4XL9A

Tailspike protein mutant d339a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xl9A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xl9A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xl9A02
4Z06A 1EE6A 4YEJA 1X0CA 4HWVA 1IDKA 4Z05A 2VBKA 4YZ0A 4Z03A 1XG2A 2O17A 4XLAA 1VBLA 2INVA 3VMWA 4YZQA 1RU4A 4XORA 2NTBA 1IA5A 1KTWA 2X6XA 2UVFA 2VBMA 1IB4A 1PE9A 1OGOX 3B8YA 4XR6A 1O8GA 3GQ9A 3T9GA 4W8RA 1O8HA 2INUA 2QY1A 4OJOA 2VJIA 3GRHA 4XN3A 2QX3A 5AMVA 3LMWA 1O8DA 4XLCA 1PLUA 4XL9A 2X3HA 2EWEA 1GQ8A 3EQOA 4XKWA 4NK8A 4XQFA 2PYGA 3UW0A 1QCXA 4XONA 1WMRA 2NSPA 4YZXA 4PMHA 3VSUA 1OFLA 2NTQA 1AIRA 4C2LA 4OZYA 3WWGA 2Z8GA 4U49A 1OFMA 1KCDA 1OOCA 4XOTA 4OJPA 2IQ7A 3B90A 1KCCA 4XLHA 4XNFA 1DBOA 4U4BA 4OZZA 4XM3A 1OGMX 2QXZA 3KRGA 4EW9A 1JRGA 1CZFA 2VJJA 1NHCA 4W8TA 2O1DA 4YZAA 4XKVA 1BN8A 4XLFA 4W8SA 2NSTA 3VSVA 1O8KA 3FY3A 3ZPPA 1IDJA 1O8IA 4MXNA 4AVZA 3ZSCA 3VSTA 3GQ8A 4XOPA 4OJ6A 2O0WA 1H80A 1QJVA 4XLEA 2PYHA 1O8JA 4XN0A 2O0VA 4URRA 2VBEA 1HG8A 1RWRA 2NT6A 2O04A 1BHEA 2X6YA 1O8LA 1O88A 1JTAA 5C1CA 4OJ5A 1PXZA 3GQAA 2NT9A 4W8QA 3B4NA 1O8EA 4OJLA 4MR0A 1DBGA 2PECA 2NZMA 2ODLA 1K5CA 2NTPA 4NK6A 1RMGA 3VMVA 3EQNA 2X85A 3SUCA 3JURA 1O8FA 4XMYA 2BSPA 2UVEA 3GQ7A 5C1EA 4YELA 4I84A 1O8MA 2X6WA
chains in the Genus database with same CATH superfamily
3HTSB 1KONA 5FLXK 3ZGKA 3WTUC 3LYCA 2BVNA 3W6VA 3ZUGA 2Z9OA 5JFRA 2EIXA 3L2VA 2IA2A 2A6TA 1MBEA 3L2WA 2DYIA 4YEIA 3JSOA 4N9HA 5L3CA 3G3ZA 1Q86D 3H3VK 2QDXA 2O6WA 2BXYA 2EILH 4YAFA 1OCCH 1RESA 3WHBA 4JYKA 1B8IB 5H5JA 1VBLA 4XK4A 2XAUA 1F1ZA 2I1LA 2CQ7A 2FNPA 1OYWA 2HQAA 2QQ8A 1FX0A 4BQQA 2EA2A 3ZC3A 4QFMA 5GPAA 4P9SA 4R71A 3W2GA 1VQ7B 3KLOA 1HXDA 2M0MA 4O3MA 3GZ5A 4Y4RA 1R71A 1ZGAA 4YRVA 2R5ZB 3JRAA 4EGZA 3KEOA 5ED4A 5JVGF 2XC1A 4PC7A 3CC7I 1IZ1A 4CZCA 3CMMA 3OJXA 3I58A 4HIZA 2ISYA 5IYRA 1K9MD 2LG4A 4YZXA 4PMHA 3OSFA 1ENHA 1VQKI 3P5JA 3WXMA 3HGYA 1VQ8B 2XAGA 5B3SH 4ESFA 2JJ7A 2R5YB 1T98A 2VXDA 5CVVA 3G1MA 4V02C 2Z3YA 1WJEA 3M1EA 4RCYA 4F7DA 1YX2A 4M9ZA 2PJPA 1OR7C 4XNFA 1DBOA 2OU2A 2A6EF 9ANTA 4PJJA 4QWQA 1AHDP 2VPLA 2QXZA 2X1EA 1TWCJ 4IHSA 1ETVA 4A3CJ 3D5SC 1R49A 3HAGA 3KEWA 4XLFA 3BQYA 3E3VA 4G7ZF 3BCFA 4LOCA 3PA1A 5B6IA 4RDKA 2ZNZA 1OCZH 1D0XA 4BJ5C 3ZN0A 1QU3A 4I01A 1F43A 4XRFA 2KIFA 2QM3A 5DM6F 1YW7A 3NB2A 3A0HC 1V0FA 4UVBA 2VC0A 2HVSA 3HOSA 4LGWA 1DP7P 1W4MA 2OZ6A 3PQKA 1T0FA 3I4NJ 2X1CA 4ZTJA 3ASPA 4K1XA 1ZR4A 2QENA 4WWCA 1QGPA 2BY0A 2HDWA 4M3EA 4B09A 1VQLI 3MCAA 2R7FA 2V9KA 2XPWA 2XVCA 4QLCU 4N3NA 5E6TA 3PNTA 2O03A 2LTPA 4IX7A 2ME6A 3HSEA 3Q9SA 4Q48A 3DKWA 1VLYA 3QFCA 2CFXA 4ZYHA 1PDNC 2DU9A 1EFTA 1A35A 2QMUA 3U6KA 1B2RA 4TT3A 3KIOA 2FE3A 4R1HA 2FX3A 3FXQA 2EZHA 3ZQQA 2EINH 5GPCA 1P9QC 5CDFA 2H1LA 2V6CA 1N75A 1RR7A 2A69F 2M4GA 2QKLB 4GCVA 3ZN1A 2BHYA 1ZM2A 1WGXA 1ZK8A 1ACIA 5LEJA 4M71A 3IL2A 3VMFA 2V79A 5A8AA 5EG0A 1Z7UA 2UVEA 2N8GA 2XASA 3WTZA 3JRHA 1SM4A 2JSCA 2HLDA 4ENNA 1TYUA 3BCDA 4YEJA 1YS6A 4YIIA 5BOXA 1R5ID 1EE6A 2A6HF 1ZG3A 1OCTC 4EH1A 3GMEA 5EDNA 3J7YJ 1N05A 1JI8A 4CA0A 1BL0A 2YWFA 2D1VA 3IUOA 5KAFC 4P55A 4AM3A 3EUHC 4HOBA 2Q6OA 1OFCX 3L1PA 5DTDA 4IQ4A 5LGTA 3LSRA 1KYWA 1UB9A 1JJ8C 3BG6A 3ONYA 4A93J 2P6TA 4R79A 2WSSA 1NTCA 3JSPA 1FBQA 3LAPA 3AG2H 5IYWA 1VQOB 2XKOA 5J8FA 4IHVA 3LJYA 2GJRA 1X3UA 2EH3A 3OYMA 4XORA 4NHJA 2NTBA 3WYAA 4BH9A 1YRNA 2GA2A 2KIUA 1OGIA 3TKYA 2ECCA 1ZRCA 2EFQA 4S0HB 2JN9A 2E1MC 3FKJA 3LQ6A 4ESBA 1BPLA 3AL0C 4D7NA 4ENKA 5EYRA 2IS1A 2HOEA 4ZZLA 3R61A 3ZZUA 5AIQA 3BR2A 3HPHA 1FZPB 3AVUA 4ZCMA 5E1XA 1JTXA 3FXRA 4UUSA 1DQUA 4A69C 5BSYA 3LA2A 3DEWA 3MZ8A 3CCVI 4YAUA 4GO1A 4B3AA 1EWYA 1DDIA 2NSPA 1XC5A 2LH9A 4L9JA 4ASNA 4OINF 1S6LA 2VLAA 2QTZA 3RPUD 1YJ9I 2VUMJ 1VQMB 3DBRB 2CH0A 2IAIA 4FE4A 1CGPA 2VE9A 2E1CA 2VBTA 3BH4A 5FKMA 1B9MA 3SXYA 4BKXA 2QEXI 4HNUA 2NNNA 4Z4WA 3CCEB 3TOAA 4LC0A 3J81K 1GLNA 2BV3A 3MZHA 1TWGJ 2X6OA 3GLLA 3RKWA 3JAMK 2P5LC 1VQOI 1ETQA 4XKBA 1ZLKA 2FA5A 1KJZA 1KTVA 1FP2A 2JA8J 3U1KA 3I55B 4LIVA 1YLOA 4BU2A 1OISA 4W8SA 2M1BA 1G59A 4EJTA 3FZVA 2WB1A 1ETXA 4V19K 3DBHB 4Y7NJ 3ZSCA 2KRHA 3IV5A 1IC8A 4OIOF 1W2BB 1E2XA 3AVYA 1IUYA 2IBDA 2TRTA 2XGCA 3QQAA 1N0VC 4BQOA 4YG2F 4RJLA 1IO2A 4GDFA 2V1DA 3O8GA 5L3BA 4I76A 2GJKA 5K1YA 2BGIA 3J80K 1KU7A 1OKRA 3A01A 2VQCA 4F3QA 1HG8A 3V7RA 2Z1DA 3COAC 1BX0A 3F8MA 3F0CA 2DA3A 2H09A 3HHHA 1JTAA 2WAFA 3GVLA 1UJ8A 2FNAA 1SVMA 5KVRA 5LD2C 1YJ9B 1LM1A 1QZEA 2KJCA 3S2DJ 3DPLC 4I02A 1YI2I 3CB4A 3FIWA 3CO6C 2LKSA 1KQ9A 1X58A 3S1NJ 2Y30A 3A0BC 2Q6IA 3S17J 3CC2I 4D5FA 1DGWY 1QUEA 2DI3A 4UHTA 1GVHA 3E1SA 4AIHA 3K69A 1ETYA 5K5RA 4WZEA 1I3QJ 3L2QA 1ZRDA 1GO2A 1QVTA 3WODF 4DQKA 1PJ6A 2RC6A 3I54A 3W5HA 3KEQA 3KE2A 1NRKA 1UG0A 1NBMA 3MCZA 4TKOB 3ONUA 3SQVA 2XV4S 5IYPA 2O61A 1MBKA 1OCRH 2E1NA 2LY1A 1S0UA 2DYRH 1Z91A 1D8JA 2XTWA 4S05A 3D5LA 1P4MA 1T56A 1V54H 4GRIA 1U6GA 4P9FA 4CH7A 3GFIA 1MMGA 2DODA 3HDDA 1VQ6I 1DP3A 4G1BA 4UNOA 4HZFA 2XDVA 3OYEA 1PVEA 1F36A 2CWEA 2P3MA 4B3GA 3FWEA 1IG7A 3ABMH 4ITVA 4XR6A 4HAMA 3S14J 4M0LA 4AF7A 5H2FC 5E18F 2P0WA 1U2RA 2E1RA 3OSGA 4M3FA 3AGPA 2QY1A 2G0EA 5BMZA 1FSHA 2Y0MA 1I6HJ 4GXOA 3E5UA 5F1JA 1H0MA 3QOPA 1YX3A 1IRGA 5DD4A 3ZQCA 2F5DA 1CQXA 4XKWA 4HLYA 2RREA 5FD6A 1A6QA 5EF6A 2C6YA 2W1OA 1OYIA 3BZCA 4ON0A 4X0GA 2Y31A 4HQMA 4OOIA 2BM4A 2XNJA 3H92A 1E0EA 2FVGA 2V7UA 3CPWB 2PG4A 1TC3C 3B90A 2RQPA 1EKEA 1OCPA 4FE7A 4LLGF 4RB0A 2BGJA 2ZB9A 2FXAA 5L3EA 3B02A 4KNYA 1W87A 4A0ZA 1CZFA 3AVVA 3BY2A 2VFOA 3GVAA 5FKKA 1Q1VA 4HSTA 1V5GA 4XKVA 3RIQA 1U8RA 3CCYA 3KX2A 4Y15A 4M6YA 3P9KA 5DYMA 1BBYA 2LBFB 1JGSA 3K2AA 4F52A 4HEA2 4PFOA 3Q38A 3CP8A 1MH3A 4MXNA 1B72A 1IAWA 3I53A 3VSTA 3K7AJ 2CUEA 4MYUA 2OV7A 1TYXA 2OD5A 2FOWA 3ABLH 3ZQIA 2WAQN 1FTTA 5GADJ 1FDRA 5F4MA 4URRA 2RN7A 4KFCA 1Z05A 4X7FA 2DMPA 2GIVA 1YHQI 1P7JA 4B44A 2CV1A 2ESHA 2X53S 2BM0A 3CC4B 3G2BA 1VZ0A 4E6KG 2R5ZA 1FRQA 1HQCA 1N25A 2PECA 1FYMA 1QFJA 2M7BA 4NDLA 2CW0F 4LB6B 2LLKA 1FPQA 1YO5C 2VOOA 3HM5A 4OIRF 1FC3A 3ZMVA 2FD5A 3RIRA 1FMWA 2DFFA 1G3YA 1HA3A 1RRJA 3V42A 3GUDA 2O6GE 1DARA 4PSXA 2LNBA 1SC7A 3BNWA 1MDMA 3BY6A 5BNGA 3CO7C 1X0CA 4M6VA 3OS0A 1G3SA 2VBWA 3LA3A 5KHDA 1Q9SA 1OB5A 1J9ZA 2A3SA 3NRVA 4DZPA 2QTLA 1I50J 1D1AA 1MD0A 3W2HA 1TNTA 4OM9A 2Y0SA 2K40A 1LB2A 2DFHA 1VQNI 1PJRA 3JX8A 2BW3A 3WTXC 3GFLA 5D5WB 5F0FA 3J80Z 2VONA 2V7XA 4YC5A 1UHMA 3I59B 3T1BA 3QOEA 2K9QA 3VO1A 1VHEA 4PJ0C 2QUFA 1EP1B 2W6IA 3GVJA 2TCTA 1SFOJ 1WKMA 4FWTA 3QYEA 1W5SA 2F5VA 5H6QA 3OFNA 1Y1WJ 5GP9A 1DU0A 1BJAA 1OGOX 3ISPA 3ML3A 2LMDA 2VQHA 1A31A 1MBGA 1WH7A 3MKWB 1Y56A 1DG1G 3DDYA 2CFOA 3QP6A 1OB0A 1O8HA 2PEXA 3BTJA 1TLHB 2F4MB 4ZC3A 3WG9A 3PSSA 1J7KA 3M07A 1O8DA 2PI0A 1BW6A 3MEXA 2LY9A 4FK8A 2HVRA 2KRCA 2QVOA 3CC2B 1QRBA 4LLLA 4GYIA 2MH2A 1P4WA 4WX9A 1XDUA 4UZEA 4UZUA 3SEJA 4NBQA 3FF5A 1YLFA 1FOWA 2W84A 5FKLA 4DIQA 4XICA 1K28D 1K6OA 4IOAF 4B8XA 4OPVA 4XRSA 3OIQA 2LY2A 3KPHA 4U87A 2CV0A 3J81k 1J0RA 1ZREA 1FRNA 2ZZGA 4I0BA 1EJ9A 2OCEA 2ZMEC 5CYVA 1JT0A 5HLGA 4NUBA 3ZQFA 4EW9A 3HUGB 3IP4B 3OOPA 2DLLA 3RYPA 1O3SA 2FSWA 4KH3A 3SHFA 1JTYA 3PNVA 3Q39A 3CCRI 1G7CA 4OP7A 3OEEA 3H3ZA 3DU5A 2IXSA 4I09A 3UNGC 3ULQB 4BEHA 4P5OA 3WE3A 2JPBA 3G1OA 3P26A 4Z4VA 2DTZA 3PENA 4RA2A 1OGJA 3OP1A 2M30A 2IOUG 1PJ7A 2FMLA 2PMZN 3W2EA 2CV2A 3WNDA 2DY1A 4NBSA 5TRDA 2CUFA 4AC0A 1WWXA 4TMTA 4G8XA 2VBEA 4BL0B 1N07A 2NYXA 4CYCB 3QSYA 1O8LA 2ESNA 1HF2A 4B43A 3QFTA 1N8RD 2RQQA 2DOFA 3IAS2 1DDNA 4A0XA 2IT0A 1RUNA 3UKGA 1FSEA 5LHIA 3GEZA 3K9TA 4MYTA 2FEZA 2CUZA 2CU7A 2MG4A 3D26A 3ASTA 1UHWA 3FXOA 2PIAA 4CCJA 4LBZA 3CP2A 3GBGA 3CMYA 1HKSA 1TNSA 4IO9F 2ISZA 1Y0YA 5HVQC 4CGZA 3DFGA 2BW3B 1WPCA 5IOYA 1VQ5B 2E5NA 2JPCA 3C7JA 5J3LA 2ETHA 4KA4A 4RD4A 1E3HA 3E20A 3OV8A 2BGCA 5FFZA 1IDKA 3J81Z 2P6SA 2DT6A 3IKTA 1FEXA 4DYRA 5IK2A 3LFUA 1YE9A 5BS6A 5J8CA 4PC6A 3ROUA 3D0SA 2D1HA 3FPPA 2DTRA 3T0YA 2YX4A 3PNYA 4M73A 3G6EI 2VNHA 1WJBA 2ZO4A 3FXUA 1OMIA 4JP0A 1B59A 2VBUA 3GTQJ 1P2FA 1ZGWA 2MW8A 1Q82D 4G7OF 5D5UB 3JQQA 1KA8A 4AYBA 2Q1ZB 5EEHA 5ILVA 3WGGA 1W0KA 2VJ4A 5LRSA 1PUFA 2E2IJ 3B8YA 1YQAA 2EPFA 4BXFA 2L3DA 1TT0A 4J01A 4II3A 4RDJA 2HDCA 4E7HA 3C2BA 2M87A 5J1RA 3CC4I 3OOCA 4Z4TA 2WJYA 2ZFUA 2JA5J 2CBXA 2JIZA 3GO5A 4LMYA 4W97A 3WGIA 4RD3A 1A6IA 4XL9A 4FETA 2NPFA 4L0YB 1ZN2A 5DUKA 1UHSA 1WJDA 4XONA 3HSRA 3B78A 2LR8A 3L2UA 3R6KA 1UD5A 3DEUA 3FK7A 2EJRA 2C2WA 3KP3A 4XLNF 3TO9A 2NRAC 1ORKA 4BQAA 2DEUA 3SY2A 2F2EA 1MNMC 4A3LJ 4KT6A 4R8HA 5DN6A 2DFEA 1HDPA 5K5OA 2EQRA 3OZUA 2O7OA 4IRIA 2BM7A 1W36D 2RV8A 3OYBA 3F22A 3A35A 4M74A 2R9VA 5EMNA 2XKPA 2O1DA 2LF7A 2L0KA 3RKYA 2YS9A 3EUHA 3WTYC 1V5VA 4UUVA 3ZPPA 3NWSA 1ELOA 3DKYA 2L9RA 2L7KA 3HG9A 3GSIA 5DNSA 1GAWA 2M8GX 4L8JA 4OOVA 1XFOA 4AVPA 1STZA 4Y3OA 3JTHA 2PYHA 1BA5A 1IJEA 3IHUA 2I5UA 2WC2A 3OIOA 5J4VA 5LGUA 4KYWA 3VR6A 2LK2A 3AKZA 4ZTFA 1H8HA 1K79A 3VEPA 1QGYA 4U88A 2XTXA 5D5XB 2IA0A 5F4JA 1U3EM 3K4JA 3NAWA 2XGEA 5ICGA 1W34A 5HNHA 2HOSA 1O8EA 3G73A 2QA4I 4IF4A 5JVTA 2KFDA 4DOZA 4BJTA 3HOVJ 4X7CA 3T51B 1SMTA 1VQ4B 2GOMA 2GK6A 1XB4A 3HYIA 4G9YA 4NK6A 2EV6A 4P1WA 4M53A 2LYCA 1HBXG 1UMKA 2GZWA 1EA0A 3QODA 1R5GA 4XMYA 4PC2A 3CCSB 5E3MA 4IHWA 1R4MB 4ANJA 2XAFA 5IY5H 5D8LB 2HYJA 1T6SA 1KGSA 1H9GA 1P4AA 1Z9CA 3PO3J 3LNNA 4M3BA 1S7AA 4EATA 4KKTA 4CSWA 4TMXA 3E1YE 1B23P 1MMNA 2Q0OA 2EV5A 3OJWA 2JSPA 2VFMA 2VL8A 1ON2A 4F93B 2QCOA 1ZM9A 4LBYA 3FKIJ 3T8RA 3BOQA 2IGKA 4BS9A 3U2RA 5F0HA 2XZPA 1FNCA 5F4OA 1LJ9A 4U7DA 4L18B 3F72A 4QHYA 3PUBA 1Z21A 2VBYA 1EP3B 1R6RA 4LJZF 4M72A 4EJVA 2R92J 2JK3A 1E3ZA 3PFYA 1L0OC 1K4SA 2HEOA 1UAAA 2CNDA 3C18A 3HJEA 3A8KA 4HQEA 5L3FA 3TH0A 4E4HA 3ECHA 3S1QJ 4RCZA 4OJOA 1WHUA 2LBFA 1MDMB 2X3UA 2QZ8A 3H5NA 1D2EA 1KRHA 4P25A 3DBLB 1FIPA 1MMAA 3BT9A 3ELKA 1NDHA 3PM1A 2BPOA 3OY9A 3OPOA 3V7AA 2OQRA 2MLGA 1WMRA 2LKPA 3QP5A 4QPOA 2VQGA 2ZFWA 1JB9A 3CCUB 1R4NB 3TQNA 1FBUA 1GV5A 4M6XA 5B1BH 4MFEA 1WOOA 3JRIA 2KL4A 2AS5F 2Z8GA 2IGNA 1KCDA 4XOTA 2KMUA 4P3YA 3DP7A 3M3YJ 3R0JA 1KYZA 2FBKA 2HCJB 1FTZA 3E5XA 1BQEA 1IHMA 3KRGA 1S29A 1B8IA 4Y33A 4N3GA 2J8KA 1Y0NA 3Q0UA 1Y1VJ 1UD4A 2RNJA 5J35A 3G6EB 3OZWA 3T56B 3U21A 4BGDA 1SKQA 2ELKA 3OW2B 5EJCA 3HOWJ 1IV8A 1YG2A 3FY3A 2COBA 2EWNA 2W24A 3OR2C 2HZDA 2DN0A 2DXIA 2I10A 1BOBA 1TZLA 1QPMA 2VI6A 2IS4A 4UVCA 2Z33A 4M2LA 3B82A 4LBVA 3JRDA 2JA2A 4XRSG 4FISA 4Z6YA 2O0VA 4WK8F 3ABUA 2QBYB 1HVXA 1KK0A 4YHBA 5E3LA 3C2HA 2V4DA 4CO8A 2COMA 1SVLA 2M7AA 3ABTA 4WWVA 4DYCA 1QGZA 3PO2J 4TN1A 1AMOA 4W8QA 2L54A 1QVUA 4OJLA 5J6XA 2P5VA 2KLOA 3TDUC 3JQRA 3HUGA 5DEQA 1HSTA 2NZMA 5JLVC 4V2GA 1HW1A 4OWRB 4OPWA 3P9IA 1LE8B 1Q1HA 2HXOA 1OR7A 2JRMA 4G94A 4Y17A 3HL2A 3OS1A 2CQKA 2DT5A 1MNDA 2F5CA 3HC7A 3REOA 1AU7A 4GFBA 2RC5A 4TMVA 1JKQC 4ZYGA 2QSFX 3VSLA 1Z6TA 4BEHB 1BI0A 1LLWA 5C1EA 2DCEA 3GLXA 1TTTA 4P1VA 2DA1A 4M3DA 1KU2A 4Z4YA 5KNLA 3GTLJ 1YFHA 1MBHA 2L02A 3L09A 2K4JA 3VYRB 1G6NA 3KZIC 4Y52J 1JUSA 4M4SA 4G6TB 3RJPA 5JLXA 4U7BA 4C2UA 2L2OA 3M4OJ 2L5QA 2Z99A 1EXMA 4I98B 5HLIA 1QA6A 1Y0RA 1MBFA 1XMAA 2Q2EA 3OL3A 1WJFA 3VDXA 1JKRC 2CRGA 1K6YA 4M1KA 1EA3A 3GTMJ 3LSGA 2VBMA 3K70D 1BI1A 1XG1A 4G6DA 1E1RA 2Z6BD 3B8HA 4P6VF 3BZKA 1V4RA 2R7ZJ 3GCMA 2WTEA 2F1LA 4W8RA 1JJ2B 1K4ZA 2VJIA 4Q5SF 2LRDA 4ZZDA 3MKZA 2QX3A 3O2PE 5AMVA 1IDZA 3LMWA 4KIGA 5F27A 1QGAA 2CO5A 1MJBA 1S5LC 2AXTC 1KZHA 2VNIA 3LSPA 4WZKA 5CVUA 1IN8A 4LK1F 1GVDA 1APLC 3WBJA 1D0YA 3TO7A 3G4SI 4EJUA 4AIKA 3LSIA 4LG0B 3SZGA 4P6YA 2MH9A 2XSJC 3GFMA 4YAOA 5FKNA 1ZAOA 4U49A 3CCQI 3FHZA 3DPUA 3V8KA 1TWFJ 3Q6RA 4GYGA 5IYQA 2HYFA 1LKXA 3KFWX 5GAEJ 5FGMA 4NB5A 3AGQA 3H3UA 5FLVA 3MMPA 1H9TA 1YJNI 3SZTA 1YITI 5J40A 3OYJA 2PMUA 1NG7A 1N06A 1N08A 2CSOA 4KJZA 3CJQB 1DPUA 1SD7A 3K0LA 3E6BA 1H8AC 2E1OA 3F6VA 3KYLA 4XIDA 3K10A 1WCMJ 2YWEA 1VI0A 4NNJA 3T53B 1O8JA 1TW2A 4Y9UA 1P7IA 5DV5A 5FIUA 3W2FA 1UMQA 2V1NA 2Z2SB 3V7SA 3IH3A 4I99C 4ZDLA 1IJFA 3K4KA 3CMEB 1VQKB 3TL4X 1UFMA 5L3DA 5E1ZB 4FX4A 1O88A 1UG2A 4EJOA 4OJ5A 1TLLA 2V1UA 1XSVA 4MGRA 1VJSA 2F48A 2K86A 1MSEC 3MZYA 2XAHA 2GREA 3VNUA 4P3IA 2MGQA 3ZQ7A 1EP2B 2X4HA 1Y8RB 3RPUA 2LREA 3JAMZ 1RQRA 4BDZA 1SAUA 3ONQA 3TGNA 1HDDC 2WY8Q 4A3EJ 3LSKA 3BWGA 3RKXA 2X85A 5AONA 3JURA 3ZPLA 5IYCJ 2VBSA 3OR1C 1WPKA 1XS9A 1XG2A 2L4AA 4KIFA 2ZXIA 3OW7A 5FA6A 4I84A 5H59A 1K8AD 1O8MA 3AG4H 2F4OB 1HOMA 1YJNB 2BM6A 2C4TA 2Q6KA 1ZGJA 4KISA 2ZBUA 1RETA 2X9DA 2PLFA 2OCCH 2UXNA 4Z05A 5E8IA 2FRHA 1X19A 2VBKA 3EYIA 1XB2A 2BXZA 2V7FA 4DQLA 1UCRA 3S8PA 2IRFG 4BAYA 2LZJA 4ZCLA 3BG5A 4FXUA 2IGOA 2QE7A 2FOKA 4Z2YA 2XROA 1JKPC 4IL6C 1G8XA 3LFKA 4C3IJ 4QSHA 4E7LA 1GXPA 1WI3A 1BX1A 3CUQB 1EFUA 2AQEA 4TMWA 5IYNA 3H5RA 1X1AA 3VFZA 4BE1A 1X1BA 4X0CA 3DU6A 1Y39A 3CD6B 1IB4A 1J9IA 2X1DA 2KVOA 1UZCA 3RSNA 3GQ9A 2B9SA 1QZYA 4P22A 5HDNA 4Q7JB 3H36A 1Z3XA 2OTLI 5HXBA 1CNFA 5DD8A 2ADUA 1LPQA 2J5OA 3JREA 3VNVA 1YX5A 2HU9A 1HCRA 2K02A 2Y75A 3KEYA 2DW4A 3LQQA 4XKCA 4L9TA 3SDGA 4Z4UA 4PK4A 4H9GA 3M8FA 3A3GA 2W48A 1K4TA 4RB1A 3VYUB 4BNCA 1GHCA 5CQEA 2ZZEA 3FISA 4RAZA 1DUXC 3F8FA 3KL9A 1LFUP 2VKEA 4BYYA 1WDTA 1S9HA 3FPKA 3JU4A 3ASRA 3ERED 1OFMA 1KQSB 3K1PA 1OOCA 2XRLA 4E0FA 4FTHA 4NC7A 2ZTNA 1E64A 4FT8A 2JA7J 3J7AO 4XSXF 1S3JA 3BJAA 1KU3A 2CMPA 4C2TA 4P26A 1X3ZB 4PCQA 2QQAA 4AF6A 4W1UA 3QU3A 5FB2A 2W7ZA 2UWMA 2HWVA 2JQ7A 3WNBA 3CMAB 5F08A 1RC9A 3PUNA 1ZQ3P 3DTEA 3K4CA 2F1MA 4AVZA 1RKWA 5DSZA 4CICA 5F0CA 2WYRA 3F6OA 2PN6A 2ZXHA 2G7HA 3Q9VA 3OYNA 4JMQA 2E34A 3G1LA 1RIOH 2EB7A 1BMFA 1FOXA 4PC3A 3PSZA 2BEOA 4MQVA 4EM0B 1KQ5A 3R60A 3H0GJ 3CJTB 4GQNA 5FO1A 4PC1A 2NOGA 3JRCA 3O8HA 3T5XA 2HTSA 2EZIA 2IA1A 3IH4A 4WF2A 2E2HJ 2OBPA 3N4MA 2XEXA 4NQWA 2VASA 4ETSA 4V2FA 2KQRA 1PXZA 3GQAA 3JW4A 3LSMA 1QHHD 2KIQA 1SMYF 2F43A 1WVRA 3KYDB 3ZR8X 1A04A 1USTA 4DK0A 2XB5A 2CJJA 3ESWB 2Q8KA 3HB9A 1EFCA 3KCCA 2JJ2A 2HYGD 1O3TA 1ZG1A 3LQEA 4X7EA 3BJ6A 4QVAA 1I39A 5H20A 1PKVA 1RPWA 2F4NA 1MJAA 1R23A 3TP0A 4BACA 3M1CA 2QWWA 4E7JA 4BHPA 3Q6QA 3JCUC 1VQ6B 3MMYB 4KMFA 1HW2A 2H6BA 3BY1A 2DBBA 4LIUA 1ULYA 4D0PA 2BM1A 2JDIA 1HZEA 3HHGA 2XNDA 2R7TA 5DM7F 3TW7A 4YZ0A 3LA7A 4PAAA 3DCFA 3H94A 2HOTA 1GDTA 4A3GJ 2E5ZA 2GXBA 3ASSA 2WWYA 1ZUNB 3GX4X 3K70C 5IT9Z 2AXLA 4BDYA 2EFWA 5A2QK 3ZRGA 3HOZJ 3TP3A 3AVXA 1IUFA 2ID6A 2GA1A 3DKXA 1O7LA 4RLQA 1KTWA 3K1NA 1MMSA 5TGTA 1S72I 2LF8A 2BV6A 4IRHA 3OMYA 1QNTA 1TQMA 4UB6C 2HDNB 1YI2B 5LEKA 2HI3A 1WZ2A 4UXNA 3CMEI 4KMUX 1QBJA 3HOXJ 2VYQA 4JQFA 2R7SA 2QZAA 1P6RA 2MD5A 2RAEA 5M5YJ 4OIPF 4RAFA 2QGGA 3SJZA 4RMNA 5IP9J 2MYSA 1ONVA 2ZITA 2P7VB 3M7GA 4UZFA 4ZYEA 1PLUA 1I8DA 1XGOA 1FBSA 1OLTA 4BY7J 2BYVE 2DDAA 2K3FA 2V7VA 1QVFB 2XSDC 2AQFA 1VQLB 2YX7A 4N4OB 1E17A 2H94A 1ZG5A 1OFLA 1WXRA 1AIRA 3V8JA 4IKFA 1KK3A 5LLQA 4WQMA 1N77A 1GUUA 1SFEA 1VTNC 4HE5A 2M5SA 3LWFA 1TWHJ 5H6RA 2OTJI 1J75A 2C78A 1RI7A 2HDDA 4HV6A 4UUSB 1EH6A 3HKZN 3CCLB 5DS9A 2XIGA 4IXAA 2Z5UA 4D5CA 4ENJA 3SLDA 1FNBA 1MGTA 1Y6IA 1W0JA 3CJRB 3W2IA 1UELB 2MA3A 1TWAJ 2HVQA 3ZMTA 1H88C 3VSVA 5BSXA 1TQIA 1OCOH 2LC2A 2Y0SN 4RAGA 2K9MA 3VODA 4IW3B 1BIBA 4RD2A 2R7RA 2BSAA 1BLIA 5GTIC 2NVYJ 4JX5A 1DU6A 4FX0A 4RM3A 4KICA 2IS2A 1JA1A 2AO9A 5E3NA 1JKOC 3FM3A 1X3WB 1MSFC 1SKYB 2OTLB 4FASD 1R36A 2IW5A 1XN7A 1VQ8I 2QQ9A 3AG3H 3AAFA 1XMXA 1NHAA 1S7EA 4C0SA 5ILSA 5KAIC 2VE8A 3W6KB 2QKMB 4DYQA 1MJ9A 2M4KA 2VFPA 2NVTJ 2KKOA 4CXFA 4ZGNB 1QUFA 2BHZA 4K2EA 1SD5A 1W9XA 2DIEA 1PP8F 2VODA 1VQ9B 3K4NA 5CVJA 4HPQA 4ABZA 2NTPA 2CW7A 3F3XA 3CZ6A 2EIMH 4RM2A 2LVSA 2XF5A 4FHTA 3DLLF 5FRMA 3OYGA 5J3OA 5CLSA 1IB0A 4A0YA 1XD7A 5TV2A 3WQZA 1TTYA 1JNYA 3DU1X 2ZXWH 2NOJB 3VSKA 3CCLI 1T8IA 3F9KA 1KD1D 5LFAA 1TYWA 2X6WA 2R7WA 3HIFA 4IVNA 2ZBVA 3P4GA 2W6JA 2B7EA 1ZTRA 1QHGA 1TT5B 2HKXA 2KIMA 2WAQA 3ZMZA 3E0JB 4Q47A 4E7ZA 3VOEA 1KMHA 4RBOA 2HR3A 5E3OA 2RKHA 3AK5A 1I6XA 3CMAI 3E97A 1WORA 4NC6A 1XGNA 3RKQA 1HC8A 3U1DA 3S2HJ 2K7LA 3R4KA 4DNCA 5LRRA 2OBSA 1REPC 1LVKA 4CCNA 5HS9A 1R1UA 1WSVA 4AUXA 1U78A 1ITYA 1T5EA 2XF6A 1XCVA 2HFHA 3F8BA 1WOSA 3E7LA 2GBYA 2WZNA 3Q3AA 5IT9K 1W35A 3I55I 4HDVA 3PJRA 2DOGA 2R5YA 2P4WA 3KZZA 1QQIA 2FU4A 5FO0A 4B3FX 4P12A 2R3SA 1G2HA 1EF4A 3A8JA 4B48A 1QA2A 2E1BA 2CQNA 5HLTA 2W25A 3NARA 2PLYA 5CPRB 2M9HA 1LEBA 3E5QA 4RAYA 3CLQA 1G7SA 4UAJA 2HQNA 4NK8A 2JTVA 3BTLA 5FRNA 4RDUA 1QFYA 4DNRB 1TP4A 2F6CA 1IRXA 2TDXA 3KP2A 3OWTA 1IF1A 2DA6A 3HTUA 3KP7A 2DMNA 2L9VA 1ZR2A 1XDSA 3LSHA 1FMVA 2GQQA 2V9PA 4HSRA 3SYTA 4OZYA 1VNDA 4OJPA 2MSYA 3WTWC 3FMRA 4C43A 5CVIA 1VQNB 3ZBTA 4WCGA 5LBQA 1AKHB 3HRSA 5J47A 3QE2A 3CDHA 1QPIA 4OZZA 4YXWA 1MKMA 3CW2A 2BF4A 1U9NA 2V7QA 5IT3A 2DA4A 3N6ZA 3VPRA 3FBNB 3DTKA 1FOKA 1W0UA 2Q6LA 3H9GA 4PJLA 4A5MA 4A5NA 1LFBA 1T38A 2Y2ZA 2ZKZA 2V7TA 4A3IJ 1C0WA 5HOOA 3T8TA 4LBWA 2YUHA 3K6GA 2ACJA 5HKKA 2VBXA 2ZSIB 2K5CA 1H80A 3PETA 2E60A 3KLNA 1YS7A 3RCOA 4B4DA 2CYYA 2L7FP 2VJ5A 3BR1A 4AC9A 3V76A 3CDIA 4RGXA 3IRQA 2B7BA 3AFHA 3FX3A 3BR5A 4A3BJ 3W2AA 2KRFA 1VQMI 5HZBA 1SANA 3DPTA 2ZL5A 2D3NA 4AWXB 1G4DA 2OZUA 4FCYA 3SZEA 4HF0A 4F91B 2MABA 2YU3A 4CHUA 1LDKB 3ZQGA 1AOYA 2QBYA 5EZGA 3CCEI 3IH2A 3QAHA 4ZCIA 4F55A 2FQ4A 2BX6A 2BMWA 4BHBA 3CRZA 3LO8A 3U2QA 2K9NA 2YPRA 3FKSA 1RKTA 3A1PA 2AHQA 2O0YA 1KU9A 1U5TA 5AIPA 3J7AY 1BR2A 4ASUA 1D1CA 2DQRA 3CC7B 2YSRA 1R1VA 1JT6A 4YELA 3C2GA 3OKXA 4J19A 1HSJA 3CF2A 1ZLJA 1FP1D 1SVOA 2ZJPF 3BTIA 1QG0A 1D1NA 3ASOH 2VPRA 4MQ9F 3WU0A 1RR8C 4Z06A 1BJKA 2QF7A 1Z0XA 3FJOA 1JHHA 2DT7B 2HXIA 3GFJA 4H4KC 2DOAA 4DJAA 5FLMJ 4RLZA 3G71B 4YALA 1I18A 4Z03A 4I0AA 2J5PA 1JHFA 2VFQA 4DW6A 1S7OA 1R5OA 1T95A 3CESA 3QPHA 3LNQA 2STTA 4MEYF 1JUMA 3KETA 2VIXA 5K7ZA 2INVA 3VMWA 1S4MA 1X1DA 2LKXA 1EV7A 1IA5A 1ETOA 2X6XA 1YIOA 1OQYA 2UVFA 2I8DA 3OYFA 1FWZA 1D5VA 3NE5B 2CG4A 1D1BA 3A3BA 3K1MA 3HKZA 3ZMUA 3GXOA 1COWA 4LLNA 2K9SA 2YR2A 4X1EA 1L3LA 2K3PA 4OOXA 2DJIA 3KP4A 3C1DA 4II2A 3GRHA 1HA8A 1Z77A 4LD5A 1V0EA 5J1YA 4S04A 1TW3A 3VB2A 2EFNA 2BE5F 5EEAA 4HLXA 1XE1A 4UY8I 4XQFA 3UW0A 2ZNYA 1YW9A 5GAHJ 4EGYA 1LUJB 3HOUJ 1QA3A 1WOPA 2DJNA 1VQ7I 2GJPA 1G7RA 2NVXJ 4C2LA 1O3QA 2GXGA 3G71I 1LLZA 2L9NA 2XPUA 1BI3A 4E7KA 2Y9ZA 3J7ZI 5HODA 4G7HF 3ZCOA 2W85A 2IJLA 3I4PA 4KUMA 3CUOA 3TW6A 2VXZA 4BE2A 2DPDA 1QH0A 1W7PB 1NJID 3AVTA 4CYDA 1ODDA 4KITB 3BR3A 1T0FC 2VJJA 3R6SA 5GV8A 2PE3A 2R93J 1R7JA 2HTJA 4ZV4A 1WJAA 4IJAA 3TO6A 4LG0A 2OBTA 1V5FA 2D9RA 1HW5A 2RDPA 1VQ4I 2DCUA 5M3FJ 3B6AA 1KK1A 4OJ6A 2KP6A 5EGOA 2DYSH 5F1RA 3ZZ0A 2ZL7A 3G05A 3V8LA 1QQ1A 1K73D 3WBKA 3AVWA 1BN5A 1U5TB 3CCSI 2H27A 1MMDA 4LFUA 1D8TA 5HDGA 4QV2A 4IOCF 2G0YA 1D3YA 3EYYA 5F04A 3PQJA 4JBAA 1Y0UA 1A36A 1FIAA 2FBIA 3QFSA 4XSZF 3GQBA 2ZMEA 3CCMB 1DBGA 1IJWC 2FF4A 4M9XA 2OA4A 2E7XA 1GT0C 2GM4A 1X2NA 4CCMA 1IRFA 4X8IA 2FBHA 5B66C 4YIRX 2HQRA 2YUSA 1T39A 1T08B 2OK7A 5KCMA 2P7CB 3SQNA 1RUOA 1OJLA 1WU8A 3H0DA 3GZ6A 1DGRM 2VOPA 3TEDA 4YFOA 3BTCA 2BVLA 1AWCA 3L9FA 3E6MA 1SD6A 2D2WA 4DK1A 3MKYB 3RPQA 1FYKA 5IYBJ 1GXQA 2CQXA 1J09A 3CDLA 3LQRA 3LSTA 4WXCA 1KK2A 1J5YA 4BHCA 3OYHA 2YWHA 3S3NA 4YFNF 3ZXSA 2KISA 2J7KA 2R6HA 1IN5A 2VKDA 2PMHA 2JUCA 3ERMA 1O7FA 3DXJF 5JLWA 3QPSA 3V7CA 2E35A 5EGOB 4YIFA 2A68F 2QEXB 2B63J 3HPGA 4G7WA 2RVCA 2WADA 2Z16A 1FNNA 2MD0A 2CF4A 4G7XA 2DA2A 4EV0A 2GPJA 4CCLA 4WZLA 2ZCWA 1EH7A 1GVJA 3DV8A 4QIWN 4J00A 3MN2A 2JJ1A 2O5RA 3VWBA 4O6JA 2FJ1A 5FJ8J 2OYNA 5FROA 3CCUI 4MTEA 1H89C 2O9LA 2Y69H 3K2ZA 2WV1A 5BPDA 4AU7A 2QA4B 4PZJA 3JRGA 4RB3C 1MNEA 3HZJA 1X1CA 1FOYA 5CKTA 5D6FA 2PMDA 3A1YA 5EG0B 1JJ6C 1I1SA 3FXMA 3ZQLA 1YIJB 5EEGA 4JOMA 1RZ4A 4XN3A 3IWFA 3CUQC 4BE0A 2XHKA 5JMCB 4ENMA 2R4GA 4XLCA 2V26A 5K5QA 4L9NA 1MBJA 1CNEA 3EQOA 4X6AJ 2VQLA 1ETKA 3Q0WA 3OYDA 3S15J 2BBYA 3S1RJ 2K85A 3BG9A 3VYSB 4EQQA 1XSXA 3I56I 3F23A 2JA6J 3I64A 1MIJA 3S3OA 2OJED 1BC8C 4C9YA 4WXHA 3OYKA 2BY1A 3WWGA 1VQPB 1U0JA 1VF7A 2NV4A 4F7ZA 2DMQA 4E7IA 2VBVA 4CCOA 3Q5FA 3GTGJ 1SEUA 3H9JA 1LFPA 3EUAA 4RS8A 3SJMA 2GK7A 3CTAA 1E43A 3NWTA 3EQLF 4RD6A 4X7DA 2HGCA 1USSA 2XUBA 4DQ2A 4YZAA 1H42A 1NG6A 3SLNA 4DZJA 3NAUA 2WB1N 1T6ZA 3S93A 3S1MJ 1NH3A 4B47A 2MBFA 1O8IA 3FBIB 4JRAC 4HX8A 1LVAA 5HDKA 4ZGQB 3OE7A 4XLEA 3JTGA 4Z4SA 4HG2A 1V5EA 5IYDJ 1M1EB 3N05A 2LP0A 1FNMA 1K78B 2YWGA 1WRJA 4D9JA 1IV6A 5C3EJ 4ROXA 2LDUA 1U5TC 3LSJA 3F8CA 4PJNA 1BHEA 2EK5A 1WSUA 4ACBA 1UD3A 2PJRB 3KYCB 3CCQB 1IDYA 2PBIA 2QQBA 4KT5C 2OC6A 5JR3A 4KDPA 3M9AA 5JI6A 3WG7H 1WFXA 3H9QA 3HEFA 2EFOA 3PFIA 3L00A 4MR0A 2A5WA 3V4GA 4PUSA 1IN7A 1LDJA 1OPCA 4NQWB 1YJWI 1HLVA 3DLAA 5HS7A 4MTDA 1W36C 1D0ZA 3A8IA 2R7UA 3WHCA 3RYRA 1SAXA 1OFEA 4QUZA 3VMVA 3OIPA 3EQNA 3SUCA 2DDBA 1IXSB 1RQPA 1O8FA 1T2KA 1IN4A 2PX9A 1P92A 5E1WA 4XLPF 2BSPA 2VFNA 5D4SA 3CJNA 4DGWB 2ZTGA 4EM2A 4G6IA 1K83J 3HGGA 2OK8A 3M8EA 4MFDA 5FKOA 1O57A 4PGHA 1YOVB 1QRYA 1X2MA 1JE8A 4FN5A 1QX4A 2IP2A 4IHYA 4BY1J 1YYVA 1BW5A 1GAQA 2EIJH 2WPDA 1FX7A 4LITA 3OYAA 3K4LA 3FXJA 4X07A 2O17A 1LEAA 1F4KA 3ZZTA 2GAUA 1E3OC 2V31A 3GYHX 2DO7A 3R0AA 5B1AH 1WQ2A 5FFXA 2ZC2A 4N4NB 3H5AA 2V1XA 3QPTA 3JQPA 3IAM2 1TYVA 3FMSA 1J59A 1E79A 1BOAA 1UD6A 5TISC 3ZQHA 2B0RA 2LSOA 4IPAA 2XGDA 1R58A 2K9LA 2V4JC 3SJPA 2J8IA 3T9GA 2L9SA 2EFPA 3QYFA 5D8KB 1L1IA 2X0KA 2NS7A 3OYIA 1BC7C 1BJZA 2NAZA 3SEZA 4E7SA 3DEEA 4OMZA 4EMSA 4Y13A 2R7VA 4C2MJ 1VQPI 2D5VA 1HKQA 4G12A 4NC8A 2C77A 2X3HA 1M90D 1GQ8A 1VF9A 2F5FA 2XB0X 2BY3A 4A3FJ 3VO2A 4HW0A 2QN6A 1YHQB 1XX5A 5C44J 2V7WA 2VNJA 3CQZJ 2EIKH 1G3TA 2W82A 4H0EA 1SFUA 2B5OA 2NVUB 2BN4A 5TJJA 2ID3A 2KZVA 4BXUA 3LVBA 1ZRFA 2WV0A 2QGUA 2XPVA 3OS2A 1QO0D 1U8BA 1TL8A 5D6EA 3IRRA 2R7XA 1GV2A 2P81A 5FO5A 3GIRA 3MHPA 1JA0A 4RD0A 4U4BA 4XM3A 1P4XA 5KW9A 1O3RA 1JRGA 2JMWA 4FQGA 4L0ZB 3S2WA 1K61A 5ERIA 2IS6A 1F5TA 3ZP5A 2W4SA 4AD9A 1GJRA 4G1VA 2UXXA 2VBZA 4RB2C 4HX7A 2PJRA 1IGNA 4JX4A 4HX4A 5FNZA 5L46A 1PUFB 5ILUA 5DUIA 1QVGB 2F3LA 4G6QA 2VN2A 1R9TJ 3CF5F 3ZPNA 3I4MJ 2IGMA 4OMYA 3C3WA 1QJVA 3ZMSA 3OYLA 1A8PA 3IWZA 2XGXA 4OAZA 2NS8A 4ZDOA 3BH7B 2CQQA 1W1WE 1LQ1A 1YJWB 1YIJI 2EZLA 2KJBA 2X6YA 2ZXJA 1FT9A 5ICFA 1FNDA 5DCMA 1CF7B 2QSGX 2ZL6A 2ZZFA 3G4SB 5IP7J 1G3WA 3I3LA 4M9SA 3EUKL 2W7NA 4HE6A 1W5TA 3A02A 1XGSA 1E3PA 1PJ5A 3SFIA 2M8EA 1G7TA 4CQJA 1QA1A 3HOTA 3Q0VA 2HPMA 1Z3YA 4WZTA 2JUGA 1CLWA 3I56B 3OEHA 2BM5A 4F92B 1MW7A 2IPQX 5GAGJ 3HSFA 5GTHC 1RMGA 4JK1X 3EDPA 4Q4ZF 2ZSHB 3PVDA 4Y7CA 5J4YA 2MLKA 1TVCA 3N90A 3WNCA 3GQ7A 2DK8A 2IVMA 3K4BA 2RC4A 4IRGA 4A12A 3MFKA 2XAJA 1MH4A 5BQTA 3DQVC 2G7UA 4HWVA 2DMTA 4UV9A 3SKBA 2DOEA 4G5GA 3WGHA 3OZVA 5B5EC 2LD5A 1BI2A 1X4OA 3QU6A 1DDGA 3RQIA 4A3DJ 1E62A 3E6DA 1XCBA 4Z4ZA 3RDIA 5ICEA 3P27A 2OBRA 4QPQA 1U9OA 2WZPP 5FL7A 3A03A 3IKVA 3PSFA 4MEXF 3I0TA 2V6EA 1NB9A 4LG3A 2XOKA 3CCRB 3B6CA 1Z6RA 3FMQA 3AL0B 3PIPF 2KZGA 1O8GA 2GQFA 1XPXA 2CK3A 4E70A 2CW8A 1FY7A 1YRNB 5LMZA 1J2XA 5CVRA 2VT3A 4P96A 4EM1A 3GVKA 2KT0A 3W3CA 3S32A 3BC9A 2O04A 2C4UA 3F21A 2M45A 3HXLA 3U6BA 2WJVA 3WTVC 3BQJA 3BDDA 3IC7A 1T6XA 2DMUA 2HMAA 4KN7X 2NTQA 3ZBUA 2ZMEB 1IN6A 1PUEE 4OOSA 4MLOA 1EZGA 3BROA 1UD8A 3SYJA 2XF7A 4ZYAA 2X51A 5AN9A 5E79C 4P2NA 4X05A 3CLOA 3W5UA 2VKHA 3GW2A 2NS0A 2GXAA 1B1BA 4C30A 4HRIA 2JN6A 1R5NA 3I1FA 3WTSC 2ELJA 3QFRA 2KPMA 3MVPA 2E71A 5D5VB 4I2OA 1R5BA 1OYYA 3PUMA 4Y9RA 4M3GA 1XQBA 5THXA 1M1KD 2ECBA 1AKHA 1LDDA 3NEUA 1TQPA 4I6ZA 5HZAA 4C3JJ 5ICCA 1O8KA 3QPLA 2KDZA 4OU0A 1H8EA 4OPSA 4L9VA 1IDJA 3W6JB 3EETA 1ETWA 2Y9YA 3BG3A 4I7HA 4BQNA 3VYTB 2H8WA 2P5KA 3Q3SA 2UZKA 2ZJRF 3RZDJ 2O0WA 3ZMDA 2DA7A 4IHXA 4PSWA 3PIOF 3WTTC 1UD2A 2DFIA 1K7AA 2W00A 2DA5A 2R7DA 4HA8A 3JRFA 2M5WA 2OUMA 3R6JA 3O6BB 1RWRA 5LHHA 1B6AA 2V9VA 2NT6A 4ZDPA 4YDTA 3LOCA 3A4CA 1E3XA 5JHUA 2QYUA 2STWA 3ISXA 2D74A 3CCJI 3BJOA 1GR1A 2DETA 5A88A 4PGGA 3BH6B 3I59A 4ESJA 4NCNA 5DCMB 1CF7A 4OAYA 3GTOJ 3ML6A 4RLFA 3SFZA 1N0UA 3RI4A 5CQGA 3W5VA 3A01B 4D7MA 5K7HA 4PGOA 1FYLA 4BBRJ 2F5EA 4PDKA 3BP8A 2CS3A 2GLOA 4HNTA 4ACAA 5C4JJ 1S72B 1D8KA 2F4IA 2PQ8A 2R7OA 5E8GA 3JRBA 3RZOJ 4PJMA 5M5XJ 1R22A 2KHMA 4KKUA 4IZZA 2WR8A 1FLIA 3FXKA 2LFBA 3L2CA 2RGVA 2H6CA 1K78A 2XRNA 2PFBA 4TSFA 3ABKH 4YCQA 2L7MP 5L3GA 4RGRA 4KKSA 1ZARA 4TV7A 5J1UA 2RNGA 2W57A 1SFKA 2E7WA 1ON1A 4BBSJ 4YFXF 3A2KA 3QYBA 2O8KA 2EA4A 4YAWA 1I3AA 1W5CC 1I1GA 1V3FA 4YZQA 3OOUA 4CUGA 2NNYA 4QVJA 5GV7A 1EFRA 1X1PA 4HF2A 1Z1DA 1B4AA 2MC4A 3B73A 2JVGA 4EEFG 5HLHA 4ZH4F 1XSDA 3HRUA 4HNVA 1B9NA 4HBLA 2NXNB 3OL4A 3MD2A 4O5VA 4UB8C 5HNFA 4A3JJ 3KZYA 2OTJB 3HOYJ 4BPRA 2EZKA 5A2QZ 3ES9A 3CCMI 2INUA 2HKOA 3SEQA 4CCKA 1LE8A 2XT4A 4RGUA 1ZM4A 2HZTA 4BJ6C 5C4XJ 1ZH5A 4A3MJ 1WH5A 2A5YB 3QWLA 2B7CA 2EV0A 1VFCA 3LMMA 4HF1A 2CW5A 1Z7LA 1XTAA 3TMOA 4B1RA 1QCXA 2PYGA 3X2QH 2BOLA 1PP7U 1U2WA 4L5EA 1XGMA 2VC1A 4GGGA 2UUZA 2WAEA 3BG7A 4B3XA 3QRFF 3JR9A 2VZLA 5FLXZ 5DCFA 3D5RC 3H35A 4MHGA 1W7PD 4B4CA 4C3HJ 1YW8A 4CYCA 4J0QA 2E19A 1PYVA 1ZHFA 2FUG2 1B72B 1R5HA 4RPBA 2R0QC 1QFZA 4PFPA 3RQ4A 5M3MJ 3BPXA 3HRMA 3E6CC 1KQ0A 3MAJA 3ASNH 2ZJ2A 3M8JA 5LHGA 3ASQA 1BIAA 1A5JA 1FJLA 1VLOA 1BN8A 4BXXJ 4N9IA 1IXCA 1EH8A 2HQ5A 3BPVA 2JT1A 5E17F 1I5ZA 5JBQA 1VQ9I 2QLZA 3WU2C 1VQ5I 3HBLA 2O8XA 3WE2A 2IEKA 4HYEA 1F60A 3MQ0A 2C5BA 4XBFA 3CCJB 2XZLA 4XN0A 2OAZA 3TBIA 2XT2A 1WTHD 3CUQA 4EVIA 4ZJZA 1AIPA 3KP6A 1Q7YD 4CZZA 1CQTA 2C5HA 4DBQA 3PUFA 4A3KJ 2GIZA 2M3AA 3I5UA 4DBRA 2OF7A 1I27A 2ZZQA 2FX0A 1R00A 1WSRA 2XTYA 1TBXA 5C1CA 5HS8A 3B4NA 1D5YA 4UVAA 3WU1B 4OPOA 5DS0A 3CD6I 5IOZA 1Y8QB 3N97A 2ODLA 5KSWB 4RGSA 5BPIA 3PL8A 1TUIA 2DAOA 2K4BA 1O4XA 2D3LA 3DF8A 4U0VA 1NB0A 2G9WA 1T33A 2Y48A 5DDGA 1SFXA 2GOXB 2HOAA 2HPIA 6PAXA 3ZIAA 1YITB 1YTYA 3TOBA 1H85A 3BQZA 4JX6A 1I7PA 3RY8A 3S16J 3I71A 1WJ5A 2EFGA 2ZJQF 3PA2A 3CPXA 3BR6A 3L2RA 2M34A 1QRCA 3GTKJ 3W2WA 4RM0A 1F20A 4EJWA 2WBMA 3BLYA 1OFDA 4RPDA 3GTJJ 1W0TA 5E20A 2VNKA 1SD4A 4AIDA 1OB2A 1JGGA 3GF2A 4L5IA 2A61A 4YFKF 2PMZA 5CJ9A 3UR3C 4CDGA 2VB6A 1N78A 2A05A 2ICWG 3MWMA 3F8NA 3KP5A 4XLAA 4TMZA 3O3KA 3NQOA 1BM9A 2HS5A 2MC3A 2JRTA 1MABA 2CC2A 2XAQA 3BC8A 4IQJA 1RU4A 4HDUA 2M0CA 4KIBA 4MIMA 4U0WA 4HV5A 2V5IA 2DQLA 3FK6A 3GWZA 1X4PA 3I9V2 3P7NA 3S3MA 4RD1A 3OYCA 2O3FA 4L5JA 3L7WA 4LB5A 1PE9A 1AA7A 4AIJA 3H09A 4UUTA 4D1QA 2FMYA 4QTRA 4AYBN 3RTRA 2WA0A 2Q2EB 4BUPA 1TSPA 2FQ3A 2X0LA 4N0BA 1DPRA 2L7ZA 1F9NA 4IHTA 1IW7F 1QZZA 2UV1A 3BCBA 1BR1A 2JZYA 1V55H 1MZBA 3HRTA 3P9CA 5JHFA 1NK3P 2A07F 4Z1MA 2EBIA 1HF0A 5A89A 2M2EA 1WI9A 2L01A 4XD7A 2EWEA 2B0LA 1ZELA 3DTIA 2CRVA 2OPTA 2LOOA 1DABA 3VSUA 3CXCB 4OIQF 4PABA 4WXDA 2DK5A 2JWTA 1JXSA 2P8TA 2H8RA 4P9UA 5K7FA 2XZOA 3FDYA 1R1TA 4U9UA 1POGA 2DERA 2VT2A 5IPAA 2X48A 4IEJA 3GTPJ 2IQ7A 3AG1H 4XLHA 3TDZC 3GZNB 3LAJA 2XGJA 1BR4A 1OHHA 1KCCA 5D4RA 2OQGA 1OGMX 3FXLA 1ZM3A 3WY9A 2YU9J 4X06A 1IXRC 1NHCA 4KN4X 1VHOA 1MRZA 4W8TA 5FD5A 5LGNA 3SDBA 2NSTA 4A2UA 3H1CA 1WJCA 4A6EA 2QSHX 3ECOA 3PSIA 1JUPA 2QYOA 2GWRA 2VKVA 3D1NI 4A6DA 1ERDA 5F6FA 1IRZA 3GQ8A 5IP6A 2AHOA 1ZKGA 4XOPA 5F64A 2H1KA 4XRMA 3H9NA 2ZBKA 2E2JJ 3U9GA 3SZPA 3W2VA 2D45A 1NK2P 3MKLA 5KK1A 2E1MB 1E63A 1ZYRF 3BZ6A 4DNTB 3LL7A 3FHNA 4MNUA 2MFZA 3BR0A 3EPZA 1KC8D 2BZTA 1XMKA 4Z4RA 1WP6A 2BY2A 2R7QA 2L4MA 3ZOBA 2NT9A 2KDOA 5EZHA 4UV8A 2DPUA 1S8NA 4MO7A 4ZYDA 2XNCA 1KZLA 5TY0A 1LNWA 2BVMA 2CUJA 1W7PA 2JVHA 3BCAA 5M5WJ 2NVQJ 2ELHA 1E1QA 3OAAA 1K5CA 1HKTA 3K4MA 1T6YA 1KQ8A 2HNHA 3DWLE 3CCVB 5TR9A 2XC7A 2ME0A 2K27A 4U0YA 1RNLA 2CGPA 1Z67A 4LK0F 4RDLA 2E36A 2X8KA 1K8FA 3FM5A 2WY7Q 1Q81D
chains in the Genus database with same CATH topology
1KONA 3ZGKA 2JDIA 1HZEA 1IDKA 2XNDA 2DT6A 2R7TA 3L2VA 5IK2A 3LFUA 2A6TA 1YE9A 3L2WA 4YZ0A 3H94A 2E5ZA 2WPDA 3FPPA 4LITA 3OYAA 3PNYA 3K4LA 3K70C 1WJBA 2O17A 4BDYA 1VBLA 2XAUA 3ZRGA 2HQAA 3DKXA 1FX0A 4AYBA 2Q1ZB 2V31A 4BQQA 4RLQA 1KTWA 4N4NB 3H5AA 5TGTA 1W0KA 2VJ4A 3IAM2 1E79A 3OMYA 2M0MA 1UD6A 3B8YA 4Y4RA 4BXFA 2V4JC 2K9LA 1TT0A 4YRVA 4J01A 2L9SA 3T9GA 4II3A 3QYFA 4E7HA 4JQFA 2R7SA 3OYIA 3SEZA 4E7SA 3DEEA 3OOCA 2WJYA 4RMNA 2MYSA 2ZFUA 2JIZA 4CZCA 1PLUA 4XL9A 3CMMA 4FETA 2R7VA 1I8DA 2X3HA 4NC8A 1OLTA 1GQ8A 4HIZA 1WJDA 4XONA 2LG4A 4YZXA 4PMHA 3L2UA 2AQFA 2W82A 4N4OB 1UD5A 1OFLA 1AIRA 4IKFA 2VXDA 2KZVA 1WJEA 1N77A 2M5SA 3OS2A 4KT6A 5DN6A 1OR7C 2R7XA 4XNFA 1DBOA 4U4BA 4PJJA 2VPLA 4XM3A 2QXZA 2X1EA 5CDFA 1W36D 1JRGA 3OYBA 2IS6A 3A35A 3D5SC 2R9VA 2W4SA 2O1DA 1Y6IA 1W0JA 3CJRB 3HAGA 3KEWA 4XLFA 3BCFA 1UELB 2PJRA 2HVQA 3VSVA 4BJ5C 1D0XA 1QU3A 3ZPPA 2LC2A 3NWSA 2K9MA 3DKYA 2L7KA 3HG9A 2R7RA 1BLIA 4L8JA 3ZPNA 2IGMA 1QJVA 1V0FA 3OYLA 4Y3OA 2HVSA 2PYHA 3HOSA 4RM3A 4OAZA 2IS2A 4ZDOA 3VR6A 2X1CA 4ZTJA 1SKYB 3AKZA 4ZTFA 1H8HA 4FASD 2HDWA 2O04A 2V9KA 2X6YA 3PNTA 2ZZFA 4IX7A 2W7NA 3I3LA 2QKMB 3EUKL 3K4JA 2M4KA 1VLYA 5HNHA 1O8EA 3HOTA 1W9XA 2DIEA 4TT3A 4DOZA 2HPMA 1Z3YA 3K4NA 2JUGA 4BJTA 3ZQQA 3T51B 2GOMA 4HPQA 2GK6A 3OEHA 2CW7A 2NTPA 1P9QC 1MW7A 3CZ6A 4RM2A 2XF5A 4F92B 1N75A 5FRMA 3OYGA 4P1WA 2ZSHB 2M4GA 1RMGA 2LYCA 2QKLB 3WQZA 3QODA 4XMYA 2UVEA 2NOJB 3VSKA 3GQ7A 3F9KA 3K4BA 4ANJA 5LFAA 2X6WA 2HLDA 2R7WA 3BCDA 4YEJA 1EE6A 2W6JA 3DQVC 1QHGA 4HWVA 2WAQA 4E7ZA 3E0JB 3LNNA 1JI8A 4CA0A 1KMHA 4EATA 4KKTA 4CSWA 1MMNA 3IUOA 2JSPA 4P22A 3EUHC 2VL8A 1X4OA 4F93B 4IQ4A 3BG6A 2IGKA 4BS9A 4R79A 2WSSA 1LVKA 4QPQA 4CCNA 2GJRA 2XZPA 5FL7A 2WZPP 3OYMA 4XORA 3PSFA 2NTBA 1T5EA 2XF6A 2V6EA 4LG3A 2XOKA 3PUBA 1Z21A 2E1MC 3FKJA 1R6RA 3AL0B 3PJRA 1O8GA 1BPLA 1E3ZA 3PFYA 3AL0C 1UAAA 2CK3A 4B3FX 2CW8A 2IS1A 4E4HA 4OJOA 2LBFA 4B48A 3HPHA 2E1BA 3H5NA 5HLTA 3GVKA 5CPRB 3W3CA 1MMAA 3S32A 3BC9A 1DQUA 4NK8A 3OPOA 3OY9A 5FRNA 4DNRB 3HXLA 2F6CA 1IRXA 2WJVA 1WMRA 2NSPA 2LH9A 3OWTA 2VQGA 4QPOA 2VLAA 3RPUD 2NTQA 2CH0A 3LSHA 3BH4A 1FMVA 4HSRA 4MLOA 2KL4A 1UD8A 3SYTA 2XF7A 4ZYAA 2IGNA 2Z8GA 4OZYA 1KCDA 4HNUA 4XOTA 2X51A 2KMUA 4OJPA 1GLNA 2VKHA 4C30A 4HRIA 4OZZA 4YXWA 3KRGA 2ELJA 2V4DA 4Y33A 4XKBA 2V7QA 2KPMA 3FBNB 3DTKA 1UD4A 4LIVA 3T56B 3U21A 3H9GA 4PJLA 4BU2A 4BGDA 4W8SA 1G59A 2WB1A 1O8KA 3FY3A 1H8EA 5HOOA 1IDJA 3OR2C 2HZDA 2KRHA 4BQNA 2DXIA 1BOBA 1TZLA 3K6GA 3VYTB 2IS4A 2GJPA 5HKKA 2ZSIB 2O0WA 2K5CA 2JA2A 1H80A 4PSWA 2E60A 4BQOA 1UD2A 3RCOA 2O0VA 2VJ5A 2W00A 2GJKA 1HVXA 2OUMA 1HG8A 2VQCA 3AFHA 4F3QA 1RWRA 3C2HA 2NT6A 3W2AA 2Z1DA 3DPTA 4ZDPA 2D3NA 3A4CA 1JTAA 2WAFA 2MABA 4F91B 1E3XA 3GVLA 1LDKB 2M7AA 4W8QA 5LD2C 4F55A 4OJLA 3DPLC 2KLOA 2NZMA 4OWRB 3FKSA 4OAYA 4RLFA 1DGWY 5CQGA 3E1SA 3HL2A 3J7AY 3OS1A 1BR2A 4ASUA 1D1CA 1MNDA 3HC7A 4BEHB 3VSLA 5C1EA 3L2QA 2CS3A 2DCEA 4YELA 3C2GA 4HNTA 3CF2A 2F4IA 2R7OA 4Z06A 4PJMA 2KHMA 4KKUA 5KNLA 4IZZA 1NRKA 1UG0A 3VYRB 1NBMA 4TKOB 2DT7B 4H4KC 4TSFA 2DOAA 4DJAA 1I18A 4Z03A 4G6TB 4KKSA 1XG2A 2RNGA 1SFKA 2LY1A 3A2KA 4U7BA 4C2UA 3QYBA 1T95A 3CESA 3D5LA 2L2OA 2L5QA 2VIXA 2INVA 3VMWA 1X1DA 4GRIA 4YZQA 3OOUA 4CUGA 4CH7A 1MMGA 1IA5A 3OL3A 3VDXA 1WJFA 1DP3A 2X6XA 1EFRA 1K6YA 2MC4A 1EA3A 2UVFA 2XDVA 3LSGA 3OYEA 2JVGA 2I8DA 3OYFA 2VBMA 3K70D 2Z6BD 1E1RA 4B3GA 3NE5B 1D1BA 3A3BA 4XR6A 4ITVA 5HNFA 3HKZA 3OL4A 3MD2A 1COWA 2P0WA 4W8RA 2K3PA 2INUA 2DJIA 2QY1A 2VJIA 4II2A 3SEQA 3GRHA 2LRDA 4CCKA 3MKZA 1HA8A 1V0EA 4BJ6C 2QX3A 3LMWA 5AMVA 1YX3A 3LMMA 4XKWA 1Z7LA 3TMOA 4XQFA 2PYGA 1QCXA 3UW0A 2BOLA 2RREA 4B3XA 2UUZA 2WAEA 1D0YA 3BG7A 3LSIA 2W1OA 3SZGA 4X0GA 3D5RC 2XSJC 3H35A 4C2LA 1PYVA 2FUG2 4U49A 2L9NA 4E7KA 1E0EA 3DPUA 4PFPA 3RQ4A 3B90A 3ZCOA 1LKXA 2VXZA 4BE2A 3M8JA 4KITB 1T0FC 2VJJA 1CZFA 4HSTA 1WJAA 1V5GA 4XKVA 3OYJA 1BN8A 3KX2A 1NG7A 2LBFB 4F52A 4KJZA 1V5FA 3CJQB 4HEA2 4PFOA 3CP8A 4MXNA 3VSTA 3KYLA 4OJ6A 2KP6A 3K10A 4NK6A 2OV7A 4NNJA 3T53B 2XZLA 1O8JA 3G05A 4XN0A 3TBIA 1WTHD 4ZJZA 4URRA 4DBQA 2V1NA 2Z2SB 1MMDA 2M3AA 4ZDLA 4DBRA 3K4KA 4B44A 3TL4X 2CV1A 2ZZQA 1O88A 3ZSCA 4OJ5A 5C1CA 1VJSA 2X53S 3B4NA 3G2BA 1VZ0A 3GQBA 4E6KG 1DBGA 2PECA 2ODLA 2M7BA 4CCMA 2LREA 3PL8A 4BDZA 1SAUA 3ONQA 2D3LA 2WY8Q 5KCMA 3LSKA 1FMWA 2X85A 2GOXB 2HPIA 3JURA 3H0DA 3ZIAA 1DGRM 3OR1C 3V42A 4PSXA 2BVLA 2ZXIA 1WJ5A 3OW7A 4I84A 4DK1A 3MKYB 1O8MA 3L2RA 1J09A 1X0CA 3OS0A 3W2WA 3OYHA 5KHDA 3S3NA 4KISA 3ZXSA 4Z05A 2WBMA 3BLYA 1X19A 2VBKA 2VKDA 2V7FA 1D1AA 3S8PA 2LZJA 4FXUA 2IGOA 2QE7A 1N78A 2PMZA 2Y0SA 3UR3C 2VB6A 1G8XA 3HPGA 4G7WA 2WADA 2Z16A 2MD0A 4XLAA 4E7LA 4G7XA 1PJRA 2BW3A 4CCLA 4J00A 2AQEA 1MABA 3BC8A 2JJ1A 4IQJA 1RU4A 2O5RA 3QOEA 3H5RA 3VWBA 1X1AA 4BE1A 1X1BA 2W6IA 3I9V2 5FROA 3GVJA 1X4PA 3DU6A 3S3MA 3QYEA 2F5VA 3OYCA 1IB4A 1PE9A 3OFNA 2X1DA 4AU7A 1AA7A 2KVOA 1OGOX 1MNEA 1X1CA 3RSNA 2VQHA 4D1QA 3GQ9A 5CKTA 3A1YA 3RTRA 1Y56A 2WA0A 3MKWB 3DDYA 2CFOA 1Z3XA 2Q2EB 4BUPA 1OB0A 1O8HA 4BE0A 4JOMA 4ZC3A 4XN3A 1BR1A 2UV1A 1YX5A 2HU9A 3BCBA 5JHFA 3KEYA 1O8DA 2R4GA 4XLCA 4XKCA 2V26A 4Z1MA 4PK4A 2EWEA 4XD7A 3A3GA 2HVRA 2KRCA 3EQOA 2VQLA 3OYDA 1ZELA 3DTIA 3VYUB 2LOOA 4UZUA 5CQEA 2ZZEA 3VSUA 3VYSB 4DIQA 1K28D 3S3OA 1S9HA 3FDYA 3JU4A 2XZOA 3OIQA 4C9YA 3OYKA 2LY2A 3WWGA 4U87A 1U0JA 2CV0A 1VF7A 1OFMA 1OOCA 4E7IA 4E0FA 2IQ7A 4CCOA 2ZZGA 4XLHA 1KCCA 4NC7A 2ZTNA 3H9JA 1BR4A 1OHHA 1LFPA 3EUAA 2GK7A 2XGJA 4NUBA 1OGMX 1E43A 3NWTA 4EW9A 3HUGB 2CMPA 3IP4B 4C2TA 1NHCA 4W8TA 3PNVA 4YZAA 2UWMA 1NG6A 3OEEA 3SDBA 2NSTA 3DU5A 1WJCA 2IXSA 3S93A 3PSIA 3UNGC 4B47A 3DTEA 4BEHA 3K4CA 1ERDA 4AVZA 2F1MA 1O8IA 4P5OA 3FBIB 3GQ8A 2ZXHA 4XOPA 3OYNA 4JMQA 3OE7A 4XLEA 1BMFA 4HG2A 1V5EA 3N05A 3W2VA 2CV2A 2E1MB 4GQNA 4DNTB 4D9JA 2VBEA 3LL7A 3FHNA 4BL0B 2MFZA 3EPZA 4PJNA 1BHEA 1O8LA 1UD3A 2PJRB 4B43A 1WP6A 2VASA 1PXZA 2RQQA 2KQRA 2R7QA 3GQAA 3LSMA 2OC6A 1QHHD 2NT9A 2KDOA 2F43A 3IAS2 4DK0A 3ZR8X 4MR0A 1WFXA 3H9QA 1KZLA 2BVMA 2CUJA 2JVHA 3BCAA 2A5WA 3OAAA 2JJ2A 4PUSA 1E1QA 2CUZA 1K5CA 3K4MA 4NQWB 1W36C 3DLAA 2HNHA 3DWLE 1D0ZA 2XC7A 2R7UA 1PKVA 3VMVA 4CCJA 3CP2A 3GBGA 3OIPA 3EQNA 4BACA 3SUCA 1O8FA 3M1CA 5HVQC 4E7JA 2BSPA 4DGWB 2BW3B 1WPCA 2X8KA 3MMYB 2E5NA 2ZTGA 4G6IA 2WY7Q 4LIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z06 A;  1EE6 A;  4YEJ A;  1X0C A;  4HWV A;  1IDK A;  4Z05 A;  2VBK A;  4YZ0 A;  4Z03 A;  1XG2 A;  2O17 A;  4XLA A;  1VBL A;  2INV A;  3VMW A;  4YZQ A;  1RU4 A;  4XOR A;  2NTB A;  1IA5 A;  1KTW A;  2X6X A;  2UVF A;  2VBM A;  1IB4 A;  1PE9 A;  1OGO X;  3B8Y A;  4XR6 A;  1O8G A;  3GQ9 A;  3T9G A;  4W8R A;  1O8H A;  2INU A;  2QY1 A;  4OJO A;  2VJI A;  3GRH A;  4XN3 A;  2QX3 A;  5AMV A;  3LMW A;  1O8D A;  4XLC A;  1PLU A;  4XL9 A;  2X3H A;  2EWE A;  1GQ8 A;  3EQO A;  4XKW A;  4NK8 A;  4XQF A;  2PYG A;  3UW0 A;  1QCX A;  4XON A;  1WMR A;  2NSP A;  4YZX A;  4PMH A;  3VSU A;  1OFL A;  2NTQ A;  1AIR A;  4C2L A;  4OZY A;  3WWG A;  2Z8G A;  4U49 A;  1OFM A;  1KCD A;  1OOC A;  4XOT A;  4OJP A;  2IQ7 A;  3B90 A;  1KCC A;  4XLH A;  4XNF A;  1DBO A;  4U4B A;  4OZZ A;  4XM3 A;  1OGM X;  2QXZ A;  3KRG A;  4EW9 A;  1JRG A;  1CZF A;  2VJJ A;  1NHC A;  4W8T A;  2O1D A;  4YZA A;  4XKV A;  1BN8 A;  4XLF A;  4W8S A;  2NST A;  3VSV A;  1O8K A;  3FY3 A;  3ZPP A;  1IDJ A;  1O8I A;  4MXN A;  4AVZ A;  3ZSC A;  3VST A;  3GQ8 A;  4XOP A;  4OJ6 A;  2O0W A;  1H80 A;  1QJV A;  4XLE A;  2PYH A;  1O8J A;  4XN0 A;  2O0V A;  4URR A;  2VBE A;  1HG8 A;  1RWR A;  2NT6 A;  2O04 A;  1BHE A;  2X6Y A;  1O8L A;  1O88 A;  1JTA A;  5C1C A;  4OJ5 A;  1PXZ A;  3GQA A;  2NT9 A;  4W8Q A;  3B4N A;  1O8E A;  4OJL A;  4MR0 A;  1DBG A;  2PEC A;  2NZM A;  2ODL A;  1K5C A;  2NTP A;  4NK6 A;  1RMG A;  3VMV A;  3EQN A;  2X85 A;  3SUC A;  3JUR A;  1O8F A;  4XMY A;  2BSP A;  2UVE A;  3GQ7 A;  5C1E A;  4YEL A;  4I84 A;  1O8M A;  2X6W A; 
#chains in the Genus database with same CATH topology
 3HTS B;  1KON A;  5FLX K;  3ZGK A;  3WTU C;  3LYC A;  2BVN A;  3W6V A;  3ZUG A;  2Z9O A;  5JFR A;  2EIX A;  3L2V A;  2IA2 A;  2A6T A;  1MBE A;  3L2W A;  2DYI A;  4YEI A;  3JSO A;  4N9H A;  5L3C A;  3G3Z A;  1Q86 D;  3H3V K;  2QDX A;  2O6W A;  2BXY A;  2EIL H;  4YAF A;  1OCC H;  1RES A;  3WHB A;  4JYK A;  1B8I B;  5H5J A;  1VBL A;  4XK4 A;  2XAU A;  1F1Z A;  2I1L A;  2CQ7 A;  2FNP A;  1OYW A;  2HQA A;  2QQ8 A;  1FX0 A;  4BQQ A;  2EA2 A;  3ZC3 A;  4QFM A;  5GPA A;  4P9S A;  4R71 A;  3W2G A;  1VQ7 B;  3KLO A;  1HXD A;  2M0M A;  4O3M A;  3GZ5 A;  4Y4R A;  1R71 A;  1ZGA A;  4YRV A;  2R5Z B;  3JRA A;  4EGZ A;  3KEO A;  5ED4 A;  5JVG F;  2XC1 A;  4PC7 A;  3CC7 I;  1IZ1 A;  4CZC A;  3CMM A;  3OJX A;  3I58 A;  4HIZ A;  2ISY A;  5IYR A;  1K9M D;  2LG4 A;  4YZX A;  4PMH A;  3OSF A;  1ENH A;  1VQK I;  3P5J A;  3WXM A;  3HGY A;  1VQ8 B;  2XAG A;  5B3S H;  4ESF A;  2JJ7 A;  2R5Y B;  1T98 A;  2VXD A;  5CVV A;  3G1M A;  4V02 C;  2Z3Y A;  1WJE A;  3M1E A;  4RCY A;  4F7D A;  1YX2 A;  4M9Z A;  2PJP A;  1OR7 C;  4XNF A;  1DBO A;  2OU2 A;  2A6E F;  9ANT A;  4PJJ A;  4QWQ A;  1AHD P;  2VPL A;  2QXZ A;  2X1E A;  1TWC J;  4IHS A;  1ETV A;  4A3C J;  3D5S C;  1R49 A;  3HAG A;  3KEW A;  4XLF A;  3BQY A;  3E3V A;  4G7Z F;  3BCF A;  4LOC A;  3PA1 A;  5B6I A;  4RDK A;  2ZNZ A;  1OCZ H;  1D0X A;  4BJ5 C;  3ZN0 A;  1QU3 A;  4I01 A;  1F43 A;  4XRF A;  2KIF A;  2QM3 A;  5DM6 F;  1YW7 A;  3NB2 A;  3A0H C;  1V0F A;  4UVB A;  2VC0 A;  2HVS A;  3HOS A;  4LGW A;  1DP7 P;  1W4M A;  2OZ6 A;  3PQK A;  1T0F A;  3I4N J;  2X1C A;  4ZTJ A;  3ASP A;  4K1X A;  1ZR4 A;  2QEN A;  4WWC A;  1QGP A;  2BY0 A;  2HDW A;  4M3E A;  4B09 A;  1VQL I;  3MCA A;  2R7F A;  2V9K A;  2XPW A;  2XVC A;  4QLC U;  4N3N A;  5E6T A;  3PNT A;  2O03 A;  2LTP A;  4IX7 A;  2ME6 A;  3HSE A;  3Q9S A;  4Q48 A;  3DKW A;  1VLY A;  3QFC A;  2CFX A;  4ZYH A;  1PDN C;  2DU9 A;  1EFT A;  1A35 A;  2QMU A;  3U6K A;  1B2R A;  4TT3 A;  3KIO A;  2FE3 A;  4R1H A;  2FX3 A;  3FXQ A;  2EZH A;  3ZQQ A;  2EIN H;  5GPC A;  1P9Q C;  5CDF A;  2H1L A;  2V6C A;  1N75 A;  1RR7 A;  2A69 F;  2M4G A;  2QKL B;  4GCV A;  3ZN1 A;  2BHY A;  1ZM2 A;  1WGX A;  1ZK8 A;  1ACI A;  5LEJ A;  4M71 A;  3IL2 A;  3VMF A;  2V79 A;  5A8A A;  5EG0 A;  1Z7U A;  2UVE A;  2N8G A;  2XAS A;  3WTZ A;  3JRH A;  1SM4 A;  2JSC A;  2HLD A;  4ENN A;  1TYU A;  3BCD A;  4YEJ A;  1YS6 A;  4YII A;  5BOX A;  1R5I D;  1EE6 A;  2A6H F;  1ZG3 A;  1OCT C;  4EH1 A;  3GME A;  5EDN A;  3J7Y J;  1N05 A;  1JI8 A;  4CA0 A;  1BL0 A;  2YWF A;  2D1V A;  3IUO A;  5KAF C;  4P55 A;  4AM3 A;  3EUH C;  4HOB A;  2Q6O A;  1OFC X;  3L1P A;  5DTD A;  4IQ4 A;  5LGT A;  3LSR A;  1KYW A;  1UB9 A;  1JJ8 C;  3BG6 A;  3ONY A;  4A93 J;  2P6T A;  4R79 A;  2WSS A;  1NTC A;  3JSP A;  1FBQ A;  3LAP A;  3AG2 H;  5IYW A;  1VQO B;  2XKO A;  5J8F A;  4IHV A;  3LJY A;  2GJR A;  1X3U A;  2EH3 A;  3OYM A;  4XOR A;  4NHJ A;  2NTB A;  3WYA A;  4BH9 A;  1YRN A;  2GA2 A;  2KIU A;  1OGI A;  3TKY A;  2ECC A;  1ZRC A;  2EFQ A;  4S0H B;  2JN9 A;  2E1M C;  3FKJ A;  3LQ6 A;  4ESB A;  1BPL A;  3AL0 C;  4D7N A;  4ENK A;  5EYR A;  2IS1 A;  2HOE A;  4ZZL A;  3R61 A;  3ZZU A;  5AIQ A;  3BR2 A;  3HPH A;  1FZP B;  3AVU A;  4ZCM A;  5E1X A;  1JTX A;  3FXR A;  4UUS A;  1DQU A;  4A69 C;  5BSY A;  3LA2 A;  3DEW A;  3MZ8 A;  3CCV I;  4YAU A;  4GO1 A;  4B3A A;  1EWY A;  1DDI A;  2NSP A;  1XC5 A;  2LH9 A;  4L9J A;  4ASN A;  4OIN F;  1S6L A;  2VLA A;  2QTZ A;  3RPU D;  1YJ9 I;  2VUM J;  1VQM B;  3DBR B;  2CH0 A;  2IAI A;  4FE4 A;  1CGP A;  2VE9 A;  2E1C A;  2VBT A;  3BH4 A;  5FKM A;  1B9M A;  3SXY A;  4BKX A;  2QEX I;  4HNU A;  2NNN A;  4Z4W A;  3CCE B;  3TOA A;  4LC0 A;  3J81 K;  1GLN A;  2BV3 A;  3MZH A;  1TWG J;  2X6O A;  3GLL A;  3RKW A;  3JAM K;  2P5L C;  1VQO I;  1ETQ A;  4XKB A;  1ZLK A;  2FA5 A;  1KJZ A;  1KTV A;  1FP2 A;  2JA8 J;  3U1K A;  3I55 B;  4LIV A;  1YLO A;  4BU2 A;  1OIS A;  4W8S A;  2M1B A;  1G59 A;  4EJT A;  3FZV A;  2WB1 A;  1ETX A;  4V19 K;  3DBH B;  4Y7N J;  3ZSC A;  2KRH A;  3IV5 A;  1IC8 A;  4OIO F;  1W2B B;  1E2X A;  3AVY A;  1IUY A;  2IBD A;  2TRT A;  2XGC A;  3QQA A;  1N0V C;  4BQO A;  4YG2 F;  4RJL A;  1IO2 A;  4GDF A;  2V1D A;  3O8G A;  5L3B A;  4I76 A;  2GJK A;  5K1Y A;  2BGI A;  3J80 K;  1KU7 A;  1OKR A;  3A01 A;  2VQC A;  4F3Q A;  1HG8 A;  3V7R A;  2Z1D A;  3COA C;  1BX0 A;  3F8M A;  3F0C A;  2DA3 A;  2H09 A;  3HHH A;  1JTA A;  2WAF A;  3GVL A;  1UJ8 A;  2FNA A;  1SVM A;  5KVR A;  5LD2 C;  1YJ9 B;  1LM1 A;  1QZE A;  2KJC A;  3S2D J;  3DPL C;  4I02 A;  1YI2 I;  3CB4 A;  3FIW A;  3CO6 C;  2LKS A;  1KQ9 A;  1X58 A;  3S1N J;  2Y30 A;  3A0B C;  2Q6I A;  3S17 J;  3CC2 I;  4D5F A;  1DGW Y;  1QUE A;  2DI3 A;  4UHT A;  1GVH A;  3E1S A;  4AIH A;  3K69 A;  1ETY A;  5K5R A;  4WZE A;  1I3Q J;  3L2Q A;  1ZRD A;  1GO2 A;  1QVT A;  3WOD F;  4DQK A;  1PJ6 A;  2RC6 A;  3I54 A;  3W5H A;  3KEQ A;  3KE2 A;  1NRK A;  1UG0 A;  1NBM A;  3MCZ A;  4TKO B;  3ONU A;  3SQV A;  2XV4 S;  5IYP A;  2O61 A;  1MBK A;  1OCR H;  2E1N A;  2LY1 A;  1S0U A;  2DYR H;  1Z91 A;  1D8J A;  2XTW A;  4S05 A;  3D5L A;  1P4M A;  1T56 A;  1V54 H;  4GRI A;  1U6G A;  4P9F A;  4CH7 A;  3GFI A;  1MMG A;  2DOD A;  3HDD A;  1VQ6 I;  1DP3 A;  4G1B A;  4UNO A;  4HZF A;  2XDV A;  3OYE A;  1PVE A;  1F36 A;  2CWE A;  2P3M A;  4B3G A;  3FWE A;  1IG7 A;  3ABM H;  4ITV A;  4XR6 A;  4HAM A;  3S14 J;  4M0L A;  4AF7 A;  5H2F C;  5E18 F;  2P0W A;  1U2R A;  2E1R A;  3OSG A;  4M3F A;  3AGP A;  2QY1 A;  2G0E A;  5BMZ A;  1FSH A;  2Y0M A;  1I6H J;  4GXO A;  3E5U A;  5F1J A;  1H0M A;  3QOP A;  1YX3 A;  1IRG A;  5DD4 A;  3ZQC A;  2F5D A;  1CQX A;  4XKW A;  4HLY A;  2RRE A;  5FD6 A;  1A6Q A;  5EF6 A;  2C6Y A;  2W1O A;  1OYI A;  3BZC A;  4ON0 A;  4X0G A;  2Y31 A;  4HQM A;  4OOI A;  2BM4 A;  2XNJ A;  3H92 A;  1E0E A;  2FVG A;  2V7U A;  3CPW B;  2PG4 A;  1TC3 C;  3B90 A;  2RQP A;  1EKE A;  1OCP A;  4FE7 A;  4LLG F;  4RB0 A;  2BGJ A;  2ZB9 A;  2FXA A;  5L3E A;  3B02 A;  4KNY A;  1W87 A;  4A0Z A;  1CZF A;  3AVV A;  3BY2 A;  2VFO A;  3GVA A;  5FKK A;  1Q1V A;  4HST A;  1V5G A;  4XKV A;  3RIQ A;  1U8R A;  3CCY A;  3KX2 A;  4Y15 A;  4M6Y A;  3P9K A;  5DYM A;  1BBY A;  2LBF B;  1JGS A;  3K2A A;  4F52 A;  4HEA 2;  4PFO A;  3Q38 A;  3CP8 A;  1MH3 A;  4MXN A;  1B72 A;  1IAW A;  3I53 A;  3VST A;  3K7A J;  2CUE A;  4MYU A;  2OV7 A;  1TYX A;  2OD5 A;  2FOW A;  3ABL H;  3ZQI A;  2WAQ N;  1FTT A;  5GAD J;  1FDR A;  5F4M A;  4URR A;  2RN7 A;  4KFC A;  1Z05 A;  4X7F A;  2DMP A;  2GIV A;  1YHQ I;  1P7J A;  4B44 A;  2CV1 A;  2ESH A;  2X53 S;  2BM0 A;  3CC4 B;  3G2B A;  1VZ0 A;  4E6K G;  2R5Z A;  1FRQ A;  1HQC A;  1N25 A;  2PEC A;  1FYM A;  1QFJ A;  2M7B A;  4NDL A;  2CW0 F;  4LB6 B;  2LLK A;  1FPQ A;  1YO5 C;  2VOO A;  3HM5 A;  4OIR F;  1FC3 A;  3ZMV A;  2FD5 A;  3RIR A;  1FMW A;  2DFF A;  1G3Y A;  1HA3 A;  1RRJ A;  3V42 A;  3GUD A;  2O6G E;  1DAR A;  4PSX A;  2LNB A;  1SC7 A;  3BNW A;  1MDM A;  3BY6 A;  5BNG A;  3CO7 C;  1X0C A;  4M6V A;  3OS0 A;  1G3S A;  2VBW A;  3LA3 A;  5KHD A;  1Q9S A;  1OB5 A;  1J9Z A;  2A3S A;  3NRV A;  4DZP A;  2QTL A;  1I50 J;  1D1A A;  1MD0 A;  3W2H A;  1TNT A;  4OM9 A;  2Y0S A;  2K40 A;  1LB2 A;  2DFH A;  1VQN I;  1PJR A;  3JX8 A;  2BW3 A;  3WTX C;  3GFL A;  5D5W B;  5F0F A;  3J80 Z;  2VON A;  2V7X A;  4YC5 A;  1UHM A;  3I59 B;  3T1B A;  3QOE A;  2K9Q A;  3VO1 A;  1VHE A;  4PJ0 C;  2QUF A;  1EP1 B;  2W6I A;  3GVJ A;  2TCT A;  1SFO J;  1WKM A;  4FWT A;  3QYE A;  1W5S A;  2F5V A;  5H6Q A;  3OFN A;  1Y1W J;  5GP9 A;  1DU0 A;  1BJA A;  1OGO X;  3ISP A;  3ML3 A;  2LMD A;  2VQH A;  1A31 A;  1MBG A;  1WH7 A;  3MKW B;  1Y56 A;  1DG1 G;  3DDY A;  2CFO A;  3QP6 A;  1OB0 A;  1O8H A;  2PEX A;  3BTJ A;  1TLH B;  2F4M B;  4ZC3 A;  3WG9 A;  3PSS A;  1J7K A;  3M07 A;  1O8D A;  2PI0 A;  1BW6 A;  3MEX A;  2LY9 A;  4FK8 A;  2HVR A;  2KRC A;  2QVO A;  3CC2 B;  1QRB A;  4LLL A;  4GYI A;  2MH2 A;  1P4W A;  4WX9 A;  1XDU A;  4UZE A;  4UZU A;  3SEJ A;  4NBQ A;  3FF5 A;  1YLF A;  1FOW A;  2W84 A;  5FKL A;  4DIQ A;  4XIC A;  1K28 D;  1K6O A;  4IOA F;  4B8X A;  4OPV A;  4XRS A;  3OIQ A;  2LY2 A;  3KPH A;  4U87 A;  2CV0 A;  3J81 k;  1J0R A;  1ZRE A;  1FRN A;  2ZZG A;  4I0B A;  1EJ9 A;  2OCE A;  2ZME C;  5CYV A;  1JT0 A;  5HLG A;  4NUB A;  3ZQF A;  4EW9 A;  3HUG B;  3IP4 B;  3OOP A;  2DLL A;  3RYP A;  1O3S A;  2FSW A;  4KH3 A;  3SHF A;  1JTY A;  3PNV A;  3Q39 A;  3CCR I;  1G7C A;  4OP7 A;  3OEE A;  3H3Z A;  3DU5 A;  2IXS A;  4I09 A;  3UNG C;  3ULQ B;  4BEH A;  4P5O A;  3WE3 A;  2JPB A;  3G1O A;  3P26 A;  4Z4V A;  2DTZ A;  3PEN A;  4RA2 A;  1OGJ A;  3OP1 A;  2M30 A;  2IOU G;  1PJ7 A;  2FML A;  2PMZ N;  3W2E A;  2CV2 A;  3WND A;  2DY1 A;  4NBS A;  5TRD A;  2CUF A;  4AC0 A;  1WWX A;  4TMT A;  4G8X A;  2VBE A;  4BL0 B;  1N07 A;  2NYX A;  4CYC B;  3QSY A;  1O8L A;  2ESN A;  1HF2 A;  4B43 A;  3QFT A;  1N8R D;  2RQQ A;  2DOF A;  3IAS 2;  1DDN A;  4A0X A;  2IT0 A;  1RUN A;  3UKG A;  1FSE A;  5LHI A;  3GEZ A;  3K9T A;  4MYT A;  2FEZ A;  2CUZ A;  2CU7 A;  2MG4 A;  3D26 A;  3AST A;  1UHW A;  3FXO A;  2PIA A;  4CCJ A;  4LBZ A;  3CP2 A;  3GBG A;  3CMY A;  1HKS A;  1TNS A;  4IO9 F;  2ISZ A;  1Y0Y A;  5HVQ C;  4CGZ A;  3DFG A;  2BW3 B;  1WPC A;  5IOY A;  1VQ5 B;  2E5N A;  2JPC A;  3C7J A;  5J3L A;  2ETH A;  4KA4 A;  4RD4 A;  1E3H A;  3E20 A;  3OV8 A;  2BGC A;  5FFZ A;  1IDK A;  3J81 Z;  2P6S A;  2DT6 A;  3IKT A;  1FEX A;  4DYR A;  5IK2 A;  3LFU A;  1YE9 A;  5BS6 A;  5J8C A;  4PC6 A;  3ROU A;  3D0S A;  2D1H A;  3FPP A;  2DTR A;  3T0Y A;  2YX4 A;  3PNY A;  4M73 A;  3G6E I;  2VNH A;  1WJB A;  2ZO4 A;  3FXU A;  1OMI A;  4JP0 A;  1B59 A;  2VBU A;  3GTQ J;  1P2F A;  1ZGW A;  2MW8 A;  1Q82 D;  4G7O F;  5D5U B;  3JQQ A;  1KA8 A;  4AYB A;  2Q1Z B;  5EEH A;  5ILV A;  3WGG A;  1W0K A;  2VJ4 A;  5LRS A;  1PUF A;  2E2I J;  3B8Y A;  1YQA A;  2EPF A;  4BXF A;  2L3D A;  1TT0 A;  4J01 A;  4II3 A;  4RDJ A;  2HDC A;  4E7H A;  3C2B A;  2M87 A;  5J1R A;  3CC4 I;  3OOC A;  4Z4T A;  2WJY A;  2ZFU A;  2JA5 J;  2CBX A;  2JIZ A;  3GO5 A;  4LMY A;  4W97 A;  3WGI A;  4RD3 A;  1A6I A;  4XL9 A;  4FET A;  2NPF A;  4L0Y B;  1ZN2 A;  5DUK A;  1UHS A;  1WJD A;  4XON A;  3HSR A;  3B78 A;  2LR8 A;  3L2U A;  3R6K A;  1UD5 A;  3DEU A;  3FK7 A;  2EJR A;  2C2W A;  3KP3 A;  4XLN F;  3TO9 A;  2NRA C;  1ORK A;  4BQA A;  2DEU A;  3SY2 A;  2F2E A;  1MNM C;  4A3L J;  4KT6 A;  4R8H A;  5DN6 A;  2DFE A;  1HDP A;  5K5O A;  2EQR A;  3OZU A;  2O7O A;  4IRI A;  2BM7 A;  1W36 D;  2RV8 A;  3OYB A;  3F22 A;  3A35 A;  4M74 A;  2R9V A;  5EMN A;  2XKP A;  2O1D A;  2LF7 A;  2L0K A;  3RKY A;  2YS9 A;  3EUH A;  3WTY C;  1V5V A;  4UUV A;  3ZPP A;  3NWS A;  1ELO A;  3DKY A;  2L9R A;  2L7K A;  3HG9 A;  3GSI A;  5DNS A;  1GAW A;  2M8G X;  4L8J A;  4OOV A;  1XFO A;  4AVP A;  1STZ A;  4Y3O A;  3JTH A;  2PYH A;  1BA5 A;  1IJE A;  3IHU A;  2I5U A;  2WC2 A;  3OIO A;  5J4V A;  5LGU A;  4KYW A;  3VR6 A;  2LK2 A;  3AKZ A;  4ZTF A;  1H8H A;  1K79 A;  3VEP A;  1QGY A;  4U88 A;  2XTX A;  5D5X B;  2IA0 A;  5F4J A;  1U3E M;  3K4J A;  3NAW A;  2XGE A;  5ICG A;  1W34 A;  5HNH A;  2HOS A;  1O8E A;  3G73 A;  2QA4 I;  4IF4 A;  5JVT A;  2KFD A;  4DOZ A;  4BJT A;  3HOV J;  4X7C A;  3T51 B;  1SMT A;  1VQ4 B;  2GOM A;  2GK6 A;  1XB4 A;  3HYI A;  4G9Y A;  4NK6 A;  2EV6 A;  4P1W A;  4M53 A;  2LYC A;  1HBX G;  1UMK A;  2GZW A;  1EA0 A;  3QOD A;  1R5G A;  4XMY A;  4PC2 A;  3CCS B;  5E3M A;  4IHW A;  1R4M B;  4ANJ A;  2XAF A;  5IY5 H;  5D8L B;  2HYJ A;  1T6S A;  1KGS A;  1H9G A;  1P4A A;  1Z9C A;  3PO3 J;  3LNN A;  4M3B A;  1S7A A;  4EAT A;  4KKT A;  4CSW A;  4TMX A;  3E1Y E;  1B23 P;  1MMN A;  2Q0O A;  2EV5 A;  3OJW A;  2JSP A;  2VFM A;  2VL8 A;  1ON2 A;  4F93 B;  2QCO A;  1ZM9 A;  4LBY A;  3FKI J;  3T8R A;  3BOQ A;  2IGK A;  4BS9 A;  3U2R A;  5F0H A;  2XZP A;  1FNC A;  5F4O A;  1LJ9 A;  4U7D A;  4L18 B;  3F72 A;  4QHY A;  3PUB A;  1Z21 A;  2VBY A;  1EP3 B;  1R6R A;  4LJZ F;  4M72 A;  4EJV A;  2R92 J;  2JK3 A;  1E3Z A;  3PFY A;  1L0O C;  1K4S A;  2HEO A;  1UAA A;  2CND A;  3C18 A;  3HJE A;  3A8K A;  4HQE A;  5L3F A;  3TH0 A;  4E4H A;  3ECH A;  3S1Q J;  4RCZ A;  4OJO A;  1WHU A;  2LBF A;  1MDM B;  2X3U A;  2QZ8 A;  3H5N A;  1D2E A;  1KRH A;  4P25 A;  3DBL B;  1FIP A;  1MMA A;  3BT9 A;  3ELK A;  1NDH A;  3PM1 A;  2BPO A;  3OY9 A;  3OPO A;  3V7A A;  2OQR A;  2MLG A;  1WMR A;  2LKP A;  3QP5 A;  4QPO A;  2VQG A;  2ZFW A;  1JB9 A;  3CCU B;  1R4N B;  3TQN A;  1FBU A;  1GV5 A;  4M6X A;  5B1B H;  4MFE A;  1WOO A;  3JRI A;  2KL4 A;  2AS5 F;  2Z8G A;  2IGN A;  1KCD A;  4XOT A;  2KMU A;  4P3Y A;  3DP7 A;  3M3Y J;  3R0J A;  1KYZ A;  2FBK A;  2HCJ B;  1FTZ A;  3E5X A;  1BQE A;  1IHM A;  3KRG A;  1S29 A;  1B8I A;  4Y33 A;  4N3G A;  2J8K A;  1Y0N A;  3Q0U A;  1Y1V J;  1UD4 A;  2RNJ A;  5J35 A;  3G6E B;  3OZW A;  3T56 B;  3U21 A;  4BGD A;  1SKQ A;  2ELK A;  3OW2 B;  5EJC A;  3HOW J;  1IV8 A;  1YG2 A;  3FY3 A;  2COB A;  2EWN A;  2W24 A;  3OR2 C;  2HZD A;  2DN0 A;  2DXI A;  2I10 A;  1BOB A;  1TZL A;  1QPM A;  2VI6 A;  2IS4 A;  4UVC A;  2Z33 A;  4M2L A;  3B82 A;  4LBV A;  3JRD A;  2JA2 A;  4XRS G;  4FIS A;  4Z6Y A;  2O0V A;  4WK8 F;  3ABU A;  2QBY B;  1HVX A;  1KK0 A;  4YHB A;  5E3L A;  3C2H A;  2V4D A;  4CO8 A;  2COM A;  1SVL A;  2M7A A;  3ABT A;  4WWV A;  4DYC A;  1QGZ A;  3PO2 J;  4TN1 A;  1AMO A;  4W8Q A;  2L54 A;  1QVU A;  4OJL A;  5J6X A;  2P5V A;  2KLO A;  3TDU C;  3JQR A;  3HUG A;  5DEQ A;  1HST A;  2NZM A;  5JLV C;  4V2G A;  1HW1 A;  4OWR B;  4OPW A;  3P9I A;  1LE8 B;  1Q1H A;  2HXO A;  1OR7 A;  2JRM A;  4G94 A;  4Y17 A;  3HL2 A;  3OS1 A;  2CQK A;  2DT5 A;  1MND A;  2F5C A;  3HC7 A;  3REO A;  1AU7 A;  4GFB A;  2RC5 A;  4TMV A;  1JKQ C;  4ZYG A;  2QSF X;  3VSL A;  1Z6T A;  4BEH B;  1BI0 A;  1LLW A;  5C1E A;  2DCE A;  3GLX A;  1TTT A;  4P1V A;  2DA1 A;  4M3D A;  1KU2 A;  4Z4Y A;  5KNL A;  3GTL J;  1YFH A;  1MBH A;  2L02 A;  3L09 A;  2K4J A;  3VYR B;  1G6N A;  3KZI C;  4Y52 J;  1JUS A;  4M4S A;  4G6T B;  3RJP A;  5JLX A;  4U7B A;  4C2U A;  2L2O A;  3M4O J;  2L5Q A;  2Z99 A;  1EXM A;  4I98 B;  5HLI A;  1QA6 A;  1Y0R A;  1MBF A;  1XMA A;  2Q2E A;  3OL3 A;  1WJF A;  3VDX A;  1JKR C;  2CRG A;  1K6Y A;  4M1K A;  1EA3 A;  3GTM J;  3LSG A;  2VBM A;  3K70 D;  1BI1 A;  1XG1 A;  4G6D A;  1E1R A;  2Z6B D;  3B8H A;  4P6V F;  3BZK A;  1V4R A;  2R7Z J;  3GCM A;  2WTE A;  2F1L A;  4W8R A;  1JJ2 B;  1K4Z A;  2VJI A;  4Q5S F;  2LRD A;  4ZZD A;  3MKZ A;  2QX3 A;  3O2P E;  5AMV A;  1IDZ A;  3LMW A;  4KIG A;  5F27 A;  1QGA A;  2CO5 A;  1MJB A;  1S5L C;  2AXT C;  1KZH A;  2VNI A;  3LSP A;  4WZK A;  5CVU A;  1IN8 A;  4LK1 F;  1GVD A;  1APL C;  3WBJ A;  1D0Y A;  3TO7 A;  3G4S I;  4EJU A;  4AIK A;  3LSI A;  4LG0 B;  3SZG A;  4P6Y A;  2MH9 A;  2XSJ C;  3GFM A;  4YAO A;  5FKN A;  1ZAO A;  4U49 A;  3CCQ I;  3FHZ A;  3DPU A;  3V8K A;  1TWF J;  3Q6R A;  4GYG A;  5IYQ A;  2HYF A;  1LKX A;  3KFW X;  5GAE J;  5FGM A;  4NB5 A;  3AGQ A;  3H3U A;  5FLV A;  3MMP A;  1H9T A;  1YJN I;  3SZT A;  1YIT I;  5J40 A;  3OYJ A;  2PMU A;  1NG7 A;  1N06 A;  1N08 A;  2CSO A;  4KJZ A;  3CJQ B;  1DPU A;  1SD7 A;  3K0L A;  3E6B A;  1H8A C;  2E1O A;  3F6V A;  3KYL A;  4XID A;  3K10 A;  1WCM J;  2YWE A;  1VI0 A;  4NNJ A;  3T53 B;  1O8J A;  1TW2 A;  4Y9U A;  1P7I A;  5DV5 A;  5FIU A;  3W2F A;  1UMQ A;  2V1N A;  2Z2S B;  3V7S A;  3IH3 A;  4I99 C;  4ZDL A;  1IJF A;  3K4K A;  3CME B;  1VQK B;  3TL4 X;  1UFM A;  5L3D A;  5E1Z B;  4FX4 A;  1O88 A;  1UG2 A;  4EJO A;  4OJ5 A;  1TLL A;  2V1U A;  1XSV A;  4MGR A;  1VJS A;  2F48 A;  2K86 A;  1MSE C;  3MZY A;  2XAH A;  2GRE A;  3VNU A;  4P3I A;  2MGQ A;  3ZQ7 A;  1EP2 B;  2X4H A;  1Y8R B;  3RPU A;  2LRE A;  3JAM Z;  1RQR A;  4BDZ A;  1SAU A;  3ONQ A;  3TGN A;  1HDD C;  2WY8 Q;  4A3E J;  3LSK A;  3BWG A;  3RKX A;  2X85 A;  5AON A;  3JUR A;  3ZPL A;  5IYC J;  2VBS A;  3OR1 C;  1WPK A;  1XS9 A;  1XG2 A;  2L4A A;  4KIF A;  2ZXI A;  3OW7 A;  5FA6 A;  4I84 A;  5H59 A;  1K8A D;  1O8M A;  3AG4 H;  2F4O B;  1HOM A;  1YJN B;  2BM6 A;  2C4T A;  2Q6K A;  1ZGJ A;  4KIS A;  2ZBU A;  1RET A;  2X9D A;  2PLF A;  2OCC H;  2UXN A;  4Z05 A;  5E8I A;  2FRH A;  1X19 A;  2VBK A;  3EYI A;  1XB2 A;  2BXZ A;  2V7F A;  4DQL A;  1UCR A;  3S8P A;  2IRF G;  4BAY A;  2LZJ A;  4ZCL A;  3BG5 A;  4FXU A;  2IGO A;  2QE7 A;  2FOK A;  4Z2Y A;  2XRO A;  1JKP C;  4IL6 C;  1G8X A;  3LFK A;  4C3I J;  4QSH A;  4E7L A;  1GXP A;  1WI3 A;  1BX1 A;  3CUQ B;  1EFU A;  2AQE A;  4TMW A;  5IYN A;  3H5R A;  1X1A A;  3VFZ A;  4BE1 A;  1X1B A;  4X0C A;  3DU6 A;  1Y39 A;  3CD6 B;  1IB4 A;  1J9I A;  2X1D A;  2KVO A;  1UZC A;  3RSN A;  3GQ9 A;  2B9S A;  1QZY A;  4P22 A;  5HDN A;  4Q7J B;  3H36 A;  1Z3X A;  2OTL I;  5HXB A;  1CNF A;  5DD8 A;  2ADU A;  1LPQ A;  2J5O A;  3JRE A;  3VNV A;  1YX5 A;  2HU9 A;  1HCR A;  2K02 A;  2Y75 A;  3KEY A;  2DW4 A;  3LQQ A;  4XKC A;  4L9T A;  3SDG A;  4Z4U A;  4PK4 A;  4H9G A;  3M8F A;  3A3G A;  2W48 A;  1K4T A;  4RB1 A;  3VYU B;  4BNC A;  1GHC A;  5CQE A;  2ZZE A;  3FIS A;  4RAZ A;  1DUX C;  3F8F A;  3KL9 A;  1LFU P;  2VKE A;  4BYY A;  1WDT A;  1S9H A;  3FPK A;  3JU4 A;  3ASR A;  3ERE D;  1OFM A;  1KQS B;  3K1P A;  1OOC A;  2XRL A;  4E0F A;  4FTH A;  4NC7 A;  2ZTN A;  1E64 A;  4FT8 A;  2JA7 J;  3J7A O;  4XSX F;  1S3J A;  3BJA A;  1KU3 A;  2CMP A;  4C2T A;  4P26 A;  1X3Z B;  4PCQ A;  2QQA A;  4AF6 A;  4W1U A;  3QU3 A;  5FB2 A;  2W7Z A;  2UWM A;  2HWV A;  2JQ7 A;  3WNB A;  3CMA B;  5F08 A;  1RC9 A;  3PUN A;  1ZQ3 P;  3DTE A;  3K4C A;  2F1M A;  4AVZ A;  1RKW A;  5DSZ A;  4CIC A;  5F0C A;  2WYR A;  3F6O A;  2PN6 A;  2ZXH A;  2G7H A;  3Q9V A;  3OYN A;  4JMQ A;  2E34 A;  3G1L A;  1RIO H;  2EB7 A;  1BMF A;  1FOX A;  4PC3 A;  3PSZ A;  2BEO A;  4MQV A;  4EM0 B;  1KQ5 A;  3R60 A;  3H0G J;  3CJT B;  4GQN A;  5FO1 A;  4PC1 A;  2NOG A;  3JRC A;  3O8H A;  3T5X A;  2HTS A;  2EZI A;  2IA1 A;  3IH4 A;  4WF2 A;  2E2H J;  2OBP A;  3N4M A;  2XEX A;  4NQW A;  2VAS A;  4ETS A;  4V2F A;  2KQR A;  1PXZ A;  3GQA A;  3JW4 A;  3LSM A;  1QHH D;  2KIQ A;  1SMY F;  2F43 A;  1WVR A;  3KYD B;  3ZR8 X;  1A04 A;  1UST A;  4DK0 A;  2XB5 A;  2CJJ A;  3ESW B;  2Q8K A;  3HB9 A;  1EFC A;  3KCC A;  2JJ2 A;  2HYG D;  1O3T A;  1ZG1 A;  3LQE A;  4X7E A;  3BJ6 A;  4QVA A;  1I39 A;  5H20 A;  1PKV A;  1RPW A;  2F4N A;  1MJA A;  1R23 A;  3TP0 A;  4BAC A;  3M1C A;  2QWW A;  4E7J A;  4BHP A;  3Q6Q A;  3JCU C;  1VQ6 B;  3MMY B;  4KMF A;  1HW2 A;  2H6B A;  3BY1 A;  2DBB A;  4LIU A;  1ULY A;  4D0P A;  2BM1 A;  2JDI A;  1HZE A;  3HHG A;  2XND A;  2R7T A;  5DM7 F;  3TW7 A;  4YZ0 A;  3LA7 A;  4PAA A;  3DCF A;  3H94 A;  2HOT A;  1GDT A;  4A3G J;  2E5Z A;  2GXB A;  3ASS A;  2WWY A;  1ZUN B;  3GX4 X;  3K70 C;  5IT9 Z;  2AXL A;  4BDY A;  2EFW A;  5A2Q K;  3ZRG A;  3HOZ J;  3TP3 A;  3AVX A;  1IUF A;  2ID6 A;  2GA1 A;  3DKX A;  1O7L A;  4RLQ A;  1KTW A;  3K1N A;  1MMS A;  5TGT A;  1S72 I;  2LF8 A;  2BV6 A;  4IRH A;  3OMY A;  1QNT A;  1TQM A;  4UB6 C;  2HDN B;  1YI2 B;  5LEK A;  2HI3 A;  1WZ2 A;  4UXN A;  3CME I;  4KMU X;  1QBJ A;  3HOX J;  2VYQ A;  4JQF A;  2R7S A;  2QZA A;  1P6R A;  2MD5 A;  2RAE A;  5M5Y J;  4OIP F;  4RAF A;  2QGG A;  3SJZ A;  4RMN A;  5IP9 J;  2MYS A;  1ONV A;  2ZIT A;  2P7V B;  3M7G A;  4UZF A;  4ZYE A;  1PLU A;  1I8D A;  1XGO A;  1FBS A;  1OLT A;  4BY7 J;  2BYV E;  2DDA A;  2K3F A;  2V7V A;  1QVF B;  2XSD C;  2AQF A;  1VQL B;  2YX7 A;  4N4O B;  1E17 A;  2H94 A;  1ZG5 A;  1OFL A;  1WXR A;  1AIR A;  3V8J A;  4IKF A;  1KK3 A;  5LLQ A;  4WQM A;  1N77 A;  1GUU A;  1SFE A;  1VTN C;  4HE5 A;  2M5S A;  3LWF A;  1TWH J;  5H6R A;  2OTJ I;  1J75 A;  2C78 A;  1RI7 A;  2HDD A;  4HV6 A;  4UUS B;  1EH6 A;  3HKZ N;  3CCL B;  5DS9 A;  2XIG A;  4IXA A;  2Z5U A;  4D5C A;  4ENJ A;  3SLD A;  1FNB A;  1MGT A;  1Y6I A;  1W0J A;  3CJR B;  3W2I A;  1UEL B;  2MA3 A;  1TWA J;  2HVQ A;  3ZMT A;  1H88 C;  3VSV A;  5BSX A;  1TQI A;  1OCO H;  2LC2 A;  2Y0S N;  4RAG A;  2K9M A;  3VOD A;  4IW3 B;  1BIB A;  4RD2 A;  2R7R A;  2BSA A;  1BLI A;  5GTI C;  2NVY J;  4JX5 A;  1DU6 A;  4FX0 A;  4RM3 A;  4KIC A;  2IS2 A;  1JA1 A;  2AO9 A;  5E3N A;  1JKO C;  3FM3 A;  1X3W B;  1MSF C;  1SKY B;  2OTL B;  4FAS D;  1R36 A;  2IW5 A;  1XN7 A;  1VQ8 I;  2QQ9 A;  3AG3 H;  3AAF A;  1XMX A;  1NHA A;  1S7E A;  4C0S A;  5ILS A;  5KAI C;  2VE8 A;  3W6K B;  2QKM B;  4DYQ A;  1MJ9 A;  2M4K A;  2VFP A;  2NVT J;  2KKO A;  4CXF A;  4ZGN B;  1QUF A;  2BHZ A;  4K2E A;  1SD5 A;  1W9X A;  2DIE A;  1PP8 F;  2VOD A;  1VQ9 B;  3K4N A;  5CVJ A;  4HPQ A;  4ABZ A;  2NTP A;  2CW7 A;  3F3X A;  3CZ6 A;  2EIM H;  4RM2 A;  2LVS A;  2XF5 A;  4FHT A;  3DLL F;  5FRM A;  3OYG A;  5J3O A;  5CLS A;  1IB0 A;  4A0Y A;  1XD7 A;  5TV2 A;  3WQZ A;  1TTY A;  1JNY A;  3DU1 X;  2ZXW H;  2NOJ B;  3VSK A;  3CCL I;  1T8I A;  3F9K A;  1KD1 D;  5LFA A;  1TYW A;  2X6W A;  2R7W A;  3HIF A;  4IVN A;  2ZBV A;  3P4G A;  2W6J A;  2B7E A;  1ZTR A;  1QHG A;  1TT5 B;  2HKX A;  2KIM A;  2WAQ A;  3ZMZ A;  3E0J B;  4Q47 A;  4E7Z A;  3VOE A;  1KMH A;  4RBO A;  2HR3 A;  5E3O A;  2RKH A;  3AK5 A;  1I6X A;  3CMA I;  3E97 A;  1WOR A;  4NC6 A;  1XGN A;  3RKQ A;  1HC8 A;  3U1D A;  3S2H J;  2K7L A;  3R4K A;  4DNC A;  5LRR A;  2OBS A;  1REP C;  1LVK A;  4CCN A;  5HS9 A;  1R1U A;  1WSV A;  4AUX A;  1U78 A;  1ITY A;  1T5E A;  2XF6 A;  1XCV A;  2HFH A;  3F8B A;  1WOS A;  3E7L A;  2GBY A;  2WZN A;  3Q3A A;  5IT9 K;  1W35 A;  3I55 I;  4HDV A;  3PJR A;  2DOG A;  2R5Y A;  2P4W A;  3KZZ A;  1QQI A;  2FU4 A;  5FO0 A;  4B3F X;  4P12 A;  2R3S A;  1G2H A;  1EF4 A;  3A8J A;  4B48 A;  1QA2 A;  2E1B A;  2CQN A;  5HLT A;  2W25 A;  3NAR A;  2PLY A;  5CPR B;  2M9H A;  1LEB A;  3E5Q A;  4RAY A;  3CLQ A;  1G7S A;  4UAJ A;  2HQN A;  4NK8 A;  2JTV A;  3BTL A;  5FRN A;  4RDU A;  1QFY A;  4DNR B;  1TP4 A;  2F6C A;  1IRX A;  2TDX A;  3KP2 A;  3OWT A;  1IF1 A;  2DA6 A;  3HTU A;  3KP7 A;  2DMN A;  2L9V A;  1ZR2 A;  1XDS A;  3LSH A;  1FMV A;  2GQQ A;  2V9P A;  4HSR A;  3SYT A;  4OZY A;  1VND A;  4OJP A;  2MSY A;  3WTW C;  3FMR A;  4C43 A;  5CVI A;  1VQN B;  3ZBT A;  4WCG A;  5LBQ A;  1AKH B;  3HRS A;  5J47 A;  3QE2 A;  3CDH A;  1QPI A;  4OZZ A;  4YXW A;  1MKM A;  3CW2 A;  2BF4 A;  1U9N A;  2V7Q A;  5IT3 A;  2DA4 A;  3N6Z A;  3VPR A;  3FBN B;  3DTK A;  1FOK A;  1W0U A;  2Q6L A;  3H9G A;  4PJL A;  4A5M A;  4A5N A;  1LFB A;  1T38 A;  2Y2Z A;  2ZKZ A;  2V7T A;  4A3I J;  1C0W A;  5HOO A;  3T8T A;  4LBW A;  2YUH A;  3K6G A;  2ACJ A;  5HKK A;  2VBX A;  2ZSI B;  2K5C A;  1H80 A;  3PET A;  2E60 A;  3KLN A;  1YS7 A;  3RCO A;  4B4D A;  2CYY A;  2L7F P;  2VJ5 A;  3BR1 A;  4AC9 A;  3V76 A;  3CDI A;  4RGX A;  3IRQ A;  2B7B A;  3AFH A;  3FX3 A;  3BR5 A;  4A3B J;  3W2A A;  2KRF A;  1VQM I;  5HZB A;  1SAN A;  3DPT A;  2ZL5 A;  2D3N A;  4AWX B;  1G4D A;  2OZU A;  4FCY A;  3SZE A;  4HF0 A;  4F91 B;  2MAB A;  2YU3 A;  4CHU A;  1LDK B;  3ZQG A;  1AOY A;  2QBY A;  5EZG A;  3CCE I;  3IH2 A;  3QAH A;  4ZCI A;  4F55 A;  2FQ4 A;  2BX6 A;  2BMW A;  4BHB A;  3CRZ A;  3LO8 A;  3U2Q A;  2K9N A;  2YPR A;  3FKS A;  1RKT A;  3A1P A;  2AHQ A;  2O0Y A;  1KU9 A;  1U5T A;  5AIP A;  3J7A Y;  1BR2 A;  4ASU A;  1D1C A;  2DQR A;  3CC7 B;  2YSR A;  1R1V A;  1JT6 A;  4YEL A;  3C2G A;  3OKX A;  4J19 A;  1HSJ A;  3CF2 A;  1ZLJ A;  1FP1 D;  1SVO A;  2ZJP F;  3BTI A;  1QG0 A;  1D1N A;  3ASO H;  2VPR A;  4MQ9 F;  3WU0 A;  1RR8 C;  4Z06 A;  1BJK A;  2QF7 A;  1Z0X A;  3FJO A;  1JHH A;  2DT7 B;  2HXI A;  3GFJ A;  4H4K C;  2DOA A;  4DJA A;  5FLM J;  4RLZ A;  3G71 B;  4YAL A;  1I18 A;  4Z03 A;  4I0A A;  2J5P A;  1JHF A;  2VFQ A;  4DW6 A;  1S7O A;  1R5O A;  1T95 A;  3CES A;  3QPH A;  3LNQ A;  2STT A;  4MEY F;  1JUM A;  3KET A;  2VIX A;  5K7Z A;  2INV A;  3VMW A;  1S4M A;  1X1D A;  2LKX A;  1EV7 A;  1IA5 A;  1ETO A;  2X6X A;  1YIO A;  1OQY A;  2UVF A;  2I8D A;  3OYF A;  1FWZ A;  1D5V A;  3NE5 B;  2CG4 A;  1D1B A;  3A3B A;  3K1M A;  3HKZ A;  3ZMU A;  3GXO A;  1COW A;  4LLN A;  2K9S A;  2YR2 A;  4X1E A;  1L3L A;  2K3P A;  4OOX A;  2DJI A;  3KP4 A;  3C1D A;  4II2 A;  3GRH A;  1HA8 A;  1Z77 A;  4LD5 A;  1V0E A;  5J1Y A;  4S04 A;  1TW3 A;  3VB2 A;  2EFN A;  2BE5 F;  5EEA A;  4HLX A;  1XE1 A;  4UY8 I;  4XQF A;  3UW0 A;  2ZNY A;  1YW9 A;  5GAH J;  4EGY A;  1LUJ B;  3HOU J;  1QA3 A;  1WOP A;  2DJN A;  1VQ7 I;  2GJP A;  1G7R A;  2NVX J;  4C2L A;  1O3Q A;  2GXG A;  3G71 I;  1LLZ A;  2L9N A;  2XPU A;  1BI3 A;  4E7K A;  2Y9Z A;  3J7Z I;  5HOD A;  4G7H F;  3ZCO A;  2W85 A;  2IJL A;  3I4P A;  4KUM A;  3CUO A;  3TW6 A;  2VXZ A;  4BE2 A;  2DPD A;  1QH0 A;  1W7P B;  1NJI D;  3AVT A;  4CYD A;  1ODD A;  4KIT B;  3BR3 A;  1T0F C;  2VJJ A;  3R6S A;  5GV8 A;  2PE3 A;  2R93 J;  1R7J A;  2HTJ A;  4ZV4 A;  1WJA A;  4IJA A;  3TO6 A;  4LG0 A;  2OBT A;  1V5F A;  2D9R A;  1HW5 A;  2RDP A;  1VQ4 I;  2DCU A;  5M3F J;  3B6A A;  1KK1 A;  4OJ6 A;  2KP6 A;  5EGO A;  2DYS H;  5F1R A;  3ZZ0 A;  2ZL7 A;  3G05 A;  3V8L A;  1QQ1 A;  1K73 D;  3WBK A;  3AVW A;  1BN5 A;  1U5T B;  3CCS I;  2H27 A;  1MMD A;  4LFU A;  1D8T A;  5HDG A;  4QV2 A;  4IOC F;  2G0Y A;  1D3Y A;  3EYY A;  5F04 A;  3PQJ A;  4JBA A;  1Y0U A;  1A36 A;  1FIA A;  2FBI A;  3QFS A;  4XSZ F;  3GQB A;  2ZME A;  3CCM B;  1DBG A;  1IJW C;  2FF4 A;  4M9X A;  2OA4 A;  2E7X A;  1GT0 C;  2GM4 A;  1X2N A;  4CCM A;  1IRF A;  4X8I A;  2FBH A;  5B66 C;  4YIR X;  2HQR A;  2YUS A;  1T39 A;  1T08 B;  2OK7 A;  5KCM A;  2P7C B;  3SQN A;  1RUO A;  1OJL A;  1WU8 A;  3H0D A;  3GZ6 A;  1DGR M;  2VOP A;  3TED A;  4YFO A;  3BTC A;  2BVL A;  1AWC A;  3L9F A;  3E6M A;  1SD6 A;  2D2W A;  4DK1 A;  3MKY B;  3RPQ A;  1FYK A;  5IYB J;  1GXQ A;  2CQX A;  1J09 A;  3CDL A;  3LQR A;  3LST A;  4WXC A;  1KK2 A;  1J5Y A;  4BHC A;  3OYH A;  2YWH A;  3S3N A;  4YFN F;  3ZXS A;  2KIS A;  2J7K A;  2R6H A;  1IN5 A;  2VKD A;  2PMH A;  2JUC A;  3ERM A;  1O7F A;  3DXJ F;  5JLW A;  3QPS A;  3V7C A;  2E35 A;  5EGO B;  4YIF A;  2A68 F;  2QEX B;  2B63 J;  3HPG A;  4G7W A;  2RVC A;  2WAD A;  2Z16 A;  1FNN A;  2MD0 A;  2CF4 A;  4G7X A;  2DA2 A;  4EV0 A;  2GPJ A;  4CCL A;  4WZL A;  2ZCW A;  1EH7 A;  1GVJ A;  3DV8 A;  4QIW N;  4J00 A;  3MN2 A;  2JJ1 A;  2O5R A;  3VWB A;  4O6J A;  2FJ1 A;  5FJ8 J;  2OYN A;  5FRO A;  3CCU I;  4MTE A;  1H89 C;  2O9L A;  2Y69 H;  3K2Z A;  2WV1 A;  5BPD A;  4AU7 A;  2QA4 B;  4PZJ A;  3JRG A;  4RB3 C;  1MNE A;  3HZJ A;  1X1C A;  1FOY A;  5CKT A;  5D6F A;  2PMD A;  3A1Y A;  5EG0 B;  1JJ6 C;  1I1S A;  3FXM A;  3ZQL A;  1YIJ B;  5EEG A;  4JOM A;  1RZ4 A;  4XN3 A;  3IWF A;  3CUQ C;  4BE0 A;  2XHK A;  5JMC B;  4ENM A;  2R4G A;  4XLC A;  2V26 A;  5K5Q A;  4L9N A;  1MBJ A;  1CNE A;  3EQO A;  4X6A J;  2VQL A;  1ETK A;  3Q0W A;  3OYD A;  3S15 J;  2BBY A;  3S1R J;  2K85 A;  3BG9 A;  3VYS B;  4EQQ A;  1XSX A;  3I56 I;  3F23 A;  2JA6 J;  3I64 A;  1MIJ A;  3S3O A;  2OJE D;  1BC8 C;  4C9Y A;  4WXH A;  3OYK A;  2BY1 A;  3WWG A;  1VQP B;  1U0J A;  1VF7 A;  2NV4 A;  4F7Z A;  2DMQ A;  4E7I A;  2VBV A;  4CCO A;  3Q5F A;  3GTG J;  1SEU A;  3H9J A;  1LFP A;  3EUA A;  4RS8 A;  3SJM A;  2GK7 A;  3CTA A;  1E43 A;  3NWT A;  3EQL F;  4RD6 A;  4X7D A;  2HGC A;  1USS A;  2XUB A;  4DQ2 A;  4YZA A;  1H42 A;  1NG6 A;  3SLN A;  4DZJ A;  3NAU A;  2WB1 N;  1T6Z A;  3S93 A;  3S1M J;  1NH3 A;  4B47 A;  2MBF A;  1O8I A;  3FBI B;  4JRA C;  4HX8 A;  1LVA A;  5HDK A;  4ZGQ B;  3OE7 A;  4XLE A;  3JTG A;  4Z4S A;  4HG2 A;  1V5E A;  5IYD J;  1M1E B;  3N05 A;  2LP0 A;  1FNM A;  1K78 B;  2YWG A;  1WRJ A;  4D9J A;  1IV6 A;  5C3E J;  4ROX A;  2LDU A;  1U5T C;  3LSJ A;  3F8C A;  4PJN A;  1BHE A;  2EK5 A;  1WSU A;  4ACB A;  1UD3 A;  2PJR B;  3KYC B;  3CCQ B;  1IDY A;  2PBI A;  2QQB A;  4KT5 C;  2OC6 A;  5JR3 A;  4KDP A;  3M9A A;  5JI6 A;  3WG7 H;  1WFX A;  3H9Q A;  3HEF A;  2EFO A;  3PFI A;  3L00 A;  4MR0 A;  2A5W A;  3V4G A;  4PUS A;  1IN7 A;  1LDJ A;  1OPC A;  4NQW B;  1YJW I;  1HLV A;  3DLA A;  5HS7 A;  4MTD A;  1W36 C;  1D0Z A;  3A8I A;  2R7U A;  3WHC A;  3RYR A;  1SAX A;  1OFE A;  4QUZ A;  3VMV A;  3OIP A;  3EQN A;  3SUC A;  2DDB A;  1IXS B;  1RQP A;  1O8F A;  1T2K A;  1IN4 A;  2PX9 A;  1P92 A;  5E1W A;  4XLP F;  2BSP A;  2VFN A;  5D4S A;  3CJN A;  4DGW B;  2ZTG A;  4EM2 A;  4G6I A;  1K83 J;  3HGG A;  2OK8 A;  3M8E A;  4MFD A;  5FKO A;  1O57 A;  4PGH A;  1YOV B;  1QRY A;  1X2M A;  1JE8 A;  4FN5 A;  1QX4 A;  2IP2 A;  4IHY A;  4BY1 J;  1YYV A;  1BW5 A;  1GAQ A;  2EIJ H;  2WPD A;  1FX7 A;  4LIT A;  3OYA A;  3K4L A;  3FXJ A;  4X07 A;  2O17 A;  1LEA A;  1F4K A;  3ZZT A;  2GAU A;  1E3O C;  2V31 A;  3GYH X;  2DO7 A;  3R0A A;  5B1A H;  1WQ2 A;  5FFX A;  2ZC2 A;  4N4N B;  3H5A A;  2V1X A;  3QPT A;  3JQP A;  3IAM 2;  1TYV A;  3FMS A;  1J59 A;  1E79 A;  1BOA A;  1UD6 A;  5TIS C;  3ZQH A;  2B0R A;  2LSO A;  4IPA A;  2XGD A;  1R58 A;  2K9L A;  2V4J C;  3SJP A;  2J8I A;  3T9G A;  2L9S A;  2EFP A;  3QYF A;  5D8K B;  1L1I A;  2X0K A;  2NS7 A;  3OYI A;  1BC7 C;  1BJZ A;  2NAZ A;  3SEZ A;  4E7S A;  3DEE A;  4OMZ A;  4EMS A;  4Y13 A;  2R7V A;  4C2M J;  1VQP I;  2D5V A;  1HKQ A;  4G12 A;  4NC8 A;  2C77 A;  2X3H A;  1M90 D;  1GQ8 A;  1VF9 A;  2F5F A;  2XB0 X;  2BY3 A;  4A3F J;  3VO2 A;  4HW0 A;  2QN6 A;  1YHQ B;  1XX5 A;  5C44 J;  2V7W A;  2VNJ A;  3CQZ J;  2EIK H;  1G3T A;  2W82 A;  4H0E A;  1SFU A;  2B5O A;  2NVU B;  2BN4 A;  5TJJ A;  2ID3 A;  2KZV A;  4BXU A;  3LVB A;  1ZRF A;  2WV0 A;  2QGU A;  2XPV A;  3OS2 A;  1QO0 D;  1U8B A;  1TL8 A;  5D6E A;  3IRR A;  2R7X A;  1GV2 A;  2P81 A;  5FO5 A;  3GIR A;  3MHP A;  1JA0 A;  4RD0 A;  4U4B A;  4XM3 A;  1P4X A;  5KW9 A;  1O3R A;  1JRG A;  2JMW A;  4FQG A;  4L0Z B;  3S2W A;  1K61 A;  5ERI A;  2IS6 A;  1F5T A;  3ZP5 A;  2W4S A;  4AD9 A;  1GJR A;  4G1V A;  2UXX A;  2VBZ A;  4RB2 C;  4HX7 A;  2PJR A;  1IGN A;  4JX4 A;  4HX4 A;  5FNZ A;  5L46 A;  1PUF B;  5ILU A;  5DUI A;  1QVG B;  2F3L A;  4G6Q A;  2VN2 A;  1R9T J;  3CF5 F;  3ZPN A;  3I4M J;  2IGM A;  4OMY A;  3C3W A;  1QJV A;  3ZMS A;  3OYL A;  1A8P A;  3IWZ A;  2XGX A;  4OAZ A;  2NS8 A;  4ZDO A;  3BH7 B;  2CQQ A;  1W1W E;  1LQ1 A;  1YJW B;  1YIJ I;  2EZL A;  2KJB A;  2X6Y A;  2ZXJ A;  1FT9 A;  5ICF A;  1FND A;  5DCM A;  1CF7 B;  2QSG X;  2ZL6 A;  2ZZF A;  3G4S B;  5IP7 J;  1G3W A;  3I3L A;  4M9S A;  3EUK L;  2W7N A;  4HE6 A;  1W5T A;  3A02 A;  1XGS A;  1E3P A;  1PJ5 A;  3SFI A;  2M8E A;  1G7T A;  4CQJ A;  1QA1 A;  3HOT A;  3Q0V A;  2HPM A;  1Z3Y A;  4WZT A;  2JUG A;  1CLW A;  3I56 B;  3OEH A;  2BM5 A;  4F92 B;  1MW7 A;  2IPQ X;  5GAG J;  3HSF A;  5GTH C;  1RMG A;  4JK1 X;  3EDP A;  4Q4Z F;  2ZSH B;  3PVD A;  4Y7C A;  5J4Y A;  2MLK A;  1TVC A;  3N90 A;  3WNC A;  3GQ7 A;  2DK8 A;  2IVM A;  3K4B A;  2RC4 A;  4IRG A;  4A12 A;  3MFK A;  2XAJ A;  1MH4 A;  5BQT A;  3DQV C;  2G7U A;  4HWV A;  2DMT A;  4UV9 A;  3SKB A;  2DOE A;  4G5G A;  3WGH A;  3OZV A;  5B5E C;  2LD5 A;  1BI2 A;  1X4O A;  3QU6 A;  1DDG A;  3RQI A;  4A3D J;  1E62 A;  3E6D A;  1XCB A;  4Z4Z A;  3RDI A;  5ICE A;  3P27 A;  2OBR A;  4QPQ A;  1U9O A;  2WZP P;  5FL7 A;  3A03 A;  3IKV A;  3PSF A;  4MEX F;  3I0T A;  2V6E A;  1NB9 A;  4LG3 A;  2XOK A;  3CCR B;  3B6C A;  1Z6R A;  3FMQ A;  3AL0 B;  3PIP F;  2KZG A;  1O8G A;  2GQF A;  1XPX A;  2CK3 A;  4E70 A;  2CW8 A;  1FY7 A;  1YRN B;  5LMZ A;  1J2X A;  5CVR A;  2VT3 A;  4P96 A;  4EM1 A;  3GVK A;  2KT0 A;  3W3C A;  3S32 A;  3BC9 A;  2O04 A;  2C4U A;  3F21 A;  2M45 A;  3HXL A;  3U6B A;  2WJV A;  3WTV C;  3BQJ A;  3BDD A;  3IC7 A;  1T6X A;  2DMU A;  2HMA A;  4KN7 X;  2NTQ A;  3ZBU A;  2ZME B;  1IN6 A;  1PUE E;  4OOS A;  4MLO A;  1EZG A;  3BRO A;  1UD8 A;  3SYJ A;  2XF7 A;  4ZYA A;  2X51 A;  5AN9 A;  5E79 C;  4P2N A;  4X05 A;  3CLO A;  3W5U A;  2VKH A;  3GW2 A;  2NS0 A;  2GXA A;  1B1B A;  4C30 A;  4HRI A;  2JN6 A;  1R5N A;  3I1F A;  3WTS C;  2ELJ A;  3QFR A;  2KPM A;  3MVP A;  2E71 A;  5D5V B;  4I2O A;  1R5B A;  1OYY A;  3PUM A;  4Y9R A;  4M3G A;  1XQB A;  5THX A;  1M1K D;  2ECB A;  1AKH A;  1LDD A;  3NEU A;  1TQP A;  4I6Z A;  5HZA A;  4C3J J;  5ICC A;  1O8K A;  3QPL A;  2KDZ A;  4OU0 A;  1H8E A;  4OPS A;  4L9V A;  1IDJ A;  3W6J B;  3EET A;  1ETW A;  2Y9Y A;  3BG3 A;  4I7H A;  4BQN A;  3VYT B;  2H8W A;  2P5K A;  3Q3S A;  2UZK A;  2ZJR F;  3RZD J;  2O0W A;  3ZMD A;  2DA7 A;  4IHX A;  4PSW A;  3PIO F;  3WTT C;  1UD2 A;  2DFI A;  1K7A A;  2W00 A;  2DA5 A;  2R7D A;  4HA8 A;  3JRF A;  2M5W A;  2OUM A;  3R6J A;  3O6B B;  1RWR A;  5LHH A;  1B6A A;  2V9V A;  2NT6 A;  4ZDP A;  4YDT A;  3LOC A;  3A4C A;  1E3X A;  5JHU A;  2QYU A;  2STW A;  3ISX A;  2D74 A;  3CCJ I;  3BJO A;  1GR1 A;  2DET A;  5A88 A;  4PGG A;  3BH6 B;  3I59 A;  4ESJ A;  4NCN A;  5DCM B;  1CF7 A;  4OAY A;  3GTO J;  3ML6 A;  4RLF A;  3SFZ A;  1N0U A;  3RI4 A;  5CQG A;  3W5V A;  3A01 B;  4D7M A;  5K7H A;  4PGO A;  1FYL A;  4BBR J;  2F5E A;  4PDK A;  3BP8 A;  2CS3 A;  2GLO A;  4HNT A;  4ACA A;  5C4J J;  1S72 B;  1D8K A;  2F4I A;  2PQ8 A;  2R7O A;  5E8G A;  3JRB A;  3RZO J;  4PJM A;  5M5X J;  1R22 A;  2KHM A;  4KKU A;  4IZZ A;  2WR8 A;  1FLI A;  3FXK A;  2LFB A;  3L2C A;  2RGV A;  2H6C A;  1K78 A;  2XRN A;  2PFB A;  4TSF A;  3ABK H;  4YCQ A;  2L7M P;  5L3G A;  4RGR A;  4KKS A;  1ZAR A;  4TV7 A;  5J1U A;  2RNG A;  2W57 A;  1SFK A;  2E7W A;  1ON1 A;  4BBS J;  4YFX F;  3A2K A;  3QYB A;  2O8K A;  2EA4 A;  4YAW A;  1I3A A;  1W5C C;  1I1G A;  1V3F A;  4YZQ A;  3OOU A;  4CUG A;  2NNY A;  4QVJ A;  5GV7 A;  1EFR A;  1X1P A;  4HF2 A;  1Z1D A;  1B4A A;  2MC4 A;  3B73 A;  2JVG A;  4EEF G;  5HLH A;  4ZH4 F;  1XSD A;  3HRU A;  4HNV A;  1B9N A;  4HBL A;  2NXN B;  3OL4 A;  3MD2 A;  4O5V A;  4UB8 C;  5HNF A;  4A3J J;  3KZY A;  2OTJ B;  3HOY J;  4BPR A;  2EZK A;  5A2Q Z;  3ES9 A;  3CCM I;  2INU A;  2HKO A;  3SEQ A;  4CCK A;  1LE8 A;  2XT4 A;  4RGU A;  1ZM4 A;  2HZT A;  4BJ6 C;  5C4X J;  1ZH5 A;  4A3M J;  1WH5 A;  2A5Y B;  3QWL A;  2B7C A;  2EV0 A;  1VFC A;  3LMM A;  4HF1 A;  2CW5 A;  1Z7L A;  1XTA A;  3TMO A;  4B1R A;  1QCX A;  2PYG A;  3X2Q H;  2BOL A;  1PP7 U;  1U2W A;  4L5E A;  1XGM A;  2VC1 A;  4GGG A;  2UUZ A;  2WAE A;  3BG7 A;  4B3X A;  3QRF F;  3JR9 A;  2VZL A;  5FLX Z;  5DCF A;  3D5R C;  3H35 A;  4MHG A;  1W7P D;  4B4C A;  4C3H J;  1YW8 A;  4CYC A;  4J0Q A;  2E19 A;  1PYV A;  1ZHF A;  2FUG 2;  1B72 B;  1R5H A;  4RPB A;  2R0Q C;  1QFZ A;  4PFP A;  3RQ4 A;  5M3M J;  3BPX A;  3HRM A;  3E6C C;  1KQ0 A;  3MAJ A;  3ASN H;  2ZJ2 A;  3M8J A;  5LHG A;  3ASQ A;  1BIA A;  1A5J A;  1FJL A;  1VLO A;  1BN8 A;  4BXX J;  4N9I A;  1IXC A;  1EH8 A;  2HQ5 A;  3BPV A;  2JT1 A;  5E17 F;  1I5Z A;  5JBQ A;  1VQ9 I;  2QLZ A;  3WU2 C;  1VQ5 I;  3HBL A;  2O8X A;  3WE2 A;  2IEK A;  4HYE A;  1F60 A;  3MQ0 A;  2C5B A;  4XBF A;  3CCJ B;  2XZL A;  4XN0 A;  2OAZ A;  3TBI A;  2XT2 A;  1WTH D;  3CUQ A;  4EVI A;  4ZJZ A;  1AIP A;  3KP6 A;  1Q7Y D;  4CZZ A;  1CQT A;  2C5H A;  4DBQ A;  3PUF A;  4A3K J;  2GIZ A;  2M3A A;  3I5U A;  4DBR A;  2OF7 A;  1I27 A;  2ZZQ A;  2FX0 A;  1R00 A;  1WSR A;  2XTY A;  1TBX A;  5C1C A;  5HS8 A;  3B4N A;  1D5Y A;  4UVA A;  3WU1 B;  4OPO A;  5DS0 A;  3CD6 I;  5IOZ A;  1Y8Q B;  3N97 A;  2ODL A;  5KSW B;  4RGS A;  5BPI A;  3PL8 A;  1TUI A;  2DAO A;  2K4B A;  1O4X A;  2D3L A;  3DF8 A;  4U0V A;  1NB0 A;  2G9W A;  1T33 A;  2Y48 A;  5DDG A;  1SFX A;  2GOX B;  2HOA A;  2HPI A;  6PAX A;  3ZIA A;  1YIT B;  1YTY A;  3TOB A;  1H85 A;  3BQZ A;  4JX6 A;  1I7P A;  3RY8 A;  3S16 J;  3I71 A;  1WJ5 A;  2EFG A;  2ZJQ F;  3PA2 A;  3CPX A;  3BR6 A;  3L2R A;  2M34 A;  1QRC A;  3GTK J;  3W2W A;  4RM0 A;  1F20 A;  4EJW A;  2WBM A;  3BLY A;  1OFD A;  4RPD A;  3GTJ J;  1W0T A;  5E20 A;  2VNK A;  1SD4 A;  4AID A;  1OB2 A;  1JGG A;  3GF2 A;  4L5I A;  2A61 A;  4YFK F;  2PMZ A;  5CJ9 A;  3UR3 C;  4CDG A;  2VB6 A;  1N78 A;  2A05 A;  2ICW G;  3MWM A;  3F8N A;  3KP5 A;  4XLA A;  4TMZ A;  3O3K A;  3NQO A;  1BM9 A;  2HS5 A;  2MC3 A;  2JRT A;  1MAB A;  2CC2 A;  2XAQ A;  3BC8 A;  4IQJ A;  1RU4 A;  4HDU A;  2M0C A;  4KIB A;  4MIM A;  4U0W A;  4HV5 A;  2V5I A;  2DQL A;  3FK6 A;  3GWZ A;  1X4P A;  3I9V 2;  3P7N A;  3S3M A;  4RD1 A;  3OYC A;  2O3F A;  4L5J A;  3L7W A;  4LB5 A;  1PE9 A;  1AA7 A;  4AIJ A;  3H09 A;  4UUT A;  4D1Q A;  2FMY A;  4QTR A;  4AYB N;  3RTR A;  2WA0 A;  2Q2E B;  4BUP A;  1TSP A;  2FQ3 A;  2X0L A;  4N0B A;  1DPR A;  2L7Z A;  1F9N A;  4IHT A;  1IW7 F;  1QZZ A;  2UV1 A;  3BCB A;  1BR1 A;  2JZY A;  1V55 H;  1MZB A;  3HRT A;  3P9C A;  5JHF A;  1NK3 P;  2A07 F;  4Z1M A;  2EBI A;  1HF0 A;  5A89 A;  2M2E A;  1WI9 A;  2L01 A;  4XD7 A;  2EWE A;  2B0L A;  1ZEL A;  3DTI A;  2CRV A;  2OPT A;  2LOO A;  1DAB A;  3VSU A;  3CXC B;  4OIQ F;  4PAB A;  4WXD A;  2DK5 A;  2JWT A;  1JXS A;  2P8T A;  2H8R A;  4P9U A;  5K7F A;  2XZO A;  3FDY A;  1R1T A;  4U9U A;  1POG A;  2DER A;  2VT2 A;  5IPA A;  2X48 A;  4IEJ A;  3GTP J;  2IQ7 A;  3AG1 H;  4XLH A;  3TDZ C;  3GZN B;  3LAJ A;  2XGJ A;  1BR4 A;  1OHH A;  1KCC A;  5D4R A;  2OQG A;  1OGM X;  3FXL A;  1ZM3 A;  3WY9 A;  2YU9 J;  4X06 A;  1IXR C;  1NHC A;  4KN4 X;  1VHO A;  1MRZ A;  4W8T A;  5FD5 A;  5LGN A;  3SDB A;  2NST A;  4A2U A;  3H1C A;  1WJC A;  4A6E A;  2QSH X;  3ECO A;  3PSI A;  1JUP A;  2QYO A;  2GWR A;  2VKV A;  3D1N I;  4A6D A;  1ERD A;  5F6F A;  1IRZ A;  3GQ8 A;  5IP6 A;  2AHO A;  1ZKG A;  4XOP A;  5F64 A;  2H1K A;  4XRM A;  3H9N A;  2ZBK A;  2E2J J;  3U9G A;  3SZP A;  3W2V A;  2D45 A;  1NK2 P;  3MKL A;  5KK1 A;  2E1M B;  1E63 A;  1ZYR F;  3BZ6 A;  4DNT B;  3LL7 A;  3FHN A;  4MNU A;  2MFZ A;  3BR0 A;  3EPZ A;  1KC8 D;  2BZT A;  1XMK A;  4Z4R A;  1WP6 A;  2BY2 A;  2R7Q A;  2L4M A;  3ZOB A;  2NT9 A;  2KDO A;  5EZH A;  4UV8 A;  2DPU A;  1S8N A;  4MO7 A;  4ZYD A;  2XNC A;  1KZL A;  5TY0 A;  1LNW A;  2BVM A;  2CUJ A;  1W7P A;  2JVH A;  3BCA A;  5M5W J;  2NVQ J;  2ELH A;  1E1Q A;  3OAA A;  1K5C A;  1HKT A;  3K4M A;  1T6Y A;  1KQ8 A;  2HNH A;  3DWL E;  3CCV B;  5TR9 A;  2XC7 A;  2ME0 A;  2K27 A;  4U0Y A;  1RNL A;  2CGP A;  1Z67 A;  4LK0 F;  4RDL A;  2E36 A;  2X8K A;  1K8F A;  3FM5 A;  2WY7 Q;  1Q81 D; 
#chains in the Genus database with same CATH homology
 1KON A;  3ZGK A;  2JDI A;  1HZE A;  1IDK A;  2XND A;  2DT6 A;  2R7T A;  3L2V A;  5IK2 A;  3LFU A;  2A6T A;  1YE9 A;  3L2W A;  4YZ0 A;  3H94 A;  2E5Z A;  2WPD A;  3FPP A;  4LIT A;  3OYA A;  3PNY A;  3K4L A;  3K70 C;  1WJB A;  2O17 A;  4BDY A;  1VBL A;  2XAU A;  3ZRG A;  2HQA A;  3DKX A;  1FX0 A;  4AYB A;  2Q1Z B;  2V31 A;  4BQQ A;  4RLQ A;  1KTW A;  4N4N B;  3H5A A;  5TGT A;  1W0K A;  2VJ4 A;  3IAM 2;  1E79 A;  3OMY A;  2M0M A;  1UD6 A;  3B8Y A;  4Y4R A;  4BXF A;  2V4J C;  2K9L A;  1TT0 A;  4YRV A;  4J01 A;  2L9S A;  3T9G A;  4II3 A;  3QYF A;  4E7H A;  4JQF A;  2R7S A;  3OYI A;  3SEZ A;  4E7S A;  3DEE A;  3OOC A;  2WJY A;  4RMN A;  2MYS A;  2ZFU A;  2JIZ A;  4CZC A;  1PLU A;  4XL9 A;  3CMM A;  4FET A;  2R7V A;  1I8D A;  2X3H A;  4NC8 A;  1OLT A;  1GQ8 A;  4HIZ A;  1WJD A;  4XON A;  2LG4 A;  4YZX A;  4PMH A;  3L2U A;  2AQF A;  2W82 A;  4N4O B;  1UD5 A;  1OFL A;  1AIR A;  4IKF A;  2VXD A;  2KZV A;  1WJE A;  1N77 A;  2M5S A;  3OS2 A;  4KT6 A;  5DN6 A;  1OR7 C;  2R7X A;  4XNF A;  1DBO A;  4U4B A;  4PJJ A;  2VPL A;  4XM3 A;  2QXZ A;  2X1E A;  5CDF A;  1W36 D;  1JRG A;  3OYB A;  2IS6 A;  3A35 A;  3D5S C;  2R9V A;  2W4S A;  2O1D A;  1Y6I A;  1W0J A;  3CJR B;  3HAG A;  3KEW A;  4XLF A;  3BCF A;  1UEL B;  2PJR A;  2HVQ A;  3VSV A;  4BJ5 C;  1D0X A;  1QU3 A;  3ZPP A;  2LC2 A;  3NWS A;  2K9M A;  3DKY A;  2L7K A;  3HG9 A;  2R7R A;  1BLI A;  4L8J A;  3ZPN A;  2IGM A;  1QJV A;  1V0F A;  3OYL A;  4Y3O A;  2HVS A;  2PYH A;  3HOS A;  4RM3 A;  4OAZ A;  2IS2 A;  4ZDO A;  3VR6 A;  2X1C A;  4ZTJ A;  1SKY B;  3AKZ A;  4ZTF A;  1H8H A;  4FAS D;  2HDW A;  2O04 A;  2V9K A;  2X6Y A;  3PNT A;  2ZZF A;  4IX7 A;  2W7N A;  3I3L A;  2QKM B;  3EUK L;  3K4J A;  2M4K A;  1VLY A;  5HNH A;  1O8E A;  3HOT A;  1W9X A;  2DIE A;  4TT3 A;  4DOZ A;  2HPM A;  1Z3Y A;  3K4N A;  2JUG A;  4BJT A;  3ZQQ A;  3T51 B;  2GOM A;  4HPQ A;  2GK6 A;  3OEH A;  2CW7 A;  2NTP A;  1P9Q C;  1MW7 A;  3CZ6 A;  4RM2 A;  2XF5 A;  4F92 B;  1N75 A;  5FRM A;  3OYG A;  4P1W A;  2ZSH B;  2M4G A;  1RMG A;  2LYC A;  2QKL B;  3WQZ A;  3QOD A;  4XMY A;  2UVE A;  2NOJ B;  3VSK A;  3GQ7 A;  3F9K A;  3K4B A;  4ANJ A;  5LFA A;  2X6W A;  2HLD A;  2R7W A;  3BCD A;  4YEJ A;  1EE6 A;  2W6J A;  3DQV C;  1QHG A;  4HWV A;  2WAQ A;  4E7Z A;  3E0J B;  3LNN A;  1JI8 A;  4CA0 A;  1KMH A;  4EAT A;  4KKT A;  4CSW A;  1MMN A;  3IUO A;  2JSP A;  4P22 A;  3EUH C;  2VL8 A;  1X4O A;  4F93 B;  4IQ4 A;  3BG6 A;  2IGK A;  4BS9 A;  4R79 A;  2WSS A;  1LVK A;  4QPQ A;  4CCN A;  2GJR A;  2XZP A;  5FL7 A;  2WZP P;  3OYM A;  4XOR A;  3PSF A;  2NTB A;  1T5E A;  2XF6 A;  2V6E A;  4LG3 A;  2XOK A;  3PUB A;  1Z21 A;  2E1M C;  3FKJ A;  1R6R A;  3AL0 B;  3PJR A;  1O8G A;  1BPL A;  1E3Z A;  3PFY A;  3AL0 C;  1UAA A;  2CK3 A;  4B3F X;  2CW8 A;  2IS1 A;  4E4H A;  4OJO A;  2LBF A;  4B48 A;  3HPH A;  2E1B A;  3H5N A;  5HLT A;  3GVK A;  5CPR B;  3W3C A;  1MMA A;  3S32 A;  3BC9 A;  1DQU A;  4NK8 A;  3OPO A;  3OY9 A;  5FRN A;  4DNR B;  3HXL A;  2F6C A;  1IRX A;  2WJV A;  1WMR A;  2NSP A;  2LH9 A;  3OWT A;  2VQG A;  4QPO A;  2VLA A;  3RPU D;  2NTQ A;  2CH0 A;  3LSH A;  3BH4 A;  1FMV A;  4HSR A;  4MLO A;  2KL4 A;  1UD8 A;  3SYT A;  2XF7 A;  4ZYA A;  2IGN A;  2Z8G A;  4OZY A;  1KCD A;  4HNU A;  4XOT A;  2X51 A;  2KMU A;  4OJP A;  1GLN A;  2VKH A;  4C30 A;  4HRI A;  4OZZ A;  4YXW A;  3KRG A;  2ELJ A;  2V4D A;  4Y33 A;  4XKB A;  2V7Q A;  2KPM A;  3FBN B;  3DTK A;  1UD4 A;  4LIV A;  3T56 B;  3U21 A;  3H9G A;  4PJL A;  4BU2 A;  4BGD A;  4W8S A;  1G59 A;  2WB1 A;  1O8K A;  3FY3 A;  1H8E A;  5HOO A;  1IDJ A;  3OR2 C;  2HZD A;  2KRH A;  4BQN A;  2DXI A;  1BOB A;  1TZL A;  3K6G A;  3VYT B;  2IS4 A;  2GJP A;  5HKK A;  2ZSI B;  2O0W A;  2K5C A;  2JA2 A;  1H80 A;  4PSW A;  2E60 A;  4BQO A;  1UD2 A;  3RCO A;  2O0V A;  2VJ5 A;  2W00 A;  2GJK A;  1HVX A;  2OUM A;  1HG8 A;  2VQC A;  3AFH A;  4F3Q A;  1RWR A;  3C2H A;  2NT6 A;  3W2A A;  2Z1D A;  3DPT A;  4ZDP A;  2D3N A;  3A4C A;  1JTA A;  2WAF A;  2MAB A;  4F91 B;  1E3X A;  3GVL A;  1LDK B;  2M7A A;  4W8Q A;  5LD2 C;  4F55 A;  4OJL A;  3DPL C;  2KLO A;  2NZM A;  4OWR B;  3FKS A;  4OAY A;  4RLF A;  1DGW Y;  5CQG A;  3E1S A;  3HL2 A;  3J7A Y;  3OS1 A;  1BR2 A;  4ASU A;  1D1C A;  1MND A;  3HC7 A;  4BEH B;  3VSL A;  5C1E A;  3L2Q A;  2CS3 A;  2DCE A;  4YEL A;  3C2G A;  4HNT A;  3CF2 A;  2F4I A;  2R7O A;  4Z06 A;  4PJM A;  2KHM A;  4KKU A;  5KNL A;  4IZZ A;  1NRK A;  1UG0 A;  3VYR B;  1NBM A;  4TKO B;  2DT7 B;  4H4K C;  4TSF A;  2DOA A;  4DJA A;  1I18 A;  4Z03 A;  4G6T B;  4KKS A;  1XG2 A;  2RNG A;  1SFK A;  2LY1 A;  3A2K A;  4U7B A;  4C2U A;  3QYB A;  1T95 A;  3CES A;  3D5L A;  2L2O A;  2L5Q A;  2VIX A;  2INV A;  3VMW A;  1X1D A;  4GRI A;  4YZQ A;  3OOU A;  4CUG A;  4CH7 A;  1MMG A;  1IA5 A;  3OL3 A;  3VDX A;  1WJF A;  1DP3 A;  2X6X A;  1EFR A;  1K6Y A;  2MC4 A;  1EA3 A;  2UVF A;  2XDV A;  3LSG A;  3OYE A;  2JVG A;  2I8D A;  3OYF A;  2VBM A;  3K70 D;  2Z6B D;  1E1R A;  4B3G A;  3NE5 B;  1D1B A;  3A3B A;  4XR6 A;  4ITV A;  5HNF A;  3HKZ A;  3OL4 A;  3MD2 A;  1COW A;  2P0W A;  4W8R A;  2K3P A;  2INU A;  2DJI A;  2QY1 A;  2VJI A;  4II2 A;  3SEQ A;  3GRH A;  2LRD A;  4CCK A;  3MKZ A;  1HA8 A;  1V0E A;  4BJ6 C;  2QX3 A;  3LMW A;  5AMV A;  1YX3 A;  3LMM A;  4XKW A;  1Z7L A;  3TMO A;  4XQF A;  2PYG A;  1QCX A;  3UW0 A;  2BOL A;  2RRE A;  4B3X A;  2UUZ A;  2WAE A;  1D0Y A;  3BG7 A;  3LSI A;  2W1O A;  3SZG A;  4X0G A;  3D5R C;  2XSJ C;  3H35 A;  4C2L A;  1PYV A;  2FUG 2;  4U49 A;  2L9N A;  4E7K A;  1E0E A;  3DPU A;  4PFP A;  3RQ4 A;  3B90 A;  3ZCO A;  1LKX A;  2VXZ A;  4BE2 A;  3M8J A;  4KIT B;  1T0F C;  2VJJ A;  1CZF A;  4HST A;  1WJA A;  1V5G A;  4XKV A;  3OYJ A;  1BN8 A;  3KX2 A;  1NG7 A;  2LBF B;  4F52 A;  4KJZ A;  1V5F A;  3CJQ B;  4HEA 2;  4PFO A;  3CP8 A;  4MXN A;  3VST A;  3KYL A;  4OJ6 A;  2KP6 A;  3K10 A;  4NK6 A;  2OV7 A;  4NNJ A;  3T53 B;  2XZL A;  1O8J A;  3G05 A;  4XN0 A;  3TBI A;  1WTH D;  4ZJZ A;  4URR A;  4DBQ A;  2V1N A;  2Z2S B;  1MMD A;  2M3A A;  4ZDL A;  4DBR A;  3K4K A;  4B44 A;  3TL4 X;  2CV1 A;  2ZZQ A;  1O88 A;  3ZSC A;  4OJ5 A;  5C1C A;  1VJS A;  2X53 S;  3B4N A;  3G2B A;  1VZ0 A;  3GQB A;  4E6K G;  1DBG A;  2PEC A;  2ODL A;  2M7B A;  4CCM A;  2LRE A;  3PL8 A;  4BDZ A;  1SAU A;  3ONQ A;  2D3L A;  2WY8 Q;  5KCM A;  3LSK A;  1FMW A;  2X85 A;  2GOX B;  2HPI A;  3JUR A;  3H0D A;  3ZIA A;  1DGR M;  3OR1 C;  3V42 A;  4PSX A;  2BVL A;  2ZXI A;  1WJ5 A;  3OW7 A;  4I84 A;  4DK1 A;  3MKY B;  1O8M A;  3L2R A;  1J09 A;  1X0C A;  3OS0 A;  3W2W A;  3OYH A;  5KHD A;  3S3N A;  4KIS A;  3ZXS A;  4Z05 A;  2WBM A;  3BLY A;  1X19 A;  2VBK A;  2VKD A;  2V7F A;  1D1A A;  3S8P A;  2LZJ A;  4FXU A;  2IGO A;  2QE7 A;  1N78 A;  2PMZ A;  2Y0S A;  3UR3 C;  2VB6 A;  1G8X A;  3HPG A;  4G7W A;  2WAD A;  2Z16 A;  2MD0 A;  4XLA A;  4E7L A;  4G7X A;  1PJR A;  2BW3 A;  4CCL A;  4J00 A;  2AQE A;  1MAB A;  3BC8 A;  2JJ1 A;  4IQJ A;  1RU4 A;  2O5R A;  3QOE A;  3H5R A;  3VWB A;  1X1A A;  4BE1 A;  1X1B A;  2W6I A;  3I9V 2;  5FRO A;  3GVJ A;  1X4P A;  3DU6 A;  3S3M A;  3QYE A;  2F5V A;  3OYC A;  1IB4 A;  1PE9 A;  3OFN A;  2X1D A;  4AU7 A;  1AA7 A;  2KVO A;  1OGO X;  1MNE A;  1X1C A;  3RSN A;  2VQH A;  4D1Q A;  3GQ9 A;  5CKT A;  3A1Y A;  3RTR A;  1Y56 A;  2WA0 A;  3MKW B;  3DDY A;  2CFO A;  1Z3X A;  2Q2E B;  4BUP A;  1OB0 A;  1O8H A;  4BE0 A;  4JOM A;  4ZC3 A;  4XN3 A;  1BR1 A;  2UV1 A;  1YX5 A;  2HU9 A;  3BCB A;  5JHF A;  3KEY A;  1O8D A;  2R4G A;  4XLC A;  4XKC A;  2V26 A;  4Z1M A;  4PK4 A;  2EWE A;  4XD7 A;  3A3G A;  2HVR A;  2KRC A;  3EQO A;  2VQL A;  3OYD A;  1ZEL A;  3DTI A;  3VYU B;  2LOO A;  4UZU A;  5CQE A;  2ZZE A;  3VSU A;  3VYS B;  4DIQ A;  1K28 D;  3S3O A;  1S9H A;  3FDY A;  3JU4 A;  2XZO A;  3OIQ A;  4C9Y A;  3OYK A;  2LY2 A;  3WWG A;  4U87 A;  1U0J A;  2CV0 A;  1VF7 A;  1OFM A;  1OOC A;  4E7I A;  4E0F A;  2IQ7 A;  4CCO A;  2ZZG A;  4XLH A;  1KCC A;  4NC7 A;  2ZTN A;  3H9J A;  1BR4 A;  1OHH A;  1LFP A;  3EUA A;  2GK7 A;  2XGJ A;  4NUB A;  1OGM X;  1E43 A;  3NWT A;  4EW9 A;  3HUG B;  2CMP A;  3IP4 B;  4C2T A;  1NHC A;  4W8T A;  3PNV A;  4YZA A;  2UWM A;  1NG6 A;  3OEE A;  3SDB A;  2NST A;  3DU5 A;  1WJC A;  2IXS A;  3S93 A;  3PSI A;  3UNG C;  4B47 A;  3DTE A;  4BEH A;  3K4C A;  1ERD A;  4AVZ A;  2F1M A;  1O8I A;  4P5O A;  3FBI B;  3GQ8 A;  2ZXH A;  4XOP A;  3OYN A;  4JMQ A;  3OE7 A;  4XLE A;  1BMF A;  4HG2 A;  1V5E A;  3N05 A;  3W2V A;  2CV2 A;  2E1M B;  4GQN A;  4DNT B;  4D9J A;  2VBE A;  3LL7 A;  3FHN A;  4BL0 B;  2MFZ A;  3EPZ A;  4PJN A;  1BHE A;  1O8L A;  1UD3 A;  2PJR B;  4B43 A;  1WP6 A;  2VAS A;  1PXZ A;  2RQQ A;  2KQR A;  2R7Q A;  3GQA A;  3LSM A;  2OC6 A;  1QHH D;  2NT9 A;  2KDO A;  2F43 A;  3IAS 2;  4DK0 A;  3ZR8 X;  4MR0 A;  1WFX A;  3H9Q A;  1KZL A;  2BVM A;  2CUJ A;  2JVH A;  3BCA A;  2A5W A;  3OAA A;  2JJ2 A;  4PUS A;  1E1Q A;  2CUZ A;  1K5C A;  3K4M A;  4NQW B;  1W36 C;  3DLA A;  2HNH A;  3DWL E;  1D0Z A;  2XC7 A;  2R7U A;  1PKV A;  3VMV A;  4CCJ A;  3CP2 A;  3GBG A;  3OIP A;  3EQN A;  4BAC A;  3SUC A;  1O8F A;  3M1C A;  5HVQ C;  4E7J A;  2BSP A;  4DGW B;  2BW3 B;  1WPC A;  2X8K A;  3MMY B;  2E5N A;  2ZTG A;  4G6I A;  2WY7 Q;  4LIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...