;  2HQA A;  4BE2 A;  2X8K A;  2LY2 A;  4BS9 A;  2O0V A;  1DP3 A;  3GQ7 A;  4XKB A;  4W8R A;  3PNV A;  3LMM A;  2UV1 A;  2UUZ A;  2ODL A;  4N4O B;  1KCC A;  3OYI A;  2X51 A;  3A1Y A;  4BL0 B;  4E6K G;  2R7V A;  1E79 A;  2NTQ A;  3GBG A;  2Z16 A;  4FXU A;  3CP8 A;  2IXS A;  3BCD A;  1OFM A;  3GQ8 A;  3ZR8 X;  4E7L A;  1Z3X A;  4JQF A;  3ONQ A;  1D0Y A;  4U7B A;  4GRI A;  4R79 A;  4BE0 A;  3T9G A;  1IA5 A;  4DIQ A;  2A5W A;  2Z8G A;  4B43 A;  1QHH D;  1UEL B;  3OOU A;  3OS2 A;  4NK8 A;  2IGN A;  4XOP A;  4HG2 A;  2KPM A;  2R9V A;  2XGJ A;  2ZZG A;  4F92 B;  2NT6 A;  3G2B A;  2LC2 A;  4XN0 A;  1COW A;  2PYH A;  1I18 A;  2L7K A;  2HVS A;  2R7Q A;  3DU6 A;  2HU9 A;  3K4N A;  2BW3 A;  1Y6I A;  4C2U A;  2AQF A;  4DOZ A;  3LSH A;  3ZGK A;  3D5R C;  1YE9 A;  4XLC A;  2GJP A;  2HZD A;  1G8X A;  3A4C A;  2L2O A;  2W6J A;  4H4K C;  1WJB A;  4NK6 A;  1WJA A;  1V0E A;  2XF6 A;  3PSF A;  4E7K A;  4W8S A;  3B4N A;  1MNE A;  1E43 A;  1UD5 A;  4NC8 A;  3GVJ A;  1O8M A;  3SUC A;  3UW0 A;  1G59 A;  2NTP A;  2ZZF A;  1EA3 A;  4B3F X;  4J01 A;  5DN6 A;  4U87 A;  1OR7 C;  4TKO B;  1X1D A;  4Z06 A;  3VSU A;  2VB6 A;  4E0F A;  3ZIA A;  1QCX A;  2LOO A;  3NE5 B;  3DKY A;  3H35 A;  3L2V A;  3AL0 C;  3WWG A;  3FBN B;  1YX5 A;  1OLT A;  2ZFU A;  4BQQ A;  3BH4 A;  3H5R A;  4ZDL A;  1BPL A;  4RM3 A;  3EPZ A;  3OMY A;  4QPQ A;  4MR0 A;  2BVL A;  3EUK L;  2VXD A;  3OEE A;  4NC7 A;  4JMQ A;  1N78 A;  1NG7 A;  2D3N A;  4UZU A;  4E7J A;  3S93 A;  3OYH A;  3HOT A;  4PUS A;  4AVZ A;  2RRE A;  1X1A A;  2MC4 A;  1LKX A;  2RQQ A;  3ZXS A;  2NSP A;  3H9G A;  2XF7 A;  3S3O A;  4LG3 A;  2IGO A;  2F6C A;  4CA0 A;  3OE7 A;  1X4P A;  3RTR A;  1X1B A;  3W2A A;  2VL8 A;  1I8D A;  1X4O A;  2ZXH A;  2KDO A;  1W9X A;  3TMO A;  1EFR A;  4YZA A;  2IS4 A;  2IGM A;  4CCM A;  4ANJ A;  2WB1 A;  3HKZ A;  4QPO A;  2GJR A;  2V7Q A;  4CCJ A;  2NST A;  2LYC A;  4PSW A;  1QJV A;  1W0K A;  2CW8 A;  3DU5 A;  4IQ4 A;  1O88 A;  3NWT A;  1VBL A;  3DTI A;  3BC9 A;  2FUG 2;  4Y4R A;  4DJA A;  2JJ1 A;  2OC6 A;  3K4J A;  3M8J A;  3T51 B;  2V1N A;  3OY9 A;  2A6T A;  3E1S A;  4HNU A;  3BCF A;  4BXF A;  2XDV A;  4C9Y A;  1U0J A;  2DJI A;  2CV2 A;  4BGD A;  2KVO A;  2XND A;  3LNN A;  4IZZ A;  1JI8 A;  3RSN A;  4X0G A;  2GOX B;  3GQB A;  1DBO A;  4PSX A;  4OJL A;  3GQA A;  3F9K A;  2HVQ A;  3OOC A;  3K4M A;  2L9N A;  2JVG A;  2HNH A;  4II2 A;  4IQJ A;  1Z3Y A;  4XMY A;  1ZEL A;  1DBG A;  2V4J C;  1MMG A;  3HPH A;  4BQN A;  1UD4 A;  3T53 B;  4B3G A;  1PXZ A;  2ZSH B;  1H8H A;  4PJM A;  4XLE A;  1UAA A;  1O8K A;  2MFZ A;  2X1E A;  3BG6 A;  4G7X A;  3DDY A;  2R7S A;  2R7T A;  3EQN A;  4W8Q A;  2KP6 A;  2M7B A;  1K28 D;  1UD3 A;  1T5E A;  1H8E A;  5HOO A;  3OL4 A;  4ZTJ A;  3H94 A;  2Z1D A;  3HOS A;  2VQH A;  2X1C A;  2DT6 A;  2HLD A;  1NRK A;  1AA7 A;  2F5V A;  2JSP A;  1IRX A;  5FRN A;  3I9V 2;  4B47 A;  2MD0 A;  2ZXI A;  3L2U A;  2NT9 A;  3IAS 2;  1PKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...