1PLUA

Pectate lyase c from erwinia chrysanthemi with 1 lu+3 ion in the putative calcium binding site
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords PROTEIN (PECTATE LYASE C)
publication title The Refined Three-Dimensional Structure of Pectate Lyase C from Erwinia chrysanthemi at 2.2 Angstrom Resolution (Implications for an Enzymatic Mechanism).
pubmed rcsb
total genus 137
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 1999-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1pluA00
1KTWA 3ZSCA 2X3HA 4EW9A 2PYGA 5C1EA 2VBEA 3SUCA 1O8MA 4YZXA 1OFMA 4NK8A 1GQ8A 2PECA 1JRGA 2NT6A 1IA5A 2NTBA 1CZFA 1O88A 1AIRA 2O04A 2X6YA 4Z03A 4Z06A 2NZMA 3UW0A 4OZZA 4XORA 4URRA 4YZ0A 3ZPPA 2UVEA 1OGOX 4XLEA 1HG8A 4W8SA 1KCCA 4XKVA 4XNFA 4YELA 1EE6A 4XLAA 1KCDA 1DBOA 1RU4A 4XN0A 4PMHA 4XKWA 2UVFA 3VSTA 4XL9A 2VJIA 2NSPA 2VBKA 1OOCA 4XOPA 2X85A 4OJOA 1K5CA 4XLCA 2VBMA 4XLFA 3FY3A 4Z05A 1O8FA 1PE9A 1O8IA 4XM3A 1QCXA 4W8RA 3KRGA 4U49A 4W8QA 3EQOA 1XG2A 2IQ7A 2O1DA 2INUA 3GQ8A 3VSUA 4MR0A 4C2LA 5AMVA 2NSTA 1O8DA 3EQNA 4OZYA 1RMGA 1O8LA 3LMWA 4OJ5A 2VJJA 4W8TA 2ODLA 3B4NA 4XQFA 1IB4A 4OJLA 1O8JA 1VBLA 1BN8A 1O8GA 2QX3A 2O0VA 2PYHA 4XONA 3VMWA 4YZQA 2QXZA 1PLUA 1O8HA 2NT9A 3GQ7A 4HWVA 3JURA 2INVA 3GQAA 4I84A 4XN3A 2O17A 3VMVA 1NHCA 2NTQA 2NTPA 2O0WA 3B8YA 4XLHA 2Z8GA 4XR6A 3WWGA 1O8KA 1O8EA 4XOTA 4OJPA 3GRHA 1JTAA 2QY1A 1IDJA 3B90A 1PXZA 3T9GA 1DBGA 4OJ6A 4XMYA 4MXNA 1QJVA 1X0CA 4AVZA 3GQ9A 1OFLA 4YEJA 1IDKA 4U4BA 1H80A 1OGMX 1WMRA 2EWEA 1RWRA 5C1CA 4NK6A 4YZAA 3VSVA 2X6WA 1BHEA 2BSPA 2X6XA
chains in the Genus database with same CATH superfamily
1KTWA 3PSSA 3ZSCA 2QZAA 3P4GA 1TYVA 2X3HA 3NAWA 4EW9A 2PYGA 2W7ZA 2VBEA 5C1EA 3BH7B 3SUCA 1O8MA 4OM9A 4YZXA 1OFMA 4NK8A 2VFQA 1LLWA 1GQ8A 2PECA 1JRGA 2NT6A 1IA5A 2NTBA 3LYCA 1CZFA 2VFNA 1O88A 1EA0A 1AIRA 2O04A 2X6YA 4Z03A 1QRBA 4Z06A 2NZMA 2BM5A 1LLZA 3UW0A 4OZZA 4XORA 4URRA 4YZ0A 3ZPPA 2UVEA 1OGOX 4XLEA 1HG8A 4W8SA 3SZEA 2VFOA 1KCCA 3PETA 4XKVA 4YDTA 1OFEA 1TSPA 4XNFA 4YELA 4YCQA 1EZGA 3TH0A 1EE6A 4XLAA 1KCDA 3SY2A 5JMCB 1DBOA 1RU4A 4XN0A 4PMHA 4XKWA 2UVFA 3AK5A 3VSTA 1QRCA 4XL9A 2VJIA 2NSPA 4JRAC 2VBKA 1OOCA 4XOPA 2X85A 4OJOA 1K5CA 4XLCA 2VBMA 4XLFA 5C1CA 3FY3A 4Z05A 2BM6A 1O8FA 1PE9A 1O8IA 2J8KA 4XM3A 4YC5A 1DABA 2F3LA 1LM1A 1QCXA 4W8RA 5DNSA 3BH6B 3KRGA 4U49A 4W8QA 1KQ5A 1L1IA 3JX8A 1TYWA 2V5IA 3EQOA 1XG2A 2IQ7A 2O1DA 1QA3A 2XTXA 2BM7A 2INUA 3GQ8A 2BX6A 4MR0A 3VSUA 5AMVA 1K4ZA 4C2LA 2YUHA 2NSTA 1O8DA 5JLVC 3EQNA 4OZYA 1RMGA 2XC1A 2XT2A 1O8LA 1QA1A 4YFOA 3LMWA 4OJ5A 2VJJA 4W8TA 2ODLA 3N6ZA 3B4NA 4XQFA 3NB2A 2BM4A 4OJLA 4YEIA 1O8JA 1VBLA 1BN8A 1IB4A 1QA2A 3DU1X 1O8GA 2QX3A 3PSZA 2G0YA 2O0VA 2PYHA 4XONA 3VMWA 3N90A 2QXZA 4YZQA 1PLUA 2XTYA 2IOUG 1WXRA 1O8HA 2NT9A 3GQ7A 4HWVA 1K8FA 2XT4A 3JURA 2INVA 3GQAA 4I84A 4XN3A 2O17A 3VMVA 1NHCA 2NTQA 2NTPA 2O0WA 3B8YA 1CLWA 2J8IA 1QQ1A 2Z8GA 4XLHA 4XR6A 1O8KA 3RIQA 3SYJA 3WWGA 2VFPA 1O8EA 4XOTA 4OJPA 2B0RA 3GRHA 4KH3A 4V02C 1JTAA 2QY1A 1IDJA 3B90A 1PXZA 3T9GA 1HF2A 1DBGA 1OFDA 4OJ6A 3ML3A 4XMYA 3H09A 4MXNA 3LJYA 1QJVA 1X0CA 4AVZA 3GQ9A 1OFLA 1TYXA 2XTWA 4YEJA 1IDKA 2QYUA 4U4BA 1H80A 1OGMX 1WMRA 2EWEA 1RWRA 2O6WA 2VFMA 4NK6A 4OPWA 4YZAA 3VSVA 2X6WA 3SQVA 1BHEA 2BSPA 2X6XA 1TYUA
chains in the Genus database with same CATH topology
1KTWA 3ZSCA 2X3HA 4EW9A 2PYGA 5C1EA 2VBEA 3SUCA 1O8MA 4YZXA 1OFMA 4NK8A 1GQ8A 2PECA 1JRGA 2NT6A 1IA5A 2NTBA 1CZFA 1O88A 1AIRA 2O04A 2X6YA 4Z03A 4Z06A 2NZMA 3UW0A 4OZZA 4XORA 4URRA 4YZ0A 3ZPPA 2UVEA 1OGOX 4XLEA 1HG8A 4W8SA 1KCCA 4XKVA 4XNFA 4YELA 1EE6A 4XLAA 1KCDA 1DBOA 1RU4A 4XN0A 4PMHA 4XKWA 2UVFA 3VSTA 4XL9A 2VJIA 2NSPA 2VBKA 1OOCA 4XOPA 2X85A 4OJOA 1K5CA 4XLCA 2VBMA 4XLFA 3FY3A 4Z05A 1O8FA 1PE9A 1O8IA 4XM3A 1QCXA 4W8RA 3KRGA 4U49A 4W8QA 3EQOA 1XG2A 2IQ7A 2O1DA 2INUA 3GQ8A 3VSUA 4MR0A 4C2LA 5AMVA 2NSTA 1O8DA 3EQNA 4OZYA 1RMGA 1O8LA 3LMWA 4OJ5A 2VJJA 4W8TA 2ODLA 3B4NA 4XQFA 1IB4A 4OJLA 1O8JA 1VBLA 1BN8A 1O8GA 2QX3A 2O0VA 2PYHA 4XONA 3VMWA 4YZQA 2QXZA 1PLUA 1O8HA 2NT9A 3GQ7A 4HWVA 3JURA 2INVA 3GQAA 4I84A 4XN3A 2O17A 3VMVA 1NHCA 2NTQA 2NTPA 2O0WA 3B8YA 4XLHA 2Z8GA 4XR6A 3WWGA 1O8KA 1O8EA 4XOTA 4OJPA 3GRHA 1JTAA 2QY1A 1IDJA 3B90A 1PXZA 3T9GA 1DBGA 4OJ6A 4XMYA 4MXNA 1QJVA 1X0CA 4AVZA 3GQ9A 1OFLA 4YEJA 1IDKA 4U4BA 1H80A 1OGMX 1WMRA 2EWEA 1RWRA 5C1CA 4NK6A 4YZAA 3VSVA 2X6WA 1BHEA 2BSPA 2X6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KTW A;  3ZSC A;  2X3H A;  4EW9 A;  2PYG A;  5C1E A;  2VBE A;  3SUC A;  1O8M A;  4YZX A;  1OFM A;  4NK8 A;  1GQ8 A;  2PEC A;  1JRG A;  2NT6 A;  1IA5 A;  2NTB A;  1CZF A;  1O88 A;  1AIR A;  2O04 A;  2X6Y A;  4Z03 A;  4Z06 A;  2NZM A;  3UW0 A;  4OZZ A;  4XOR A;  4URR A;  4YZ0 A;  3ZPP A;  2UVE A;  1OGO X;  4XLE A;  1HG8 A;  4W8S A;  1KCC A;  4XKV A;  4XNF A;  4YEL A;  1EE6 A;  4XLA A;  1KCD A;  1DBO A;  1RU4 A;  4XN0 A;  4PMH A;  4XKW A;  2UVF A;  3VST A;  4XL9 A;  2VJI A;  2NSP A;  2VBK A;  1OOC A;  4XOP A;  2X85 A;  4OJO A;  1K5C A;  4XLC A;  2VBM A;  4XLF A;  3FY3 A;  4Z05 A;  1O8F A;  1PE9 A;  1O8I A;  4XM3 A;  1QCX A;  4W8R A;  3KRG A;  4U49 A;  4W8Q A;  3EQO A;  1XG2 A;  2IQ7 A;  2O1D A;  2INU A;  3GQ8 A;  3VSU A;  4MR0 A;  4C2L A;  5AMV A;  2NST A;  1O8D A;  3EQN A;  4OZY A;  1RMG A;  1O8L A;  3LMW A;  4OJ5 A;  2VJJ A;  4W8T A;  2ODL A;  3B4N A;  4XQF A;  1IB4 A;  4OJL A;  1O8J A;  1VBL A;  1BN8 A;  1O8G A;  2QX3 A;  2O0V A;  2PYH A;  4XON A;  3VMW A;  4YZQ A;  2QXZ A;  1PLU A;  1O8H A;  2NT9 A;  3GQ7 A;  4HWV A;  3JUR A;  2INV A;  3GQA A;  4I84 A;  4XN3 A;  2O17 A;  3VMV A;  1NHC A;  2NTQ A;  2NTP A;  2O0W A;  3B8Y A;  4XLH A;  2Z8G A;  4XR6 A;  3WWG A;  1O8K A;  1O8E A;  4XOT A;  4OJP A;  3GRH A;  1JTA A;  2QY1 A;  1IDJ A;  3B90 A;  1PXZ A;  3T9G A;  1DBG A;  4OJ6 A;  4XMY A;  4MXN A;  1QJV A;  1X0C A;  4AVZ A;  3GQ9 A;  1OFL A;  4YEJ A;  1IDK A;  4U4B A;  1H80 A;  1OGM X;  1WMR A;  2EWE A;  1RWR A;  5C1C A;  4NK6 A;  4YZA A;  3VSV A;  2X6W A;  1BHE A;  2BSP A;  2X6X A; 
#chains in the Genus database with same CATH topology
 1KTW A;  3PSS A;  3ZSC A;  2QZA A;  3P4G A;  1TYV A;  2X3H A;  3NAW A;  4EW9 A;  2PYG A;  2W7Z A;  2VBE A;  5C1E A;  3BH7 B;  3SUC A;  1O8M A;  4OM9 A;  4YZX A;  1OFM A;  4NK8 A;  2VFQ A;  1LLW A;  1GQ8 A;  2PEC A;  1JRG A;  2NT6 A;  1IA5 A;  2NTB A;  3LYC A;  1CZF A;  2VFN A;  1O88 A;  1EA0 A;  1AIR A;  2O04 A;  2X6Y A;  4Z03 A;  1QRB A;  4Z06 A;  2NZM A;  2BM5 A;  1LLZ A;  3UW0 A;  4OZZ A;  4XOR A;  4URR A;  4YZ0 A;  3ZPP A;  2UVE A;  1OGO X;  4XLE A;  1HG8 A;  4W8S A;  3SZE A;  2VFO A;  1KCC A;  3PET A;  4XKV A;  4YDT A;  1OFE A;  1TSP A;  4XNF A;  4YEL A;  4YCQ A;  1EZG A;  3TH0 A;  1EE6 A;  4XLA A;  1KCD A;  3SY2 A;  5JMC B;  1DBO A;  1RU4 A;  4XN0 A;  4PMH A;  4XKW A;  2UVF A;  3AK5 A;  3VST A;  1QRC A;  4XL9 A;  2VJI A;  2NSP A;  4JRA C;  2VBK A;  1OOC A;  4XOP A;  2X85 A;  4OJO A;  1K5C A;  4XLC A;  2VBM A;  4XLF A;  5C1C A;  3FY3 A;  4Z05 A;  2BM6 A;  1O8F A;  1PE9 A;  1O8I A;  2J8K A;  4XM3 A;  4YC5 A;  1DAB A;  2F3L A;  1LM1 A;  1QCX A;  4W8R A;  5DNS A;  3BH6 B;  3KRG A;  4U49 A;  4W8Q A;  1KQ5 A;  1L1I A;  3JX8 A;  1TYW A;  2V5I A;  3EQO A;  1XG2 A;  2IQ7 A;  2O1D A;  1QA3 A;  2XTX A;  2BM7 A;  2INU A;  3GQ8 A;  2BX6 A;  4MR0 A;  3VSU A;  5AMV A;  1K4Z A;  4C2L A;  2YUH A;  2NST A;  1O8D A;  5JLV C;  3EQN A;  4OZY A;  1RMG A;  2XC1 A;  2XT2 A;  1O8L A;  1QA1 A;  4YFO A;  3LMW A;  4OJ5 A;  2VJJ A;  4W8T A;  2ODL A;  3N6Z A;  3B4N A;  4XQF A;  3NB2 A;  2BM4 A;  4OJL A;  4YEI A;  1O8J A;  1VBL A;  1BN8 A;  1IB4 A;  1QA2 A;  3DU1 X;  1O8G A;  2QX3 A;  3PSZ A;  2G0Y A;  2O0V A;  2PYH A;  4XON A;  3VMW A;  3N90 A;  2QXZ A;  4YZQ A;  1PLU A;  2XTY A;  2IOU G;  1WXR A;  1O8H A;  2NT9 A;  3GQ7 A;  4HWV A;  1K8F A;  2XT4 A;  3JUR A;  2INV A;  3GQA A;  4I84 A;  4XN3 A;  2O17 A;  3VMV A;  1NHC A;  2NTQ A;  2NTP A;  2O0W A;  3B8Y A;  1CLW A;  2J8I A;  1QQ1 A;  2Z8G A;  4XLH A;  4XR6 A;  1O8K A;  3RIQ A;  3SYJ A;  3WWG A;  2VFP A;  1O8E A;  4XOT A;  4OJP A;  2B0R A;  3GRH A;  4KH3 A;  4V02 C;  1JTA A;  2QY1 A;  1IDJ A;  3B90 A;  1PXZ A;  3T9G A;  1HF2 A;  1DBG A;  1OFD A;  4OJ6 A;  3ML3 A;  4XMY A;  3H09 A;  4MXN A;  3LJY A;  1QJV A;  1X0C A;  4AVZ A;  3GQ9 A;  1OFL A;  1TYX A;  2XTW A;  4YEJ A;  1IDK A;  2QYU A;  4U4B A;  1H80 A;  1OGM X;  1WMR A;  2EWE A;  1RWR A;  2O6W A;  2VFM A;  4NK6 A;  4OPW A;  4YZA A;  3VSV A;  2X6W A;  3SQV A;  1BHE A;  2BSP A;  2X6X A;  1TYU A; 
#chains in the Genus database with same CATH homology
 1KTW A;  3ZSC A;  2X3H A;  4EW9 A;  2PYG A;  5C1E A;  2VBE A;  3SUC A;  1O8M A;  4YZX A;  1OFM A;  4NK8 A;  1GQ8 A;  2PEC A;  1JRG A;  2NT6 A;  1IA5 A;  2NTB A;  1CZF A;  1O88 A;  1AIR A;  2O04 A;  2X6Y A;  4Z03 A;  4Z06 A;  2NZM A;  3UW0 A;  4OZZ A;  4XOR A;  4URR A;  4YZ0 A;  3ZPP A;  2UVE A;  1OGO X;  4XLE A;  1HG8 A;  4W8S A;  1KCC A;  4XKV A;  4XNF A;  4YEL A;  1EE6 A;  4XLA A;  1KCD A;  1DBO A;  1RU4 A;  4XN0 A;  4PMH A;  4XKW A;  2UVF A;  3VST A;  4XL9 A;  2VJI A;  2NSP A;  2VBK A;  1OOC A;  4XOP A;  2X85 A;  4OJO A;  1K5C A;  4XLC A;  2VBM A;  4XLF A;  3FY3 A;  4Z05 A;  1O8F A;  1PE9 A;  1O8I A;  4XM3 A;  1QCX A;  4W8R A;  3KRG A;  4U49 A;  4W8Q A;  3EQO A;  1XG2 A;  2IQ7 A;  2O1D A;  2INU A;  3GQ8 A;  3VSU A;  4MR0 A;  4C2L A;  5AMV A;  2NST A;  1O8D A;  3EQN A;  4OZY A;  1RMG A;  1O8L A;  3LMW A;  4OJ5 A;  2VJJ A;  4W8T A;  2ODL A;  3B4N A;  4XQF A;  1IB4 A;  4OJL A;  1O8J A;  1VBL A;  1BN8 A;  1O8G A;  2QX3 A;  2O0V A;  2PYH A;  4XON A;  3VMW A;  4YZQ A;  2QXZ A;  1PLU A;  1O8H A;  2NT9 A;  3GQ7 A;  4HWV A;  3JUR A;  2INV A;  3GQA A;  4I84 A;  4XN3 A;  2O17 A;  3VMV A;  1NHC A;  2NTQ A;  2NTP A;  2O0W A;  3B8Y A;  4XLH A;  2Z8G A;  4XR6 A;  3WWG A;  1O8K A;  1O8E A;  4XOT A;  4OJP A;  3GRH A;  1JTA A;  2QY1 A;  1IDJ A;  3B90 A;  1PXZ A;  3T9G A;  1DBG A;  4OJ6 A;  4XMY A;  4MXN A;  1QJV A;  1X0C A;  4AVZ A;  3GQ9 A;  1OFL A;  4YEJ A;  1IDK A;  4U4B A;  1H80 A;  1OGM X;  1WMR A;  2EWE A;  1RWR A;  5C1C A;  4NK6 A;  4YZA A;  3VSV A;  2X6W A;  1BHE A;  2BSP A;  2X6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...