2VJIA

Tailspike protein of e.coli bacteriophage hk620
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE PROTEIN
publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Bacteriophage hk620
molecule tags Viral protein
total genus 229
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjiA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjiA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjiA02
2UVFA 1PLUA 3ZPPA 1K5CA 5AMVA 3B8YA 2NSTA 3VSVA 4XNFA 4W8SA 1WMRA 4XLCA 1GQ8A 4OZZA 1O8GA 1OFMA 1OGOX 3VSUA 4XQFA 1DBGA 2UVEA 4W8TA 3T9GA 4XMYA 1IA5A 4MXNA 4AVZA 3GQ7A 4PMHA 4MR0A 2IQ7A 2BSPA 1O8DA 2NZMA 2O04A 2NT6A 4YZ0A 4XOPA 4XM3A 4XN0A 1OOCA 4XLHA 1BHEA 3JURA 2NSPA 4XN3A 2INVA 3EQOA 3B90A 1H80A 1DBOA 3SUCA 4OJ6A 1IB4A 4HWVA 2O0VA 2VBMA 4C2LA 4XOTA 4XLEA 4XORA 3GQ9A 4YZAA 4OJ5A 4OJLA 2Z8GA 4NK8A 1BN8A 4YZQA 2X85A 1PXZA 2O0WA 3VMWA 4XONA 2X6XA 3ZSCA 3EQNA 2PYGA 2VJIA 1RU4A 1O8KA 5C1EA 3WWGA 2PYHA 4YZXA 1O8HA 2QY1A 1HG8A 2NTBA 1AIRA 4U49A 3VMVA 2QXZA 2VBEA 2NTPA 1O8FA 1CZFA 2O1DA 1X0CA 3GQ8A 2ODLA 1XG2A 1JTAA 4Z06A 1VBLA 4OZYA 3VSTA 1RMGA 1PE9A 1O8LA 4XLAA 1O8MA 1IDKA 2O17A 1KCCA 4XLFA 4XKWA 3UW0A 4I84A 1KCDA 2VBKA 1O88A 4XKVA 2VJJA 1OGMX 3GQAA 3LMWA 4EW9A 1O8JA 1IDJA 1KTWA 3GRHA 4U4BA 4YEJA 2QX3A 4OJOA 3B4NA 4W8RA 3KRGA 2X3HA 1RWRA 1OFLA 2INUA 3FY3A 2EWEA 1NHCA 2PECA 4Z05A 1O8EA 2NT9A 4URRA 1EE6A 4W8QA 4Z03A 1O8IA 1QCXA 4XL9A 2NTQA 4NK6A 4YELA 4OJPA 5C1CA 2X6YA 1JRGA 1QJVA 2X6WA 4XR6A
chains in the Genus database with same CATH superfamily
5KW9A 1PLUA 4YFOA 2E1RA 1FBQA 3ES9A 1TYXA 2MABA 2MW8A 2NS7A 3FBNB 3CCRB 1VLYA 3C18A 2O9LA 1K4SA 2PMUA 1XN7A 1FY7A 2WAQN 1J2XA 3ONQA 5FKLA 1SKYB 2RREA 2R7SA 3GWZA 2IBDA 4FX0A 5FIUA 4XMYA 1WSRA 1VLOA 1IA5A 3S14J 4DBQA 3BC9A 3W5HA 2XZOA 2L3DA 4Z6YA 5GP9A 3HG9A 2GZWA 1BIBA 2JUGA 4EJTA 1VHEA 1XS9A 2CMPA 3NEUA 4RAYA 1WSVA 1AMOA 4BXXJ 3FPKA 3BTJA 1YYVA 5D5WB 1AA7A 1EFTA 3WE3A 4WWVA 2K9MA 2ZSIB 3E97A 4DGWB 5JI6A 1JXSA 1WCMJ 5EG0B 4LLNA 1W5SA 2M87A 3HSEA 3V8JA 3NE5B 1F4KA 2E34A 2F4IA 5IOYA 1GDTA 3MKLA 5E3NA 1Z3YA 1NG7A 5HLHA 2PFBA 3F8BA 2QKLB 5GAGJ 4O5VA 4UV8A 2C4TA 2R7QA 4WZLA 3I59B 4GDFA 1UHWA 5E79C 3J81k 1KGSA 1R5GA 3ZQLA 4ESJA 2DA3A 2NV4A 1QVUA 4J19A 2W7ZA 2KT0A 2X6XA 1RKTA 3H3ZA 2STWA 1BW5A 1FLIA 3WNBA 1VTNC 3ZC3A 2F4MB 5FKMA 3JRAA 2G0EA 4FTHA 4PJ0C 2XTYA 4YZXA 2CQXA 1EZGA 3LQRA 3CCSI 4IHXA 5B66C 2DMPA 2OK7A 3L9FA 2O5RA 3EDPA 1VQMI 4ZCMA 1MBFA 2KVOA 4P1WA 1TLLA 5GV8A 1KYWA 1XMAA 3GTKJ 2O1DA 3KYCB 3N4MA 2A07F 2CGPA 2AHOA 5IT3A 5FA6A 2JQ7A 1XSVA 3A1YA 2WWYA 4WQMA 4C0SA 4MLOA 4M4SA 1IDKA 1J75A 3JU4A 5IP9J 1Z9CA 4R79A 1IHMA 2BMWA 3UW0A 2UXNA 2QWWA 2DTRA 1O3RA 1Y1WJ 2DQRA 5IYRA 3CUQC 3DQVC 1JT0A 2DERA 2QENA 3CLOA 5LD2C 3ZZTA 4U0YA 4N0BA 3KIOA 2HFHA 2V9KA 2LBFA 5CKTA 1RUNA 3H36A 1IV6A 1HZEA 3AGPA 1JKRC 5D6FA 3I56I 1JT6A 2E1NA 3CP8A 2KJCA 3KEOA 4RA2A 4UUSB 2F5FA 2AO9A 1CF7A 1RWRA 2P0WA 3L2VA 1FNCA 1NB9A 3IWFA 5L3DA 1YJWB 3W2EA 4QIWN 2W48A 1QGPA 3GVAA 4BQQA 3E6CC 1YITB 2E60A 3K2AA 2M4GA 4BUPA 1UG2A 4I98B 1KQ5A 2W84A 2KIMA 3DEUA 3HB9A 2PJRA 1CGPA 1OCOH 3HM5A 2ZXHA 4YCQA 1DG1G 3WTYC 1ZM2A 3GTGJ 4RAGA 3W2HA 3HDDA 1JUPA 2AXLA 1SM4A 2BY0A 2CFOA 3AKZA 1UD8A 2BM6A 3MZHA 2L9NA 3FHNA 3FISA 4HPQA 2M0MA 1SVMA 5F0CA 3OKXA 5CVVA 1VQKB 5CQEA 1O8GA 1R23A 3HOZJ 5HLTA 4ENKA 4HZFA 5J40A 4C3JJ 2JJ1A 4RDLA 1S7OA 2ME0A 3FXRA 2K4BA 4N4OB 1QZYA 1GV5A 4I02A 1P92A 2ZL5A 1VQ5B 1G7RA 1TBXA 2EQRA 2X6OA 1J5YA 1JI8A 1OCCH 3NB2A 1BA5A 1MBHA 5FKKA 1YITI 1G59A 2MH2A 4LMYA 3EQLF 5IT9K 3LQQA 3R0JA 3S93A 3W3CA 1BI0A 3KP7A 4R8HA 1FNNA 4I7HA 3H0GJ 4EV0A 1AIPA 4JRAC 3GFLA 1TW2A 2M7AA 2Q6IA 2TDXA 3ELKA 2INVA 2M34A 1MNMC 2GJRA 2JPBA 2QLZA 1QU3A 1MMAA 4YIFA 1IB4A 2OUMA 4JOMA 3DBLB 3LA2A 4W97A 3WQZA 1N08A 3OIPA 4EGYA 3CF2A 3WTWC 5F1RA 2K3PA 3ML6A 1MBJA 3PJRA 2GXAA 2UV1A 1GT0C 3BH4A 1Z1DA 4P22A 2YU9J 3IH4A 3ZSCA 2ZSHB 1VFCA 2JN9A 2M3AA 4NNJA 4U88A 1JKQC 2WB1A 4I99C 2MYSA 2Q8KA 3QPLA 4D5FA 2PMZN 4HYEA 1IN5A 2HXIA 5IYPA 3CMEB 2ZMEB 4A0XA 2P6SA 1JA0A 4DNRB 2VBEA 3IRQA 2KIUA 4UXNA 2JVHA 2B5OA 2EWNA 4QSHA 2IT0A 4DK1A 3T8RA 2OF7A 1T0FA 1MJAA 3OS1A 3S8PA 3GTOJ 2XF6A 5E3MA 3PQJA 3QYBA 2O17A 1B72B 1X3WB 3BR5A 1JUSA 4LG3A 4XLNF 2R0QC 1K78A 3JQQA 4ZDLA 2DN0A 1XCVA 1X2MA 4PUSA 5IYNA 5K7HA 3I64A 1J0RA 3I55B 1BJZA 4QPQA 3W2IA 2NVYJ 2EPFA 4M6VA 3M7GA 1GXPA 4I09A 1KU7A 2B0RA 1RESA 2BM1A 1Z7LA 1VQLB 2WV0A 2JSPA 3LA7A 3OW7A 1K7AA 2VQLA 3I0TA 3KRGA 3P9CA 4PK4A 3H9JA 1OFDA 4UB8C 1U2RA 1QBJA 3FHZA 3S1RJ 4G6QA 1U5TC 1X1DA 1U8RA 2BOLA 3K0LA 5KAFC 4J0QA 2WA0A 5BNGA 4Q7JB 2K9QA 1DDGA 2ZBKA 4HX7A 4KA4A 1J09A 3CC7B 3K10A 1X19A 3CC4I 3DU1X 2KMUA 4P6VF 5LGNA 4FN5A 3DBRB 3H0DA 4BE1A 2FF4A 3E3VA 4GXOA 4U0WA 2DK5A 2ZJQF 2ISZA 2Z6BD 4ZC3A 4CYCA 2XAFA 2W85A 3I55I 2XAJA 3GLXA 3K4JA 4HEA2 2BM4A 4JBAA 4A3EJ 3MVPA 2W00A 2VBVA 1MIJA 2M4KA 2VBZA 4N3GA 4II3A 1FNBA 3WG7H 1BX1A 1OQYA 1ZARA 2DMNA 2VC1A 2ZL6A 1ETXA 4ZYGA 2JA2A 2QA4I 2DLLA 3F72A 4LK0F 1O7LA 2DA2A 3AFHA 3TOAA 4BEHA 4P9FA 4RCZA 2V7TA 5H2FC 4H4KC 2AQEA 5LRSA 1YW8A 2Q6LA 2JMWA 3VYSB 1MZBA 3RTRA 1S3JA 1DPRA 4BHCA 3JTGA 1D1BA 1LFUP 4IVNA 3WTVC 3DP7A 2IGNA 4LJZF 2R7OA 4ACAA 4UAJA 2ZJ2A 2DYSH 2OV7A 1HKSA 4KIGA 2WAQA 4XN3A 2R7FA 3OIOA 2GLOA 1R1UA 4ZDPA 1PKVA 3QFTA 4EATA 5JBQA 3LSRA 2HNHA 2WTEA 3BY6A 2P3MA 3S3MA 2DJNA 1G3WA 2A6TA 2H09A 1RZ4A 2IEKA 2XRLA 3DTEA 1ZGAA 1TNTA 5DCMA 1JJ6C 1Z6TA 1Z77A 2V9VA 4M3GA 4A6EA 4V19K 4NBSA 5F08A 1Z05A 3G1MA 2ME6A 1FIAA 3W6VA 3F9KA 2GREA 1J7KA 3ZP5A 2Q0OA 2F6CA 3FIWA 1OYWA 1MABA 2PMHA 2V7UA 2RV8A 3OYEA 2MA3A 3BLYA 4RGSA 4AC9A 3ONUA 1V0EA 1O8HA 4S05A 2HXOA 3KPHA 3A01A 1PJ5A 1B8IB 2NTBA 1W35A 1I7PA 4M6YA 2QXZA 2OBRA 3ZMZA 4Z4UA 2JK3A 2BEOA 5HXBA 5M3MJ 3Q5FA 4RMNA 4IHVA 1K4ZA 1YJ9B 4BQNA 3SYJA 2KRFA 4E7HA 2BXYA 4D5CA 3R6JA 3VODA 1U2WA 1ZRFA 2F5EA 4BHBA 2A5YB 4CA0A 1ORKA 2JDIA 1WKMA 2EZIA 3MAJA 3R60A 4FWTA 1B23P 4F7ZA 1Y0RA 4JMQA 3LJYA 1T6YA 4RD6A 4CZCA 4HA8A 5HDKA 1W0JA 4R71A 5DM7F 2WY7Q 2XHKA 2VJ5A 4F3QA 2K02A 3TW7A 1KD1D 4B43A 4G6DA 1JKPC 1ELOA 5LMZA 1XSXA 1K8FA 3KFWX 1G7SA 2D3NA 4M9XA 5C44J 1UJ8A 2F4NA 1Y0UA 3GYHX 1YRNA 2AQFA 2GBYA 1RRJA 3DPLC 2XPWA 3H5AA 2KZGA 2CU7A 2X0KA 3H94A 2Q1ZB 2C5HA 1Z6RA 1J9IA 3G73A 1AKHA 1XDSA 1TT5B 5BSYA 4Z05A 3SZPA 3T0YA 2ZBUA 5ERIA 5HS7A 3ABKH 2A69F 3WGHA 1S29A 2HQRA 2R3SA 3JR9A 3AAFA 3CD6B 5A2QZ 1QQ1A 4XL9A 2CJJA 2BY2A 2ZNYA 2ZJPF 2OAZA 3RIQA 1S9HA 3KETA 2JPCA 2W24A 2P5VA 2R93J 3V7RA 2JSCA 4DZPA 2M1BA 4M74A 5A2QK 1WJDA 3PO2J 3ASSA 4RB0A 1A6QA 3U21A 3M9AA 3BPVA 4FX4A 3VB2A 2PJPA 1TSPA 4S0HB 2HOSA 3GFIA 5JR3A 3E6DA 2UVEA 2K9NA 3T9GA 2F5VA 2VIXA 2W6IA 3WYAA 4ZTJA 2L7ZA 1VQ8B 3PFIA 5J47A 3PENA 5KK1A 4DNCA 5EGOA 2ZNZA 1HCRA 2YX7A 3VWBA 3IV5A 1T38A 3F23A 4KNYA 1DDIA 1S0UA 3CD6I 1GAQA 2LR8A 1HW1A 1P4AA 2A68F 4AWXB 5EEAA 4ESFA 1BHEA 2MFZA 3CCJB 2L9SA 2X1CA 2ZFWA 2BHYA 1ETOA 3U2RA 2YWGA 3CJQB 3FXKA 2ID6A 4Y3OA 4RDJA 1S4MA 1R4MB 2BSAA 5J8CA 3VFZA 4EM1A 2PBIA 4E7LA 4P12A 4HWVA 3LSKA 1FRQA 2LY9A 1G4DA 5E18F 3ASRA 3NARA 3PNTA 4UUTA 2GJKA 2X85A 4G9YA 1ON2A 3DPTA 2LP0A 1LNWA 4NC7A 4XONA 3VPRA 3BR3A 3GZ6A 1HLVA 1N78A 2DY1A 3QPTA 3G71I 2QYOA 1WDTA 4OPSA 3JRHA 2PYGA 3SHFA 4U7BA 3Q9SA 4BAYA 1AOYA 4G1VA 1YG2A 1VQPB 3HOUJ 4RCYA 4Y33A 2V1DA 2IS4A 3ZBUA 2V7WA 1YJNB 3WTZA 2FMLA 2FXAA 4Z4YA 3B78A 3HUGA 2FNPA 1ZELA 1BOAA 2R7RA 4EJVA 2W4SA 1IN6A 3QP5A 2H27A 3KL9A 1N05A 4KDPA 3PETA 1T95A 2WADA 1XSDA 3SJMA 5E3LA 3DEEA 4GYGA 4PC6A 3M07A 4YG2F 2OTLB 3AL0B 4NC8A 3HL2A 1DU0A 3RKQA 1D1CA 1M90D 3DKXA 5HVQC 3LQ6A 4ENMA 4HNVA 1I6XA 2TCTA 1N25A 3ZGKA 2VOOA 4XKVA 2PLYA 4Z4RA 2Y0SA 4DNTB 2PMZA 2Y0MA 2F1MA 1JJ2B 2R7WA 1IJWC 1I6HJ 1QUFA 3OYJA 3OOCA 1LVKA 2Y9YA 4KT6A 2FRHA 1W4MA 1QZEA 3OS0A 1JHFA 1U5TB 1Y1VJ 4OAYA 2ACJA 2W1OA 4OMYA 3K2ZA 3ZZ0A 2BYVE 3EUKL 3KP6A 2INUA 1ZM3A 2ZZQA 2XGCA 3ZBTA 3FY3A 1PVEA 3K4KA 2OC6A 4A6DA 3H35A 4FQGA 3FKSA 3FXMA 2Z9OA 2R7XA 3CC2I 1OHHA 2VT3A 1IUFA 3RKYA 2HDWA 4R1HA 1QFYA 5HNFA 4W8QA 2CWEA 4Q48A 5DDGA 4ETSA 5F4MA 1X1CA 3KE2A 2HVQA 3LSIA 4A3CJ 3ZPNA 4IOCF 4Y9UA 1E1RA 2L7FP 4I2OA 1TYUA 4MTEA 3CCUI 1A31A 4HW0A 3EPZA 3L00A 3R0AA 1FOXA 3BY2A 3WTSC 4L0ZB 3WBKA 2LFBA 1W87A 1I3AA 3A8KA 1VQ6B 3BC8A 1W0UA 2A6HF 3LNQA 1UHMA 4ZYAA 3FXLA 3QFRA 1EFCA 2C6YA 2KFDA 3DWLE 3CPXA 1MSFC 4YAOA 4W8TA 4PSWA 1QPIA 4ZTFA 2EFOA 3A3GA 2FUG2 4HIZA 2V7FA 1DU6A 1KU3A 3C2HA 1ETVA 2P7VB 4BY7J 4BDYA 1WJEA 3KP4A 2H94A 2C78A 5H59A 3PSSA 3H5NA 2NZMA 1XTAA 2E36A 3CTAA 1E3OC 1G8XA 4B8XA 2O61A 3RZOJ 2LC2A 3CESA 4XOPA 4YFXF 3ASOH 2VKVA 2QN6A 3JURA 1OCZH 3K4BA 4ZH4F 3JREA 2D1VA 2EFWA 2PX9A 2PLFA 3F22A 3BOQA 4RD2A 3E5QA 1Y56A 2Z3YA 1LQ1A 3SZGA 4BQOA 3CCVB 1YOVB 2M0CA 3MCAA 3Q38A 3S32A 3PUMA 2VQCA 1U8BA 4PFPA 2OBTA 3OYKA 3HSFA 1U6GA 1UG0A 5J1YA 4N9HA 5GPCA 3TBIA 3FPPA 1I18A 1YS7A 2MD5A 4UV9A 2FJ1A 4I6ZA 4CZZA 2ELJA 3J7AY 5FB2A 2HCJB 4JK1X 4J00A 1ULYA 4PGHA 4ROXA 4C9YA 1V0FA 1OISA 2F48A 3GZ5A 1TL8A 2K86A 3AG3H 1TWFJ 3QP6A 4XSXF 3V42A 1VQ4B 2XTWA 2MBFA 2LDUA 2KRCA 1H8AC 2RDPA 1BMFA 4AM3A 5KAIC 2B7BA 2WB1N 2M8GX 3J80Z 1WORA 3SQNA 2ODLA 4B09A 4BNCA 4KKTA 2YWEA 1R1VA 4RDUA 2ZZEA 1QNTA 4TSFA 4HQMA 3MFKA 2F5CA 3I9V2 3OSGA 1GAWA 2LTPA 2B0LA 2MD0A 3J80K 1OR7C 1GVJA 4C43A 1UD3A 4M0LA 1K4TA 3O2PE 3V4GA 3GX4X 3SEZA 2L9RA 4EJOA 4FETA 4G6TB 2EIKH 1KZHA 2XDVA 4YEJA 2BBYA 1XX5A 4EQQA 3IHUA 1H42A 2XB0X 1JNYA 3BROA 4HRIA 3KZYA 3SFIA 3C2BA 1F20A 3K4LA 3TW6A 3EUHA 4KKUA 5F0FA 1IJFA 3DDYA 3WODF 5BQTA 2F3LA 3GFJA 2E1MB 2UWMA 5K7ZA 2ZMEC 5CPRB 4HV6A 1IN7A 3L09A 4B1RA 4MQ9F 2V1UA 5CVUA 3RIRA 2JTVA 2HGCA 1QZZA 4KKSA 1UAAA 3PL8A 1DQUA 1B9MA 1ETKA 1TQIA 3IKVA 1KONA 1G7CA 2EILH 1U0JA 4Y13A 4HE6A 3WXMA 1ZG5A 4U0VA 2XT2A 5K1YA 4XLCA 2X8KA 3Q0WA 1IRGA 4A3FJ 3E0JB 1KC8D 2WAEA 5IPAA 2V6CA 3HBLA 2HQ5A 5BOXA 3JSOA 1FJLA 1WPKA 2J8IA 1M1KD 4YIRX 4BY1J 1OB2A 1R36A 3DXJF 4WF2A 1X1AA 2XNCA 2G0YA 3KLOA 1YIJI 3FK6A 3NRVA 4MR0A 4OIPF 1WJAA 3L2RA 2Q2EA 4PJLA 2HKXA 5K7FA 4KMFA 4YFKF 2JA8J 2QF7A 3OEEA 4XLHA 1G2HA 1FMVA 1SD7A 3FZVA 3HGYA 3WU0A 1ZK8A 2EV0A 3HXLA 1BPLA 4AYBA 1VNDA 2IA1A 1XB2A 2E35A 1SC7A 1X3UA 1V5VA 3Q0UA 3RI4A 3LSMA 5HLIA 3WHCA 1R9TJ 3OYIA 1MMGA 1U9OA 1GV2A 3HZJA 2QEXB 4MEXF 3B02A 1Q81D 4CCOA 1D0XA 1KK0A 3P26A 3H9QA 4NK8A 4DOZA 2XSJC 2QBYA 4B4DA 3GMEA 2OCEA 2COMA 1K79A 1XDUA 4WXCA 3AVVA 1RKWA 4BE2A 3FF5A 3T5XA 1TUIA 1H89C 2C2WA 1K9MD 2MH9A 2VASA 5ICCA 2PYHA 3D5SC 3I58A 5E20A 2KIQA 3SXYA 1QFJA 4DK0A 1A6IA 3OY9A 2X0LA 5CLSA 2AHQA 2DDAA 3CLQA 2ESNA 3SFZA 3R6KA 3DU5A 4Z4WA 3B6CA 1O8FA 3CCRI 4UUVA 2RQQA 2WJVA 2ZZGA 3HC7A 2EJRA 4OAZA 3CPWB 1HA8A 4A3LJ 2EIJH 1TWGJ 1ERDA 3LOCA 5M5WJ 2J5PA 2D45A 3ABLH 1K61A 5E17F 1EH7A 3BJOA 3K4NA 1MMNA 1QRBA 4OJOA 4HDUA 4L5EA 4MFEA 4RGUA 1ZG1A 4L9NA 1ZREA 1R5OA 1WRJA 2FX0A 2VE8A 1D5VA 5EJCA 4OPOA 3FKJA 5D4RA 4ANJA 1R6RA 5E3OA 5BPDA 2PMDA 1LE8B 1OFEA 4I76A 1SFOJ 5IYDJ 1BI1A 1T6ZA 2E2JJ 4PC7A 3FBIB 3GTLJ 1HW2A 3CDIA 2QTZA 3GZNB 2WYRA 2ELHA 2G7HA 1MH3A 3M8JA 4NQWB 5F0HA 1R5BA 1YX2A 1Y6IA 5KHDA 2BXZA 4E7SA 1ZLJA 5AIPA 1IDZA 1XC5A 3MN2A 2V79A 2KJBA 5HLGA 1EE6A 1O8IA 1RUOA 1CLWA 4Z4ZA 4LLGF 3DPUA 4YELA 4NBQA 3ZQGA 2XASA 2LY1A 3FM5A 3D1NI 2R5ZA 3U6BA 1JRGA 1IXRC 3ZIAA 1QJVA 1HBXG 1POGA 3HGGA 3V7AA 3U6KA 5AMVA 2STTA 3ZPPA 1MNDA 3CCYA 1TVCA 3NAUA 1LDJA 1H9GA 3OYNA 2VPLA 3DEWA 3HEFA 4V2GA 4RDKA 1R71A 1W36D 2OA4A 2I5UA 2JA5J 2FMYA 2ZB9A 1IC8A 5IYWA 2OCCH 5F64A 2C77A 1T33A 1T6SA 5DTDA 3GQ7A 1UMQA 5F04A 3TP0A 4LLLA 4HV5A 1W5CC 3NWTA 1OYYA 1NBMA 1IXSB 4XK4A 3PIPF 1X4PA 2QZ8A 4OWRB 2B9SA 2NSPA 4YRVA 4EVIA 2E71A 2MLKA 2ECCA 3ISXA 3PO3J 1I3QJ 3P4GA 1F43A 4LB6B 2IPQX 2LRDA 1DARA 1QUEA 4DQLA 5DSZA 5BS6A 4E4HA 3RCOA 4G7XA 3B90A 1DBOA 5EEGA 4BU2A 1QFZA 3GBGA 2W7NA 2CUFA 2L7KA 3S3NA 1UFMA 1YX3A 4M71A 3F8MA 1XPXA 2R6HA 1YJWI 4ZDOA 4LGWA 2CBXA 2XRNA 1XGOA 4E7KA 1FYLA 3VO2A 3PA1A 3G1LA 4B3FX 4Q47A 2R5YB 4KITB 5CYVA 2ZFUA 3OS2A 2LREA 4ITVA 5C1EA 3ZOBA 3CW2A 1DGRM 3P27A 2HLDA 1MDMA 4BJTA 4BJ6C 3PNYA 1KQSB 5CVRA 3OL3A 5FFZA 4Z2YA 4JX5A 1QGAA 3W2FA 2HOTA 2IW5A 4IQ4A 3GVKA 1OGJA 3JCUC 1VQKI 2JVGA 2Y48A 3TL4X 4LG0A 3ZPLA 4IW3B 4ZJZA 2WAFA 4G7WA 5FO0A 3OP1A 5L46A 3CJNA 4MO7A 4F92B 3PIOF 3TDUC 1FNMA 1YHQB 3K4CA 4HX8A 1VQ5I 2X1DA 1OFCX 4CDGA 4L9VA 2XROA 1WSUA 1BI3A 1I39A 1E64A 4G1BA 4WZTA 4ZGQB 3B73A 2O3FA 1JTXA 2HZTA 5EF6A 4A3MJ 1JGGA 2LF8A 2K9SA 3K1MA 5FRMA 3GQAA 4MGRA 1X58A 1QQIA 1WJCA 3M8EA 4UNOA 5FFXA 1WOSA 1SEUA 2IS1A 1ZG3A 1HVXA 2Y0SN 2QQAA 3GLLA 5GAHJ 2LG4A 1MNEA 3CB4A 2L9VA 4A3BJ 3VEPA 1PYVA 5TV2A 1OCPA 3O6BB 3E5UA 5TISC 4HLXA 3S15J 1VHOA 3ZUGA 1OMIA 1WJ5A 3DKYA 4HSRA 2GXGA 2VN2A 2OZ6A 2QGUA 1IUYA 3I4NJ 4A12A 2DA7A 5LHIA 2LZJA 2WZNA 4URRA 3Q39A 4N3NA 2IJLA 3OOUA 4RS8A 5TJJA 5THXA 4OJPA 4Z1MA 1FWZA 2XAGA 4WWCA 4XR6A 2BW3A 3OWTA 2VOPA 2WV1A 1LB2A 3AL0C 2HYGD 2XIGA 2I8DA 3BG5A 4EJUA 5GADJ 4NHJA 4E7IA 1T0FC 2ZL7A 3CMEI 1MBKA 1PJ7A 2C4UA 4YDTA 2M5WA 4TT3A 3SYTA 2M8EA 2CW5A 3TGNA 5H5JA 3U2QA 1WI3A 1YW7A 3VSLA 3CDLA 4U9UA 4I01A 3KEWA 3H92A 2AS5F 3RJPA 1A8PA 1GLNA 5TRDA 4IRGA 1WI9A 3P9IA 4HX4A 5JFRA 4ENNA 1FSHA 1OJLA 3B8HA 1BC8C 2DOAA 3BCFA 2O04A 2HQAA 3KEYA 1B4AA 2NXNB 3BTIA 3K4MA 5KVRA 2NVQJ 3SY2A 1QA1A 1E3HA 3E5XA 3MWMA 3RPUA 4RAZA 3PFYA 5IK2A 4S04A 3CCQB 4KN7X 1NRKA 3UKGA 1VQLI 3I1FA 2W25A 3TO9A 3OYLA 1D1AA 3ROUA 1QHHD 4PC3A 1RI7A 1SMYF 4C2MJ 5M5XJ 2DPDA 1QA6A 4XORA 1WXRA 4OJ5A 1MJBA 3QQAA 1Z67A 1TNSA 3ZN1A 5AIQA 3L2WA 5E6TA 1FT9A 5FLVA 6PAXA 3S2DJ 1A04A 1UD5A 1TWHJ 5DNSA 1HDDC 1UHSA 4EGZA 4MQVA 3CC7I 4XKCA 1GO2A 2KDZA 4LOCA 2IOUG 4C2UA 3W2VA 3G6EB 1IW7F 1QA3A 2DT6A 3P7NA 2DBBA 3AVTA 1EFRA 3BTLA 2FQ4A 2VNIA 4U7DA 1KJZA 4CUGA 1MKMA 4AVPA 3VMVA 3JQRA 4P1VA 3VYTB 1XGNA 2MGQA 2PIAA 4OM9A 5IYBJ 1WZ2A 3V8LA 1N07A 1SD6A 4CGZA 2BE5F 2DIEA 1X4OA 3BR2A 3ZMSA 2EZLA 5HS9A 3LL7A 1KZLA 1ZTRA 4QFMA 4G8XA 1B6AA 4CYDA 1LDDA 2DOEA 2VJJA 1HDPA 1KQ0A 3GUDA 3OMYA 4PSXA 4ASUA 3G6EI 1W0KA 5EYRA 4XRSG 2X51A 1IDJA 2FQ3A 2VC0A 1KTWA 3LVBA 1IJEA 2CW7A 1ON1A 5DM6F 3Q6RA 3BDDA 4PGGA 3GTQJ 4L9TA 1Z21A 2X3HA 2X4HA 3G3ZA 4B47A 4EM0B 3LNNA 3LSTA 1OFLA 1XGSA 2DFEA 3J81Z 2EV5A 2HZDA 1D1NA 3T8TA 1J59A 1JA1A 4O3MA 2EWEA 1BJAA 2WY8Q 2PECA 3GIRA 4AF6A 2IGMA 3VYUB 2WC2A 3BG3A 1P4XA 4AIHA 1EWYA 1HA3A 1T6XA 2X3UA 2QSGX 3J81K 1UB9A 2QQBA 1ZM9A 4LBZA 4FE7A 1EP3B 3FXUA 1RC9A 3BH7B 2O03A 2OZUA 3IKTA 2D9RA 2XNDA 4KT5C 2G9WA 4M72A 3B8YA 2VONA 2R5ZB 2VFOA 3HOTA 1UMKA 3QRFF 2QYUA 4OZZA 3O3KA 1OB5A 1T08B 3N05A 1OGOX 4XQFA 5J4YA 4OPVA 2CW0F 5E8IA 2VODA 1H85A 3HSRA 2RNGA 2LBFB 4ZZLA 1U78A 1R49A 3GTMJ 1YJ9I 4LBVA 2DA1A 1UD2A 2GK7A 5D6EA 3CCLB 2KKOA 1QPMA 4M3EA 4CO8A 1NB0A 3PUBA 1CF7B 2CV2A 2FEZA 5C4JJ 2O7OA 1S5LC 3SLNA 3KZIC 3W6JB 1X3ZB 2D74A 5J1RA 2FX3A 3ASQA 4E7JA 1Z7UA 2Y30A 3BZKA 2E1MC 4RLZA 3WGIA 2VNKA 1RR7A 1WJBA 3X2QH 1SD4A 2A5WA 1WTHD 4X7FA 1KQ8A 4I0BA 2P7CB 4F93B 2PJRB 2DYIA 4X07A 2KL4A 2CQKA 3HKZN 3L2CA 4PCQA 3E1YE 2MG4A 4QVJA 4AYBN 2LY2A 3FMRA 5D4SA 4KIFA 3OYBA 4AIKA 2HPMA 2EIXA 1NHAA 1ZM4A 3EYIA 2K7LA 3KP2A 1JJ8C 3HTSB 5EDNA 3FX3A 2DOFA 3FKIJ 3H5RA 3MKYB 2BVMA 1FYKA 1S6LA 1IF1A 3OEHA 5HZBA 4OPWA 3CMAB 1PUFA 1IDYA 3M3YJ 1E1QA 1YI2B 5AONA 1TC3C 5E1WA 4IOAF 5DUIA 5IP6A 2NAZA 1G6NA 3HOWJ 1V5GA 5DN6A 3A0HC 4X0GA 2NTPA 5LGUA 2O0YA 3MZ8A 2L01A 2YWFA 1MDMB 3CJRB 5LLQA 1XG2A 2D1HA 4AUXA 1XB4A 2DFHA 1STZA 5J6XA 5TY0A 2IS2A 1FIPA 1FYMA 5DV5A 2NYXA 2OD5A 1O8LA 1VQ8I 3UNGC 3OIQA 1QO0D 3BQJA 2WZPP 2FE3A 1ZGJA 1D5YA 4ABZA 2LKPA 3BH6B 2LK2A 4XKWA 1KMHA 4P26A 2BHZA 2L2OA 1QG0A 2W82A 1QVTA 3N97A 4GFBA 2VPRA 1VQ7B 3LMMA 2BGCA 4LBYA 4RGXA 1ZR4A 4RPDA 3O8HA 1O57A 2ZXWH 4HNTA 4MIMA 5J4VA 4IZZA 3A2KA 3RPUD 2ZTNA 2OYNA 2CK3A 5JVGF 4M73A 3TOBA 3CCJI 4BHPA 2V31A 4Z4SA 2CQQA 2DJIA 1YS6A 5H20A 5D5VB 2H8WA 3KCCA 1JGSA 2OPTA 2F43A 4L5JA 2XAHA 2KZVA 2XZLA 5FLXZ 1HW5A 1FP2A 2UXXA 2OU2A 3A02A 4B3GA 3OJWA 4ENJA 3SZEA 1NHCA 4CCKA 2XC7A 3CO7C 1D8JA 2KHMA 3MCZA 1BQEA 2GPJA 4MYTA 2DTZA 2RQPA 4KICA 4LD5A 1FP1D 1KRHA 2XGEA 2FBIA 3HJEA 3QYFA 4GGGA 2P81A 3TQNA 1KK3A 5ICGA 3EYYA 5LEJA 5EG0A 2O6WA 2QM3A 2GOMA 4FT8A 2V7XA 4C3IJ 1A5JA 4K1XA 3C2GA 3HOSA 2DOGA 4OIQF 1K5CA 1T2KA 5K5QA 1VQPI 3PM1A 3IWZA 3KYLA 3C7JA 1K78B 2YWHA 1WMRA 4W8SA 1IO2A 2J8KA 2L02A 1UD6A 1YJNI 1GVHA 2CW8A 3I59A 3SKBA 1E0EA 1M1EB 1U3EM 2JUCA 4D1QA 4Y7CA 3H9GA 5FO1A 2V26A 2DETA 2H8RA 1NJID 2OK8A 2KDOA 2MC3A 2WPDA 2XEXA 3HPGA 2HQNA 3F8FA 4F55A 2ZJRF 3E6MA 1FX0A 2DFFA 2OTLI 2NT6A 3AK5A 2VYQA 3O8GA 2K4JA 3FDYA 3ZQFA 3K70D 1I8DA 2VXZA 2HEOA 1USSA 4XICA 1IV8A 4OMZA 4L9JA 2EINH 2BV6A 2KISA 2H1KA 1Q86D 1XMXA 3OV8A 4HSTA 5LHGA 1UCRA 4WK8F 2XSDC 3ZZUA 1VQ9B 2XUBA 3HHGA 4UVBA 3R4KA 1VJSA 4OJ6A 4CYCB 4CSWA 2CYYA 2CS3A 3AVYA 3REOA 2JA7J 3H1CA 2DCEA 2L5QA 3MMYB 2DXIA 1W7PA 1LEAA 2XVCA 3RQIA 2BVNA 2Q6OA 2L0KA 1X2NA 1XCBA 1KQ9A 1IG7A 4PJJA 3I53A 5FLMJ 1B59A 3BPXA 3OYGA 2VBWA 3N90A 1Z0XA 4XRFA 4UUSA 3RY8A 4A69C 1MBEA 3RKXA 4BEHB 3MKWB 2K40A 3G1OA 2QY1A 3MHPA 3FMQA 3BY1A 1T5EA 3SLDA 2R7VA 3LAJA 4X7DA 1R00A 4RLQA 1NH3A 1VQ6I 2VFMA 3GO5A 4WZEA 4FASD 1DGWY 1V5FA 3BR6A 1OKRA 2GAUA 1VBLA 4OZYA 4A5NA 1T39A 4YFNF 5KNLA 1E3XA 1MMDA 3L2UA 4KIBA 3KP3A 4F91B 1EA3A 2XC1A 4XKBA 3DBHB 2XPVA 1N8RD 1W0TA 5DCMB 4BDZA 1S72B 1BI2A 2Z1DA 1O8JA 2DEUA 4RJLA 3I3LA 3LSJA 5B1BH 3CF5F 5B6IA 1F1ZA 2COBA 4BS9A 2LKXA 5FD5A 2DCUA 4M1KA 3CMYA 1V3FA 2NS8A 4X6AJ 3IH3A 3ZR8X 1T56A 2HDDA 2CO5A 2CQ7A 1BX0A 1TZLA 4LC0A 2FSWA 3HYIA 1AHDP 4D0PA 4ZYDA 3A01B 1NDHA 1VQNB 3CCVI 2HPIA 2HDCA 2IGKA 2NOGA 4M9ZA 5DS0A 1TLHB 1EFUA 2O8KA 1O8EA 1FRNA 3HRTA 1WH5A 3P9KA 4YC5A 1VF7A 1D3YA 2LKSA 1KA8A 1JE8A 1APLC 5FNZA 1I5ZA 3F6OA 1ACIA 3BG6A 2OBPA 1CQXA 1JKOC 5JVTA 1E17A 2UVFA 2Y31A 4O6JA 3OR2C 1W36C 2X53S 4BXFA 1VQ4I 2DYRH 1MD0A 2V1NA 4DZJA 2JIZA 2IAIA 2Z99A 3ZQ7A 4GCVA 3VR6A 1FZPB 4XRSA 4ZZDA 5LBQA 2CRVA 1DBGA 3U1DA 3JAMZ 4DYCA 3VSKA 1HKTA 3TO6A 1S7AA 2KP6A 4CHUA 1G3SA 2LVSA 3ABTA 3QU3A 4AVZA 4IHTA 2YUHA 1P6RA 4BACA 3JTHA 2Z33A 2ETHA 1YRNB 4PMHA 3Q3SA 3RYPA 2R7TA 3GVLA 2BSPA 3JAMK 2VKDA 3AG1H 1ZHFA 4BPRA 4G7ZF 2ZMEA 2QSHX 2E2HJ 1AKHB 2OTJB 4XN0A 4DJAA 3HOXJ 1QGZA 3CCMB 4TMTA 1I1SA 1W34A 3BCDA 4UZEA 3EQOA 4GRIA 4F52A 1F5TA 2CSOA 3KP5A 5FROA 1TYWA 2VE9A 3A35A 2ELKA 1B72A 5C3EJ 4EJWA 5D8KB 1N0UA 1MW7A 2O0VA 2VBMA 1F36A 1HSTA 5C4XJ 4F7DA 1CNEA 2GXBA 1D0YA 2M45A 1UELB 3RKWA 2NPFA 1MSEC 1QVGB 1Q1HA 4A0ZA 1BN8A 1TTTA 3L7WA 3ABMH 1JTYA 4X8IA 3HHHA 5EEHA 4NCNA 4BYYA 1MJ9A 4DQKA 1WFXA 2VJIA 3QAHA 1R1TA 3OYCA 5EGOB 4EH1A 2LOOA 5CVIA 3CCMI 2K3FA 4RBOA 3HKZA 3CXCB 3WHBA 3FMSA 1QGYA 4UVCA 9ANTA 1FBSA 3JRDA 5JLVC 4GYIA 4Z4VA 2BM7A 1N77A 1TQPA 3CQZJ 2WBMA 4HG2A 3ZQCA 1EV7A 4B48A 1PE9A 4D7MA 2QTLA 2EA2A 2LH9A 1IRFA 2E2IJ 2ESHA 2XB5A 2ZKZA 4WCGA 3SJPA 4YALA 1BL0A 2QGGA 5EZHA 3L2QA 2RN7A 4DW6A 2YX4A 3BJAA 3OSFA 1Q9SA 1KCDA 2TRTA 1DUXC 1E2XA 4NC6A 5GPAA 1WH7A 5K5OA 3CUOA 4XSZF 3ECHA 4AC0A 3LFKA 1YLFA 1F9NA 1OB0A 1PP8F 3DTKA 5F4JA 5LGTA 4JX4A 5LHHA 3ASTA 2YU3A 3WBJA 1WOPA 2E5ZA 2NNNA 4GQNA 2RGVA 1ENHA 3NWSA 4CH7A 4A3DJ 2KPMA 4E0FA 3HUGB 2XTXA 1W7PD 2BY1A 3D0SA 2QEXI 1DPUA 3KYDB 1Y8RB 1RR8C 2Z2SB 3K6GA 4KJZA 1GR1A 2IP2A 2CV0A 4NK6A 4RPBA 2V6EA 3IAM2 2BV3A 1FEXA 3CCSB 2XF7A 2LYCA 3HRUA 5ILSA 4M3FA 1VQMB 4B3XA 4G5GA 2R9VA 2QSFX 2ZXIA 2EZKA 4ACBA 3AVUA 3GCMA 3BQZA 1BN5A 5DCFA 1IN4A 2P8TA 2X48A 3VSUA 1YE9A 2ZTGA 4TMZA 3QWLA 3GVJA 3V8KA 5GAEJ 3PNVA 2VNJA 1BIAA 2E1CA 2VBXA 3F8NA 2K9LA 3KX2A 1MH4A 3B82A 2XNJA 4M6XA 1K73D 1WHUA 1X1BA 3HIFA 3QOEA 1T8IA 5ILVA 1B8IA 3GSIA 1IN8A 2EFQA 2HMAA 3SEQA 1WJFA 4WXDA 3T51B 3Q0VA 2NVXJ 3BQYA 4WXHA 4EEFG 2D3LA 2L54A 3ZMDA 1OOCA 3GTPJ 3H09A 3I56B 1MGTA 2VKHA 3TEDA 3HRSA 4IX7A 1K83J 2P6TA 3S1NJ 1WVRA 3CUQA 5K5RA 4XRMA 3MD2A 4TN1A 1FC3A 5GTIC 4C2LA 1UZCA 1SFUA 2DO7A 3BWGA 1OLTA 4OJLA 2LLKA 2Z8GA 3OYAA 1XFOA 3M1EA 2C5BA 2RC6A 4YZQA 4OU0A 5BPIA 1X1PA 3VMWA 3M8FA 4IO9F 2I10A 4BBSJ 5GV7A 1LLZA 1CQTA 5JHFA 1L3LA 1W7PB 4IKFA 5D5UB 2B7CA 1QHGA 3JSPA 1EP2B 3BCAA 4OIRF 2GQQA 1GHCA 1G7TA 1Q7YD 3NQOA 3F6VA 1AIRA 2DW4A 2CQNA 3TO7A 5M3FJ 3QE2A 1LKXA 2EH3A 4LBWA 1WU8A 4OINF 2V7VA 3QFCA 2GA1A 5L3GA 1ETWA 3A3BA 1JTAA 3A4CA 3RQ4A 5D5XB 1HSJA 1RMGA 4L8JA 3CZ6A 4E7ZA 1E43A 2VL8A 3RPQA 2UZKA 1ITYA 1BC7C 1MRZA 2RNJA 2Q6KA 2VZLA 4RD0A 3Q3AA 2QQ8A 2CUZA 2H1LA 1IRXA 2FA5A 4TKOB 4UHTA 1VI0A 4AIJA 3JQPA 1QRCA 1O88A 3NAWA 3LMWA 3J7ZI 3JX8A 3BR0A 1KTVA 4I0AA 1D0ZA 1H0MA 3W5VA 3DFGA 4P9SA 2QDXA 2DQLA 2D2WA 2V9PA 3MQ0A 3QPHA 4PC2A 2V4JC 4PJMA 4ESBA 5IT9Z 5A8AA 5J3OA 1EH8A 4IRIA 2M9HA 2QVOA 3D5LA 4RB2C 3F8CA 3OE7A 3C3WA 1DABA 2Z16A 1I1GA 4IHSA 4PGOA 2NT9A 2WSSA 2E7WA 5HDNA 5ED4A 4L18B 2VI6A 4H9GA 1LVAA 1VF9A 2OBSA 1P9QC 3U9GA 3IH2A 2XGDA 4CCJA 4Y17A 4RB1A 2ID3A 3QYEA 2RKHA 1SAUA 3RZDJ 2IVMA 2RVCA 5TGTA 4EM2A 1YLOA 1O3SA 3SJZA 5ICFA 4N9IA 1QRYA 4DBRA 4M3BA 4V2FA 2FD5A 2GK6A 3ESWB 4RD4A 5IY5H 3WNCA 4CCNA 1R22A 3L1PA 5J8FA 5BMZA 1LLWA 1Y8QB 2PI0A 1V5EA 2ZCWA 2W57A 2R7UA 4BQAA 1ZAOA 3BT9A 4D9JA 2PEXA 1W9XA 1E3PA 3MZYA 1NK2P 2ZZFA 4GO1A 4OOSA 1ZR2A 4ASNA 2KRHA 5GTHC 4LB5A 1YHQI 1SD5A 2DPUA 1TQMA 5J1UA 4ZYEA 2PE3A 5FO5A 3T1BA 2CF4A 3GQBA 4OOIA 2BX6A 4YZ0A 2QQ9A 3VYRB 3WE2A 3HOYJ 3Q6QA 4XD7A 2Z5UA 4TV7A 1B9NA 3BP8A 3BZCA 3QU6A 2R7DA 1TYVA 4IRHA 3E6BA 5DEQA 5F4OA 3AVXA 2DODA 4J01A 3CO6C 1ODDA 5IOZA 3GEZA 1FBUA 3KZZA 2RC4A 1MMSA 3HPHA 1H80A 5CQGA 4HF2A 1RETA 2V1XA 2NRAC 1N06A 4M9SA 2XZPA 2B63J 2DMQA 4MFDA 1XE1A 4YZAA 1B2RA 5F6FA 5FGMA 2EIMH 4P55A 1EF4A 2ISYA 4RM2A 3CC4B 3BNWA 4Y9RA 2H6BA 2RC5A 2DT5A 5H6QA 1PXZA 2ZITA 2JWTA 4G12A 1U5TA 3HTUA 1R5HA 1D8KA 2L4AA 2YS9A 3UR3C 4A3GJ 2K27A 1RU4A 1SMTA 1SFKA 4C2TA 3IC7A 3A8JA 3V7CA 1BR4A 1YQAA 1SFEA 2EB7A 1DDNA 1OPCA 5E8GA 3HRMA 5L3BA 3LYCA 2Q2EB 3PSFA 4XIDA 1PUEE 2Y69H 2G7UA 3GQ8A 3IAS2 2VBUA 2QA4B 3EETA 3OOPA 4P5OA 1NK3P 3JRCA 4Z4TA 2UUZA 3ISPA 1RNLA 2CV1A 2VJ4A 2HTSA 2BM5A 4LITA 4MTDA 1IAWA 4HF0A 3ZQQA 1FTTA 2HYFA 4QWQA 4QTRA 1T98A 3CJTB 3E1SA 4IQJA 2ZO4A 3M4OJ 3ABUA 1YTYA 4I84A 3Q9VA 4YAFA 4ZGNB 1YIOA 3W2AA 2EFPA 1REPC 1ZUNB 4IXAA 3ERED 4AIDA 4BGDA 1IRZA 1FTZA 4BXUA 4YXWA 4PDKA 2QBYB 3T53B 2PG4A 4B4CA 2DA5A 1SVLA 3K69A 3CCEB 5DS9A 4ZYHA 5LRRA 3CCQI 2KIFA 4X06A 4CQJA 4IPAA 1NTCA 2IA2A 2E1OA 4P3IA 2D5VA 3QODA 1LPQA 3LSHA 4BH9A 4L0YB 1O4XA 4UZUA 4RGRA 4V02C 5FJ8J 1K6YA 2DA6A 4Z03A 1VZ0A 5FRNA 2O8XA 4QLCU 3ASPA 2NTQA 2LSOA 2QMUA 5FKOA 2MLGA 4NB5A 3MMPA 2HOEA 3S16J 3J7YJ 1U9NA 2IS6A 3N6ZA 4W1UA 2X6WA 3OYFA 3ZN0A 1BBYA 1BJKA 3ERMA 5B5EC 3HAGA 4NDLA 4UB6C 1TWCJ 3SZTA 3J7AO 3VSVA 4XNFA 1YX5A 4Y4RA 4RD3A 5ICEA 1FOKA 2GQFA 4ZCLA 3H3UA 3CCEI 1FDRA 2M2EA 2LD5A 1W1WE 3GTJJ 4MNUA 1HQCA 4P9UA 1F60A 4MXNA 2DDBA 1LFBA 3K70C 3C1DA 3LO8A 1XD7A 4CICA 2V7QA 4HAMA 1G3TA 4FHTA 3ZRGA 5HODA 1O8DA 2GJPA 3IUOA 4KH3A 4HOBA 3KEQA 4IF4A 1O3TA 4M53A 4HE5A 1IB0A 4XM3A 4FISA 3S1MJ 1TT0A 5JLXA 5CVJA 3WTXC 1COWA 4TMWA 4TMXA 2R7ZJ 2GA2A 1USTA 1KYZA 1WGXA 5JLWA 1WPCA 4IJAA 4KYWA 4QV2A 1E63A 4IEJA 1KK1A 3ZMVA 2VBYA 3R61A 3FK7A 1HC8A 1HKQA 1OCTC 2CFXA 1P4WA 4OP7A 1PP7U 1L1IA 3G4SB 1C0WA 3ULQB 4XBFA 1Y0NA 3CUQB 2PQ8A 3H9NA 5AN9A 4IHWA 1Q82D 2EA4A 2IXSA 4HQEA 2O0WA 1OYIA 4P3YA 1K8AD 4BJ5C 3EQNA 3BG7A 2GOXB 3WU1B 3DLLF 3V76A 3QSYA 2BVLA 1ONVA 4MEYF 5DUKA 1O8KA 3EUAA 3U1KA 5DD4A 5BSXA 4X0CA 1KU2A 2DT7B 5KCMA 2FBHA 1HG8A 3WNDA 1PDNC 3A1PA 2KQRA 3OYMA 3OZVA 2LNBA 4U49A 1EP1B 2Y2ZA 4Y7NJ 1DP3A 4BE0A 3RDIA 4OOVA 2ADUA 4YEIA 1K28D 2E1BA 4BKXA 5HOOA 1FMWA 2FBKA 2GIZA 3QOPA 1H9TA 4Z06A 1W2BB 3BG9A 4JX6A 3LFUA 3LSGA 3OZWA 3VSTA 2HS5A 4M3DA 1B1BA 3G2BA 4AU7A 3G4SI 3W2GA 4YIIA 3AG4H 2XV4S 4X1EA 3D26A 4XLAA 2HDNB 2R92J 5KSWB 1KCCA 5H6RA 3CCLI 3DF8A 2BN4A 2HU9A 3WTTC 2FVGA 1E62A 2VBKA 1H88C 3S2HJ 1SANA 3ZXSA 4EW9A 1D2EA 2JN6A 3HOVJ 3IL2A 4AF7A 2QX3A 3TP3A 2VFPA 1EKEA 2J5OA 3A8IA 1CNFA 2B7EA 1ETQA 2FOKA 1S7EA 3DTIA 5EMNA 4RM3A 3MEXA 3BTCA 1FNDA 2VBTA 3JW4A 3BZ6A 2I1LA 2DAOA 1AU7A 1SAXA 3PVDA 4G94A 4LIUA 1LJ9A 4E6KG 2JRMA 1O7FA 3GW2A 1EA0A 3G71B 4DYQA 1JUMA 1LFPA 3I5UA 1LUJB 3MKZA 4LG0B 2XPUA 3WTUC 2MSYA 3VNUA 5L3EA 2N8GA 5M5YJ 2V5IA 4DYRA 2WR8A 5CJ9A 1ZH5A 3PQKA 4UZFA 3CMAI 1GUUA 1V54H 1ZN2A 2IA0A 1YI2I 2NSTA 4PJNA 3BR1A 1YO5C 3H3VK 2DMUA 4AD9A 3SQVA 1GXQA 1RPWA 1ZRCA 1JB9A 1HF2A 2EBIA 1BOBA 2VQHA 3E7LA 3JRGA 4U87A 1PJ6A 2VNHA 5L3FA 1TW3A 3OPOA 3R6SA 2IRFG 2NVUB 1XQBA 3FWEA 4RB3C 2OQGA 1BR1A 4A5MA 4A3JJ 3RYRA 2J7KA 4X05A 3CDHA 2M7BA 3QPSA 5DYMA 2P4WA 4DQ2A 2IQ7A 4CXFA 2R4GA 3M1CA 3K1PA 2V4DA 1ZQ3P 4QVAA 5CDFA 2QZAA 4L5IA 4UVAA 3S17J 2ZBVA 2VFQA 4P25A 1Q1VA 2FNAA 1BM9A 4BBRJ 5FLXK 2ZXJA 3OR1C 4OOXA 1AWCA 1VQ7I 5IP7J 2JJ7A 3B6AA 5HKKA 5EZGA 1E79A 4P2NA 3E20A 1G3YA 4P6YA 3VMFA 1P7JA 1XGMA 4JQFA 3G05A 2BY3A 4PC1A 3SUCA 2NS0A 2L7MP 3DLAA 4UY8I 2XGXA 1VQOB 2HI3A 2BW3B 5DD8A 1P7IA 3GQ9A 2LMDA 2HVRA 3FJOA 1BLIA 3CC2B 2VQGA 1V4RA 3A03A 3SDGA 1XG1A 4TMVA 4WZKA 1TP4A 3QFSA 1LE8A 3SDBA 3VOEA 4C30A 3ZMTA 1H8EA 3PA2A 1WWXA 1ZYRF 2PN6A 3GXOA 4FXUA 1SVOA 4G7OF 4KMUX 3CCUB 4OIOF 3AG2H 1LDKB 2FU4A 5E1ZB 1EJ9A 2M30A 1NG6A 1OCRH 4NQWA 4EMSA 3TKYA 2NNYA 4A0YA 3V7SA 4DIQA 3S3OA 2BGIA 2EFNA 1R5NA 3VNVA 4PZJA 2QKMB 1SFXA 1YW9A 2HTJA 2XGJA 4HBLA 4QHYA 3A0BC 3I4MJ 1X0CA 5ILUA 2JRTA 2HYJA 1VQOI 3PSZA 2RAEA 3LQEA 1Y39A 2Y75A 3AGQA 4H0EA 4HLYA 3W6KB 5FKNA 1EXMA 2EV6A 1ETYA 2P5KA 1O8MA 4D7NA 3FM3A 4A3IJ 4IL6C 4II2A 4KISA 3JRBA 4XLFA 4ZV4A 1S8NA 2CRGA 4Y52J 1EH6A 3ZCOA 4CCMA 4FE4A 2F5DA 2ZC2A 3ML3A 4FK8A 1DP7P 1HXDA 4U4BA 2AXTC 3RSNA 1QH0A 5A88A 2XKOA 5HNHA 2XF5A 4QPOA 5FD6A 4RLFA 3GFMA 4LK1F 2HVSA 1VQ9I 3CP2A 2F1LA 3SEJA 4X7CA 2DA4A 1O3QA 4Y15A 2XT4A 3KLNA 3WY9A 4XLPF 4Q4ZF 3F21A 3P5JA 4X7EA 3PSIA 1QVFB 2GWRA 3DKWA 4WX9A 2EZHA 3W2WA 1MBGA 1TWAJ 3K1NA 4KFCA 3FXJA 3OW2B 1H8HA 1R5ID 4C3HJ 5C1CA 1LM1A 4N4NB 1IGNA 2FOWA 1Z3XA 1RQRA 1ZRDA 1N0VC 1IXCA 2GM4A 1QA2A 5IYCJ 1KK2A 2YUSA 2JZYA 3PUFA 1WOOA 4RD1A 5IYQA 3OFNA 4PABA 5B1AH 1GQ8A 3PUNA 4JYKA 2DI3A 4HF1A 3S1QJ 1OFMA 3BJ6A 3ONYA 1WQ2A 3ASNH 4HNUA 4QUZA 1XMKA 2XAQA 3CMMA 5B3SH 2Y9ZA 3K9TA 5LFAA 1J9ZA 2X9DA 2R5YA 1SKQA 3OJXA 4JP0A 4P96A 2OQRA 1YFHA 1R4NB 1V55H 5HS8A 1P4MA 2YR2A 4MHGA 2A3SA 1FSEA 3CRZA 2ECBA 2YPRA 2O6GE 3COAC 2IGOA 2QE7A 2CC2A 4HDVA 1IZ1A 1OR7A 1JHHA 3LWFA 5F1JA 2H6CA 1S72I 4PAAA 3FXQA 1UD4A 4RM0A 3VDXA 4PFOA 1WP6A 2L4MA 2LF7A 2OJED 2E5NA 3ECOA 4IHYA 2HR3A 2ICWG 1HOMA 3VO1A 5D8LB 3F3XA 2VBSA 1I50J 3WGGA 2VFNA 5J35A 4XOTA 4XLEA 2XOKA 2CNDA 1FX7A 1K6OA 3JRFA 1D8TA 4BL0B 4G6IA 3ZQIA 1VQNI 1TTYA 1GJRA 2BM0A 4LIVA 1KU9A 1QX4A 2A6EF 1A35A 5F27A 2CUEA 1N75A 3OYDA 2BGJA 4Q5SF 2KLOA 2NVTJ 1LEBA 2CG4A 1ZKGA 1FOYA 5J3LA 1OGIA 3WWGA 4B3AA 4A3KJ 2BZTA 5L3CA 3OAAA 1RQPA 2DFIA 2K85A 1E3ZA 4CCLA 2QUFA 2CH0A 2JA6J 4E70A 1A36A 2VXDA 2BPOA 4M2LA 1BW6A 2X1EA 3EUHC 2M5SA 2EK5A 1CZFA 2JJ2A 4NUBA 1PJRA 2HKOA 3AVWA 3TH0A 5E1XA 1FOWA 2NOJB 3IRRA 5FL7A 3T56B 3OL4A 1HF0A 2BF4A 2CUJA 3JRIA 2XAUA 1R7JA 3TMOA 3LSPA 1YIJB 2VT2A 2E7XA 2EFGA 3WU2C 3W5UA 1Y0YA 4A93J 2DU9A 1W5TA 4B44A 3I54A 1ZLKA 5JMCB 2F2EA 2A05A 2W6JA 2QCOA 4ZCIA 2JT1A 4YHBA 3S2WA 2HOAA 2VLAA 1OGMX 1BR2A 3FXOA 2P5LC 3ZMUA 3I4PA 5HZAA 5HDGA 1FPQA 1Z91A 3BCBA 1I27A 2OTJI 3GRHA 3OYHA 2A61A 5JHUA 5A89A 4YAUA 3B4NA 2DMTA 4W8RA 3DCFA 3F0CA 2F4OB 4MYUA 2VB6A 2MC4A 3DV8A 3I71A 1P2FA 1L0OC 3IP4B 3LAPA 1PUFB 3WG9A 1RIOH 2GIVA 5TR9A 5LEKA 2K5CA 2WJYA 3D5RC 2HWVA 2E19A 4RAFA 1R58A 3OZUA 4ON0A 2VKEA 2YSRA 2VUMJ 4K2EA 3GF2A 3LA3A 4G7HF 3TDZC 1ZGWA 1QCXA 3ZQHA 4KUMA 4LFUA 4A2UA 2X6YA 2XKPA 3K7AJ 1GVDA 4YAWA 4FCYA 3DU6A 2DK8A 4KN4X
chains in the Genus database with same CATH topology
3QYEA 1SAUA 2XNDA 1PLUA 3EPZA 5TGTA 3B8YA 2MABA 3BC8A 4DBRA 4ZYAA 3FBNB 3HOTA 4OZZA 1VLYA 2GK6A 3DWLE 3N05A 1OGOX 4XQFA 1SKYB 3ONQA 2RREA 4CCNA 2R7SA 4W8TA 4PSWA 2RNGA 4XMYA 1V5EA 2LBFB 4ZTFA 3A3GA 2FUG2 2R7UA 4HIZA 1IA5A 2V7FA 1UD2A 4D9JA 1W9XA 3C2HA 2GK7A 2ZZFA 4BDYA 2KRHA 1WJEA 3PUBA 2CV2A 4DBQA 3BC9A 2XZOA 3H5NA 2NZMA 1G8XA 3GQBA 3HG9A 4YZ0A 2LC2A 3VYRB 3CESA 4XD7A 4XOPA 2JUGA 4E7JA 2CMPA 2E1MC 3JURA 3K4BA 1AA7A 1WJBA 4J01A 2A5WA 2K9MA 2ZSIB 4DGWB 1WTHD 4F93B 1Y56A 2PJRB 3HPHA 1H80A 5CQGA 3NE5B 2XZPA 2KL4A 2F4IA 3SZGA 4BQOA 1Z3YA 1NG7A 2LY2A 2VQCA 3S32A 4YZAA 4PFPA 2QKLB 3OYKA 1UG0A 4RM2A 2R7QA 3OYBA 3TBIA 3FPPA 1I18A 2HPMA 1PXZA 2ELJA 3J7AY 2X6XA 4J00A 3MKYB 3H5RA 2BVMA 3UR3C 4C9YA 3OEHA 1V0FA 1RU4A 1SFKA 1E1QA 4YZXA 3V42A 4C2TA 1BR4A 2KRCA 2O5RA 1BMFA 1V5GA 2Q2EB 3PSFA 4P1WA 4X0GA 2KVOA 5DN6A 2NTPA 2O1DA 3GQ8A 2ODLA 3IAS2 1XG2A 3CJRB 4KKTA 2ZZEA 4P5OA 2IS2A 2UUZA 4TSFA 2CV1A 2VJ4A 3A1YA 4LITA 1O8LA 4MLOA 3I9V2 3ZQQA 1IDKA 2WZPP 2MD0A 3OIQA 3UNGC 3JU4A 1OR7C 3E1SA 4IQJA 1KMHA 4XKWA 4R79A 1UD3A 2L2OA 4I84A 3UW0A 2W82A 3W2AA 3SEZA 4BGDA 3DQVC 3LMMA 4YXWA 5LD2C 4HNTA 4FETA 5CKTA 2V9KA 4G6TB 2LBFA 4IZZA 3A2KA 2XDVA 4YEJA 3RPUD 2ZTNA 1HZEA 2CK3A 3T53B 4OJOA 2V31A 2DJIA 3CP8A 2F43A 4HRIA 1RWRA 2P0WA 3K4LA 2KZVA 2XZLA 3L2VA 4KKUA 3QODA 4B3GA 3DDYA 1NHCA 3LSHA 4CCKA 2E1MB 2XC7A 2UWMA 2KHMA 4BQQA 5CPRB 4UZUA 1K6YA 2E60A 2M4GA 3QYFA 4BUPA 1VZ0A 4Z03A 5FRNA 2NTQA 4KKSA 1UAAA 2PJRA 3PL8A 1DQUA 2GOMA 2ZXHA 2IS6A 1KONA 2X6WA 3OYFA 1U0JA 3C2GA 3HOSA 2CFOA 3AKZA 1UD8A 3HAGA 1K5CA 2L9NA 3FHNA 4HPQA 2M0MA 3KYLA 3VSVA 4XNFA 4W8SA 1YX5A 4Y4RA 1WMRA 4XLCA 1UD6A 2X8KA 5CQEA 1O8GA 3E0JB 5HLTA 2CW8A 2JJ1A 2WAEA 1E0EA 4N4OB 4D1QA 3H9GA 2V26A 4MXNA 1X1AA 3K70C 1JI8A 4MR0A 2KDOA 1G59A 2WPDA 2V7QA 3ZRGA 3HPGA 4F55A 1O8DA 1FX0A 2GJPA 3IUOA 2NT6A 1WJAA 3L2RA 3S93A 3W3CA 3FDYA 4PJLA 3K70D 4XM3A 2VXZA 1I8DA 3OEEA 4XLHA 1TT0A 1COWA 1FMVA 2M7AA 3HXLA 2NSPA 1BPLA 4HSTA 2INVA 4AYBA 1WPCA 2GJRA 1QU3A 1VJSA 3LSMA 1MMAA 4OJ6A 1IB4A 2OUMA 4JOMA 4CSWA 3OYIA 2CS3A 1MMGA 3WQZA 2DCEA 2L5QA 3OIPA 3CF2A 3MMYB 2DXIA 4CCOA 1D0XA 2K3PA 4NK8A 3H9QA 3PJRA 4DOZA 2UV1A 2XSJC 4PJJA 3BH4A 4P22A 2IXSA 2O0WA 4BJ5C 3OYGA 3ZSCA 2ZSHB 3EQNA 3BG7A 2GOXB 4BE2A 2BVLA 2M3AA 2VASA 4NNJA 4BEHB 3MKWB 1O8KA 3EUAA 2PYHA 2WB1A 3D5SC 2MYSA 2QY1A 2DT7B 5KCMA 1HG8A 1T5EA 3OY9A 4DK0A 2KQRA 3OYMA 2R7VA 4U49A 1DP3A 4RLQA 4BE0A 4DNRB 2VBEA 1O8FA 3DU5A 4FASD 1K28D 1DGWY 1V5FA 2E1BA 2JVHA 2RQQA 1FMWA 5HOOA 2WJVA 3HC7A 4OAZA 2ZZGA 4Z06A 1VBLA 1HA8A 4DK1A 4OZYA 3LFUA 3LSGA 3VSTA 5KNLA 3OS1A 3S8PA 1MMDA 3G2BA 4AU7A 3L2UA 1ERDA 1E3XA 2XF6A 4F91B 3QYBA 4XLAA 1EA3A 2O17A 1KCCA 3K4NA 1MMNA 4LG3A 4XKBA 4ZDLA 2HU9A 2VBKA 4PUSA 3ZXSA 4BDZA 3FKJA 4EW9A 2Z1DA 1R6RA 4ANJA 4QPQA 1O8JA 3I3LA 4BS9A 1Z7LA 2QX3A 2JSPA 3OW7A 2VQLA 3DTIA 3FBIB 3ZR8X 3KRGA 4RM3A 4PK4A 3H9JA 4NQWB 3M8JA 1TZLA 1Y6IA 5KHDA 2HPIA 1X1DA 2BOLA 4E7SA 2WA0A 4LIUA 4E6KG 2IGKA 1J09A 3K10A 1X19A 1O8EA 1EE6A 2KMUA 1O8IA 1LFPA 3MKZA 1VF7A 3H0DA 4YELA 3DPUA 4BE1A 1JRGA 2LY1A 2Z6BD 1QJVA 3BG6A 3ZIAA 4ZC3A 2UVFA 1W36C 2X53S 3OR2C 3ZPPA 4BXFA 5AMVA 3K4JA 4HEA2 2V1NA 2NSTA 1MNDA 4PJNA 2JIZA 3VR6A 3OYNA 2VPLA 2W00A 1BOBA 2M4KA 2VQHA 1DBGA 4U87A 4II3A 1W36D 3VSKA 2KP6A 3OPOA 2JA2A 4AVZA 1BR1A 3GQ7A 3AFHA 4BEHA 4BACA 4PMHA 2M7BA 3NWTA 2AQEA 4H4KC 2R7TA 1NBMA 3GVLA 2R4GA 3M1CA 2BSPA 2V4DA 3VYSB 1X4PA 2VKDA 5CDFA 3RTRA 4OWRB 4YRVA 1D1BA 3OR1C 4XN0A 2IGNA 2R7OA 4DJAA 5HKKA 1E79A 2OV7A 2LRDA 3BCDA 2WAQA 4XN3A 3EQOA 4GRIA 4JQFA 4F52A 3G05A 4E4HA 3RCOA 4ZDPA 1PKVA 5FROA 4G7XA 4EATA 1DBOA 3A35A 3DLAA 4BU2A 3B90A 3SUCA 2HNHA 3GBGA 3S3MA 1MW7A 2W7NA 2L7KA 2A6TA 2BW3B 3S3NA 1YX3A 2O0VA 2VBMA 3GQ9A 2HVRA 1BLIA 3DTEA 2VQGA 1D0YA 4ZDOA 1UELB 4E7KA 1BN8A 3SDBA 4C30A 1H8EA 4B3FX 3F9KA 4FXUA 4KITB 2F6CA 2ZFUA 3OS2A 1MABA 1WFXA 2VJIA 2LREA 3BLYA 1LDKB 3OYCA 4ITVA 3OYEA 5C1EA 1NG6A 1V0EA 1DGRM 2LOOA 1O8HA 2HLDA 4DIQA 4BJTA 4BJ6C 3PNYA 3S3OA 2NTBA 3HKZA 3OL3A 2QKMB 2QXZA 4IQ4A 3GVKA 2XGJA 4RMNA 1X0CA 2JVGA 1N77A 3TL4X 2WBMA 4HG2A 4BQNA 4ZJZA 2WAFA 4G7WA 4E7HA 4F92B 4B48A 1PE9A 2LH9A 3K4CA 4CA0A 1O8MA 2JDIA 2X1DA 4II2A 4KISA 3L2QA 4XLFA 4JMQA 1KCDA 4CZCA 1W0JA 5FRMA 3GQAA 3ZCOA 4CCMA 2WY7Q 2VJ5A 4F3QA 1WJCA 4B43A 4U4BA 2IS1A 1HVXA 1OB0A 3RSNA 3DTKA 2LG4A 1MNEA 2D3NA 5HNHA 2XF5A 2AQFA 4QPOA 4RLFA 1PYVA 2HVSA 3DPLC 2E5ZA 3CP2A 3H5AA 4GQNA 3NWSA 1WJ5A 3DKYA 2Q1ZB 4HSRA 4CH7A 2KPMA 3H94A 4E0FA 3HUGB 4Z05A 3PSIA 2LZJA 4URRA 3W2WA 2Z2SB 3K6GA 4KJZA 4XL9A 2CV0A 1H8HA 4NK6A 3OOUA 4OJPA 5C1CA 2V6EA 3IAM2 4Z1MA 1S9HA 4N4NB 2XF7A 1Z3XA 4XR6A 2LYCA 2BW3A 3OWTA 4B3XA 3AL0C 2I8DA 1WJDA 2R9VA 3OFNA 2ZXIA 4E7IA 1T0FC 3U21A 1GQ8A 1OFMA 3VSUA 4HNUA 4TT3A 1YE9A 2ZTGA 3SYTA 3CMMA 2UVEA 5LFAA 3GVJA 3T9GA 2F5VA 3VSLA 2VIXA 2W6IA 4ZTJA 3PNVA 3KEWA 1GLNA 3VWBA 2K9LA 3KX2A 1X1BA 3QOEA 2DOAA 3BCFA 2O04A 3SEQA 1WJFA 2HQAA 2IGOA 3KEYA 2QE7A 3T51B 3K4MA 2D3LA 1OOCA 1BHEA 2MFZA 2L9SA 2X1CA 2VKHA 3PFYA 4IX7A 3CJQB 5IK2A 1UD4A 4Y3OA 4PFOA 3VDXA 1NRKA 1WP6A 2E5NA 3OYLA 1D1AA 1QHHD 3MD2A 4E7LA 4HWVA 4C2LA 3LSKA 4XOTA 4XLEA 4XORA 2XOKA 4OJ5A 1OLTA 4OJLA 4BL0B 3PNTA 4G6IA 2Z8GA 3L2WA 2GJKA 3OYAA 4YZQA 4LIVA 2X85A 1UD5A 3DPTA 3VMWA 1N75A 4NC7A 4XONA 3OYDA 1N78A 4XKCA 5JHFA 2KLOA 4C2UA 3W2VA 4IKFA 2PYGA 4U7BA 1QHGA 2DT6A 3WWGA 1EFRA 3BCAA 3OAAA 1E3ZA 4Y33A 4CCLA 4CUGA 2IS4A 2CH0A 2VXDA 1AIRA 3VMVA 3VYTB 2X1EA 3EUHC 1LKXA 2M5SA 1ZELA 1CZFA 2R7RA 2JJ2A 4NUBA 1PJRA 2W4SA 3T56B 2NOJB 3A3BA 5FL7A 3A4CA 3RQ4A 1JTAA 3OL4A 2CUJA 2XAUA 3TMOA 2DIEA 1RMGA 1T95A 2WADA 3CZ6A 4E7ZA 2VL8A 1E43A 4L8JA 3DEEA 1X4OA 1KZLA 3LL7A 2CUZA 4B44A 4NC8A 3HL2A 1IRXA 3AL0B 1D1CA 4TKOB 3DKXA 5HVQC 2W6JA 3ZGKA 1O88A 4XKVA 2VJJA 2Y0SA 2VLAA 3OMYA 4PSXA 1BR2A 2PMZA 4ASUA 4DNTB 2F1MA 1OGMX 3LMWA 2R7WA 1W0KA 2X51A 3OYJA 3OOCA 1LVKA 3BCBA 1IDJA 1KTWA 3GRHA 4KT6A 3OS0A 3OYHA 1D0ZA 2CW7A 4OAYA 3B4NA 2IQ7A 4W8RA 2W1OA 1Z21A 2VB6A 2MC4A 3IP4B 2X3HA 3EUKL 2V4JC 4PJMA 4B47A 3LNNA 1OFLA 2INUA 2ZZQA 2HZDA 3FY3A 2K5CA 2OC6A 3K4KA 2WJYA 3D5LA 2EWEA 2WY8Q 3D5RC 3H35A 3FKSA 2PECA 2R7XA 3OE7A 2IGMA 3VYUB 2Z16A 1OHHA 4W8QA 2NT9A 2HDWA 2WSSA 5HNFA 1QCXA 1X1CA 3ZPNA 2HVQA 2X6YA 1P9QC 3LSIA 4CCJA 1E1RA 3DU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVF A;  1PLU A;  3ZPP A;  1K5C A;  5AMV A;  3B8Y A;  2NST A;  3VSV A;  4XNF A;  4W8S A;  1WMR A;  4XLC A;  1GQ8 A;  4OZZ A;  1O8G A;  1OFM A;  1OGO X;  3VSU A;  4XQF A;  1DBG A;  2UVE A;  4W8T A;  3T9G A;  4XMY A;  1IA5 A;  4MXN A;  4AVZ A;  3GQ7 A;  4PMH A;  4MR0 A;  2IQ7 A;  2BSP A;  1O8D A;  2NZM A;  2O04 A;  2NT6 A;  4YZ0 A;  4XOP A;  4XM3 A;  4XN0 A;  1OOC A;  4XLH A;  1BHE A;  3JUR A;  2NSP A;  4XN3 A;  2INV A;  3EQO A;  3B90 A;  1H80 A;  1DBO A;  3SUC A;  4OJ6 A;  1IB4 A;  4HWV A;  2O0V A;  2VBM A;  4C2L A;  4XOT A;  4XLE A;  4XOR A;  3GQ9 A;  4YZA A;  4OJ5 A;  4OJL A;  2Z8G A;  4NK8 A;  1BN8 A;  4YZQ A;  2X85 A;  1PXZ A;  2O0W A;  3VMW A;  4XON A;  2X6X A;  3ZSC A;  3EQN A;  2PYG A;  2VJI A;  1RU4 A;  1O8K A;  5C1E A;  3WWG A;  2PYH A;  4YZX A;  1O8H A;  2QY1 A;  1HG8 A;  2NTB A;  1AIR A;  4U49 A;  3VMV A;  2QXZ A;  2VBE A;  2NTP A;  1O8F A;  1CZF A;  2O1D A;  1X0C A;  3GQ8 A;  2ODL A;  1XG2 A;  1JTA A;  4Z06 A;  1VBL A;  4OZY A;  3VST A;  1RMG A;  1PE9 A;  1O8L A;  4XLA A;  1O8M A;  1IDK A;  2O17 A;  1KCC A;  4XLF A;  4XKW A;  3UW0 A;  4I84 A;  1KCD A;  2VBK A;  1O88 A;  4XKV A;  2VJJ A;  1OGM X;  3GQA A;  3LMW A;  4EW9 A;  1O8J A;  1IDJ A;  1KTW A;  3GRH A;  4U4B A;  4YEJ A;  2QX3 A;  4OJO A;  3B4N A;  4W8R A;  3KRG A;  2X3H A;  1RWR A;  1OFL A;  2INU A;  3FY3 A;  2EWE A;  1NHC A;  2PEC A;  4Z05 A;  1O8E A;  2NT9 A;  4URR A;  1EE6 A;  4W8Q A;  4Z03 A;  1O8I A;  1QCX A;  4XL9 A;  2NTQ A;  4NK6 A;  4YEL A;  4OJP A;  5C1C A;  2X6Y A;  1JRG A;  1QJV A;  2X6W A;  4XR6 A; 
#chains in the Genus database with same CATH topology
 5KW9 A;  1PLU A;  4YFO A;  2E1R A;  1FBQ A;  3ES9 A;  1TYX A;  2MAB A;  2MW8 A;  2NS7 A;  3FBN B;  3CCR B;  1VLY A;  3C18 A;  2O9L A;  1K4S A;  2PMU A;  1XN7 A;  1FY7 A;  2WAQ N;  1J2X A;  3ONQ A;  5FKL A;  1SKY B;  2RRE A;  2R7S A;  3GWZ A;  2IBD A;  4FX0 A;  5FIU A;  4XMY A;  1WSR A;  1VLO A;  1IA5 A;  3S14 J;  4DBQ A;  3BC9 A;  3W5H A;  2XZO A;  2L3D A;  4Z6Y A;  5GP9 A;  3HG9 A;  2GZW A;  1BIB A;  2JUG A;  4EJT A;  1VHE A;  1XS9 A;  2CMP A;  3NEU A;  4RAY A;  1WSV A;  1AMO A;  4BXX J;  3FPK A;  3BTJ A;  1YYV A;  5D5W B;  1AA7 A;  1EFT A;  3WE3 A;  4WWV A;  2K9M A;  2ZSI B;  3E97 A;  4DGW B;  5JI6 A;  1JXS A;  1WCM J;  5EG0 B;  4LLN A;  1W5S A;  2M87 A;  3HSE A;  3V8J A;  3NE5 B;  1F4K A;  2E34 A;  2F4I A;  5IOY A;  1GDT A;  3MKL A;  5E3N A;  1Z3Y A;  1NG7 A;  5HLH A;  2PFB A;  3F8B A;  2QKL B;  5GAG J;  4O5V A;  4UV8 A;  2C4T A;  2R7Q A;  4WZL A;  3I59 B;  4GDF A;  1UHW A;  5E79 C;  3J81 k;  1KGS A;  1R5G A;  3ZQL A;  4ESJ A;  2DA3 A;  2NV4 A;  1QVU A;  4J19 A;  2W7Z A;  2KT0 A;  2X6X A;  1RKT A;  3H3Z A;  2STW A;  1BW5 A;  1FLI A;  3WNB A;  1VTN C;  3ZC3 A;  2F4M B;  5FKM A;  3JRA A;  2G0E A;  4FTH A;  4PJ0 C;  2XTY A;  4YZX A;  2CQX A;  1EZG A;  3LQR A;  3CCS I;  4IHX A;  5B66 C;  2DMP A;  2OK7 A;  3L9F A;  2O5R A;  3EDP A;  1VQM I;  4ZCM A;  1MBF A;  2KVO A;  4P1W A;  1TLL A;  5GV8 A;  1KYW A;  1XMA A;  3GTK J;  2O1D A;  3KYC B;  3N4M A;  2A07 F;  2CGP A;  2AHO A;  5IT3 A;  5FA6 A;  2JQ7 A;  1XSV A;  3A1Y A;  2WWY A;  4WQM A;  4C0S A;  4MLO A;  4M4S A;  1IDK A;  1J75 A;  3JU4 A;  5IP9 J;  1Z9C A;  4R79 A;  1IHM A;  2BMW A;  3UW0 A;  2UXN A;  2QWW A;  2DTR A;  1O3R A;  1Y1W J;  2DQR A;  5IYR A;  3CUQ C;  3DQV C;  1JT0 A;  2DER A;  2QEN A;  3CLO A;  5LD2 C;  3ZZT A;  4U0Y A;  4N0B A;  3KIO A;  2HFH A;  2V9K A;  2LBF A;  5CKT A;  1RUN A;  3H36 A;  1IV6 A;  1HZE A;  3AGP A;  1JKR C;  5D6F A;  3I56 I;  1JT6 A;  2E1N A;  3CP8 A;  2KJC A;  3KEO A;  4RA2 A;  4UUS B;  2F5F A;  2AO9 A;  1CF7 A;  1RWR A;  2P0W A;  3L2V A;  1FNC A;  1NB9 A;  3IWF A;  5L3D A;  1YJW B;  3W2E A;  4QIW N;  2W48 A;  1QGP A;  3GVA A;  4BQQ A;  3E6C C;  1YIT B;  2E60 A;  3K2A A;  2M4G A;  4BUP A;  1UG2 A;  4I98 B;  1KQ5 A;  2W84 A;  2KIM A;  3DEU A;  3HB9 A;  2PJR A;  1CGP A;  1OCO H;  3HM5 A;  2ZXH A;  4YCQ A;  1DG1 G;  3WTY C;  1ZM2 A;  3GTG J;  4RAG A;  3W2H A;  3HDD A;  1JUP A;  2AXL A;  1SM4 A;  2BY0 A;  2CFO A;  3AKZ A;  1UD8 A;  2BM6 A;  3MZH A;  2L9N A;  3FHN A;  3FIS A;  4HPQ A;  2M0M A;  1SVM A;  5F0C A;  3OKX A;  5CVV A;  1VQK B;  5CQE A;  1O8G A;  1R23 A;  3HOZ J;  5HLT A;  4ENK A;  4HZF A;  5J40 A;  4C3J J;  2JJ1 A;  4RDL A;  1S7O A;  2ME0 A;  3FXR A;  2K4B A;  4N4O B;  1QZY A;  1GV5 A;  4I02 A;  1P92 A;  2ZL5 A;  1VQ5 B;  1G7R A;  1TBX A;  2EQR A;  2X6O A;  1J5Y A;  1JI8 A;  1OCC H;  3NB2 A;  1BA5 A;  1MBH A;  5FKK A;  1YIT I;  1G59 A;  2MH2 A;  4LMY A;  3EQL F;  5IT9 K;  3LQQ A;  3R0J A;  3S93 A;  3W3C A;  1BI0 A;  3KP7 A;  4R8H A;  1FNN A;  4I7H A;  3H0G J;  4EV0 A;  1AIP A;  4JRA C;  3GFL A;  1TW2 A;  2M7A A;  2Q6I A;  2TDX A;  3ELK A;  2INV A;  2M34 A;  1MNM C;  2GJR A;  2JPB A;  2QLZ A;  1QU3 A;  1MMA A;  4YIF A;  1IB4 A;  2OUM A;  4JOM A;  3DBL B;  3LA2 A;  4W97 A;  3WQZ A;  1N08 A;  3OIP A;  4EGY A;  3CF2 A;  3WTW C;  5F1R A;  2K3P A;  3ML6 A;  1MBJ A;  3PJR A;  2GXA A;  2UV1 A;  1GT0 C;  3BH4 A;  1Z1D A;  4P22 A;  2YU9 J;  3IH4 A;  3ZSC A;  2ZSH B;  1VFC A;  2JN9 A;  2M3A A;  4NNJ A;  4U88 A;  1JKQ C;  2WB1 A;  4I99 C;  2MYS A;  2Q8K A;  3QPL A;  4D5F A;  2PMZ N;  4HYE A;  1IN5 A;  2HXI A;  5IYP A;  3CME B;  2ZME B;  4A0X A;  2P6S A;  1JA0 A;  4DNR B;  2VBE A;  3IRQ A;  2KIU A;  4UXN A;  2JVH A;  2B5O A;  2EWN A;  4QSH A;  2IT0 A;  4DK1 A;  3T8R A;  2OF7 A;  1T0F A;  1MJA A;  3OS1 A;  3S8P A;  3GTO J;  2XF6 A;  5E3M A;  3PQJ A;  3QYB A;  2O17 A;  1B72 B;  1X3W B;  3BR5 A;  1JUS A;  4LG3 A;  4XLN F;  2R0Q C;  1K78 A;  3JQQ A;  4ZDL A;  2DN0 A;  1XCV A;  1X2M A;  4PUS A;  5IYN A;  5K7H A;  3I64 A;  1J0R A;  3I55 B;  1BJZ A;  4QPQ A;  3W2I A;  2NVY J;  2EPF A;  4M6V A;  3M7G A;  1GXP A;  4I09 A;  1KU7 A;  2B0R A;  1RES A;  2BM1 A;  1Z7L A;  1VQL B;  2WV0 A;  2JSP A;  3LA7 A;  3OW7 A;  1K7A A;  2VQL A;  3I0T A;  3KRG A;  3P9C A;  4PK4 A;  3H9J A;  1OFD A;  4UB8 C;  1U2R A;  1QBJ A;  3FHZ A;  3S1R J;  4G6Q A;  1U5T C;  1X1D A;  1U8R A;  2BOL A;  3K0L A;  5KAF C;  4J0Q A;  2WA0 A;  5BNG A;  4Q7J B;  2K9Q A;  1DDG A;  2ZBK A;  4HX7 A;  4KA4 A;  1J09 A;  3CC7 B;  3K10 A;  1X19 A;  3CC4 I;  3DU1 X;  2KMU A;  4P6V F;  5LGN A;  4FN5 A;  3DBR B;  3H0D A;  4BE1 A;  2FF4 A;  3E3V A;  4GXO A;  4U0W A;  2DK5 A;  2ZJQ F;  2ISZ A;  2Z6B D;  4ZC3 A;  4CYC A;  2XAF A;  2W85 A;  3I55 I;  2XAJ A;  3GLX A;  3K4J A;  4HEA 2;  2BM4 A;  4JBA A;  4A3E J;  3MVP A;  2W00 A;  2VBV A;  1MIJ A;  2M4K A;  2VBZ A;  4N3G A;  4II3 A;  1FNB A;  3WG7 H;  1BX1 A;  1OQY A;  1ZAR A;  2DMN A;  2VC1 A;  2ZL6 A;  1ETX A;  4ZYG A;  2JA2 A;  2QA4 I;  2DLL A;  3F72 A;  4LK0 F;  1O7L A;  2DA2 A;  3AFH A;  3TOA A;  4BEH A;  4P9F A;  4RCZ A;  2V7T A;  5H2F C;  4H4K C;  2AQE A;  5LRS A;  1YW8 A;  2Q6L A;  2JMW A;  3VYS B;  1MZB A;  3RTR A;  1S3J A;  1DPR A;  4BHC A;  3JTG A;  1D1B A;  1LFU P;  4IVN A;  3WTV C;  3DP7 A;  2IGN A;  4LJZ F;  2R7O A;  4ACA A;  4UAJ A;  2ZJ2 A;  2DYS H;  2OV7 A;  1HKS A;  4KIG A;  2WAQ A;  4XN3 A;  2R7F A;  3OIO A;  2GLO A;  1R1U A;  4ZDP A;  1PKV A;  3QFT A;  4EAT A;  5JBQ A;  3LSR A;  2HNH A;  2WTE A;  3BY6 A;  2P3M A;  3S3M A;  2DJN A;  1G3W A;  2A6T A;  2H09 A;  1RZ4 A;  2IEK A;  2XRL A;  3DTE A;  1ZGA A;  1TNT A;  5DCM A;  1JJ6 C;  1Z6T A;  1Z77 A;  2V9V A;  4M3G A;  4A6E A;  4V19 K;  4NBS A;  5F08 A;  1Z05 A;  3G1M A;  2ME6 A;  1FIA A;  3W6V A;  3F9K A;  2GRE A;  1J7K A;  3ZP5 A;  2Q0O A;  2F6C A;  3FIW A;  1OYW A;  1MAB A;  2PMH A;  2V7U A;  2RV8 A;  3OYE A;  2MA3 A;  3BLY A;  4RGS A;  4AC9 A;  3ONU A;  1V0E A;  1O8H A;  4S05 A;  2HXO A;  3KPH A;  3A01 A;  1PJ5 A;  1B8I B;  2NTB A;  1W35 A;  1I7P A;  4M6Y A;  2QXZ A;  2OBR A;  3ZMZ A;  4Z4U A;  2JK3 A;  2BEO A;  5HXB A;  5M3M J;  3Q5F A;  4RMN A;  4IHV A;  1K4Z A;  1YJ9 B;  4BQN A;  3SYJ A;  2KRF A;  4E7H A;  2BXY A;  4D5C A;  3R6J A;  3VOD A;  1U2W A;  1ZRF A;  2F5E A;  4BHB A;  2A5Y B;  4CA0 A;  1ORK A;  2JDI A;  1WKM A;  2EZI A;  3MAJ A;  3R60 A;  4FWT A;  1B23 P;  4F7Z A;  1Y0R A;  4JMQ A;  3LJY A;  1T6Y A;  4RD6 A;  4CZC A;  4HA8 A;  5HDK A;  1W0J A;  4R71 A;  5DM7 F;  2WY7 Q;  2XHK A;  2VJ5 A;  4F3Q A;  2K02 A;  3TW7 A;  1KD1 D;  4B43 A;  4G6D A;  1JKP C;  1ELO A;  5LMZ A;  1XSX A;  1K8F A;  3KFW X;  1G7S A;  2D3N A;  4M9X A;  5C44 J;  1UJ8 A;  2F4N A;  1Y0U A;  3GYH X;  1YRN A;  2AQF A;  2GBY A;  1RRJ A;  3DPL C;  2XPW A;  3H5A A;  2KZG A;  2CU7 A;  2X0K A;  3H94 A;  2Q1Z B;  2C5H A;  1Z6R A;  1J9I A;  3G73 A;  1AKH A;  1XDS A;  1TT5 B;  5BSY A;  4Z05 A;  3SZP A;  3T0Y A;  2ZBU A;  5ERI A;  5HS7 A;  3ABK H;  2A69 F;  3WGH A;  1S29 A;  2HQR A;  2R3S A;  3JR9 A;  3AAF A;  3CD6 B;  5A2Q Z;  1QQ1 A;  4XL9 A;  2CJJ A;  2BY2 A;  2ZNY A;  2ZJP F;  2OAZ A;  3RIQ A;  1S9H A;  3KET A;  2JPC A;  2W24 A;  2P5V A;  2R93 J;  3V7R A;  2JSC A;  4DZP A;  2M1B A;  4M74 A;  5A2Q K;  1WJD A;  3PO2 J;  3ASS A;  4RB0 A;  1A6Q A;  3U21 A;  3M9A A;  3BPV A;  4FX4 A;  3VB2 A;  2PJP A;  1TSP A;  4S0H B;  2HOS A;  3GFI A;  5JR3 A;  3E6D A;  2UVE A;  2K9N A;  3T9G A;  2F5V A;  2VIX A;  2W6I A;  3WYA A;  4ZTJ A;  2L7Z A;  1VQ8 B;  3PFI A;  5J47 A;  3PEN A;  5KK1 A;  4DNC A;  5EGO A;  2ZNZ A;  1HCR A;  2YX7 A;  3VWB A;  3IV5 A;  1T38 A;  3F23 A;  4KNY A;  1DDI A;  1S0U A;  3CD6 I;  1GAQ A;  2LR8 A;  1HW1 A;  1P4A A;  2A68 F;  4AWX B;  5EEA A;  4ESF A;  1BHE A;  2MFZ A;  3CCJ B;  2L9S A;  2X1C A;  2ZFW A;  2BHY A;  1ETO A;  3U2R A;  2YWG A;  3CJQ B;  3FXK A;  2ID6 A;  4Y3O A;  4RDJ A;  1S4M A;  1R4M B;  2BSA A;  5J8C A;  3VFZ A;  4EM1 A;  2PBI A;  4E7L A;  4P12 A;  4HWV A;  3LSK A;  1FRQ A;  2LY9 A;  1G4D A;  5E18 F;  3ASR A;  3NAR A;  3PNT A;  4UUT A;  2GJK A;  2X85 A;  4G9Y A;  1ON2 A;  3DPT A;  2LP0 A;  1LNW A;  4NC7 A;  4XON A;  3VPR A;  3BR3 A;  3GZ6 A;  1HLV A;  1N78 A;  2DY1 A;  3QPT A;  3G71 I;  2QYO A;  1WDT A;  4OPS A;  3JRH A;  2PYG A;  3SHF A;  4U7B A;  3Q9S A;  4BAY A;  1AOY A;  4G1V A;  1YG2 A;  1VQP B;  3HOU J;  4RCY A;  4Y33 A;  2V1D A;  2IS4 A;  3ZBU A;  2V7W A;  1YJN B;  3WTZ A;  2FML A;  2FXA A;  4Z4Y A;  3B78 A;  3HUG A;  2FNP A;  1ZEL A;  1BOA A;  2R7R A;  4EJV A;  2W4S A;  1IN6 A;  3QP5 A;  2H27 A;  3KL9 A;  1N05 A;  4KDP A;  3PET A;  1T95 A;  2WAD A;  1XSD A;  3SJM A;  5E3L A;  3DEE A;  4GYG A;  4PC6 A;  3M07 A;  4YG2 F;  2OTL B;  3AL0 B;  4NC8 A;  3HL2 A;  1DU0 A;  3RKQ A;  1D1C A;  1M90 D;  3DKX A;  5HVQ C;  3LQ6 A;  4ENM A;  4HNV A;  1I6X A;  2TCT A;  1N25 A;  3ZGK A;  2VOO A;  4XKV A;  2PLY A;  4Z4R A;  2Y0S A;  4DNT B;  2PMZ A;  2Y0M A;  2F1M A;  1JJ2 B;  2R7W A;  1IJW C;  1I6H J;  1QUF A;  3OYJ A;  3OOC A;  1LVK A;  2Y9Y A;  4KT6 A;  2FRH A;  1W4M A;  1QZE A;  3OS0 A;  1JHF A;  1U5T B;  1Y1V J;  4OAY A;  2ACJ A;  2W1O A;  4OMY A;  3K2Z A;  3ZZ0 A;  2BYV E;  3EUK L;  3KP6 A;  2INU A;  1ZM3 A;  2ZZQ A;  2XGC A;  3ZBT A;  3FY3 A;  1PVE A;  3K4K A;  2OC6 A;  4A6D A;  3H35 A;  4FQG A;  3FKS A;  3FXM A;  2Z9O A;  2R7X A;  3CC2 I;  1OHH A;  2VT3 A;  1IUF A;  3RKY A;  2HDW A;  4R1H A;  1QFY A;  5HNF A;  4W8Q A;  2CWE A;  4Q48 A;  5DDG A;  4ETS A;  5F4M A;  1X1C A;  3KE2 A;  2HVQ A;  3LSI A;  4A3C J;  3ZPN A;  4IOC F;  4Y9U A;  1E1R A;  2L7F P;  4I2O A;  1TYU A;  4MTE A;  3CCU I;  1A31 A;  4HW0 A;  3EPZ A;  3L00 A;  3R0A A;  1FOX A;  3BY2 A;  3WTS C;  4L0Z B;  3WBK A;  2LFB A;  1W87 A;  1I3A A;  3A8K A;  1VQ6 B;  3BC8 A;  1W0U A;  2A6H F;  3LNQ A;  1UHM A;  4ZYA A;  3FXL A;  3QFR A;  1EFC A;  2C6Y A;  2KFD A;  3DWL E;  3CPX A;  1MSF C;  4YAO A;  4W8T A;  4PSW A;  1QPI A;  4ZTF A;  2EFO A;  3A3G A;  2FUG 2;  4HIZ A;  2V7F A;  1DU6 A;  1KU3 A;  3C2H A;  1ETV A;  2P7V B;  4BY7 J;  4BDY A;  1WJE A;  3KP4 A;  2H94 A;  2C78 A;  5H59 A;  3PSS A;  3H5N A;  2NZM A;  1XTA A;  2E36 A;  3CTA A;  1E3O C;  1G8X A;  4B8X A;  2O61 A;  3RZO J;  2LC2 A;  3CES A;  4XOP A;  4YFX F;  3ASO H;  2VKV A;  2QN6 A;  3JUR A;  1OCZ H;  3K4B A;  4ZH4 F;  3JRE A;  2D1V A;  2EFW A;  2PX9 A;  2PLF A;  3F22 A;  3BOQ A;  4RD2 A;  3E5Q A;  1Y56 A;  2Z3Y A;  1LQ1 A;  3SZG A;  4BQO A;  3CCV B;  1YOV B;  2M0C A;  3MCA A;  3Q38 A;  3S32 A;  3PUM A;  2VQC A;  1U8B A;  4PFP A;  2OBT A;  3OYK A;  3HSF A;  1U6G A;  1UG0 A;  5J1Y A;  4N9H A;  5GPC A;  3TBI A;  3FPP A;  1I18 A;  1YS7 A;  2MD5 A;  4UV9 A;  2FJ1 A;  4I6Z A;  4CZZ A;  2ELJ A;  3J7A Y;  5FB2 A;  2HCJ B;  4JK1 X;  4J00 A;  1ULY A;  4PGH A;  4ROX A;  4C9Y A;  1V0F A;  1OIS A;  2F48 A;  3GZ5 A;  1TL8 A;  2K86 A;  3AG3 H;  1TWF J;  3QP6 A;  4XSX F;  3V42 A;  1VQ4 B;  2XTW A;  2MBF A;  2LDU A;  2KRC A;  1H8A C;  2RDP A;  1BMF A;  4AM3 A;  5KAI C;  2B7B A;  2WB1 N;  2M8G X;  3J80 Z;  1WOR A;  3SQN A;  2ODL A;  4B09 A;  4BNC A;  4KKT A;  2YWE A;  1R1V A;  4RDU A;  2ZZE A;  1QNT A;  4TSF A;  4HQM A;  3MFK A;  2F5C A;  3I9V 2;  3OSG A;  1GAW A;  2LTP A;  2B0L A;  2MD0 A;  3J80 K;  1OR7 C;  1GVJ A;  4C43 A;  1UD3 A;  4M0L A;  1K4T A;  3O2P E;  3V4G A;  3GX4 X;  3SEZ A;  2L9R A;  4EJO A;  4FET A;  4G6T B;  2EIK H;  1KZH A;  2XDV A;  4YEJ A;  2BBY A;  1XX5 A;  4EQQ A;  3IHU A;  1H42 A;  2XB0 X;  1JNY A;  3BRO A;  4HRI A;  3KZY A;  3SFI A;  3C2B A;  1F20 A;  3K4L A;  3TW6 A;  3EUH A;  4KKU A;  5F0F A;  1IJF A;  3DDY A;  3WOD F;  5BQT A;  2F3L A;  3GFJ A;  2E1M B;  2UWM A;  5K7Z A;  2ZME C;  5CPR B;  4HV6 A;  1IN7 A;  3L09 A;  4B1R A;  4MQ9 F;  2V1U A;  5CVU A;  3RIR A;  2JTV A;  2HGC A;  1QZZ A;  4KKS A;  1UAA A;  3PL8 A;  1DQU A;  1B9M A;  1ETK A;  1TQI A;  3IKV A;  1KON A;  1G7C A;  2EIL H;  1U0J A;  4Y13 A;  4HE6 A;  3WXM A;  1ZG5 A;  4U0V A;  2XT2 A;  5K1Y A;  4XLC A;  2X8K A;  3Q0W A;  1IRG A;  4A3F J;  3E0J B;  1KC8 D;  2WAE A;  5IPA A;  2V6C A;  3HBL A;  2HQ5 A;  5BOX A;  3JSO A;  1FJL A;  1WPK A;  2J8I A;  1M1K D;  4YIR X;  4BY1 J;  1OB2 A;  1R36 A;  3DXJ F;  4WF2 A;  1X1A A;  2XNC A;  2G0Y A;  3KLO A;  1YIJ I;  3FK6 A;  3NRV A;  4MR0 A;  4OIP F;  1WJA A;  3L2R A;  2Q2E A;  4PJL A;  2HKX A;  5K7F A;  4KMF A;  4YFK F;  2JA8 J;  2QF7 A;  3OEE A;  4XLH A;  1G2H A;  1FMV A;  1SD7 A;  3FZV A;  3HGY A;  3WU0 A;  1ZK8 A;  2EV0 A;  3HXL A;  1BPL A;  4AYB A;  1VND A;  2IA1 A;  1XB2 A;  2E35 A;  1SC7 A;  1X3U A;  1V5V A;  3Q0U A;  3RI4 A;  3LSM A;  5HLI A;  3WHC A;  1R9T J;  3OYI A;  1MMG A;  1U9O A;  1GV2 A;  3HZJ A;  2QEX B;  4MEX F;  3B02 A;  1Q81 D;  4CCO A;  1D0X A;  1KK0 A;  3P26 A;  3H9Q A;  4NK8 A;  4DOZ A;  2XSJ C;  2QBY A;  4B4D A;  3GME A;  2OCE A;  2COM A;  1K79 A;  1XDU A;  4WXC A;  3AVV A;  1RKW A;  4BE2 A;  3FF5 A;  3T5X A;  1TUI A;  1H89 C;  2C2W A;  1K9M D;  2MH9 A;  2VAS A;  5ICC A;  2PYH A;  3D5S C;  3I58 A;  5E20 A;  2KIQ A;  3SXY A;  1QFJ A;  4DK0 A;  1A6I A;  3OY9 A;  2X0L A;  5CLS A;  2AHQ A;  2DDA A;  3CLQ A;  2ESN A;  3SFZ A;  3R6K A;  3DU5 A;  4Z4W A;  3B6C A;  1O8F A;  3CCR I;  4UUV A;  2RQQ A;  2WJV A;  2ZZG A;  3HC7 A;  2EJR A;  4OAZ A;  3CPW B;  1HA8 A;  4A3L J;  2EIJ H;  1TWG J;  1ERD A;  3LOC A;  5M5W J;  2J5P A;  2D45 A;  3ABL H;  1K61 A;  5E17 F;  1EH7 A;  3BJO A;  3K4N A;  1MMN A;  1QRB A;  4OJO A;  4HDU A;  4L5E A;  4MFE A;  4RGU A;  1ZG1 A;  4L9N A;  1ZRE A;  1R5O A;  1WRJ A;  2FX0 A;  2VE8 A;  1D5V A;  5EJC A;  4OPO A;  3FKJ A;  5D4R A;  4ANJ A;  1R6R A;  5E3O A;  5BPD A;  2PMD A;  1LE8 B;  1OFE A;  4I76 A;  1SFO J;  5IYD J;  1BI1 A;  1T6Z A;  2E2J J;  4PC7 A;  3FBI B;  3GTL J;  1HW2 A;  3CDI A;  2QTZ A;  3GZN B;  2WYR A;  2ELH A;  2G7H A;  1MH3 A;  3M8J A;  4NQW B;  5F0H A;  1R5B A;  1YX2 A;  1Y6I A;  5KHD A;  2BXZ A;  4E7S A;  1ZLJ A;  5AIP A;  1IDZ A;  1XC5 A;  3MN2 A;  2V79 A;  2KJB A;  5HLG A;  1EE6 A;  1O8I A;  1RUO A;  1CLW A;  4Z4Z A;  4LLG F;  3DPU A;  4YEL A;  4NBQ A;  3ZQG A;  2XAS A;  2LY1 A;  3FM5 A;  3D1N I;  2R5Z A;  3U6B A;  1JRG A;  1IXR C;  3ZIA A;  1QJV A;  1HBX G;  1POG A;  3HGG A;  3V7A A;  3U6K A;  5AMV A;  2STT A;  3ZPP A;  1MND A;  3CCY A;  1TVC A;  3NAU A;  1LDJ A;  1H9G A;  3OYN A;  2VPL A;  3DEW A;  3HEF A;  4V2G A;  4RDK A;  1R71 A;  1W36 D;  2OA4 A;  2I5U A;  2JA5 J;  2FMY A;  2ZB9 A;  1IC8 A;  5IYW A;  2OCC H;  5F64 A;  2C77 A;  1T33 A;  1T6S A;  5DTD A;  3GQ7 A;  1UMQ A;  5F04 A;  3TP0 A;  4LLL A;  4HV5 A;  1W5C C;  3NWT A;  1OYY A;  1NBM A;  1IXS B;  4XK4 A;  3PIP F;  1X4P A;  2QZ8 A;  4OWR B;  2B9S A;  2NSP A;  4YRV A;  4EVI A;  2E71 A;  2MLK A;  2ECC A;  3ISX A;  3PO3 J;  1I3Q J;  3P4G A;  1F43 A;  4LB6 B;  2IPQ X;  2LRD A;  1DAR A;  1QUE A;  4DQL A;  5DSZ A;  5BS6 A;  4E4H A;  3RCO A;  4G7X A;  3B90 A;  1DBO A;  5EEG A;  4BU2 A;  1QFZ A;  3GBG A;  2W7N A;  2CUF A;  2L7K A;  3S3N A;  1UFM A;  1YX3 A;  4M71 A;  3F8M A;  1XPX A;  2R6H A;  1YJW I;  4ZDO A;  4LGW A;  2CBX A;  2XRN A;  1XGO A;  4E7K A;  1FYL A;  3VO2 A;  3PA1 A;  3G1L A;  4B3F X;  4Q47 A;  2R5Y B;  4KIT B;  5CYV A;  2ZFU A;  3OS2 A;  2LRE A;  4ITV A;  5C1E A;  3ZOB A;  3CW2 A;  1DGR M;  3P27 A;  2HLD A;  1MDM A;  4BJT A;  4BJ6 C;  3PNY A;  1KQS B;  5CVR A;  3OL3 A;  5FFZ A;  4Z2Y A;  4JX5 A;  1QGA A;  3W2F A;  2HOT A;  2IW5 A;  4IQ4 A;  3GVK A;  1OGJ A;  3JCU C;  1VQK I;  2JVG A;  2Y48 A;  3TL4 X;  4LG0 A;  3ZPL A;  4IW3 B;  4ZJZ A;  2WAF A;  4G7W A;  5FO0 A;  3OP1 A;  5L46 A;  3CJN A;  4MO7 A;  4F92 B;  3PIO F;  3TDU C;  1FNM A;  1YHQ B;  3K4C A;  4HX8 A;  1VQ5 I;  2X1D A;  1OFC X;  4CDG A;  4L9V A;  2XRO A;  1WSU A;  1BI3 A;  1I39 A;  1E64 A;  4G1B A;  4WZT A;  4ZGQ B;  3B73 A;  2O3F A;  1JTX A;  2HZT A;  5EF6 A;  4A3M J;  1JGG A;  2LF8 A;  2K9S A;  3K1M A;  5FRM A;  3GQA A;  4MGR A;  1X58 A;  1QQI A;  1WJC A;  3M8E A;  4UNO A;  5FFX A;  1WOS A;  1SEU A;  2IS1 A;  1ZG3 A;  1HVX A;  2Y0S N;  2QQA A;  3GLL A;  5GAH J;  2LG4 A;  1MNE A;  3CB4 A;  2L9V A;  4A3B J;  3VEP A;  1PYV A;  5TV2 A;  1OCP A;  3O6B B;  3E5U A;  5TIS C;  4HLX A;  3S15 J;  1VHO A;  3ZUG A;  1OMI A;  1WJ5 A;  3DKY A;  4HSR A;  2GXG A;  2VN2 A;  2OZ6 A;  2QGU A;  1IUY A;  3I4N J;  4A12 A;  2DA7 A;  5LHI A;  2LZJ A;  2WZN A;  4URR A;  3Q39 A;  4N3N A;  2IJL A;  3OOU A;  4RS8 A;  5TJJ A;  5THX A;  4OJP A;  4Z1M A;  1FWZ A;  2XAG A;  4WWC A;  4XR6 A;  2BW3 A;  3OWT A;  2VOP A;  2WV1 A;  1LB2 A;  3AL0 C;  2HYG D;  2XIG A;  2I8D A;  3BG5 A;  4EJU A;  5GAD J;  4NHJ A;  4E7I A;  1T0F C;  2ZL7 A;  3CME I;  1MBK A;  1PJ7 A;  2C4U A;  4YDT A;  2M5W A;  4TT3 A;  3SYT A;  2M8E A;  2CW5 A;  3TGN A;  5H5J A;  3U2Q A;  1WI3 A;  1YW7 A;  3VSL A;  3CDL A;  4U9U A;  4I01 A;  3KEW A;  3H92 A;  2AS5 F;  3RJP A;  1A8P A;  1GLN A;  5TRD A;  4IRG A;  1WI9 A;  3P9I A;  4HX4 A;  5JFR A;  4ENN A;  1FSH A;  1OJL A;  3B8H A;  1BC8 C;  2DOA A;  3BCF A;  2O04 A;  2HQA A;  3KEY A;  1B4A A;  2NXN B;  3BTI A;  3K4M A;  5KVR A;  2NVQ J;  3SY2 A;  1QA1 A;  1E3H A;  3E5X A;  3MWM A;  3RPU A;  4RAZ A;  3PFY A;  5IK2 A;  4S04 A;  3CCQ B;  4KN7 X;  1NRK A;  3UKG A;  1VQL I;  3I1F A;  2W25 A;  3TO9 A;  3OYL A;  1D1A A;  3ROU A;  1QHH D;  4PC3 A;  1RI7 A;  1SMY F;  4C2M J;  5M5X J;  2DPD A;  1QA6 A;  4XOR A;  1WXR A;  4OJ5 A;  1MJB A;  3QQA A;  1Z67 A;  1TNS A;  3ZN1 A;  5AIQ A;  3L2W A;  5E6T A;  1FT9 A;  5FLV A;  6PAX A;  3S2D J;  1A04 A;  1UD5 A;  1TWH J;  5DNS A;  1HDD C;  1UHS A;  4EGZ A;  4MQV A;  3CC7 I;  4XKC A;  1GO2 A;  2KDZ A;  4LOC A;  2IOU G;  4C2U A;  3W2V A;  3G6E B;  1IW7 F;  1QA3 A;  2DT6 A;  3P7N A;  2DBB A;  3AVT A;  1EFR A;  3BTL A;  2FQ4 A;  2VNI A;  4U7D A;  1KJZ A;  4CUG A;  1MKM A;  4AVP A;  3VMV A;  3JQR A;  4P1V A;  3VYT B;  1XGN A;  2MGQ A;  2PIA A;  4OM9 A;  5IYB J;  1WZ2 A;  3V8L A;  1N07 A;  1SD6 A;  4CGZ A;  2BE5 F;  2DIE A;  1X4O A;  3BR2 A;  3ZMS A;  2EZL A;  5HS9 A;  3LL7 A;  1KZL A;  1ZTR A;  4QFM A;  4G8X A;  1B6A A;  4CYD A;  1LDD A;  2DOE A;  2VJJ A;  1HDP A;  1KQ0 A;  3GUD A;  3OMY A;  4PSX A;  4ASU A;  3G6E I;  1W0K A;  5EYR A;  4XRS G;  2X51 A;  1IDJ A;  2FQ3 A;  2VC0 A;  1KTW A;  3LVB A;  1IJE A;  2CW7 A;  1ON1 A;  5DM6 F;  3Q6R A;  3BDD A;  4PGG A;  3GTQ J;  4L9T A;  1Z21 A;  2X3H A;  2X4H A;  3G3Z A;  4B47 A;  4EM0 B;  3LNN A;  3LST A;  1OFL A;  1XGS A;  2DFE A;  3J81 Z;  2EV5 A;  2HZD A;  1D1N A;  3T8T A;  1J59 A;  1JA1 A;  4O3M A;  2EWE A;  1BJA A;  2WY8 Q;  2PEC A;  3GIR A;  4AF6 A;  2IGM A;  3VYU B;  2WC2 A;  3BG3 A;  1P4X A;  4AIH A;  1EWY A;  1HA3 A;  1T6X A;  2X3U A;  2QSG X;  3J81 K;  1UB9 A;  2QQB A;  1ZM9 A;  4LBZ A;  4FE7 A;  1EP3 B;  3FXU A;  1RC9 A;  3BH7 B;  2O03 A;  2OZU A;  3IKT A;  2D9R A;  2XND A;  4KT5 C;  2G9W A;  4M72 A;  3B8Y A;  2VON A;  2R5Z B;  2VFO A;  3HOT A;  1UMK A;  3QRF F;  2QYU A;  4OZZ A;  3O3K A;  1OB5 A;  1T08 B;  3N05 A;  1OGO X;  4XQF A;  5J4Y A;  4OPV A;  2CW0 F;  5E8I A;  2VOD A;  1H85 A;  3HSR A;  2RNG A;  2LBF B;  4ZZL A;  1U78 A;  1R49 A;  3GTM J;  1YJ9 I;  4LBV A;  2DA1 A;  1UD2 A;  2GK7 A;  5D6E A;  3CCL B;  2KKO A;  1QPM A;  4M3E A;  4CO8 A;  1NB0 A;  3PUB A;  1CF7 B;  2CV2 A;  2FEZ A;  5C4J J;  2O7O A;  1S5L C;  3SLN A;  3KZI C;  3W6J B;  1X3Z B;  2D74 A;  5J1R A;  2FX3 A;  3ASQ A;  4E7J A;  1Z7U A;  2Y30 A;  3BZK A;  2E1M C;  4RLZ A;  3WGI A;  2VNK A;  1RR7 A;  1WJB A;  3X2Q H;  1SD4 A;  2A5W A;  1WTH D;  4X7F A;  1KQ8 A;  4I0B A;  2P7C B;  4F93 B;  2PJR B;  2DYI A;  4X07 A;  2KL4 A;  2CQK A;  3HKZ N;  3L2C A;  4PCQ A;  3E1Y E;  2MG4 A;  4QVJ A;  4AYB N;  2LY2 A;  3FMR A;  5D4S A;  4KIF A;  3OYB A;  4AIK A;  2HPM A;  2EIX A;  1NHA A;  1ZM4 A;  3EYI A;  2K7L A;  3KP2 A;  1JJ8 C;  3HTS B;  5EDN A;  3FX3 A;  2DOF A;  3FKI J;  3H5R A;  3MKY B;  2BVM A;  1FYK A;  1S6L A;  1IF1 A;  3OEH A;  5HZB A;  4OPW A;  3CMA B;  1PUF A;  1IDY A;  3M3Y J;  1E1Q A;  1YI2 B;  5AON A;  1TC3 C;  5E1W A;  4IOA F;  5DUI A;  5IP6 A;  2NAZ A;  1G6N A;  3HOW J;  1V5G A;  5DN6 A;  3A0H C;  4X0G A;  2NTP A;  5LGU A;  2O0Y A;  3MZ8 A;  2L01 A;  2YWF A;  1MDM B;  3CJR B;  5LLQ A;  1XG2 A;  2D1H A;  4AUX A;  1XB4 A;  2DFH A;  1STZ A;  5J6X A;  5TY0 A;  2IS2 A;  1FIP A;  1FYM A;  5DV5 A;  2NYX A;  2OD5 A;  1O8L A;  1VQ8 I;  3UNG C;  3OIQ A;  1QO0 D;  3BQJ A;  2WZP P;  2FE3 A;  1ZGJ A;  1D5Y A;  4ABZ A;  2LKP A;  3BH6 B;  2LK2 A;  4XKW A;  1KMH A;  4P26 A;  2BHZ A;  2L2O A;  1QG0 A;  2W82 A;  1QVT A;  3N97 A;  4GFB A;  2VPR A;  1VQ7 B;  3LMM A;  2BGC A;  4LBY A;  4RGX A;  1ZR4 A;  4RPD A;  3O8H A;  1O57 A;  2ZXW H;  4HNT A;  4MIM A;  5J4V A;  4IZZ A;  3A2K A;  3RPU D;  2ZTN A;  2OYN A;  2CK3 A;  5JVG F;  4M73 A;  3TOB A;  3CCJ I;  4BHP A;  2V31 A;  4Z4S A;  2CQQ A;  2DJI A;  1YS6 A;  5H20 A;  5D5V B;  2H8W A;  3KCC A;  1JGS A;  2OPT A;  2F43 A;  4L5J A;  2XAH A;  2KZV A;  2XZL A;  5FLX Z;  1HW5 A;  1FP2 A;  2UXX A;  2OU2 A;  3A02 A;  4B3G A;  3OJW A;  4ENJ A;  3SZE A;  1NHC A;  4CCK A;  2XC7 A;  3CO7 C;  1D8J A;  2KHM A;  3MCZ A;  1BQE A;  2GPJ A;  4MYT A;  2DTZ A;  2RQP A;  4KIC A;  4LD5 A;  1FP1 D;  1KRH A;  2XGE A;  2FBI A;  3HJE A;  3QYF A;  4GGG A;  2P81 A;  3TQN A;  1KK3 A;  5ICG A;  3EYY A;  5LEJ A;  5EG0 A;  2O6W A;  2QM3 A;  2GOM A;  4FT8 A;  2V7X A;  4C3I J;  1A5J A;  4K1X A;  3C2G A;  3HOS A;  2DOG A;  4OIQ F;  1K5C A;  1T2K A;  5K5Q A;  1VQP I;  3PM1 A;  3IWZ A;  3KYL A;  3C7J A;  1K78 B;  2YWH A;  1WMR A;  4W8S A;  1IO2 A;  2J8K A;  2L02 A;  1UD6 A;  1YJN I;  1GVH A;  2CW8 A;  3I59 A;  3SKB A;  1E0E A;  1M1E B;  1U3E M;  2JUC A;  4D1Q A;  4Y7C A;  3H9G A;  5FO1 A;  2V26 A;  2DET A;  2H8R A;  1NJI D;  2OK8 A;  2KDO A;  2MC3 A;  2WPD A;  2XEX A;  3HPG A;  2HQN A;  3F8F A;  4F55 A;  2ZJR F;  3E6M A;  1FX0 A;  2DFF A;  2OTL I;  2NT6 A;  3AK5 A;  2VYQ A;  3O8G A;  2K4J A;  3FDY A;  3ZQF A;  3K70 D;  1I8D A;  2VXZ A;  2HEO A;  1USS A;  4XIC A;  1IV8 A;  4OMZ A;  4L9J A;  2EIN H;  2BV6 A;  2KIS A;  2H1K A;  1Q86 D;  1XMX A;  3OV8 A;  4HST A;  5LHG A;  1UCR A;  4WK8 F;  2XSD C;  3ZZU A;  1VQ9 B;  2XUB A;  3HHG A;  4UVB A;  3R4K A;  1VJS A;  4OJ6 A;  4CYC B;  4CSW A;  2CYY A;  2CS3 A;  3AVY A;  3REO A;  2JA7 J;  3H1C A;  2DCE A;  2L5Q A;  3MMY B;  2DXI A;  1W7P A;  1LEA A;  2XVC A;  3RQI A;  2BVN A;  2Q6O A;  2L0K A;  1X2N A;  1XCB A;  1KQ9 A;  1IG7 A;  4PJJ A;  3I53 A;  5FLM J;  1B59 A;  3BPX A;  3OYG A;  2VBW A;  3N90 A;  1Z0X A;  4XRF A;  4UUS A;  3RY8 A;  4A69 C;  1MBE A;  3RKX A;  4BEH B;  3MKW B;  2K40 A;  3G1O A;  2QY1 A;  3MHP A;  3FMQ A;  3BY1 A;  1T5E A;  3SLD A;  2R7V A;  3LAJ A;  4X7D A;  1R00 A;  4RLQ A;  1NH3 A;  1VQ6 I;  2VFM A;  3GO5 A;  4WZE A;  4FAS D;  1DGW Y;  1V5F A;  3BR6 A;  1OKR A;  2GAU A;  1VBL A;  4OZY A;  4A5N A;  1T39 A;  4YFN F;  5KNL A;  1E3X A;  1MMD A;  3L2U A;  4KIB A;  3KP3 A;  4F91 B;  1EA3 A;  2XC1 A;  4XKB A;  3DBH B;  2XPV A;  1N8R D;  1W0T A;  5DCM B;  4BDZ A;  1S72 B;  1BI2 A;  2Z1D A;  1O8J A;  2DEU A;  4RJL A;  3I3L A;  3LSJ A;  5B1B H;  3CF5 F;  5B6I A;  1F1Z A;  2COB A;  4BS9 A;  2LKX A;  5FD5 A;  2DCU A;  4M1K A;  3CMY A;  1V3F A;  2NS8 A;  4X6A J;  3IH3 A;  3ZR8 X;  1T56 A;  2HDD A;  2CO5 A;  2CQ7 A;  1BX0 A;  1TZL A;  4LC0 A;  2FSW A;  3HYI A;  1AHD P;  4D0P A;  4ZYD A;  3A01 B;  1NDH A;  1VQN B;  3CCV I;  2HPI A;  2HDC A;  2IGK A;  2NOG A;  4M9Z A;  5DS0 A;  1TLH B;  1EFU A;  2O8K A;  1O8E A;  1FRN A;  3HRT A;  1WH5 A;  3P9K A;  4YC5 A;  1VF7 A;  1D3Y A;  2LKS A;  1KA8 A;  1JE8 A;  1APL C;  5FNZ A;  1I5Z A;  3F6O A;  1ACI A;  3BG6 A;  2OBP A;  1CQX A;  1JKO C;  5JVT A;  1E17 A;  2UVF A;  2Y31 A;  4O6J A;  3OR2 C;  1W36 C;  2X53 S;  4BXF A;  1VQ4 I;  2DYR H;  1MD0 A;  2V1N A;  4DZJ A;  2JIZ A;  2IAI A;  2Z99 A;  3ZQ7 A;  4GCV A;  3VR6 A;  1FZP B;  4XRS A;  4ZZD A;  5LBQ A;  2CRV A;  1DBG A;  3U1D A;  3JAM Z;  4DYC A;  3VSK A;  1HKT A;  3TO6 A;  1S7A A;  2KP6 A;  4CHU A;  1G3S A;  2LVS A;  3ABT A;  3QU3 A;  4AVZ A;  4IHT A;  2YUH A;  1P6R A;  4BAC A;  3JTH A;  2Z33 A;  2ETH A;  1YRN B;  4PMH A;  3Q3S A;  3RYP A;  2R7T A;  3GVL A;  2BSP A;  3JAM K;  2VKD A;  3AG1 H;  1ZHF A;  4BPR A;  4G7Z F;  2ZME A;  2QSH X;  2E2H J;  1AKH B;  2OTJ B;  4XN0 A;  4DJA A;  3HOX J;  1QGZ A;  3CCM B;  4TMT A;  1I1S A;  1W34 A;  3BCD A;  4UZE A;  3EQO A;  4GRI A;  4F52 A;  1F5T A;  2CSO A;  3KP5 A;  5FRO A;  1TYW A;  2VE9 A;  3A35 A;  2ELK A;  1B72 A;  5C3E J;  4EJW A;  5D8K B;  1N0U A;  1MW7 A;  2O0V A;  2VBM A;  1F36 A;  1HST A;  5C4X J;  4F7D A;  1CNE A;  2GXB A;  1D0Y A;  2M45 A;  1UEL B;  3RKW A;  2NPF A;  1MSE C;  1QVG B;  1Q1H A;  4A0Z A;  1BN8 A;  1TTT A;  3L7W A;  3ABM H;  1JTY A;  4X8I A;  3HHH A;  5EEH A;  4NCN A;  4BYY A;  1MJ9 A;  4DQK A;  1WFX A;  2VJI A;  3QAH A;  1R1T A;  3OYC A;  5EGO B;  4EH1 A;  2LOO A;  5CVI A;  3CCM I;  2K3F A;  4RBO A;  3HKZ A;  3CXC B;  3WHB A;  3FMS A;  1QGY A;  4UVC A;  9ANT A;  1FBS A;  3JRD A;  5JLV C;  4GYI A;  4Z4V A;  2BM7 A;  1N77 A;  1TQP A;  3CQZ J;  2WBM A;  4HG2 A;  3ZQC A;  1EV7 A;  4B48 A;  1PE9 A;  4D7M A;  2QTL A;  2EA2 A;  2LH9 A;  1IRF A;  2E2I J;  2ESH A;  2XB5 A;  2ZKZ A;  4WCG A;  3SJP A;  4YAL A;  1BL0 A;  2QGG A;  5EZH A;  3L2Q A;  2RN7 A;  4DW6 A;  2YX4 A;  3BJA A;  3OSF A;  1Q9S A;  1KCD A;  2TRT A;  1DUX C;  1E2X A;  4NC6 A;  5GPA A;  1WH7 A;  5K5O A;  3CUO A;  4XSZ F;  3ECH A;  4AC0 A;  3LFK A;  1YLF A;  1F9N A;  1OB0 A;  1PP8 F;  3DTK A;  5F4J A;  5LGT A;  4JX4 A;  5LHH A;  3AST A;  2YU3 A;  3WBJ A;  1WOP A;  2E5Z A;  2NNN A;  4GQN A;  2RGV A;  1ENH A;  3NWS A;  4CH7 A;  4A3D J;  2KPM A;  4E0F A;  3HUG B;  2XTX A;  1W7P D;  2BY1 A;  3D0S A;  2QEX I;  1DPU A;  3KYD B;  1Y8R B;  1RR8 C;  2Z2S B;  3K6G A;  4KJZ A;  1GR1 A;  2IP2 A;  2CV0 A;  4NK6 A;  4RPB A;  2V6E A;  3IAM 2;  2BV3 A;  1FEX A;  3CCS B;  2XF7 A;  2LYC A;  3HRU A;  5ILS A;  4M3F A;  1VQM B;  4B3X A;  4G5G A;  2R9V A;  2QSF X;  2ZXI A;  2EZK A;  4ACB A;  3AVU A;  3GCM A;  3BQZ A;  1BN5 A;  5DCF A;  1IN4 A;  2P8T A;  2X48 A;  3VSU A;  1YE9 A;  2ZTG A;  4TMZ A;  3QWL A;  3GVJ A;  3V8K A;  5GAE J;  3PNV A;  2VNJ A;  1BIA A;  2E1C A;  2VBX A;  3F8N A;  2K9L A;  3KX2 A;  1MH4 A;  3B82 A;  2XNJ A;  4M6X A;  1K73 D;  1WHU A;  1X1B A;  3HIF A;  3QOE A;  1T8I A;  5ILV A;  1B8I A;  3GSI A;  1IN8 A;  2EFQ A;  2HMA A;  3SEQ A;  1WJF A;  4WXD A;  3T51 B;  3Q0V A;  2NVX J;  3BQY A;  4WXH A;  4EEF G;  2D3L A;  2L54 A;  3ZMD A;  1OOC A;  3GTP J;  3H09 A;  3I56 B;  1MGT A;  2VKH A;  3TED A;  3HRS A;  4IX7 A;  1K83 J;  2P6T A;  3S1N J;  1WVR A;  3CUQ A;  5K5R A;  4XRM A;  3MD2 A;  4TN1 A;  1FC3 A;  5GTI C;  4C2L A;  1UZC A;  1SFU A;  2DO7 A;  3BWG A;  1OLT A;  4OJL A;  2LLK A;  2Z8G A;  3OYA A;  1XFO A;  3M1E A;  2C5B A;  2RC6 A;  4YZQ A;  4OU0 A;  5BPI A;  1X1P A;  3VMW A;  3M8F A;  4IO9 F;  2I10 A;  4BBS J;  5GV7 A;  1LLZ A;  1CQT A;  5JHF A;  1L3L A;  1W7P B;  4IKF A;  5D5U B;  2B7C A;  1QHG A;  3JSP A;  1EP2 B;  3BCA A;  4OIR F;  2GQQ A;  1GHC A;  1G7T A;  1Q7Y D;  3NQO A;  3F6V A;  1AIR A;  2DW4 A;  2CQN A;  3TO7 A;  5M3F J;  3QE2 A;  1LKX A;  2EH3 A;  4LBW A;  1WU8 A;  4OIN F;  2V7V A;  3QFC A;  2GA1 A;  5L3G A;  1ETW A;  3A3B A;  1JTA A;  3A4C A;  3RQ4 A;  5D5X B;  1HSJ A;  1RMG A;  4L8J A;  3CZ6 A;  4E7Z A;  1E43 A;  2VL8 A;  3RPQ A;  2UZK A;  1ITY A;  1BC7 C;  1MRZ A;  2RNJ A;  2Q6K A;  2VZL A;  4RD0 A;  3Q3A A;  2QQ8 A;  2CUZ A;  2H1L A;  1IRX A;  2FA5 A;  4TKO B;  4UHT A;  1VI0 A;  4AIJ A;  3JQP A;  1QRC A;  1O88 A;  3NAW A;  3LMW A;  3J7Z I;  3JX8 A;  3BR0 A;  1KTV A;  4I0A A;  1D0Z A;  1H0M A;  3W5V A;  3DFG A;  4P9S A;  2QDX A;  2DQL A;  2D2W A;  2V9P A;  3MQ0 A;  3QPH A;  4PC2 A;  2V4J C;  4PJM A;  4ESB A;  5IT9 Z;  5A8A A;  5J3O A;  1EH8 A;  4IRI A;  2M9H A;  2QVO A;  3D5L A;  4RB2 C;  3F8C A;  3OE7 A;  3C3W A;  1DAB A;  2Z16 A;  1I1G A;  4IHS A;  4PGO A;  2NT9 A;  2WSS A;  2E7W A;  5HDN A;  5ED4 A;  4L18 B;  2VI6 A;  4H9G A;  1LVA A;  1VF9 A;  2OBS A;  1P9Q C;  3U9G A;  3IH2 A;  2XGD A;  4CCJ A;  4Y17 A;  4RB1 A;  2ID3 A;  3QYE A;  2RKH A;  1SAU A;  3RZD J;  2IVM A;  2RVC A;  5TGT A;  4EM2 A;  1YLO A;  1O3S A;  3SJZ A;  5ICF A;  4N9I A;  1QRY A;  4DBR A;  4M3B A;  4V2F A;  2FD5 A;  2GK6 A;  3ESW B;  4RD4 A;  5IY5 H;  3WNC A;  4CCN A;  1R22 A;  3L1P A;  5J8F A;  5BMZ A;  1LLW A;  1Y8Q B;  2PI0 A;  1V5E A;  2ZCW A;  2W57 A;  2R7U A;  4BQA A;  1ZAO A;  3BT9 A;  4D9J A;  2PEX A;  1W9X A;  1E3P A;  3MZY A;  1NK2 P;  2ZZF A;  4GO1 A;  4OOS A;  1ZR2 A;  4ASN A;  2KRH A;  5GTH C;  4LB5 A;  1YHQ I;  1SD5 A;  2DPU A;  1TQM A;  5J1U A;  4ZYE A;  2PE3 A;  5FO5 A;  3T1B A;  2CF4 A;  3GQB A;  4OOI A;  2BX6 A;  4YZ0 A;  2QQ9 A;  3VYR B;  3WE2 A;  3HOY J;  3Q6Q A;  4XD7 A;  2Z5U A;  4TV7 A;  1B9N A;  3BP8 A;  3BZC A;  3QU6 A;  2R7D A;  1TYV A;  4IRH A;  3E6B A;  5DEQ A;  5F4O A;  3AVX A;  2DOD A;  4J01 A;  3CO6 C;  1ODD A;  5IOZ A;  3GEZ A;  1FBU A;  3KZZ A;  2RC4 A;  1MMS A;  3HPH A;  1H80 A;  5CQG A;  4HF2 A;  1RET A;  2V1X A;  2NRA C;  1N06 A;  4M9S A;  2XZP A;  2B63 J;  2DMQ A;  4MFD A;  1XE1 A;  4YZA A;  1B2R A;  5F6F A;  5FGM A;  2EIM H;  4P55 A;  1EF4 A;  2ISY A;  4RM2 A;  3CC4 B;  3BNW A;  4Y9R A;  2H6B A;  2RC5 A;  2DT5 A;  5H6Q A;  1PXZ A;  2ZIT A;  2JWT A;  4G12 A;  1U5T A;  3HTU A;  1R5H A;  1D8K A;  2L4A A;  2YS9 A;  3UR3 C;  4A3G J;  2K27 A;  1RU4 A;  1SMT A;  1SFK A;  4C2T A;  3IC7 A;  3A8J A;  3V7C A;  1BR4 A;  1YQA A;  1SFE A;  2EB7 A;  1DDN A;  1OPC A;  5E8G A;  3HRM A;  5L3B A;  3LYC A;  2Q2E B;  3PSF A;  4XID A;  1PUE E;  2Y69 H;  2G7U A;  3GQ8 A;  3IAS 2;  2VBU A;  2QA4 B;  3EET A;  3OOP A;  4P5O A;  1NK3 P;  3JRC A;  4Z4T A;  2UUZ A;  3ISP A;  1RNL A;  2CV1 A;  2VJ4 A;  2HTS A;  2BM5 A;  4LIT A;  4MTD A;  1IAW A;  4HF0 A;  3ZQQ A;  1FTT A;  2HYF A;  4QWQ A;  4QTR A;  1T98 A;  3CJT B;  3E1S A;  4IQJ A;  2ZO4 A;  3M4O J;  3ABU A;  1YTY A;  4I84 A;  3Q9V A;  4YAF A;  4ZGN B;  1YIO A;  3W2A A;  2EFP A;  1REP C;  1ZUN B;  4IXA A;  3ERE D;  4AID A;  4BGD A;  1IRZ A;  1FTZ A;  4BXU A;  4YXW A;  4PDK A;  2QBY B;  3T53 B;  2PG4 A;  4B4C A;  2DA5 A;  1SVL A;  3K69 A;  3CCE B;  5DS9 A;  4ZYH A;  5LRR A;  3CCQ I;  2KIF A;  4X06 A;  4CQJ A;  4IPA A;  1NTC A;  2IA2 A;  2E1O A;  4P3I A;  2D5V A;  3QOD A;  1LPQ A;  3LSH A;  4BH9 A;  4L0Y B;  1O4X A;  4UZU A;  4RGR A;  4V02 C;  5FJ8 J;  1K6Y A;  2DA6 A;  4Z03 A;  1VZ0 A;  5FRN A;  2O8X A;  4QLC U;  3ASP A;  2NTQ A;  2LSO A;  2QMU A;  5FKO A;  2MLG A;  4NB5 A;  3MMP A;  2HOE A;  3S16 J;  3J7Y J;  1U9N A;  2IS6 A;  3N6Z A;  4W1U A;  2X6W A;  3OYF A;  3ZN0 A;  1BBY A;  1BJK A;  3ERM A;  5B5E C;  3HAG A;  4NDL A;  4UB6 C;  1TWC J;  3SZT A;  3J7A O;  3VSV A;  4XNF A;  1YX5 A;  4Y4R A;  4RD3 A;  5ICE A;  1FOK A;  2GQF A;  4ZCL A;  3H3U A;  3CCE I;  1FDR A;  2M2E A;  2LD5 A;  1W1W E;  3GTJ J;  4MNU A;  1HQC A;  4P9U A;  1F60 A;  4MXN A;  2DDB A;  1LFB A;  3K70 C;  3C1D A;  3LO8 A;  1XD7 A;  4CIC A;  2V7Q A;  4HAM A;  1G3T A;  4FHT A;  3ZRG A;  5HOD A;  1O8D A;  2GJP A;  3IUO A;  4KH3 A;  4HOB A;  3KEQ A;  4IF4 A;  1O3T A;  4M53 A;  4HE5 A;  1IB0 A;  4XM3 A;  4FIS A;  3S1M J;  1TT0 A;  5JLX A;  5CVJ A;  3WTX C;  1COW A;  4TMW A;  4TMX A;  2R7Z J;  2GA2 A;  1UST A;  1KYZ A;  1WGX A;  5JLW A;  1WPC A;  4IJA A;  4KYW A;  4QV2 A;  1E63 A;  4IEJ A;  1KK1 A;  3ZMV A;  2VBY A;  3R61 A;  3FK7 A;  1HC8 A;  1HKQ A;  1OCT C;  2CFX A;  1P4W A;  4OP7 A;  1PP7 U;  1L1I A;  3G4S B;  1C0W A;  3ULQ B;  4XBF A;  1Y0N A;  3CUQ B;  2PQ8 A;  3H9N A;  5AN9 A;  4IHW A;  1Q82 D;  2EA4 A;  2IXS A;  4HQE A;  2O0W A;  1OYI A;  4P3Y A;  1K8A D;  4BJ5 C;  3EQN A;  3BG7 A;  2GOX B;  3WU1 B;  3DLL F;  3V76 A;  3QSY A;  2BVL A;  1ONV A;  4MEY F;  5DUK A;  1O8K A;  3EUA A;  3U1K A;  5DD4 A;  5BSX A;  4X0C A;  1KU2 A;  2DT7 B;  5KCM A;  2FBH A;  1HG8 A;  3WND A;  1PDN C;  3A1P A;  2KQR A;  3OYM A;  3OZV A;  2LNB A;  4U49 A;  1EP1 B;  2Y2Z A;  4Y7N J;  1DP3 A;  4BE0 A;  3RDI A;  4OOV A;  2ADU A;  4YEI A;  1K28 D;  2E1B A;  4BKX A;  5HOO A;  1FMW A;  2FBK A;  2GIZ A;  3QOP A;  1H9T A;  4Z06 A;  1W2B B;  3BG9 A;  4JX6 A;  3LFU A;  3LSG A;  3OZW A;  3VST A;  2HS5 A;  4M3D A;  1B1B A;  3G2B A;  4AU7 A;  3G4S I;  3W2G A;  4YII A;  3AG4 H;  2XV4 S;  4X1E A;  3D26 A;  4XLA A;  2HDN B;  2R92 J;  5KSW B;  1KCC A;  5H6R A;  3CCL I;  3DF8 A;  2BN4 A;  2HU9 A;  3WTT C;  2FVG A;  1E62 A;  2VBK A;  1H88 C;  3S2H J;  1SAN A;  3ZXS A;  4EW9 A;  1D2E A;  2JN6 A;  3HOV J;  3IL2 A;  4AF7 A;  2QX3 A;  3TP3 A;  2VFP A;  1EKE A;  2J5O A;  3A8I A;  1CNF A;  2B7E A;  1ETQ A;  2FOK A;  1S7E A;  3DTI A;  5EMN A;  4RM3 A;  3MEX A;  3BTC A;  1FND A;  2VBT A;  3JW4 A;  3BZ6 A;  2I1L A;  2DAO A;  1AU7 A;  1SAX A;  3PVD A;  4G94 A;  4LIU A;  1LJ9 A;  4E6K G;  2JRM A;  1O7F A;  3GW2 A;  1EA0 A;  3G71 B;  4DYQ A;  1JUM A;  1LFP A;  3I5U A;  1LUJ B;  3MKZ A;  4LG0 B;  2XPU A;  3WTU C;  2MSY A;  3VNU A;  5L3E A;  2N8G A;  5M5Y J;  2V5I A;  4DYR A;  2WR8 A;  5CJ9 A;  1ZH5 A;  3PQK A;  4UZF A;  3CMA I;  1GUU A;  1V54 H;  1ZN2 A;  2IA0 A;  1YI2 I;  2NST A;  4PJN A;  3BR1 A;  1YO5 C;  3H3V K;  2DMU A;  4AD9 A;  3SQV A;  1GXQ A;  1RPW A;  1ZRC A;  1JB9 A;  1HF2 A;  2EBI A;  1BOB A;  2VQH A;  3E7L A;  3JRG A;  4U87 A;  1PJ6 A;  2VNH A;  5L3F A;  1TW3 A;  3OPO A;  3R6S A;  2IRF G;  2NVU B;  1XQB A;  3FWE A;  4RB3 C;  2OQG A;  1BR1 A;  4A5M A;  4A3J J;  3RYR A;  2J7K A;  4X05 A;  3CDH A;  2M7B A;  3QPS A;  5DYM A;  2P4W A;  4DQ2 A;  2IQ7 A;  4CXF A;  2R4G A;  3M1C A;  3K1P A;  2V4D A;  1ZQ3 P;  4QVA A;  5CDF A;  2QZA A;  4L5I A;  4UVA A;  3S17 J;  2ZBV A;  2VFQ A;  4P25 A;  1Q1V A;  2FNA A;  1BM9 A;  4BBR J;  5FLX K;  2ZXJ A;  3OR1 C;  4OOX A;  1AWC A;  1VQ7 I;  5IP7 J;  2JJ7 A;  3B6A A;  5HKK A;  5EZG A;  1E79 A;  4P2N A;  3E20 A;  1G3Y A;  4P6Y A;  3VMF A;  1P7J A;  1XGM A;  4JQF A;  3G05 A;  2BY3 A;  4PC1 A;  3SUC A;  2NS0 A;  2L7M P;  3DLA A;  4UY8 I;  2XGX A;  1VQO B;  2HI3 A;  2BW3 B;  5DD8 A;  1P7I A;  3GQ9 A;  2LMD A;  2HVR A;  3FJO A;  1BLI A;  3CC2 B;  2VQG A;  1V4R A;  3A03 A;  3SDG A;  1XG1 A;  4TMV A;  4WZK A;  1TP4 A;  3QFS A;  1LE8 A;  3SDB A;  3VOE A;  4C30 A;  3ZMT A;  1H8E A;  3PA2 A;  1WWX A;  1ZYR F;  2PN6 A;  3GXO A;  4FXU A;  1SVO A;  4G7O F;  4KMU X;  3CCU B;  4OIO F;  3AG2 H;  1LDK B;  2FU4 A;  5E1Z B;  1EJ9 A;  2M30 A;  1NG6 A;  1OCR H;  4NQW A;  4EMS A;  3TKY A;  2NNY A;  4A0Y A;  3V7S A;  4DIQ A;  3S3O A;  2BGI A;  2EFN A;  1R5N A;  3VNV A;  4PZJ A;  2QKM B;  1SFX A;  1YW9 A;  2HTJ A;  2XGJ A;  4HBL A;  4QHY A;  3A0B C;  3I4M J;  1X0C A;  5ILU A;  2JRT A;  2HYJ A;  1VQO I;  3PSZ A;  2RAE A;  3LQE A;  1Y39 A;  2Y75 A;  3AGQ A;  4H0E A;  4HLY A;  3W6K B;  5FKN A;  1EXM A;  2EV6 A;  1ETY A;  2P5K A;  1O8M A;  4D7N A;  3FM3 A;  4A3I J;  4IL6 C;  4II2 A;  4KIS A;  3JRB A;  4XLF A;  4ZV4 A;  1S8N A;  2CRG A;  4Y52 J;  1EH6 A;  3ZCO A;  4CCM A;  4FE4 A;  2F5D A;  2ZC2 A;  3ML3 A;  4FK8 A;  1DP7 P;  1HXD A;  4U4B A;  2AXT C;  3RSN A;  1QH0 A;  5A88 A;  2XKO A;  5HNH A;  2XF5 A;  4QPO A;  5FD6 A;  4RLF A;  3GFM A;  4LK1 F;  2HVS A;  1VQ9 I;  3CP2 A;  2F1L A;  3SEJ A;  4X7C A;  2DA4 A;  1O3Q A;  4Y15 A;  2XT4 A;  3KLN A;  3WY9 A;  4XLP F;  4Q4Z F;  3F21 A;  3P5J A;  4X7E A;  3PSI A;  1QVF B;  2GWR A;  3DKW A;  4WX9 A;  2EZH A;  3W2W A;  1MBG A;  1TWA J;  3K1N A;  4KFC A;  3FXJ A;  3OW2 B;  1H8H A;  1R5I D;  4C3H J;  5C1C A;  1LM1 A;  4N4N B;  1IGN A;  2FOW A;  1Z3X A;  1RQR A;  1ZRD A;  1N0V C;  1IXC A;  2GM4 A;  1QA2 A;  5IYC J;  1KK2 A;  2YUS A;  2JZY A;  3PUF A;  1WOO A;  4RD1 A;  5IYQ A;  3OFN A;  4PAB A;  5B1A H;  1GQ8 A;  3PUN A;  4JYK A;  2DI3 A;  4HF1 A;  3S1Q J;  1OFM A;  3BJ6 A;  3ONY A;  1WQ2 A;  3ASN H;  4HNU A;  4QUZ A;  1XMK A;  2XAQ A;  3CMM A;  5B3S H;  2Y9Z A;  3K9T A;  5LFA A;  1J9Z A;  2X9D A;  2R5Y A;  1SKQ A;  3OJX A;  4JP0 A;  4P96 A;  2OQR A;  1YFH A;  1R4N B;  1V55 H;  5HS8 A;  1P4M A;  2YR2 A;  4MHG A;  2A3S A;  1FSE A;  3CRZ A;  2ECB A;  2YPR A;  2O6G E;  3COA C;  2IGO A;  2QE7 A;  2CC2 A;  4HDV A;  1IZ1 A;  1OR7 A;  1JHH A;  3LWF A;  5F1J A;  2H6C A;  1S72 I;  4PAA A;  3FXQ A;  1UD4 A;  4RM0 A;  3VDX A;  4PFO A;  1WP6 A;  2L4M A;  2LF7 A;  2OJE D;  2E5N A;  3ECO A;  4IHY A;  2HR3 A;  2ICW G;  1HOM A;  3VO1 A;  5D8L B;  3F3X A;  2VBS A;  1I50 J;  3WGG A;  2VFN A;  5J35 A;  4XOT A;  4XLE A;  2XOK A;  2CND A;  1FX7 A;  1K6O A;  3JRF A;  1D8T A;  4BL0 B;  4G6I A;  3ZQI A;  1VQN I;  1TTY A;  1GJR A;  2BM0 A;  4LIV A;  1KU9 A;  1QX4 A;  2A6E F;  1A35 A;  5F27 A;  2CUE A;  1N75 A;  3OYD A;  2BGJ A;  4Q5S F;  2KLO A;  2NVT J;  1LEB A;  2CG4 A;  1ZKG A;  1FOY A;  5J3L A;  1OGI A;  3WWG A;  4B3A A;  4A3K J;  2BZT A;  5L3C A;  3OAA A;  1RQP A;  2DFI A;  2K85 A;  1E3Z A;  4CCL A;  2QUF A;  2CH0 A;  2JA6 J;  4E70 A;  1A36 A;  2VXD A;  2BPO A;  4M2L A;  1BW6 A;  2X1E A;  3EUH C;  2M5S A;  2EK5 A;  1CZF A;  2JJ2 A;  4NUB A;  1PJR A;  2HKO A;  3AVW A;  3TH0 A;  5E1X A;  1FOW A;  2NOJ B;  3IRR A;  5FL7 A;  3T56 B;  3OL4 A;  1HF0 A;  2BF4 A;  2CUJ A;  3JRI A;  2XAU A;  1R7J A;  3TMO A;  3LSP A;  1YIJ B;  2VT2 A;  2E7X A;  2EFG A;  3WU2 C;  3W5U A;  1Y0Y A;  4A93 J;  2DU9 A;  1W5T A;  4B44 A;  3I54 A;  1ZLK A;  5JMC B;  2F2E A;  2A05 A;  2W6J A;  2QCO A;  4ZCI A;  2JT1 A;  4YHB A;  3S2W A;  2HOA A;  2VLA A;  1OGM X;  1BR2 A;  3FXO A;  2P5L C;  3ZMU A;  3I4P A;  5HZA A;  5HDG A;  1FPQ A;  1Z91 A;  3BCB A;  1I27 A;  2OTJ I;  3GRH A;  3OYH A;  2A61 A;  5JHU A;  5A89 A;  4YAU A;  3B4N A;  2DMT A;  4W8R A;  3DCF A;  3F0C A;  2F4O B;  4MYU A;  2VB6 A;  2MC4 A;  3DV8 A;  3I71 A;  1P2F A;  1L0O C;  3IP4 B;  3LAP A;  1PUF B;  3WG9 A;  1RIO H;  2GIV A;  5TR9 A;  5LEK A;  2K5C A;  2WJY A;  3D5R C;  2HWV A;  2E19 A;  4RAF A;  1R58 A;  3OZU A;  4ON0 A;  2VKE A;  2YSR A;  2VUM J;  4K2E A;  3GF2 A;  3LA3 A;  4G7H F;  3TDZ C;  1ZGW A;  1QCX A;  3ZQH A;  4KUM A;  4LFU A;  4A2U A;  2X6Y A;  2XKP A;  3K7A J;  1GVD A;  4YAW A;  4FCY A;  3DU6 A;  2DK8 A;  4KN4 X; 
#chains in the Genus database with same CATH homology
 3QYE A;  1SAU A;  2XND A;  1PLU A;  3EPZ A;  5TGT A;  3B8Y A;  2MAB A;  3BC8 A;  4DBR A;  4ZYA A;  3FBN B;  3HOT A;  4OZZ A;  1VLY A;  2GK6 A;  3DWL E;  3N05 A;  1OGO X;  4XQF A;  1SKY B;  3ONQ A;  2RRE A;  4CCN A;  2R7S A;  4W8T A;  4PSW A;  2RNG A;  4XMY A;  1V5E A;  2LBF B;  4ZTF A;  3A3G A;  2FUG 2;  2R7U A;  4HIZ A;  1IA5 A;  2V7F A;  1UD2 A;  4D9J A;  1W9X A;  3C2H A;  2GK7 A;  2ZZF A;  4BDY A;  2KRH A;  1WJE A;  3PUB A;  2CV2 A;  4DBQ A;  3BC9 A;  2XZO A;  3H5N A;  2NZM A;  1G8X A;  3GQB A;  3HG9 A;  4YZ0 A;  2LC2 A;  3VYR B;  3CES A;  4XD7 A;  4XOP A;  2JUG A;  4E7J A;  2CMP A;  2E1M C;  3JUR A;  3K4B A;  1AA7 A;  1WJB A;  4J01 A;  2A5W A;  2K9M A;  2ZSI B;  4DGW B;  1WTH D;  4F93 B;  1Y56 A;  2PJR B;  3HPH A;  1H80 A;  5CQG A;  3NE5 B;  2XZP A;  2KL4 A;  2F4I A;  3SZG A;  4BQO A;  1Z3Y A;  1NG7 A;  2LY2 A;  2VQC A;  3S32 A;  4YZA A;  4PFP A;  2QKL B;  3OYK A;  1UG0 A;  4RM2 A;  2R7Q A;  3OYB A;  3TBI A;  3FPP A;  1I18 A;  2HPM A;  1PXZ A;  2ELJ A;  3J7A Y;  2X6X A;  4J00 A;  3MKY B;  3H5R A;  2BVM A;  3UR3 C;  4C9Y A;  3OEH A;  1V0F A;  1RU4 A;  1SFK A;  1E1Q A;  4YZX A;  3V42 A;  4C2T A;  1BR4 A;  2KRC A;  2O5R A;  1BMF A;  1V5G A;  2Q2E B;  3PSF A;  4P1W A;  4X0G A;  2KVO A;  5DN6 A;  2NTP A;  2O1D A;  3GQ8 A;  2ODL A;  3IAS 2;  1XG2 A;  3CJR B;  4KKT A;  2ZZE A;  4P5O A;  2IS2 A;  2UUZ A;  4TSF A;  2CV1 A;  2VJ4 A;  3A1Y A;  4LIT A;  1O8L A;  4MLO A;  3I9V 2;  3ZQQ A;  1IDK A;  2WZP P;  2MD0 A;  3OIQ A;  3UNG C;  3JU4 A;  1OR7 C;  3E1S A;  4IQJ A;  1KMH A;  4XKW A;  4R79 A;  1UD3 A;  2L2O A;  4I84 A;  3UW0 A;  2W82 A;  3W2A A;  3SEZ A;  4BGD A;  3DQV C;  3LMM A;  4YXW A;  5LD2 C;  4HNT A;  4FET A;  5CKT A;  2V9K A;  4G6T B;  2LBF A;  4IZZ A;  3A2K A;  2XDV A;  4YEJ A;  3RPU D;  2ZTN A;  1HZE A;  2CK3 A;  3T53 B;  4OJO A;  2V31 A;  2DJI A;  3CP8 A;  2F43 A;  4HRI A;  1RWR A;  2P0W A;  3K4L A;  2KZV A;  2XZL A;  3L2V A;  4KKU A;  3QOD A;  4B3G A;  3DDY A;  1NHC A;  3LSH A;  4CCK A;  2E1M B;  2XC7 A;  2UWM A;  2KHM A;  4BQQ A;  5CPR B;  4UZU A;  1K6Y A;  2E60 A;  2M4G A;  3QYF A;  4BUP A;  1VZ0 A;  4Z03 A;  5FRN A;  2NTQ A;  4KKS A;  1UAA A;  2PJR A;  3PL8 A;  1DQU A;  2GOM A;  2ZXH A;  2IS6 A;  1KON A;  2X6W A;  3OYF A;  1U0J A;  3C2G A;  3HOS A;  2CFO A;  3AKZ A;  1UD8 A;  3HAG A;  1K5C A;  2L9N A;  3FHN A;  4HPQ A;  2M0M A;  3KYL A;  3VSV A;  4XNF A;  4W8S A;  1YX5 A;  4Y4R A;  1WMR A;  4XLC A;  1UD6 A;  2X8K A;  5CQE A;  1O8G A;  3E0J B;  5HLT A;  2CW8 A;  2JJ1 A;  2WAE A;  1E0E A;  4N4O B;  4D1Q A;  3H9G A;  2V26 A;  4MXN A;  1X1A A;  3K70 C;  1JI8 A;  4MR0 A;  2KDO A;  1G59 A;  2WPD A;  2V7Q A;  3ZRG A;  3HPG A;  4F55 A;  1O8D A;  1FX0 A;  2GJP A;  3IUO A;  2NT6 A;  1WJA A;  3L2R A;  3S93 A;  3W3C A;  3FDY A;  4PJL A;  3K70 D;  4XM3 A;  2VXZ A;  1I8D A;  3OEE A;  4XLH A;  1TT0 A;  1COW A;  1FMV A;  2M7A A;  3HXL A;  2NSP A;  1BPL A;  4HST A;  2INV A;  4AYB A;  1WPC A;  2GJR A;  1QU3 A;  1VJS A;  3LSM A;  1MMA A;  4OJ6 A;  1IB4 A;  2OUM A;  4JOM A;  4CSW A;  3OYI A;  2CS3 A;  1MMG A;  3WQZ A;  2DCE A;  2L5Q A;  3OIP A;  3CF2 A;  3MMY B;  2DXI A;  4CCO A;  1D0X A;  2K3P A;  4NK8 A;  3H9Q A;  3PJR A;  4DOZ A;  2UV1 A;  2XSJ C;  4PJJ A;  3BH4 A;  4P22 A;  2IXS A;  2O0W A;  4BJ5 C;  3OYG A;  3ZSC A;  2ZSH B;  3EQN A;  3BG7 A;  2GOX B;  4BE2 A;  2BVL A;  2M3A A;  2VAS A;  4NNJ A;  4BEH B;  3MKW B;  1O8K A;  3EUA A;  2PYH A;  2WB1 A;  3D5S C;  2MYS A;  2QY1 A;  2DT7 B;  5KCM A;  1HG8 A;  1T5E A;  3OY9 A;  4DK0 A;  2KQR A;  3OYM A;  2R7V A;  4U49 A;  1DP3 A;  4RLQ A;  4BE0 A;  4DNR B;  2VBE A;  1O8F A;  3DU5 A;  4FAS D;  1K28 D;  1DGW Y;  1V5F A;  2E1B A;  2JVH A;  2RQQ A;  1FMW A;  5HOO A;  2WJV A;  3HC7 A;  4OAZ A;  2ZZG A;  4Z06 A;  1VBL A;  1HA8 A;  4DK1 A;  4OZY A;  3LFU A;  3LSG A;  3VST A;  5KNL A;  3OS1 A;  3S8P A;  1MMD A;  3G2B A;  4AU7 A;  3L2U A;  1ERD A;  1E3X A;  2XF6 A;  4F91 B;  3QYB A;  4XLA A;  1EA3 A;  2O17 A;  1KCC A;  3K4N A;  1MMN A;  4LG3 A;  4XKB A;  4ZDL A;  2HU9 A;  2VBK A;  4PUS A;  3ZXS A;  4BDZ A;  3FKJ A;  4EW9 A;  2Z1D A;  1R6R A;  4ANJ A;  4QPQ A;  1O8J A;  3I3L A;  4BS9 A;  1Z7L A;  2QX3 A;  2JSP A;  3OW7 A;  2VQL A;  3DTI A;  3FBI B;  3ZR8 X;  3KRG A;  4RM3 A;  4PK4 A;  3H9J A;  4NQW B;  3M8J A;  1TZL A;  1Y6I A;  5KHD A;  2HPI A;  1X1D A;  2BOL A;  4E7S A;  2WA0 A;  4LIU A;  4E6K G;  2IGK A;  1J09 A;  3K10 A;  1X19 A;  1O8E A;  1EE6 A;  2KMU A;  1O8I A;  1LFP A;  3MKZ A;  1VF7 A;  3H0D A;  4YEL A;  3DPU A;  4BE1 A;  1JRG A;  2LY1 A;  2Z6B D;  1QJV A;  3BG6 A;  3ZIA A;  4ZC3 A;  2UVF A;  1W36 C;  2X53 S;  3OR2 C;  3ZPP A;  4BXF A;  5AMV A;  3K4J A;  4HEA 2;  2V1N A;  2NST A;  1MND A;  4PJN A;  2JIZ A;  3VR6 A;  3OYN A;  2VPL A;  2W00 A;  1BOB A;  2M4K A;  2VQH A;  1DBG A;  4U87 A;  4II3 A;  1W36 D;  3VSK A;  2KP6 A;  3OPO A;  2JA2 A;  4AVZ A;  1BR1 A;  3GQ7 A;  3AFH A;  4BEH A;  4BAC A;  4PMH A;  2M7B A;  3NWT A;  2AQE A;  4H4K C;  2R7T A;  1NBM A;  3GVL A;  2R4G A;  3M1C A;  2BSP A;  2V4D A;  3VYS B;  1X4P A;  2VKD A;  5CDF A;  3RTR A;  4OWR B;  4YRV A;  1D1B A;  3OR1 C;  4XN0 A;  2IGN A;  2R7O A;  4DJA A;  5HKK A;  1E79 A;  2OV7 A;  2LRD A;  3BCD A;  2WAQ A;  4XN3 A;  3EQO A;  4GRI A;  4JQF A;  4F52 A;  3G05 A;  4E4H A;  3RCO A;  4ZDP A;  1PKV A;  5FRO A;  4G7X A;  4EAT A;  1DBO A;  3A35 A;  3DLA A;  4BU2 A;  3B90 A;  3SUC A;  2HNH A;  3GBG A;  3S3M A;  1MW7 A;  2W7N A;  2L7K A;  2A6T A;  2BW3 B;  3S3N A;  1YX3 A;  2O0V A;  2VBM A;  3GQ9 A;  2HVR A;  1BLI A;  3DTE A;  2VQG A;  1D0Y A;  4ZDO A;  1UEL B;  4E7K A;  1BN8 A;  3SDB A;  4C30 A;  1H8E A;  4B3F X;  3F9K A;  4FXU A;  4KIT B;  2F6C A;  2ZFU A;  3OS2 A;  1MAB A;  1WFX A;  2VJI A;  2LRE A;  3BLY A;  1LDK B;  3OYC A;  4ITV A;  3OYE A;  5C1E A;  1NG6 A;  1V0E A;  1DGR M;  2LOO A;  1O8H A;  2HLD A;  4DIQ A;  4BJT A;  4BJ6 C;  3PNY A;  3S3O A;  2NTB A;  3HKZ A;  3OL3 A;  2QKM B;  2QXZ A;  4IQ4 A;  3GVK A;  2XGJ A;  4RMN A;  1X0C A;  2JVG A;  1N77 A;  3TL4 X;  2WBM A;  4HG2 A;  4BQN A;  4ZJZ A;  2WAF A;  4G7W A;  4E7H A;  4F92 B;  4B48 A;  1PE9 A;  2LH9 A;  3K4C A;  4CA0 A;  1O8M A;  2JDI A;  2X1D A;  4II2 A;  4KIS A;  3L2Q A;  4XLF A;  4JMQ A;  1KCD A;  4CZC A;  1W0J A;  5FRM A;  3GQA A;  3ZCO A;  4CCM A;  2WY7 Q;  2VJ5 A;  4F3Q A;  1WJC A;  4B43 A;  4U4B A;  2IS1 A;  1HVX A;  1OB0 A;  3RSN A;  3DTK A;  2LG4 A;  1MNE A;  2D3N A;  5HNH A;  2XF5 A;  2AQF A;  4QPO A;  4RLF A;  1PYV A;  2HVS A;  3DPL C;  2E5Z A;  3CP2 A;  3H5A A;  4GQN A;  3NWS A;  1WJ5 A;  3DKY A;  2Q1Z B;  4HSR A;  4CH7 A;  2KPM A;  3H94 A;  4E0F A;  3HUG B;  4Z05 A;  3PSI A;  2LZJ A;  4URR A;  3W2W A;  2Z2S B;  3K6G A;  4KJZ A;  4XL9 A;  2CV0 A;  1H8H A;  4NK6 A;  3OOU A;  4OJP A;  5C1C A;  2V6E A;  3IAM 2;  4Z1M A;  1S9H A;  4N4N B;  2XF7 A;  1Z3X A;  4XR6 A;  2LYC A;  2BW3 A;  3OWT A;  4B3X A;  3AL0 C;  2I8D A;  1WJD A;  2R9V A;  3OFN A;  2ZXI A;  4E7I A;  1T0F C;  3U21 A;  1GQ8 A;  1OFM A;  3VSU A;  4HNU A;  4TT3 A;  1YE9 A;  2ZTG A;  3SYT A;  3CMM A;  2UVE A;  5LFA A;  3GVJ A;  3T9G A;  2F5V A;  3VSL A;  2VIX A;  2W6I A;  4ZTJ A;  3PNV A;  3KEW A;  1GLN A;  3VWB A;  2K9L A;  3KX2 A;  1X1B A;  3QOE A;  2DOA A;  3BCF A;  2O04 A;  3SEQ A;  1WJF A;  2HQA A;  2IGO A;  3KEY A;  2QE7 A;  3T51 B;  3K4M A;  2D3L A;  1OOC A;  1BHE A;  2MFZ A;  2L9S A;  2X1C A;  2VKH A;  3PFY A;  4IX7 A;  3CJQ B;  5IK2 A;  1UD4 A;  4Y3O A;  4PFO A;  3VDX A;  1NRK A;  1WP6 A;  2E5N A;  3OYL A;  1D1A A;  1QHH D;  3MD2 A;  4E7L A;  4HWV A;  4C2L A;  3LSK A;  4XOT A;  4XLE A;  4XOR A;  2XOK A;  4OJ5 A;  1OLT A;  4OJL A;  4BL0 B;  3PNT A;  4G6I A;  2Z8G A;  3L2W A;  2GJK A;  3OYA A;  4YZQ A;  4LIV A;  2X85 A;  1UD5 A;  3DPT A;  3VMW A;  1N75 A;  4NC7 A;  4XON A;  3OYD A;  1N78 A;  4XKC A;  5JHF A;  2KLO A;  4C2U A;  3W2V A;  4IKF A;  2PYG A;  4U7B A;  1QHG A;  2DT6 A;  3WWG A;  1EFR A;  3BCA A;  3OAA A;  1E3Z A;  4Y33 A;  4CCL A;  4CUG A;  2IS4 A;  2CH0 A;  2VXD A;  1AIR A;  3VMV A;  3VYT B;  2X1E A;  3EUH C;  1LKX A;  2M5S A;  1ZEL A;  1CZF A;  2R7R A;  2JJ2 A;  4NUB A;  1PJR A;  2W4S A;  3T56 B;  2NOJ B;  3A3B A;  5FL7 A;  3A4C A;  3RQ4 A;  1JTA A;  3OL4 A;  2CUJ A;  2XAU A;  3TMO A;  2DIE A;  1RMG A;  1T95 A;  2WAD A;  3CZ6 A;  4E7Z A;  2VL8 A;  1E43 A;  4L8J A;  3DEE A;  1X4O A;  1KZL A;  3LL7 A;  2CUZ A;  4B44 A;  4NC8 A;  3HL2 A;  1IRX A;  3AL0 B;  1D1C A;  4TKO B;  3DKX A;  5HVQ C;  2W6J A;  3ZGK A;  1O88 A;  4XKV A;  2VJJ A;  2Y0S A;  2VLA A;  3OMY A;  4PSX A;  1BR2 A;  2PMZ A;  4ASU A;  4DNT B;  2F1M A;  1OGM X;  3LMW A;  2R7W A;  1W0K A;  2X51 A;  3OYJ A;  3OOC A;  1LVK A;  3BCB A;  1IDJ A;  1KTW A;  3GRH A;  4KT6 A;  3OS0 A;  3OYH A;  1D0Z A;  2CW7 A;  4OAY A;  3B4N A;  2IQ7 A;  4W8R A;  2W1O A;  1Z21 A;  2VB6 A;  2MC4 A;  3IP4 B;  2X3H A;  3EUK L;  2V4J C;  4PJM A;  4B47 A;  3LNN A;  1OFL A;  2INU A;  2ZZQ A;  2HZD A;  3FY3 A;  2K5C A;  2OC6 A;  3K4K A;  2WJY A;  3D5L A;  2EWE A;  2WY8 Q;  3D5R C;  3H35 A;  3FKS A;  2PEC A;  2R7X A;  3OE7 A;  2IGM A;  3VYU B;  2Z16 A;  1OHH A;  4W8Q A;  2NT9 A;  2HDW A;  2WSS A;  5HNF A;  1QCX A;  1X1C A;  3ZPN A;  2HVQ A;  2X6Y A;  1P9Q C;  3LSI A;  4CCJ A;  1E1R A;  3DU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...