2VJIA

Tailspike protein of e.coli bacteriophage hk620
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN
publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Bacteriophage hk620
total genus 229
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjiA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjiA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjiA02
4XM3A 4XOPA 2O04A 1O88A 2X85A 2O17A 1O8GA 2VBMA 2INUA 5C1CA 5C1EA 1K5CA 4XMYA 4Z05A 4XLAA 3VSUA 4YEJA 3ZSCA 1IDKA 4XNFA 3JURA 4YZQA 2NT9A 1NHCA 3GQ9A 2QX3A 1OOCA 1WMRA 2NSPA 2X6YA 4OJ6A 1O8DA 1X0CA 4XR6A 3SUCA 1IA5A 1GQ8A 4OJPA 4YZ0A 1JTAA 1PLUA 3T9GA 4MXNA 3UW0A 4EW9A 4XLHA 2PYHA 1JRGA 4XKVA 4NK8A 4OJOA 4W8QA 1KCDA 1IDJA 2X6XA 2EWEA 2VBKA 3VSTA 3VMVA 1O8EA 1OGOX 1QCXA 2ODLA 4XLCA 1O8FA 4YZXA 4XOTA 1DBGA 1O8IA 4XLEA 1O8KA 4XL9A 1OFMA 3B4NA 1RMGA 3VMWA 2O0WA 2BSPA 2Z8GA 2NTBA 1BHEA 3KRGA 1DBOA 4U4BA 2NT6A 4Z03A 4Z06A 1OFLA 1PE9A 1O8JA 3LMWA 4MR0A 4URRA 2NZMA 1RWRA 4XONA 4XN0A 4XKWA 4XQFA 3GQ7A 3B8YA 1QJVA 4AVZA 1BN8A 2PYGA 4HWVA 1RU4A 2VJJA 2O0VA 2INVA 4OZZA 2O1DA 2QY1A 3B90A 2X3HA 1AIRA 1IB4A 2PECA 3WWGA 4NK6A 1KTWA 4PMHA 1KCCA 2X6WA 1HG8A 4W8SA 1O8MA 2UVEA 2UVFA 2NSTA 1EE6A 4YZAA 1PXZA 3GRHA 3VSVA 4YELA 2NTQA 1XG2A 4W8RA 4OJLA 1VBLA 4XLFA 4OJ5A 3EQNA 4XORA 4XN3A 1OGMX 5AMVA 3ZPPA 1H80A 4U49A 4I84A 4W8TA 1O8LA 3FY3A 2NTPA 3GQ8A 4OZYA 1CZFA 3GQAA 3EQOA 2QXZA 2VJIA 2VBEA 4C2LA 2IQ7A 1O8HA
chains in the Genus database with same CATH superfamily
2QZ8A 3K1NA 3QYBA 3MAJA 3LO8A 1QA2A 3IH4A 3A35A 2GAUA 2CYYA 3ABMH 4RB0A 1BI0A 1X19A 5CLSA 4N0BA 3U21A 4OMYA 9ANTA 1TYXA 1S5LC 3WG7H 1K5CA 4Z05A 1YFHA 1IHMA 2VBSA 3FXUA 1Q1HA 4Y9RA 5TGTA 3WHBA 1KK0A 4FCYA 1QRYA 5DEQA 1LB2A 2IXSA 5E20A 5EGOA 4OU0A 1VQNI 5J6XA 2NT9A 4PJLA 2BY3A 3DQVC 3RCOA 2M45A 5KW9A 4WZEA 2L9SA 3HTSB 3U2QA 1IA5A 1D1CA 2HS5A 5HLTA 5DCMB 2XPUA 4BEHA 3WGIA 4U88A 1TYUA 2QGGA 2RC6A 1KONA 4A3JJ 3BWGA 1XS9A 4MYTA 1HQCA 4EJVA 4FTHA 2Z9OA 2K86A 3WYAA 4I0BA 3CB4A 2XZLA 1X1CA 5FO5A 4DQLA 5DD8A 1LQ1A 1VI0A 2DA7A 3AL0B 3QP6A 1I6HJ 3S3MA 1AU7A 2DYSH 1HLVA 1DDNA 1Z77A 2DW4A 2L3DA 1R4NB 3ASOH 3OS2A 2MC3A 3KE2A 3SFZA 2NXNB 4CYDA 2XF7A 4P5OA 2OCEA 1KK3A 3SJPA 1FNCA 2CQKA 2Z16A 2M2EA 1A35A 3RYPA 3LAPA 1KU2A 2IAIA 2GA2A 1W5CC 3S14J 3IWZA 2V1NA 3EYYA 1VQ6I 1KK1A 5IT3A 1I18A 2OUMA 3I0TA 4RDJA 5FFXA 5FLVA 2JA7J 1WPCA 1D1BA 3KEOA 1AA7A 1O57A 1ZREA 5J1UA 1LUJB 5IYDJ 2R7QA 2VKDA 2W4SA 4U7DA 3ABTA 3SDGA 2X4HA 3AAFA 4IEJA 1GXQA 1HDPA 3H5RA 3QFRA 1OB2A 2ZCWA 3R61A 1FC3A 2GXBA 1KMHA 2UVEA 1WI3A 3W6VA 2ZXHA 2NSTA 1KQ0A 1N0UA 2XNCA 4PJMA 5EF6A 2E1RA 1PVEA 3OJXA 4M6VA 1AOYA 2WV1A 1V4RA 3B02A 2Y0SN 4KITB 1HA3A 2XEXA 3ONYA 2VFPA 5DM7F 1ITYA 3PNTA 4Y3OA 5DS9A 2QMUA 2QEXI 2ZNZA 3HUGA 4KICA 4ON0A 1USSA 1EA0A 1KU7A 2QF7A 3KLNA 3GSIA 4ZDPA 4D1QA 5JMCB 4B44A 1VQ5B 2Z3YA 3RKYA 3SDBA 1YIJI 3WU1B 2XGDA 3TOAA 3CC7I 2PMUA 3ZQGA 3W2HA 2V9KA 3QQAA 3K4KA 4OP7A 3S32A 1VQOI 1NB9A 2K9LA 4RPDA 4L9JA 5F0CA 2H27A 4L0YB 5B1BH 3GUDA 4DYCA 2NVTJ 2R3SA 2OBRA 1NJID 2O04A 3DU1X 3E6BA 2MYSA 4M3EA 2JIZA 2YWHA 2FNAA 3KP6A 3BQZA 4C3IJ 4F3QA 2VBMA 2DTRA 2JRMA 4GXOA 1G7CA 2LKXA 1GAQA 4LBVA 4MO7A 2EH3A 5KK1A 1WZ2A 4P96A 1QZZA 3H3UA 4YFKF 1WSVA 3BC9A 2PBIA 2K9NA 5LLQA 3DBRB 4MLOA 1X2NA 2VKVA 2P7VB 4OWRB 1N25A 2R7XA 1OKRA 4MHGA 3PUBA 4ZDOA 5DDGA 1WJBA 1D8KA 2IS2A 4Y33A 4B09A 3G6EI 2DA6A 1BX1A 1JTAA 3R4KA 2P5VA 2F43A 4LGWA 1O4XA 3C2GA 2AXTC 3F22A 1TVCA 1W87A 4JBAA 2R7DA 2WAEA 4N9IA 3LA7A 4G7WA 1ZH5A 1TC3C 1IN6A 4G12A 1D5VA 2N8GA 1P4AA 3ASTA 4XD7A 4U87A 5HS9A 3W2GA 1U0JA 2QLZA 2XAHA 4XLCA 1MMDA 1K6OA 1ZN2A 1R23A 3KP2A 5AONA 5DD4A 2LD5A 2DOFA 1JUPA 1O8IA 2WPDA 4UV9A 1JGSA 2ELHA 1OCPA 2XTYA 3G1MA 3FISA 1N06A 2BXYA 2XKPA 1XX5A 4P9UA 1FJLA 2CV1A 1YOVB 5B5EC 3J7AO 3OYIA 3H9NA 3BPVA 4Y17A 4UVCA 4E7SA 4ZYDA 2VPLA 1DDGA 3CPXA 3CCUB 1QFYA 2V7TA 3BTIA 4AU7A 3WGHA 1JKOC 3IAS2 1AMOA 2M30A 5C3EJ 1H8AC 5JHUA 1WGXA 5J8CA 4JRAC 1EP2B 5FIUA 3K4LA 1QFZA 1YJNB 4ENKA 3K7AJ 2CV0A 2LRDA 4JYKA 1DPRA 4LG0B 1IUYA 1FMVA 3CCJI 4Y13A 2VBWA 2YSRA 3WTWC 1RQPA 1STZA 2QY1A 2V1DA 2DY1A 4BJ5C 4PUSA 3CXCB 4C3HJ 1GO2A 2ELJA 2RV8A 2LLKA 4XRSA 2A5YB 2VODA 3TMOA 3TL4X 3SZTA 4WZLA 1BPLA 5EG0A 2F2EA 2HGCA 2GA1A 5F04A 4A69C 4BGDA 3CJRB 5HDGA 5TY0A 1YI2B 4OJLA 2VE8A 1SC7A 2ZNYA 1YS7A 4L9NA 4G7OF 2AQFA 1W9XA 1T95A 3EQNA 2KFDA 1WXRA 1G7SA 5B3SH 1W0TA 1IN7A 4BJ6C 2CW8A 5CVUA 4X8IA 4YAUA 4XIDA 3CD6I 3FMRA 4RAGA 2KKOA 1T98A 3SYTA 1MBJA 3DF8A 2R9VA 3FY3A 2LH9A 2P81A 4C2TA 5DNSA 2QCOA 4RM2A 1GDTA 3I54A 3S8PA 3CDLA 4B47A 1HC8A 2YX7A 4CZZA 1VNDA 3HAGA 2OAZA 1VQ7I 5BQTA 2W57A 2E1CA 1O8GA 1P7IA 1TUIA 2XTWA 2INUA 5C1CA 4DIQA 3TW7A 3VYUB 5HNHA 5FD5A 4RLQA 2L7MP 4TN1A 4P9SA 5FNZA 1BX0A 1OLTA 1SD6A 3D5RC 4OPSA 4HE6A 5K5QA 4FISA 4QSHA 4TMZA 2GM4A 2BVMA 3MKLA 2DETA 3KEYA 4BACA 3GQ9A 4FETA 2EIXA 1BMFA 4A3MJ 2VKEA 3MEXA 1EP3B 3GVKA 3H0DA 3JU4A 5FL7A 3FK7A 2M8GX 3SUCA 3V7AA 1S9HA 5L3FA 2R6HA 2DPUA 1NG7A 1J7KA 4JX6A 2E7WA 3S2WA 3SHFA 1FBUA 2YUHA 1FMWA 2XIGA 1KD1D 4OMZA 1JRGA 1VJSA 4WQMA 3CPWB 2J5PA 4OJOA 4FHTA 2R5ZA 4X7DA 3JQQA 1XE1A 1P4WA 4A3CJ 2QQAA 3HOYJ 3LQ6A 3VSTA 3VSLA 1XQBA 2VQGA 1IZ1A 2E1NA 2YS9A 1JA0A 1PKVA 1ACIA 3ZMSA 2BX6A 3FF5A 1OCZH 4I01A 2R7WA 1KTVA 3O8HA 4XLEA 1SFOJ 2BOLA 1I1GA 1MBEA 3AFHA 4P26A 2GOXB 3FHNA 1YLOA 2R0QC 3MFKA 1ZM4A 2ZBUA 3LA3A 1ETVA 3X2QH 1ERDA 2KZGA 1KRHA 4ETSA 5LMZA 4C2UA 1OR7C 2M4GA 3CCRI 5LD2C 3M1CA 3QPHA 1IRXA 1ZGJA 3R6KA 4YALA 5H5JA 1MSFC 1QA1A 4XQFA 4D7MA 3CTAA 1Z6RA 3OYKA 1B8IA 2WB1A 3VYSB 2Z1DA 2CW7A 1U9NA 2GQFA 5GV7A 3CUQA 3CF2A 2FNPA 1XDUA 3JTGA 2JUCA 2QTZA 5GADJ 1IB4A 1QVGB 3EPZA 1ZLKA 1VQKI 3BP8A 4BXXJ 1X1BA 4RGRA 4C30A 3EUKL 2BVLA 4HX7A 3TKYA 1Y39A 1WTHD 1QHGA 2GZWA 3D5LA 3U1KA 2BGIA 2V6CA 1KTWA 4IHTA 2DQRA 2FSWA 1N07A 3OS1A 5IT9Z 2V7QA 2DCEA 1YITB 3RPQA 5KVRA 3VSVA 3S1RJ 3WTTC 2KJBA 1R4MB 2Q6KA 1QZEA 4ASUA 5L3GA 3BG7A 1Y0YA 1NTCA 2CC2A 2LK2A 1COWA 3CMEB 1TWGJ 2FX0A 2PG4A 3VWBA 2HVSA 1PUFA 4UZFA 1HSTA 2OZUA 3OV8A 3QFTA 3ROUA 2Y31A 3B78A 3SYJA 2VNKA 1RUNA 1PJ5A 1OB5A 1LEAA 3GBGA 4LBYA 1E3HA 3LSMA 3HDDA 1K4SA 2WJVA 2AHQA 1K79A 1OB0A 1WWXA 3A1YA 1WU8A 4I99C 1E3OC 2AO9A 2PEXA 2DA3A 2ZO4A 4ZCIA 2JDIA 2BV3A 4K1XA 5C44J 2OQGA 2JPBA 4KT5C 2HQNA 1JT0A 1BW5A 1F43A 1FY7A 4KUMA 2VC1A 3A01A 2VUMJ 2QTLA 4JMQA 3OR1C 4EQQA 1LDDA 2ID6A 5EYRA 4Z4ZA 1MNDA 3RJPA 5DN6A 4I98B 4EV0A 4IHXA 3A0HC 2G9WA 2BGCA 4XMYA 2X8KA 2RVCA 3S2HJ 1S4MA 4WK8F 3F0CA 5HZBA 4XNFA 3CP2A 3LL7A 2K9MA 3GF2A 1E64A 2B7EA 4LLGF 4IXAA 4RM3A 4IL6C 3CCYA 3A1PA 1V5VA 4BUPA 2Z2SB 2Z99A 3W3CA 4DQKA 2G0YA 3I3LA 4RB3C 3GTJJ 3T9GA 1A31A 5KAIC 3M1EA 1D1AA 3CCLI 2J5OA 4B48A 1EWYA 2IA2A 1FPQA 1LE8A 1Y1VJ 3VDXA 1ETYA 1QZYA 2ZXIA 4LG3A 2V79A 6PAXA 4E0FA 1UELB 4EMSA 2B0LA 1OCCH 3ASNH 4YZXA 1PDNC 1LFPA 2VXZA 4XKBA 3JW4A 4YIFA 4O3MA 1E3ZA 5HXBA 4DZJA 3JX8A 3HOXJ 2DA2A 1GXPA 4GQNA 3K2AA 4JK1X 1WOPA 4RGUA 2W1OA 3Q9VA 3OYBA 3A8JA 2NV4A 3ZMUA 1YTYA 5CDFA 3SEJA 1T39A 1RMGA 2RKHA 3RY8A 2F5CA 4FASD 2D1HA 4UZEA 2DQLA 4WXHA 4ZZDA 2F1LA 2XRLA 2HVRA 2HZTA 3TH0A 2YR2A 1XSVA 4U7BA 3AL0C 4MR0A 2FD5A 2VE9A 2XF5A 2QSGX 2DT7B 1MH3A 3EUAA 1JNYA 1ZM9A 3F6VA 2EZHA 4P12A 4D5FA 4ZDLA 3ZMDA 4P25A 4AVZA 1RESA 2XROA 1K78A 2VNHA 2DK5A 2XVCA 1DU6A 1Y0NA 1KYWA 1Z21A 3TDZC 1KK2A 2INVA 5FKNA 1BR1A 2ESNA 4F7ZA 1HCRA 2XB5A 3N97A 1TNTA 3LSHA 1K83J 4HQEA 4LFUA 4MGRA 5J47A 4UB8C 4J19A 2V1UA 3JRAA 2HTSA 3RKQA 1FOKA 2O61A 1J9ZA 4P22A 4ZCMA 1VQNB 2E36A 2QN6A 3G71B 1YG2A 2FUG2 4TMWA 2PJPA 1JUSA 1UHWA 1CGPA 1MJBA 5K7FA 4PJ0C 3TEDA 1EV7A 1FYKA 1QX4A 1A5JA 5CVIA 3E3VA 3RZOJ 1IJFA 1QA3A 4CCKA 2V7VA 1FRNA 4I76A 3WU2C 1QA6A 2X53S 3LQEA 4NUBA 1W0JA 1ZRDA 3K6GA 1V3FA 3ZPPA 3ABLH 2KPMA 1H80A 3MQ0A 4I84A 3E1YE 2B7CA 1QPMA 2OTJI 1XB2A 4EEFG 1WH5A 1FZPB 2PFBA 2A6HF 1FLIA 3Q5FA 4X7CA 1VQLI 2RC4A 4LBWA 3EQOA 1BBYA 1XMKA 1MJAA 4A0ZA 3JR9A 4YAWA 3DPTA 2V26A 4AF7A 1ZK8A 4L5EA 2JZYA 3DLLF 4BHPA 3VFZA 1KQ9A 4HDVA 2CWEA 4YIRX 1K28D 4ZGQB 4WZKA 2RN7A 2JPCA 4HF1A 1BQEA 3JCUC 2X9DA 5A2QZ 4A3LJ 1IO2A 2GQQA 1S7EA 2OQRA 3CMMA 3F23A 4IHWA 3P5JA 3AVYA 3F8BA 1E43A 1EFCA 1NHCA 3O8GA 3D0SA 5FO1A 3RZDJ 4A3KJ 4Y7NJ 5K5OA 4E7HA 1OFMA 1OOCA 2DAOA 1VHOA 3HKZN 1VQ8I 2XC1A 3VPRA 3U2RA 4OJPA 3FK6A 5BSYA 2ICWG 3M07A 1EH8A 2DOAA 3ES9A 4E7IA 2LBFB 3RSNA 5EZGA 1F36A 1MABA 4AYBA 3DCFA 3GW2A 2R4GA 1PP8F 2BM0A 3VO1A 2VFOA 1TWHJ 1W2BB 1N08A 4Z2YA 3DEEA 3VB2A 1VQ9I 2ODLA 4RD1A 3MD2A 4HE5A 3BY2A 1DBGA 2XAFA 2OBSA 1TP4A 2GIZA 4L5JA 2O0WA 5K5RA 2DBBA 3KYLA 4OPVA 1W36D 1TSPA 3OZVA 2NVXJ 1J09A 2Q2EB 3ZMTA 4U9UA 2ME0A 2FBIA 2ZXJA 4URRA 3ZQFA 1EFTA 1FP2A 3PA2A 4DNTB 4KDPA 3CC7B 3KP4A 4HAMA 4CZCA 1EFRA 1YX3A 3F21A 2KRFA 4M3FA 4CA0A 4H0EA 3EYIA 3MN2A 2CQNA 2TRTA 2PLYA 3V76A 1OYYA 3V42A 2GJPA 5IYCJ 1I3QJ 4B3GA 2IGOA 3VEPA 3ZGKA 2WC2A 3ABKH 4M1KA 1XMAA 1Z67A 4HV5A 4BY7J 1WDTA 2I1LA 1SMYF 1IV6A 4EATA 1JA1A 4CHUA 1QVTA 2EPFA 3DU6A 4DYRA 3I56I 1WORA 1IN5A 1I39A 4BQNA 4YDTA 2D45A 1FTTA 4BE0A 1HSJA 3FMQA 1D3YA 5IYRA 1O3QA 1FP1D 4PC6A 1IC8A 4IQJA 2GIVA 1WRJA 2L0KA 4DW6A 3WODF 5IT9K 3WNCA 2XSDC 4OIOF 2DEUA 3KX2A 3QP5A 3E5UA 5DUKA 4CICA 1FYLA 3C7JA 1D0XA 2E35A 2CUFA 3IV5A 4LBZA 5D5UB 1V0FA 2CBXA 2X1DA 2K3PA 3FX3A 1NG6A 3H3VK 3M9AA 3BTLA 4RD3A 3REOA 1MJ9A 2F4MB 2EZIA 3ONUA 1EZGA 4W8TA 5ICEA 1K7AA 1RUOA 3KEWA 1G6NA 2JUGA 3BZKA 1ZR2A 2EBIA 2V7UA 3AVTA 5FKLA 1E1RA 4IRHA 1OCRH 2QZAA 2XRNA 2JRTA 3R6JA 2VBVA 2Y9ZA 1Y8RB 2MD0A 2O8XA 4AIKA 1YW7A 1J59A 1I1SA 2LVSA 3QPSA 2VL8A 3RYRA 4E7LA 1TT5B 4LK0F 4HNVA 3SQNA 3GTPJ 3CW2A 3G05A 4C43A 3GZNB 3DU5A 4AC0A 1K4TA 1P92A 4X07A 4IRGA 2W6IA 5FRNA 3OPOA 2E2HJ 3BR1A 1K8AD 2R7UA 1Q82D 1JGGA 1VTNC 2DYIA 3BG5A 4YG2F 4HF2A 1SKYB 2DT6A 5CYVA 1AWCA 2HOSA 1ZM2A 4AIHA 3KP3A 5FGMA 3CCJB 3ULQB 5CPRB 3ECOA 4RCYA 3AK5A 5GAEJ 4PC2A 2LOOA 2RDPA 3JRCA 2STWA 4Q7JB 1LM1A 5E79C 1PLUA 2EA4A 1TWAJ 4EM1A 4M3DA 3ASQA 2PYHA 2PI0A 5FJ8J 3CMAB 5KAFC 1I7PA 2KISA 1IDJA 1WJ5A 4EJOA 3ZP5A 4OOXA 2H8RA 4L5IA 4MNUA 1OGOX 2F3LA 3I64A 5KHDA 2V9VA 3WE3A 3HSRA 2WV0A 1Q81D 3K9TA 1B9MA 1WHUA 4NBQA 4ROXA 2XGEA 5CVRA 1B9NA 1SFXA 4II3A 5TR9A 3CCQI 3F8CA 3E1SA 4PGGA 1EA3A 2VI6A 3CCVB 1KU9A 5TRDA 4Z03A 3V4GA 1U78A 2UZKA 1PJ6A 5JVTA 4WWVA 5DYMA 3T1BA 4MFDA 3G2BA 3FWEA 5HS8A 4LB6B 4DNCA 2WR8A 2ECBA 2HYJA 1S7AA 2MGQA 1IUFA 3OL3A 3WBKA 3BH4A 2J7KA 4XLPF 3N4MA 1SD4A 4H9GA 3FKSA 1BN8A 3SQVA 1VQ7B 3LMMA 4WX9A 1O7LA 2H09A 4KMUX 3RKXA 3AVWA 2BY0A 2X3HA 1YJWI 2W7NA 4N9HA 2P8TA 3OZWA 4IHSA 1MD0A 4PGHA 4E7KA 3NWSA 1YW8A 3HOZJ 3E7LA 1G7TA 3HBLA 3HB9A 4UAJA 3DFGA 5LRSA 1KCCA 1WJEA 2DYRH 5GTHC 2UVFA 1OYIA 1FSHA 3CCEI 1SVOA 1TTYA 2FU4A 4RCZA 4B4CA 2D2WA 2HTJA 3TBIA 2QVOA 3WE2A 3LFUA 4YELA 1MNMC 3LSKA 1REPC 4S04A 1GUUA 4OINF 3ZMZA 1UZCA 4XLFA 1OGIA 2Q6LA 1HF0A 2BY1A 4KT6A 4TMTA 2DMTA 1VBLA 4NC8A 1SMTA 1OHHA 3ESWB 4ZTJA 2Y48A 1R7JA 4G6IA 4UUTA 3CJQB 2UV1A 2BM1A 2A6TA 4LD5A 1XB4A 3TW6A 2VBTA 3TO6A 4MEYF 5BOXA 1S72I 2BBYA 2Q6IA 2EZKA 3Q38A 5E17F 2AS5F 1CZFA 2EV5A 2XPWA 4DBQA 2JSCA 2FMLA 5LGNA 2YPRA 3Q39A 3U9GA 3S1QJ 3GVJA 2V31A 4C2LA 1O7FA 4U0VA 4Y7CA 2Z5UA 1O8HA 4XOPA 2RQPA 3AVUA 3JREA 4RLZA 1Y56A 2VT2A 1BN5A 2HEOA 1TW3A 2D3NA 1VQ4I 1VQMB 1RI7A 3I5UA 2RREA 1GR1A 3H0GJ 5C1EA 1RPWA 4KNYA 1JHHA 4KIGA 3EQLF 3GQBA 1IDKA 1ON1A 1W7PD 3FM3A 3VODA 5D5WB 1X3ZB 3CO7C 3WTXC 3ISXA 4QHYA 1U9OA 3ASRA 3S3NA 5A2QK 1G4DA 2R5YB 3U6BA 1LVKA 4AM3A 2CFOA 4AIJA 2DK8A 1QRBA 4BYYA 2DA4A 4PJJA 2LZJA 3IH2A 4TV7A 2K9SA 1O8DA 1X0CA 3OYJA 5CVVA 5DS0A 4YZ0A 1WQ2A 3PQJA 5E18F 4HYEA 2B9SA 1U8RA 1FOXA 3KL9A 2K02A 1VQKB 5E3OA 4U0WA 1GLNA 4RDLA 5D5VB 1XSDA 3BCAA 3ZXSA 1MBGA 2VZLA 1TL8A 4J0QA 4WCGA 3WBJA 3HOVJ 3SZEA 2MG4A 3VMVA 1O8EA 1I27A 3L2RA 2QQBA 3GLLA 3OYNA 1R00A 1NK2P 3F8MA 3GXOA 1QFJA 2F48A 1BIAA 5GP9A 2E1MC 1JKQC 2E2IJ 4Z6YA 3O6BB 3I4MJ 1R5HA 2XDVA 2XF6A 3R0JA 5F0HA 2FBHA 2HR3A 5THXA 1TYWA 1IN8A 2CMPA 1ZG3A 4A5NA 5E8IA 2IS4A 1FNNA 3OP1A 2QYUA 3Q0UA 3QU6A 4U4BA 2LF7A 1YX2A 1V54H 2B7BA 1IXCA 1FBQA 3ZZ0A 4KIBA 1N75A 2A05A 4ZYEA 3CP8A 4D9JA 1VFCA 3J7YJ 1JE8A 4CYCB 2NOGA 5J40A 2JN6A 3BJ6A 2L5QA 5J35A 2VQHA 1MSEC 3A3GA 3T53B 2ZL5A 4XRSG 3HPGA 1R6RA 2V1XA 2YUSA 2VONA 3H92A 2KLOA 3W2IA 2XGXA 2ZTNA 1Z7UA 3GFMA 2HDNB 3MHPA 2C4TA 3LSTA 3T56B 1GVDA 3GZ5A 1YIOA 2D9RA 3K70D 5L3BA 2FVGA 3VYTB 2P3MA 4IF4A 3ZQIA 4QPOA 1BL0A 4M74A 2VYQA 1PXZA 3F9KA 4MQVA 1RR7A 2L2OA 2IGMA 4RAYA 1MDMB 2GPJA 3CJNA 3G4SI 3J81k 3MZ8A 4X6AJ 3LSRA 2Y0SA 5M5XJ 2E5ZA 3AG3H 2BPOA 1TW2A 1P9QC 4XORA 2C78A 2EILH 1T6XA 1TTTA 1AIPA 3ZBUA 1BOBA 5ED4A 1Y0RA 3RQIA 2NPFA 2RQQA 4IVNA 3MKWB 1S7OA 1P6RA 3H09A 3NWTA 3NE5B 5LGTA 1GJRA 3O2PE 4HIZA 3I71A 3OZUA 2UWMA 1FRQA 3ZCOA 2UUZA 4N3GA 2RGVA 1KGSA 3KZYA 3TQNA 1ETWA 4BQAA 1FOYA 4YHBA 5GV8A 4ZYAA 1HF2A 1O8KA 1SAXA 1W7PB 1ZLJA 1FNDA 2CQXA 3I9V2 4Z4UA 2PJRB 2BY2A 5C4JJ 5J3LA 4RAFA 4BE1A 1PJRA 4XLAA 1BIBA 3AKZA 4CXFA 2EA2A 2R93J 2WTEA 3RTRA 4AUXA 4QFMA 4YZQA 4HEA2 1X3UA 2ISYA 2ZJRF 2CK3A 3Q6QA 4HSTA 5LHHA 1DUXC 3C3WA 4IHYA 3FMSA 1LPQA 4CQJA 2A3SA 2QKLB 4E4HA 5HS7A 2VNIA 2VFNA 4PC3A 2EV6A 2KP6A 2QSHX 1GQ8A 3ZBTA 3P7NA 1JTXA 1NRKA 4HNTA 3K69A 3Q0WA 3AGPA 2L9RA 3B82A 5ILVA 2CFXA 2CRVA 5FLXZ 4I6ZA 3ZQLA 1XSXA 4S05A 4F55A 1FSEA 2LTPA 2NS8A 1JI8A 4X7FA 1HBXG 4QVJA 4GRIA 3CUQC 5IPAA 3TO9A 1ZQ3P 2L4MA 3BR5A 3ERMA 2CF4A 3ECHA 2IA0A 2DJIA 1Y8QB 1QUEA 2ZC2A 3MMPA 3BLYA 5J8FA 3PSSA 3M8JA 2EQRA 1X4OA 2ACJA 3HG9A 1USTA 4AD9A 4EJUA 1LNWA 2VBXA 4XLNF 3RPUA 3ERED 2CW5A 3V8JA 2LKSA 2A61A 4BAYA 2OTJB 4NCNA 1K73D 1RWRA 4IX7A 2HYFA 1Y0UA 4EM2A 4XN0A 1VQLB 4NC7A 2BM4A 2J8IA 2WAFA 4FE7A 2ISZA 1Z6TA 2NVUB 2F5DA 3KP7A 5K1YA 2M7BA 2RNGA 2JJ2A 3F6OA 2Q6OA 1KU3A 1JJ2B 1J2XA 4XRFA 4HWVA 3V7RA 2IGNA 1M1EB 2JMWA 2V7FA 2GK6A 3HYIA 5HLGA 2H6BA 1YJ9B 3H3ZA 2V9PA 3DKWA 2L01A 1QPIA 1HW5A 2ZKZA 3IAM2 4Y9UA 2QSFX 3VMFA 3HL2A 1SVLA 3QPLA 4M4SA 3B8HA 2VB6A 3LQQA 1CF7A 5M5YJ 2DIEA 1RIOH 3BCDA 4OPWA 2BF4A 1R5GA 1P2FA 3AG4H 2XZOA 2VJ5A 3I53A 2XSJC 2DXIA 1XG2A 2ZMEB 3ZR8X 3ZQCA 3W6JB 2OYNA 3OW7A 1XGNA 2Y0MA 3L09A 2VLAA 1IG7A 1YRNA 4RD0A 4B8XA 3TDUC 1YHQB 3S3OA 3E5QA 4HLYA 3CCSB 3K2ZA 2D5VA 4L0ZB 2EFGA 5KNLA 2F4IA 2M4KA 1LLZA 1BM9A 3WTSC 2W82A 3TP0A 3R60A 1VQ9B 2VBZA 3I59A 1CQXA 2QXZA 2VBEA 3HZJA 2O03A 2EJRA 4GO1A 1NDHA 1MMAA 2YU3A 2OA4A 4UNOA 3FHZA 1VQ5I 1BI1A 5F1RA 5LBQA 1FWZA 1Z9CA 4V02C 1T0FC 2ZB9A 1H8HA 1DGWY 2WY7Q 4F52A 4HV6A 3PJRA 3BTCA 1ETQA 2Q2EA 3WTYC 3SKBA 2EFNA 3OOUA 4KISA 4P3YA 3SLDA 3P4GA 3OOPA 3CZ6A 1HKSA 1E62A 3RPUD 2LY2A 1UD4A 1KQ5A 3RIRA 2VKHA 4YC5A 1UB9A 3DBLB 2ZL7A 3L00A 1SFEA 3DPLC 5HZAA 2HI3A 2OTLB 2RAEA 2VPRA 2A6EF 3W2FA 2KZVA 2LC2A 2HPMA 1UD5A 2IVMA 5IP7J 4UVAA 4WZTA 2QKMB 3JRHA 3RKWA 2XOKA 3I56B 4DZPA 1UHSA 4G9YA 5ILUA 1MMSA 4RLFA 1F5TA 4P55A 4F92B 4IRIA 3U6KA 3OW2B 1A04A 2VBUA 3PO3J 2KVOA 3AGQA 2PIAA 3E0JB 5HLIA 3L9FA 4I0AA 4XOTA 3WTUC 2HPIA 4FQGA 1LFUP 5IK2A 3WNDA 1VQPB 1R49A 2W25A 3BOQA 1Z7LA 5L3DA 2NOJB 1OCTC 4OPOA 4X06A 1ZAOA 3K4MA 3PQKA 3GYHX 2CGPA 2V4DA 3OS0A 3H9JA 1XGOA 4YEIA 2LYCA 2CV2A 1FYMA 1N78A 1XD7A 4RGSA 2R92J 1H85A 5IYWA 2ZZQA 5AIQA 2P6SA 4RB1A 1S3JA 3BT9A 2W6JA 4TSFA 1MH4A 1W36C 3GO5A 4PSWA 1KC8D 2CU7A 1HW2A 2FOKA 4IHVA 3JRFA 4Z4TA 2KL4A 4XKWA 4BU2A 2NVYJ 2A07F 2WSSA 4WXCA 4BH9A 4E7ZA 3LWFA 2P5LC 4ENMA 1ETOA 4UHTA 1WSUA 3GFIA 2WZPP 1Z0XA 5HVQC 1T0FA 2OJED 3BR0A 3IRQA 2PYGA 3E6CC 3BR2A 1ZKGA 3CCUI 3GMEA 4QPQA 4OZZA 1ZTRA 1AIRA 2IJLA 3MZYA 2R7TA 4PSXA 4XKCA 5CQEA 2R7VA 3OEEA 2XB0X 1J5YA 3GTGJ 4V2FA 1ZELA 3GLXA 3NAUA 1YJNI 4W8SA 2LSOA 4U0YA 2Z33A 3OY9A 4ZV4A 4MIMA 3JQPA 3CRZA 3TGNA 5HDKA 1DPUA 4ANJA 3SZPA 2FOWA 1QH0A 1G7RA 2HNHA 1U2RA 1FIAA 3VOEA 2CQQA 4YCQA 2OZ6A 1A6QA 1K6YA 1BR2A 3K4NA 1J0RA 1TLLA 2EFPA 5BSXA 1B6AA 4P9FA 3A3BA 4YFOA 5EG0B 4G7ZF 3JTHA 4ESBA 4M3GA 4ZTFA 1MIJA 2XGCA 1OPCA 1CLWA 1TNSA 4ZC3A 1YI2I 2M7AA 3NAWA 4NQWB 3PENA 3I4PA 3WY9A 2ZXWH 4BQQA 4ZYGA 3KZIC 4EH1A 2ZJQF 4P1WA 5JLWA 1L1IA 2P5KA 2K7LA 1MZBA 3B73A 3BY6A 3PSFA 4YIIA 1W4MA 2X1CA 3DXJF 5LRRA 2X48A 4BL0B 5H2FC 1S6LA 2KIUA 1TQPA 2Y9YA 3H36A 1IJWC 3M3YJ 1E1QA 2H6CA 4LK1F 4YFNF 5DCMA 2FBKA 3U1DA 3BH7B 2MC4A 2HXOA 2XAUA 1UG0A 3DEUA 3JRIA 3GWZA 4MFEA 3W2WA 3GX4X 1X2MA 2V5IA 4HNUA 3DBHB 5GPAA 1PUEE 1CNFA 4OJ6A 2GXGA 2OC6A 2QA4I 4KN7X 5EMNA 2WA0A 3O3KA 1T6ZA 1R1TA 1QQIA 1GVHA 4AF6A 3RQ4A 2Y2ZA 2E60A 3FKJA 3WHCA 2YWEA 4BQOA 2CO5A 1SVMA 4ESJA 2BN4A 3IUOA 4DYQA 2X6XA 3BDDA 1F1ZA 5FLXK 2EIMH 1B4AA 1JKPC 5HKKA 1N05A 2LF8A 2VOPA 4BHCA 3ABUA 3HGGA 3BNWA 4WWCA 1Q7YD 2XNDA 2FF4A 1O8FA 3J7ZI 1FT9A 4LB5A 2OD5A 3HC7A 3CDHA 2O6WA 2F4OB 5IYNA 2A68F 2ZZGA 1VQ6B 4DNRB 2Z8GA 1ZR4A 3G73A 2V7WA 4CCLA 4LJZF 3ZIAA 5H6QA 2BW3B 4H4KC 5EEGA 1OFLA 1PE9A 5FD6A 4RGXA 1PJ7A 4OOSA 1S72B 2JSPA 3LMWA 4KFCA 3K4BA 2L9NA 2QQ9A 1FIPA 3K4JA 1T08B 4LLLA 4YXWA 2BM6A 5BNGA 3OYHA 1IV8A 1E63A 2IBDA 3JAMZ 3CLQA 3B8YA 2PMZN 1SFKA 4M73A 5DV5A 4ACBA 2E1BA 4HRIA 1QGYA 3QSYA 2YX4A 1X3WB 2XT4A 1R36A 3MMYB 4EJTA 3S15J 1I8DA 2KRHA 3NRVA 4UY8I 1WJDA 4BS9A 1OISA 4ZJZA 1D5YA 1JB9A 1BI2A 4LMYA 1AKHB 4L8JA 4ABZA 1P4XA 5LHGA 5FRMA 4HG2A 3BH6B 4JX5A 2QEXB 5TJJA 4NK6A 3HOWJ 3SEZA 3KEQA 2EIJH 5FROA 1WPKA 3OSFA 5A88A 2GREA 3IKVA 5H6RA 4QUZA 3BC8A 4X7EA 1FBSA 2PMHA 1DU0A 2Q0OA 4CCNA 4K2EA 3S17J 1IRZA 3ML6A 2NNNA 1T8IA 2R5YA 3LNNA 1EH7A 1YIJB 2JWTA 2QENA 2VQCA 1RR8C 3F8NA 4JX4A 3AG1H 4W8RA 4OOIA 1EXMA 2RNJA 3ZQQA 2CS3A 3NARA 2NRAC 3A2KA 4OOVA 5HNFA 4B3FX 1U6GA 4N3NA 5F4MA 1VQOB 4XN3A 4UUVA 2NS0A 1MKMA 5BPDA 1JTYA 5GAGJ 2GJRA 4G1BA 4X0CA 1Z05A 3A03A 4QWQA 4ASNA 5C4XJ 1YITI 1GV2A 2M5SA 1WJAA 5L46A 4L9VA 4LIVA 1A8PA 3TOBA 4OZYA 4GCVA 3BTJA 2EIKH 4I02A 3CMEI 2GOMA 2BM7A 2DMQA 4NBSA 1GHCA 1OQYA 1TBXA 3OIPA 2HMAA 3PIPF 1NBMA 2LKPA 1FX7A 4RS8A 4Y52J 1PYVA 2NYXA 2M8EA 5IOYA 4X0GA 3BQYA 1T33A 2EWNA 3G6EB 2DOEA 3DWLE 3DPUA 1MBKA 3OAAA 2ZJ2A 2DI3A 3W5VA 2R7FA 1A6IA 1OJLA 1H42A 3J81Z 2IP2A 4UXNA 5HODA 4IOCF 3LSPA 2O8KA 4IPAA 2WAQA 2FE3A 1DQUA 2E7XA 1U5TB 2ZFUA 3MKYB 3CO6C 5ICCA 3OJWA 1I3AA 2OU2A 1WMRA 3QODA 1UFMA 4G8XA 3JSOA 3LNQA 2PQ8A 3C18A 1F9NA 4G6TB 2KIMA 2IS1A 1RETA 3FXRA 2BGJA 3OYLA 2BEOA 5AIPA 3ML3A 2QGUA 3I55I 1B2RA 2WBMA 1T2KA 2KIQA 1CQTA 3L2WA 2BZTA 2EK5A 3LSGA 4DQ2A 4FX4A 1QCXA 4OM9A 1NK3P 1CNEA 2HDWA 4PCQA 2B5OA 3G4SB 2VFMA 4G6DA 1WOOA 1UMQA 3WG9A 3IWFA 1IB0A 3VR6A 2O3FA 1O3RA 2L7KA 4WF2A 3PETA 1H89C 3T5XA 3EETA 2DDBA 2K4BA 4HA8A 1ZG1A 4I2OA 2I10A 2NT6A 4LG0A 2H8WA 4TMXA 4RB2C 3QFCA 2FX3A 5H20A 4GYIA 3BCBA 3HEFA 4G94A 1E0EA 3P9CA 1H88C 3NB2A 5M5WJ 3CUOA 4PDKA 1H8EA 5F4OA 3GFJA 3H35A 4BBRJ 5EDNA 2H1KA 1ORKA 3OYFA 5CVJA 4MQ9F 4LIUA 3J7AY 2R7ZJ 1UD2A 1X58A 4Z4VA 2IGKA 4HOBA 3DTEA 3LVBA 4AWXB 1QO0D 4ZCLA 3DEWA 3K0LA 4AIDA 3SY2A 1W7PA 1W0UA 4ZGNB 2DOGA 4FX0A 1UHMA 5HLHA 2GXAA 1YX5A 2PJRA 1W0KA 1KZLA 3FDYA 1TQMA 2K27A 3CC4I 3KLOA 3KZZA 4PFOA 1UD8A 4KYWA 4M53A 1M90D 2KJCA 5D6EA 4HQMA 2QM3A 5TISC 4N4OB 4RD4A 3K70C 1TLHB 1R22A 5JBQA 4C9YA 4MTDA 3GEZA 3CD6B 2QBYB 1EE6A 1QVUA 5DCFA 3GRHA 3BPXA 3S2DJ 1ZUNB 2HOTA 1RRJA 1XTAA 3JQRA 1IGNA 1DGRM 2DLLA 5IOZA 1D8TA 2O5RA 3ZUGA 5K7ZA 3OYEA 1N77A 3GTMJ 3LYCA 3ZMVA 1XDSA 2HOEA 4M71A 4G7HF 3M4OJ 2CQ7A 2KT0A 2ZSIB 1OGMX 1XG1A 4OAYA 4Q5SF 3CC2I 3G71I 2L7ZA 1B72B 3WTZA 1TWFJ 2XASA 2ZMEC 2D3LA 2JQ7A 1SFUA 4PGOA 1XCBA 5EEAA 5B66C 3J80Z 1XPXA 2TDXA 4GGGA 4W1UA 2JTVA 4LLNA 5JI6A 3A8IA 1BC7C 5M3FJ 2IQ7A 1IW7F 3RIQA 3D5SC 4RJLA 2VJ4A 1POGA 5DUIA 4GFBA 4XM3A 4RD2A 3LA2A 3DP7A 4YFXF 1QVFB 4P3IA 1O88A 1DG1G 4DJAA 1L3LA 4IKFA 3PL8A 1X1PA 2XZPA 1IRGA 3WNBA 3W2AA 1IRFA 2VBYA 3H9QA 3OYCA 3FXOA 2O6GE 1H9GA 1ZGAA 1D2EA 3JURA 3F3XA 4V2GA 3OYDA 1DP7P 1P4MA 3ZZUA 1LDKB 3L2VA 2DPDA 3MZHA 1XC5A 2F1MA 1LLWA 4WXDA 4J01A 2K3FA 5EEHA 1WSRA 2JA2A 3L2QA 2VOOA 2BHYA 4M3BA 2GWRA 1ZGWA 2X6OA 1W1WE 1HXDA 3EUHC 3WQZA 1BW6A 1I6XA 3ZQHA 4UUSB 2JA8J 2BE5F 4RAZA 4E7JA 2DMPA 1RQRA 3A0BC 3UW0A 3B6AA 5B6IA 3HIFA 4KIFA 4XKVA 1F60A 1SKQA 4W8QA 1KCDA 4Z4WA 5TV2A 2V4JC 1GVJA 2WWYA 1QGZA 4PAAA 1KJZA 2VBKA 3SZGA 4BXFA 4FWTA 4DK0A 3K10A 3CCRB 4KH3A 3P26A 3AVXA 1P7JA 3KYCB 1R5ID 2ETHA 4OAZA 5D8KB 4JP0A 3FPPA 3B4NA 4KKTA 2LY9A 2ZMEA 4B4DA 1FDRA 2BSPA 3FXLA 3R0AA 3OKXA 4KKUA 1MRZA 3UR3C 3V8KA 3NQOA 1BLIA 4PC7A 4Z06A 1MMNA 3BCFA 4A12A 4CGZA 2P6TA 2GBYA 2Y69H 3QYFA 2PE3A 1R1VA 2TCTA 2HU9A 3HXLA 4HLXA 3E20A 3FM5A 5J1RA 4CSWA 1N0VC 2IOUG 3GCMA 5L3CA 2QWWA 2WJYA 1B1BA 5DM6F 3IKTA 2XAJA 3LOCA 4IW3B 3I1FA 3PSZA 2EFQA 2WZNA 3GFLA 3JAMK 2OBTA 4PC1A 4RPBA 2V7XA 4A0YA 3DTIA 4BJTA 4IZZA 4P6YA 2FQ3A 2I8DA 3HOSA 3P9KA 1W35A 1B23P 5F0FA 2PECA 1WVRA 3WWGA 3ISPA 3QFSA 2BXZA 3E6MA 2X6WA 2HQRA 2XC7A 3S93A 3Q9SA 3W5UA 1O8MA 1OYWA 2IPQX 4DOZA 3CCMI 1IDZA 4YZAA 1DARA 3RI4A 2BSAA 4IQ4A 3EUHA 2CUZA 1F4KA 5JLXA 3HHHA 2L7FP 1AHDP 3VO2A 2FQ4A 3QAHA 4EGYA 1JJ8C 2DMNA 2HYGD 2XAGA 2EB7A 3GIRA 1TYVA 3HSFA 3ELKA 1WH7A 3OWTA 3JRDA 4KMFA 3W2EA 4V19K 4R8HA 1Y6IA 1OMIA 1J9IA 1BA5A 3WU0A 4QV2A 1FNMA 2JJ1A 1BOAA 2HQ5A 1Y1WJ 4BY1J 3GTLJ 1O8LA 3V7SA 3GQAA 1Z1DA 2A69F 2ME6A 2ZITA 4D5CA 3DV8A 2VJIA 3SEQA 4D7NA 1I50J 1NB0A 4XRMA 2DN0A 1EKEA 2C2WA 4MYUA 1JJ6C 5FKKA 4MTEA 1SM4A 3LSJA 1O3SA 2X85A 3T0YA 4ZZLA 3LQRA 4HF0A 2O17A 3HSEA 4A3BJ 2WYRA 1T38A 4YAFA 1R71A 1JHFA 1V55H 3CJTB 3IH3A 3A8KA 3PO2J 5IP9J 4XBFA 2PLFA 1WFXA 2LDUA 1LEBA 2ADUA 3D26A 4B43A 1E3PA 3CCLB 1YW9A 1VF7A 4W97A 3QPTA 5E1WA 4RD6A 1QHHD 4ENJA 3IC7A 1K4ZA 3C1DA 3AG2H 4A5MA 4EVIA 4A6DA 1RZ4A 2L02A 2O7OA 3J81K 3PA1A 2ZZFA 3QU3A 2O9LA 2P7CB 2J8KA 5BPIA 2HLDA 2MSYA 5E8GA 2GK7A 1HKQA 1FEXA 1EF4A 2DFFA 3GTQJ 2DODA 5FKOA 3CF5F 2MD5A 4J00A 4TT3A 5B1AH 4G7XA 2K85A 3QWLA 1QQ1A 3IL2A 3HRTA 2KIFA 3OR2C 2P4WA 4L9TA 2R7SA 1D8JA 1G3SA 2JK3A 3GVLA 3H1CA 2WY8Q 4Z4RA 5D8LB 4BXUA 1QGPA 4A3IJ 1MBHA 1QG0A 5J4VA 4KJZA 5D6FA 3N90A 1YS6A 4DK1A 5EJCA 3CMAI 3G1LA 3H5AA 4OIQF 1ENHA 2PN6A 3FBNB 1LJ9A 3KRGA 1DBOA 3SJZA 4M6XA 1N8RD 4PZJA 4Z1MA 2ESHA 3Q3AA 3UKGA 3HRUA 1O8JA 2UXNA 3HRMA 5EGOB 1WJFA 1SEUA 4Y15A 3BQJA 4XONA 1LVAA 2V6EA 2WB1N 3GQ7A 3RDIA 5KCMA 3M8FA 4NQWA 1FTZA 4GDFA 3KFWX 3N05A 1OCOH 4P6VF 2NVQJ 2JT1A 2P0WA 3IHUA 3CCVI 4BEHB 4JOMA 1RNLA 3C2BA 1RU4A 2BV6A 3B90A 4A3EJ 1Q86D 2L4AA 2LR8A 5D4RA 2HQAA 3S1MJ 1UJ8A 3PFYA 4DBRA 5E3LA 2HFHA 4PMHA 4BHBA 4QLCU 1YQAA 5E1ZB 1G3YA 2G7HA 2YU9J 3H9GA 2VIXA 5K7HA 1MBFA 2Z6BD 2BYVE 4BDZA 5DSZA 1R1UA 1SANA 1ELOA 1JXSA 4OJ5A 2K9QA 3LFKA 2QA4B 1OGJA 1LFBA 1YE9A 2MLKA 2OK7A 3PNYA 1TQIA 5J4YA 4BE2A 3WXMA 1MMGA 4Y4RA 1WOSA 4HZFA 1X1AA 3GZ6A 3OSGA 1KQ8A 2A5WA 3PVDA 1WCMJ 3BJAA 2DT5A 3EDPA 1OFCX 3G1OA 3T8TA 4Z4YA 3GQ8A 5FB2A 2ID3A 3DTKA 2MABA 4NHJA 3OE7A 2E1OA 5JFRA 4A0XA 3J80K 1T5EA 1KZHA 1OFDA 1RC9A 4A3GJ 2F5VA 3OIQA 1W34A 4G1VA 2K4JA 1IN4A 1IDYA 4O6JA 4CCOA 5LEJA 2IRFG 4ACAA 4EGZA 3DKYA 3CMYA 2GLOA 1VQ8B 2VASA 2BW3A 1DABA 1T6YA 2LREA 5F4JA 3A4CA 1EP1B 4KN4X 1HW1A 1TZLA 4A3DJ 4E70A 2DA1A 4F7DA 1KQSB 2KHMA 2HDDA 3BZCA 3HJEA 2LBFA 5E1XA 3OYAA 2CJJA 4EJWA 2NAZA 1VQMI 2X6YA 2DCUA 4RM0A 2C77A 4R71A 3HUGB 3ONQA 2C4UA 4QVAA 4TKOB 2FJ1A 1ZRCA 2XKOA 2MBFA 3CDIA 2KDZA 3P27A 3W2VA 1AKHA 4MXNA 2ZTGA 1U5TC 2KMUA 2MH9A 4FXUA 2IS6A 1WI9A 2D1VA 4UB6C 3VSKA 4M0LA 4C0SA 4NK8A 2M5WA 1HA8A 5IYPA 3ZN1A 1LDJA 3FXMA 2FRHA 2NNYA 1GT0C 4CO8A 2M87A 2VNJA 2EWEA 2L54A 3IRRA 4HX8A 5GAHJ 4O5VA 2FXAA 2CUJA 2JVGA 3E6DA 3ZPLA 5KSWB 3IP4B 2WADA 1RKTA 4RMNA 4IO9F 5F08A 3VMWA 2HKXA 3COAC 1R5OA 1WKMA 2OF7A 1J75A 4BKXA 3BR3A 2FA5A 4M2LA 1VHEA 4BDYA 4CDGA 1G3WA 3KETA 1R5BA 3E5XA 5FO0A 1Q1VA 2F4NA 1RKWA 2LY1A 3PUFA 3OFNA 5E6TA 3ZQ7A 1QBJA 3K1PA 2NZMA 2VN2A 3BG9A 4RA2A 1D1NA 3L7WA 3BZ6A 1V5GA 2Y75A 1JT6A 4RDKA 2BMWA 5GTIC 2XTXA 1Z3YA 4A2UA 1YO5C 3ZOBA 4YAOA 1H9TA 1OFEA 2X51A 4XK4A 3DLAA 1BJKA 4NB5A 1ON2A 1QUFA 3QOPA 4M9SA 2AHOA 4TMVA 2AQEA 1IXSB 5DTDA 2E34A 2X0KA 3D1NI 2HDCA 4F93B 3GTKJ 3ASPA 4E6KG 1EFUA 3BJOA 4M9XA 2G7UA 4A93J 2H94A 4PK4A 1OR7A 2XT2A 5J3OA 2HWVA 3L2CA 1BC8C 2ZZEA 5CJ9A 3R6SA 1U5TA 5FKMA 3ZRGA 2XGJA 4M6YA 2QQ8A 2R7OA 3A02A 3FXQA 1HKTA 3CQZJ 3H5NA 2DO7A 2XPVA 5FA6A 3I55B 4X1EA 1ONVA 5EZHA 1K61A 1XMXA 5F6FA 1DDIA 1V0EA 2HCJB 2PMDA 2DFEA 5A8AA 2DERA 2XUBA 2NTPA 1QGAA 3C2HA 4P1VA 2K40A 5ICGA 1E2XA 5CKTA 3TO7A 1JKRC 3DDYA 2HOAA 4EM0B 2BHZA 1UD3A 2MW8A 4UV8A 3W5HA 2XHKA 3G3ZA 5LGUA 3S1NJ 3HGYA 2E1MB 1MGTA 2DMUA 1APLC 3KIOA 2LNBA 2LMDA 4YEJA 3ZSCA 1T6SA 4ITVA 5D4SA 1Z3XA 1GAWA 3Q3SA 1ZARA 2DJNA 5L3EA 2ZL6A 1UD6A 4Q47A 1E3XA 5F64A 2QX3A 4G5GA 4QTRA 1U8BA 5BMZA 1BJAA 4B1RA 1X1DA 3WGGA 2X1EA 4YRVA 4Q4ZF 1VLOA 3FKIJ 4UVBA 3VNVA 1T56A 2DA5A 2HVQA 3MVPA 2K5CA 3BY1A 4PABA 3F8FA 4UZUA 3OMYA 2ELKA 4PJNA 4AYBN 2O0YA 3ZPNA 4EW9A 1C0WA 2E5NA 5LFAA 1MNEA 3CESA 2M1BA 3CCQB 3CC4B 4C2MJ 2CUEA 2EFWA 2EZLA 1YLFA 4IJAA 3K1MA 3PUNA 4HSRA 5A89A 4FE4A 5E3MA 3QYEA 3PIOF 4KA4A 3HM5A 3PSIA 4DGWB 2QBYA 1M1KD 4B3XA 2B0RA 1R58A 2UXXA 5D5XB 4I7HA 1Q9SA 4P2NA 4XL9A 3QE2A 4HDUA 1G59A 2IW5A 1GV5A 2OBPA 1FOWA 2H1LA 3QRFF 3AVVA 1IXRC 2M3AA 2COMA 3LAJA 3CC2B 2DDAA 1O3TA 4A3FJ 4L18B 3VNUA 1VZ0A 3SJMA 3HPHA 4ZH4F 4FN5A 1YJWB 2NS7A 1B72A 2EFOA 4NC6A 1G2HA 1VF9A 3MCAA 1KA8A 5F27A 4HX4A 4F91B 2KRCA 2W85A 4BNCA 1YYVA 3ZZTA 4FK8A 1QJVA 2I5UA 3KP5A 5HDNA 3CCEB 2X3UA 1K9MD 4GYGA 4XSXF 2EINH 4ESFA 4C3JJ 2VJJA 2ZBVA 2X0LA 4CUGA 1E17A 1WP6A 1HZEA 2QUFA 2M0CA 2OPTA 4CCMA 4ENNA 4X05A 3PFIA 3V7CA 2R5ZB 1ZG5A 1X4PA 1DP3A 2IT0A 1ZYRF 3JRBA 1U2WA 2KDOA 5JHFA 2ZSHB 3L2UA 3FIWA 2VT3A 3OYMA 2M9HA 2ECCA 3OYGA 1XGMA 4AC9A 2NTQA 3PUMA 5AN9A 2E71A 1BR4A 2PX9A 2VFQA 5IY5H 1IAWA 1YJ9I 3BROA 1Z91A 1UCRA 3Q0VA 1XN7A 3CLOA 3TP3A 3JSPA 1QNTA 3FXKA 4II2A 2CNDA 3ASSA 2WAQN 1CF7B 4U49A 4UUSA 3NEUA 1S8NA 3HRSA 3L1PA 3JRGA 4LC0A 1VQ4B 1BI3A 1TT0A 2MLGA 5JR3A 2R7RA 2KQRA 2YWGA 3T51B 2HKOA 2F6CA 4RBOA 1B8IB 2M34A 1EJ9A 1YRNB 4QIWN 5H59A 5IYBJ 3CUQB 1HOMA 1YHQI 2VXDA 1E79A 2C5HA 5LEKA 4R1HA 3KYDB 4FT8A 4NNJA 2CG4A 4ZYHA 3FJOA 1PP7U 3CCSI 5CQGA 3QOEA 2MA3A 3I59B 3VSUA 3LSIA 4D0PA 3M8EA 2D74A 2F5EA 3HOTA 1ZRFA 2AXLA 2YWFA 2OK8A 1QU3A 3OEHA 2DU9A 1B59A 2DFHA 1W5TA 1L0OC 1W5SA 3FZVA 3PM1A 1ETXA 1NHAA 1H0MA 2G0EA 4B3AA 5LHIA 2STTA 2NSPA 4OIRF 2CW0F 3M7GA 2F5FA 1D0YA 2FMYA 3HHGA 4XR6A 5IP6A 4OIPF 1PUFB 2JA5J 1ZHFA 1SD7A 3F72A 3MCZA 2JA6J 1FNBA 2CRGA 2Y30A 1S0UA 4Z4SA 3HTUA 4HPQA 2BVNA 3MWMA 4XLHA 4AVPA 2Q1ZB 1ULYA 3V8LA 3BG3A 3K4CA 3T8RA 2JVHA 5ICFA 3N6ZA 3BG6A 1XCVA 4PFPA 3CCMB 2OTLI 3P9IA 5JLVC 4XSZF 1LKXA 2ZBKA 3KPHA 1UMKA 4M9ZA 4NDLA 2HZDA 1A36A 3A01B 1R5NA 4LOCA 1V5EA 3S16J 3B6CA 5FFZA 4CYCA 1FX0A 5GPCA 3H94A 4LITA 3W6KB 2QE7A 1D0ZA 3LJYA 2GJKA 5ERIA 3SLNA 1JUMA 2NTBA 1BHEA 1IJEA 4CCJA 2ZFWA 3GTOJ 4KKSA 2W84A 4XICA 1HDDC 5ILSA 1I5ZA 1UAAA 2IA1A 2VQLA 4N4NB 3FBIB 3UNGC 3HKZA 3ZN0A 1K8FA 1VQPI 3I58A 1S29A 3BR6A 5M3MJ 3SXYA 2C6YA 2C5BA 1EH6A 1UG2A 2EV0A 4BBSJ 2CSOA 2W00A 1U3EM 1ODDA 3MKZA 2BM5A 2E19A 4I09A 5BS6A 5J1YA 4M72A 2PMZA 2LG4A 2ZJPF 4RDUA 3VYRB 4Q48A 2O0VA 1NH3A 2E2JJ 3I4NJ 1ETKA 2O1DA 1MDMA 2MH2A 5JVGF 2B63J 3DKXA 4G6QA 1LE8B 4CH7A 2M0MA 1IF1A 5HOOA 1HG8A 2XNJA 1ZM3A 1SAUA 3KCCA 3PNVA 1BJZA 1XFOA 4S0HB 2W48A 1TWCJ 2W24A 1SD5A 2CH0A 1F20A 2HXIA 5IYQA 4JQFA 2XV4S 3FPKA 2DTZA 4HBLA 1V5FA 2VC0A 2JJ7A 2W7ZA 3OIOA 2DFIA 4R79A 5F1JA 2LFBA 3WTVC 1MW7A 2LP0A 1R9TJ 1HVXA 1VLYA 3SFIA 3FXJA 4MEXF 4IOAF 5AMVA 2OCCH 2XAQA 1XGSA 2QDXA 2MFZA 1G8XA 1G3TA 2L9VA 2JN9A 1WJCA 2RC5A 3OOCA 2Q8KA 3ZC3A 5E3NA 2FEZA 3OL4A 3HOUJ 3GVAA 1QRCA 4BPRA 3E97A 4A6EA 2OV7A 2IEKA 1K78B 4HW0A 1KYZA 2COBA 5FLMJ 2QYOA 3Q6RA
chains in the Genus database with same CATH topology
1MMAA 2X85A 3QYBA 1K28D 3A35A 2O17A 1X19A 3U21A 1K5CA 4Z05A 1T0FC 1H8HA 1DGWY 2WY7Q 5TGTA 1WFXA 3CMMA 4F52A 3PJRA 4KISA 3OOUA 4B43A 2IXSA 1E43A 1VF7A 2NT9A 1NHCA 3CZ6A 4PJLA 1QHHD 1UD4A 3RPUD 2LY2A 3DQVC 3RCOA 4E7HA 2VKHA 1OOCA 3DPLC 2L9SA 2ZZFA 1IA5A 1D1CA 4OJPA 2KZVA 2LC2A 4BEHA 5HLTA 2HPMA 2HLDA 1UD5A 2GK7A 1KONA 2DOAA 4E7IA 2LBFB 2QKMB 3RSNA 2XOKA 1MABA 4AYBA 2R4GA 4RLFA 4F92B 4J00A 4TT3A 4G7XA 2XZLA 3DEEA 3OR2C 2R7SA 2KVOA 1X1CA 2ODLA 3E0JB 3GVLA 4XOTA 2WY8Q 2HPIA 3MD2A 5IK2A 1Z7LA 3AL0B 2NOJB 4KJZA 1DBGA 3S3MA 3K4MA 2V4DA 4DK1A 3OS0A 3H9JA 2O0WA 2LYCA 3H5AA 2CV2A 3OS2A 3FBNB 1N78A 3KYLA 1W36D 2ZZQA 3KRGA 1DBOA 1J09A 2W6JA 2XF7A 2Q2EB 4TSFA 4Z1MA 4P5OA 1W36C 1O8JA 4PSWA 4URRA 1WJFA 4DNTB 2Z16A 4XONA 2KL4A 4XKWA 4BU2A 1YX3A 4CZCA 2V6EA 1EFRA 5KCMA 4E7ZA 2WSSA 4CA0A 2V1NA 1I18A 2OUMA 2WZPP 3N05A 3V42A 5HVQC 2GJPA 2PYGA 2P0WA 1WPCA 1D1BA 4BEHB 4B3GA 2IGOA 1AA7A 4JOMA 3ZGKA 4QPQA 1RU4A 4OZZA 3B90A 2R7QA 1AIRA 2VKDA 2W4SA 2R7TA 4PSXA 2HQAA 4XKCA 5CQEA 4EATA 3PFYA 4DBRA 3DU6A 2R7VA 3OEEA 3H5RA 4PMHA 1ZELA 4BQNA 4W8SA 3OY9A 1KMHA 2UVEA 2ZXHA 4BE0A 2NSTA 4PJMA 4ANJA 3H9GA 4IQJA 2HNHA 2VIXA 4KITB 2Z6BD 3KX2A 4BDZA 3PNTA 4OJ5A 1K6YA 4Y3OA 1BR2A 1D0XA 3K4NA 1V0FA 1YE9A 2X1DA 2K3PA 3PNYA 4BE2A 1NG6A 1MMGA 3A3BA 4Y4RA 1X1AA 4ZDPA 4D1QA 4W8TA 2A5WA 4B44A 3SDBA 3KEWA 2JUGA 4ZTFA 3GQ8A 4ZC3A 2V9KA 2M7AA 4NQWB 3DTKA 2MABA 3K4KA 3OE7A 1E1RA 3S32A 2K9LA 1T5EA 4BQQA 2F5VA 3OIQA 2O04A 4P1WA 2MYSA 2MD0A 4CCOA 2JIZA 3PSFA 2X1CA 4F3QA 3DKYA 2VBMA 2VL8A 4E7LA 4BL0B 2VASA 2BW3A 3G05A 2LREA 3DU5A 1E1QA 3A4CA 2W6IA 5FRNA 3OPOA 2MC4A 1TZLA 2XAUA 1UG0A 2KHMA 3BC9A 2R7UA 2LBFA 3OYAA 4MLOA 3W2WA 2R7XA 4OWRB 1SKYB 2DT6A 4HNUA 2X6YA 3PUBA 4ZDOA 4OJ6A 1WJBA 3HUGB 3ONQA 2OC6A 5CPRB 4Y33A 2IS2A 4TKOB 2LOOA 2WA0A 1JTAA 2F43A 1PLUA 3C2GA 3W2VA 4MXNA 2ZTGA 2KMUA 2WAEA 3RQ4A 4FXUA 2PYHA 2IS6A 4G7WA 2E60A 3VSKA 3FKJA 4NK8A 1HA8A 4BQOA 1IDJA 1WJ5A 3IUOA 2X6XA 2EWEA 5HKKA 4XD7A 4U87A 1U0JA 1OGOX 4XLCA 5KHDA 1MMDA 1O8FA 2XNDA 2CUJA 2JVGA 3HC7A 3IP4B 2WADA 1O8IA 2WPDA 4RMNA 4II3A 3VMWA 2ZZGA 4DNRB 2CV1A 2Z8GA 3ZIAA 4CCLA 3E1SA 1EA3A 2BW3B 4H4KC 3OYIA 4Z03A 4E7SA 2VPLA 4BDYA 1OFLA 1PE9A 3LMWA 4AU7A 2JSPA 3K4BA 2LY1A 3IAS2 3OFNA 2L9NA 2NZMA 3G2BA 3K4JA 4YXWA 3OYHA 3B8YA 3K4LA 3OL3A 1SFKA 1V5GA 3BH4A 2E1BA 4HRIA 2CV0A 2LRDA 3MMYB 1Z3YA 1FMVA 3FKSA 1I8DA 1BN8A 2KRHA 3LMMA 2X51A 1WJDA 3DLAA 4BS9A 4ZJZA 4L8JA 2QY1A 2X3HA 2W7NA 4BJ5C 4PUSA 5CDFA 2AQEA 5FRMA 4HG2A 4NK6A 2ELJA 4E7KA 3SEZA 3NWSA 5FROA 4F93B 1KCCA 4E6KG 3BC8A 1WJEA 3TMOA 2UVFA 4CCNA 3TL4X 4PK4A 1BPLA 3TBIA 3LNNA 3LFUA 4YELA 2ZZEA 3LSKA 2VQCA 4BGDA 3CJRB 3ZRGA 4W8RA 4OJLA 1VBLA 4XLFA 2XGJA 2R7OA 4KT6A 2CS3A 2AQFA 3ZQQA 1T95A 3A2KA 5HNFA 1W9XA 4B3FX 4NC8A 3EQNA 4XN3A 1OHHA 4BJ6C 4ZTJA 2CW8A 2GJRA 4G6IA 3H5NA 3CJQB 2UV1A 2A6TA 3SYTA 1WJAA 2M5SA 2R9VA 1V0EA 3FY3A 4LIVA 3B4NA 2LH9A 4C2TA 2NTPA 3C2HA 4RM2A 1CZFA 4OZYA 3S8PA 4DBQA 4B47A 5CKTA 3DDYA 2GOMA 3GVJA 1UD3A 2V31A 4C2LA 3HAGA 3OIPA 1O8HA 4XOPA 1NBMA 1Y56A 2D3NA 2E1MB 1PYVA 1O8GA 4X0GA 2INUA 2RREA 5C1CA 4DIQA 5C1EA 5HNHA 3VYUB 4RLQA 3GQBA 4YEJA 3ZSCA 1IDKA 3DWLE 4ITVA 3DPUA 1Z3XA 1OLTA 3D5RC 3OAAA 3S3NA 1UD6A 1LVKA 2BVMA 2CFOA 2WAQA 1DQUA 3KEYA 4BACA 2ZFUA 3MKYB 1E3XA 3GQ9A 4FETA 1WMRA 1BMFA 2QX3A 4PJJA 3QODA 3GVKA 2LZJA 3JU4A 3H0DA 5FL7A 1O8DA 1X1DA 1X0CA 2X1EA 4YRVA 4G6TB 3OYJA 3SUCA 2IS1A 1S9HA 4YZ0A 2HVQA 2K5CA 1NG7A 3OYLA 4UZUA 3OMYA 4PJNA 3ZPNA 4EW9A 1FMWA 2E5NA 1GLNA 1MNEA 5LFAA 3CESA 1VJSA 1JRGA 2WBMA 4OJOA 3BCAA 3ZXSA 3L2WA 3LSGA 3VSTA 3VMVA 4HSRA 3VSLA 1O8EA 3L2RA 2VQGA 1QCXA 1PKVA 3OYNA 3QYEA 3PSIA 4DGWB 2HDWA 4B3XA 2R7WA 2E1MC 4XLEA 3VR6A 2BOLA 4XL9A 3AFHA 2L7KA 2GOXB 2XDVA 2XF6A 1G59A 2CMPA 3FHNA 2M3AA 2IS4A 4U4BA 2NT6A 1ERDA 1VZ0A 3HPHA 4C2UA 1OR7C 2M4GA 5LD2C 1N75A 3M1CA 3BCBA 3CP8A 1IRXA 4D9JA 1E0EA 4XQFA 4F91B 2KRCA 2L5QA 1H8EA 2VQHA 3H35A 3OYKA 3A3GA 3T53B 2WB1A 3GQ7A 1QJVA 3OYFA 3VYSB 3HPGA 1R6RA 2Z1DA 2CW7A 4LIUA 3J7AY 3CF2A 2KLOA 1UD2A 2ZTNA 2IGKA 3DTEA 2VJJA 1IB4A 4CUGA 1WP6A 1HZEA 3EPZA 1X1BA 4C30A 4CCMA 3EUKL 2BVLA 1W0KA 1WTHD 2PJRA 1YX5A 1QHGA 3D5LA 1KZLA 3FDYA 1X4PA 1DP3A 1KTWA 3K70D 1UD8A 4PFOA 2KDOA 5JHFA 2ZSHB 3VYTB 4N4OB 3OS1A 3K70C 3L2UA 4C9YA 2V7QA 1EE6A 2DCEA 4QPOA 1PXZA 3F9KA 3GRHA 3OYMA 2L2OA 2IGMA 3VSVA 3OYGA 1DGRM 2NTQA 4ASUA 1BR4A 2O5RA 3BG7A 2Y0SA 3OYEA 2E5ZA 1N77A 1COWA 1P9QC 4XORA 3VWBA 2HVSA 1BOBA 2ZSIB 4II2A 1OGMX 2RQQA 4OAYA 3MKWB 4U49A 3NWTA 3NE5B 3GBGA 2D3LA 1TT0A 3LSMA 2R7RA 2WJVA 2KQRA 1OB0A 3A1YA 4HIZA 3T51B 2F6CA 2UWMA 3ZCOA 2UUZA 2IQ7A 2JDIA 3D5SC 3T56B 2VXDA 2VJ4A 1E79A 4XM3A 4JMQA 1O88A 3OR1C 4ZYAA 4DJAA 1O8KA 4NNJA 3I9V2 4IKFA 1MNDA 2PJRB 3PL8A 2XZPA 5DN6A 4BE1A 5CQGA 1PJRA 4XMYA 3QOEA 3W2AA 4XLAA 3H9QA 2X8KA 3VSUA 3LSIA 3AKZA 3OYCA 4XNFA 3CP2A 3RTRA 3LL7A 3HOTA 3JURA 4YZQA 2K9MA 3OYDA 1QU3A 3OEHA 4HEA2 1LDKB 3L2VA 2CK3A 4HSTA 2F1MA 2NSPA 4RM3A 2QKLB 4J01A 4E4HA 2JA2A 4BUPA 3L2QA 2Z2SB 1D0YA 4XR6A 3W3CA 3I3LA 2KP6A 1GQ8A 3EUHC 3WQZA 1NRKA 4HNTA 3T9GA 4E7JA 1D1AA 4HPQA 3UW0A 4XLHA 2Q1ZB 4B48A 4XKVA 4F55A 3K4CA 4W8QA 3VDXA 2JVHA 1KCDA 2V4JC 2ZXIA 3BG6A 4LG3A 1JI8A 4GRIA 4PFPA 4E0FA 2VBKA 1UELB 3SZGA 4BXFA 4DK0A 1LKXA 3K10A 4YZXA 1LFPA 2VXZA 4XKBA 1E3ZA 2HZDA 2DJIA 4OAZA 4GQNA 3FPPA 1V5EA 1FX0A 3H94A 2W1OA 3OYBA 3BLYA 4KKTA 4LITA 2QE7A 3M8JA 1D0ZA 1OFMA 2GJKA 1RMGA 4KKUA 1X4OA 4FASD 2BSPA 3HG9A 3UR3C 1BLIA 2NTBA 1BHEA 4CCJA 2HVRA 4KKSA 4Z06A 1MMNA 3BCFA 1UAAA 4U7BA 4N4NB 2VQLA 3AL0C 3FBIB 3UNGC 3HKZA 3QYFA 4MR0A 2HU9A 2XF5A 3HXLA 1RWRA 4IX7A 4CSWA 4XN0A 4NC7A 2DT7B 3EUAA 2WAFA 2WJYA 2W00A 4ZDLA 3MKZA 2M7BA 2RNGA 2JJ2A 4AVZA 2PMZA 2LG4A 4HWVA 3VYRB 2O0VA 1Z21A 2IGNA 3DTIA 4BJTA 4IZZA 2V7FA 2I8DA 2INVA 2O1DA 3HOSA 1BR1A 2GK6A 2PECA 3WWGA 3DKXA 4CH7A 2M0MA 3LSHA 5HOOA 2X6WA 1HG8A 3IAM2 2XC7A 1SAUA 3S93A 3PNVA 3HL2A 4P22A 1O8MA 4DOZA 2VB6A 4YZAA 2FUG2 2CH0A 4IQ4A 2CUZA 2DIEA 4JQFA 3BCDA 2XZOA 2VJ5A 1XG2A 2XSJC 2DXIA 3ZR8X 1V5FA 3OW7A 4CCKA 2VLAA 4R79A 1VLYA 2X53S 1MW7A 3OWTA 1HVXA 4NUBA 3S3OA 1W0JA 3K6GA 5AMVA 3ZPPA 2KPMA 1Y6IA 1H80A 4I84A 2MFZA 1G8XA 2JJ1A 1O8LA 3OOCA 1WJCA 2F4IA 2M4KA 5KNLA 2W82A 3GQAA 3EQOA 3OL4A 2QXZA 2OV7A 2VJIA 3SEQA 2VBEA 3DPTA 2V26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XM3 A;  4XOP A;  2O04 A;  1O88 A;  2X85 A;  2O17 A;  1O8G A;  2VBM A;  2INU A;  5C1C A;  5C1E A;  1K5C A;  4XMY A;  4Z05 A;  4XLA A;  3VSU A;  4YEJ A;  3ZSC A;  1IDK A;  4XNF A;  3JUR A;  4YZQ A;  2NT9 A;  1NHC A;  3GQ9 A;  2QX3 A;  1OOC A;  1WMR A;  2NSP A;  2X6Y A;  4OJ6 A;  1O8D A;  1X0C A;  4XR6 A;  3SUC A;  1IA5 A;  1GQ8 A;  4OJP A;  4YZ0 A;  1JTA A;  1PLU A;  3T9G A;  4MXN A;  3UW0 A;  4EW9 A;  4XLH A;  2PYH A;  1JRG A;  4XKV A;  4NK8 A;  4OJO A;  4W8Q A;  1KCD A;  1IDJ A;  2X6X A;  2EWE A;  2VBK A;  3VST A;  3VMV A;  1O8E A;  1OGO X;  1QCX A;  2ODL A;  4XLC A;  1O8F A;  4YZX A;  4XOT A;  1DBG A;  1O8I A;  4XLE A;  1O8K A;  4XL9 A;  1OFM A;  3B4N A;  1RMG A;  3VMW A;  2O0W A;  2BSP A;  2Z8G A;  2NTB A;  1BHE A;  3KRG A;  1DBO A;  4U4B A;  2NT6 A;  4Z03 A;  4Z06 A;  1OFL A;  1PE9 A;  1O8J A;  3LMW A;  4MR0 A;  4URR A;  2NZM A;  1RWR A;  4XON A;  4XN0 A;  4XKW A;  4XQF A;  3GQ7 A;  3B8Y A;  1QJV A;  4AVZ A;  1BN8 A;  2PYG A;  4HWV A;  1RU4 A;  2VJJ A;  2O0V A;  2INV A;  4OZZ A;  2O1D A;  2QY1 A;  3B90 A;  2X3H A;  1AIR A;  1IB4 A;  2PEC A;  3WWG A;  4NK6 A;  1KTW A;  4PMH A;  1KCC A;  2X6W A;  1HG8 A;  4W8S A;  1O8M A;  2UVE A;  2UVF A;  2NST A;  1EE6 A;  4YZA A;  1PXZ A;  3GRH A;  3VSV A;  4YEL A;  2NTQ A;  1XG2 A;  4W8R A;  4OJL A;  1VBL A;  4XLF A;  4OJ5 A;  3EQN A;  4XOR A;  4XN3 A;  1OGM X;  5AMV A;  3ZPP A;  1H80 A;  4U49 A;  4I84 A;  4W8T A;  1O8L A;  3FY3 A;  2NTP A;  3GQ8 A;  4OZY A;  1CZF A;  3GQA A;  3EQO A;  2QXZ A;  2VJI A;  2VBE A;  4C2L A;  2IQ7 A;  1O8H A; 
#chains in the Genus database with same CATH topology
 2QZ8 A;  3K1N A;  3QYB A;  3MAJ A;  3LO8 A;  1QA2 A;  3IH4 A;  3A35 A;  2GAU A;  2CYY A;  3ABM H;  4RB0 A;  1BI0 A;  1X19 A;  5CLS A;  4N0B A;  3U21 A;  4OMY A;  9ANT A;  1TYX A;  1S5L C;  3WG7 H;  1K5C A;  4Z05 A;  1YFH A;  1IHM A;  2VBS A;  3FXU A;  1Q1H A;  4Y9R A;  5TGT A;  3WHB A;  1KK0 A;  4FCY A;  1QRY A;  5DEQ A;  1LB2 A;  2IXS A;  5E20 A;  5EGO A;  4OU0 A;  1VQN I;  5J6X A;  2NT9 A;  4PJL A;  2BY3 A;  3DQV C;  3RCO A;  2M45 A;  5KW9 A;  4WZE A;  2L9S A;  3HTS B;  3U2Q A;  1IA5 A;  1D1C A;  2HS5 A;  5HLT A;  5DCM B;  2XPU A;  4BEH A;  3WGI A;  4U88 A;  1TYU A;  2QGG A;  2RC6 A;  1KON A;  4A3J J;  3BWG A;  1XS9 A;  4MYT A;  1HQC A;  4EJV A;  4FTH A;  2Z9O A;  2K86 A;  3WYA A;  4I0B A;  3CB4 A;  2XZL A;  1X1C A;  5FO5 A;  4DQL A;  5DD8 A;  1LQ1 A;  1VI0 A;  2DA7 A;  3AL0 B;  3QP6 A;  1I6H J;  3S3M A;  1AU7 A;  2DYS H;  1HLV A;  1DDN A;  1Z77 A;  2DW4 A;  2L3D A;  1R4N B;  3ASO H;  3OS2 A;  2MC3 A;  3KE2 A;  3SFZ A;  2NXN B;  4CYD A;  2XF7 A;  4P5O A;  2OCE A;  1KK3 A;  3SJP A;  1FNC A;  2CQK A;  2Z16 A;  2M2E A;  1A35 A;  3RYP A;  3LAP A;  1KU2 A;  2IAI A;  2GA2 A;  1W5C C;  3S14 J;  3IWZ A;  2V1N A;  3EYY A;  1VQ6 I;  1KK1 A;  5IT3 A;  1I18 A;  2OUM A;  3I0T A;  4RDJ A;  5FFX A;  5FLV A;  2JA7 J;  1WPC A;  1D1B A;  3KEO A;  1AA7 A;  1O57 A;  1ZRE A;  5J1U A;  1LUJ B;  5IYD J;  2R7Q A;  2VKD A;  2W4S A;  4U7D A;  3ABT A;  3SDG A;  2X4H A;  3AAF A;  4IEJ A;  1GXQ A;  1HDP A;  3H5R A;  3QFR A;  1OB2 A;  2ZCW A;  3R61 A;  1FC3 A;  2GXB A;  1KMH A;  2UVE A;  1WI3 A;  3W6V A;  2ZXH A;  2NST A;  1KQ0 A;  1N0U A;  2XNC A;  4PJM A;  5EF6 A;  2E1R A;  1PVE A;  3OJX A;  4M6V A;  1AOY A;  2WV1 A;  1V4R A;  3B02 A;  2Y0S N;  4KIT B;  1HA3 A;  2XEX A;  3ONY A;  2VFP A;  5DM7 F;  1ITY A;  3PNT A;  4Y3O A;  5DS9 A;  2QMU A;  2QEX I;  2ZNZ A;  3HUG A;  4KIC A;  4ON0 A;  1USS A;  1EA0 A;  1KU7 A;  2QF7 A;  3KLN A;  3GSI A;  4ZDP A;  4D1Q A;  5JMC B;  4B44 A;  1VQ5 B;  2Z3Y A;  3RKY A;  3SDB A;  1YIJ I;  3WU1 B;  2XGD A;  3TOA A;  3CC7 I;  2PMU A;  3ZQG A;  3W2H A;  2V9K A;  3QQA A;  3K4K A;  4OP7 A;  3S32 A;  1VQO I;  1NB9 A;  2K9L A;  4RPD A;  4L9J A;  5F0C A;  2H27 A;  4L0Y B;  5B1B H;  3GUD A;  4DYC A;  2NVT J;  2R3S A;  2OBR A;  1NJI D;  2O04 A;  3DU1 X;  3E6B A;  2MYS A;  4M3E A;  2JIZ A;  2YWH A;  2FNA A;  3KP6 A;  3BQZ A;  4C3I J;  4F3Q A;  2VBM A;  2DTR A;  2JRM A;  4GXO A;  1G7C A;  2LKX A;  1GAQ A;  4LBV A;  4MO7 A;  2EH3 A;  5KK1 A;  1WZ2 A;  4P96 A;  1QZZ A;  3H3U A;  4YFK F;  1WSV A;  3BC9 A;  2PBI A;  2K9N A;  5LLQ A;  3DBR B;  4MLO A;  1X2N A;  2VKV A;  2P7V B;  4OWR B;  1N25 A;  2R7X A;  1OKR A;  4MHG A;  3PUB A;  4ZDO A;  5DDG A;  1WJB A;  1D8K A;  2IS2 A;  4Y33 A;  4B09 A;  3G6E I;  2DA6 A;  1BX1 A;  1JTA A;  3R4K A;  2P5V A;  2F43 A;  4LGW A;  1O4X A;  3C2G A;  2AXT C;  3F22 A;  1TVC A;  1W87 A;  4JBA A;  2R7D A;  2WAE A;  4N9I A;  3LA7 A;  4G7W A;  1ZH5 A;  1TC3 C;  1IN6 A;  4G12 A;  1D5V A;  2N8G A;  1P4A A;  3AST A;  4XD7 A;  4U87 A;  5HS9 A;  3W2G A;  1U0J A;  2QLZ A;  2XAH A;  4XLC A;  1MMD A;  1K6O A;  1ZN2 A;  1R23 A;  3KP2 A;  5AON A;  5DD4 A;  2LD5 A;  2DOF A;  1JUP A;  1O8I A;  2WPD A;  4UV9 A;  1JGS A;  2ELH A;  1OCP A;  2XTY A;  3G1M A;  3FIS A;  1N06 A;  2BXY A;  2XKP A;  1XX5 A;  4P9U A;  1FJL A;  2CV1 A;  1YOV B;  5B5E C;  3J7A O;  3OYI A;  3H9N A;  3BPV A;  4Y17 A;  4UVC A;  4E7S A;  4ZYD A;  2VPL A;  1DDG A;  3CPX A;  3CCU B;  1QFY A;  2V7T A;  3BTI A;  4AU7 A;  3WGH A;  1JKO C;  3IAS 2;  1AMO A;  2M30 A;  5C3E J;  1H8A C;  5JHU A;  1WGX A;  5J8C A;  4JRA C;  1EP2 B;  5FIU A;  3K4L A;  1QFZ A;  1YJN B;  4ENK A;  3K7A J;  2CV0 A;  2LRD A;  4JYK A;  1DPR A;  4LG0 B;  1IUY A;  1FMV A;  3CCJ I;  4Y13 A;  2VBW A;  2YSR A;  3WTW C;  1RQP A;  1STZ A;  2QY1 A;  2V1D A;  2DY1 A;  4BJ5 C;  4PUS A;  3CXC B;  4C3H J;  1GO2 A;  2ELJ A;  2RV8 A;  2LLK A;  4XRS A;  2A5Y B;  2VOD A;  3TMO A;  3TL4 X;  3SZT A;  4WZL A;  1BPL A;  5EG0 A;  2F2E A;  2HGC A;  2GA1 A;  5F04 A;  4A69 C;  4BGD A;  3CJR B;  5HDG A;  5TY0 A;  1YI2 B;  4OJL A;  2VE8 A;  1SC7 A;  2ZNY A;  1YS7 A;  4L9N A;  4G7O F;  2AQF A;  1W9X A;  1T95 A;  3EQN A;  2KFD A;  1WXR A;  1G7S A;  5B3S H;  1W0T A;  1IN7 A;  4BJ6 C;  2CW8 A;  5CVU A;  4X8I A;  4YAU A;  4XID A;  3CD6 I;  3FMR A;  4RAG A;  2KKO A;  1T98 A;  3SYT A;  1MBJ A;  3DF8 A;  2R9V A;  3FY3 A;  2LH9 A;  2P81 A;  4C2T A;  5DNS A;  2QCO A;  4RM2 A;  1GDT A;  3I54 A;  3S8P A;  3CDL A;  4B47 A;  1HC8 A;  2YX7 A;  4CZZ A;  1VND A;  3HAG A;  2OAZ A;  1VQ7 I;  5BQT A;  2W57 A;  2E1C A;  1O8G A;  1P7I A;  1TUI A;  2XTW A;  2INU A;  5C1C A;  4DIQ A;  3TW7 A;  3VYU B;  5HNH A;  5FD5 A;  4RLQ A;  2L7M P;  4TN1 A;  4P9S A;  5FNZ A;  1BX0 A;  1OLT A;  1SD6 A;  3D5R C;  4OPS A;  4HE6 A;  5K5Q A;  4FIS A;  4QSH A;  4TMZ A;  2GM4 A;  2BVM A;  3MKL A;  2DET A;  3KEY A;  4BAC A;  3GQ9 A;  4FET A;  2EIX A;  1BMF A;  4A3M J;  2VKE A;  3MEX A;  1EP3 B;  3GVK A;  3H0D A;  3JU4 A;  5FL7 A;  3FK7 A;  2M8G X;  3SUC A;  3V7A A;  1S9H A;  5L3F A;  2R6H A;  2DPU A;  1NG7 A;  1J7K A;  4JX6 A;  2E7W A;  3S2W A;  3SHF A;  1FBU A;  2YUH A;  1FMW A;  2XIG A;  1KD1 D;  4OMZ A;  1JRG A;  1VJS A;  4WQM A;  3CPW B;  2J5P A;  4OJO A;  4FHT A;  2R5Z A;  4X7D A;  3JQQ A;  1XE1 A;  1P4W A;  4A3C J;  2QQA A;  3HOY J;  3LQ6 A;  3VST A;  3VSL A;  1XQB A;  2VQG A;  1IZ1 A;  2E1N A;  2YS9 A;  1JA0 A;  1PKV A;  1ACI A;  3ZMS A;  2BX6 A;  3FF5 A;  1OCZ H;  4I01 A;  2R7W A;  1KTV A;  3O8H A;  4XLE A;  1SFO J;  2BOL A;  1I1G A;  1MBE A;  3AFH A;  4P26 A;  2GOX B;  3FHN A;  1YLO A;  2R0Q C;  3MFK A;  1ZM4 A;  2ZBU A;  3LA3 A;  1ETV A;  3X2Q H;  1ERD A;  2KZG A;  1KRH A;  4ETS A;  5LMZ A;  4C2U A;  1OR7 C;  2M4G A;  3CCR I;  5LD2 C;  3M1C A;  3QPH A;  1IRX A;  1ZGJ A;  3R6K A;  4YAL A;  5H5J A;  1MSF C;  1QA1 A;  4XQF A;  4D7M A;  3CTA A;  1Z6R A;  3OYK A;  1B8I A;  2WB1 A;  3VYS B;  2Z1D A;  2CW7 A;  1U9N A;  2GQF A;  5GV7 A;  3CUQ A;  3CF2 A;  2FNP A;  1XDU A;  3JTG A;  2JUC A;  2QTZ A;  5GAD J;  1IB4 A;  1QVG B;  3EPZ A;  1ZLK A;  1VQK I;  3BP8 A;  4BXX J;  1X1B A;  4RGR A;  4C30 A;  3EUK L;  2BVL A;  4HX7 A;  3TKY A;  1Y39 A;  1WTH D;  1QHG A;  2GZW A;  3D5L A;  3U1K A;  2BGI A;  2V6C A;  1KTW A;  4IHT A;  2DQR A;  2FSW A;  1N07 A;  3OS1 A;  5IT9 Z;  2V7Q A;  2DCE A;  1YIT B;  3RPQ A;  5KVR A;  3VSV A;  3S1R J;  3WTT C;  2KJB A;  1R4M B;  2Q6K A;  1QZE A;  4ASU A;  5L3G A;  3BG7 A;  1Y0Y A;  1NTC A;  2CC2 A;  2LK2 A;  1COW A;  3CME B;  1TWG J;  2FX0 A;  2PG4 A;  3VWB A;  2HVS A;  1PUF A;  4UZF A;  1HST A;  2OZU A;  3OV8 A;  3QFT A;  3ROU A;  2Y31 A;  3B78 A;  3SYJ A;  2VNK A;  1RUN A;  1PJ5 A;  1OB5 A;  1LEA A;  3GBG A;  4LBY A;  1E3H A;  3LSM A;  3HDD A;  1K4S A;  2WJV A;  2AHQ A;  1K79 A;  1OB0 A;  1WWX A;  3A1Y A;  1WU8 A;  4I99 C;  1E3O C;  2AO9 A;  2PEX A;  2DA3 A;  2ZO4 A;  4ZCI A;  2JDI A;  2BV3 A;  4K1X A;  5C44 J;  2OQG A;  2JPB A;  4KT5 C;  2HQN A;  1JT0 A;  1BW5 A;  1F43 A;  1FY7 A;  4KUM A;  2VC1 A;  3A01 A;  2VUM J;  2QTL A;  4JMQ A;  3OR1 C;  4EQQ A;  1LDD A;  2ID6 A;  5EYR A;  4Z4Z A;  1MND A;  3RJP A;  5DN6 A;  4I98 B;  4EV0 A;  4IHX A;  3A0H C;  2G9W A;  2BGC A;  4XMY A;  2X8K A;  2RVC A;  3S2H J;  1S4M A;  4WK8 F;  3F0C A;  5HZB A;  4XNF A;  3CP2 A;  3LL7 A;  2K9M A;  3GF2 A;  1E64 A;  2B7E A;  4LLG F;  4IXA A;  4RM3 A;  4IL6 C;  3CCY A;  3A1P A;  1V5V A;  4BUP A;  2Z2S B;  2Z99 A;  3W3C A;  4DQK A;  2G0Y A;  3I3L A;  4RB3 C;  3GTJ J;  3T9G A;  1A31 A;  5KAI C;  3M1E A;  1D1A A;  3CCL I;  2J5O A;  4B48 A;  1EWY A;  2IA2 A;  1FPQ A;  1LE8 A;  1Y1V J;  3VDX A;  1ETY A;  1QZY A;  2ZXI A;  4LG3 A;  2V79 A;  6PAX A;  4E0F A;  1UEL B;  4EMS A;  2B0L A;  1OCC H;  3ASN H;  4YZX A;  1PDN C;  1LFP A;  2VXZ A;  4XKB A;  3JW4 A;  4YIF A;  4O3M A;  1E3Z A;  5HXB A;  4DZJ A;  3JX8 A;  3HOX J;  2DA2 A;  1GXP A;  4GQN A;  3K2A A;  4JK1 X;  1WOP A;  4RGU A;  2W1O A;  3Q9V A;  3OYB A;  3A8J A;  2NV4 A;  3ZMU A;  1YTY A;  5CDF A;  3SEJ A;  1T39 A;  1RMG A;  2RKH A;  3RY8 A;  2F5C A;  4FAS D;  2D1H A;  4UZE A;  2DQL A;  4WXH A;  4ZZD A;  2F1L A;  2XRL A;  2HVR A;  2HZT A;  3TH0 A;  2YR2 A;  1XSV A;  4U7B A;  3AL0 C;  4MR0 A;  2FD5 A;  2VE9 A;  2XF5 A;  2QSG X;  2DT7 B;  1MH3 A;  3EUA A;  1JNY A;  1ZM9 A;  3F6V A;  2EZH A;  4P12 A;  4D5F A;  4ZDL A;  3ZMD A;  4P25 A;  4AVZ A;  1RES A;  2XRO A;  1K78 A;  2VNH A;  2DK5 A;  2XVC A;  1DU6 A;  1Y0N A;  1KYW A;  1Z21 A;  3TDZ C;  1KK2 A;  2INV A;  5FKN A;  1BR1 A;  2ESN A;  4F7Z A;  1HCR A;  2XB5 A;  3N97 A;  1TNT A;  3LSH A;  1K83 J;  4HQE A;  4LFU A;  4MGR A;  5J47 A;  4UB8 C;  4J19 A;  2V1U A;  3JRA A;  2HTS A;  3RKQ A;  1FOK A;  2O61 A;  1J9Z A;  4P22 A;  4ZCM A;  1VQN B;  2E36 A;  2QN6 A;  3G71 B;  1YG2 A;  2FUG 2;  4TMW A;  2PJP A;  1JUS A;  1UHW A;  1CGP A;  1MJB A;  5K7F A;  4PJ0 C;  3TED A;  1EV7 A;  1FYK A;  1QX4 A;  1A5J A;  5CVI A;  3E3V A;  3RZO J;  1IJF A;  1QA3 A;  4CCK A;  2V7V A;  1FRN A;  4I76 A;  3WU2 C;  1QA6 A;  2X53 S;  3LQE A;  4NUB A;  1W0J A;  1ZRD A;  3K6G A;  1V3F A;  3ZPP A;  3ABL H;  2KPM A;  1H80 A;  3MQ0 A;  4I84 A;  3E1Y E;  2B7C A;  1QPM A;  2OTJ I;  1XB2 A;  4EEF G;  1WH5 A;  1FZP B;  2PFB A;  2A6H F;  1FLI A;  3Q5F A;  4X7C A;  1VQL I;  2RC4 A;  4LBW A;  3EQO A;  1BBY A;  1XMK A;  1MJA A;  4A0Z A;  3JR9 A;  4YAW A;  3DPT A;  2V26 A;  4AF7 A;  1ZK8 A;  4L5E A;  2JZY A;  3DLL F;  4BHP A;  3VFZ A;  1KQ9 A;  4HDV A;  2CWE A;  4YIR X;  1K28 D;  4ZGQ B;  4WZK A;  2RN7 A;  2JPC A;  4HF1 A;  1BQE A;  3JCU C;  2X9D A;  5A2Q Z;  4A3L J;  1IO2 A;  2GQQ A;  1S7E A;  2OQR A;  3CMM A;  3F23 A;  4IHW A;  3P5J A;  3AVY A;  3F8B A;  1E43 A;  1EFC A;  1NHC A;  3O8G A;  3D0S A;  5FO1 A;  3RZD J;  4A3K J;  4Y7N J;  5K5O A;  4E7H A;  1OFM A;  1OOC A;  2DAO A;  1VHO A;  3HKZ N;  1VQ8 I;  2XC1 A;  3VPR A;  3U2R A;  4OJP A;  3FK6 A;  5BSY A;  2ICW G;  3M07 A;  1EH8 A;  2DOA A;  3ES9 A;  4E7I A;  2LBF B;  3RSN A;  5EZG A;  1F36 A;  1MAB A;  4AYB A;  3DCF A;  3GW2 A;  2R4G A;  1PP8 F;  2BM0 A;  3VO1 A;  2VFO A;  1TWH J;  1W2B B;  1N08 A;  4Z2Y A;  3DEE A;  3VB2 A;  1VQ9 I;  2ODL A;  4RD1 A;  3MD2 A;  4HE5 A;  3BY2 A;  1DBG A;  2XAF A;  2OBS A;  1TP4 A;  2GIZ A;  4L5J A;  2O0W A;  5K5R A;  2DBB A;  3KYL A;  4OPV A;  1W36 D;  1TSP A;  3OZV A;  2NVX J;  1J09 A;  2Q2E B;  3ZMT A;  4U9U A;  2ME0 A;  2FBI A;  2ZXJ A;  4URR A;  3ZQF A;  1EFT A;  1FP2 A;  3PA2 A;  4DNT B;  4KDP A;  3CC7 B;  3KP4 A;  4HAM A;  4CZC A;  1EFR A;  1YX3 A;  3F21 A;  2KRF A;  4M3F A;  4CA0 A;  4H0E A;  3EYI A;  3MN2 A;  2CQN A;  2TRT A;  2PLY A;  3V76 A;  1OYY A;  3V42 A;  2GJP A;  5IYC J;  1I3Q J;  4B3G A;  2IGO A;  3VEP A;  3ZGK A;  2WC2 A;  3ABK H;  4M1K A;  1XMA A;  1Z67 A;  4HV5 A;  4BY7 J;  1WDT A;  2I1L A;  1SMY F;  1IV6 A;  4EAT A;  1JA1 A;  4CHU A;  1QVT A;  2EPF A;  3DU6 A;  4DYR A;  3I56 I;  1WOR A;  1IN5 A;  1I39 A;  4BQN A;  4YDT A;  2D45 A;  1FTT A;  4BE0 A;  1HSJ A;  3FMQ A;  1D3Y A;  5IYR A;  1O3Q A;  1FP1 D;  4PC6 A;  1IC8 A;  4IQJ A;  2GIV A;  1WRJ A;  2L0K A;  4DW6 A;  3WOD F;  5IT9 K;  3WNC A;  2XSD C;  4OIO F;  2DEU A;  3KX2 A;  3QP5 A;  3E5U A;  5DUK A;  4CIC A;  1FYL A;  3C7J A;  1D0X A;  2E35 A;  2CUF A;  3IV5 A;  4LBZ A;  5D5U B;  1V0F A;  2CBX A;  2X1D A;  2K3P A;  3FX3 A;  1NG6 A;  3H3V K;  3M9A A;  3BTL A;  4RD3 A;  3REO A;  1MJ9 A;  2F4M B;  2EZI A;  3ONU A;  1EZG A;  4W8T A;  5ICE A;  1K7A A;  1RUO A;  3KEW A;  1G6N A;  2JUG A;  3BZK A;  1ZR2 A;  2EBI A;  2V7U A;  3AVT A;  5FKL A;  1E1R A;  4IRH A;  1OCR H;  2QZA A;  2XRN A;  2JRT A;  3R6J A;  2VBV A;  2Y9Z A;  1Y8R B;  2MD0 A;  2O8X A;  4AIK A;  1YW7 A;  1J59 A;  1I1S A;  2LVS A;  3QPS A;  2VL8 A;  3RYR A;  4E7L A;  1TT5 B;  4LK0 F;  4HNV A;  3SQN A;  3GTP J;  3CW2 A;  3G05 A;  4C43 A;  3GZN B;  3DU5 A;  4AC0 A;  1K4T A;  1P92 A;  4X07 A;  4IRG A;  2W6I A;  5FRN A;  3OPO A;  2E2H J;  3BR1 A;  1K8A D;  2R7U A;  1Q82 D;  1JGG A;  1VTN C;  2DYI A;  3BG5 A;  4YG2 F;  4HF2 A;  1SKY B;  2DT6 A;  5CYV A;  1AWC A;  2HOS A;  1ZM2 A;  4AIH A;  3KP3 A;  5FGM A;  3CCJ B;  3ULQ B;  5CPR B;  3ECO A;  4RCY A;  3AK5 A;  5GAE J;  4PC2 A;  2LOO A;  2RDP A;  3JRC A;  2STW A;  4Q7J B;  1LM1 A;  5E79 C;  1PLU A;  2EA4 A;  1TWA J;  4EM1 A;  4M3D A;  3ASQ A;  2PYH A;  2PI0 A;  5FJ8 J;  3CMA B;  5KAF C;  1I7P A;  2KIS A;  1IDJ A;  1WJ5 A;  4EJO A;  3ZP5 A;  4OOX A;  2H8R A;  4L5I A;  4MNU A;  1OGO X;  2F3L A;  3I64 A;  5KHD A;  2V9V A;  3WE3 A;  3HSR A;  2WV0 A;  1Q81 D;  3K9T A;  1B9M A;  1WHU A;  4NBQ A;  4ROX A;  2XGE A;  5CVR A;  1B9N A;  1SFX A;  4II3 A;  5TR9 A;  3CCQ I;  3F8C A;  3E1S A;  4PGG A;  1EA3 A;  2VI6 A;  3CCV B;  1KU9 A;  5TRD A;  4Z03 A;  3V4G A;  1U78 A;  2UZK A;  1PJ6 A;  5JVT A;  4WWV A;  5DYM A;  3T1B A;  4MFD A;  3G2B A;  3FWE A;  5HS8 A;  4LB6 B;  4DNC A;  2WR8 A;  2ECB A;  2HYJ A;  1S7A A;  2MGQ A;  1IUF A;  3OL3 A;  3WBK A;  3BH4 A;  2J7K A;  4XLP F;  3N4M A;  1SD4 A;  4H9G A;  3FKS A;  1BN8 A;  3SQV A;  1VQ7 B;  3LMM A;  4WX9 A;  1O7L A;  2H09 A;  4KMU X;  3RKX A;  3AVW A;  2BY0 A;  2X3H A;  1YJW I;  2W7N A;  4N9H A;  2P8T A;  3OZW A;  4IHS A;  1MD0 A;  4PGH A;  4E7K A;  3NWS A;  1YW8 A;  3HOZ J;  3E7L A;  1G7T A;  3HBL A;  3HB9 A;  4UAJ A;  3DFG A;  5LRS A;  1KCC A;  1WJE A;  2DYR H;  5GTH C;  2UVF A;  1OYI A;  1FSH A;  3CCE I;  1SVO A;  1TTY A;  2FU4 A;  4RCZ A;  4B4C A;  2D2W A;  2HTJ A;  3TBI A;  2QVO A;  3WE2 A;  3LFU A;  4YEL A;  1MNM C;  3LSK A;  1REP C;  4S04 A;  1GUU A;  4OIN F;  3ZMZ A;  1UZC A;  4XLF A;  1OGI A;  2Q6L A;  1HF0 A;  2BY1 A;  4KT6 A;  4TMT A;  2DMT A;  1VBL A;  4NC8 A;  1SMT A;  1OHH A;  3ESW B;  4ZTJ A;  2Y48 A;  1R7J A;  4G6I A;  4UUT A;  3CJQ B;  2UV1 A;  2BM1 A;  2A6T A;  4LD5 A;  1XB4 A;  3TW6 A;  2VBT A;  3TO6 A;  4MEY F;  5BOX A;  1S72 I;  2BBY A;  2Q6I A;  2EZK A;  3Q38 A;  5E17 F;  2AS5 F;  1CZF A;  2EV5 A;  2XPW A;  4DBQ A;  2JSC A;  2FML A;  5LGN A;  2YPR A;  3Q39 A;  3U9G A;  3S1Q J;  3GVJ A;  2V31 A;  4C2L A;  1O7F A;  4U0V A;  4Y7C A;  2Z5U A;  1O8H A;  4XOP A;  2RQP A;  3AVU A;  3JRE A;  4RLZ A;  1Y56 A;  2VT2 A;  1BN5 A;  2HEO A;  1TW3 A;  2D3N A;  1VQ4 I;  1VQM B;  1RI7 A;  3I5U A;  2RRE A;  1GR1 A;  3H0G J;  5C1E A;  1RPW A;  4KNY A;  1JHH A;  4KIG A;  3EQL F;  3GQB A;  1IDK A;  1ON1 A;  1W7P D;  3FM3 A;  3VOD A;  5D5W B;  1X3Z B;  3CO7 C;  3WTX C;  3ISX A;  4QHY A;  1U9O A;  3ASR A;  3S3N A;  5A2Q K;  1G4D A;  2R5Y B;  3U6B A;  1LVK A;  4AM3 A;  2CFO A;  4AIJ A;  2DK8 A;  1QRB A;  4BYY A;  2DA4 A;  4PJJ A;  2LZJ A;  3IH2 A;  4TV7 A;  2K9S A;  1O8D A;  1X0C A;  3OYJ A;  5CVV A;  5DS0 A;  4YZ0 A;  1WQ2 A;  3PQJ A;  5E18 F;  4HYE A;  2B9S A;  1U8R A;  1FOX A;  3KL9 A;  2K02 A;  1VQK B;  5E3O A;  4U0W A;  1GLN A;  4RDL A;  5D5V B;  1XSD A;  3BCA A;  3ZXS A;  1MBG A;  2VZL A;  1TL8 A;  4J0Q A;  4WCG A;  3WBJ A;  3HOV J;  3SZE A;  2MG4 A;  3VMV A;  1O8E A;  1I27 A;  3L2R A;  2QQB A;  3GLL A;  3OYN A;  1R00 A;  1NK2 P;  3F8M A;  3GXO A;  1QFJ A;  2F48 A;  1BIA A;  5GP9 A;  2E1M C;  1JKQ C;  2E2I J;  4Z6Y A;  3O6B B;  3I4M J;  1R5H A;  2XDV A;  2XF6 A;  3R0J A;  5F0H A;  2FBH A;  2HR3 A;  5THX A;  1TYW A;  1IN8 A;  2CMP A;  1ZG3 A;  4A5N A;  5E8I A;  2IS4 A;  1FNN A;  3OP1 A;  2QYU A;  3Q0U A;  3QU6 A;  4U4B A;  2LF7 A;  1YX2 A;  1V54 H;  2B7B A;  1IXC A;  1FBQ A;  3ZZ0 A;  4KIB A;  1N75 A;  2A05 A;  4ZYE A;  3CP8 A;  4D9J A;  1VFC A;  3J7Y J;  1JE8 A;  4CYC B;  2NOG A;  5J40 A;  2JN6 A;  3BJ6 A;  2L5Q A;  5J35 A;  2VQH A;  1MSE C;  3A3G A;  3T53 B;  2ZL5 A;  4XRS G;  3HPG A;  1R6R A;  2V1X A;  2YUS A;  2VON A;  3H92 A;  2KLO A;  3W2I A;  2XGX A;  2ZTN A;  1Z7U A;  3GFM A;  2HDN B;  3MHP A;  2C4T A;  3LST A;  3T56 B;  1GVD A;  3GZ5 A;  1YIO A;  2D9R A;  3K70 D;  5L3B A;  2FVG A;  3VYT B;  2P3M A;  4IF4 A;  3ZQI A;  4QPO A;  1BL0 A;  4M74 A;  2VYQ A;  1PXZ A;  3F9K A;  4MQV A;  1RR7 A;  2L2O A;  2IGM A;  4RAY A;  1MDM B;  2GPJ A;  3CJN A;  3G4S I;  3J81 k;  3MZ8 A;  4X6A J;  3LSR A;  2Y0S A;  5M5X J;  2E5Z A;  3AG3 H;  2BPO A;  1TW2 A;  1P9Q C;  4XOR A;  2C78 A;  2EIL H;  1T6X A;  1TTT A;  1AIP A;  3ZBU A;  1BOB A;  5ED4 A;  1Y0R A;  3RQI A;  2NPF A;  2RQQ A;  4IVN A;  3MKW B;  1S7O A;  1P6R A;  3H09 A;  3NWT A;  3NE5 B;  5LGT A;  1GJR A;  3O2P E;  4HIZ A;  3I71 A;  3OZU A;  2UWM A;  1FRQ A;  3ZCO A;  2UUZ A;  4N3G A;  2RGV A;  1KGS A;  3KZY A;  3TQN A;  1ETW A;  4BQA A;  1FOY A;  4YHB A;  5GV8 A;  4ZYA A;  1HF2 A;  1O8K A;  1SAX A;  1W7P B;  1ZLJ A;  1FND A;  2CQX A;  3I9V 2;  4Z4U A;  2PJR B;  2BY2 A;  5C4J J;  5J3L A;  4RAF A;  4BE1 A;  1PJR A;  4XLA A;  1BIB A;  3AKZ A;  4CXF A;  2EA2 A;  2R93 J;  2WTE A;  3RTR A;  4AUX A;  4QFM A;  4YZQ A;  4HEA 2;  1X3U A;  2ISY A;  2ZJR F;  2CK3 A;  3Q6Q A;  4HST A;  5LHH A;  1DUX C;  3C3W A;  4IHY A;  3FMS A;  1LPQ A;  4CQJ A;  2A3S A;  2QKL B;  4E4H A;  5HS7 A;  2VNI A;  2VFN A;  4PC3 A;  2EV6 A;  2KP6 A;  2QSH X;  1GQ8 A;  3ZBT A;  3P7N A;  1JTX A;  1NRK A;  4HNT A;  3K69 A;  3Q0W A;  3AGP A;  2L9R A;  3B82 A;  5ILV A;  2CFX A;  2CRV A;  5FLX Z;  4I6Z A;  3ZQL A;  1XSX A;  4S05 A;  4F55 A;  1FSE A;  2LTP A;  2NS8 A;  1JI8 A;  4X7F A;  1HBX G;  4QVJ A;  4GRI A;  3CUQ C;  5IPA A;  3TO9 A;  1ZQ3 P;  2L4M A;  3BR5 A;  3ERM A;  2CF4 A;  3ECH A;  2IA0 A;  2DJI A;  1Y8Q B;  1QUE A;  2ZC2 A;  3MMP A;  3BLY A;  5J8F A;  3PSS A;  3M8J A;  2EQR A;  1X4O A;  2ACJ A;  3HG9 A;  1UST A;  4AD9 A;  4EJU A;  1LNW A;  2VBX A;  4XLN F;  3RPU A;  3ERE D;  2CW5 A;  3V8J A;  2LKS A;  2A61 A;  4BAY A;  2OTJ B;  4NCN A;  1K73 D;  1RWR A;  4IX7 A;  2HYF A;  1Y0U A;  4EM2 A;  4XN0 A;  1VQL B;  4NC7 A;  2BM4 A;  2J8I A;  2WAF A;  4FE7 A;  2ISZ A;  1Z6T A;  2NVU B;  2F5D A;  3KP7 A;  5K1Y A;  2M7B A;  2RNG A;  2JJ2 A;  3F6O A;  2Q6O A;  1KU3 A;  1JJ2 B;  1J2X A;  4XRF A;  4HWV A;  3V7R A;  2IGN A;  1M1E B;  2JMW A;  2V7F A;  2GK6 A;  3HYI A;  5HLG A;  2H6B A;  1YJ9 B;  3H3Z A;  2V9P A;  3DKW A;  2L01 A;  1QPI A;  1HW5 A;  2ZKZ A;  3IAM 2;  4Y9U A;  2QSF X;  3VMF A;  3HL2 A;  1SVL A;  3QPL A;  4M4S A;  3B8H A;  2VB6 A;  3LQQ A;  1CF7 A;  5M5Y J;  2DIE A;  1RIO H;  3BCD A;  4OPW A;  2BF4 A;  1R5G A;  1P2F A;  3AG4 H;  2XZO A;  2VJ5 A;  3I53 A;  2XSJ C;  2DXI A;  1XG2 A;  2ZME B;  3ZR8 X;  3ZQC A;  3W6J B;  2OYN A;  3OW7 A;  1XGN A;  2Y0M A;  3L09 A;  2VLA A;  1IG7 A;  1YRN A;  4RD0 A;  4B8X A;  3TDU C;  1YHQ B;  3S3O A;  3E5Q A;  4HLY A;  3CCS B;  3K2Z A;  2D5V A;  4L0Z B;  2EFG A;  5KNL A;  2F4I A;  2M4K A;  1LLZ A;  1BM9 A;  3WTS C;  2W82 A;  3TP0 A;  3R60 A;  1VQ9 B;  2VBZ A;  3I59 A;  1CQX A;  2QXZ A;  2VBE A;  3HZJ A;  2O03 A;  2EJR A;  4GO1 A;  1NDH A;  1MMA A;  2YU3 A;  2OA4 A;  4UNO A;  3FHZ A;  1VQ5 I;  1BI1 A;  5F1R A;  5LBQ A;  1FWZ A;  1Z9C A;  4V02 C;  1T0F C;  2ZB9 A;  1H8H A;  1DGW Y;  2WY7 Q;  4F52 A;  4HV6 A;  3PJR A;  3BTC A;  1ETQ A;  2Q2E A;  3WTY C;  3SKB A;  2EFN A;  3OOU A;  4KIS A;  4P3Y A;  3SLD A;  3P4G A;  3OOP A;  3CZ6 A;  1HKS A;  1E62 A;  3RPU D;  2LY2 A;  1UD4 A;  1KQ5 A;  3RIR A;  2VKH A;  4YC5 A;  1UB9 A;  3DBL B;  2ZL7 A;  3L00 A;  1SFE A;  3DPL C;  5HZA A;  2HI3 A;  2OTL B;  2RAE A;  2VPR A;  2A6E F;  3W2F A;  2KZV A;  2LC2 A;  2HPM A;  1UD5 A;  2IVM A;  5IP7 J;  4UVA A;  4WZT A;  2QKM B;  3JRH A;  3RKW A;  2XOK A;  3I56 B;  4DZP A;  1UHS A;  4G9Y A;  5ILU A;  1MMS A;  4RLF A;  1F5T A;  4P55 A;  4F92 B;  4IRI A;  3U6K A;  3OW2 B;  1A04 A;  2VBU A;  3PO3 J;  2KVO A;  3AGQ A;  2PIA A;  3E0J B;  5HLI A;  3L9F A;  4I0A A;  4XOT A;  3WTU C;  2HPI A;  4FQG A;  1LFU P;  5IK2 A;  3WND A;  1VQP B;  1R49 A;  2W25 A;  3BOQ A;  1Z7L A;  5L3D A;  2NOJ B;  1OCT C;  4OPO A;  4X06 A;  1ZAO A;  3K4M A;  3PQK A;  3GYH X;  2CGP A;  2V4D A;  3OS0 A;  3H9J A;  1XGO A;  4YEI A;  2LYC A;  2CV2 A;  1FYM A;  1N78 A;  1XD7 A;  4RGS A;  2R92 J;  1H85 A;  5IYW A;  2ZZQ A;  5AIQ A;  2P6S A;  4RB1 A;  1S3J A;  3BT9 A;  2W6J A;  4TSF A;  1MH4 A;  1W36 C;  3GO5 A;  4PSW A;  1KC8 D;  2CU7 A;  1HW2 A;  2FOK A;  4IHV A;  3JRF A;  4Z4T A;  2KL4 A;  4XKW A;  4BU2 A;  2NVY J;  2A07 F;  2WSS A;  4WXC A;  4BH9 A;  4E7Z A;  3LWF A;  2P5L C;  4ENM A;  1ETO A;  4UHT A;  1WSU A;  3GFI A;  2WZP P;  1Z0X A;  5HVQ C;  1T0F A;  2OJE D;  3BR0 A;  3IRQ A;  2PYG A;  3E6C C;  3BR2 A;  1ZKG A;  3CCU I;  3GME A;  4QPQ A;  4OZZ A;  1ZTR A;  1AIR A;  2IJL A;  3MZY A;  2R7T A;  4PSX A;  4XKC A;  5CQE A;  2R7V A;  3OEE A;  2XB0 X;  1J5Y A;  3GTG J;  4V2F A;  1ZEL A;  3GLX A;  3NAU A;  1YJN I;  4W8S A;  2LSO A;  4U0Y A;  2Z33 A;  3OY9 A;  4ZV4 A;  4MIM A;  3JQP A;  3CRZ A;  3TGN A;  5HDK A;  1DPU A;  4ANJ A;  3SZP A;  2FOW A;  1QH0 A;  1G7R A;  2HNH A;  1U2R A;  1FIA A;  3VOE A;  2CQQ A;  4YCQ A;  2OZ6 A;  1A6Q A;  1K6Y A;  1BR2 A;  3K4N A;  1J0R A;  1TLL A;  2EFP A;  5BSX A;  1B6A A;  4P9F A;  3A3B A;  4YFO A;  5EG0 B;  4G7Z F;  3JTH A;  4ESB A;  4M3G A;  4ZTF A;  1MIJ A;  2XGC A;  1OPC A;  1CLW A;  1TNS A;  4ZC3 A;  1YI2 I;  2M7A A;  3NAW A;  4NQW B;  3PEN A;  3I4P A;  3WY9 A;  2ZXW H;  4BQQ A;  4ZYG A;  3KZI C;  4EH1 A;  2ZJQ F;  4P1W A;  5JLW A;  1L1I A;  2P5K A;  2K7L A;  1MZB A;  3B73 A;  3BY6 A;  3PSF A;  4YII A;  1W4M A;  2X1C A;  3DXJ F;  5LRR A;  2X48 A;  4BL0 B;  5H2F C;  1S6L A;  2KIU A;  1TQP A;  2Y9Y A;  3H36 A;  1IJW C;  3M3Y J;  1E1Q A;  2H6C A;  4LK1 F;  4YFN F;  5DCM A;  2FBK A;  3U1D A;  3BH7 B;  2MC4 A;  2HXO A;  2XAU A;  1UG0 A;  3DEU A;  3JRI A;  3GWZ A;  4MFE A;  3W2W A;  3GX4 X;  1X2M A;  2V5I A;  4HNU A;  3DBH B;  5GPA A;  1PUE E;  1CNF A;  4OJ6 A;  2GXG A;  2OC6 A;  2QA4 I;  4KN7 X;  5EMN A;  2WA0 A;  3O3K A;  1T6Z A;  1R1T A;  1QQI A;  1GVH A;  4AF6 A;  3RQ4 A;  2Y2Z A;  2E60 A;  3FKJ A;  3WHC A;  2YWE A;  4BQO A;  2CO5 A;  1SVM A;  4ESJ A;  2BN4 A;  3IUO A;  4DYQ A;  2X6X A;  3BDD A;  1F1Z A;  5FLX K;  2EIM H;  1B4A A;  1JKP C;  5HKK A;  1N05 A;  2LF8 A;  2VOP A;  4BHC A;  3ABU A;  3HGG A;  3BNW A;  4WWC A;  1Q7Y D;  2XND A;  2FF4 A;  1O8F A;  3J7Z I;  1FT9 A;  4LB5 A;  2OD5 A;  3HC7 A;  3CDH A;  2O6W A;  2F4O B;  5IYN A;  2A68 F;  2ZZG A;  1VQ6 B;  4DNR B;  2Z8G A;  1ZR4 A;  3G73 A;  2V7W A;  4CCL A;  4LJZ F;  3ZIA A;  5H6Q A;  2BW3 B;  4H4K C;  5EEG A;  1OFL A;  1PE9 A;  5FD6 A;  4RGX A;  1PJ7 A;  4OOS A;  1S72 B;  2JSP A;  3LMW A;  4KFC A;  3K4B A;  2L9N A;  2QQ9 A;  1FIP A;  3K4J A;  1T08 B;  4LLL A;  4YXW A;  2BM6 A;  5BNG A;  3OYH A;  1IV8 A;  1E63 A;  2IBD A;  3JAM Z;  3CLQ A;  3B8Y A;  2PMZ N;  1SFK A;  4M73 A;  5DV5 A;  4ACB A;  2E1B A;  4HRI A;  1QGY A;  3QSY A;  2YX4 A;  1X3W B;  2XT4 A;  1R36 A;  3MMY B;  4EJT A;  3S15 J;  1I8D A;  2KRH A;  3NRV A;  4UY8 I;  1WJD A;  4BS9 A;  1OIS A;  4ZJZ A;  1D5Y A;  1JB9 A;  1BI2 A;  4LMY A;  1AKH B;  4L8J A;  4ABZ A;  1P4X A;  5LHG A;  5FRM A;  4HG2 A;  3BH6 B;  4JX5 A;  2QEX B;  5TJJ A;  4NK6 A;  3HOW J;  3SEZ A;  3KEQ A;  2EIJ H;  5FRO A;  1WPK A;  3OSF A;  5A88 A;  2GRE A;  3IKV A;  5H6R A;  4QUZ A;  3BC8 A;  4X7E A;  1FBS A;  2PMH A;  1DU0 A;  2Q0O A;  4CCN A;  4K2E A;  3S17 J;  1IRZ A;  3ML6 A;  2NNN A;  1T8I A;  2R5Y A;  3LNN A;  1EH7 A;  1YIJ B;  2JWT A;  2QEN A;  2VQC A;  1RR8 C;  3F8N A;  4JX4 A;  3AG1 H;  4W8R A;  4OOI A;  1EXM A;  2RNJ A;  3ZQQ A;  2CS3 A;  3NAR A;  2NRA C;  3A2K A;  4OOV A;  5HNF A;  4B3F X;  1U6G A;  4N3N A;  5F4M A;  1VQO B;  4XN3 A;  4UUV A;  2NS0 A;  1MKM A;  5BPD A;  1JTY A;  5GAG J;  2GJR A;  4G1B A;  4X0C A;  1Z05 A;  3A03 A;  4QWQ A;  4ASN A;  5C4X J;  1YIT I;  1GV2 A;  2M5S A;  1WJA A;  5L46 A;  4L9V A;  4LIV A;  1A8P A;  3TOB A;  4OZY A;  4GCV A;  3BTJ A;  2EIK H;  4I02 A;  3CME I;  2GOM A;  2BM7 A;  2DMQ A;  4NBS A;  1GHC A;  1OQY A;  1TBX A;  3OIP A;  2HMA A;  3PIP F;  1NBM A;  2LKP A;  1FX7 A;  4RS8 A;  4Y52 J;  1PYV A;  2NYX A;  2M8E A;  5IOY A;  4X0G A;  3BQY A;  1T33 A;  2EWN A;  3G6E B;  2DOE A;  3DWL E;  3DPU A;  1MBK A;  3OAA A;  2ZJ2 A;  2DI3 A;  3W5V A;  2R7F A;  1A6I A;  1OJL A;  1H42 A;  3J81 Z;  2IP2 A;  4UXN A;  5HOD A;  4IOC F;  3LSP A;  2O8K A;  4IPA A;  2WAQ A;  2FE3 A;  1DQU A;  2E7X A;  1U5T B;  2ZFU A;  3MKY B;  3CO6 C;  5ICC A;  3OJW A;  1I3A A;  2OU2 A;  1WMR A;  3QOD A;  1UFM A;  4G8X A;  3JSO A;  3LNQ A;  2PQ8 A;  3C18 A;  1F9N A;  4G6T B;  2KIM A;  2IS1 A;  1RET A;  3FXR A;  2BGJ A;  3OYL A;  2BEO A;  5AIP A;  3ML3 A;  2QGU A;  3I55 I;  1B2R A;  2WBM A;  1T2K A;  2KIQ A;  1CQT A;  3L2W A;  2BZT A;  2EK5 A;  3LSG A;  4DQ2 A;  4FX4 A;  1QCX A;  4OM9 A;  1NK3 P;  1CNE A;  2HDW A;  4PCQ A;  2B5O A;  3G4S B;  2VFM A;  4G6D A;  1WOO A;  1UMQ A;  3WG9 A;  3IWF A;  1IB0 A;  3VR6 A;  2O3F A;  1O3R A;  2L7K A;  4WF2 A;  3PET A;  1H89 C;  3T5X A;  3EET A;  2DDB A;  2K4B A;  4HA8 A;  1ZG1 A;  4I2O A;  2I10 A;  2NT6 A;  4LG0 A;  2H8W A;  4TMX A;  4RB2 C;  3QFC A;  2FX3 A;  5H20 A;  4GYI A;  3BCB A;  3HEF A;  4G94 A;  1E0E A;  3P9C A;  1H88 C;  3NB2 A;  5M5W J;  3CUO A;  4PDK A;  1H8E A;  5F4O A;  3GFJ A;  3H35 A;  4BBR J;  5EDN A;  2H1K A;  1ORK A;  3OYF A;  5CVJ A;  4MQ9 F;  4LIU A;  3J7A Y;  2R7Z J;  1UD2 A;  1X58 A;  4Z4V A;  2IGK A;  4HOB A;  3DTE A;  3LVB A;  4AWX B;  1QO0 D;  4ZCL A;  3DEW A;  3K0L A;  4AID A;  3SY2 A;  1W7P A;  1W0U A;  4ZGN B;  2DOG A;  4FX0 A;  1UHM A;  5HLH A;  2GXA A;  1YX5 A;  2PJR A;  1W0K A;  1KZL A;  3FDY A;  1TQM A;  2K27 A;  3CC4 I;  3KLO A;  3KZZ A;  4PFO A;  1UD8 A;  4KYW A;  4M53 A;  1M90 D;  2KJC A;  5D6E A;  4HQM A;  2QM3 A;  5TIS C;  4N4O B;  4RD4 A;  3K70 C;  1TLH B;  1R22 A;  5JBQ A;  4C9Y A;  4MTD A;  3GEZ A;  3CD6 B;  2QBY B;  1EE6 A;  1QVU A;  5DCF A;  3GRH A;  3BPX A;  3S2D J;  1ZUN B;  2HOT A;  1RRJ A;  1XTA A;  3JQR A;  1IGN A;  1DGR M;  2DLL A;  5IOZ A;  1D8T A;  2O5R A;  3ZUG A;  5K7Z A;  3OYE A;  1N77 A;  3GTM J;  3LYC A;  3ZMV A;  1XDS A;  2HOE A;  4M71 A;  4G7H F;  3M4O J;  2CQ7 A;  2KT0 A;  2ZSI B;  1OGM X;  1XG1 A;  4OAY A;  4Q5S F;  3CC2 I;  3G71 I;  2L7Z A;  1B72 B;  3WTZ A;  1TWF J;  2XAS A;  2ZME C;  2D3L A;  2JQ7 A;  1SFU A;  4PGO A;  1XCB A;  5EEA A;  5B66 C;  3J80 Z;  1XPX A;  2TDX A;  4GGG A;  4W1U A;  2JTV A;  4LLN A;  5JI6 A;  3A8I A;  1BC7 C;  5M3F J;  2IQ7 A;  1IW7 F;  3RIQ A;  3D5S C;  4RJL A;  2VJ4 A;  1POG A;  5DUI A;  4GFB A;  4XM3 A;  4RD2 A;  3LA2 A;  3DP7 A;  4YFX F;  1QVF B;  4P3I A;  1O88 A;  1DG1 G;  4DJA A;  1L3L A;  4IKF A;  3PL8 A;  1X1P A;  2XZP A;  1IRG A;  3WNB A;  3W2A A;  1IRF A;  2VBY A;  3H9Q A;  3OYC A;  3FXO A;  2O6G E;  1H9G A;  1ZGA A;  1D2E A;  3JUR A;  3F3X A;  4V2G A;  3OYD A;  1DP7 P;  1P4M A;  3ZZU A;  1LDK B;  3L2V A;  2DPD A;  3MZH A;  1XC5 A;  2F1M A;  1LLW A;  4WXD A;  4J01 A;  2K3F A;  5EEH A;  1WSR A;  2JA2 A;  3L2Q A;  2VOO A;  2BHY A;  4M3B A;  2GWR A;  1ZGW A;  2X6O A;  1W1W E;  1HXD A;  3EUH C;  3WQZ A;  1BW6 A;  1I6X A;  3ZQH A;  4UUS B;  2JA8 J;  2BE5 F;  4RAZ A;  4E7J A;  2DMP A;  1RQR A;  3A0B C;  3UW0 A;  3B6A A;  5B6I A;  3HIF A;  4KIF A;  4XKV A;  1F60 A;  1SKQ A;  4W8Q A;  1KCD A;  4Z4W A;  5TV2 A;  2V4J C;  1GVJ A;  2WWY A;  1QGZ A;  4PAA A;  1KJZ A;  2VBK A;  3SZG A;  4BXF A;  4FWT A;  4DK0 A;  3K10 A;  3CCR B;  4KH3 A;  3P26 A;  3AVX A;  1P7J A;  3KYC B;  1R5I D;  2ETH A;  4OAZ A;  5D8K B;  4JP0 A;  3FPP A;  3B4N A;  4KKT A;  2LY9 A;  2ZME A;  4B4D A;  1FDR A;  2BSP A;  3FXL A;  3R0A A;  3OKX A;  4KKU A;  1MRZ A;  3UR3 C;  3V8K A;  3NQO A;  1BLI A;  4PC7 A;  4Z06 A;  1MMN A;  3BCF A;  4A12 A;  4CGZ A;  2P6T A;  2GBY A;  2Y69 H;  3QYF A;  2PE3 A;  1R1V A;  2TCT A;  2HU9 A;  3HXL A;  4HLX A;  3E20 A;  3FM5 A;  5J1R A;  4CSW A;  1N0V C;  2IOU G;  3GCM A;  5L3C A;  2QWW A;  2WJY A;  1B1B A;  5DM6 F;  3IKT A;  2XAJ A;  3LOC A;  4IW3 B;  3I1F A;  3PSZ A;  2EFQ A;  2WZN A;  3GFL A;  3JAM K;  2OBT A;  4PC1 A;  4RPB A;  2V7X A;  4A0Y A;  3DTI A;  4BJT A;  4IZZ A;  4P6Y A;  2FQ3 A;  2I8D A;  3HOS A;  3P9K A;  1W35 A;  1B23 P;  5F0F A;  2PEC A;  1WVR A;  3WWG A;  3ISP A;  3QFS A;  2BXZ A;  3E6M A;  2X6W A;  2HQR A;  2XC7 A;  3S93 A;  3Q9S A;  3W5U A;  1O8M A;  1OYW A;  2IPQ X;  4DOZ A;  3CCM I;  1IDZ A;  4YZA A;  1DAR A;  3RI4 A;  2BSA A;  4IQ4 A;  3EUH A;  2CUZ A;  1F4K A;  5JLX A;  3HHH A;  2L7F P;  1AHD P;  3VO2 A;  2FQ4 A;  3QAH A;  4EGY A;  1JJ8 C;  2DMN A;  2HYG D;  2XAG A;  2EB7 A;  3GIR A;  1TYV A;  3HSF A;  3ELK A;  1WH7 A;  3OWT A;  3JRD A;  4KMF A;  3W2E A;  4V19 K;  4R8H A;  1Y6I A;  1OMI A;  1J9I A;  1BA5 A;  3WU0 A;  4QV2 A;  1FNM A;  2JJ1 A;  1BOA A;  2HQ5 A;  1Y1W J;  4BY1 J;  3GTL J;  1O8L A;  3V7S A;  3GQA A;  1Z1D A;  2A69 F;  2ME6 A;  2ZIT A;  4D5C A;  3DV8 A;  2VJI A;  3SEQ A;  4D7N A;  1I50 J;  1NB0 A;  4XRM A;  2DN0 A;  1EKE A;  2C2W A;  4MYU A;  1JJ6 C;  5FKK A;  4MTE A;  1SM4 A;  3LSJ A;  1O3S A;  2X85 A;  3T0Y A;  4ZZL A;  3LQR A;  4HF0 A;  2O17 A;  3HSE A;  4A3B J;  2WYR A;  1T38 A;  4YAF A;  1R71 A;  1JHF A;  1V55 H;  3CJT B;  3IH3 A;  3A8K A;  3PO2 J;  5IP9 J;  4XBF A;  2PLF A;  1WFX A;  2LDU A;  1LEB A;  2ADU A;  3D26 A;  4B43 A;  1E3P A;  3CCL B;  1YW9 A;  1VF7 A;  4W97 A;  3QPT A;  5E1W A;  4RD6 A;  1QHH D;  4ENJ A;  3IC7 A;  1K4Z A;  3C1D A;  3AG2 H;  4A5M A;  4EVI A;  4A6D A;  1RZ4 A;  2L02 A;  2O7O A;  3J81 K;  3PA1 A;  2ZZF A;  3QU3 A;  2O9L A;  2P7C B;  2J8K A;  5BPI A;  2HLD A;  2MSY A;  5E8G A;  2GK7 A;  1HKQ A;  1FEX A;  1EF4 A;  2DFF A;  3GTQ J;  2DOD A;  5FKO A;  3CF5 F;  2MD5 A;  4J00 A;  4TT3 A;  5B1A H;  4G7X A;  2K85 A;  3QWL A;  1QQ1 A;  3IL2 A;  3HRT A;  2KIF A;  3OR2 C;  2P4W A;  4L9T A;  2R7S A;  1D8J A;  1G3S A;  2JK3 A;  3GVL A;  3H1C A;  2WY8 Q;  4Z4R A;  5D8L B;  4BXU A;  1QGP A;  4A3I J;  1MBH A;  1QG0 A;  5J4V A;  4KJZ A;  5D6F A;  3N90 A;  1YS6 A;  4DK1 A;  5EJC A;  3CMA I;  3G1L A;  3H5A A;  4OIQ F;  1ENH A;  2PN6 A;  3FBN B;  1LJ9 A;  3KRG A;  1DBO A;  3SJZ A;  4M6X A;  1N8R D;  4PZJ A;  4Z1M A;  2ESH A;  3Q3A A;  3UKG A;  3HRU A;  1O8J A;  2UXN A;  3HRM A;  5EGO B;  1WJF A;  1SEU A;  4Y15 A;  3BQJ A;  4XON A;  1LVA A;  2V6E A;  2WB1 N;  3GQ7 A;  3RDI A;  5KCM A;  3M8F A;  4NQW A;  1FTZ A;  4GDF A;  3KFW X;  3N05 A;  1OCO H;  4P6V F;  2NVQ J;  2JT1 A;  2P0W A;  3IHU A;  3CCV I;  4BEH B;  4JOM A;  1RNL A;  3C2B A;  1RU4 A;  2BV6 A;  3B90 A;  4A3E J;  1Q86 D;  2L4A A;  2LR8 A;  5D4R A;  2HQA A;  3S1M J;  1UJ8 A;  3PFY A;  4DBR A;  5E3L A;  2HFH A;  4PMH A;  4BHB A;  4QLC U;  1YQA A;  5E1Z B;  1G3Y A;  2G7H A;  2YU9 J;  3H9G A;  2VIX A;  5K7H A;  1MBF A;  2Z6B D;  2BYV E;  4BDZ A;  5DSZ A;  1R1U A;  1SAN A;  1ELO A;  1JXS A;  4OJ5 A;  2K9Q A;  3LFK A;  2QA4 B;  1OGJ A;  1LFB A;  1YE9 A;  2MLK A;  2OK7 A;  3PNY A;  1TQI A;  5J4Y A;  4BE2 A;  3WXM A;  1MMG A;  4Y4R A;  1WOS A;  4HZF A;  1X1A A;  3GZ6 A;  3OSG A;  1KQ8 A;  2A5W A;  3PVD A;  1WCM J;  3BJA A;  2DT5 A;  3EDP A;  1OFC X;  3G1O A;  3T8T A;  4Z4Y A;  3GQ8 A;  5FB2 A;  2ID3 A;  3DTK A;  2MAB A;  4NHJ A;  3OE7 A;  2E1O A;  5JFR A;  4A0X A;  3J80 K;  1T5E A;  1KZH A;  1OFD A;  1RC9 A;  4A3G J;  2F5V A;  3OIQ A;  1W34 A;  4G1V A;  2K4J A;  1IN4 A;  1IDY A;  4O6J A;  4CCO A;  5LEJ A;  2IRF G;  4ACA A;  4EGZ A;  3DKY A;  3CMY A;  2GLO A;  1VQ8 B;  2VAS A;  2BW3 A;  1DAB A;  1T6Y A;  2LRE A;  5F4J A;  3A4C A;  1EP1 B;  4KN4 X;  1HW1 A;  1TZL A;  4A3D J;  4E70 A;  2DA1 A;  4F7D A;  1KQS B;  2KHM A;  2HDD A;  3BZC A;  3HJE A;  2LBF A;  5E1X A;  3OYA A;  2CJJ A;  4EJW A;  2NAZ A;  1VQM I;  2X6Y A;  2DCU A;  4RM0 A;  2C77 A;  4R71 A;  3HUG B;  3ONQ A;  2C4U A;  4QVA A;  4TKO B;  2FJ1 A;  1ZRC A;  2XKO A;  2MBF A;  3CDI A;  2KDZ A;  3P27 A;  3W2V A;  1AKH A;  4MXN A;  2ZTG A;  1U5T C;  2KMU A;  2MH9 A;  4FXU A;  2IS6 A;  1WI9 A;  2D1V A;  4UB6 C;  3VSK A;  4M0L A;  4C0S A;  4NK8 A;  2M5W A;  1HA8 A;  5IYP A;  3ZN1 A;  1LDJ A;  3FXM A;  2FRH A;  2NNY A;  1GT0 C;  4CO8 A;  2M87 A;  2VNJ A;  2EWE A;  2L54 A;  3IRR A;  4HX8 A;  5GAH J;  4O5V A;  2FXA A;  2CUJ A;  2JVG A;  3E6D A;  3ZPL A;  5KSW B;  3IP4 B;  2WAD A;  1RKT A;  4RMN A;  4IO9 F;  5F08 A;  3VMW A;  2HKX A;  3COA C;  1R5O A;  1WKM A;  2OF7 A;  1J75 A;  4BKX A;  3BR3 A;  2FA5 A;  4M2L A;  1VHE A;  4BDY A;  4CDG A;  1G3W A;  3KET A;  1R5B A;  3E5X A;  5FO0 A;  1Q1V A;  2F4N A;  1RKW A;  2LY1 A;  3PUF A;  3OFN A;  5E6T A;  3ZQ7 A;  1QBJ A;  3K1P A;  2NZM A;  2VN2 A;  3BG9 A;  4RA2 A;  1D1N A;  3L7W A;  3BZ6 A;  1V5G A;  2Y75 A;  1JT6 A;  4RDK A;  2BMW A;  5GTI C;  2XTX A;  1Z3Y A;  4A2U A;  1YO5 C;  3ZOB A;  4YAO A;  1H9T A;  1OFE A;  2X51 A;  4XK4 A;  3DLA A;  1BJK A;  4NB5 A;  1ON2 A;  1QUF A;  3QOP A;  4M9S A;  2AHO A;  4TMV A;  2AQE A;  1IXS B;  5DTD A;  2E34 A;  2X0K A;  3D1N I;  2HDC A;  4F93 B;  3GTK J;  3ASP A;  4E6K G;  1EFU A;  3BJO A;  4M9X A;  2G7U A;  4A93 J;  2H94 A;  4PK4 A;  1OR7 A;  2XT2 A;  5J3O A;  2HWV A;  3L2C A;  1BC8 C;  2ZZE A;  5CJ9 A;  3R6S A;  1U5T A;  5FKM A;  3ZRG A;  2XGJ A;  4M6Y A;  2QQ8 A;  2R7O A;  3A02 A;  3FXQ A;  1HKT A;  3CQZ J;  3H5N A;  2DO7 A;  2XPV A;  5FA6 A;  3I55 B;  4X1E A;  1ONV A;  5EZH A;  1K61 A;  1XMX A;  5F6F A;  1DDI A;  1V0E A;  2HCJ B;  2PMD A;  2DFE A;  5A8A A;  2DER A;  2XUB A;  2NTP A;  1QGA A;  3C2H A;  4P1V A;  2K40 A;  5ICG A;  1E2X A;  5CKT A;  3TO7 A;  1JKR C;  3DDY A;  2HOA A;  4EM0 B;  2BHZ A;  1UD3 A;  2MW8 A;  4UV8 A;  3W5H A;  2XHK A;  3G3Z A;  5LGU A;  3S1N J;  3HGY A;  2E1M B;  1MGT A;  2DMU A;  1APL C;  3KIO A;  2LNB A;  2LMD A;  4YEJ A;  3ZSC A;  1T6S A;  4ITV A;  5D4S A;  1Z3X A;  1GAW A;  3Q3S A;  1ZAR A;  2DJN A;  5L3E A;  2ZL6 A;  1UD6 A;  4Q47 A;  1E3X A;  5F64 A;  2QX3 A;  4G5G A;  4QTR A;  1U8B A;  5BMZ A;  1BJA A;  4B1R A;  1X1D A;  3WGG A;  2X1E A;  4YRV A;  4Q4Z F;  1VLO A;  3FKI J;  4UVB A;  3VNV A;  1T56 A;  2DA5 A;  2HVQ A;  3MVP A;  2K5C A;  3BY1 A;  4PAB A;  3F8F A;  4UZU A;  3OMY A;  2ELK A;  4PJN A;  4AYB N;  2O0Y A;  3ZPN A;  4EW9 A;  1C0W A;  2E5N A;  5LFA A;  1MNE A;  3CES A;  2M1B A;  3CCQ B;  3CC4 B;  4C2M J;  2CUE A;  2EFW A;  2EZL A;  1YLF A;  4IJA A;  3K1M A;  3PUN A;  4HSR A;  5A89 A;  4FE4 A;  5E3M A;  3QYE A;  3PIO F;  4KA4 A;  3HM5 A;  3PSI A;  4DGW B;  2QBY A;  1M1K D;  4B3X A;  2B0R A;  1R58 A;  2UXX A;  5D5X B;  4I7H A;  1Q9S A;  4P2N A;  4XL9 A;  3QE2 A;  4HDU A;  1G59 A;  2IW5 A;  1GV5 A;  2OBP A;  1FOW A;  2H1L A;  3QRF F;  3AVV A;  1IXR C;  2M3A A;  2COM A;  3LAJ A;  3CC2 B;  2DDA A;  1O3T A;  4A3F J;  4L18 B;  3VNU A;  1VZ0 A;  3SJM A;  3HPH A;  4ZH4 F;  4FN5 A;  1YJW B;  2NS7 A;  1B72 A;  2EFO A;  4NC6 A;  1G2H A;  1VF9 A;  3MCA A;  1KA8 A;  5F27 A;  4HX4 A;  4F91 B;  2KRC A;  2W85 A;  4BNC A;  1YYV A;  3ZZT A;  4FK8 A;  1QJV A;  2I5U A;  3KP5 A;  5HDN A;  3CCE B;  2X3U A;  1K9M D;  4GYG A;  4XSX F;  2EIN H;  4ESF A;  4C3J J;  2VJJ A;  2ZBV A;  2X0L A;  4CUG A;  1E17 A;  1WP6 A;  1HZE A;  2QUF A;  2M0C A;  2OPT A;  4CCM A;  4ENN A;  4X05 A;  3PFI A;  3V7C A;  2R5Z B;  1ZG5 A;  1X4P A;  1DP3 A;  2IT0 A;  1ZYR F;  3JRB A;  1U2W A;  2KDO A;  5JHF A;  2ZSH B;  3L2U A;  3FIW A;  2VT3 A;  3OYM A;  2M9H A;  2ECC A;  3OYG A;  1XGM A;  4AC9 A;  2NTQ A;  3PUM A;  5AN9 A;  2E71 A;  1BR4 A;  2PX9 A;  2VFQ A;  5IY5 H;  1IAW A;  1YJ9 I;  3BRO A;  1Z91 A;  1UCR A;  3Q0V A;  1XN7 A;  3CLO A;  3TP3 A;  3JSP A;  1QNT A;  3FXK A;  4II2 A;  2CND A;  3ASS A;  2WAQ N;  1CF7 B;  4U49 A;  4UUS A;  3NEU A;  1S8N A;  3HRS A;  3L1P A;  3JRG A;  4LC0 A;  1VQ4 B;  1BI3 A;  1TT0 A;  2MLG A;  5JR3 A;  2R7R A;  2KQR A;  2YWG A;  3T51 B;  2HKO A;  2F6C A;  4RBO A;  1B8I B;  2M34 A;  1EJ9 A;  1YRN B;  4QIW N;  5H59 A;  5IYB J;  3CUQ B;  1HOM A;  1YHQ I;  2VXD A;  1E79 A;  2C5H A;  5LEK A;  4R1H A;  3KYD B;  4FT8 A;  4NNJ A;  2CG4 A;  4ZYH A;  3FJO A;  1PP7 U;  3CCS I;  5CQG A;  3QOE A;  2MA3 A;  3I59 B;  3VSU A;  3LSI A;  4D0P A;  3M8E A;  2D74 A;  2F5E A;  3HOT A;  1ZRF A;  2AXL A;  2YWF A;  2OK8 A;  1QU3 A;  3OEH A;  2DU9 A;  1B59 A;  2DFH A;  1W5T A;  1L0O C;  1W5S A;  3FZV A;  3PM1 A;  1ETX A;  1NHA A;  1H0M A;  2G0E A;  4B3A A;  5LHI A;  2STT A;  2NSP A;  4OIR F;  2CW0 F;  3M7G A;  2F5F A;  1D0Y A;  2FMY A;  3HHG A;  4XR6 A;  5IP6 A;  4OIP F;  1PUF B;  2JA5 J;  1ZHF A;  1SD7 A;  3F72 A;  3MCZ A;  2JA6 J;  1FNB A;  2CRG A;  2Y30 A;  1S0U A;  4Z4S A;  3HTU A;  4HPQ A;  2BVN A;  3MWM A;  4XLH A;  4AVP A;  2Q1Z B;  1ULY A;  3V8L A;  3BG3 A;  3K4C A;  3T8R A;  2JVH A;  5ICF A;  3N6Z A;  3BG6 A;  1XCV A;  4PFP A;  3CCM B;  2OTL I;  3P9I A;  5JLV C;  4XSZ F;  1LKX A;  2ZBK A;  3KPH A;  1UMK A;  4M9Z A;  4NDL A;  2HZD A;  1A36 A;  3A01 B;  1R5N A;  4LOC A;  1V5E A;  3S16 J;  3B6C A;  5FFZ A;  4CYC A;  1FX0 A;  5GPC A;  3H94 A;  4LIT A;  3W6K B;  2QE7 A;  1D0Z A;  3LJY A;  2GJK A;  5ERI A;  3SLN A;  1JUM A;  2NTB A;  1BHE A;  1IJE A;  4CCJ A;  2ZFW A;  3GTO J;  4KKS A;  2W84 A;  4XIC A;  1HDD C;  5ILS A;  1I5Z A;  1UAA A;  2IA1 A;  2VQL A;  4N4N B;  3FBI B;  3UNG C;  3HKZ A;  3ZN0 A;  1K8F A;  1VQP I;  3I58 A;  1S29 A;  3BR6 A;  5M3M J;  3SXY A;  2C6Y A;  2C5B A;  1EH6 A;  1UG2 A;  2EV0 A;  4BBS J;  2CSO A;  2W00 A;  1U3E M;  1ODD A;  3MKZ A;  2BM5 A;  2E19 A;  4I09 A;  5BS6 A;  5J1Y A;  4M72 A;  2PMZ A;  2LG4 A;  2ZJP F;  4RDU A;  3VYR B;  4Q48 A;  2O0V A;  1NH3 A;  2E2J J;  3I4N J;  1ETK A;  2O1D A;  1MDM A;  2MH2 A;  5JVG F;  2B63 J;  3DKX A;  4G6Q A;  1LE8 B;  4CH7 A;  2M0M A;  1IF1 A;  5HOO A;  1HG8 A;  2XNJ A;  1ZM3 A;  1SAU A;  3KCC A;  3PNV A;  1BJZ A;  1XFO A;  4S0H B;  2W48 A;  1TWC J;  2W24 A;  1SD5 A;  2CH0 A;  1F20 A;  2HXI A;  5IYQ A;  4JQF A;  2XV4 S;  3FPK A;  2DTZ A;  4HBL A;  1V5F A;  2VC0 A;  2JJ7 A;  2W7Z A;  3OIO A;  2DFI A;  4R79 A;  5F1J A;  2LFB A;  3WTV C;  1MW7 A;  2LP0 A;  1R9T J;  1HVX A;  1VLY A;  3SFI A;  3FXJ A;  4MEX F;  4IOA F;  5AMV A;  2OCC H;  2XAQ A;  1XGS A;  2QDX A;  2MFZ A;  1G8X A;  1G3T A;  2L9V A;  2JN9 A;  1WJC A;  2RC5 A;  3OOC A;  2Q8K A;  3ZC3 A;  5E3N A;  2FEZ A;  3OL4 A;  3HOU J;  3GVA A;  1QRC A;  4BPR A;  3E97 A;  4A6E A;  2OV7 A;  2IEK A;  1K78 B;  4HW0 A;  1KYZ A;  2COB A;  5FLM J;  2QYO A;  3Q6R A; 
#chains in the Genus database with same CATH homology
 1MMA A;  2X85 A;  3QYB A;  1K28 D;  3A35 A;  2O17 A;  1X19 A;  3U21 A;  1K5C A;  4Z05 A;  1T0F C;  1H8H A;  1DGW Y;  2WY7 Q;  5TGT A;  1WFX A;  3CMM A;  4F52 A;  3PJR A;  4KIS A;  3OOU A;  4B43 A;  2IXS A;  1E43 A;  1VF7 A;  2NT9 A;  1NHC A;  3CZ6 A;  4PJL A;  1QHH D;  1UD4 A;  3RPU D;  2LY2 A;  3DQV C;  3RCO A;  4E7H A;  2VKH A;  1OOC A;  3DPL C;  2L9S A;  2ZZF A;  1IA5 A;  1D1C A;  4OJP A;  2KZV A;  2LC2 A;  4BEH A;  5HLT A;  2HPM A;  2HLD A;  1UD5 A;  2GK7 A;  1KON A;  2DOA A;  4E7I A;  2LBF B;  2QKM B;  3RSN A;  2XOK A;  1MAB A;  4AYB A;  2R4G A;  4RLF A;  4F92 B;  4J00 A;  4TT3 A;  4G7X A;  2XZL A;  3DEE A;  3OR2 C;  2R7S A;  2KVO A;  1X1C A;  2ODL A;  3E0J B;  3GVL A;  4XOT A;  2WY8 Q;  2HPI A;  3MD2 A;  5IK2 A;  1Z7L A;  3AL0 B;  2NOJ B;  4KJZ A;  1DBG A;  3S3M A;  3K4M A;  2V4D A;  4DK1 A;  3OS0 A;  3H9J A;  2O0W A;  2LYC A;  3H5A A;  2CV2 A;  3OS2 A;  3FBN B;  1N78 A;  3KYL A;  1W36 D;  2ZZQ A;  3KRG A;  1DBO A;  1J09 A;  2W6J A;  2XF7 A;  2Q2E B;  4TSF A;  4Z1M A;  4P5O A;  1W36 C;  1O8J A;  4PSW A;  4URR A;  1WJF A;  4DNT B;  2Z16 A;  4XON A;  2KL4 A;  4XKW A;  4BU2 A;  1YX3 A;  4CZC A;  2V6E A;  1EFR A;  5KCM A;  4E7Z A;  2WSS A;  4CA0 A;  2V1N A;  1I18 A;  2OUM A;  2WZP P;  3N05 A;  3V42 A;  5HVQ C;  2GJP A;  2PYG A;  2P0W A;  1WPC A;  1D1B A;  4BEH B;  4B3G A;  2IGO A;  1AA7 A;  4JOM A;  3ZGK A;  4QPQ A;  1RU4 A;  4OZZ A;  3B90 A;  2R7Q A;  1AIR A;  2VKD A;  2W4S A;  2R7T A;  4PSX A;  2HQA A;  4XKC A;  5CQE A;  4EAT A;  3PFY A;  4DBR A;  3DU6 A;  2R7V A;  3OEE A;  3H5R A;  4PMH A;  1ZEL A;  4BQN A;  4W8S A;  3OY9 A;  1KMH A;  2UVE A;  2ZXH A;  4BE0 A;  2NST A;  4PJM A;  4ANJ A;  3H9G A;  4IQJ A;  2HNH A;  2VIX A;  4KIT B;  2Z6B D;  3KX2 A;  4BDZ A;  3PNT A;  4OJ5 A;  1K6Y A;  4Y3O A;  1BR2 A;  1D0X A;  3K4N A;  1V0F A;  1YE9 A;  2X1D A;  2K3P A;  3PNY A;  4BE2 A;  1NG6 A;  1MMG A;  3A3B A;  4Y4R A;  1X1A A;  4ZDP A;  4D1Q A;  4W8T A;  2A5W A;  4B44 A;  3SDB A;  3KEW A;  2JUG A;  4ZTF A;  3GQ8 A;  4ZC3 A;  2V9K A;  2M7A A;  4NQW B;  3DTK A;  2MAB A;  3K4K A;  3OE7 A;  1E1R A;  3S32 A;  2K9L A;  1T5E A;  4BQQ A;  2F5V A;  3OIQ A;  2O04 A;  4P1W A;  2MYS A;  2MD0 A;  4CCO A;  2JIZ A;  3PSF A;  2X1C A;  4F3Q A;  3DKY A;  2VBM A;  2VL8 A;  4E7L A;  4BL0 B;  2VAS A;  2BW3 A;  3G05 A;  2LRE A;  3DU5 A;  1E1Q A;  3A4C A;  2W6I A;  5FRN A;  3OPO A;  2MC4 A;  1TZL A;  2XAU A;  1UG0 A;  2KHM A;  3BC9 A;  2R7U A;  2LBF A;  3OYA A;  4MLO A;  3W2W A;  2R7X A;  4OWR B;  1SKY B;  2DT6 A;  4HNU A;  2X6Y A;  3PUB A;  4ZDO A;  4OJ6 A;  1WJB A;  3HUG B;  3ONQ A;  2OC6 A;  5CPR B;  4Y33 A;  2IS2 A;  4TKO B;  2LOO A;  2WA0 A;  1JTA A;  2F43 A;  1PLU A;  3C2G A;  3W2V A;  4MXN A;  2ZTG A;  2KMU A;  2WAE A;  3RQ4 A;  4FXU A;  2PYH A;  2IS6 A;  4G7W A;  2E60 A;  3VSK A;  3FKJ A;  4NK8 A;  1HA8 A;  4BQO A;  1IDJ A;  1WJ5 A;  3IUO A;  2X6X A;  2EWE A;  5HKK A;  4XD7 A;  4U87 A;  1U0J A;  1OGO X;  4XLC A;  5KHD A;  1MMD A;  1O8F A;  2XND A;  2CUJ A;  2JVG A;  3HC7 A;  3IP4 B;  2WAD A;  1O8I A;  2WPD A;  4RMN A;  4II3 A;  3VMW A;  2ZZG A;  4DNR B;  2CV1 A;  2Z8G A;  3ZIA A;  4CCL A;  3E1S A;  1EA3 A;  2BW3 B;  4H4K C;  3OYI A;  4Z03 A;  4E7S A;  2VPL A;  4BDY A;  1OFL A;  1PE9 A;  3LMW A;  4AU7 A;  2JSP A;  3K4B A;  2LY1 A;  3IAS 2;  3OFN A;  2L9N A;  2NZM A;  3G2B A;  3K4J A;  4YXW A;  3OYH A;  3B8Y A;  3K4L A;  3OL3 A;  1SFK A;  1V5G A;  3BH4 A;  2E1B A;  4HRI A;  2CV0 A;  2LRD A;  3MMY B;  1Z3Y A;  1FMV A;  3FKS A;  1I8D A;  1BN8 A;  2KRH A;  3LMM A;  2X51 A;  1WJD A;  3DLA A;  4BS9 A;  4ZJZ A;  4L8J A;  2QY1 A;  2X3H A;  2W7N A;  4BJ5 C;  4PUS A;  5CDF A;  2AQE A;  5FRM A;  4HG2 A;  4NK6 A;  2ELJ A;  4E7K A;  3SEZ A;  3NWS A;  5FRO A;  4F93 B;  1KCC A;  4E6K G;  3BC8 A;  1WJE A;  3TMO A;  2UVF A;  4CCN A;  3TL4 X;  4PK4 A;  1BPL A;  3TBI A;  3LNN A;  3LFU A;  4YEL A;  2ZZE A;  3LSK A;  2VQC A;  4BGD A;  3CJR B;  3ZRG A;  4W8R A;  4OJL A;  1VBL A;  4XLF A;  2XGJ A;  2R7O A;  4KT6 A;  2CS3 A;  2AQF A;  3ZQQ A;  1T95 A;  3A2K A;  5HNF A;  1W9X A;  4B3F X;  4NC8 A;  3EQN A;  4XN3 A;  1OHH A;  4BJ6 C;  4ZTJ A;  2CW8 A;  2GJR A;  4G6I A;  3H5N A;  3CJQ B;  2UV1 A;  2A6T A;  3SYT A;  1WJA A;  2M5S A;  2R9V A;  1V0E A;  3FY3 A;  4LIV A;  3B4N A;  2LH9 A;  4C2T A;  2NTP A;  3C2H A;  4RM2 A;  1CZF A;  4OZY A;  3S8P A;  4DBQ A;  4B47 A;  5CKT A;  3DDY A;  2GOM A;  3GVJ A;  1UD3 A;  2V31 A;  4C2L A;  3HAG A;  3OIP A;  1O8H A;  4XOP A;  1NBM A;  1Y56 A;  2D3N A;  2E1M B;  1PYV A;  1O8G A;  4X0G A;  2INU A;  2RRE A;  5C1C A;  4DIQ A;  5C1E A;  5HNH A;  3VYU B;  4RLQ A;  3GQB A;  4YEJ A;  3ZSC A;  1IDK A;  3DWL E;  4ITV A;  3DPU A;  1Z3X A;  1OLT A;  3D5R C;  3OAA A;  3S3N A;  1UD6 A;  1LVK A;  2BVM A;  2CFO A;  2WAQ A;  1DQU A;  3KEY A;  4BAC A;  2ZFU A;  3MKY B;  1E3X A;  3GQ9 A;  4FET A;  1WMR A;  1BMF A;  2QX3 A;  4PJJ A;  3QOD A;  3GVK A;  2LZJ A;  3JU4 A;  3H0D A;  5FL7 A;  1O8D A;  1X1D A;  1X0C A;  2X1E A;  4YRV A;  4G6T B;  3OYJ A;  3SUC A;  2IS1 A;  1S9H A;  4YZ0 A;  2HVQ A;  2K5C A;  1NG7 A;  3OYL A;  4UZU A;  3OMY A;  4PJN A;  3ZPN A;  4EW9 A;  1FMW A;  2E5N A;  1GLN A;  1MNE A;  5LFA A;  3CES A;  1VJS A;  1JRG A;  2WBM A;  4OJO A;  3BCA A;  3ZXS A;  3L2W A;  3LSG A;  3VST A;  3VMV A;  4HSR A;  3VSL A;  1O8E A;  3L2R A;  2VQG A;  1QCX A;  1PKV A;  3OYN A;  3QYE A;  3PSI A;  4DGW B;  2HDW A;  4B3X A;  2R7W A;  2E1M C;  4XLE A;  3VR6 A;  2BOL A;  4XL9 A;  3AFH A;  2L7K A;  2GOX B;  2XDV A;  2XF6 A;  1G59 A;  2CMP A;  3FHN A;  2M3A A;  2IS4 A;  4U4B A;  2NT6 A;  1ERD A;  1VZ0 A;  3HPH A;  4C2U A;  1OR7 C;  2M4G A;  5LD2 C;  1N75 A;  3M1C A;  3BCB A;  3CP8 A;  1IRX A;  4D9J A;  1E0E A;  4XQF A;  4F91 B;  2KRC A;  2L5Q A;  1H8E A;  2VQH A;  3H35 A;  3OYK A;  3A3G A;  3T53 B;  2WB1 A;  3GQ7 A;  1QJV A;  3OYF A;  3VYS B;  3HPG A;  1R6R A;  2Z1D A;  2CW7 A;  4LIU A;  3J7A Y;  3CF2 A;  2KLO A;  1UD2 A;  2ZTN A;  2IGK A;  3DTE A;  2VJJ A;  1IB4 A;  4CUG A;  1WP6 A;  1HZE A;  3EPZ A;  1X1B A;  4C30 A;  4CCM A;  3EUK L;  2BVL A;  1W0K A;  1WTH D;  2PJR A;  1YX5 A;  1QHG A;  3D5L A;  1KZL A;  3FDY A;  1X4P A;  1DP3 A;  1KTW A;  3K70 D;  1UD8 A;  4PFO A;  2KDO A;  5JHF A;  2ZSH B;  3VYT B;  4N4O B;  3OS1 A;  3K70 C;  3L2U A;  4C9Y A;  2V7Q A;  1EE6 A;  2DCE A;  4QPO A;  1PXZ A;  3F9K A;  3GRH A;  3OYM A;  2L2O A;  2IGM A;  3VSV A;  3OYG A;  1DGR M;  2NTQ A;  4ASU A;  1BR4 A;  2O5R A;  3BG7 A;  2Y0S A;  3OYE A;  2E5Z A;  1N77 A;  1COW A;  1P9Q C;  4XOR A;  3VWB A;  2HVS A;  1BOB A;  2ZSI B;  4II2 A;  1OGM X;  2RQQ A;  4OAY A;  3MKW B;  4U49 A;  3NWT A;  3NE5 B;  3GBG A;  2D3L A;  1TT0 A;  3LSM A;  2R7R A;  2WJV A;  2KQR A;  1OB0 A;  3A1Y A;  4HIZ A;  3T51 B;  2F6C A;  2UWM A;  3ZCO A;  2UUZ A;  2IQ7 A;  2JDI A;  3D5S C;  3T56 B;  2VXD A;  2VJ4 A;  1E79 A;  4XM3 A;  4JMQ A;  1O88 A;  3OR1 C;  4ZYA A;  4DJA A;  1O8K A;  4NNJ A;  3I9V 2;  4IKF A;  1MND A;  2PJR B;  3PL8 A;  2XZP A;  5DN6 A;  4BE1 A;  5CQG A;  1PJR A;  4XMY A;  3QOE A;  3W2A A;  4XLA A;  3H9Q A;  2X8K A;  3VSU A;  3LSI A;  3AKZ A;  3OYC A;  4XNF A;  3CP2 A;  3RTR A;  3LL7 A;  3HOT A;  3JUR A;  4YZQ A;  2K9M A;  3OYD A;  1QU3 A;  3OEH A;  4HEA 2;  1LDK B;  3L2V A;  2CK3 A;  4HST A;  2F1M A;  2NSP A;  4RM3 A;  2QKL B;  4J01 A;  4E4H A;  2JA2 A;  4BUP A;  3L2Q A;  2Z2S B;  1D0Y A;  4XR6 A;  3W3C A;  3I3L A;  2KP6 A;  1GQ8 A;  3EUH C;  3WQZ A;  1NRK A;  4HNT A;  3T9G A;  4E7J A;  1D1A A;  4HPQ A;  3UW0 A;  4XLH A;  2Q1Z B;  4B48 A;  4XKV A;  4F55 A;  3K4C A;  4W8Q A;  3VDX A;  2JVH A;  1KCD A;  2V4J C;  2ZXI A;  3BG6 A;  4LG3 A;  1JI8 A;  4GRI A;  4PFP A;  4E0F A;  2VBK A;  1UEL B;  3SZG A;  4BXF A;  4DK0 A;  1LKX A;  3K10 A;  4YZX A;  1LFP A;  2VXZ A;  4XKB A;  1E3Z A;  2HZD A;  2DJI A;  4OAZ A;  4GQN A;  3FPP A;  1V5E A;  1FX0 A;  3H94 A;  2W1O A;  3OYB A;  3BLY A;  4KKT A;  4LIT A;  2QE7 A;  3M8J A;  1D0Z A;  1OFM A;  2GJK A;  1RMG A;  4KKU A;  1X4O A;  4FAS D;  2BSP A;  3HG9 A;  3UR3 C;  1BLI A;  2NTB A;  1BHE A;  4CCJ A;  2HVR A;  4KKS A;  4Z06 A;  1MMN A;  3BCF A;  1UAA A;  4U7B A;  4N4N B;  2VQL A;  3AL0 C;  3FBI B;  3UNG C;  3HKZ A;  3QYF A;  4MR0 A;  2HU9 A;  2XF5 A;  3HXL A;  1RWR A;  4IX7 A;  4CSW A;  4XN0 A;  4NC7 A;  2DT7 B;  3EUA A;  2WAF A;  2WJY A;  2W00 A;  4ZDL A;  3MKZ A;  2M7B A;  2RNG A;  2JJ2 A;  4AVZ A;  2PMZ A;  2LG4 A;  4HWV A;  3VYR B;  2O0V A;  1Z21 A;  2IGN A;  3DTI A;  4BJT A;  4IZZ A;  2V7F A;  2I8D A;  2INV A;  2O1D A;  3HOS A;  1BR1 A;  2GK6 A;  2PEC A;  3WWG A;  3DKX A;  4CH7 A;  2M0M A;  3LSH A;  5HOO A;  2X6W A;  1HG8 A;  3IAM 2;  2XC7 A;  1SAU A;  3S93 A;  3PNV A;  3HL2 A;  4P22 A;  1O8M A;  4DOZ A;  2VB6 A;  4YZA A;  2FUG 2;  2CH0 A;  4IQ4 A;  2CUZ A;  2DIE A;  4JQF A;  3BCD A;  2XZO A;  2VJ5 A;  1XG2 A;  2XSJ C;  2DXI A;  3ZR8 X;  1V5F A;  3OW7 A;  4CCK A;  2VLA A;  4R79 A;  1VLY A;  2X53 S;  1MW7 A;  3OWT A;  1HVX A;  4NUB A;  3S3O A;  1W0J A;  3K6G A;  5AMV A;  3ZPP A;  2KPM A;  1Y6I A;  1H80 A;  4I84 A;  2MFZ A;  1G8X A;  2JJ1 A;  1O8L A;  3OOC A;  1WJC A;  2F4I A;  2M4K A;  5KNL A;  2W82 A;  3GQA A;  3EQO A;  3OL4 A;  2QXZ A;  2OV7 A;  2VJI A;  3SEQ A;  2VBE A;  3DPT A;  2V26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...