1PLUA

Pectate lyase c from erwinia chrysanthemi with 1 lu+3 ion in the putative calcium binding site
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (PECTATE LYASE C)
publication title The Refined Three-Dimensional Structure of Pectate Lyase C from Erwinia chrysanthemi at 2.2 Angstrom Resolution (Implications for an Enzymatic Mechanism).
pubmed rcsb
molecule tags Lyase
total genus 137
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 1999-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1pluA00
2VJIA 3VSTA 4XONA 3T9GA 2O17A 1O8JA 4W8QA 4XLFA 3JURA 4XOPA 4NK8A 3SUCA 4XOTA 2NT9A 2INVA 2NTQA 4I84A 4Z05A 3B8YA 4OJOA 1O8KA 3GQ9A 2PECA 1O88A 4XLCA 1O8DA 4YELA 4XLHA 2QXZA 3ZSCA 1X0CA 3VMWA 2INUA 4XN3A 1CZFA 5C1CA 2EWEA 4XL9A 1BN8A 3WWGA 2QY1A 1O8MA 1PXZA 4C2LA 3B4NA 1AIRA 4URRA 1O8GA 3GQAA 2BSPA 4MR0A 3ZPPA 4NK6A 2X6XA 4OJPA 1IA5A 3FY3A 1KTWA 4XORA 3UW0A 2O0VA 3VSVA 4XQFA 2Z8GA 4OJ5A 4YZXA 1KCDA 1JRGA 2NT6A 2VBKA 2X3HA 5AMVA 1RMGA 2O04A 1DBGA 4Z06A 2VBEA 1EE6A 4OJLA 1OGMX 2O1DA 2PYHA 4YZQA 4U4BA 2X85A 4XLEA 4OJ6A 3EQNA 1DBOA 2IQ7A 1H80A 4OZYA 3LMWA 1OGOX 3VMVA 2QX3A 1QCXA 1IDJA 4XM3A 1PLUA 4AVZA 4MXNA 4W8RA 1OFLA 1O8IA 4EW9A 1RWRA 1NHCA 4XNFA 2X6YA 4OZZA 1BHEA 1PE9A 2X6WA 4XKVA 4XN0A 2PYGA 1O8FA 1JTAA 3KRGA 4YEJA 3B90A 1VBLA 4XMYA 1XG2A 2O0WA 4YZ0A 2UVFA 4W8SA 2VBMA 2ODLA 3GRHA 1O8EA 1IB4A 4PMHA 1OOCA 2NSPA 1GQ8A 2NZMA 4YZAA 4HWVA 1O8LA 3GQ7A 2NTBA 3EQOA 1QJVA 3GQ8A 4W8TA 4Z03A 1K5CA 2NSTA 4XR6A 1HG8A 4XLAA 1O8HA 1RU4A 4XKWA 2NTPA 5C1EA 1WMRA 1OFMA 2UVEA 3VSUA 4U49A 1IDKA 1KCCA 2VJJA
chains in the Genus database with same CATH superfamily
3H09A 2VJIA 3SQVA 3VSTA 1LLWA 2VFPA 2XT4A 4XONA 3T9GA 2QYUA 2O17A 1O8JA 4W8QA 4XLFA 1QA3A 3JURA 4XOPA 4NK8A 3SUCA 4XOTA 1K4ZA 2INVA 2NT9A 2BM5A 2NTQA 4I84A 4Z05A 2B0RA 3B8YA 4OJOA 1CLWA 2XTXA 1O8KA 2V5IA 3GQ9A 2PECA 1O88A 2BM4A 1O8DA 4XLCA 4YELA 4XLHA 3LJYA 2QXZA 3ZSCA 1X0CA 2VFNA 2INUA 3N90A 1CZFA 2J8IA 4XN3A 3VMWA 5C1CA 2QZAA 1LLZA 2EWEA 4XL9A 1BN8A 3WWGA 2QY1A 1O8MA 1PXZA 2VFMA 3P4GA 4C2LA 3SY2A 3B4NA 1AIRA 3PETA 4URRA 1O8GA 3GQAA 2BSPA 4MR0A 1TSPA 4JRAC 2X6XA 4NK6A 4OJPA 3TH0A 3ZPPA 1WXRA 1IA5A 3FY3A 1KTWA 3ML3A 4XORA 3UW0A 2O0VA 3VSVA 4XQFA 2BX6A 2Z8GA 4OJ5A 4YZXA 1JRGA 1KCDA 2NT6A 2VBKA 2O6WA 2X3HA 5AMVA 1RMGA 3NAWA 3RIQA 2IOUG 2O04A 2J8KA 1EA0A 1DBGA 4Z06A 2VBEA 1EE6A 4OJLA 1OGMX 4YC5A 1TYXA 2O1DA 3SYJA 2PYHA 4YZQA 4U4BA 2X85A 4KH3A 4XLEA 3PSSA 4OJ6A 2F3LA 3EQNA 1DBOA 2IQ7A 1H80A 2BM7A 4OZYA 2XTWA 3LMWA 1HF2A 3DU1X 3PSZA 3NB2A 1OGOX 2VFQA 2QX3A 3VMVA 1QCXA 1IDJA 1TYWA 1PLUA 2XC1A 4XM3A 4AVZA 4MXNA 1DABA 4W8RA 1QA2A 1OFLA 1O8IA 4OM9A 4EW9A 1RWRA 1NHCA 4XNFA 2X6YA 4OZZA 4OPWA 1BHEA 1KQ5A 1PE9A 2X6WA 4XKVA 3SZEA 2W7ZA 4XN0A 2PYGA 1O8FA 3BH6B 1L1IA 1JTAA 3KRGA 4YEJA 1K8FA 3B90A 1OFEA 4YDTA 2XT2A 1VBLA 4XMYA 2VFOA 1XG2A 5DNSA 3N6ZA 2BM6A 2O0WA 1QRBA 4YZ0A 5JLVC 2UVFA 5JMCB 4W8SA 2VBMA 2ODLA 3GRHA 3AK5A 1O8EA 1IB4A 4PMHA 2XTYA 4YCQA 1EZGA 1OOCA 2NSPA 1GQ8A 2NZMA 4YZAA 4HWVA 1O8LA 2G0YA 2YUHA 4V02C 3GQ7A 2NTBA 3EQOA 1QJVA 3GQ8A 4W8TA 3JX8A 4Z03A 1K5CA 2NSTA 1QRCA 4XR6A 1HG8A 4XLAA 1TYUA 1QQ1A 1O8HA 1TYVA 1RU4A 4YFOA 4XKWA 2NTPA 5C1EA 1WMRA 1OFMA 2UVEA 3LYCA 3VSUA 4U49A 1QA1A 4YEIA 1IDKA 1LM1A 3BH7B 1OFDA 1KCCA 2VJJA
chains in the Genus database with same CATH topology
2VJIA 3VSTA 4XONA 3T9GA 2O17A 1O8JA 4W8QA 4XLFA 3JURA 4XOPA 4NK8A 3SUCA 4XOTA 2NT9A 2INVA 2NTQA 4I84A 4Z05A 3B8YA 4OJOA 1O8KA 3GQ9A 2PECA 1O88A 4XLCA 1O8DA 4YELA 4XLHA 2QXZA 3ZSCA 1X0CA 3VMWA 2INUA 4XN3A 1CZFA 5C1CA 2EWEA 4XL9A 1BN8A 3WWGA 2QY1A 1O8MA 1PXZA 4C2LA 3B4NA 1AIRA 4URRA 1O8GA 3GQAA 2BSPA 4MR0A 3ZPPA 4NK6A 2X6XA 4OJPA 1IA5A 3FY3A 1KTWA 4XORA 3UW0A 2O0VA 3VSVA 4XQFA 2Z8GA 4OJ5A 4YZXA 1KCDA 1JRGA 2NT6A 2VBKA 2X3HA 5AMVA 1RMGA 2O04A 1DBGA 4Z06A 2VBEA 1EE6A 4OJLA 1OGMX 2O1DA 2PYHA 4YZQA 4U4BA 2X85A 4XLEA 4OJ6A 3EQNA 1DBOA 2IQ7A 1H80A 4OZYA 3LMWA 1OGOX 3VMVA 2QX3A 1QCXA 1IDJA 4XM3A 1PLUA 4AVZA 4MXNA 4W8RA 1OFLA 1O8IA 4EW9A 1RWRA 1NHCA 4XNFA 2X6YA 4OZZA 1BHEA 1PE9A 2X6WA 4XKVA 4XN0A 2PYGA 1O8FA 1JTAA 3KRGA 4YEJA 3B90A 1VBLA 4XMYA 1XG2A 2O0WA 4YZ0A 2UVFA 4W8SA 2VBMA 2ODLA 3GRHA 1O8EA 1IB4A 4PMHA 1OOCA 2NSPA 1GQ8A 2NZMA 4YZAA 4HWVA 1O8LA 3GQ7A 2NTBA 3EQOA 1QJVA 3GQ8A 4W8TA 4Z03A 1K5CA 2NSTA 4XR6A 1HG8A 4XLAA 1O8HA 1RU4A 4XKWA 2NTPA 5C1EA 1WMRA 1OFMA 2UVEA 3VSUA 4U49A 1IDKA 1KCCA 2VJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJI A;  3VST A;  4XON A;  3T9G A;  2O17 A;  1O8J A;  4W8Q A;  4XLF A;  3JUR A;  4XOP A;  4NK8 A;  3SUC A;  4XOT A;  2NT9 A;  2INV A;  2NTQ A;  4I84 A;  4Z05 A;  3B8Y A;  4OJO A;  1O8K A;  3GQ9 A;  2PEC A;  1O88 A;  4XLC A;  1O8D A;  4YEL A;  4XLH A;  2QXZ A;  3ZSC A;  1X0C A;  3VMW A;  2INU A;  4XN3 A;  1CZF A;  5C1C A;  2EWE A;  4XL9 A;  1BN8 A;  3WWG A;  2QY1 A;  1O8M A;  1PXZ A;  4C2L A;  3B4N A;  1AIR A;  4URR A;  1O8G A;  3GQA A;  2BSP A;  4MR0 A;  3ZPP A;  4NK6 A;  2X6X A;  4OJP A;  1IA5 A;  3FY3 A;  1KTW A;  4XOR A;  3UW0 A;  2O0V A;  3VSV A;  4XQF A;  2Z8G A;  4OJ5 A;  4YZX A;  1KCD A;  1JRG A;  2NT6 A;  2VBK A;  2X3H A;  5AMV A;  1RMG A;  2O04 A;  1DBG A;  4Z06 A;  2VBE A;  1EE6 A;  4OJL A;  1OGM X;  2O1D A;  2PYH A;  4YZQ A;  4U4B A;  2X85 A;  4XLE A;  4OJ6 A;  3EQN A;  1DBO A;  2IQ7 A;  1H80 A;  4OZY A;  3LMW A;  1OGO X;  3VMV A;  2QX3 A;  1QCX A;  1IDJ A;  4XM3 A;  1PLU A;  4AVZ A;  4MXN A;  4W8R A;  1OFL A;  1O8I A;  4EW9 A;  1RWR A;  1NHC A;  4XNF A;  2X6Y A;  4OZZ A;  1BHE A;  1PE9 A;  2X6W A;  4XKV A;  4XN0 A;  2PYG A;  1O8F A;  1JTA A;  3KRG A;  4YEJ A;  3B90 A;  1VBL A;  4XMY A;  1XG2 A;  2O0W A;  4YZ0 A;  2UVF A;  4W8S A;  2VBM A;  2ODL A;  3GRH A;  1O8E A;  1IB4 A;  4PMH A;  1OOC A;  2NSP A;  1GQ8 A;  2NZM A;  4YZA A;  4HWV A;  1O8L A;  3GQ7 A;  2NTB A;  3EQO A;  1QJV A;  3GQ8 A;  4W8T A;  4Z03 A;  1K5C A;  2NST A;  4XR6 A;  1HG8 A;  4XLA A;  1O8H A;  1RU4 A;  4XKW A;  2NTP A;  5C1E A;  1WMR A;  1OFM A;  2UVE A;  3VSU A;  4U49 A;  1IDK A;  1KCC A;  2VJJ A; 
#chains in the Genus database with same CATH topology
 3H09 A;  2VJI A;  3SQV A;  3VST A;  1LLW A;  2VFP A;  2XT4 A;  4XON A;  3T9G A;  2QYU A;  2O17 A;  1O8J A;  4W8Q A;  4XLF A;  1QA3 A;  3JUR A;  4XOP A;  4NK8 A;  3SUC A;  4XOT A;  1K4Z A;  2INV A;  2NT9 A;  2BM5 A;  2NTQ A;  4I84 A;  4Z05 A;  2B0R A;  3B8Y A;  4OJO A;  1CLW A;  2XTX A;  1O8K A;  2V5I A;  3GQ9 A;  2PEC A;  1O88 A;  2BM4 A;  1O8D A;  4XLC A;  4YEL A;  4XLH A;  3LJY A;  2QXZ A;  3ZSC A;  1X0C A;  2VFN A;  2INU A;  3N90 A;  1CZF A;  2J8I A;  4XN3 A;  3VMW A;  5C1C A;  2QZA A;  1LLZ A;  2EWE A;  4XL9 A;  1BN8 A;  3WWG A;  2QY1 A;  1O8M A;  1PXZ A;  2VFM A;  3P4G A;  4C2L A;  3SY2 A;  3B4N A;  1AIR A;  3PET A;  4URR A;  1O8G A;  3GQA A;  2BSP A;  4MR0 A;  1TSP A;  4JRA C;  2X6X A;  4NK6 A;  4OJP A;  3TH0 A;  3ZPP A;  1WXR A;  1IA5 A;  3FY3 A;  1KTW A;  3ML3 A;  4XOR A;  3UW0 A;  2O0V A;  3VSV A;  4XQF A;  2BX6 A;  2Z8G A;  4OJ5 A;  4YZX A;  1JRG A;  1KCD A;  2NT6 A;  2VBK A;  2O6W A;  2X3H A;  5AMV A;  1RMG A;  3NAW A;  3RIQ A;  2IOU G;  2O04 A;  2J8K A;  1EA0 A;  1DBG A;  4Z06 A;  2VBE A;  1EE6 A;  4OJL A;  1OGM X;  4YC5 A;  1TYX A;  2O1D A;  3SYJ A;  2PYH A;  4YZQ A;  4U4B A;  2X85 A;  4KH3 A;  4XLE A;  3PSS A;  4OJ6 A;  2F3L A;  3EQN A;  1DBO A;  2IQ7 A;  1H80 A;  2BM7 A;  4OZY A;  2XTW A;  3LMW A;  1HF2 A;  3DU1 X;  3PSZ A;  3NB2 A;  1OGO X;  2VFQ A;  2QX3 A;  3VMV A;  1QCX A;  1IDJ A;  1TYW A;  1PLU A;  2XC1 A;  4XM3 A;  4AVZ A;  4MXN A;  1DAB A;  4W8R A;  1QA2 A;  1OFL A;  1O8I A;  4OM9 A;  4EW9 A;  1RWR A;  1NHC A;  4XNF A;  2X6Y A;  4OZZ A;  4OPW A;  1BHE A;  1KQ5 A;  1PE9 A;  2X6W A;  4XKV A;  3SZE A;  2W7Z A;  4XN0 A;  2PYG A;  1O8F A;  3BH6 B;  1L1I A;  1JTA A;  3KRG A;  4YEJ A;  1K8F A;  3B90 A;  1OFE A;  4YDT A;  2XT2 A;  1VBL A;  4XMY A;  2VFO A;  1XG2 A;  5DNS A;  3N6Z A;  2BM6 A;  2O0W A;  1QRB A;  4YZ0 A;  5JLV C;  2UVF A;  5JMC B;  4W8S A;  2VBM A;  2ODL A;  3GRH A;  3AK5 A;  1O8E A;  1IB4 A;  4PMH A;  2XTY A;  4YCQ A;  1EZG A;  1OOC A;  2NSP A;  1GQ8 A;  2NZM A;  4YZA A;  4HWV A;  1O8L A;  2G0Y A;  2YUH A;  4V02 C;  3GQ7 A;  2NTB A;  3EQO A;  1QJV A;  3GQ8 A;  4W8T A;  3JX8 A;  4Z03 A;  1K5C A;  2NST A;  1QRC A;  4XR6 A;  1HG8 A;  4XLA A;  1TYU A;  1QQ1 A;  1O8H A;  1TYV A;  1RU4 A;  4YFO A;  4XKW A;  2NTP A;  5C1E A;  1WMR A;  1OFM A;  2UVE A;  3LYC A;  3VSU A;  4U49 A;  1QA1 A;  4YEI A;  1IDK A;  1LM1 A;  3BH7 B;  1OFD A;  1KCC A;  2VJJ A; 
#chains in the Genus database with same CATH homology
 2VJI A;  3VST A;  4XON A;  3T9G A;  2O17 A;  1O8J A;  4W8Q A;  4XLF A;  3JUR A;  4XOP A;  4NK8 A;  3SUC A;  4XOT A;  2NT9 A;  2INV A;  2NTQ A;  4I84 A;  4Z05 A;  3B8Y A;  4OJO A;  1O8K A;  3GQ9 A;  2PEC A;  1O88 A;  4XLC A;  1O8D A;  4YEL A;  4XLH A;  2QXZ A;  3ZSC A;  1X0C A;  3VMW A;  2INU A;  4XN3 A;  1CZF A;  5C1C A;  2EWE A;  4XL9 A;  1BN8 A;  3WWG A;  2QY1 A;  1O8M A;  1PXZ A;  4C2L A;  3B4N A;  1AIR A;  4URR A;  1O8G A;  3GQA A;  2BSP A;  4MR0 A;  3ZPP A;  4NK6 A;  2X6X A;  4OJP A;  1IA5 A;  3FY3 A;  1KTW A;  4XOR A;  3UW0 A;  2O0V A;  3VSV A;  4XQF A;  2Z8G A;  4OJ5 A;  4YZX A;  1KCD A;  1JRG A;  2NT6 A;  2VBK A;  2X3H A;  5AMV A;  1RMG A;  2O04 A;  1DBG A;  4Z06 A;  2VBE A;  1EE6 A;  4OJL A;  1OGM X;  2O1D A;  2PYH A;  4YZQ A;  4U4B A;  2X85 A;  4XLE A;  4OJ6 A;  3EQN A;  1DBO A;  2IQ7 A;  1H80 A;  4OZY A;  3LMW A;  1OGO X;  3VMV A;  2QX3 A;  1QCX A;  1IDJ A;  4XM3 A;  1PLU A;  4AVZ A;  4MXN A;  4W8R A;  1OFL A;  1O8I A;  4EW9 A;  1RWR A;  1NHC A;  4XNF A;  2X6Y A;  4OZZ A;  1BHE A;  1PE9 A;  2X6W A;  4XKV A;  4XN0 A;  2PYG A;  1O8F A;  1JTA A;  3KRG A;  4YEJ A;  3B90 A;  1VBL A;  4XMY A;  1XG2 A;  2O0W A;  4YZ0 A;  2UVF A;  4W8S A;  2VBM A;  2ODL A;  3GRH A;  1O8E A;  1IB4 A;  4PMH A;  1OOC A;  2NSP A;  1GQ8 A;  2NZM A;  4YZA A;  4HWV A;  1O8L A;  3GQ7 A;  2NTB A;  3EQO A;  1QJV A;  3GQ8 A;  4W8T A;  4Z03 A;  1K5C A;  2NST A;  4XR6 A;  1HG8 A;  4XLA A;  1O8H A;  1RU4 A;  4XKW A;  2NTP A;  5C1E A;  1WMR A;  1OFM A;  2UVE A;  3VSU A;  4U49 A;  1IDK A;  1KCC A;  2VJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...