4XL9A

Tailspike protein mutant d339a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xl9A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xl9A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xl9A02
1KCDA 5C1CA 4XLEA 1OGOX 1IB4A 4MXNA 4Z06A 4W8QA 3VMVA 4YZAA 4OJLA 4Z03A 4AVZA 4W8RA 1O8KA 1OFLA 1O8EA 4I84A 4YZ0A 4XOPA 1BN8A 3WWGA 4XORA 1OOCA 4HWVA 2VJIA 2QXZA 2VBMA 3B4NA 1JTAA 2INVA 3JURA 1PE9A 4XL9A 1KTWA 1O8HA 2O04A 4OZZA 4YZXA 4XOTA 4XLCA 1O8DA 1NHCA 1IDJA 2O1DA 4YZQA 2NTPA 4OJ5A 4OZYA 3SUCA 3GQAA 2NZMA 1AIRA 5C1EA 4XQFA 4URRA 2X3HA 2X6XA 1RU4A 3EQOA 1BHEA 3GQ8A 1K5CA 2QY1A 2O0VA 2NTBA 3GQ9A 1O8LA 3LMWA 4NK8A 4XN3A 4XM3A 2EWEA 2PECA 4XR6A 2NSTA 2PYGA 1XG2A 4XN0A 2X6YA 4MR0A 4XKWA 2X6WA 1RMGA 2BSPA 3B90A 1QJVA 1WMRA 1IA5A 3FY3A 3VSVA 2VJJA 1O8MA 1O8FA 1HG8A 3VSUA 2ODLA 1O88A 1X0CA 4PMHA 4U4BA 4OJPA 2IQ7A 2VBKA 4NK6A 3B8YA 1PLUA 1CZFA 1VBLA 2Z8GA 2NT6A 4OJOA 1O8JA 4YEJA 1OGMX 2O17A 2NT9A 4W8TA 3ZPPA 4XNFA 3KRGA 4XLAA 1RWRA 4EW9A 3VSTA 2UVFA 5AMVA 3T9GA 1DBGA 4C2LA 1O8IA 4XONA 1H80A 3UW0A 1GQ8A 2QX3A 4YELA 4U49A 2PYHA 1PXZA 2INUA 2VBEA 3VMWA 3EQNA 1O8GA 2NSPA 1IDKA 3GQ7A 2X85A 1DBOA 1KCCA 1EE6A 4Z05A 2O0WA 4XMYA 3ZSCA 3GRHA 4XLFA 1JRGA 1OFMA 4XLHA 4W8SA 2UVEA 4OJ6A 1QCXA 2NTQA 4XKVA
chains in the Genus database with same CATH superfamily
3GTLJ 1VHOA 2DJNA 2M7AA 4G7HF 3GTPJ 2DW4A 2GXGA 4MXNA 2HMAA 4W8QA 2QM3A 2CUEA 4ASUA 3HPHA 2VQLA 3HHHA 1PJ7A 1FBUA 1KU9A 2VC0A 1R5NA 2IA1A 1IB0A 2X0KA 4M3EA 4MFDA 4V2GA 5C44J 3W2EA 3VODA 5KNLA 2K86A 4A3GJ 3HSFA 1GAWA 1VJSA 4XKCA 3UNGC 4OIOF 4Q7JB 3S1QJ 3WWGA 3N4MA 1QPIA 1HDPA 1W0TA 4I99C 3CC2B 2VBMA 2DXIA 2HDNB 2RC4A 3P26A 1XFOA 1OYWA 2ID6A 3I3LA 2VBVA 5EJCA 3A8KA 4P96A 1BW5A 5K5OA 3FM5A 5GAGJ 5K1YA 3WYAA 4ZGQB 3KP4A 2J8IA 2DLLA 5HLIA 3LSPA 5E18F 1HA3A 1BIAA 3WGGA 4FHTA 4N9HA 1PJ6A 2QSGX 3I1FA 3H0GJ 4KJZA 4RD4A 2XF5A 5LGUA 2C4UA 1SFXA 2B9SA 3PUFA 3M8EA 1IJEA 1W34A 3PM1A 2CV2A 1ZKGA 4JX4A 5EEGA 1MMNA 2DMPA 4RB3C 2X3HA 2YSRA 1QA3A 3M8JA 4WCGA 4L18B 1ETXA 2OU2A 5DCFA 5IYWA 1EXMA 3KYDB 4WXDA 1UD4A 3PL8A 1NTCA 2L3DA 3MMYB 4UUSA 1WH5A 2NSTA 3HYIA 5JHFA 2OD5A 2M0MA 4P9FA 2ESNA 4XN0A 1CNFA 4A0ZA 4PUSA 4GXOA 1YX2A 3HG9A 4I0BA 4EH1A 5HOOA 3CCLB 2XPUA 4M3DA 2BEOA 1AKHA 4F91B 4KKUA 2YUHA 3N6ZA 1XMKA 2HZDA 3PSIA 4WF2A 3V7SA 2P3MA 1FOYA 3RI4A 3SJPA 2LKPA 4A3BJ 1IZ1A 3VMFA 4KNYA 1DDIA 1E3HA 5FROA 4OJPA 1RR8C 2OCEA 3E6DA 3F8MA 5E1WA 5KVRA 2W24A 4KICA 3BPXA 2W6IA 4N3NA 3KFWX 4FX0A 5M5YJ 2LMDA 1OCRH 1V0FA 3DLLF 2C5BA 4M4SA 2GLOA 3FDYA 3G73A 4U7DA 4LBZA 4ESJA 3QOEA 2QTZA 3IUOA 4NQWB 2ICWG 2E1BA 2FSWA 4LBVA 3ZPPA 1G6NA 2UZKA 5FB2A 4U0VA 4R1HA 3OYAA 1HKQA 2BE5F 4MEYF 3J80Z 3LA3A 2W48A 4RPBA 5HS9A 3EUHC 1Z7LA 3T9GA 1XB4A 5IP7J 1FOKA 1LVAA 1W5SA 2PG4A 3IWZA 3FJOA 1RPWA 2BHZA 3K0LA 1MJ9A 2NOJB 3LNNA 1VZ0A 2E1MB 1GQ8A 3FHNA 2OTJI 3R6KA 5ED4A 2HNHA 2LOOA 2VONA 4Q47A 4E7JA 3MKZA 3CCEI 1T38A 1JTXA 2DT7B 2XZOA 3U6BA 2E1OA 5LHHA 3JRFA 2OV7A 3S1RJ 3OSFA 1WXRA 1SMTA 4L5JA 3E0JB 4E7HA 5EF6A 2XGEA 1JRGA 1OFMA 2M4GA 3PA2A 4YC5A 1BC8C 3SJMA 1NB9A 4CDGA 2VIXA 1TUIA 1YLOA 1IDZA 4QVAA 3C7JA 3K4JA 2R7VA 4M6XA 1VQ7I 5M3MJ 4DK1A 2ELKA 2WY7Q 3PQJA 3Q39A 4QUZA 2JDIA 4Z03A 1V54H 2O8XA 1OB0A 4A6DA 3F72A 4DNTB 1OFLA 3R61A 1G8XA 3CO6C 4CH7A 3BG7A 1IRXA 1TNTA 1X2MA 3CMYA 1IC8A 1J9ZA 2M45A 3H3VK 3PNTA 2NNYA 3SZEA 1F4KA 1FRQA 5D8LB 1YI2I 3CW2A 4KIFA 3S2DJ 5IT9Z 3JURA 1YJ9B 1R36A 2BZTA 2CV1A 3QP5A 3S2HJ 4W1UA 2E7XA 1IN6A 3T1BA 2IJLA 1F60A 1D5YA 2M8EA 1DABA 3VYTB 2V7VA 2NVTJ 5H2FC 2CU7A 4A3DJ 1EP2B 4RGXA 3ZIAA 1QGPA 3FXJA 3G1MA 2QBYA 1YW7A 4URRA 4HQMA 4PGOA 2CRVA 4RDKA 1ON2A 2XGDA 4N0BA 3OYIA 2NXNB 1TBXA 3T8RA 1K5CA 1WHUA 1NRKA 3A1YA 5DDGA 2R3SA 5D5UB 2EWEA 3KEQA 5F04A 3JAMK 1T98A 4KT5C 1VQ9I 2GIZA 1FTZA 2BM1A 3OYHA 1XGSA 2P7VB 4RB0A 3TO6A 2HVRA 4DQKA 4M6VA 4M2LA 3PFIA 3B6CA 2VBTA 3H35A 2GK6A 4E7LA 1SEUA 4JRAC 2BY3A 4C3JJ 2VNJA 1U9OA 3BTJA 1HA8A 3L2CA 3S3NA 1R5HA 1QVUA 5ICGA 1VLYA 5JMCB 2ELHA 2IVMA 3HHGA 4QPOA 2HYJA 4ACAA 1RKTA 4HAMA 3OEHA 3SEZA 3MVPA 2UXNA 1SM4A 1SD7A 4F55A 3T51B 1E0EA 3RZDJ 2DA3A 3JREA 1TWFJ 3U21A 5BOXA 3VO2A 1KYWA 1LB2A 1B8IB 3B73A 5FLXZ 3ZQFA 2FMYA 5D6FA 2R7UA 5IPAA 3SQVA 1EJ9A 1ZREA 2BPOA 2EQRA 1P4MA 3KRGA 1V5GA 4HF1A 1ZUNB 4U0YA 3BCAA 2X6OA 4GYGA 2GPJA 1X4PA 5F27A 5CQEA 3H9QA 2FA5A 2G7UA 1Q9SA 1AHDP 2OBRA 3K4LA 4HX8A 4ZCLA 3JRDA 3VNVA 4EJUA 1UFMA 4P55A 3M9AA 2LFBA 4C0SA 3TEDA 1BMFA 1F9NA 3IP4B 2VNHA 1ZN2A 2L7KA 3AG2H 5GV7A 3FXRA 2VNIA 2Y0SN 4U49A 1R71A 2R6HA 1LDDA 1ZARA 2RAEA 4FETA 2DK5A 3LQRA 5A88A 3HOXJ 2DOAA 2D1HA 4EJOA 3OYLA 2A3SA 4ON0A 3CJQB 3C2BA 3ONUA 1GXPA 4UUTA 4PGGA 4BDZA 1KU2A 2C4TA 3GVLA 3L2WA 3DCFA 1PYVA 3DEUA 3JTGA 1BI3A 5CVIA 5K7HA 2NTQA 2R5YB 3GFJA 2MBFA 3SKBA 1OGOX 1X1PA 3HEFA 1YRNA 4Z06A 1N77A 3PIPF 4IPAA 2WR8A 1QZYA 2E1NA 2CV0A 2KKOA 2XPVA 2WADA 2Z6BD 3SEQA 3A1PA 2FF4A 3RYRA 5JLXA 3LYCA 2I10A 3ABKH 5FLXK 1J7KA 4LLNA 1QFJA 3I55B 2L7ZA 2K27A 3AG4H 2BM0A 3SDBA 4EJWA 4BBRJ 1SD4A 2JJ1A 5ICCA 2ZFUA 2HOTA 1O8HA 2JUCA 4BL0B 5KAIC 1ZG3A 2NS0A 2HQRA 2R7DA 4P26A 2ZZEA 1K4ZA 3JX8A 2WB1A 2LF8A 2YX4A 3L7WA 1W36D 3WTUC 5JFRA 3ZC3A 4XSZF 4AVPA 2BBYA 2KJBA 3MD2A 4Z4VA 1NB0A 1DU6A 4F93B 3BLYA 1XCBA 1FIAA 3CCRB 4A5MA 2V79A 2A68F 4BJ5C 2K9SA 1A8PA 1YHQB 1LFPA 4HG2A 1X3WB 3BG3A 3ZZ0A 1H8AC 3TBIA 4BS9A 4S04A 4LB6B 5B1AH 4LBWA 1ETWA 2VZLA 3CLQA 4P1VA 1IV6A 2K4JA 2Z1DA 2PJPA 1ZRFA 3K1PA 3EUHA 5EEHA 4D0PA 3GMEA 1W7PD 3PNYA 3WODF 1ONVA 1AMOA 1EH7A 5DEQA 2PEXA 4I01A 1XS9A 3Q0VA 2LBFB 4W97A 3HAGA 1WMRA 3TO9A 4MHGA 2WA0A 4M3FA 3VSVA 1I39A 3DLAA 5IYQA 4YAWA 2PJRA 1GDTA 3IRQA 4KITB 1R5BA 4H0EA 2TCTA 2JVHA 2O3FA 4DBQA 2ZL7A 2YU3A 1BR1A 4IL6C 3J81Z 3H9NA 1I5ZA 1ENHA 3QE2A 1S0UA 1S72I 3ECOA 2O7OA 5GP9A 5GAEJ 4MTDA 3C18A 1KK3A 2CFOA 1FPQA 3H3UA 2V1DA 2PMZN 4D5FA 1R7JA 2HYFA 1UD3A 1QNTA 1V5FA 2VYQA 2LR8A 3QFCA 4P22A 2NVYJ 4TN1A 1OB2A 3VSTA 2UXXA 4MYUA 4LIUA 2IT0A 2UVFA 5AMVA 4WK8F 1DBGA 3HXLA 4JX6A 3WU2C 2L9VA 2Q2EB 1ZYRF 1O3RA 1EFRA 3DPUA 4I84A 4ZYDA 4UNOA 1K4SA 3WY9A 2PYHA 4BY1J 1A6QA 2QUFA 4C3IJ 3RKQA 1DU0A 2QBYB 3A4CA 3A35A 1K28D 1KCCA 2E34A 2DQLA 4Z05A 2H6CA 1T56A 1BR2A 1IDYA 1ZTRA 3P9IA 5H6RA 2WAFA 2CH0A 2HXOA 2ZITA 2VASA 1YJWB 4CSWA 2F2EA 5F1RA 4W8SA 4OOVA 2UVEA 1X3ZB 2KQRA 3LSMA 4M3GA 3DF8A 2FVGA 1S7AA 2HXIA 4XLEA 5LHGA 2PIAA 5KW9A 1KMHA 4PJLA 4X7DA 3N90A 4Y3OA 3BH7B 1TL8A 1Z0XA 1XSVA 4MFEA 3E1YE 2LDUA 4JOMA 5IOYA 2IRFG 1GJRA 2YWFA 2MG4A 1YI2B 2ZBKA 1W87A 2D3NA 1LPQA 3W2IA 3G05A 3ZBTA 1RQRA 3ZMUA 4IJAA 2LC2A 5F0FA 3SEJA 2EZIA 1QRBA 1T95A 2CSOA 4ZZLA 4IQJA 1WGXA 4Z4ZA 2EZHA 3L2QA 1WKMA 1UELB 5DTDA 1DDNA 3VDXA 1QRCA 2KPMA 3TP0A 4U87A 1AOYA 5J8FA 2F48A 4YZQA 5FNZA 5J35A 2B7CA 2HGCA 3FZVA 2XB5A 3BR6A 2VOOA 1J59A 3SLNA 1WSRA 3BCDA 1OCCH 4PC3A 2DBBA 4BYYA 1Y1VJ 4LMYA 4XRFA 3O6BB 1I6XA 2E1MC 4A69C 1YJNB 3GCMA 3L09A 2H27A 1A5JA 3EETA 2KVOA 1MBJA 1Z1DA 5GAHJ 4MNUA 4GGGA 3HJEA 3O8HA 2CC2A 1XSXA 3OL3A 1IJWC 4TMXA 2M5WA 2XOKA 3AVUA 2GZWA 5DD4A 2ZMEA 4HOBA 4MGRA 4WXCA 5FD5A 3WTYC 4FE7A 5FO1A 4BQNA 3Q0UA 4NNJA 2HR3A 2JTVA 1GV2A 3HTSB 4MTEA 4UUVA 2OTJB 1XX5A 1WFXA 2HKXA 4YFOA 5D5VB 1HW2A 1TYVA 5AIQA 1KQ0A 1MDMA 2GK7A 2G0EA 3BZCA 4PDKA 2F1MA 4YFNF 2CQNA 1HSTA 1HG8A 1YFHA 4FQGA 2ODLA 5HKKA 3OOPA 1H9TA 3L2RA 1IJFA 4AUXA 4Y7CA 4HIZA 4UV8A 2PMUA 2ID3A 3OW2B 4E7ZA 2A5YB 1QPMA 1D1BA 3ZPLA 4ZYHA 3L9FA 2LYCA 4BXFA 2R0QC 1UAAA 4YEJA 4M73A 2DYIA 1JUSA 5IYDJ 3CUOA 2HDDA 3JCUC 5TGTA 1K78B 1VLOA 3IC7A 5D5XB 4OPSA 1MBGA 3I59A 1FYLA 1LNWA 4A0XA 1REPC 5EGOA 4UUSB 1P7IA 4MEXF 1QBJA 1R49A 1KK0A 4H9GA 3H09A 4X7CA 1T08B 1Z91A 3W6VA 1BI0A 1H9GA 1ZG1A 3K4MA 3Q6RA 2ZFWA 3AVXA 5GTHC 3BROA 2QX3A 1XC5A 4I6ZA 2FX3A 1O7LA 3OFNA 4YEIA 3HUGA 1GHCA 5FLMJ 3OJXA 1OLTA 3VWBA 1K73D 2FQ4A 1JNYA 1OGJA 2XAFA 3OYCA 4N4NB 1QU3A 1U78A 1A35A 2QWWA 2DA2A 1FNMA 2L9SA 3ZQCA 1SFKA 3ZZTA 3NARA 1R5ID 4BQQA 4B1RA 3X2QH 4K2EA 4XKVA 1FSEA 2QQBA 3HRSA 4EMSA 3B78A 1MABA 1JJ8C 1LM1A 4BQOA 1TNSA 2V1NA 3K9TA 2HVQA 3HC7A 3S1NJ 1VQ9B 2FBHA 3H5RA 3JRHA 3VO1A 1Z77A 3MQ0A 3SZTA 3ZQIA 3RZOJ 4WX9A 1MKMA 2L2OA 5HDGA 3BY2A 3F8CA 4XORA 2F5CA 5EYRA 5M5XJ 4ETSA 2VJIA 3P7NA 2BHYA 4HA8A 3ZN0A 1PP8F 1S29A 1NK3P 3AL0B 4Z4WA 5CKTA 1JTAA 2FEZA 3NAUA 2P0WA 2NS7A 1O3SA 4TMWA 2KIMA 3S15J 2BY0A 2GJRA 5DS9A 5E3MA 3V76A 2WAEA 1KTWA 1D1CA 4AIKA 1JT0A 1IRGA 4W8TA 2K9MA 3ELKA 5THXA 4YCQA 3CMEI 2ME0A 2MW8A 2Y69H 1JTYA 2NOGA 1FNNA 3TW6A 3ONYA 5F1JA 3GQAA 2JPBA 1L0OC 3OYMA 3HOUJ 2QE7A 4CCKA 3N05A 1U5TB 1JJ6C 2LZJA 2JSCA 3BR0A 4YDTA 3DEWA 5KCMA 1P9QC 1NH3A 3W5HA 1W36C 1OFCX 1X1DA 3WTTC 4D1QA 3F6OA 2NTBA 4KMUX 4BHBA 4EJTA 2M8GX 4V02C 1AWCA 2HYGD 4L5EA 1ZH5A 1U2RA 4J0QA 2AXLA 3H36A 3CMAI 2PFBA 5FKOA 4AC0A 3W5VA 3QPSA 3EUKL 4U7BA 1UMKA 1HF0A 4Y7NJ 4U0WA 3DPTA 4II3A 3CC4B 3D0SA 4KFCA 2VC1A 4MYTA 4MR0A 2P5KA 3RYPA 2R5YA 4AF6A 1KZLA 1SAXA 2VOPA 1WCMJ 4D9JA 4ANJA 5HLTA 2DMNA 1VHEA 1R00A 3PFYA 3IH2A 2GOMA 3BC8A 1WDTA 1BA5A 3H94A 3VSUA 3JTHA 4GCVA 4V2FA 1MBHA 2WV1A 2L54A 4I98B 1QZZA 2BMWA 4HYEA 2WTEA 4YRVA 1S7OA 4JBAA 2VBYA 4JQFA 1B6AA 5KAFC 4RD1A 1KQ8A 1B4AA 4OINF 1G7TA 2UV1A 3E97A 5A8AA 3JRGA 3JRBA 5FKMA 3S17J 1TWAJ 1OKRA 4YFXF 3R60A 2GA1A 3LMMA 1G59A 4R79A 2O9LA 1F43A 1JI8A 2BF4A 1Q7YD 1YJNI 3ZMVA 2E35A 2QSHX 1TW2A 3ZMZA 2RC5A 2ZL6A 4PC1A 2IS2A 3WU1B 1BOBA 4G8XA 1LFBA 2HTSA 3BTCA 5J6XA 3MCAA 4FX4A 5KSWB 1VQKI 2OJED 2K5CA 4J01A 2OCCH 1APLC 1EA3A 2EZLA 4A93J 4HF0A 3FPKA 1OMIA 5AIPA 2JIZA 2PLFA 2YR2A 3ERMA 1DPUA 2P4WA 4RDLA 1I50J 3CCSB 2XT4A 3CZ6A 1X1CA 1U5TC 3BOQA 3MZYA 2XC7A 4E7KA 3LO8A 4TT3A 3ZQLA 4ROXA 5M3FJ 1VF7A 2XTWA 1QRYA 4LK0F 4F92B 2RDPA 2XGCA 3RDIA 3CUQC 2HPIA 1TYUA 5IYBJ 1R9TJ 2CJJA 2HFHA 4L8JA 2V9PA 2DYSH 4G7XA 1GVJA 2LNBA 3TQNA 4ZTJA 4BBSJ 1Y8RB 2LBFA 2L4MA 5CYVA 3LAJA 2P5LC 4ZC3A 4XLFA 1TVCA 4FASD 1LUJB 3CDIA 4CA0A 3WHBA 2PJRB 1H0MA 4XD7A 3P9KA 1LE8B 2A5WA 3RIRA 3ASSA 3LOCA 4AC9A 3QP6A 3BJOA 5FRNA 1Z3XA 2DFHA 4TMVA 4W8RA 4GO1A 1O4XA 1D8TA 3MEXA 3BP8A 1O8EA 3WU0A 3WE2A 2A05A 4DYRA 1KRHA 1KQ5A 3CPXA 4ABZA 1ETKA 3SZPA 1N0VC 4IRHA 4BGDA 5L3BA 1EV7A 2C6YA 1B72B 1NK2P 4CYCA 1PE9A 1BI1A 2OK7A 3A3BA 3WTVC 3K70D 1B1BA 2M4KA 4QIWN 1BX0A 2VFNA 3OR2C 3KETA 5DSZA 2O1DA 5D4RA 2RC6A 3U1DA 3J7ZI 2P5VA 3COAC 2QZ8A 4UAJA 2NTPA 1WH7A 3V8LA 3V42A 3KEOA 3DBRB 3EDPA 4MIMA 1XDUA 3BZKA 5IP9J 2BM4A 2DCUA 4XRSG 4X06A 2XAJA 1G4DA 1BHEA 1MMAA 2EIMH 1LEAA 1F1ZA 1WJAA 5DCMA 2ZBVA 2QKMB 4XM3A 5TY0A 5BMZA 1FY7A 3ROUA 4L9TA 1FC3A 2M34A 5CQGA 1N08A 3RPUA 2DPDA 1VQ8B 4PFOA 2VT3A 2PE3A 1XG2A 3SDGA 2K40A 2A61A 2X6YA 2ME6A 3L2UA 3FISA 4I02A 1FSHA 3OIPA 2X6WA 3MAJA 5DUKA 3K6GA 5B66C 2BM6A 1Y0NA 1O8FA 5B3SH 5LEJA 1G3TA 2IQ7A 2FNAA 3Q6QA 3KCCA 3RKXA 2JA8J 2GJKA 2DY1A 3DFGA 4BXXJ 2VKEA 2NT6A 2Z3YA 5TISC 1OJLA 3QFRA 2PMHA 2QGUA 4RLZA 3PSSA 1MH4A 5F4OA 3LQQA 3T0YA 4DNCA 1V5EA 2DA5A 1A31A 1RESA 2QEXI 2MYSA 5GPCA 4EW9A 5C4JJ 1WSVA 1Z3YA 4Y13A 4G1VA 1DG1G 2GAUA 3VEPA 4PSWA 1ULYA 2QQAA 4E70A 2JWTA 1B2RA 4F7DA 1Y56A 1VNDA 3M1EA 2HVSA 2F6CA 2LSOA 4DOZA 3BH4A 1R6RA 4HDVA 1DARA 2DT6A 2MFZA 5HXBA 2F3LA 1B23P 1QO0D 2ADUA 2XPWA 1SD6A 1X4OA 4M9XA 3RQ4A 3JRAA 3VMWA 2Q6KA 2NSPA 2XAHA 1EH8A 1E17A 3HRMA 1P4AA 1EFUA 2PN6A 4B8XA 1P2FA 3LSIA 3MKWB 4P25A 3ZSCA 3QU6A 3AG3H 1MDMB 4IHXA 3FXQA 1W5TA 4P12A 1RC9A 3BJAA 2O61A 4ENJA 1MZBA 2X0LA 3KP3A 5FO0A 2MC4A 4X0CA 2VL8A 4BUPA 1KCDA 1W1WE 5L3EA 2B5OA 4B4DA 3K4KA 1FWZA 1XN7A 3E5XA 4LG3A 3PIOF 1W0UA 3GW2A 2H09A 2PBIA 2KMUA 3T8TA 3ZQQA 3QU3A 2W00A 5DYMA 5FKNA 2Z33A 3CUQA 3IAM2 3LNQA 1MBKA 1HDDC 2GQQA 3SFIA 1U0JA 1FT9A 2LP0A 2M7BA 2F5FA 2EIJH 1FX7A 1R1UA 1UCRA 2JA7J 3B8HA 3ZBUA 5HS7A 4GRIA 3JR9A 1A04A 2BN4A 1GT0C 4P2NA 1T5EA 3KX2A 3GQBA 1OCPA 1OYIA 3I71A 1MBEA 1U9NA 2ZO4A 3OYBA 2QKLB 1RNLA 2XAUA 2YX7A 3LA7A 2LY2A 1R23A 3I54A 1ZR2A 4B3AA 1VQ7B 2JPCA 1E1QA 3EQOA 5DCMB 3HGGA 1JKPC 1Z9CA 4WWVA 2QY1A 4CO8A 4RS8A 5EEAA 2C2WA 4YIFA 4FISA 2QDXA 4NK8A 3GZ5A 1IRZA 4KUMA 3GLXA 1WSUA 1GO2A 2DIEA 1G7SA 3A0HC 2D3LA 4B3XA 3GZ6A 3LSRA 3B6AA 2XT2A 2DYRH 1T6SA 1WI3A 4OAZA 4BJTA 2VKHA 5E3LA 3A0BC 3JQPA 2KFDA 4OMZA 4XKWA 3P4GA 3H5NA 2XB0X 3S3MA 1VQ6I 3ZZUA 1SC7A 1TQIA 5HVQC 2Y31A 2CWEA 3QOPA 3ASRA 2YS9A 2ZSIB 1D1AA 2P81A 5JLWA 2OZ6A 3BT9A 3KPHA 4XRMA 1CNEA 3GIRA 1X0CA 4NK6A 2VQHA 1KJZA 4E0FA 2VBXA 2D2WA 4IEJA 2Z8GA 4PC6A 5D5WB 2CQQA 3W2VA 3TDZC 2X4HA 3MHPA 1WJFA 2IS1A 3I4NJ 2NT9A 2DFEA 1J5YA 1TTTA 3PSZA 2NVUB 2JT1A 3S14J 4EVIA 2GXBA 5CVRA 3WG9A 3QWLA 3ASNH 3VPRA 4ZDLA 3LL7A 4PSXA 2JA6J 2FJ1A 1U5TA 2RGVA 4X07A 2WZNA 1ETVA 4LD5A 3QSYA 4KKTA 3FMQA 2W7NA 1H80A 3CO7C 4FTHA 2CGPA 1FOWA 2K9LA 1TTYA 4H4KC 1MMDA 1S8NA 3AL0C 4OWRB 4P9SA 1PXZA 2VFOA 3DQVC 4WXHA 3J81k 2AHQA 1BN5A 2YU9J 1KONA 2M1BA 2L5QA 3RPUD 2EK5A 3Q9SA 1GUUA 1DPRA 1YIOA 3PSFA 2Y30A 3CB4A 4Z4SA 3G6EI 3F3XA 1LEBA 4UVAA 4IHTA 5F64A 4DZPA 4OIQF 3OYFA 4P3YA 1OR7C 2VUMJ 5HODA 4NB5A 4AM3A 1S4MA 4M1KA 3NAWA 4ACBA 3DU1X 3HB9A 1K78A 1JUMA 3CDHA 1I18A 4HNUA 2BGJA 1WJDA 4YZAA 4OJLA 4LFUA 1BBYA 3HKZN 5D4SA 3E6BA 4A3LJ 2WAQN 4D7MA 4E7SA 4YG2F 2F43A 3CQZJ 5CVJA 1OOCA 1LJ9A 4RA2A 5L3FA 1ACIA 1YIJB 3VR6A 4FE4A 4IVNA 1VFCA 1Y0YA 1TZLA 3M8FA 4NQWA 1BJKA 1XSDA 2FX0A 2H6BA 3JRIA 2HDWA 2PI0A 4OIRF 2VKVA 1BR4A 2ZCWA 2E1CA 4XOTA 4BAYA 5J4YA 3F0CA 4IO9F 2X8KA 1JJ2B 2KP6A 1XB2A 5A89A 2M30A 1BX1A 2HEOA 2VLAA 2J8KA 2VBSA 2DTRA 2BW3A 5E8IA 1LQ1A 2B0LA 1TC3C 4N9IA 1QFZA 2OQGA 2EV0A 4ENMA 1Q82D 3AGPA 3G71B 2KISA 2O0VA 3ULQB 2DA7A 4ZV4A 2EWNA 2PECA 2DFFA 2XNJA 5F0HA 5A2QK 2M87A 3IKTA 3CC7B 1SFUA 3KE2A 1T6XA 4AYBN 1IW7F 2V7FA 3F6VA 2H8WA 1QGYA 3P27A 2WZPP 1W35A 1CLWA 2V5IA 4E6KG 2ZBUA 3KEWA 4RM3A 2XSDC 4BDYA 5LHIA 3ZMDA 4XSXF 5EGOB 3BQYA 3CC7I 1VQLB 1Y39A 1WI9A 1QJVA 4BE0A 1E1RA 3FKSA 4HE6A 2AO9A 2K02A 1T33A 2CG4A 5H6QA 1WJ5A 5IOZA 2RNGA 4XBFA 1VQNI 3RCOA 3EUAA 1EP3B 4IRIA 3HKZA 2VBZA 1G7RA 2OYNA 1ZQ3P 4RGRA 3NB2A 1KK2A 4NC7A 1GXQA 2VBUA 1RUNA 2XF7A 4C2MJ 4ZTFA 4MO7A 5J1UA 3OYGA 2D5VA 3WBKA 4A3IJ 1S5LC 3AVTA 2MH2A 2MA3A 2Z5UA 2CF4A 1VQLI 5FIUA 2EBIA 5EZHA 4HLYA 1FP1D 1UD5A 5J3LA 4A3MJ 4N3GA 1TYXA 3FXMA 1BOAA 2JSPA 5ICFA 2X1EA 4KMFA 4CCLA 4UZFA 1Z6TA 4XONA 3ZQHA 1WTHD 2XZPA 1HQCA 5LLQA 4YAFA 2C5HA 2H8RA 5DN6A 3AKZA 1B9MA 2ZXHA 1O8GA 2R7FA 2BGCA 2X1DA 3TKYA 2DK8A 1OISA 1WJBA 2DTZA 2NAZA 3P5JA 5BNGA 2XKPA 1LFUP 2ZNYA 2WPDA 2HTJA 2NPFA 2XZLA 2RKHA 4BHCA 1IAWA 1WOSA 1N0UA 3GFMA 1ZG5A 3Q0WA 4G7WA 3CJNA 3PUBA 3U2RA 3WTZA 4IRGA 5KK1A 1K7AA 1VQ4I 4YXWA 4Y4RA 2HQ5A 1NJID 2OBPA 3FBNB 3HOWJ 2DI3A 3SY2A 3W6JB 3HM5A 2JRMA 4HF2A 4YZ0A 2ZB9A 4Z2YA 2B0RA 5BQTA 3MZ8A 4NC6A 2DU9A 2JN9A 1STZA 4HLXA 3I4PA 1AU7A 5BSXA 2E1RA 4HSTA 1ZLJA 3S16J 3GWZA 3LSGA 1TQPA 1YQAA 5FKKA 2H94A 3LJYA 4OPWA 1JT6A 3OYDA 2Q6OA 2KT0A 2HI3A 3F8BA 2OA4A 4XQFA 4X6AJ 3CCEB 2RN7A 4D5CA 1J75A 4Q5SF 2V7TA 1KC8D 4IF4A 3TDUC 1H42A 1VQMI 5E17F 3ZXSA 3BQJA 3JQRA 2WB1N 2QEXB 5AN9A 1IN5A 2E7WA 1O8LA 1WPCA 4RLQA 3F23A 2CNDA 5FRMA 1G3YA 4CHUA 2IGKA 4BH9A 4PJNA 1V0EA 3OZVA 3ZPNA 2DEUA 3I58A 2MD0A 3K70C 5J3OA 3NEUA 4RBOA 1R4MB 4RAGA 1LLZA 2LTPA 2QVOA 5HLHA 2ZJQF 1FTTA 5H59A 5H20A 2V7WA 3WG7H 2VE9A 3B90A 2NRAC 1FLIA 2HQNA 2A69F 5TRDA 1I3AA 2R7OA 1TWGJ 3BTIA 2V6CA 3G2BA 3FK7A 5CJ9A 1FX0A 3WXMA 2O6WA 1BIBA 2Q1ZB 2D9RA 3MMPA 2E60A 2LF7A 4PMHA 3AVWA 1SAUA 1HOMA 1ITYA 4YAUA 3KLNA 4DJAA 4A6EA 3B8YA 4XLPF 4OOSA 1VBLA 3CCQI 3D1NI 3AK5A 3KZYA 2ACJA 1XPXA 1TWHJ 2WSSA 1Z05A 2CQ7A 3DU5A 3E5UA 4BACA 3P9CA 3A03A 4CXFA 1QA6A 2GM4A 1FEXA 2QN6A 5J40A 3WE3A 3CXCB 4DW6A 4PABA 3FBIB 5J1RA 3CCUB 4OOIA 2DN0A 4OIPF 3LFUA 1RR7A 1UD6A 4ZCIA 4AIJA 3LSJA 2JQ7A 1HXDA 2X51A 4HW0A 2AXTC 5FFZA 1MH3A 4JK1X 3VFZA 3LVBA 1W9XA 2GWRA 2Z9OA 3KLOA 3SHFA 3ES9A 2FXAA 4FCYA 1PKVA 1SFEA 3IAS2 4CICA 1MNEA 4IOAF 1EZGA 1DUXC 1QVFB 2CBXA 2Y9YA 3BDDA 3U6KA 4P5OA 3O8GA 4I0AA 1ZGAA 4CYCB 1LE8A 4GYIA 3ML6A 5GADJ 1YX3A 1SKYB 2YWEA 2HU9A 2NYXA 3KZZA 5B5EC 4BY7J 4ZZDA 5FA6A 2OBSA 2W7ZA 3PETA 3B82A 1G3WA 1W0KA 1XGOA 1P92A 1B9NA 4P6YA 5JR3A 2VI6A 1I1GA 2QQ8A 4WZEA 4Z4YA 3IWFA 2EV5A 2L7MP 2XAGA 4M71A 1OPCA 3HOVJ 3BCFA 1VI0A 3DDYA 4OPVA 2A07F 5CLSA 1N8RD 4NUBA 3ABMH 3J81K 4IX7A 3MN2A 4EV0A 1OFDA 1WRJA 1I27A 1XCVA 3WGHA 1BN8A 2XRLA 3H92A 3C1DA 5AONA 3A8JA 3G1OA 5IY5H 2INVA 2MC3A 1AA7A 3CCJI 2QLZA 1VQPI 3R0JA 4EGZA 3OL4A 3K7AJ 5CVVA 3DV8A 4EQQA 3H3ZA 1O3QA 1VQ5I 1VQ8I 3CCSI 5LD2C 5E6TA 4G1BA 3LSHA 3V7RA 1PDNC 3JU4A 4RD0A 2L02A 1EF4A 2ZZGA 4HNVA 3DKYA 3NWSA 2Q2EA 1CQXA 2JK3A 3I0TA 2VQCA 2EFWA 4XLNF 1JHHA 3OYJA 2OF7A 4Y9RA 1IF1A 3JW4A 2EV6A 4M6YA 2X6XA 4AD9A 3WTWC 4HBLA 4PZJA 5CVUA 3IH3A 3LMWA 3QPLA 3UKGA 1MIJA 2J5PA 3BZ6A 4XR6A 1JA1A 2O5RA 4AF7A 3MZHA 3FX3A 1ZGWA 3HBLA 3DTKA 3DTEA 4UY8I 4Q4ZF 1FBSA 2HOSA 1T2KA 3BJ6A 1T0FA 2ZZFA 5BPDA 2V7UA 1W5CC 3LQEA 4C2TA 3DP7A 5FL7A 3S2WA 2VNKA 3BTLA 1FYMA 4A3EJ 4XK4A 3U2QA 1E3PA 2EIXA 3ASQA 5HZAA 2C77A 2EJRA 1JE8A 2IS4A 3SQNA 3ZMSA 2ZTGA 1IV8A 5K5QA 5J1YA 3OE7A 4QSHA 5FD6A 1EWYA 2VJ4A 4L5IA 3RPQA 2EA4A 3ZRGA 5C3EJ 1H8HA 2DOFA 1M1EB 1JKQC 5DM6F 2R5ZB 4NC8A 1GVHA 4X7EA 2AQEA 1E3OC 4RD6A 2DA1A 1UZCA 5IT3A 1QFYA 2EFGA 4NHJA 2O17A 2DMUA 2V1UA 1HC8A 3WNBA 2LLKA 3CCMB 4I76A 4YHBA 2Q6IA 2K85A 1YX5A 1MGTA 3GTGJ 2ZMEB 4NCNA 4HSRA 2L4AA 4EGYA 1D0YA 1W4MA 2QENA 3Q38A 1E2XA 2VT2A 4UHTA 3NWTA 4OAYA 5ERIA 3ZQ7A 3LA2A 4AU7A 1OCOH 4I7HA 1O8IA 1Y0RA 1O57A 1HKSA 2H1LA 3OMYA 2K3PA 3FXUA 3H0DA 4XKBA 3ABLH 3CCRI 2LG4A 2LD5A 3HDDA 1IHMA 3ABTA 5IYRA 2BX6A 2ECCA 2INUA 3A01A 2HZTA 1XQBA 2DO7A 2MABA 3AVVA 5C4XJ 3MKYB 1IDKA 1OFEA 3PUNA 2X85A 1A6IA 3HPGA 5B1BH 4AYBA 1IG7A 2QCOA 4KA4A 3IL2A 4V19K 2F5VA 2B63J 3GTQJ 4ZDOA 1NDHA 1YW8A 2VJ5A 2C78A 1R5GA 4G7ZF 1T39A 3WNDA 3I59B 5IYNA 1TYWA 3R0AA 1YIJI 4LOCA 3OYKA 3KP6A 3E1SA 4TMTA 3HTUA 2QYUA 4BXUA 4D7NA 2W6JA 1J9IA 1H8EA 4DQLA 3HZJA 3V7CA 1ZM4A 4TSFA 1JHFA 5J47A 3PENA 1O8KA 3ZMTA 3RKWA 2GXAA 3J7AO 2L9NA 4G6QA 5J8CA 1SVOA 3N97A 4L9JA 4IXAA 3ISPA 4P9UA 2FU4A 2XGXA 2PMDA 1W7PA 6PAXA 4CZZA 1OHHA 4L0YB 4ZYGA 2L01A 2F4OB 3GUDA 4BKXA 4CCNA 4QLCU 4IHVA 1E62A 1MJAA 2E5ZA 2TRTA 4UVBA 4GQNA 4KDPA 2DPUA 2XNDA 3DBLB 3EQLF 1WQ2A 2IAIA 3E6CC 2VFMA 4RM0A 5FLVA 1N06A 4KT6A 3OKXA 1WZ2A 1RZ4A 1RU4A 3IHUA 1IXCA 4Z4RA 2W57A 4Z1MA 3CMAB 2G7HA 3HOTA 2WJYA 2Y2ZA 3FM3A 1BI2A 3PQKA 3G6EB 1NBMA 2EPFA 2VE8A 1JGGA 3CCLI 3K10A 2YWHA 1W0JA 1CF7B 4WZLA 1D8KA 1TLHB 3GYHX 4PFPA 2R92J 1KQSB 1V5VA 4TMZA 2VBWA 3S3OA 1RMGA 1D1NA 1Q1VA 3D5LA 3G1LA 1KTVA 4IOCF 1M1KD 5DS0A 1DGRM 3HGYA 2IA2A 3TH0A 1U2WA 5HZBA 4BU2A 2VJJA 5L3DA 1WJEA 3MFKA 2VQGA 1RKWA 3RJPA 4KH3A 3HOYJ 1FBQA 2V26A 1Z21A 5IP6A 2COBA 4BE2A 4FXUA 3TP3A 4RDJA 2WV0A 2EILH 3CP2A 3GBGA 1FNCA 4UZUA 3SXYA 2DDBA 2EA2A 2AS5F 1R22A 3IRRA 3K4CA 4OJOA 3O3KA 2GBYA 2ZXWH 1ZHFA 2M9HA 1V4RA 3H9JA 3W2GA 2FD5A 2QMUA 2R9VA 1VQKB 1Y1WJ 1TSPA 5EMNA 1S6LA 3ZP5A 2O6GE 3I55I 2XROA 1G3SA 4Z4UA 3FMSA 4LIVA 4A5NA 1S9HA 2AQFA 2Q6LA 1D8JA 5ILSA 3BWGA 1K8AD 2A6EF 1IGNA 2BM5A 5A2QZ 1OR7A 2BVLA 3ZN1A 4YELA 4EM0B 3GX4X 2FMLA 4QFMA 3RQIA 1C0WA 1MNMC 4LG0B 2UWMA 2K7LA 4OU0A 5L3GA 1L3LA 1D2EA 1BJAA 4DGWB 3BC9A 1UMQA 3VB2A 2D1VA 4PGHA 1N75A 3JRCA 4RD3A 3GRHA 3DKWA 1IRFA 1OYYA 2W84A 4LG0A 4XLHA 3AGQA 4P3IA 3D5SC 1Q81D 4WQMA 2ISZA 2LRDA 1JB9A 4TKOB 2FBIA 1TP4A 5HDNA 2KDOA 2IEKA 2ZXIA 2IA0A 3Q3AA 1FP2A 5DNSA 3LSKA 1YJ9I 4IZZA 1R5OA 1H89C 4XOPA 1A36A 3QFTA 2MSYA 2VN2A 2X3UA 2BVMA 2JVGA 4HWVA 2BOLA 2CUJA 2K3FA 1YITI 4C3HJ 3B4NA 2HS5A 1ETYA 4QPQA 4YALA 4OP7A 1WWXA 2RREA 4XL9A 5LFAA 2V6EA 5C1EA 3HSRA 2O04A 3B02A 2KDZA 1BJZA 2XDVA 1HVXA 1NHCA 2QTLA 5F4JA 2PQ8A 2DT5A 5D6EA 4HX4A 2DMTA 1FJLA 1WP6A 3OIQA 4LLGF 5E3NA 5HNHA 3F22A 1BL0A 4OZYA 1I1SA 3RIQA 2XHKA 3OW7A 3CF5F 3V7AA 2QQ9A 4ITVA 2HQAA 5LRRA 1CQTA 3QYBA 3VYUB 2Z99A 3VSKA 2QA4B 2VFPA 1EP1B 3VOEA 3A8IA 2XSJC 2R7TA 4B3FX 1DDGA 1JKRC 3BR2A 2B7BA 1CGPA 3M1CA 5ICEA 3K1NA 1YG2A 1YO5C 1ON1A 2E36A 3W5UA 3KZIC 4DK0A 2F4MB 2GA2A 4Z6YA 2O8KA 3FIWA 1CF7A 4WZKA 3JSOA 3CD6B 2PYGA 2EB7A 4YFKF 3OZWA 1FMVA 4QHYA 4A12A 1MD0A 1VTNC 1X1BA 2R7QA 1K83J 4MLOA 5LMZA 3QPHA 2VODA 3OWTA 2KRHA 4A3CJ 3OJWA 3CPWB 1F20A 3ONQA 3HRTA 2P6TA 1KA8A 1LDKB 1SANA 2Z2SB 4R71A 3QPTA 4A0YA 2XV4S 2ZJPF 4Y15A 1LDJA 4G9YA 3OYNA 4XRSA 2BYVE 4Y33A 4CCJA 3CCUI 2ZC2A 2ZSHB 1FIPA 4C9YA 3FXLA 5E8GA 2V4JC 4CYDA 3QRFF 5JBQA 2PX9A 2R7WA 1CZFA 1N78A 2BGIA 3ERED 4UVCA 3WNCA 2KZVA 1U8RA 5E1XA 1N05A 4KISA 1PVEA 1YTYA 2BY1A 2DFIA 2W4SA 2I1LA 2YWGA 2OC6A 4L0ZB 3ISXA 2WYRA 1VQOB 3C3WA 3E20A 3QODA 1WOPA 4B3GA 4XNFA 3DBHB 3HSEA 4ASNA 4HX7A 1U3EM 4RB2C 4QVJA 1D5VA 1W7PB 4G5GA 1RWRA 2ISYA 2XGJA 1YS7A 1QX4A 2ZXJA 4X05A 1EH6A 4HQEA 3CRZA 2R7XA 5LBQA 3F8NA 1XD7A 3ESWB 1OQYA 4B09A 4B43A 2DOGA 4KN4X 1VQMB 2IXSA 4RAYA 1ZGJA 4A3FJ 1BPLA 2IW5A 3I9V2 1ZR4A 1ORKA 2IGOA 5LEKA 3EQNA 2KZGA 3DTIA 1L1IA 4M9SA 2CRGA 4NDLA 4KN7X 3I56I 4A3JJ 1QA2A 3L1PA 5LGTA 1P7JA 1Z7UA 2JA5J 3DU6A 1I8DA 4M3BA 1MMGA 3FXOA 3T53B 1EKEA 1EA0A 1MJBA 2GIVA 2DQRA 2JA2A 2R7SA 2ESHA 1ZM2A 3K2ZA 2RVCA 5L46A 2HLDA 3KEYA 1V55H 4LGWA 4KIGA 5FJ8J 1OCZH 3HOSA 3S93A 3FKIJ 4O5VA 3KL9A 3PA1A 1UHMA 1N25A 1DQUA 5F6FA 3H1CA 1NHAA 4I2OA 2WAQA 2Y48A 2QSFX 2V1XA 2G9WA 3RSNA 3BPVA 4B48A 2D45A 1KU7A 2VXZA 3NE5B 5EZGA 4ZDPA 2NVQJ 4K1XA 5TV2A 2QZAA 2EFOA 1TT0A 3A2KA 2OTLB 2STTA 1HCRA 3SYJA 1SD5A 4G6TB 2EFPA 3LAPA 3M3YJ 1QZEA 4DYCA 4AIDA 4QTRA 5F4MA 4UV9A 1TW3A 3L00A 3Q5FA 1MMSA 1FNBA 1MNDA 4UZEA 1IDJA 2IPQX 2MD5A 1J09A 5FGMA 1S7EA 1PUFA 4CZCA 1X1AA 2ZTNA 1I3QJ 4DBRA 3HOZJ 1B72A 2G0YA 2DDAA 1QQIA 2E71A 3FHZA 2OUMA 1U8BA 2E2IJ 3DPLC 4X0GA 2R93J 3CUQB 1R4NB 5LGNA 2O0YA 3IH4A 3OEEA 1WPKA 3MWMA 5IYCJ 4EATA 3ABUA 4S05A 4O6JA 1MBFA 2GQFA 4E7IA 1J2XA 2I8DA 2GREA 2F5DA 2OPTA 2CMPA 2F5EA 3F8FA 1ZM3A 2R7ZJ 3V8JA 1QGAA 2L0KA 2L9RA 4HEA2 5K7FA 4RMNA 1XG1A 4OM9A 5E1ZB 2FOKA 4JYKA 4BJ6C 4A3KJ 4KIBA 5JI6A 1QHGA 2OK8A 1E3XA 1IXRC 4BEHB 4M0LA 2QYOA 5E79C 3GSIA 3AAFA 1JXSA 3G3ZA 2P8TA 2VBKA 1G7CA 1VQ6B 1J0RA 4AIHA 3I5UA 4UB8C 3BG5A 3BH6B 3NQOA 1SVMA 5F08A 3VYSB 2V7XA 3SFZA 1NG7A 3F9KA 3KYCB 1SFOJ 2P6SA 1R58A 3TGNA 4PC7A 3JQQA 1WJCA 2Y75A 4PCQA 3OR1C 4PK4A 1PJRA 1QG0A 1S72B 1D0ZA 2CYYA 2EIKH 2RQPA 4KKSA 3KP2A 2MGQA 4EM1A 3BCBA 4PC2A 3HRUA 3QYFA 1U6GA 2NS8A 4LITA 5ILVA 4RPDA 3UR3C 1YW9A 3WHCA 4I09A 4UB6C 5EDNA 5CDFA 4JX5A 3UW0A 3R6SA 2XNCA 2VBEA 2ECBA 2E2HJ 4HV6A 1ZELA 3GTOJ 5HDKA 3BQZA 4O3MA 4OMYA 1IUFA 2LKXA 4XICA 2ZNZA 1UD8A 2XASA 3CF2A 1SMYF 1B59A 2DJIA 4HPQA 3DEEA 3I64A 1YLFA 2H1KA 2O0WA 4M72A 2ZJ2A 2LREA 3U1KA 3V4GA 4ENKA 3PO2J 3CJTB 4DZJA 4J00A 3PVDA 3SLDA 1GV5A 2CW0F 5DM7F 2ELJA 2HCJB 2VFQA 2GJPA 4X8IA 1HLVA 1K6OA 5GTIC 1E79A 5IYPA 1QCXA 1IN7A 3BR5A 2E19A 3O2PE 4LB5A 3G4SB 1VQ5B 3GVAA 3MCZA 1IN8A 1ZK8A 4LK1F 4GFBA 4Y17A 3VMVA 1YRNB 1Q86D 3K69A 1R1TA 2XVCA 2JJ7A 1X58A 4QWQA 4MQVA 3D26A 4ZCMA 3Q3SA 1XDSA 3A02A 3GF2A 2COMA 2ZJRF 4FT8A 4ZH4F 1BLIA 2EINH 3TL4X 1JA0A 3U9GA 1OGIA 1USSA 1T8IA 3OPOA 5LRSA 5TR9A 3I56B 3AFHA 4EM2A 1RI7A 3WBJA 2TDXA 4OZZA 3IKVA 2WWYA 3GZNB 1Y0UA 3L2VA 1SKQA 1O8DA 2XTXA 4CUGA 2XC1A 5E3OA 1KQ9A 4PJJA 2M5SA 3GVKA 4M9ZA 4C2UA 4CCMA 3CC2I 2MH9A 3QYEA 1KK1A 1VQ4B 4IQ4A 1E43A 2LK2A 2HPMA 5IK2A 3E7LA 2DMQA 1UD2A 5EG0A 1YOVB 2EFNA 2KRFA 4G7OF 1AIPA 1Y6IA 5TJJA 1FMWA 1YYVA 1VF9A 1ZAOA 1RIOH 1FNDA 2V7QA 1WORA 2O03A 2W82A 1IN4A 2DOEA 1HW5A 1GVDA 3CLOA 3HIFA 3LFKA 4G12A 4IHWA 3GLLA 4AWXB 2AHOA 3PO3J 2KHMA 4X7FA 4L9VA 4ZGNB 4E4HA 4LC0A 3DWLE 4RLFA 3PJRA 2FBKA 2Y9ZA 2WY8Q 1EFCA 1K61A 2FUG2 3ZQGA 2X48A 5HS8A 3K4NA 5DV5A 1OCTC 3RY8A 2CUZA 3EPZA 1N07A 3CCJB 3D5RC 3T5XA 1JGSA 4WZTA 1LKXA 3OIOA 1PLUA 1ZRCA 1K4TA 2DERA 1VQOI 5D8KB 1K9MD 3TOAA 1OB5A 3GO5A 4TV7A 1FOXA 3CTAA 3IV5A 4S0HB 4LBYA 4RJLA 2W85A 1G2HA 3VNUA 2Q0OA 2OQRA 4RGUA 2CQKA 4XLAA 4U88A 3S32A 3GTKJ 3GTJJ 3VYRB 2CW8A 1PUEE 2E2JJ 2IS6A 1HBXG 1GAQA 1Y8QB 1WOOA 4DYQA 2LY1A 2STWA 1GR1A 1QUEA 1UHSA 3OY9A 2V9KA 4HZFA 1F5TA 3OZUA 4Z4TA 3FPPA 2DAOA 2HOAA 3VSLA 4L9NA 4IHYA 5GPAA 3ASTA 1YS6A 4P1WA 3ML3A 2EH3A 1KZHA 2HDCA 1HSJA 4HE5A 2JUGA 1DBOA 1EE6A 1QH0A 4FN5A 3FMRA 4DNRB 2BSAA 3Q9VA 1O7FA 2RNJA 4HDUA 2BXYA 2BVNA 3M4OJ 3FF5A 2BV6A 3ASOH 2KLOA 1YITB 2QA4I 1ZRDA 1XGMA 2LH9A 5DD8A 4BHPA 4ESBA 2BY2A 1WU8A 1IB4A 2GOXB 4G6IA 3F21A 2E5NA 2R7RA 4AVZA 4PJMA 1XGNA 4Y52J 5JVTA 2F4IA 2XF6A 3CESA 2NVXJ 4HRIA 3R6JA 3W6KB 5BPIA 2ETHA 2OTLI 2L7FP 1WVRA 3S8PA 3OYEA 3JSPA 2IGNA 3OP1A 1Z6RA 2W1OA 4BEHA 2QXZA 4F7ZA 4Y9UA 4RCZA 2CO5A 4ENNA 1GLNA 1ZLKA 2WJVA 2Y0SA 1I6HJ 1ZM9A 4DQ2A 3E5QA 3LSTA 5JVGF 4OJ5A 4YIRX 2HOEA 4RAZA 2F4NA 4EJVA 3QQAA 4A2UA 1UG0A 3W3CA 4EEFG 4FK8A 3KP7A 1E64A 1TLLA 3GEZA 5GV8A 3CMEB 1DP7P 5DUIA 3A3GA 3GQ8A 3J7AY 2MLGA 1SVLA 3T56B 3BY6A 2DODA 1D3YA 4F3QA 3GQ9A 3W2HA 5F0CA 1KU3A 2FOWA 3ZOBA 5IT9K 4LJZF 1NG6A 3CMMA 2WC2A 4G94A 3C2HA 1QVGB 3J80K 3CCVI 2CW7A 1Q1HA 3ZR8X 2R5ZA 5BS6A 2XEXA 4YAOA 3SZGA 1BC7C 1IO2A 5JHUA 2CQXA 1MRZA 5FKLA 3OAAA 1UJ8A 1DP3A 4BPRA 2BSPA 1IUYA 2FE3A 3LQ6A 1IA5A 3FY3A 1T0FC 1MSEC 3CC4I 3CCQB 3TW7A 1Z67A 2VKDA 2CW5A 1YE9A 4II2A 4B47A 1RQPA 1O88A 3DXJF 4ZJZA 3E6MA 3REOA 1F36A 2KIFA 3FWEA 4LLLA 4BE1A 3ASPA 4PJ0C 3BR3A 3W2WA 1H88C 2CUFA 3FXKA 2BW3B 2HKOA 2W25A 5E20A 5KHDA 4Q48A 1O8JA 1OGMX 4PAAA 2IBDA 1ELOA 3BG6A 3BNWA 3A01B 3HL2A 4U9UA 5ILUA 2RQQA 5HNFA 4FWTA 2VB6A 4QV2A 1ETOA 1K79A 4CGZA 5CPRB 3OOCA 3FK6A 2KL4A 4ESFA 4J19A 1XE1A 1USTA 3ECHA 2IP2A 3GTMJ 3NRVA 1P4XA 4C2LA 4C43A 3TOBA 3CP8A 5JLVC 2BM7A 1FRNA 2DCEA 2LVSA 2XIGA 2J7KA 4JMQA 3OV8A 1KD1D 2P7CB 2QGGA 3TO7A 3OS0A 3BG9A 2B7EA 1PJ5A 1ODDA 4ZYEA 3EYIA 1RETA 2JRTA 4NBSA 1K8FA 2DA4A 2KIUA 4CCOA 3CD6I 4GDFA 3GQ7A 3ZCOA 5J4VA 2Q8KA 3AG1H 5K5RA 3LWFA 1YHQI 1D0XA 3J7YJ 1IXSB 1AKHB 4IKFA 3RTRA 4KYWA 2K4BA 2V9VA 2JN6A 3KYLA 1QUFA 1M90D 3TMOA 2M0CA 4R8HA 2NNNA 3EYYA 5C1CA 2Y0MA 2DETA 3CDLA 1TWCJ 2XTYA 4YIIA 4OOXA 5B6IA 3HUGB 1RRJA 2PMZA 2VXDA 3QAHA 4P6VF 2R4GA 1QVTA 5K7ZA 3I53A 1K6YA 1UB9A 2K9QA 2XRNA 1VQNB 3V8KA 2JZYA 2MLKA 4OPOA 4F52A 4BNCA 3GXOA 2BV3A 4IHSA 4IW3B 4MQ9F 4YZXA 4XLCA 4RDUA 1X19A 4BQAA 4C30A 4B4CA 4HNTA 3ZUGA 4DIQA 2XKOA 1LVKA 5H5JA 1BQEA 3SUCA 3SYTA 2NZMA 1VQPB 3WTSC 1TT5B 2DA6A 1AIRA 1BM9A 1R1VA 2QF7A 1H85A 3C2GA 3CCYA 1UHWA 1HKTA 3BR1A 2KJCA 1LLWA 2CK3A 5BSYA 5FO5A 9ANTA 2OAZA 1QA1A 4XN3A 3H5AA 3WQZA 2V4DA 1DGWY 1XMXA 1S3JA 1COWA 3R4KA 3WGIA 1B8IA 3I4MJ 2X53S 2JMWA 2OBTA 1T6YA 3OS2A 2F1LA 3OOUA 2A6TA 1T6ZA 1QQ1A 2YPRA 2NV4A 3ZGKA 3PUMA 1PP7U 4UXNA 2IGMA 3OS1A 3M07A 4RB1A 3QFSA 4N4OB 1TQMA 4NBQA 4RM2A 1YJWI 2EFQA 1O3TA 4RAFA 4RD2A 1X2NA 1ETQA 3SJZA 1HW1A 4JP0A 1O8MA 4RGSA 1X3UA 2VPRA 2VPLA 2A6HF 2Z16A 1BW6A 4U4BA 3GFIA 2WBMA 3M7GA 4CQJA 1PUFB 2ZZQA 3GFLA 2M2EA 1XMAA 3H9GA 2LKSA 3BY1A 2K9NA 1P6RA 3K2AA 2V31A 4RCYA 2CFXA 4M74A 3CCMI 1FYKA 2FQ3A 2XUBA 1POGA 1EFTA 2ZL5A 2M3AA 3K4BA 2ZKZA 2EZKA 1P4WA 1E3ZA 3RKYA 1QGZA 2IOUG 2UUZA 1FZPB 3S1MJ 1V3FA 4HV5A 5HLGA 2OZUA 1JKOC 3CJRB 2PLYA 3CCVB 2D74A 2HWVA 2RV8A 3E3VA 2X1CA 2I5UA 5FFXA 1RUOA 3GVJA 2ZMEC 3MKLA 2N8GA 2KIQA 3KP5A 5EG0B 1E63A 1XTAA 3WTXC 2XAQA 2FNPA 4B44A 3PNVA 5M5WJ 2BXZA 4G6DA 3JAMZ 3G4SI 4X1EA 3W2FA 1MW7A 2CS3A 1KGSA 3KIOA 4XIDA 3W2AA 4M53A 3OSGA 3G71I 2KRCA 2X9DA 1FDRA 4WWCA 2JJ2A 2FRHA 3FKJA 1ERDA 4XMYA 1MSFC 1HZEA 2LY9A 3K1MA 2YUSA 1I7PA 2J5OA 1W2BB 1KYZA 1QHHD 4ZYAA 3AVYA 1HF2A 4OJ6A 3DKXA 5L3CA 1UG2A 1JUPA
chains in the Genus database with same CATH topology
2M7AA 3S93A 4BQOA 3HOSA 4MXNA 2V1NA 4Y4RA 4YXWA 4W8QA 2HVQA 3HC7A 1DQUA 3HPHA 4ASUA 2VQLA 3FBNB 3H5RA 2WAQA 3RSNA 4B48A 4I84A 3NE5B 4YZ0A 5KNLA 2VXZA 4ZDPA 1VJSA 2L2OA 4XKCA 4XORA 3UNGC 3WWGA 2VJIA 1TT0A 3AL0B 2VBMA 2DXIA 3A2KA 1JTAA 5CKTA 2P0WA 4G6TB 3I3LA 2GJRA 1KTWA 2WAEA 1D1CA 2K9MA 4HSTA 3LSGA 1MNDA 1IDJA 1J09A 3OYDA 4KJZA 3GQAA 2XF5A 3OYMA 2QE7A 4CZCA 1X1AA 4CCKA 2ZTNA 3N05A 4DBRA 2CV2A 4XQFA 2LZJA 2WPDA 1MMNA 2X3HA 5KCMA 1P9QC 2OUMA 1W36C 3M8JA 1X1DA 3DPLC 4X0GA 3ZXSA 4D1QA 1O8LA 2NTBA 3OEEA 1WPCA 4RLQA 1UD4A 3PL8A 4EATA 3MMYB 3EUKL 4U7BA 4E7IA 5FRMA 2IGKA 2NSTA 2I8DA 4PJNA 5JHFA 3DPTA 2M0MA 4II3A 1V0EA 3ZPNA 2MD0A 3K70C 4XN0A 4MR0A 2CMPA 4PUSA 4HEA2 1KZLA 3HG9A 4RMNA 5HOOA 3B90A 4D9JA 4ANJA 5HLTA 4BJ6C 4F91B 4KKUA 3PFYA 2HZDA 2GOMA 3PSIA 1QHGA 2R7OA 3BC8A 3G2BA 1E3XA 4BEHB 1FX0A 3H94A 3VSUA 2Q1ZB 2E60A 4PMHA 5FROA 4OJPA 1SAUA 2VBKA 4DJAA 2W6IA 3B8YA 4YRVA 4JQFA 1VBLA 1V0FA 2UV1A 3FDYA 3VYSB 2WSSA 1NG7A 1G59A 3DU5A 3QOEA 3LMMA 4BACA 1JI8A 4R79A 3F9KA 3IUOA 4NQWB 3ZPPA 1WJCA 2IS2A 1BOBA 3OYAA 3FBIB 3OR1C 4PK4A 1PJRA 1Z7LA 1D0ZA 3EUHC 2K5CA 3LFUA 4J01A 1UD6A 1EA3A 4KKSA 3T9GA 3BCBA 3QYFA 2JIZA 4LITA 2X51A 3UR3C 2NOJB 3LNNA 1VZ0A 2E1MB 1W9XA 3CZ6A 1X1CA 5CDFA 1GQ8A 3FHNA 3UW0A 2HNHA 2LOOA 2XC7A 4E7KA 1PKVA 4TT3A 4E7JA 2VBEA 1ZELA 3MKZA 1UD8A 3IAS2 1VF7A 4F92B 2DT7B 1MNEA 3CF2A 2HPIA 2XZOA 2DJIA 4HPQA 3DEEA 2OV7A 4P5OA 4L8JA 2O0WA 4G7XA 2LREA 1YX3A 4ZTJA 1SKYB 2HU9A 2LBFA 3E0JB 4E7HA 4ZC3A 4J00A 4XLFA 1JRGA 1OFMA 2ELJA 2M4GA 4FASD 2GJPA 4CA0A 2PJRB 1QCXA 2VIXA 1E79A 1W0KA 4XD7A 2A5WA 3K4JA 2R7VA 4DK1A 2WY7Q 5FRNA 3VMVA 2JDIA 1Z3XA 4Z03A 1OB0A 4W8RA 3BCFA 3DDYA 4DNTB 1OFLA 4NUBA 1G8XA 4IX7A 4CH7A 1O8EA 3BG7A 1IRXA 1BN8A 1BLIA 3PNTA 4BGDA 3TL4X 3OPOA 2INVA 1AA7A 3JURA 1PE9A 3A3BA 3K70D 3OL4A 2M4KA 3AFHA 4OZZA 2CV1A 3OR2C 3L2VA 1O8DA 5LD2C 4CUGA 2O1DA 2NTPA 3LSHA 3JU4A 3VYTB 2ZZGA 4PJJA 3V42A 3DKYA 3NWSA 2M5SA 3GVKA 3ZIAA 2VQCA 4C2UA 3OYJA 4CCMA 3QYEA 4URRA 3OYIA 2X6XA 4IQ4A 1E43A 1BHEA 1MMAA 1K5CA 2HPMA 1WJAA 1NRKA 5IK2A 3A1YA 1UD2A 3LMWA 2QKMB 4XM3A 2EWEA 4XR6A 2O5RA 1Y6IA 1FMWA 5CQGA 3DTKA 2V7QA 3DTEA 3OYHA 2HVRA 2W82A 4PFOA 1XG2A 3H35A 2X6YA 2GK6A 4E7LA 2ZZFA 3L2UA 2KHMA 5FL7A 4C2TA 1HA8A 4E4HA 3S3NA 3OIPA 2X6WA 3DWLE 4RLFA 3K6GA 3PJRA 1VLYA 2WY8Q 2FUG2 3K4NA 1O8FA 4QPOA 2CUZA 2IS4A 2ZTGA 3OEHA 3EPZA 3OE7A 3D5RC 2IQ7A 2VJ4A 1LKXA 3SEZA 3ZRGA 1H8HA 2GJKA 1PLUA 4F55A 4NC8A 2AQEA 1E0EA 3T51B 2NT6A 3U21A 2O17A 2R7UA 1YX5A 1V5EA 2MYSA 3KRGA 1V5GA 4HSRA 4XLAA 4EW9A 3BCAA 1D0YA 1Z3YA 3S32A 3VYRB 2CW8A 1X4PA 2IS6A 5CQEA 3H9QA 4PSWA 3NWTA 4OAYA 3K4LA 1Y56A 4AU7A 2LY1A 2HVSA 2F6CA 4DOZA 3BH4A 1R6RA 2DT6A 2MFZA 1O8IA 3OY9A 2V9KA 3H0DA 3OMYA 3IP4B 2K3PA 1BMFA 2L7KA 4XKBA 3FPPA 2LG4A 3RQ4A 3VSLA 1X4OA 4U49A 2INUA 3VMWA 2MABA 4P1WA 2NSPA 4FETA 3MKYB 1IDKA 2X85A 2JUGA 3HPGA 1DBOA 4AYBA 1EE6A 2DOAA 3LSIA 3MKWB 2F5VA 3OYLA 4ZDOA 4DNRB 3ZSCA 2VJ5A 3CJQB 4BDZA 3GVLA 3L2WA 1PYVA 2KLOA 2MC4A 2NTQA 2LH9A 2VL8A 4BUPA 3OYKA 1KCDA 3E1SA 1OGOX 1IB4A 2GOXB 3K4KA 4G6IA 1N77A 2W6JA 4LG3A 2E5NA 4Z06A 1H8EA 2R7RA 4AVZA 4PJMA 2KMUA 3ZQQA 4TSFA 2CV0A 1O8KA 2W00A 2F4IA 2XF6A 2WADA 3CESA 4HRIA 2Z6BD 3SEQA 2L9NA 3IAM2 3OYEA 3S8PA 1U0JA 2IGNA 2W1OA 4BEHA 2M7BA 1OHHA 2QXZA 4GRIA 3SDBA 2JJ1A 4CCNA 2ZFUA 1O8HA 1T5EA 2E5ZA 3KX2A 1GLNA 2WJVA 3GQBA 2Y0SA 4GQNA 4BL0B 4OJ5A 3OYBA 2XNDA 2ZZEA 2QKLB 1UG0A 3W3CA 2XAUA 2WB1A 2LY2A 1W36D 4KT6A 3MD2A 1E1QA 3A3GA 1RU4A 3EQOA 4F93B 3J7AY 3GQ8A 3T56B 2QY1A 3BLYA 4Z1MA 4F3QA 3GQ9A 4BJ5C 3HOTA 2WJYA 4NK8A 2DIEA 1LFPA 4HG2A 2D3LA 1NG6A 3TBIA 4BS9A 1NBMA 4B3XA 3CMMA 3K10A 3C2HA 1W0JA 2Z1DA 2CW7A 3ZR8X 4OAZA 4BJTA 2VKHA 3SZGA 4PFPA 4XKWA 3PNYA 3H5NA 3S3OA 3S3MA 1RMGA 3OAAA 3D5LA 1DP3A 3HAGA 2BSPA 2LBFB 1WMRA 1IA5A 1DGRM 1T0FC 5HVQC 3FY3A 2WA0A 4BU2A 2VJJA 3VSVA 3DLAA 1WJEA 2VKDA 2ZSIB 1YE9A 2VQGA 2PJRA 4II2A 1D1AA 4B47A 4KITB 1O88A 4ZJZA 1X0CA 2V26A 1Z21A 4BE1A 4NK6A 2JVHA 2VQHA 4E0FA 4BE2A 4FXUA 3W2WA 4DBQA 4UZUA 3CP2A 3GBGA 1BR1A 2Z8GA 2BW3B 3K4CA 3W2VA 5KHDA 4OJOA 1O8JA 1OGMX 3H9JA 1WJFA 2IS1A 2R9VA 3BG6A 2NT9A 3HL2A 2RQQA 5HNFA 2VB6A 2CFOA 1UD3A 5CPRB 4P22A 1V5FA 3OOCA 2KL4A 4LIVA 3VSTA 1S9HA 2AQFA 4LIUA 2UVFA 4ZDLA 5AMVA 3LL7A 1DBGA 4PSXA 4C2LA 3HXLA 2Q2EB 3CP8A 1EFRA 3DPUA 2DCEA 2W7NA 4KKTA 1H80A 2BVLA 4JMQA 2K9LA 3OS0A 4H4KC 4YELA 2PYHA 1MMDA 3AL0C 1PXZA 4OWRB 3DQVC 3A4CA 1KONA 2L5QA 3RPUD 4CCOA 2UWMA 3A35A 3GQ7A 1K28D 1KCCA 3ZCOA 4DGWB 4Z05A 3BC9A 3PSFA 1BR2A 1N75A 1D0XA 2WAFA 2CH0A 4IKFA 3GRHA 2VASA 3RTRA 4CSWA 3KYLA 3OYFA 4XLHA 3TMOA 3D5SC 4W8SA 1OR7C 2UVEA 2KQRA 3LSMA 2LRDA 4TKOB 5C1CA 4XLEA 1I18A 2KDOA 4HNUA 1KMHA 4PJLA 1WJDA 4YZAA 3HUGB 2ZXIA 4Y3OA 4OJLA 2PMZA 3LSKA 2VXDA 4E7SA 4IZZA 4JOMA 2R4GA 4XOPA 2F43A 2BVMA 1OOCA 2JVGA 2D3NA 4HWVA 3G05A 2BOLA 2CUJA 1K6YA 3VR6A 3B4NA 2LC2A 4QPQA 1TZLA 1T95A 2RREA 4XL9A 5LFAA 2V6EA 2HDWA 4IQJA 4F52A 2O04A 1BR4A 3L2QA 1UELB 3VDXA 4YZXA 4XOTA 4XLCA 2XDVA 1X19A 2KPMA 4C30A 4HNTA 4U87A 1HVXA 4YZQA 2X8KA 4DIQA 1NHCA 2KP6A 1LVKA 1WP6A 3OIQA 4OZYA 3SYTA 5HNHA 3SUCA 2NZMA 1AIRA 2VLAA 3OW7A 5C1EA 2BW3A 3C2GA 2E1BA 3BCDA 4ITVA 2HQAA 3QYBA 3VYUB 3VSKA 2E1MC 2CK3A 2XSJC 2R7TA 2KVOA 4B3FX 2O0VA 4XN3A 3H5AA 3WQZA 3M1CA 1DGWY 2V4DA 2PECA 1COWA 4DK0A 3OL3A 2X53S 2XOKA 2PYGA 3OS2A 2V7FA 3OOUA 1FMVA 2A6TA 2WZPP 4BQNA 3ZGKA 1X1BA 2R7QA 4MLOA 2IGMA 4NNJA 4E6KG 3OS1A 3KEWA 4N4OB 4RM3A 4BDYA 3OWTA 1WFXA 2KRHA 4RM2A 1QJVA 3ONQA 4BE0A 1LDKB 1E1RA 3FKSA 2Z2SB 2GK7A 2F1MA 1O8MA 1HG8A 1WJ5A 3OYNA 2RNGA 2VPLA 5HKKA 2ODLA 4Y33A 2Z16A 3RCOA 2ZSHB 3EUAA 2WBMA 4CCJA 3L2RA 4C9YA 2ZZQA 4U4BA 4HIZA 3HKZA 2V4JC 3H9GA 4E7ZA 2R7WA 1CZFA 1N78A 2V31A 1D1BA 4NC7A 4BXFA 2LYCA 2KZVA 1UAAA 4YEJA 2XF7A 4KISA 4ZTFA 2W4SA 2M3AA 3OYGA 2OC6A 3K4BA 4W8TA 5TGTA 1E3ZA 3QODA 4B3GA 4XNFA 2UUZA 1RWRA 2XGJA 3CJRB 2X1CA 1UD5A 2R7XA 3GVJA 2JSPA 2X1EA 3K4MA 4CCLA 4B43A 4XONA 1WTHD 2XZPA 2IXSA 4B44A 1BPLA 2QX3A 3PNVA 3I9V2 2IGOA 1MW7A 3AKZA 5DN6A 2CS3A 2ZXHA 3DTIA 1O8GA 3OFNA 3EQNA 3W2AA 1OLTA 3VWBA 2KRCA 2X1DA 2JJ2A 1WJBA 3FKJA 3DU6A 4XMYA 3OYCA 4N4NB 1MMGA 1QU3A 1ERDA 1HZEA 1I8DA 3T53B 2XZLA 2JA2A 2L9SA 1SFKA 2R7SA 1QHHD 4ZYAA 4BQQA 2HLDA 4OJ6A 3KEYA 3DKXA 4G7WA 4XKVA 3PUBA 1MABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KCD A;  5C1C A;  4XLE A;  1OGO X;  1IB4 A;  4MXN A;  4Z06 A;  4W8Q A;  3VMV A;  4YZA A;  4OJL A;  4Z03 A;  4AVZ A;  4W8R A;  1O8K A;  1OFL A;  1O8E A;  4I84 A;  4YZ0 A;  4XOP A;  1BN8 A;  3WWG A;  4XOR A;  1OOC A;  4HWV A;  2VJI A;  2QXZ A;  2VBM A;  3B4N A;  1JTA A;  2INV A;  3JUR A;  1PE9 A;  4XL9 A;  1KTW A;  1O8H A;  2O04 A;  4OZZ A;  4YZX A;  4XOT A;  4XLC A;  1O8D A;  1NHC A;  1IDJ A;  2O1D A;  4YZQ A;  2NTP A;  4OJ5 A;  4OZY A;  3SUC A;  3GQA A;  2NZM A;  1AIR A;  5C1E A;  4XQF A;  4URR A;  2X3H A;  2X6X A;  1RU4 A;  3EQO A;  1BHE A;  3GQ8 A;  1K5C A;  2QY1 A;  2O0V A;  2NTB A;  3GQ9 A;  1O8L A;  3LMW A;  4NK8 A;  4XN3 A;  4XM3 A;  2EWE A;  2PEC A;  4XR6 A;  2NST A;  2PYG A;  1XG2 A;  4XN0 A;  2X6Y A;  4MR0 A;  4XKW A;  2X6W A;  1RMG A;  2BSP A;  3B90 A;  1QJV A;  1WMR A;  1IA5 A;  3FY3 A;  3VSV A;  2VJJ A;  1O8M A;  1O8F A;  1HG8 A;  3VSU A;  2ODL A;  1O88 A;  1X0C A;  4PMH A;  4U4B A;  4OJP A;  2IQ7 A;  2VBK A;  4NK6 A;  3B8Y A;  1PLU A;  1CZF A;  1VBL A;  2Z8G A;  2NT6 A;  4OJO A;  1O8J A;  4YEJ A;  1OGM X;  2O17 A;  2NT9 A;  4W8T A;  3ZPP A;  4XNF A;  3KRG A;  4XLA A;  1RWR A;  4EW9 A;  3VST A;  2UVF A;  5AMV A;  3T9G A;  1DBG A;  4C2L A;  1O8I A;  4XON A;  1H80 A;  3UW0 A;  1GQ8 A;  2QX3 A;  4YEL A;  4U49 A;  2PYH A;  1PXZ A;  2INU A;  2VBE A;  3VMW A;  3EQN A;  1O8G A;  2NSP A;  1IDK A;  3GQ7 A;  2X85 A;  1DBO A;  1KCC A;  1EE6 A;  4Z05 A;  2O0W A;  4XMY A;  3ZSC A;  3GRH A;  4XLF A;  1JRG A;  1OFM A;  4XLH A;  4W8S A;  2UVE A;  4OJ6 A;  1QCX A;  2NTQ A;  4XKV A; 
#chains in the Genus database with same CATH topology
 3GTL J;  1VHO A;  2DJN A;  2M7A A;  4G7H F;  3GTP J;  2DW4 A;  2GXG A;  4MXN A;  2HMA A;  4W8Q A;  2QM3 A;  2CUE A;  4ASU A;  3HPH A;  2VQL A;  3HHH A;  1PJ7 A;  1FBU A;  1KU9 A;  2VC0 A;  1R5N A;  2IA1 A;  1IB0 A;  2X0K A;  4M3E A;  4MFD A;  4V2G A;  5C44 J;  3W2E A;  3VOD A;  5KNL A;  2K86 A;  4A3G J;  3HSF A;  1GAW A;  1VJS A;  4XKC A;  3UNG C;  4OIO F;  4Q7J B;  3S1Q J;  3WWG A;  3N4M A;  1QPI A;  1HDP A;  1W0T A;  4I99 C;  3CC2 B;  2VBM A;  2DXI A;  2HDN B;  2RC4 A;  3P26 A;  1XFO A;  1OYW A;  2ID6 A;  3I3L A;  2VBV A;  5EJC A;  3A8K A;  4P96 A;  1BW5 A;  5K5O A;  3FM5 A;  5GAG J;  5K1Y A;  3WYA A;  4ZGQ B;  3KP4 A;  2J8I A;  2DLL A;  5HLI A;  3LSP A;  5E18 F;  1HA3 A;  1BIA A;  3WGG A;  4FHT A;  4N9H A;  1PJ6 A;  2QSG X;  3I1F A;  3H0G J;  4KJZ A;  4RD4 A;  2XF5 A;  5LGU A;  2C4U A;  1SFX A;  2B9S A;  3PUF A;  3M8E A;  1IJE A;  1W34 A;  3PM1 A;  2CV2 A;  1ZKG A;  4JX4 A;  5EEG A;  1MMN A;  2DMP A;  4RB3 C;  2X3H A;  2YSR A;  1QA3 A;  3M8J A;  4WCG A;  4L18 B;  1ETX A;  2OU2 A;  5DCF A;  5IYW A;  1EXM A;  3KYD B;  4WXD A;  1UD4 A;  3PL8 A;  1NTC A;  2L3D A;  3MMY B;  4UUS A;  1WH5 A;  2NST A;  3HYI A;  5JHF A;  2OD5 A;  2M0M A;  4P9F A;  2ESN A;  4XN0 A;  1CNF A;  4A0Z A;  4PUS A;  4GXO A;  1YX2 A;  3HG9 A;  4I0B A;  4EH1 A;  5HOO A;  3CCL B;  2XPU A;  4M3D A;  2BEO A;  1AKH A;  4F91 B;  4KKU A;  2YUH A;  3N6Z A;  1XMK A;  2HZD A;  3PSI A;  4WF2 A;  3V7S A;  2P3M A;  1FOY A;  3RI4 A;  3SJP A;  2LKP A;  4A3B J;  1IZ1 A;  3VMF A;  4KNY A;  1DDI A;  1E3H A;  5FRO A;  4OJP A;  1RR8 C;  2OCE A;  3E6D A;  3F8M A;  5E1W A;  5KVR A;  2W24 A;  4KIC A;  3BPX A;  2W6I A;  4N3N A;  3KFW X;  4FX0 A;  5M5Y J;  2LMD A;  1OCR H;  1V0F A;  3DLL F;  2C5B A;  4M4S A;  2GLO A;  3FDY A;  3G73 A;  4U7D A;  4LBZ A;  4ESJ A;  3QOE A;  2QTZ A;  3IUO A;  4NQW B;  2ICW G;  2E1B A;  2FSW A;  4LBV A;  3ZPP A;  1G6N A;  2UZK A;  5FB2 A;  4U0V A;  4R1H A;  3OYA A;  1HKQ A;  2BE5 F;  4MEY F;  3J80 Z;  3LA3 A;  2W48 A;  4RPB A;  5HS9 A;  3EUH C;  1Z7L A;  3T9G A;  1XB4 A;  5IP7 J;  1FOK A;  1LVA A;  1W5S A;  2PG4 A;  3IWZ A;  3FJO A;  1RPW A;  2BHZ A;  3K0L A;  1MJ9 A;  2NOJ B;  3LNN A;  1VZ0 A;  2E1M B;  1GQ8 A;  3FHN A;  2OTJ I;  3R6K A;  5ED4 A;  2HNH A;  2LOO A;  2VON A;  4Q47 A;  4E7J A;  3MKZ A;  3CCE I;  1T38 A;  1JTX A;  2DT7 B;  2XZO A;  3U6B A;  2E1O A;  5LHH A;  3JRF A;  2OV7 A;  3S1R J;  3OSF A;  1WXR A;  1SMT A;  4L5J A;  3E0J B;  4E7H A;  5EF6 A;  2XGE A;  1JRG A;  1OFM A;  2M4G A;  3PA2 A;  4YC5 A;  1BC8 C;  3SJM A;  1NB9 A;  4CDG A;  2VIX A;  1TUI A;  1YLO A;  1IDZ A;  4QVA A;  3C7J A;  3K4J A;  2R7V A;  4M6X A;  1VQ7 I;  5M3M J;  4DK1 A;  2ELK A;  2WY7 Q;  3PQJ A;  3Q39 A;  4QUZ A;  2JDI A;  4Z03 A;  1V54 H;  2O8X A;  1OB0 A;  4A6D A;  3F72 A;  4DNT B;  1OFL A;  3R61 A;  1G8X A;  3CO6 C;  4CH7 A;  3BG7 A;  1IRX A;  1TNT A;  1X2M A;  3CMY A;  1IC8 A;  1J9Z A;  2M45 A;  3H3V K;  3PNT A;  2NNY A;  3SZE A;  1F4K A;  1FRQ A;  5D8L B;  1YI2 I;  3CW2 A;  4KIF A;  3S2D J;  5IT9 Z;  3JUR A;  1YJ9 B;  1R36 A;  2BZT A;  2CV1 A;  3QP5 A;  3S2H J;  4W1U A;  2E7X A;  1IN6 A;  3T1B A;  2IJL A;  1F60 A;  1D5Y A;  2M8E A;  1DAB A;  3VYT B;  2V7V A;  2NVT J;  5H2F C;  2CU7 A;  4A3D J;  1EP2 B;  4RGX A;  3ZIA A;  1QGP A;  3FXJ A;  3G1M A;  2QBY A;  1YW7 A;  4URR A;  4HQM A;  4PGO A;  2CRV A;  4RDK A;  1ON2 A;  2XGD A;  4N0B A;  3OYI A;  2NXN B;  1TBX A;  3T8R A;  1K5C A;  1WHU A;  1NRK A;  3A1Y A;  5DDG A;  2R3S A;  5D5U B;  2EWE A;  3KEQ A;  5F04 A;  3JAM K;  1T98 A;  4KT5 C;  1VQ9 I;  2GIZ A;  1FTZ A;  2BM1 A;  3OYH A;  1XGS A;  2P7V B;  4RB0 A;  3TO6 A;  2HVR A;  4DQK A;  4M6V A;  4M2L A;  3PFI A;  3B6C A;  2VBT A;  3H35 A;  2GK6 A;  4E7L A;  1SEU A;  4JRA C;  2BY3 A;  4C3J J;  2VNJ A;  1U9O A;  3BTJ A;  1HA8 A;  3L2C A;  3S3N A;  1R5H A;  1QVU A;  5ICG A;  1VLY A;  5JMC B;  2ELH A;  2IVM A;  3HHG A;  4QPO A;  2HYJ A;  4ACA A;  1RKT A;  4HAM A;  3OEH A;  3SEZ A;  3MVP A;  2UXN A;  1SM4 A;  1SD7 A;  4F55 A;  3T51 B;  1E0E A;  3RZD J;  2DA3 A;  3JRE A;  1TWF J;  3U21 A;  5BOX A;  3VO2 A;  1KYW A;  1LB2 A;  1B8I B;  3B73 A;  5FLX Z;  3ZQF A;  2FMY A;  5D6F A;  2R7U A;  5IPA A;  3SQV A;  1EJ9 A;  1ZRE A;  2BPO A;  2EQR A;  1P4M A;  3KRG A;  1V5G A;  4HF1 A;  1ZUN B;  4U0Y A;  3BCA A;  2X6O A;  4GYG A;  2GPJ A;  1X4P A;  5F27 A;  5CQE A;  3H9Q A;  2FA5 A;  2G7U A;  1Q9S A;  1AHD P;  2OBR A;  3K4L A;  4HX8 A;  4ZCL A;  3JRD A;  3VNV A;  4EJU A;  1UFM A;  4P55 A;  3M9A A;  2LFB A;  4C0S A;  3TED A;  1BMF A;  1F9N A;  3IP4 B;  2VNH A;  1ZN2 A;  2L7K A;  3AG2 H;  5GV7 A;  3FXR A;  2VNI A;  2Y0S N;  4U49 A;  1R71 A;  2R6H A;  1LDD A;  1ZAR A;  2RAE A;  4FET A;  2DK5 A;  3LQR A;  5A88 A;  3HOX J;  2DOA A;  2D1H A;  4EJO A;  3OYL A;  2A3S A;  4ON0 A;  3CJQ B;  3C2B A;  3ONU A;  1GXP A;  4UUT A;  4PGG A;  4BDZ A;  1KU2 A;  2C4T A;  3GVL A;  3L2W A;  3DCF A;  1PYV A;  3DEU A;  3JTG A;  1BI3 A;  5CVI A;  5K7H A;  2NTQ A;  2R5Y B;  3GFJ A;  2MBF A;  3SKB A;  1OGO X;  1X1P A;  3HEF A;  1YRN A;  4Z06 A;  1N77 A;  3PIP F;  4IPA A;  2WR8 A;  1QZY A;  2E1N A;  2CV0 A;  2KKO A;  2XPV A;  2WAD A;  2Z6B D;  3SEQ A;  3A1P A;  2FF4 A;  3RYR A;  5JLX A;  3LYC A;  2I10 A;  3ABK H;  5FLX K;  1J7K A;  4LLN A;  1QFJ A;  3I55 B;  2L7Z A;  2K27 A;  3AG4 H;  2BM0 A;  3SDB A;  4EJW A;  4BBR J;  1SD4 A;  2JJ1 A;  5ICC A;  2ZFU A;  2HOT A;  1O8H A;  2JUC A;  4BL0 B;  5KAI C;  1ZG3 A;  2NS0 A;  2HQR A;  2R7D A;  4P26 A;  2ZZE A;  1K4Z A;  3JX8 A;  2WB1 A;  2LF8 A;  2YX4 A;  3L7W A;  1W36 D;  3WTU C;  5JFR A;  3ZC3 A;  4XSZ F;  4AVP A;  2BBY A;  2KJB A;  3MD2 A;  4Z4V A;  1NB0 A;  1DU6 A;  4F93 B;  3BLY A;  1XCB A;  1FIA A;  3CCR B;  4A5M A;  2V79 A;  2A68 F;  4BJ5 C;  2K9S A;  1A8P A;  1YHQ B;  1LFP A;  4HG2 A;  1X3W B;  3BG3 A;  3ZZ0 A;  1H8A C;  3TBI A;  4BS9 A;  4S04 A;  4LB6 B;  5B1A H;  4LBW A;  1ETW A;  2VZL A;  3CLQ A;  4P1V A;  1IV6 A;  2K4J A;  2Z1D A;  2PJP A;  1ZRF A;  3K1P A;  3EUH A;  5EEH A;  4D0P A;  3GME A;  1W7P D;  3PNY A;  3WOD F;  1ONV A;  1AMO A;  1EH7 A;  5DEQ A;  2PEX A;  4I01 A;  1XS9 A;  3Q0V A;  2LBF B;  4W97 A;  3HAG A;  1WMR A;  3TO9 A;  4MHG A;  2WA0 A;  4M3F A;  3VSV A;  1I39 A;  3DLA A;  5IYQ A;  4YAW A;  2PJR A;  1GDT A;  3IRQ A;  4KIT B;  1R5B A;  4H0E A;  2TCT A;  2JVH A;  2O3F A;  4DBQ A;  2ZL7 A;  2YU3 A;  1BR1 A;  4IL6 C;  3J81 Z;  3H9N A;  1I5Z A;  1ENH A;  3QE2 A;  1S0U A;  1S72 I;  3ECO A;  2O7O A;  5GP9 A;  5GAE J;  4MTD A;  3C18 A;  1KK3 A;  2CFO A;  1FPQ A;  3H3U A;  2V1D A;  2PMZ N;  4D5F A;  1R7J A;  2HYF A;  1UD3 A;  1QNT A;  1V5F A;  2VYQ A;  2LR8 A;  3QFC A;  4P22 A;  2NVY J;  4TN1 A;  1OB2 A;  3VST A;  2UXX A;  4MYU A;  4LIU A;  2IT0 A;  2UVF A;  5AMV A;  4WK8 F;  1DBG A;  3HXL A;  4JX6 A;  3WU2 C;  2L9V A;  2Q2E B;  1ZYR F;  1O3R A;  1EFR A;  3DPU A;  4I84 A;  4ZYD A;  4UNO A;  1K4S A;  3WY9 A;  2PYH A;  4BY1 J;  1A6Q A;  2QUF A;  4C3I J;  3RKQ A;  1DU0 A;  2QBY B;  3A4C A;  3A35 A;  1K28 D;  1KCC A;  2E34 A;  2DQL A;  4Z05 A;  2H6C A;  1T56 A;  1BR2 A;  1IDY A;  1ZTR A;  3P9I A;  5H6R A;  2WAF A;  2CH0 A;  2HXO A;  2ZIT A;  2VAS A;  1YJW B;  4CSW A;  2F2E A;  5F1R A;  4W8S A;  4OOV A;  2UVE A;  1X3Z B;  2KQR A;  3LSM A;  4M3G A;  3DF8 A;  2FVG A;  1S7A A;  2HXI A;  4XLE A;  5LHG A;  2PIA A;  5KW9 A;  1KMH A;  4PJL A;  4X7D A;  3N90 A;  4Y3O A;  3BH7 B;  1TL8 A;  1Z0X A;  1XSV A;  4MFE A;  3E1Y E;  2LDU A;  4JOM A;  5IOY A;  2IRF G;  1GJR A;  2YWF A;  2MG4 A;  1YI2 B;  2ZBK A;  1W87 A;  2D3N A;  1LPQ A;  3W2I A;  3G05 A;  3ZBT A;  1RQR A;  3ZMU A;  4IJA A;  2LC2 A;  5F0F A;  3SEJ A;  2EZI A;  1QRB A;  1T95 A;  2CSO A;  4ZZL A;  4IQJ A;  1WGX A;  4Z4Z A;  2EZH A;  3L2Q A;  1WKM A;  1UEL B;  5DTD A;  1DDN A;  3VDX A;  1QRC A;  2KPM A;  3TP0 A;  4U87 A;  1AOY A;  5J8F A;  2F48 A;  4YZQ A;  5FNZ A;  5J35 A;  2B7C A;  2HGC A;  3FZV A;  2XB5 A;  3BR6 A;  2VOO A;  1J59 A;  3SLN A;  1WSR A;  3BCD A;  1OCC H;  4PC3 A;  2DBB A;  4BYY A;  1Y1V J;  4LMY A;  4XRF A;  3O6B B;  1I6X A;  2E1M C;  4A69 C;  1YJN B;  3GCM A;  3L09 A;  2H27 A;  1A5J A;  3EET A;  2KVO A;  1MBJ A;  1Z1D A;  5GAH J;  4MNU A;  4GGG A;  3HJE A;  3O8H A;  2CC2 A;  1XSX A;  3OL3 A;  1IJW C;  4TMX A;  2M5W A;  2XOK A;  3AVU A;  2GZW A;  5DD4 A;  2ZME A;  4HOB A;  4MGR A;  4WXC A;  5FD5 A;  3WTY C;  4FE7 A;  5FO1 A;  4BQN A;  3Q0U A;  4NNJ A;  2HR3 A;  2JTV A;  1GV2 A;  3HTS B;  4MTE A;  4UUV A;  2OTJ B;  1XX5 A;  1WFX A;  2HKX A;  4YFO A;  5D5V B;  1HW2 A;  1TYV A;  5AIQ A;  1KQ0 A;  1MDM A;  2GK7 A;  2G0E A;  3BZC A;  4PDK A;  2F1M A;  4YFN F;  2CQN A;  1HST A;  1HG8 A;  1YFH A;  4FQG A;  2ODL A;  5HKK A;  3OOP A;  1H9T A;  3L2R A;  1IJF A;  4AUX A;  4Y7C A;  4HIZ A;  4UV8 A;  2PMU A;  2ID3 A;  3OW2 B;  4E7Z A;  2A5Y B;  1QPM A;  1D1B A;  3ZPL A;  4ZYH A;  3L9F A;  2LYC A;  4BXF A;  2R0Q C;  1UAA A;  4YEJ A;  4M73 A;  2DYI A;  1JUS A;  5IYD J;  3CUO A;  2HDD A;  3JCU C;  5TGT A;  1K78 B;  1VLO A;  3IC7 A;  5D5X B;  4OPS A;  1MBG A;  3I59 A;  1FYL A;  1LNW A;  4A0X A;  1REP C;  5EGO A;  4UUS B;  1P7I A;  4MEX F;  1QBJ A;  1R49 A;  1KK0 A;  4H9G A;  3H09 A;  4X7C A;  1T08 B;  1Z91 A;  3W6V A;  1BI0 A;  1H9G A;  1ZG1 A;  3K4M A;  3Q6R A;  2ZFW A;  3AVX A;  5GTH C;  3BRO A;  2QX3 A;  1XC5 A;  4I6Z A;  2FX3 A;  1O7L A;  3OFN A;  4YEI A;  3HUG A;  1GHC A;  5FLM J;  3OJX A;  1OLT A;  3VWB A;  1K73 D;  2FQ4 A;  1JNY A;  1OGJ A;  2XAF A;  3OYC A;  4N4N B;  1QU3 A;  1U78 A;  1A35 A;  2QWW A;  2DA2 A;  1FNM A;  2L9S A;  3ZQC A;  1SFK A;  3ZZT A;  3NAR A;  1R5I D;  4BQQ A;  4B1R A;  3X2Q H;  4K2E A;  4XKV A;  1FSE A;  2QQB A;  3HRS A;  4EMS A;  3B78 A;  1MAB A;  1JJ8 C;  1LM1 A;  4BQO A;  1TNS A;  2V1N A;  3K9T A;  2HVQ A;  3HC7 A;  3S1N J;  1VQ9 B;  2FBH A;  3H5R A;  3JRH A;  3VO1 A;  1Z77 A;  3MQ0 A;  3SZT A;  3ZQI A;  3RZO J;  4WX9 A;  1MKM A;  2L2O A;  5HDG A;  3BY2 A;  3F8C A;  4XOR A;  2F5C A;  5EYR A;  5M5X J;  4ETS A;  2VJI A;  3P7N A;  2BHY A;  4HA8 A;  3ZN0 A;  1PP8 F;  1S29 A;  1NK3 P;  3AL0 B;  4Z4W A;  5CKT A;  1JTA A;  2FEZ A;  3NAU A;  2P0W A;  2NS7 A;  1O3S A;  4TMW A;  2KIM A;  3S15 J;  2BY0 A;  2GJR A;  5DS9 A;  5E3M A;  3V76 A;  2WAE A;  1KTW A;  1D1C A;  4AIK A;  1JT0 A;  1IRG A;  4W8T A;  2K9M A;  3ELK A;  5THX A;  4YCQ A;  3CME I;  2ME0 A;  2MW8 A;  2Y69 H;  1JTY A;  2NOG A;  1FNN A;  3TW6 A;  3ONY A;  5F1J A;  3GQA A;  2JPB A;  1L0O C;  3OYM A;  3HOU J;  2QE7 A;  4CCK A;  3N05 A;  1U5T B;  1JJ6 C;  2LZJ A;  2JSC A;  3BR0 A;  4YDT A;  3DEW A;  5KCM A;  1P9Q C;  1NH3 A;  3W5H A;  1W36 C;  1OFC X;  1X1D A;  3WTT C;  4D1Q A;  3F6O A;  2NTB A;  4KMU X;  4BHB A;  4EJT A;  2M8G X;  4V02 C;  1AWC A;  2HYG D;  4L5E A;  1ZH5 A;  1U2R A;  4J0Q A;  2AXL A;  3H36 A;  3CMA I;  2PFB A;  5FKO A;  4AC0 A;  3W5V A;  3QPS A;  3EUK L;  4U7B A;  1UMK A;  1HF0 A;  4Y7N J;  4U0W A;  3DPT A;  4II3 A;  3CC4 B;  3D0S A;  4KFC A;  2VC1 A;  4MYT A;  4MR0 A;  2P5K A;  3RYP A;  2R5Y A;  4AF6 A;  1KZL A;  1SAX A;  2VOP A;  1WCM J;  4D9J A;  4ANJ A;  5HLT A;  2DMN A;  1VHE A;  1R00 A;  3PFY A;  3IH2 A;  2GOM A;  3BC8 A;  1WDT A;  1BA5 A;  3H94 A;  3VSU A;  3JTH A;  4GCV A;  4V2F A;  1MBH A;  2WV1 A;  2L54 A;  4I98 B;  1QZZ A;  2BMW A;  4HYE A;  2WTE A;  4YRV A;  1S7O A;  4JBA A;  2VBY A;  4JQF A;  1B6A A;  5KAF C;  4RD1 A;  1KQ8 A;  1B4A A;  4OIN F;  1G7T A;  2UV1 A;  3E97 A;  5A8A A;  3JRG A;  3JRB A;  5FKM A;  3S17 J;  1TWA J;  1OKR A;  4YFX F;  3R60 A;  2GA1 A;  3LMM A;  1G59 A;  4R79 A;  2O9L A;  1F43 A;  1JI8 A;  2BF4 A;  1Q7Y D;  1YJN I;  3ZMV A;  2E35 A;  2QSH X;  1TW2 A;  3ZMZ A;  2RC5 A;  2ZL6 A;  4PC1 A;  2IS2 A;  3WU1 B;  1BOB A;  4G8X A;  1LFB A;  2HTS A;  3BTC A;  5J6X A;  3MCA A;  4FX4 A;  5KSW B;  1VQK I;  2OJE D;  2K5C A;  4J01 A;  2OCC H;  1APL C;  1EA3 A;  2EZL A;  4A93 J;  4HF0 A;  3FPK A;  1OMI A;  5AIP A;  2JIZ A;  2PLF A;  2YR2 A;  3ERM A;  1DPU A;  2P4W A;  4RDL A;  1I50 J;  3CCS B;  2XT4 A;  3CZ6 A;  1X1C A;  1U5T C;  3BOQ A;  3MZY A;  2XC7 A;  4E7K A;  3LO8 A;  4TT3 A;  3ZQL A;  4ROX A;  5M3F J;  1VF7 A;  2XTW A;  1QRY A;  4LK0 F;  4F92 B;  2RDP A;  2XGC A;  3RDI A;  3CUQ C;  2HPI A;  1TYU A;  5IYB J;  1R9T J;  2CJJ A;  2HFH A;  4L8J A;  2V9P A;  2DYS H;  4G7X A;  1GVJ A;  2LNB A;  3TQN A;  4ZTJ A;  4BBS J;  1Y8R B;  2LBF A;  2L4M A;  5CYV A;  3LAJ A;  2P5L C;  4ZC3 A;  4XLF A;  1TVC A;  4FAS D;  1LUJ B;  3CDI A;  4CA0 A;  3WHB A;  2PJR B;  1H0M A;  4XD7 A;  3P9K A;  1LE8 B;  2A5W A;  3RIR A;  3ASS A;  3LOC A;  4AC9 A;  3QP6 A;  3BJO A;  5FRN A;  1Z3X A;  2DFH A;  4TMV A;  4W8R A;  4GO1 A;  1O4X A;  1D8T A;  3MEX A;  3BP8 A;  1O8E A;  3WU0 A;  3WE2 A;  2A05 A;  4DYR A;  1KRH A;  1KQ5 A;  3CPX A;  4ABZ A;  1ETK A;  3SZP A;  1N0V C;  4IRH A;  4BGD A;  5L3B A;  1EV7 A;  2C6Y A;  1B72 B;  1NK2 P;  4CYC A;  1PE9 A;  1BI1 A;  2OK7 A;  3A3B A;  3WTV C;  3K70 D;  1B1B A;  2M4K A;  4QIW N;  1BX0 A;  2VFN A;  3OR2 C;  3KET A;  5DSZ A;  2O1D A;  5D4R A;  2RC6 A;  3U1D A;  3J7Z I;  2P5V A;  3COA C;  2QZ8 A;  4UAJ A;  2NTP A;  1WH7 A;  3V8L A;  3V42 A;  3KEO A;  3DBR B;  3EDP A;  4MIM A;  1XDU A;  3BZK A;  5IP9 J;  2BM4 A;  2DCU A;  4XRS G;  4X06 A;  2XAJ A;  1G4D A;  1BHE A;  1MMA A;  2EIM H;  1LEA A;  1F1Z A;  1WJA A;  5DCM A;  2ZBV A;  2QKM B;  4XM3 A;  5TY0 A;  5BMZ A;  1FY7 A;  3ROU A;  4L9T A;  1FC3 A;  2M34 A;  5CQG A;  1N08 A;  3RPU A;  2DPD A;  1VQ8 B;  4PFO A;  2VT3 A;  2PE3 A;  1XG2 A;  3SDG A;  2K40 A;  2A61 A;  2X6Y A;  2ME6 A;  3L2U A;  3FIS A;  4I02 A;  1FSH A;  3OIP A;  2X6W A;  3MAJ A;  5DUK A;  3K6G A;  5B66 C;  2BM6 A;  1Y0N A;  1O8F A;  5B3S H;  5LEJ A;  1G3T A;  2IQ7 A;  2FNA A;  3Q6Q A;  3KCC A;  3RKX A;  2JA8 J;  2GJK A;  2DY1 A;  3DFG A;  4BXX J;  2VKE A;  2NT6 A;  2Z3Y A;  5TIS C;  1OJL A;  3QFR A;  2PMH A;  2QGU A;  4RLZ A;  3PSS A;  1MH4 A;  5F4O A;  3LQQ A;  3T0Y A;  4DNC A;  1V5E A;  2DA5 A;  1A31 A;  1RES A;  2QEX I;  2MYS A;  5GPC A;  4EW9 A;  5C4J J;  1WSV A;  1Z3Y A;  4Y13 A;  4G1V A;  1DG1 G;  2GAU A;  3VEP A;  4PSW A;  1ULY A;  2QQA A;  4E70 A;  2JWT A;  1B2R A;  4F7D A;  1Y56 A;  1VND A;  3M1E A;  2HVS A;  2F6C A;  2LSO A;  4DOZ A;  3BH4 A;  1R6R A;  4HDV A;  1DAR A;  2DT6 A;  2MFZ A;  5HXB A;  2F3L A;  1B23 P;  1QO0 D;  2ADU A;  2XPW A;  1SD6 A;  1X4O A;  4M9X A;  3RQ4 A;  3JRA A;  3VMW A;  2Q6K A;  2NSP A;  2XAH A;  1EH8 A;  1E17 A;  3HRM A;  1P4A A;  1EFU A;  2PN6 A;  4B8X A;  1P2F A;  3LSI A;  3MKW B;  4P25 A;  3ZSC A;  3QU6 A;  3AG3 H;  1MDM B;  4IHX A;  3FXQ A;  1W5T A;  4P12 A;  1RC9 A;  3BJA A;  2O61 A;  4ENJ A;  1MZB A;  2X0L A;  3KP3 A;  5FO0 A;  2MC4 A;  4X0C A;  2VL8 A;  4BUP A;  1KCD A;  1W1W E;  5L3E A;  2B5O A;  4B4D A;  3K4K A;  1FWZ A;  1XN7 A;  3E5X A;  4LG3 A;  3PIO F;  1W0U A;  3GW2 A;  2H09 A;  2PBI A;  2KMU A;  3T8T A;  3ZQQ A;  3QU3 A;  2W00 A;  5DYM A;  5FKN A;  2Z33 A;  3CUQ A;  3IAM 2;  3LNQ A;  1MBK A;  1HDD C;  2GQQ A;  3SFI A;  1U0J A;  1FT9 A;  2LP0 A;  2M7B A;  2F5F A;  2EIJ H;  1FX7 A;  1R1U A;  1UCR A;  2JA7 J;  3B8H A;  3ZBU A;  5HS7 A;  4GRI A;  3JR9 A;  1A04 A;  2BN4 A;  1GT0 C;  4P2N A;  1T5E A;  3KX2 A;  3GQB A;  1OCP A;  1OYI A;  3I71 A;  1MBE A;  1U9N A;  2ZO4 A;  3OYB A;  2QKL B;  1RNL A;  2XAU A;  2YX7 A;  3LA7 A;  2LY2 A;  1R23 A;  3I54 A;  1ZR2 A;  4B3A A;  1VQ7 B;  2JPC A;  1E1Q A;  3EQO A;  5DCM B;  3HGG A;  1JKP C;  1Z9C A;  4WWV A;  2QY1 A;  4CO8 A;  4RS8 A;  5EEA A;  2C2W A;  4YIF A;  4FIS A;  2QDX A;  4NK8 A;  3GZ5 A;  1IRZ A;  4KUM A;  3GLX A;  1WSU A;  1GO2 A;  2DIE A;  1G7S A;  3A0H C;  2D3L A;  4B3X A;  3GZ6 A;  3LSR A;  3B6A A;  2XT2 A;  2DYR H;  1T6S A;  1WI3 A;  4OAZ A;  4BJT A;  2VKH A;  5E3L A;  3A0B C;  3JQP A;  2KFD A;  4OMZ A;  4XKW A;  3P4G A;  3H5N A;  2XB0 X;  3S3M A;  1VQ6 I;  3ZZU A;  1SC7 A;  1TQI A;  5HVQ C;  2Y31 A;  2CWE A;  3QOP A;  3ASR A;  2YS9 A;  2ZSI B;  1D1A A;  2P81 A;  5JLW A;  2OZ6 A;  3BT9 A;  3KPH A;  4XRM A;  1CNE A;  3GIR A;  1X0C A;  4NK6 A;  2VQH A;  1KJZ A;  4E0F A;  2VBX A;  2D2W A;  4IEJ A;  2Z8G A;  4PC6 A;  5D5W B;  2CQQ A;  3W2V A;  3TDZ C;  2X4H A;  3MHP A;  1WJF A;  2IS1 A;  3I4N J;  2NT9 A;  2DFE A;  1J5Y A;  1TTT A;  3PSZ A;  2NVU B;  2JT1 A;  3S14 J;  4EVI A;  2GXB A;  5CVR A;  3WG9 A;  3QWL A;  3ASN H;  3VPR A;  4ZDL A;  3LL7 A;  4PSX A;  2JA6 J;  2FJ1 A;  1U5T A;  2RGV A;  4X07 A;  2WZN A;  1ETV A;  4LD5 A;  3QSY A;  4KKT A;  3FMQ A;  2W7N A;  1H80 A;  3CO7 C;  4FTH A;  2CGP A;  1FOW A;  2K9L A;  1TTY A;  4H4K C;  1MMD A;  1S8N A;  3AL0 C;  4OWR B;  4P9S A;  1PXZ A;  2VFO A;  3DQV C;  4WXH A;  3J81 k;  2AHQ A;  1BN5 A;  2YU9 J;  1KON A;  2M1B A;  2L5Q A;  3RPU D;  2EK5 A;  3Q9S A;  1GUU A;  1DPR A;  1YIO A;  3PSF A;  2Y30 A;  3CB4 A;  4Z4S A;  3G6E I;  3F3X A;  1LEB A;  4UVA A;  4IHT A;  5F64 A;  4DZP A;  4OIQ F;  3OYF A;  4P3Y A;  1OR7 C;  2VUM J;  5HOD A;  4NB5 A;  4AM3 A;  1S4M A;  4M1K A;  3NAW A;  4ACB A;  3DU1 X;  3HB9 A;  1K78 A;  1JUM A;  3CDH A;  1I18 A;  4HNU A;  2BGJ A;  1WJD A;  4YZA A;  4OJL A;  4LFU A;  1BBY A;  3HKZ N;  5D4S A;  3E6B A;  4A3L J;  2WAQ N;  4D7M A;  4E7S A;  4YG2 F;  2F43 A;  3CQZ J;  5CVJ A;  1OOC A;  1LJ9 A;  4RA2 A;  5L3F A;  1ACI A;  1YIJ B;  3VR6 A;  4FE4 A;  4IVN A;  1VFC A;  1Y0Y A;  1TZL A;  3M8F A;  4NQW A;  1BJK A;  1XSD A;  2FX0 A;  2H6B A;  3JRI A;  2HDW A;  2PI0 A;  4OIR F;  2VKV A;  1BR4 A;  2ZCW A;  2E1C A;  4XOT A;  4BAY A;  5J4Y A;  3F0C A;  4IO9 F;  2X8K A;  1JJ2 B;  2KP6 A;  1XB2 A;  5A89 A;  2M30 A;  1BX1 A;  2HEO A;  2VLA A;  2J8K A;  2VBS A;  2DTR A;  2BW3 A;  5E8I A;  1LQ1 A;  2B0L A;  1TC3 C;  4N9I A;  1QFZ A;  2OQG A;  2EV0 A;  4ENM A;  1Q82 D;  3AGP A;  3G71 B;  2KIS A;  2O0V A;  3ULQ B;  2DA7 A;  4ZV4 A;  2EWN A;  2PEC A;  2DFF A;  2XNJ A;  5F0H A;  5A2Q K;  2M87 A;  3IKT A;  3CC7 B;  1SFU A;  3KE2 A;  1T6X A;  4AYB N;  1IW7 F;  2V7F A;  3F6V A;  2H8W A;  1QGY A;  3P27 A;  2WZP P;  1W35 A;  1CLW A;  2V5I A;  4E6K G;  2ZBU A;  3KEW A;  4RM3 A;  2XSD C;  4BDY A;  5LHI A;  3ZMD A;  4XSX F;  5EGO B;  3BQY A;  3CC7 I;  1VQL B;  1Y39 A;  1WI9 A;  1QJV A;  4BE0 A;  1E1R A;  3FKS A;  4HE6 A;  2AO9 A;  2K02 A;  1T33 A;  2CG4 A;  5H6Q A;  1WJ5 A;  5IOZ A;  2RNG A;  4XBF A;  1VQN I;  3RCO A;  3EUA A;  1EP3 B;  4IRI A;  3HKZ A;  2VBZ A;  1G7R A;  2OYN A;  1ZQ3 P;  4RGR A;  3NB2 A;  1KK2 A;  4NC7 A;  1GXQ A;  2VBU A;  1RUN A;  2XF7 A;  4C2M J;  4ZTF A;  4MO7 A;  5J1U A;  3OYG A;  2D5V A;  3WBK A;  4A3I J;  1S5L C;  3AVT A;  2MH2 A;  2MA3 A;  2Z5U A;  2CF4 A;  1VQL I;  5FIU A;  2EBI A;  5EZH A;  4HLY A;  1FP1 D;  1UD5 A;  5J3L A;  4A3M J;  4N3G A;  1TYX A;  3FXM A;  1BOA A;  2JSP A;  5ICF A;  2X1E A;  4KMF A;  4CCL A;  4UZF A;  1Z6T A;  4XON A;  3ZQH A;  1WTH D;  2XZP A;  1HQC A;  5LLQ A;  4YAF A;  2C5H A;  2H8R A;  5DN6 A;  3AKZ A;  1B9M A;  2ZXH A;  1O8G A;  2R7F A;  2BGC A;  2X1D A;  3TKY A;  2DK8 A;  1OIS A;  1WJB A;  2DTZ A;  2NAZ A;  3P5J A;  5BNG A;  2XKP A;  1LFU P;  2ZNY A;  2WPD A;  2HTJ A;  2NPF A;  2XZL A;  2RKH A;  4BHC A;  1IAW A;  1WOS A;  1N0U A;  3GFM A;  1ZG5 A;  3Q0W A;  4G7W A;  3CJN A;  3PUB A;  3U2R A;  3WTZ A;  4IRG A;  5KK1 A;  1K7A A;  1VQ4 I;  4YXW A;  4Y4R A;  2HQ5 A;  1NJI D;  2OBP A;  3FBN B;  3HOW J;  2DI3 A;  3SY2 A;  3W6J B;  3HM5 A;  2JRM A;  4HF2 A;  4YZ0 A;  2ZB9 A;  4Z2Y A;  2B0R A;  5BQT A;  3MZ8 A;  4NC6 A;  2DU9 A;  2JN9 A;  1STZ A;  4HLX A;  3I4P A;  1AU7 A;  5BSX A;  2E1R A;  4HST A;  1ZLJ A;  3S16 J;  3GWZ A;  3LSG A;  1TQP A;  1YQA A;  5FKK A;  2H94 A;  3LJY A;  4OPW A;  1JT6 A;  3OYD A;  2Q6O A;  2KT0 A;  2HI3 A;  3F8B A;  2OA4 A;  4XQF A;  4X6A J;  3CCE B;  2RN7 A;  4D5C A;  1J75 A;  4Q5S F;  2V7T A;  1KC8 D;  4IF4 A;  3TDU C;  1H42 A;  1VQM I;  5E17 F;  3ZXS A;  3BQJ A;  3JQR A;  2WB1 N;  2QEX B;  5AN9 A;  1IN5 A;  2E7W A;  1O8L A;  1WPC A;  4RLQ A;  3F23 A;  2CND A;  5FRM A;  1G3Y A;  4CHU A;  2IGK A;  4BH9 A;  4PJN A;  1V0E A;  3OZV A;  3ZPN A;  2DEU A;  3I58 A;  2MD0 A;  3K70 C;  5J3O A;  3NEU A;  4RBO A;  1R4M B;  4RAG A;  1LLZ A;  2LTP A;  2QVO A;  5HLH A;  2ZJQ F;  1FTT A;  5H59 A;  5H20 A;  2V7W A;  3WG7 H;  2VE9 A;  3B90 A;  2NRA C;  1FLI A;  2HQN A;  2A69 F;  5TRD A;  1I3A A;  2R7O A;  1TWG J;  3BTI A;  2V6C A;  3G2B A;  3FK7 A;  5CJ9 A;  1FX0 A;  3WXM A;  2O6W A;  1BIB A;  2Q1Z B;  2D9R A;  3MMP A;  2E60 A;  2LF7 A;  4PMH A;  3AVW A;  1SAU A;  1HOM A;  1ITY A;  4YAU A;  3KLN A;  4DJA A;  4A6E A;  3B8Y A;  4XLP F;  4OOS A;  1VBL A;  3CCQ I;  3D1N I;  3AK5 A;  3KZY A;  2ACJ A;  1XPX A;  1TWH J;  2WSS A;  1Z05 A;  2CQ7 A;  3DU5 A;  3E5U A;  4BAC A;  3P9C A;  3A03 A;  4CXF A;  1QA6 A;  2GM4 A;  1FEX A;  2QN6 A;  5J40 A;  3WE3 A;  3CXC B;  4DW6 A;  4PAB A;  3FBI B;  5J1R A;  3CCU B;  4OOI A;  2DN0 A;  4OIP F;  3LFU A;  1RR7 A;  1UD6 A;  4ZCI A;  4AIJ A;  3LSJ A;  2JQ7 A;  1HXD A;  2X51 A;  4HW0 A;  2AXT C;  5FFZ A;  1MH3 A;  4JK1 X;  3VFZ A;  3LVB A;  1W9X A;  2GWR A;  2Z9O A;  3KLO A;  3SHF A;  3ES9 A;  2FXA A;  4FCY A;  1PKV A;  1SFE A;  3IAS 2;  4CIC A;  1MNE A;  4IOA F;  1EZG A;  1DUX C;  1QVF B;  2CBX A;  2Y9Y A;  3BDD A;  3U6K A;  4P5O A;  3O8G A;  4I0A A;  1ZGA A;  4CYC B;  1LE8 A;  4GYI A;  3ML6 A;  5GAD J;  1YX3 A;  1SKY B;  2YWE A;  2HU9 A;  2NYX A;  3KZZ A;  5B5E C;  4BY7 J;  4ZZD A;  5FA6 A;  2OBS A;  2W7Z A;  3PET A;  3B82 A;  1G3W A;  1W0K A;  1XGO A;  1P92 A;  1B9N A;  4P6Y A;  5JR3 A;  2VI6 A;  1I1G A;  2QQ8 A;  4WZE A;  4Z4Y A;  3IWF A;  2EV5 A;  2L7M P;  2XAG A;  4M71 A;  1OPC A;  3HOV J;  3BCF A;  1VI0 A;  3DDY A;  4OPV A;  2A07 F;  5CLS A;  1N8R D;  4NUB A;  3ABM H;  3J81 K;  4IX7 A;  3MN2 A;  4EV0 A;  1OFD A;  1WRJ A;  1I27 A;  1XCV A;  3WGH A;  1BN8 A;  2XRL A;  3H92 A;  3C1D A;  5AON A;  3A8J A;  3G1O A;  5IY5 H;  2INV A;  2MC3 A;  1AA7 A;  3CCJ I;  2QLZ A;  1VQP I;  3R0J A;  4EGZ A;  3OL4 A;  3K7A J;  5CVV A;  3DV8 A;  4EQQ A;  3H3Z A;  1O3Q A;  1VQ5 I;  1VQ8 I;  3CCS I;  5LD2 C;  5E6T A;  4G1B A;  3LSH A;  3V7R A;  1PDN C;  3JU4 A;  4RD0 A;  2L02 A;  1EF4 A;  2ZZG A;  4HNV A;  3DKY A;  3NWS A;  2Q2E A;  1CQX A;  2JK3 A;  3I0T A;  2VQC A;  2EFW A;  4XLN F;  1JHH A;  3OYJ A;  2OF7 A;  4Y9R A;  1IF1 A;  3JW4 A;  2EV6 A;  4M6Y A;  2X6X A;  4AD9 A;  3WTW C;  4HBL A;  4PZJ A;  5CVU A;  3IH3 A;  3LMW A;  3QPL A;  3UKG A;  1MIJ A;  2J5P A;  3BZ6 A;  4XR6 A;  1JA1 A;  2O5R A;  4AF7 A;  3MZH A;  3FX3 A;  1ZGW A;  3HBL A;  3DTK A;  3DTE A;  4UY8 I;  4Q4Z F;  1FBS A;  2HOS A;  1T2K A;  3BJ6 A;  1T0F A;  2ZZF A;  5BPD A;  2V7U A;  1W5C C;  3LQE A;  4C2T A;  3DP7 A;  5FL7 A;  3S2W A;  2VNK A;  3BTL A;  1FYM A;  4A3E J;  4XK4 A;  3U2Q A;  1E3P A;  2EIX A;  3ASQ A;  5HZA A;  2C77 A;  2EJR A;  1JE8 A;  2IS4 A;  3SQN A;  3ZMS A;  2ZTG A;  1IV8 A;  5K5Q A;  5J1Y A;  3OE7 A;  4QSH A;  5FD6 A;  1EWY A;  2VJ4 A;  4L5I A;  3RPQ A;  2EA4 A;  3ZRG A;  5C3E J;  1H8H A;  2DOF A;  1M1E B;  1JKQ C;  5DM6 F;  2R5Z B;  4NC8 A;  1GVH A;  4X7E A;  2AQE A;  1E3O C;  4RD6 A;  2DA1 A;  1UZC A;  5IT3 A;  1QFY A;  2EFG A;  4NHJ A;  2O17 A;  2DMU A;  2V1U A;  1HC8 A;  3WNB A;  2LLK A;  3CCM B;  4I76 A;  4YHB A;  2Q6I A;  2K85 A;  1YX5 A;  1MGT A;  3GTG J;  2ZME B;  4NCN A;  4HSR A;  2L4A A;  4EGY A;  1D0Y A;  1W4M A;  2QEN A;  3Q38 A;  1E2X A;  2VT2 A;  4UHT A;  3NWT A;  4OAY A;  5ERI A;  3ZQ7 A;  3LA2 A;  4AU7 A;  1OCO H;  4I7H A;  1O8I A;  1Y0R A;  1O57 A;  1HKS A;  2H1L A;  3OMY A;  2K3P A;  3FXU A;  3H0D A;  4XKB A;  3ABL H;  3CCR I;  2LG4 A;  2LD5 A;  3HDD A;  1IHM A;  3ABT A;  5IYR A;  2BX6 A;  2ECC A;  2INU A;  3A01 A;  2HZT A;  1XQB A;  2DO7 A;  2MAB A;  3AVV A;  5C4X J;  3MKY B;  1IDK A;  1OFE A;  3PUN A;  2X85 A;  1A6I A;  3HPG A;  5B1B H;  4AYB A;  1IG7 A;  2QCO A;  4KA4 A;  3IL2 A;  4V19 K;  2F5V A;  2B63 J;  3GTQ J;  4ZDO A;  1NDH A;  1YW8 A;  2VJ5 A;  2C78 A;  1R5G A;  4G7Z F;  1T39 A;  3WND A;  3I59 B;  5IYN A;  1TYW A;  3R0A A;  1YIJ I;  4LOC A;  3OYK A;  3KP6 A;  3E1S A;  4TMT A;  3HTU A;  2QYU A;  4BXU A;  4D7N A;  2W6J A;  1J9I A;  1H8E A;  4DQL A;  3HZJ A;  3V7C A;  1ZM4 A;  4TSF A;  1JHF A;  5J47 A;  3PEN A;  1O8K A;  3ZMT A;  3RKW A;  2GXA A;  3J7A O;  2L9N A;  4G6Q A;  5J8C A;  1SVO A;  3N97 A;  4L9J A;  4IXA A;  3ISP A;  4P9U A;  2FU4 A;  2XGX A;  2PMD A;  1W7P A;  6PAX A;  4CZZ A;  1OHH A;  4L0Y B;  4ZYG A;  2L01 A;  2F4O B;  3GUD A;  4BKX A;  4CCN A;  4QLC U;  4IHV A;  1E62 A;  1MJA A;  2E5Z A;  2TRT A;  4UVB A;  4GQN A;  4KDP A;  2DPU A;  2XND A;  3DBL B;  3EQL F;  1WQ2 A;  2IAI A;  3E6C C;  2VFM A;  4RM0 A;  5FLV A;  1N06 A;  4KT6 A;  3OKX A;  1WZ2 A;  1RZ4 A;  1RU4 A;  3IHU A;  1IXC A;  4Z4R A;  2W57 A;  4Z1M A;  3CMA B;  2G7H A;  3HOT A;  2WJY A;  2Y2Z A;  3FM3 A;  1BI2 A;  3PQK A;  3G6E B;  1NBM A;  2EPF A;  2VE8 A;  1JGG A;  3CCL I;  3K10 A;  2YWH A;  1W0J A;  1CF7 B;  4WZL A;  1D8K A;  1TLH B;  3GYH X;  4PFP A;  2R92 J;  1KQS B;  1V5V A;  4TMZ A;  2VBW A;  3S3O A;  1RMG A;  1D1N A;  1Q1V A;  3D5L A;  3G1L A;  1KTV A;  4IOC F;  1M1K D;  5DS0 A;  1DGR M;  3HGY A;  2IA2 A;  3TH0 A;  1U2W A;  5HZB A;  4BU2 A;  2VJJ A;  5L3D A;  1WJE A;  3MFK A;  2VQG A;  1RKW A;  3RJP A;  4KH3 A;  3HOY J;  1FBQ A;  2V26 A;  1Z21 A;  5IP6 A;  2COB A;  4BE2 A;  4FXU A;  3TP3 A;  4RDJ A;  2WV0 A;  2EIL H;  3CP2 A;  3GBG A;  1FNC A;  4UZU A;  3SXY A;  2DDB A;  2EA2 A;  2AS5 F;  1R22 A;  3IRR A;  3K4C A;  4OJO A;  3O3K A;  2GBY A;  2ZXW H;  1ZHF A;  2M9H A;  1V4R A;  3H9J A;  3W2G A;  2FD5 A;  2QMU A;  2R9V A;  1VQK B;  1Y1W J;  1TSP A;  5EMN A;  1S6L A;  3ZP5 A;  2O6G E;  3I55 I;  2XRO A;  1G3S A;  4Z4U A;  3FMS A;  4LIV A;  4A5N A;  1S9H A;  2AQF A;  2Q6L A;  1D8J A;  5ILS A;  3BWG A;  1K8A D;  2A6E F;  1IGN A;  2BM5 A;  5A2Q Z;  1OR7 A;  2BVL A;  3ZN1 A;  4YEL A;  4EM0 B;  3GX4 X;  2FML A;  4QFM A;  3RQI A;  1C0W A;  1MNM C;  4LG0 B;  2UWM A;  2K7L A;  4OU0 A;  5L3G A;  1L3L A;  1D2E A;  1BJA A;  4DGW B;  3BC9 A;  1UMQ A;  3VB2 A;  2D1V A;  4PGH A;  1N75 A;  3JRC A;  4RD3 A;  3GRH A;  3DKW A;  1IRF A;  1OYY A;  2W84 A;  4LG0 A;  4XLH A;  3AGQ A;  4P3I A;  3D5S C;  1Q81 D;  4WQM A;  2ISZ A;  2LRD A;  1JB9 A;  4TKO B;  2FBI A;  1TP4 A;  5HDN A;  2KDO A;  2IEK A;  2ZXI A;  2IA0 A;  3Q3A A;  1FP2 A;  5DNS A;  3LSK A;  1YJ9 I;  4IZZ A;  1R5O A;  1H89 C;  4XOP A;  1A36 A;  3QFT A;  2MSY A;  2VN2 A;  2X3U A;  2BVM A;  2JVG A;  4HWV A;  2BOL A;  2CUJ A;  2K3F A;  1YIT I;  4C3H J;  3B4N A;  2HS5 A;  1ETY A;  4QPQ A;  4YAL A;  4OP7 A;  1WWX A;  2RRE A;  4XL9 A;  5LFA A;  2V6E A;  5C1E A;  3HSR A;  2O04 A;  3B02 A;  2KDZ A;  1BJZ A;  2XDV A;  1HVX A;  1NHC A;  2QTL A;  5F4J A;  2PQ8 A;  2DT5 A;  5D6E A;  4HX4 A;  2DMT A;  1FJL A;  1WP6 A;  3OIQ A;  4LLG F;  5E3N A;  5HNH A;  3F22 A;  1BL0 A;  4OZY A;  1I1S A;  3RIQ A;  2XHK A;  3OW7 A;  3CF5 F;  3V7A A;  2QQ9 A;  4ITV A;  2HQA A;  5LRR A;  1CQT A;  3QYB A;  3VYU B;  2Z99 A;  3VSK A;  2QA4 B;  2VFP A;  1EP1 B;  3VOE A;  3A8I A;  2XSJ C;  2R7T A;  4B3F X;  1DDG A;  1JKR C;  3BR2 A;  2B7B A;  1CGP A;  3M1C A;  5ICE A;  3K1N A;  1YG2 A;  1YO5 C;  1ON1 A;  2E36 A;  3W5U A;  3KZI C;  4DK0 A;  2F4M B;  2GA2 A;  4Z6Y A;  2O8K A;  3FIW A;  1CF7 A;  4WZK A;  3JSO A;  3CD6 B;  2PYG A;  2EB7 A;  4YFK F;  3OZW A;  1FMV A;  4QHY A;  4A12 A;  1MD0 A;  1VTN C;  1X1B A;  2R7Q A;  1K83 J;  4MLO A;  5LMZ A;  3QPH A;  2VOD A;  3OWT A;  2KRH A;  4A3C J;  3OJW A;  3CPW B;  1F20 A;  3ONQ A;  3HRT A;  2P6T A;  1KA8 A;  1LDK B;  1SAN A;  2Z2S B;  4R71 A;  3QPT A;  4A0Y A;  2XV4 S;  2ZJP F;  4Y15 A;  1LDJ A;  4G9Y A;  3OYN A;  4XRS A;  2BYV E;  4Y33 A;  4CCJ A;  3CCU I;  2ZC2 A;  2ZSH B;  1FIP A;  4C9Y A;  3FXL A;  5E8G A;  2V4J C;  4CYD A;  3QRF F;  5JBQ A;  2PX9 A;  2R7W A;  1CZF A;  1N78 A;  2BGI A;  3ERE D;  4UVC A;  3WNC A;  2KZV A;  1U8R A;  5E1X A;  1N05 A;  4KIS A;  1PVE A;  1YTY A;  2BY1 A;  2DFI A;  2W4S A;  2I1L A;  2YWG A;  2OC6 A;  4L0Z B;  3ISX A;  2WYR A;  1VQO B;  3C3W A;  3E20 A;  3QOD A;  1WOP A;  4B3G A;  4XNF A;  3DBH B;  3HSE A;  4ASN A;  4HX7 A;  1U3E M;  4RB2 C;  4QVJ A;  1D5V A;  1W7P B;  4G5G A;  1RWR A;  2ISY A;  2XGJ A;  1YS7 A;  1QX4 A;  2ZXJ A;  4X05 A;  1EH6 A;  4HQE A;  3CRZ A;  2R7X A;  5LBQ A;  3F8N A;  1XD7 A;  3ESW B;  1OQY A;  4B09 A;  4B43 A;  2DOG A;  4KN4 X;  1VQM B;  2IXS A;  4RAY A;  1ZGJ A;  4A3F J;  1BPL A;  2IW5 A;  3I9V 2;  1ZR4 A;  1ORK A;  2IGO A;  5LEK A;  3EQN A;  2KZG A;  3DTI A;  1L1I A;  4M9S A;  2CRG A;  4NDL A;  4KN7 X;  3I56 I;  4A3J J;  1QA2 A;  3L1P A;  5LGT A;  1P7J A;  1Z7U A;  2JA5 J;  3DU6 A;  1I8D A;  4M3B A;  1MMG A;  3FXO A;  3T53 B;  1EKE A;  1EA0 A;  1MJB A;  2GIV A;  2DQR A;  2JA2 A;  2R7S A;  2ESH A;  1ZM2 A;  3K2Z A;  2RVC A;  5L46 A;  2HLD A;  3KEY A;  1V55 H;  4LGW A;  4KIG A;  5FJ8 J;  1OCZ H;  3HOS A;  3S93 A;  3FKI J;  4O5V A;  3KL9 A;  3PA1 A;  1UHM A;  1N25 A;  1DQU A;  5F6F A;  3H1C A;  1NHA A;  4I2O A;  2WAQ A;  2Y48 A;  2QSF X;  2V1X A;  2G9W A;  3RSN A;  3BPV A;  4B48 A;  2D45 A;  1KU7 A;  2VXZ A;  3NE5 B;  5EZG A;  4ZDP A;  2NVQ J;  4K1X A;  5TV2 A;  2QZA A;  2EFO A;  1TT0 A;  3A2K A;  2OTL B;  2STT A;  1HCR A;  3SYJ A;  1SD5 A;  4G6T B;  2EFP A;  3LAP A;  3M3Y J;  1QZE A;  4DYC A;  4AID A;  4QTR A;  5F4M A;  4UV9 A;  1TW3 A;  3L00 A;  3Q5F A;  1MMS A;  1FNB A;  1MND A;  4UZE A;  1IDJ A;  2IPQ X;  2MD5 A;  1J09 A;  5FGM A;  1S7E A;  1PUF A;  4CZC A;  1X1A A;  2ZTN A;  1I3Q J;  4DBR A;  3HOZ J;  1B72 A;  2G0Y A;  2DDA A;  1QQI A;  2E71 A;  3FHZ A;  2OUM A;  1U8B A;  2E2I J;  3DPL C;  4X0G A;  2R93 J;  3CUQ B;  1R4N B;  5LGN A;  2O0Y A;  3IH4 A;  3OEE A;  1WPK A;  3MWM A;  5IYC J;  4EAT A;  3ABU A;  4S05 A;  4O6J A;  1MBF A;  2GQF A;  4E7I A;  1J2X A;  2I8D A;  2GRE A;  2F5D A;  2OPT A;  2CMP A;  2F5E A;  3F8F A;  1ZM3 A;  2R7Z J;  3V8J A;  1QGA A;  2L0K A;  2L9R A;  4HEA 2;  5K7F A;  4RMN A;  1XG1 A;  4OM9 A;  5E1Z B;  2FOK A;  4JYK A;  4BJ6 C;  4A3K J;  4KIB A;  5JI6 A;  1QHG A;  2OK8 A;  1E3X A;  1IXR C;  4BEH B;  4M0L A;  2QYO A;  5E79 C;  3GSI A;  3AAF A;  1JXS A;  3G3Z A;  2P8T A;  2VBK A;  1G7C A;  1VQ6 B;  1J0R A;  4AIH A;  3I5U A;  4UB8 C;  3BG5 A;  3BH6 B;  3NQO A;  1SVM A;  5F08 A;  3VYS B;  2V7X A;  3SFZ A;  1NG7 A;  3F9K A;  3KYC B;  1SFO J;  2P6S A;  1R58 A;  3TGN A;  4PC7 A;  3JQQ A;  1WJC A;  2Y75 A;  4PCQ A;  3OR1 C;  4PK4 A;  1PJR A;  1QG0 A;  1S72 B;  1D0Z A;  2CYY A;  2EIK H;  2RQP A;  4KKS A;  3KP2 A;  2MGQ A;  4EM1 A;  3BCB A;  4PC2 A;  3HRU A;  3QYF A;  1U6G A;  2NS8 A;  4LIT A;  5ILV A;  4RPD A;  3UR3 C;  1YW9 A;  3WHC A;  4I09 A;  4UB6 C;  5EDN A;  5CDF A;  4JX5 A;  3UW0 A;  3R6S A;  2XNC A;  2VBE A;  2ECB A;  2E2H J;  4HV6 A;  1ZEL A;  3GTO J;  5HDK A;  3BQZ A;  4O3M A;  4OMY A;  1IUF A;  2LKX A;  4XIC A;  2ZNZ A;  1UD8 A;  2XAS A;  3CF2 A;  1SMY F;  1B59 A;  2DJI A;  4HPQ A;  3DEE A;  3I64 A;  1YLF A;  2H1K A;  2O0W A;  4M72 A;  2ZJ2 A;  2LRE A;  3U1K A;  3V4G A;  4ENK A;  3PO2 J;  3CJT B;  4DZJ A;  4J00 A;  3PVD A;  3SLD A;  1GV5 A;  2CW0 F;  5DM7 F;  2ELJ A;  2HCJ B;  2VFQ A;  2GJP A;  4X8I A;  1HLV A;  1K6O A;  5GTI C;  1E79 A;  5IYP A;  1QCX A;  1IN7 A;  3BR5 A;  2E19 A;  3O2P E;  4LB5 A;  3G4S B;  1VQ5 B;  3GVA A;  3MCZ A;  1IN8 A;  1ZK8 A;  4LK1 F;  4GFB A;  4Y17 A;  3VMV A;  1YRN B;  1Q86 D;  3K69 A;  1R1T A;  2XVC A;  2JJ7 A;  1X58 A;  4QWQ A;  4MQV A;  3D26 A;  4ZCM A;  3Q3S A;  1XDS A;  3A02 A;  3GF2 A;  2COM A;  2ZJR F;  4FT8 A;  4ZH4 F;  1BLI A;  2EIN H;  3TL4 X;  1JA0 A;  3U9G A;  1OGI A;  1USS A;  1T8I A;  3OPO A;  5LRS A;  5TR9 A;  3I56 B;  3AFH A;  4EM2 A;  1RI7 A;  3WBJ A;  2TDX A;  4OZZ A;  3IKV A;  2WWY A;  3GZN B;  1Y0U A;  3L2V A;  1SKQ A;  1O8D A;  2XTX A;  4CUG A;  2XC1 A;  5E3O A;  1KQ9 A;  4PJJ A;  2M5S A;  3GVK A;  4M9Z A;  4C2U A;  4CCM A;  3CC2 I;  2MH9 A;  3QYE A;  1KK1 A;  1VQ4 B;  4IQ4 A;  1E43 A;  2LK2 A;  2HPM A;  5IK2 A;  3E7L A;  2DMQ A;  1UD2 A;  5EG0 A;  1YOV B;  2EFN A;  2KRF A;  4G7O F;  1AIP A;  1Y6I A;  5TJJ A;  1FMW A;  1YYV A;  1VF9 A;  1ZAO A;  1RIO H;  1FND A;  2V7Q A;  1WOR A;  2O03 A;  2W82 A;  1IN4 A;  2DOE A;  1HW5 A;  1GVD A;  3CLO A;  3HIF A;  3LFK A;  4G12 A;  4IHW A;  3GLL A;  4AWX B;  2AHO A;  3PO3 J;  2KHM A;  4X7F A;  4L9V A;  4ZGN B;  4E4H A;  4LC0 A;  3DWL E;  4RLF A;  3PJR A;  2FBK A;  2Y9Z A;  2WY8 Q;  1EFC A;  1K61 A;  2FUG 2;  3ZQG A;  2X48 A;  5HS8 A;  3K4N A;  5DV5 A;  1OCT C;  3RY8 A;  2CUZ A;  3EPZ A;  1N07 A;  3CCJ B;  3D5R C;  3T5X A;  1JGS A;  4WZT A;  1LKX A;  3OIO A;  1PLU A;  1ZRC A;  1K4T A;  2DER A;  1VQO I;  5D8K B;  1K9M D;  3TOA A;  1OB5 A;  3GO5 A;  4TV7 A;  1FOX A;  3CTA A;  3IV5 A;  4S0H B;  4LBY A;  4RJL A;  2W85 A;  1G2H A;  3VNU A;  2Q0O A;  2OQR A;  4RGU A;  2CQK A;  4XLA A;  4U88 A;  3S32 A;  3GTK J;  3GTJ J;  3VYR B;  2CW8 A;  1PUE E;  2E2J J;  2IS6 A;  1HBX G;  1GAQ A;  1Y8Q B;  1WOO A;  4DYQ A;  2LY1 A;  2STW A;  1GR1 A;  1QUE A;  1UHS A;  3OY9 A;  2V9K A;  4HZF A;  1F5T A;  3OZU A;  4Z4T A;  3FPP A;  2DAO A;  2HOA A;  3VSL A;  4L9N A;  4IHY A;  5GPA A;  3AST A;  1YS6 A;  4P1W A;  3ML3 A;  2EH3 A;  1KZH A;  2HDC A;  1HSJ A;  4HE5 A;  2JUG A;  1DBO A;  1EE6 A;  1QH0 A;  4FN5 A;  3FMR A;  4DNR B;  2BSA A;  3Q9V A;  1O7F A;  2RNJ A;  4HDU A;  2BXY A;  2BVN A;  3M4O J;  3FF5 A;  2BV6 A;  3ASO H;  2KLO A;  1YIT B;  2QA4 I;  1ZRD A;  1XGM A;  2LH9 A;  5DD8 A;  4BHP A;  4ESB A;  2BY2 A;  1WU8 A;  1IB4 A;  2GOX B;  4G6I A;  3F21 A;  2E5N A;  2R7R A;  4AVZ A;  4PJM A;  1XGN A;  4Y52 J;  5JVT A;  2F4I A;  2XF6 A;  3CES A;  2NVX J;  4HRI A;  3R6J A;  3W6K B;  5BPI A;  2ETH A;  2OTL I;  2L7F P;  1WVR A;  3S8P A;  3OYE A;  3JSP A;  2IGN A;  3OP1 A;  1Z6R A;  2W1O A;  4BEH A;  2QXZ A;  4F7Z A;  4Y9U A;  4RCZ A;  2CO5 A;  4ENN A;  1GLN A;  1ZLK A;  2WJV A;  2Y0S A;  1I6H J;  1ZM9 A;  4DQ2 A;  3E5Q A;  3LST A;  5JVG F;  4OJ5 A;  4YIR X;  2HOE A;  4RAZ A;  2F4N A;  4EJV A;  3QQA A;  4A2U A;  1UG0 A;  3W3C A;  4EEF G;  4FK8 A;  3KP7 A;  1E64 A;  1TLL A;  3GEZ A;  5GV8 A;  3CME B;  1DP7 P;  5DUI A;  3A3G A;  3GQ8 A;  3J7A Y;  2MLG A;  1SVL A;  3T56 B;  3BY6 A;  2DOD A;  1D3Y A;  4F3Q A;  3GQ9 A;  3W2H A;  5F0C A;  1KU3 A;  2FOW A;  3ZOB A;  5IT9 K;  4LJZ F;  1NG6 A;  3CMM A;  2WC2 A;  4G94 A;  3C2H A;  1QVG B;  3J80 K;  3CCV I;  2CW7 A;  1Q1H A;  3ZR8 X;  2R5Z A;  5BS6 A;  2XEX A;  4YAO A;  3SZG A;  1BC7 C;  1IO2 A;  5JHU A;  2CQX A;  1MRZ A;  5FKL A;  3OAA A;  1UJ8 A;  1DP3 A;  4BPR A;  2BSP A;  1IUY A;  2FE3 A;  3LQ6 A;  1IA5 A;  3FY3 A;  1T0F C;  1MSE C;  3CC4 I;  3CCQ B;  3TW7 A;  1Z67 A;  2VKD A;  2CW5 A;  1YE9 A;  4II2 A;  4B47 A;  1RQP A;  1O88 A;  3DXJ F;  4ZJZ A;  3E6M A;  3REO A;  1F36 A;  2KIF A;  3FWE A;  4LLL A;  4BE1 A;  3ASP A;  4PJ0 C;  3BR3 A;  3W2W A;  1H88 C;  2CUF A;  3FXK A;  2BW3 B;  2HKO A;  2W25 A;  5E20 A;  5KHD A;  4Q48 A;  1O8J A;  1OGM X;  4PAA A;  2IBD A;  1ELO A;  3BG6 A;  3BNW A;  3A01 B;  3HL2 A;  4U9U A;  5ILU A;  2RQQ A;  5HNF A;  4FWT A;  2VB6 A;  4QV2 A;  1ETO A;  1K79 A;  4CGZ A;  5CPR B;  3OOC A;  3FK6 A;  2KL4 A;  4ESF A;  4J19 A;  1XE1 A;  1UST A;  3ECH A;  2IP2 A;  3GTM J;  3NRV A;  1P4X A;  4C2L A;  4C43 A;  3TOB A;  3CP8 A;  5JLV C;  2BM7 A;  1FRN A;  2DCE A;  2LVS A;  2XIG A;  2J7K A;  4JMQ A;  3OV8 A;  1KD1 D;  2P7C B;  2QGG A;  3TO7 A;  3OS0 A;  3BG9 A;  2B7E A;  1PJ5 A;  1ODD A;  4ZYE A;  3EYI A;  1RET A;  2JRT A;  4NBS A;  1K8F A;  2DA4 A;  2KIU A;  4CCO A;  3CD6 I;  4GDF A;  3GQ7 A;  3ZCO A;  5J4V A;  2Q8K A;  3AG1 H;  5K5R A;  3LWF A;  1YHQ I;  1D0X A;  3J7Y J;  1IXS B;  1AKH B;  4IKF A;  3RTR A;  4KYW A;  2K4B A;  2V9V A;  2JN6 A;  3KYL A;  1QUF A;  1M90 D;  3TMO A;  2M0C A;  4R8H A;  2NNN A;  3EYY A;  5C1C A;  2Y0M A;  2DET A;  3CDL A;  1TWC J;  2XTY A;  4YII A;  4OOX A;  5B6I A;  3HUG B;  1RRJ A;  2PMZ A;  2VXD A;  3QAH A;  4P6V F;  2R4G A;  1QVT A;  5K7Z A;  3I53 A;  1K6Y A;  1UB9 A;  2K9Q A;  2XRN A;  1VQN B;  3V8K A;  2JZY A;  2MLK A;  4OPO A;  4F52 A;  4BNC A;  3GXO A;  2BV3 A;  4IHS A;  4IW3 B;  4MQ9 F;  4YZX A;  4XLC A;  4RDU A;  1X19 A;  4BQA A;  4C30 A;  4B4C A;  4HNT A;  3ZUG A;  4DIQ A;  2XKO A;  1LVK A;  5H5J A;  1BQE A;  3SUC A;  3SYT A;  2NZM A;  1VQP B;  3WTS C;  1TT5 B;  2DA6 A;  1AIR A;  1BM9 A;  1R1V A;  2QF7 A;  1H85 A;  3C2G A;  3CCY A;  1UHW A;  1HKT A;  3BR1 A;  2KJC A;  1LLW A;  2CK3 A;  5BSY A;  5FO5 A;  9ANT A;  2OAZ A;  1QA1 A;  4XN3 A;  3H5A A;  3WQZ A;  2V4D A;  1DGW Y;  1XMX A;  1S3J A;  1COW A;  3R4K A;  3WGI A;  1B8I A;  3I4M J;  2X53 S;  2JMW A;  2OBT A;  1T6Y A;  3OS2 A;  2F1L A;  3OOU A;  2A6T A;  1T6Z A;  1QQ1 A;  2YPR A;  2NV4 A;  3ZGK A;  3PUM A;  1PP7 U;  4UXN A;  2IGM A;  3OS1 A;  3M07 A;  4RB1 A;  3QFS A;  4N4O B;  1TQM A;  4NBQ A;  4RM2 A;  1YJW I;  2EFQ A;  1O3T A;  4RAF A;  4RD2 A;  1X2N A;  1ETQ A;  3SJZ A;  1HW1 A;  4JP0 A;  1O8M A;  4RGS A;  1X3U A;  2VPR A;  2VPL A;  2A6H F;  2Z16 A;  1BW6 A;  4U4B A;  3GFI A;  2WBM A;  3M7G A;  4CQJ A;  1PUF B;  2ZZQ A;  3GFL A;  2M2E A;  1XMA A;  3H9G A;  2LKS A;  3BY1 A;  2K9N A;  1P6R A;  3K2A A;  2V31 A;  4RCY A;  2CFX A;  4M74 A;  3CCM I;  1FYK A;  2FQ3 A;  2XUB A;  1POG A;  1EFT A;  2ZL5 A;  2M3A A;  3K4B A;  2ZKZ A;  2EZK A;  1P4W A;  1E3Z A;  3RKY A;  1QGZ A;  2IOU G;  2UUZ A;  1FZP B;  3S1M J;  1V3F A;  4HV5 A;  5HLG A;  2OZU A;  1JKO C;  3CJR B;  2PLY A;  3CCV B;  2D74 A;  2HWV A;  2RV8 A;  3E3V A;  2X1C A;  2I5U A;  5FFX A;  1RUO A;  3GVJ A;  2ZME C;  3MKL A;  2N8G A;  2KIQ A;  3KP5 A;  5EG0 B;  1E63 A;  1XTA A;  3WTX C;  2XAQ A;  2FNP A;  4B44 A;  3PNV A;  5M5W J;  2BXZ A;  4G6D A;  3JAM Z;  3G4S I;  4X1E A;  3W2F A;  1MW7 A;  2CS3 A;  1KGS A;  3KIO A;  4XID A;  3W2A A;  4M53 A;  3OSG A;  3G71 I;  2KRC A;  2X9D A;  1FDR A;  4WWC A;  2JJ2 A;  2FRH A;  3FKJ A;  1ERD A;  4XMY A;  1MSF C;  1HZE A;  2LY9 A;  3K1M A;  2YUS A;  1I7P A;  2J5O A;  1W2B B;  1KYZ A;  1QHH D;  4ZYA A;  3AVY A;  1HF2 A;  4OJ6 A;  3DKX A;  5L3C A;  1UG2 A;  1JUP A; 
#chains in the Genus database with same CATH homology
 2M7A A;  3S93 A;  4BQO A;  3HOS A;  4MXN A;  2V1N A;  4Y4R A;  4YXW A;  4W8Q A;  2HVQ A;  3HC7 A;  1DQU A;  3HPH A;  4ASU A;  2VQL A;  3FBN B;  3H5R A;  2WAQ A;  3RSN A;  4B48 A;  4I84 A;  3NE5 B;  4YZ0 A;  5KNL A;  2VXZ A;  4ZDP A;  1VJS A;  2L2O A;  4XKC A;  4XOR A;  3UNG C;  3WWG A;  2VJI A;  1TT0 A;  3AL0 B;  2VBM A;  2DXI A;  3A2K A;  1JTA A;  5CKT A;  2P0W A;  4G6T B;  3I3L A;  2GJR A;  1KTW A;  2WAE A;  1D1C A;  2K9M A;  4HST A;  3LSG A;  1MND A;  1IDJ A;  1J09 A;  3OYD A;  4KJZ A;  3GQA A;  2XF5 A;  3OYM A;  2QE7 A;  4CZC A;  1X1A A;  4CCK A;  2ZTN A;  3N05 A;  4DBR A;  2CV2 A;  4XQF A;  2LZJ A;  2WPD A;  1MMN A;  2X3H A;  5KCM A;  1P9Q C;  2OUM A;  1W36 C;  3M8J A;  1X1D A;  3DPL C;  4X0G A;  3ZXS A;  4D1Q A;  1O8L A;  2NTB A;  3OEE A;  1WPC A;  4RLQ A;  1UD4 A;  3PL8 A;  4EAT A;  3MMY B;  3EUK L;  4U7B A;  4E7I A;  5FRM A;  2IGK A;  2NST A;  2I8D A;  4PJN A;  5JHF A;  3DPT A;  2M0M A;  4II3 A;  1V0E A;  3ZPN A;  2MD0 A;  3K70 C;  4XN0 A;  4MR0 A;  2CMP A;  4PUS A;  4HEA 2;  1KZL A;  3HG9 A;  4RMN A;  5HOO A;  3B90 A;  4D9J A;  4ANJ A;  5HLT A;  4BJ6 C;  4F91 B;  4KKU A;  3PFY A;  2HZD A;  2GOM A;  3PSI A;  1QHG A;  2R7O A;  3BC8 A;  3G2B A;  1E3X A;  4BEH B;  1FX0 A;  3H94 A;  3VSU A;  2Q1Z B;  2E60 A;  4PMH A;  5FRO A;  4OJP A;  1SAU A;  2VBK A;  4DJA A;  2W6I A;  3B8Y A;  4YRV A;  4JQF A;  1VBL A;  1V0F A;  2UV1 A;  3FDY A;  3VYS B;  2WSS A;  1NG7 A;  1G59 A;  3DU5 A;  3QOE A;  3LMM A;  4BAC A;  1JI8 A;  4R79 A;  3F9K A;  3IUO A;  4NQW B;  3ZPP A;  1WJC A;  2IS2 A;  1BOB A;  3OYA A;  3FBI B;  3OR1 C;  4PK4 A;  1PJR A;  1Z7L A;  1D0Z A;  3EUH C;  2K5C A;  3LFU A;  4J01 A;  1UD6 A;  1EA3 A;  4KKS A;  3T9G A;  3BCB A;  3QYF A;  2JIZ A;  4LIT A;  2X51 A;  3UR3 C;  2NOJ B;  3LNN A;  1VZ0 A;  2E1M B;  1W9X A;  3CZ6 A;  1X1C A;  5CDF A;  1GQ8 A;  3FHN A;  3UW0 A;  2HNH A;  2LOO A;  2XC7 A;  4E7K A;  1PKV A;  4TT3 A;  4E7J A;  2VBE A;  1ZEL A;  3MKZ A;  1UD8 A;  3IAS 2;  1VF7 A;  4F92 B;  2DT7 B;  1MNE A;  3CF2 A;  2HPI A;  2XZO A;  2DJI A;  4HPQ A;  3DEE A;  2OV7 A;  4P5O A;  4L8J A;  2O0W A;  4G7X A;  2LRE A;  1YX3 A;  4ZTJ A;  1SKY B;  2HU9 A;  2LBF A;  3E0J B;  4E7H A;  4ZC3 A;  4J00 A;  4XLF A;  1JRG A;  1OFM A;  2ELJ A;  2M4G A;  4FAS D;  2GJP A;  4CA0 A;  2PJR B;  1QCX A;  2VIX A;  1E79 A;  1W0K A;  4XD7 A;  2A5W A;  3K4J A;  2R7V A;  4DK1 A;  2WY7 Q;  5FRN A;  3VMV A;  2JDI A;  1Z3X A;  4Z03 A;  1OB0 A;  4W8R A;  3BCF A;  3DDY A;  4DNT B;  1OFL A;  4NUB A;  1G8X A;  4IX7 A;  4CH7 A;  1O8E A;  3BG7 A;  1IRX A;  1BN8 A;  1BLI A;  3PNT A;  4BGD A;  3TL4 X;  3OPO A;  2INV A;  1AA7 A;  3JUR A;  1PE9 A;  3A3B A;  3K70 D;  3OL4 A;  2M4K A;  3AFH A;  4OZZ A;  2CV1 A;  3OR2 C;  3L2V A;  1O8D A;  5LD2 C;  4CUG A;  2O1D A;  2NTP A;  3LSH A;  3JU4 A;  3VYT B;  2ZZG A;  4PJJ A;  3V42 A;  3DKY A;  3NWS A;  2M5S A;  3GVK A;  3ZIA A;  2VQC A;  4C2U A;  3OYJ A;  4CCM A;  3QYE A;  4URR A;  3OYI A;  2X6X A;  4IQ4 A;  1E43 A;  1BHE A;  1MMA A;  1K5C A;  2HPM A;  1WJA A;  1NRK A;  5IK2 A;  3A1Y A;  1UD2 A;  3LMW A;  2QKM B;  4XM3 A;  2EWE A;  4XR6 A;  2O5R A;  1Y6I A;  1FMW A;  5CQG A;  3DTK A;  2V7Q A;  3DTE A;  3OYH A;  2HVR A;  2W82 A;  4PFO A;  1XG2 A;  3H35 A;  2X6Y A;  2GK6 A;  4E7L A;  2ZZF A;  3L2U A;  2KHM A;  5FL7 A;  4C2T A;  1HA8 A;  4E4H A;  3S3N A;  3OIP A;  2X6W A;  3DWL E;  4RLF A;  3K6G A;  3PJR A;  1VLY A;  2WY8 Q;  2FUG 2;  3K4N A;  1O8F A;  4QPO A;  2CUZ A;  2IS4 A;  2ZTG A;  3OEH A;  3EPZ A;  3OE7 A;  3D5R C;  2IQ7 A;  2VJ4 A;  1LKX A;  3SEZ A;  3ZRG A;  1H8H A;  2GJK A;  1PLU A;  4F55 A;  4NC8 A;  2AQE A;  1E0E A;  3T51 B;  2NT6 A;  3U21 A;  2O17 A;  2R7U A;  1YX5 A;  1V5E A;  2MYS A;  3KRG A;  1V5G A;  4HSR A;  4XLA A;  4EW9 A;  3BCA A;  1D0Y A;  1Z3Y A;  3S32 A;  3VYR B;  2CW8 A;  1X4P A;  2IS6 A;  5CQE A;  3H9Q A;  4PSW A;  3NWT A;  4OAY A;  3K4L A;  1Y56 A;  4AU7 A;  2LY1 A;  2HVS A;  2F6C A;  4DOZ A;  3BH4 A;  1R6R A;  2DT6 A;  2MFZ A;  1O8I A;  3OY9 A;  2V9K A;  3H0D A;  3OMY A;  3IP4 B;  2K3P A;  1BMF A;  2L7K A;  4XKB A;  3FPP A;  2LG4 A;  3RQ4 A;  3VSL A;  1X4O A;  4U49 A;  2INU A;  3VMW A;  2MAB A;  4P1W A;  2NSP A;  4FET A;  3MKY B;  1IDK A;  2X85 A;  2JUG A;  3HPG A;  1DBO A;  4AYB A;  1EE6 A;  2DOA A;  3LSI A;  3MKW B;  2F5V A;  3OYL A;  4ZDO A;  4DNR B;  3ZSC A;  2VJ5 A;  3CJQ B;  4BDZ A;  3GVL A;  3L2W A;  1PYV A;  2KLO A;  2MC4 A;  2NTQ A;  2LH9 A;  2VL8 A;  4BUP A;  3OYK A;  1KCD A;  3E1S A;  1OGO X;  1IB4 A;  2GOX B;  3K4K A;  4G6I A;  1N77 A;  2W6J A;  4LG3 A;  2E5N A;  4Z06 A;  1H8E A;  2R7R A;  4AVZ A;  4PJM A;  2KMU A;  3ZQQ A;  4TSF A;  2CV0 A;  1O8K A;  2W00 A;  2F4I A;  2XF6 A;  2WAD A;  3CES A;  4HRI A;  2Z6B D;  3SEQ A;  2L9N A;  3IAM 2;  3OYE A;  3S8P A;  1U0J A;  2IGN A;  2W1O A;  4BEH A;  2M7B A;  1OHH A;  2QXZ A;  4GRI A;  3SDB A;  2JJ1 A;  4CCN A;  2ZFU A;  1O8H A;  1T5E A;  2E5Z A;  3KX2 A;  1GLN A;  2WJV A;  3GQB A;  2Y0S A;  4GQN A;  4BL0 B;  4OJ5 A;  3OYB A;  2XND A;  2ZZE A;  2QKL B;  1UG0 A;  3W3C A;  2XAU A;  2WB1 A;  2LY2 A;  1W36 D;  4KT6 A;  3MD2 A;  1E1Q A;  3A3G A;  1RU4 A;  3EQO A;  4F93 B;  3J7A Y;  3GQ8 A;  3T56 B;  2QY1 A;  3BLY A;  4Z1M A;  4F3Q A;  3GQ9 A;  4BJ5 C;  3HOT A;  2WJY A;  4NK8 A;  2DIE A;  1LFP A;  4HG2 A;  2D3L A;  1NG6 A;  3TBI A;  4BS9 A;  1NBM A;  4B3X A;  3CMM A;  3K10 A;  3C2H A;  1W0J A;  2Z1D A;  2CW7 A;  3ZR8 X;  4OAZ A;  4BJT A;  2VKH A;  3SZG A;  4PFP A;  4XKW A;  3PNY A;  3H5N A;  3S3O A;  3S3M A;  1RMG A;  3OAA A;  3D5L A;  1DP3 A;  3HAG A;  2BSP A;  2LBF B;  1WMR A;  1IA5 A;  1DGR M;  1T0F C;  5HVQ C;  3FY3 A;  2WA0 A;  4BU2 A;  2VJJ A;  3VSV A;  3DLA A;  1WJE A;  2VKD A;  2ZSI B;  1YE9 A;  2VQG A;  2PJR A;  4II2 A;  1D1A A;  4B47 A;  4KIT B;  1O88 A;  4ZJZ A;  1X0C A;  2V26 A;  1Z21 A;  4BE1 A;  4NK6 A;  2JVH A;  2VQH A;  4E0F A;  4BE2 A;  4FXU A;  3W2W A;  4DBQ A;  4UZU A;  3CP2 A;  3GBG A;  1BR1 A;  2Z8G A;  2BW3 B;  3K4C A;  3W2V A;  5KHD A;  4OJO A;  1O8J A;  1OGM X;  3H9J A;  1WJF A;  2IS1 A;  2R9V A;  3BG6 A;  2NT9 A;  3HL2 A;  2RQQ A;  5HNF A;  2VB6 A;  2CFO A;  1UD3 A;  5CPR B;  4P22 A;  1V5F A;  3OOC A;  2KL4 A;  4LIV A;  3VST A;  1S9H A;  2AQF A;  4LIU A;  2UVF A;  4ZDL A;  5AMV A;  3LL7 A;  1DBG A;  4PSX A;  4C2L A;  3HXL A;  2Q2E B;  3CP8 A;  1EFR A;  3DPU A;  2DCE A;  2W7N A;  4KKT A;  1H80 A;  2BVL A;  4JMQ A;  2K9L A;  3OS0 A;  4H4K C;  4YEL A;  2PYH A;  1MMD A;  3AL0 C;  1PXZ A;  4OWR B;  3DQV C;  3A4C A;  1KON A;  2L5Q A;  3RPU D;  4CCO A;  2UWM A;  3A35 A;  3GQ7 A;  1K28 D;  1KCC A;  3ZCO A;  4DGW B;  4Z05 A;  3BC9 A;  3PSF A;  1BR2 A;  1N75 A;  1D0X A;  2WAF A;  2CH0 A;  4IKF A;  3GRH A;  2VAS A;  3RTR A;  4CSW A;  3KYL A;  3OYF A;  4XLH A;  3TMO A;  3D5S C;  4W8S A;  1OR7 C;  2UVE A;  2KQR A;  3LSM A;  2LRD A;  4TKO B;  5C1C A;  4XLE A;  1I18 A;  2KDO A;  4HNU A;  1KMH A;  4PJL A;  1WJD A;  4YZA A;  3HUG B;  2ZXI A;  4Y3O A;  4OJL A;  2PMZ A;  3LSK A;  2VXD A;  4E7S A;  4IZZ A;  4JOM A;  2R4G A;  4XOP A;  2F43 A;  2BVM A;  1OOC A;  2JVG A;  2D3N A;  4HWV A;  3G05 A;  2BOL A;  2CUJ A;  1K6Y A;  3VR6 A;  3B4N A;  2LC2 A;  4QPQ A;  1TZL A;  1T95 A;  2RRE A;  4XL9 A;  5LFA A;  2V6E A;  2HDW A;  4IQJ A;  4F52 A;  2O04 A;  1BR4 A;  3L2Q A;  1UEL B;  3VDX A;  4YZX A;  4XOT A;  4XLC A;  2XDV A;  1X19 A;  2KPM A;  4C30 A;  4HNT A;  4U87 A;  1HVX A;  4YZQ A;  2X8K A;  4DIQ A;  1NHC A;  2KP6 A;  1LVK A;  1WP6 A;  3OIQ A;  4OZY A;  3SYT A;  5HNH A;  3SUC A;  2NZM A;  1AIR A;  2VLA A;  3OW7 A;  5C1E A;  2BW3 A;  3C2G A;  2E1B A;  3BCD A;  4ITV A;  2HQA A;  3QYB A;  3VYU B;  3VSK A;  2E1M C;  2CK3 A;  2XSJ C;  2R7T A;  2KVO A;  4B3F X;  2O0V A;  4XN3 A;  3H5A A;  3WQZ A;  3M1C A;  1DGW Y;  2V4D A;  2PEC A;  1COW A;  4DK0 A;  3OL3 A;  2X53 S;  2XOK A;  2PYG A;  3OS2 A;  2V7F A;  3OOU A;  1FMV A;  2A6T A;  2WZP P;  4BQN A;  3ZGK A;  1X1B A;  2R7Q A;  4MLO A;  2IGM A;  4NNJ A;  4E6K G;  3OS1 A;  3KEW A;  4N4O B;  4RM3 A;  4BDY A;  3OWT A;  1WFX A;  2KRH A;  4RM2 A;  1QJV A;  3ONQ A;  4BE0 A;  1LDK B;  1E1R A;  3FKS A;  2Z2S B;  2GK7 A;  2F1M A;  1O8M A;  1HG8 A;  1WJ5 A;  3OYN A;  2RNG A;  2VPL A;  5HKK A;  2ODL A;  4Y33 A;  2Z16 A;  3RCO A;  2ZSH B;  3EUA A;  2WBM A;  4CCJ A;  3L2R A;  4C9Y A;  2ZZQ A;  4U4B A;  4HIZ A;  3HKZ A;  2V4J C;  3H9G A;  4E7Z A;  2R7W A;  1CZF A;  1N78 A;  2V31 A;  1D1B A;  4NC7 A;  4BXF A;  2LYC A;  2KZV A;  1UAA A;  4YEJ A;  2XF7 A;  4KIS A;  4ZTF A;  2W4S A;  2M3A A;  3OYG A;  2OC6 A;  3K4B A;  4W8T A;  5TGT A;  1E3Z A;  3QOD A;  4B3G A;  4XNF A;  2UUZ A;  1RWR A;  2XGJ A;  3CJR B;  2X1C A;  1UD5 A;  2R7X A;  3GVJ A;  2JSP A;  2X1E A;  3K4M A;  4CCL A;  4B43 A;  4XON A;  1WTH D;  2XZP A;  2IXS A;  4B44 A;  1BPL A;  2QX3 A;  3PNV A;  3I9V 2;  2IGO A;  1MW7 A;  3AKZ A;  5DN6 A;  2CS3 A;  2ZXH A;  3DTI A;  1O8G A;  3OFN A;  3EQN A;  3W2A A;  1OLT A;  3VWB A;  2KRC A;  2X1D A;  2JJ2 A;  1WJB A;  3FKJ A;  3DU6 A;  4XMY A;  3OYC A;  4N4N B;  1MMG A;  1QU3 A;  1ERD A;  1HZE A;  1I8D A;  3T53 B;  2XZL A;  2JA2 A;  2L9S A;  1SFK A;  2R7S A;  1QHH D;  4ZYA A;  4BQQ A;  2HLD A;  4OJ6 A;  3KEY A;  3DKX A;  4G7W A;  4XKV A;  3PUB A;  1MAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...