2VJIA

Tailspike protein of e.coli bacteriophage hk620
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Bacteriophage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN
total genus 229
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjiA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjiA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjiA02
1PLUA 3SUCA 4Z03A 2X6WA 4OJLA 4XKVA 4OJPA 3GQ8A 1K5CA 4C2LA 4OJ6A 4XLCA 4XOPA 4NK6A 4YZXA 4XL9A 2X3HA 4XKWA 4YZ0A 2UVFA 1KTWA 2NTQA 4XM3A 4XLFA 4XOTA 1QCXA 4XLAA 2BSPA 2NZMA 4Z06A 1RU4A 1KCCA 4U49A 4MR0A 2VJIA 2X85A 1O8HA 2EWEA 2Z8GA 3EQOA 2O1DA 4XLEA 2O04A 1O8KA 1IA5A 1AIRA 3T9GA 4XORA 4AVZA 1PE9A 1O8DA 3B90A 3FY3A 4XNFA 2VJJA 1RMGA 1NHCA 1O8GA 2NTPA 4URRA 3VMWA 1IDJA 1VBLA 4OZZA 4XN3A 2NSTA 1OGOX 1OOCA 2NT9A 4XLHA 4EW9A 1JRGA 2X6XA 2QX3A 1WMRA 2ODLA 1OFLA 1O8EA 3UW0A 1KCDA 3VSVA 2O0WA 1DBOA 3ZSCA 2NSPA 4YZQA 2VBEA 5AMVA 2PECA 4OJOA 3VSTA 3ZPPA 2INVA 1O8JA 4YELA 4XQFA 2O17A 4PMHA 4XN0A 3LMWA 1BHEA 1RWRA 2IQ7A 4W8SA 4OJ5A 4XMYA 1IDKA 1IB4A 4I84A 2VBKA 4YEJA 2QXZA 3VSUA 1O8LA 1O88A 1O8IA 2O0VA 3B8YA 4XR6A 1H80A 2X6YA 3GRHA 1DBGA 3GQAA 4NK8A 3GQ9A 2NT6A 1XG2A 4HWVA 4U4BA 3WWGA 2UVEA 2NTBA 3EQNA 5C1CA 2QY1A 4W8RA 1OGMX 4XONA 1GQ8A 1JTAA 3KRGA 1O8FA 3GQ7A 3VMVA 1PXZA 4W8TA 1EE6A 5C1EA 2VBMA 2PYGA 2INUA 1O8MA 1OFMA 4Z05A 1QJVA 4MXNA 1HG8A 2PYHA 4OZYA 1BN8A 4W8QA 4YZAA 1CZFA 3JURA 3B4NA 1X0CA
chains in the Genus database with same CATH superfamily
1ZGWA 1VQLI 3OJXA 1TBXA 2FRHA 1BJAA 3VB2A 1A35A 1G2HA 3BC9A 2XGCA 5HZAA 1RKTA 4EM1A 1GO2A 2CW5A 3CW2A 2VFPA 1U0JA 2HQNA 3VR6A 3ZQHA 3JRIA 4HNTA 1A6QA 4KICA 1QVUA 4KIGA 4C3IJ 2FBIA 4B43A 3QPSA 3GLXA 2DOFA 4N0BA 2JK3A 4M53A 2DI3A 1P9QC 5DCMB 1Q1VA 1UZCA 1QCXA 2VN2A 2BSPA 1KCCA 2J8KA 2KKOA 3OS0A 4D7MA 2ZBVA 4DYCA 1LB2A 2L9SA 1FP1D 3LWFA 1VF7A 1W34A 3W5VA 4RM0A 1W2BB 3OSGA 2RGVA 1G7CA 1Z7LA 1TWGJ 1S72I 1TC3C 3GW2A 2C4TA 2Q6OA 4QVJA 3CCSB 1HF2A 1MBFA 2DFFA 4J01A 1JKPC 1BPLA 2KL4A 1IA5A 4AC9A 1ODDA 4OOIA 4Q7JB 3F8FA 4IOCF 1ETWA 2H8WA 2Q2EA 2O8XA 2XGEA 3PUFA 4DOZA 3L2VA 3LVBA 3OL4A 3EUKL 3K70D 2STTA 1QFZA 3ELKA 2E7WA 5LEJA 2XPVA 4IRHA 4I0AA 3BG9A 3VOEA 2MLGA 3K4NA 3W2VA 1VBLA 2PFBA 4I99C 2OV7A 4XICA 2DPUA 2KIUA 3CCVI 2K3FA 1RR8C 3ZMSA 5EF6A 2DCUA 3A1YA 1KYZA 3ASNH 2QTLA 2O3FA 2Q6KA 3Q9SA 1J7KA 3K9TA 3JU4A 2O0WA 1CNFA 4CCNA 3SKBA 2LC2A 1NG6A 4F91B 4P55A 3FKJA 3QODA 4P1WA 2OPTA 1S72B 3ZPPA 1WTHD 4QUZA 3L09A 1W7PA 5E8IA 4L9JA 1MDMA 1UAAA 2LF7A 2GIZA 2X0KA 2CRVA 4E7IA 3SDBA 5FLMJ 1I8DA 1XE1A 3AGQA 4KKTA 4PMHA 3DCFA 3GZ6A 4A3DJ 3ZRGA 1VZ0A 1TTYA 2AO9A 2DT7B 2ID3A 1FOKA 4KT5C 4HW0A 1RQPA 3ZC3A 4LK0F 3K4MA 3A8KA 4V02C 4GQNA 3QOPA 5LGNA 4A3IJ 4DNRB 3SQNA 4RB1A 1XS9A 4XLNF 4AVPA 4PFOA 3COAC 3AK5A 4EJWA 3OOCA 2KZGA 4MHGA 3I59A 1J5YA 1ZM2A 4A0XA 5D5XB 2EH3A 2LMDA 1HVXA 3QYFA 2EB7A 3ZXSA 5LD2C 2HYJA 1MRZA 4U4BA 2BHYA 2D1HA 4S0HB 1F5TA 2JJ1A 2VJ5A 1QGYA 2EIMH 1VQ7B 2EFGA 4M6VA 3A03A 3HZJA 2LDUA 4ZYAA 1GQ8A 4P9UA 2X1CA 3BOQA 3D5SC 3K4CA 5CYVA 3S17J 3M07A 2JA7J 4ZGNB 3C2GA 4C3HJ 1N08A 4M1KA 2FNAA 4A2UA 5J8FA 5B5EC 3SLDA 2R0QC 4BXXJ 1MBJA 4LG0A 3R6KA 1HW2A 3BJ6A 4IO9F 4LOCA 3S3OA 1BN5A 2A69F 3WTXC 1ACIA 2RC6A 3OEEA 5TY0A 4U0VA 1ZAOA 2FUG2 3ECHA 5IOZA 3KIOA 2BYVE 2AS5F 4UXNA 1V0FA 3SZPA 4RD3A 2JMWA 2CYYA 2DQRA 4HV5A 2M34A 1FMWA 2K27A 3SUCA 1BI1A 1B8IB 3GTMJ 1VQ6I 4P22A 3WTSC 1TQIA 3K6GA 5DD4A 2DN0A 2FBKA 4HEA2 1O3QA 1LPQA 2QCOA 5E17F 1N05A 4M0LA 2X3HA 3ZUGA 1VHEA 5IYBJ 4U7BA 2W6IA 2KPMA 2QGUA 1K6YA 3BR0A 3FZVA 1B72B 4KKSA 4GYGA 1P2FA 4Z2YA 4AIDA 3PO2J 5F4MA 5JR3A 4XLAA 1ON2A 1PYVA 4FCYA 2GK7A 2VFOA 3SEQA 3V8KA 1OQYA 1R6RA 1SD7A 4L5IA 2WYRA 1U5TA 4RPDA 3CLQA 2DT6A 2P3MA 3CP2A 4IQJA 2XIGA 2ZSHB 5A89A 1EH7A 1ENHA 2FBHA 3DQVC 1QVGB 1KA8A 1I3AA 1KTVA 3FPKA 3Q9VA 2L2OA 1Z05A 3BDDA 1A5JA 1USTA 5F27A 1IZ1A 3RDIA 2WZPP 4PJNA 3IWFA 2VZLA 1H8AC 3VWBA 4G9YA 1IJFA 2JUGA 3OMYA 1Y0RA 1KD1D 4XORA 4Y33A 4NQWB 5FRNA 1AA7A 5DV5A 5CKTA 2FMYA 5J1YA 5JLWA 2ZKZA 4CQJA 2HGCA 1R71A 4QWQA 3OSFA 1OB2A 2Q6LA 1W7PD 4ENJA 2YU3A 3KLOA 1X4PA 2VB6A 3KFWX 1JT6A 3LQ6A 1OGOX 3PQKA 4XLHA 1P92A 4D1QA 1VQNI 4CA0A 1G3TA 3CCEB 1KQ0A 2COMA 2L7MP 2QA4B 4MQVA 3L7WA 2PMZA 4UY8I 5EEHA 1TLLA 3HM5A 3PSZA 1MBGA 3G3ZA 1BI2A 1WJCA 3ZGKA 1BJZA 1K83J 1QGZA 2XHKA 2XAGA 1CF7A 4AC0A 3ES9A 1YYVA 2CJJA 4BYYA 4ZZLA 4PJMA 5H20A 4Z4SA 1T2KA 5IT9K 2DA4A 1S9HA 3HEFA 2BBYA 3CCUI 5F08A 4BBSJ 3R61A 4A0ZA 1YIOA 3F8NA 3H5NA 4BJTA 4KYWA 2NS0A 4HLXA 3DEUA 4BXFA 1RI7A 1FX7A 3SZTA 3UR3C 4BQOA 1NRKA 1R58A 4XMYA 2ZZGA 3VNVA 5EJCA 2I10A 3OAAA 1DP7P 1W0JA 4HA8A 4HDVA 1O7FA 4G7ZF 3GRHA 2IA2A 1UD2A 4HZFA 4U88A 5D5UB 5C44J 4HWVA 3WWGA 2WPDA 1I18A 1OLTA 4HF0A 3L00A 4ASNA 2EIKH 2O5RA 3FM5A 3LNQA 4D7NA 5KSWB 5E3MA 1KQSB 4JYKA 4AIJA 1O8FA 1JA1A 4M3EA 1J09A 4YIIA 3QFTA 2GM4A 3ABUA 1PJ6A 4P3IA 1I7PA 3CD6I 2DJNA 4DBQA 4DYRA 2V79A 4BGDA 4WF2A 1D0YA 1OGJA 4YHBA 1CNEA 1E17A 2EIJH 1HBXG 4XKCA 4P9SA 1GAWA 1MNEA 1FNNA 3PUBA 3G4SB 3F8CA 2QF7A 5FKNA 2WAEA 4JX6A 3OZWA 1C0WA 2Y0SN 3HOSA 1GV2A 4CCOA 3A01A 1WJEA 2V7TA 1K5CA 3LSRA 3O2PE 3LNNA 1KQ9A 4HPQA 2IEKA 5J8CA 4RLFA 2IRFG 3EYIA 3BY2A 1LLWA 2KIFA 1IW7F 2K02A 5DD8A 4ZYDA 1QGPA 2A5YB 4I7HA 1NJID 2HXOA 2M0MA 2ZMEB 3WXMA 3CDIA 3I55B 1N06A 1XMKA 2RKHA 5K5RA 2AXTC 2CBXA 4DQ2A 2ZC2A 4P9FA 1EA0A 2Y9ZA 3ASSA 2RVCA 3R0JA 1T56A 1DP3A 1YI2B 4NBQA 1HA8A 3NRVA 1NK3P 2GXAA 1EJ9A 2B5OA 1SVLA 5EMNA 3I3LA 1MBKA 5IT3A 1QGAA 2EFOA 2LSOA 4NNJA 4F92B 3OR1C 4ABZA 2C4UA 2NT9A 3TEDA 1B6AA 1EWYA 1S4MA 4S05A 1XN7A 3GXOA 3R6SA 3J7ZI 2M87A 2ECCA 2GWRA 1TTTA 2E36A 4BHCA 2Z1DA 1RNLA 2RAEA 2NXNB 2TCTA 3QRFF 5DTDA 4PC6A 3TKYA 2F3LA 3H3UA 2V7FA 3Q0UA 5TGTA 4E6KG 4RM2A 1K78A 2VBXA 2QQBA 4ZTJA 5B66C 2P0WA 4KKUA 4DGWB 2V4DA 2WSSA 4OP7A 5B1BH 1ZG1A 3HJEA 1AKHA 3I4PA 1EKEA 3OYFA 2DY1A 3CESA 2OAZA 1NBMA 1VQ5B 1R23A 1FIPA 4FN5A 3I58A 2VNJA 2V9VA 4HNVA 3LQEA 1KZLA 1USSA 3P27A 2V1UA 1U3EM 2CMPA 4B8XA 2FEZA 3ZIAA 2V31A 1P4AA 4FWTA 2DIEA 3RPUA 4HX7A 3CPXA 2ZFUA 4HX4A 3WY9A 4LC0A 2KIQA 2W85A 2IS1A 3AVYA 2F4NA 2LY1A 3QPHA 4L5EA 4C30A 5EEAA 3E0JB 1QRCA 1YJWI 1ETVA 1O3SA 3M1CA 1FSEA 2XPWA 2R7XA 5GAEJ 2OJED 3K7AJ 1TT0A 4CICA 1G8XA 2J8IA 2KJBA 3ZQIA 1BC7C 2P6TA 1CQXA 5CDFA 4M6YA 1IXSB 3P7NA 2V1XA 2HDWA 2INUA 3PETA 1B4AA 1GAQA 1BM9A 3KZIC 2VNIA 4A3BJ 3CCQI 1V5EA 2K4BA 2FF4A 3E5QA 4L5JA 5H6QA 3GYHX 2PJRB 5BSXA 2IOUG 4B3AA 2UWMA 1R1TA 3A1PA 4Y7NJ 5EGOB 3K1MA 5L3GA 1X19A 3DP7A 4CUGA 2Z2SB 4I0BA 4EATA 3JQQA 3RPUD 2F1LA 3S1QJ 1PP7U 3GSIA 3MMPA 3WBJA 3GTPJ 3MEXA 3ASTA 2KDZA 4HG2A 4G6QA 1AKHB 5TV2A 1LDJA 5FD5A 5J40A 2GIVA 2DOAA 3I1FA 3CTAA 3N90A 2YUHA 4LJZF 1O3TA 2DU9A 3CCEI 4I2OA 2K7LA 3MKWB 4OOVA 4ZC3A 4J0QA 3VO1A 4Z06A 1HC8A 2ICWG 2QYUA 2R92J 2HQRA 2XF5A 2MW8A 5KNLA 2V6CA 4IW3B 4C2MJ 4I01A 5A2QK 1WZ2A 1XGSA 2Z3YA 2O1DA 4F7ZA 1M1KD 1MH3A 3AG4H 4AU7A 3OYNA 2HZDA 3J7AO 4Y9UA 3HPHA 4IL6C 3TW7A 1K7AA 4KDPA 4TV7A 1FBQA 3P9IA 2DCEA 5K7HA 1D8JA 3I56B 2Y0MA 3TDZC 1OCRH 1WP6A 4G1VA 4DNCA 2CQ7A 2VNHA 1KC8D 2RC5A 2XNDA 4DJAA 4PCQA 5E20A 3JRFA 3HL2A 1PE9A 3BY1A 4ZV4A 5HLIA 3WGIA 3RKQA 2CU7A 3MMYB 1NHCA 2XASA 5HS7A 3W6KB 1BI0A 1S29A 5KHDA 1Q7YD 2DA3A 1IRFA 5J35A 2QTZA 2STWA 1ZREA 5JVGF 1ERDA 3LA7A 2QGGA 1YQAA 1BR1A 2DTZA 4WCGA 4UB6C 3FM3A 2LR8A 3G71B 4J00A 3TO9A 2RREA 1OYWA 3A3BA 1FY7A 1MH4A 3CCRB 1MNDA 4WXHA 4XBFA 4YEIA 4IVNA 4OPSA 1T5EA 3Q3AA 1XC5A 2HWVA 2RDPA 3BR2A 1RPWA 2PECA 3TGNA 3C1DA 3RKWA 1QA2A 2EFQA 2LLKA 1GDTA 2VKDA 2IGMA 2K9NA 1BI3A 4AD9A 1OFEA 2Y48A 1WHUA 2VNKA 3Q6QA 4UVCA 1E1RA 3ZZTA 1I27A 6PAXA 2LY9A 3OY9A 1MSFC 2BW3B 2K3PA 1P4XA 2IW5A 1IDKA 3P9KA 5E3NA 3U21A 3AVUA 2OBRA 2VJ4A 2PLYA 4KFCA 5EYRA 4EM2A 3OW7A 3KX2A 1IUFA 1XSXA 1BIAA 2X4HA 1W1WE 2QEXB 2XGDA 2G7HA 4J19A 3KE2A 4CCLA 1O7LA 1Z7UA 5D5WB 1E0EA 1YITI 1MZBA 2XB0X 5FKMA 3J80Z 4BDZA 4YAOA 1UCRA 3DKXA 2I5UA 2YX7A 1O4XA 3FHNA 4FE7A 3Q39A 1I6XA 1R7JA 1AOYA 3H0DA 3HRUA 5HLGA 2G0YA 5J6XA 1YOVB 1TZLA 2HYGD 4YFKF 1U5TB 3CRZA 1DPRA 3IRQA 3JCUC 3G73A 1ZR2A 4GRIA 4LB5A 1SD4A 1DU0A 1Y8RB 2JVHA 2CS3A 2YUSA 3B78A 2L0KA 2PYHA 3N6ZA 3F6OA 3CC4B 3CC2B 2P4WA 1S7EA 2CV0A 3S2HJ 5IY5H 2VXDA 1SVOA 3UNGC 1HQCA 4V2FA 1W87A 1WOOA 3EYYA 3TMOA 3ONQA 1W7PB 3LSPA 1MDMB 1JNYA 2GJKA 2KLOA 3IAS2 5EDNA 2IT0A 2OQGA 3MZ8A 4XIDA 3L2QA 4IJAA 2R7RA 4UUTA 1Z6TA 1JI8A 1P7IA 5HDKA 1U5TC 4R8HA 2PMHA 3SJZA 1YJWB 4E7KA 3EPZA 4XLPF 1GVDA 3CO7C 3JRGA 4MTEA 1A8PA 4U49A 2QENA 1H89C 2IGKA 1XB4A 3S3NA 5LBQA 3PIOF 3B82A 4XLEA 3WG9A 2FX0A 3PFIA 2WJVA 3WU2C 3OP1A 4PSXA 2NS8A 3W6JB 1E3OC 2ZNYA 4L9TA 4YFOA 2VIXA 2PMUA 3U2RA 2MFZA 2VKHA 3HKZA 1ZM4A 4DQLA 1E3PA 2R5ZA 4MEYF 1WDTA 2Z6BD 2VKVA 5GPCA 3KLNA 2PJPA 2D3LA 3NB2A 2LTPA 1VQ5I 3HC7A 2A05A 2C6YA 1W5TA 1B1BA 3KP6A 3J81k 1OMIA 2MC3A 4OMZA 5B3SH 3CXCB 3BPXA 1FP2A 3BCBA 2IVMA 5D6EA 3I53A 4PC2A 2OTJI 1EP3B 1U8RA 3DEEA 2YWHA 1T08B 1WMRA 1IXCA 2JPCA 4E4HA 4UUVA 3P5JA 3BR5A 4L0ZB 4M6XA 2VQCA 2V7XA 5IYQA 4CCJA 5GPAA 1PJ5A 2A3SA 1KJZA 1VF9A 5L3DA 2JTVA 2JRTA 2AXLA 2W1OA 3ERED 1NHAA 4PZJA 2YWEA 3PA2A 1BX0A 1V4RA 2HOSA 2L9VA 2BV3A 1F60A 1EFCA 2RQQA 4HV6A 5E1XA 2M4GA 2TDXA 3FXOA 3LOCA 4II3A 1K61A 1YX3A 1D3YA 3BJAA 3H9QA 5TISC 2IQ7A 1TYWA 1LDDA 4MFEA 2DA5A 4FQGA 1WSUA 2LFBA 4QIWN 1KU7A 3BQZA 2CGPA 3FJOA 4LD5A 3H09A 4Y52J 3CJNA 3VSUA 3FMSA 5DS0A 1O8LA 1VQ8B 1XSDA 2CQKA 1TYUA 4P3YA 4FTHA 2M45A 3RZDJ 3G05A 2L5QA 1ZELA 1RC9A 3ZOBA 3CPWB 1X1BA 3DDYA 1UHMA 3S3MA 4NQWA 1WGXA 1E3ZA 3OYKA 2D9RA 3CUQA 4JX5A 2VE8A 4R1HA 2Y9YA 3BZ6A 2IS6A 1JGSA 4NDLA 3PA1A 1MMDA 2XGXA 1D5VA 4OAYA 4NBSA 5F0CA 3GIRA 3S1MJ 2Q2EB 3U1DA 2ZZQA 4PGOA 5J3OA 1JT0A 1KYWA 2GXGA 1V55H 3KCCA 1WH5A 2VBZA 5EG0A 4RGSA 1GR1A 1CZFA 1FBSA 2GOXB 3HHGA 1PUEE 4DK1A 3D1NI 4EM0B 2DQLA 1G7TA 2DDBA 1F20A 1TNSA 2XTXA 1OCOH 4KH3A 1ONVA 4BHPA 1UHSA 5TJJA 3JR9A 3VYRB 1V54H 3A02A 1FNBA 1ETKA 4NC7A 1YLOA 2X9DA 3H3ZA 4UZUA 3CUQB 1JE8A 3QYEA 1T6ZA 2XVCA 4RJLA 1MJAA 5IYDJ 1KTWA 1BX1A 1FT9A 4XRFA 3CJTB 4XLFA 1K4TA 2AHOA 1SKQA 3SLNA 2W00A 1S0UA 2QQ9A 5FLVA 3OYAA 1B9MA 2COBA 4BHBA 1RKWA 2R3SA 1UD6A 4KISA 3FPPA 2R7UA 1R00A 3FXKA 3GFIA 5A8AA 4Y9RA 4N4OB 1N75A 4C3JJ 1XGNA 1JJ2B 4UV9A 2OC6A 1KK1A 5F0FA 2DOGA 3R60A 3CF5F 3OKXA 1K4SA 2VXZA 1M1EB 1R22A 3LFKA 4M3FA 4UHTA 2AQEA 4DZJA 2P5LC 2XC7A 1L0OC 2M5WA 2DFHA 3V4GA 3CC7I 3OJWA 3KP2A 1LLZA 2QMUA 2NSTA 3C2HA 2HFHA 1TYXA 2E1MB 1HDDC 1ZQ3P 2B63J 2BVNA 3ZQQA 1SAXA 5FKOA 2F4OB 2X6XA 3RJPA 3OZVA 1KGSA 3CCSI 3HGYA 1YX2A 4OIRF 2DODA 2WC2A 3UW0A 2JVGA 2QKMB 4AF6A 3HBLA 3VSVA 1LQ1A 5DEQA 5EEGA 2YPRA 2QWWA 4LGWA 3T1BA 1QQ1A 2IXSA 5AMVA 2EJRA 1JGGA 1RUOA 3BQYA 2KRHA 2EFPA 4O6JA 5KCMA 4TMXA 2JN6A 5LHIA 3AKZA 1QA3A 3HOTA 3K10A 1IHMA 1FYMA 1DG1G 3WYAA 3KP7A 5M5WJ 3K4LA 2PX9A 1Z9CA 3KETA 1S6LA 4B4DA 3VODA 2JA8J 5IP9J 3NEUA 4PC1A 2H1LA 2M0CA 1IN5A 2EV6A 4OWRB 2VQGA 5J1UA 3OW2B 5B1AH 3M8FA 4DNTB 3H92A 3FK6A 3ZMDA 4PJ0C 2YU9J 3DKYA 1VQPB 4YEJA 3K2AA 3O3KA 4ESBA 4V19K 4ITVA 4KNYA 2P7CB 3IP4B 1B8IA 2VBWA 2DMTA 4EVIA 4M3DA 1HCRA 3RI4A 1ZG3A 2X1DA 3RTRA 3K1NA 1A36A 3P4GA 5FLXK 1MJBA 3CUOA 1FEXA 3AVWA 1OGMX 1IRZA 2NYXA 2FD5A 1KU2A 1MABA 3CMEI 1ON1A 3ERMA 4YAUA 3ML3A 2DMPA 1F9NA 3L2RA 4GO1A 2VBMA 2L7FP 1ZRDA 2JSCA 2BSAA 2VKEA 1L3LA 1SFEA 2DMNA 1VQ8I 4WZEA 4ZZDA 1OCTC 1HG8A 4A3CJ 3CMAI 2XGJA 1RZ4A 1X58A 2UXXA 5FO0A 2XT4A 2V4JC 4PC3A 1U8BA 4FK8A 2H8RA 1I1SA 2DA6A 4LBYA 4Z4WA 1KQ5A 1W5CC 1KQ8A 3G71I 3Q0VA 5F64A 1A6IA 1ETOA 4A3MJ 2QE7A 4Z03A 5J4YA 2AHQA 2ZXHA 4YIFA 4N3GA 4KJZA 4Q47A 4Y4RA 2F43A 3IUOA 1DQUA 5F04A 1IUYA 1YIJB 2KJCA 1GHCA 4W97A 1U2RA 2VT3A 4X0CA 1U9OA 5GADJ 4EJVA 2HKOA 3ZQ7A 1Z0XA 3JRBA 2E2JJ 1DDIA 5H5JA 3S93A 3HKZN 2NTQA 2KDOA 4XOTA 3V7SA 2RNGA 4PFPA 4RLQA 1FSHA 1QZYA 3WNDA 1W0UA 3GFMA 3VYSB 3E7LA 2Q8KA 4RGUA 4QPQA 2OTJB 2EWEA 2R7WA 2V26A 1E64A 4UV8A 3U6KA 4GCVA 1G7SA 1SKYB 2YR2A 3QFRA 3GQBA 5KK1A 5F6FA 3Q0WA 3OFNA 2KISA 3I0TA 3B8HA 3NWSA 1IO2A 2O6WA 1YRNB 1AIRA 3FKIJ 2AQFA 1A31A 2BM0A 4RLZA 1GLNA 1JTXA 2DW4A 3CUQC 4JRAC 2BW3A 2M7BA 4HSTA 4KN4X 3MVPA 4RA2A 1WOPA 2PMDA 3A4CA 4JOMA 2RV8A 4XN3A 4RB3C 1F36A 5GTIC 4KT6A 4CZCA 1E3HA 4YAWA 4YCQA 2W57A 2WADA 2RNJA 4G7OF 1XB2A 1VQOI 2QBYB 2WJYA 2R7OA 3HSEA 3L2WA 1VI0A 3G6EB 2FJ1A 2NVYJ 3E6MA 2JQ7A 1DPUA 3OPOA 2F5CA 5AONA 2ZMEC 1W4MA 3E5XA 3K0LA 1GVJA 1WJDA 2FOKA 1ITYA 1S3JA 1UFMA 1TT5B 2E5NA 1D0XA 3CCVB 2XZPA 1OHHA 1ZUNB 4QPOA 1VNDA 1RWRA 4UUSB 3LJYA 2GQFA 2XNJA 2XB5A 3CC2I 3U9GA 1VQ9B 1ZLKA 2QXZA 1SFOJ 1PKVA 1YW8A 4A3GJ 3RKXA 1G4DA 2A68F 1G59A 5C4JJ 1O88A 4LBVA 3PM1A 2ZXJA 1DBGA 4HE6A 5CVIA 1B59A 3S15J 1W36C 5KAIC 3ZPLA 1DU6A 1QHHD 1TWFJ 4MYUA 4IZZA 3BG6A 1MW7A 3LFUA 4M74A 3OIOA 2NVUB 4YIRX 1QA1A 2QY1A 1ZARA 3BG5A 3FMQA 4PABA 1P4MA 5AN9A 2F48A 5CVVA 1SFKA 1HDPA 2X0LA 1VQNB 2MH9A 1SMTA 3QYBA 1F43A 4JK1X 2YWFA 2MGQA 1V5FA 2QEXI 1LVKA 3F9KA 4EH1A 4MIMA 2ZSIB 2BM5A 4AWXB 2BY0A 2K9LA 4CXFA 2Z9OA 5JMCB 2FX3A 2XSJC 1I5ZA 2QM3A 2K86A 1JUSA 3R4KA 2CQNA 3HOXJ 3LYCA 2R7SA 2LKXA 2X1EA 2VFMA 1HLVA 4IOAF 2HCJB 3TQNA 3GTGJ 1PUFA 4IHVA 2C5BA 1XDSA 3SEZA 5FGMA 4BACA 3F23A 4OJLA 2LK2A 4OJPA 1Z21A 3S2DJ 2JRMA 3M9AA 4JX4A 1EFUA 2FXAA 4FETA 2HOAA 1T6SA 3GTKJ 1W0KA 1J2XA 2R4GA 2Q0OA 4ZDLA 1ETQA 2O8KA 2ZCWA 2IAIA 1ULYA 2G0EA 3K4JA 4PGHA 4RBOA 3CCRI 4ZCLA 1RU4A 2NZMA 4MO7A 2MG4A 3CF2A 2R5ZB 3GX4X 5HS9A 1X3UA 2Z8GA 1WU8A 4BE0A 1SMYF 3H1CA 2KZVA 1VQKI 3CCJI 4IF4A 5FO1A 2VPLA 3WGHA 1HF0A 3T9GA 4P26A 2IGNA 4EJOA 5BMZA 3BWGA 3BZCA 3B90A 1O8DA 3JAMK 4HDUA 3Q5FA 4OPOA 4FXUA 2HPIA 4IPAA 2KP6A 2UV1A 4OU0A 3ASOH 1LUJB 1XTAA 2BY2A 3DPUA 2HEOA 4BUPA 1RETA 3FXJA 4BQQA 3R6JA 1D1NA 1EH8A 1JB9A 4OPWA 1Y0UA 3MD2A 5KAFC 2P7VB 2LBFA 3SYJA 3LMMA 1D8KA 2EIXA 2CFOA 3DTIA 4A12A 2ODLA 4FX4A 3LSGA 1OFLA 4UZEA 2B7EA 2V9PA 3PNVA 1T38A 1P4WA 2HU9A 1I3QJ 4BU2A 3LSJA 2HTSA 2K9SA 1R1UA 4P25A 1O57A 2LY2A 2HLDA 5EZHA 3GEZA 1D1AA 4I6ZA 3AL0B 3HIFA 4A5NA 1O8JA 1TNTA 5THXA 1DGRM 3QQAA 4X7CA 1GV5A 3VEPA 1LE8A 2K4JA 2DTRA 3LAJA 1FNMA 1UG0A 2ZJRF 1MD0A 3BCAA 3CO6C 3W2EA 3W2FA 3NE5B 3RKYA 1IDZA 3CCYA 2XRLA 2O0VA 1PVEA 2LOOA 3HUGA 5HKKA 1H80A 3ZMUA 4IKFA 1NDHA 3GQAA 1L1IA 2Z5UA 3HOUJ 2L7KA 5M3FJ 2KRCA 2EBIA 4BEHB 3I64A 3CCQB 3EQNA 1H8EA 5CVJA 5H6RA 2HDNB 5ILUA 1SANA 2GOMA 5BPDA 2EFWA 4IHYA 3BCFA 2L4MA 4O3MA 5C4XJ 4A69C 1VLOA 3AGPA 3PUMA 1PXZA 2BPOA 1EE6A 3WNCA 1YTYA 3E97A 1TQMA 2B7CA 1V5VA 3SEJA 2VFNA 3DV8A 2V5IA 1OKRA 2DFIA 2GBYA 3G1OA 3HRMA 3H35A 4HAMA 3H36A 4QV2A 4RDJA 3T5XA 2BHZA 3BTJA 2P8TA 3KL9A 2Y31A 3U6BA 2M9HA 3CP8A 2HYFA 4HBLA 4GFBA 3IKVA 3M4OJ 1BQEA 5FRMA 2M2EA 4I98B 4OM9A 3MKLA 4HNUA 4YRVA 2JZYA 3C18A 5GV8A 1IN4A 2FNPA 2HQ5A 1QRYA 4Y15A 3ZQCA 3VPRA 4DYQA 4XL9A 1T0FA 2DDAA 3ZMZA 4CDGA 2HOEA 5ICFA 1R4NB 1V5GA 3OIPA 5IT9Z 1EF4A 3HTUA 1WORA 3HUGB 3IHUA 4C43A 3IKTA 1LVAA 2XF7A 4X6AJ 3WTVC 1IV8A 1UHWA 4B3FX 5HXBA 2VJIA 3V42A 3OYDA 1PDNC 3WTYC 4BEHA 3BH4A 5ICGA 1SM4A 4ON0A 3OV8A 1E43A 4WX9A 3LSIA 1U2WA 5E3LA 1IRGA 5CQEA 1BLIA 2PI0A 2CG4A 5LRSA 1LJ9A 2G7UA 1HSJA 4ESJA 1PJRA 1W35A 4ZCMA 1R9TJ 1J9ZA 2EZIA 2FVGA 3JAMZ 2ECBA 1BL0A 2XNCA 2BGIA 3V76A 4G6IA 2WV1A 3E1SA 5F4JA 1D1BA 2FA5A 3FXMA 1X1CA 3RQIA 2GA2A 3DFGA 2HZTA 2XROA 5F1RA 1K8FA 1UJ8A 2R7DA 5A88A 1X4OA 2R6HA 3CCLI 4IX7A 1YO5C 1OCZH 5DCMA 3GZNB 4B4CA 2NRAC 4TMZA 1QHGA 4FASD 3QE2A 2IPQX 2MD5A 2A6TA 3DXJF 1XGOA 3L2CA 2BN4A 5CPRB 3CB4A 1TYVA 4PK4A 2CQXA 4AF7A 4RAFA 4X8IA 3DKWA 3LO8A 3VSTA 4LFUA 5HNHA 2ZJPF 2R5YB 2BOLA 3B6CA 4EEFG 2E7XA 3AFHA 3HYIA 5IYPA 3DLAA 1TWHJ 4E7SA 3BR3A 2GK6A 3OYIA 3FBIB 1E3XA 1HZEA 4ZH4F 3WTTC 3A35A 1SAUA 3B73A 2KVOA 4X7EA 2MH2A 4DIQA 1EFTA 3BTIA 2R7VA 3WG7H 5K1YA 2ELJA 2VBKA 4E7HA 3EUHA 3G2BA 5ERIA 4N9HA 1PJ7A 3G4SI 2CF4A 2V7WA 5FB2A 2H27A 2R7QA 4CYDA 2CNDA 4GGGA 2B9SA 5J47A 4DW6A 1WJFA 1CF7B 1X1PA 3PFYA 4P12A 2ZXIA 4F7DA 4U0YA 1J0RA 5CLSA 1HOMA 1WXRA 1U6GA 2XF6A 3K70C 4WZTA 3U1KA 3SFZA 1YFHA 1GXQA 2CUZA 1Y1VJ 3IH2A 3REOA 1ZR4A 2A5WA 1BA5A 3GVLA 1JTAA 2D74A 1FOXA 1Z1DA 1WSRA 4LLLA 4CHUA 1EV7A 2ME0A 3NAUA 1LFUP 4LBZA 3AVXA 4I09A 1BOAA 2ME6A 2EFNA 1OCCH 3WODF 4GDFA 5DM6F 3PNTA 3ZP5A 1Q1HA 3PSSA 3K2ZA 3ZN1A 4A3EJ 1JKOC 2PLFA 1IG7A 1BW5A 1S8NA 1YRNA 2LZJA 1KU3A 3H0GJ 2E35A 2WY8Q 5DN6A 2QSFX 3GFLA 5B6IA 5DS9A 4QFMA 5EG0B 3CCUB 1JJ6C 2MSYA 2OU2A 3FBNB 2WBMA 3OWTA 1QFYA 4TSFA 1Y8QB 3QPTA 4C2LA 5C3EJ 3RQ4A 2WR8A 1RUNA 1XGMA 2LP0A 4D5FA 5TR9A 5D4RA 1NB9A 1FZPB 2FQ4A 1AHDP 1ZRFA 1LDKB 1J59A 4XM3A 5IP6A 2V7QA 1ETYA 3G6EI 3WBKA 3JW4A 1LNWA 5K7FA 3LA2A 1WJAA 5L3FA 1DUXC 3EQOA 2ZO4A 2DK8A 2ADUA 1GUUA 3VNUA 2JSPA 5FROA 5HZBA 4BJ6C 1RRJA 2IBDA 1X2NA 2UXNA 4YFNF 2CUFA 3ESWB 4G7HF 1YITB 1R1VA 4Z6YA 1KK2A 4WQMA 3QFCA 3D5LA 1E1QA 1OB0A 3BR1A 2XTWA 2O7OA 3F21A 1FRQA 2MD0A 3RCOA 1UD5A 2MBFA 5AIQA 1QUFA 2NTPA 1D0ZA 1XCBA 2ZITA 2L3DA 3VMWA 5LMZA 2UZKA 1WKMA 4MEXF 3K1PA 2JA5J 4X0GA 4M3BA 2EZKA 5BPIA 2OA4A 1YX5A 1ZK8A 2QDXA 3PUNA 4EW9A 2E1CA 3VDXA 1FYKA 1JXSA 3ASQA 3ZZUA 3IH4A 2OYNA 5L3EA 3BZKA 3E5UA 5M3MJ 4QHYA 2N8GA 5K5QA 3DU1X 1DBOA 1J9IA 1ZTRA 4HYEA 4ZTFA 2F5FA 4HE5A 5HDGA 4MYTA 3PVDA 3SQVA 1COWA 3W2IA 2EWNA 3ZBUA 4PJLA 4DK0A 1X2MA 2OD5A 2VQLA 4M9SA 4WWVA 4LIVA 2FU4A 5HLTA 1T6XA 2XSDC 1ZM3A 4LBWA 2DA1A 2DLLA 3E1YE 1FNCA 2V1DA 4XN0A 4P6YA 3W3CA 1M90D 3A01B 4FE4A 3AVTA 3N97A 1WPCA 1S7AA 1JA0A 2CSOA 1MMGA 1TQPA 1MJ9A 2IGOA 3DPLC 4IHTA 1XPXA 2V7VA 2NOGA 2L4AA 3WE2A 3A8IA 4AIHA 1O8IA 1ZKGA 2C77A 2ZTGA 2DJIA 1WH7A 5ICCA 2XV4S 4G5GA 3GQ9A 2E1BA 1FPQA 2HVQA 3LSKA 2VBTA 3SJMA 3S8PA 1MMNA 3NQOA 2R7ZJ 4W8RA 3FXQA 2VE9A 4XONA 1YS7A 4PC7A 3AG1H 3SJPA 1OFDA 2P6SA 4C2UA 3KRGA 3GLLA 3OR2C 2D5VA 3H9JA 4IRIA 5BQTA 5DCFA 3FXUA 1XX5A 4UZFA 4W8TA 3ZQFA 5HODA 2F5DA 2JDIA 4F52A 2CO5A 1QBJA 3J81K 2W82A 4HRIA 3NWTA 1QJVA 2DYRH 1ZGJA 2BVLA 2PQ8A 3VSKA 4UUSA 4CYCB 1T8IA 2VODA 3IV5A 4EQQA 4LMYA 3ABMH 3FWEA 1GJRA 3S16J 1SD5A 2BXZA 2M4KA 2ZL6A 2R5YA 1GT0C 2ESHA 3HSRA 4M72A 5LHGA 1LFBA 2ID6A 3BLYA 2Q1ZB 4RB2C 2WWYA 3BQJA 4M3GA 3ONYA 3LA3A 3ONUA 2QSHX 2X8KA 2KT0A 4FT8A 3TO7A 3FX3A 4WZLA 1FYLA 3FIWA 3JRCA 2XZOA 4UVAA 3KZZA 4Z4YA 2CW0F 2ETHA 2CRGA 5HDNA 2DMQA 2EV0A 2F4IA 1WOSA 4Q5SF 1DDGA 2M3AA 2X85A 4TN1A 3J7YJ 1BC8C 4XSZF 3MAJA 2O04A 2BGJA 5E6TA 2LKPA 2XZLA 2F6CA 3IL2A 1WFXA 2Q6IA 4U0WA 2KHMA 3HSFA 1HW1A 4ZDOA 2ZJ2A 4M9XA 3W2HA 4AVZA 2QQ8A 4OMYA 1AMOA 2DETA 3PIPF 4WZKA 2QYOA 3T8RA 2M8EA 3CJQB 1OB5A 1N78A 4BY7J 3OYBA 2DAOA 1Y1WJ 5H2FC 4E0FA 2DA2A 4HOBA 2VLAA 4OZZA 1JUPA 2CH0A 4N4NB 4XRSG 1KMHA 1YW9A 3GBGA 2DOEA 3D0SA 1JRGA 1YS6A 4Z4RA 1T98A 2D2WA 4A0YA 3BPVA 2MABA 1WSVA 2HKXA 1O8EA 2XAHA 3WTZA 3ZSCA 3KYLA 4LITA 3WU0A 1N8RD 4YZQA 3KEQA 2GPJA 1XD7A 3OIQA 1Q9SA 4XSXF 3RYPA 4OJOA 3N05A 2XAUA 3GTOJ 2HDDA 4OIPF 5L3CA 3H94A 2E1RA 2F4MB 2O03A 3O6BB 4BAYA 3LQRA 4KMFA 1B2RA 1FC3A 1WI9A 1D2EA 4H4KC 2OBTA 3HAGA 5FFXA 3FKSA 2ZMEA 3WGGA 5HS8A 4ETSA 4G94A 4PJJA 5FLXZ 4TKOB 5GAHJ 1YLFA 5DNSA 3ZMVA 2M30A 2LNBA 4RD6A 3V7AA 3RPQA 2HNHA 4I84A 1S7OA 3MWMA 5GAGJ 1XG1A 4RB0A 1T0FC 4MFDA 1IJEA 1E63A 3ZBTA 3LSMA 1TLHB 2X6YA 1FOYA 1B9NA 3IH3A 4UVBA 3X2QH 3DU6A 1OR7C 1HW5A 4U87A 1SFUA 1X3WB 3MHPA 1O3RA 5C1CA 4GXOA 1DARA 1YI2I 1NB0A 1QG0A 5L46A 2DPDA 3W5HA 3CCJB 4LG3A 1EA3A 4QSHA 4ANJA 4FX0A 5KW9A 2BXYA 2H6BA 2WB1N 1VQ6B 3MKZA 5HVQC 4PGGA 4ZDPA 5C1EA 4U9UA 1UD8A 3ASPA 3I71A 2VPRA 3NARA 1QRBA 5DUKA 1H8HA 1OISA 1YHQB 3HOVJ 4M4SA 4RCZA 3AL0C 4MTDA 1QPIA 1EFRA 1R5NA 4TMVA 3TDUC 1BN8A 5GP9A 3ZQGA 5IK2A 4W8QA 5JI6A 3JURA 3B4NA 1MBEA 2NV4A 2VYQA 2O9LA 1JKQC 2IA0A 3ZR8X 5E8GA 3DU5A 3SDGA 5IPAA 1G3SA 3ZMTA 5IYCJ 4BJ5C 1KK3A 5FL7A 1FIAA 3ISPA 1U78A 1E79A 2BGCA 3OYCA 3M7GA 4JP0A 4RDKA 1EP2B 3H5AA 3TW6A 2Y75A 1T33A 1JTYA 3A0HC 4GYIA 4RM3A 4D9JA 1FTTA 3I56I 4XOPA 4NK6A 4YZXA 2E5ZA 2R93J 3EUAA 4QVAA 4G12A 4RAZA 2JPBA 1N0UA 4YZ0A 2A61A 2JJ7A 2F1MA 4TT3A 2OQRA 2CUEA 5J4VA 2ZBKA 4CZZA 1H9GA 4B1RA 3QSYA 1TUIA 3MQ0A 4E70A 3HTSB 1NTCA 3TP0A 4BBRJ 1R5BA 1VHOA 3HG9A 1ZN2A 4A5MA 4H9GA 3U2QA 3AG2H 5HLHA 3T53B 5FD6A 1BW6A 3ZPNA 4YDTA 3AG3H 2LRDA 4Z4ZA 2DMUA 2E1MC 4WXDA 1O8KA 1FDRA 5LRRA 1LKXA 2WY7Q 5ICEA 1HKQA 1R5HA 4F55A 2BM4A 1EZGA 2J5OA 4A93J 2IJLA 5FFZA 1D8TA 1V3FA 4JMQA 4RDLA 2VJJA 5AIPA 3FY3A 3O8GA 2LBFB 1SC7A 4Y7CA 4B3GA 2WA0A 3G1LA 1JHHA 4OINF 2IS4A 2FOWA 2ZBUA 4TMTA 3JTGA 2HXIA 2W6JA 1IDJA 4DBRA 1SD6A 3OOPA 1R5ID 3BNWA 2BM6A 4MLOA 1UG2A 3KZYA 4KIBA 3B6AA 1APLC 1WQ2A 3BT9A 1J75A 3DBLB 3KP5A 5IYRA 3QAHA 3GMEA 5DM7F 1K79A 1YJNB 4G7XA 2H09A 3UKGA 1NK2P 4EJTA 1VJSA 3WQZA 2XTYA 3JRHA 1JKRC 2XKPA 3RYRA 3PL8A 1U9NA 2MYSA 3CDHA 3F0CA 1FBUA 2DBBA 2M1BA 1XMXA 4I76A 2C78A 1IGNA 4CGZA 4R79A 4W1UA 1KONA 2JJ2A 2IP2A 3IAM2 2WV0A 2XDVA 4F93B 4AIKA 4ACAA 5BSYA 1BHEA 3LMWA 3NAWA 1LEBA 3C2BA 3LSHA 4CSWA 1VQOB 1IB0A 4W8SA 2JN9A 5CJ9A 3OS1A 2BZTA 2OK7A 3F3XA 2D45A 4NHJA 5JLVC 3LSTA 2DYIA 1MMAA 1X3ZB 1MGTA 3B8YA 1FTZA 1XDUA 4P2NA 4HF2A 4EGYA 3ASRA 2V9KA 4B44A 1ZH5A 1OCPA 5FKLA 4U7DA 4K1XA 1IN8A 1AWCA 2XUBA 3PENA 3HB9A 3WU1B 2VONA 4X7FA 3VSLA 5KVRA 2XC1A 1ZRCA 1W5SA 2R9VA 3ABKH 4NCNA 2LREA 4HX8A 4Y17A 3EQLF 2QUFA 3EDPA 1OJLA 3FDYA 4O5VA 4QLCU 3GTLJ 3VO2A 2QZAA 2X48A 2A6EF 2Y30A 5ED4A 3H9GA 1Y0NA 1QO0D 5IYWA 1TP4A 3OYGA 3WTUC 1K28D 1QZEA 2H94A 2EILH 4B48A 3ZQLA 1Y39A 3WNBA 1I39A 3GZ5A 2CFXA 1G3WA 2XPUA 3FK7A 3TOAA 3KP4A 3BP8A 1UMKA 1Q82D 2YX4A 3GVAA 3DBHB 1SEUA 1G7RA 4X07A 4G1BA 5F1JA 4XRSA 5FA6A 1Z67A 9ANTA 1QVTA 4RGXA 3FMRA 2XT2A 1K4ZA 1BBYA 1XFOA 2HTJA 2DK5A 2DT5A 2ZZFA 3CCLB 1LEAA 2ZTNA 2IS2A 1X1DA 3GF2A 3DEWA 1GXPA 4HLYA 1VFCA 4RGRA 2L01A 1BR4A 3HRSA 5BNGA 2ZXWH 2B0LA 1TWCJ 4EV0A 4P1VA 2V1NA 5F4OA 4UAJA 1B23P 2BY1A 5LEKA 2VT2A 4BL0B 1IV6A 2LYCA 3WHBA 4ZYGA 4L8JA 2ACJA 3OZUA 2KRFA 3HPGA 3KEOA 2LVSA 3CCMI 2YWGA 2D1VA 2QBYA 1MKMA 2DXIA 4XNFA 3DBRB 1T6YA 2LH9A 3MFKA 4BS9A 3OYLA 3ROUA 5IOYA 5D4SA 2F2EA 3F72A 3OL3A 3P26A 2QLZA 1KRHA 1UMQA 4N9IA 2X51A 2JWTA 4FHTA 3Q6RA 1OOCA 2VFQA 1JHFA 2ZB9A 4RDUA 2PBIA 1Y56A 4A3KJ 1NG7A 4YALA 4A3LJ 2JA2A 1E2XA 1W36D 1KCDA 5EGOA 1P7JA 4KA4A 2OTLB 2ZL7A 1HKTA 2WB1A 1FX0A 2R7TA 3OOUA 3E6DA 3QP6A 3SZGA 3ULQB 2L7ZA 2VBUA 4WK8F 3H9NA 2CV1A 3W2WA 1QFJA 3CZ6A 4C2TA 3HDDA 3MCAA 1ZM9A 4XQFA 4G6TB 1VQ9I 4M73A 4G6DA 2F5VA 4BQAA 2KIMA 2HI3A 3L2UA 4XRMA 4IRGA 2L9NA 2HVSA 4AUXA 1N07A 1KU9A 3LAPA 2X53S 2JT1A 1Y6IA 3SFIA 1K78B 2C5HA 4HIZA 3MZYA 3GUDA 4IHSA 1R5GA 5GV7A 3W5UA 3BC8A 4XR6A 3S2WA 2DEUA 3D5RC 4P96A 2RC4A 3P9CA 2DFEA 2MC4A 2UVEA 5JBQA 1OYYA 3K69A 3RY8A 3J80K 2CC2A 3PSFA 1W9XA 1WCMJ 3BROA 2BX6A 1FJLA 4HF1A 3FF5A 1HSTA 3GTJJ 3KYCB 5A2QZ 1GVHA 2QN6A 1MIJA 1BMFA 2OK8A 3GQ7A 3CJRB 3ML6A 1PUFB 2ISYA 2QSGX 2CW8A 2Z99A 5E18F 1EP1B 5D6FA 2QA4I 2JA6J 2QVOA 2OF7A 3JRDA 1O8MA 4Z05A 3SZEA 1Z77A 4LLNA 3QP5A 1FLIA 3GTQJ 2VQHA 5DYMA 1OR7A 2HMAA 3FXRA 5D5VB 5E3OA 2L02A 2Z16A 2DO7A 3PO3J 2DYSH 2PN6A 3AVVA 3S1NJ 5FJ8J 1IRXA 1TW2A 2GREA 4EJUA 3F22A 1RIOH 2WAQA 4A6EA 4BNCA 3SY2A 4KN7X 3GQ8A 1LFPA 4E7JA 1OGIA 4XLCA 3V8JA 4CCMA 1I50J 4C9YA 4LLGF 4BKXA 4Z4VA 2PJRA 4XK4A 1HXDA 2FE3A 2EA4A 3CLOA 2O0YA 1UELB 4IHXA 1VQLB 1TSPA 2GA1A 4LIUA 3L1PA 4L9VA 2PG4A 2ZFWA 1MBHA 4L9NA 2CV2A 2E1NA 4UB8C 4FISA 3ABLH 3K4BA 2QKLB 3S32A 1Z91A 2G9WA 3TOBA 2D3NA 3V8LA 1R5OA 3I59B 4N3NA 1TWAJ 2BMWA 1IAWA 3ABTA 5FO5A 3PNYA 1IJWC 1IF1A 2B0RA 2H6CA 1ORKA 2L9RA 5CVUA 3T8TA 4XKBA 4RPBA 4V2GA 3JSPA 1SFXA 4EMSA 4S04A 4KUMA 4URRA 1YHQI 2VI6A 2J5PA 1TW3A 1RESA 1WI3A 2CWEA 1D5YA 1MMSA 1OFCX 3T51B 3B02A 2NPFA 5E1WA 2CK3A 2W7ZA 1V0EA 4JQFA 4WWCA 2QX3A 3KEYA 4QTRA 1BIBA 1JUMA 4HQMA 3JSOA 2C2WA 1N77A 2LF8A 2VBSA 3I55I 2VL8A 1Z6RA 2VC1A 1LE8B 2PMZN 2HQAA 3HGGA 1JJ8C 3CMYA 2HR3A 3BR6A 5CVRA 3AAFA 2PIAA 2Y0SA 3E20A 3J7AY 3SHFA 1CLWA 3C3WA 3PJRA 2I8DA 3SXYA 3S1RJ 3FHZA 2ESNA 2XEXA 1W0TA 2HDCA 2E1OA 3WTWC 2VOPA 1E62A 4ROXA 2O17A 1HA3A 1IN7A 3M8EA 4PDKA 2BM1A 2NNYA 2QQAA 4ESFA 4YAFA 1QVFB 2GLOA 3I4NJ 4Y3OA 4MGRA 1S5LC 3F8MA 5EZGA 4RS8A 3TH0A 2NS7A 3GFJA 4M71A 4Z4TA 4Z4UA 3IWZA 1BJKA 1X1AA 5ILSA 4DZPA 3CD6B 2VUMJ 4PUSA 3EUHC 2RQPA 5M5XJ 4OIQF 2VC0A 1ZG5A 2GJPA 4NK8A 4X05A 2XAJA 2JUCA 2JIZA 4NB5A 4K2EA 1MSEC 2ZZEA 4HQEA 2LG4A 2BV6A 1F1ZA 3DLLF 2PE3A 4RD1A 4OOSA 3WE3A 4YXWA 3MN2A 2XKOA 4RMNA 3OS2A 3H5RA 1AU7A 2X3UA 3M1EA 1H42A 3RSNA 3LQQA 3JRAA 2PYGA 5JVTA 3S14J 1QPMA 3K4KA 3OYMA 2K85A 3HOZJ 1OFMA 4MXNA 3DF8A 2P5KA 2V6EA 4RCYA 5DDGA 3VYTB 4MQ9F 2MLKA 4MNUA 1WRJA 1YG2A 3QPLA 5HOOA 4TMWA 2K40A 4X06A 5L3BA 5JLXA 3E6BA 1H9TA 2R7FA 1PLUA 2EQRA 4BPRA 3A0BC 3MCZA 3GVKA 4OJ6A 3D26A 4ZYHA 4IEJA 1ZLJA 2CW7A 2B7BA 5DUIA 3V7CA 2KMUA 2UVFA 1P6RA 1DGWY 4X1EA 5LGTA 3CC4I 3BJOA 3H3VK 4NUBA 3TL4X 1IDYA 2M7AA 4BE1A 3JREA 1UD3A 1LM1A 4MR0A 1A04A 2EZHA 3EETA 2Z33A 3ZZ0A 1Q81D 3QU3A 4ENKA 2HVRA 3FXLA 2W84A 3O8HA 3Q3SA 3ZN0A 1YJ9B 4C0SA 4H0EA 2H1KA 3JQPA 2BVMA 5LHHA 5GTHC 2CUJA 2LKSA 2PEXA 2NAZA 3BTCA 3SYTA 3ECOA 3E6CC 3TP3A 2ISZA 3KPHA 4Y13A 4LB6B 1RMGA 1CGPA 4YC5A 3BY6A 2E2HJ 4BH9A 4XD7A 1N25A 2OCEA 2YSRA 2TRTA 1N0VC 4II2A 4OPVA 1FOWA 2OUMA 2XRNA 3BH6B 1VQKB 5CQGA 4L18B 1AIPA 1Y0YA 2GAUA 2E60A 2ZJQF 4F3QA 3OYJA 3A2KA 2E34A 1QZZA 3RIRA 3HOYJ 4X7DA 3GCMA 2VBEA 3RIQA 2E19A 1FWZA 3BG7A 2BEOA 4B47A 4ZCIA 3KYDB 3Q38A 2EPFA 2A6HF 2M8GX 1BR2A 5BOXA 3JQRA 2OBPA 2EV5A 3N4MA 4CYCA 4ZGQB 3FISA 4ZYEA 1Q86D 1R4MB 4LK1F 1H0MA 1FNDA 4P5OA 1K73D 2E71A 1QA6A 1XQBA 5M5YJ 1FRNA 4NC6A 1IB4A 1REPC 3OEHA 4IXAA 1MNMC 4OOXA 4Q4ZF 5FIUA 4IQ4A 2OCCH 1G6NA 3TO6A 3A8JA 4WXCA 2ELHA 2VBYA 1XG2A 2HPMA 1Z3YA 3QFSA 2UUZA 1KK0A 1QX4A 2ZL5A 2NTBA 4CCKA 3F6VA 2NVXJ 1XMAA 2EA2A 2NVQJ 1SVMA 3BG3A 5IP7J 2OZUA 5H59A 4A6DA 1D1CA 2VOOA 2L54A 4BE2A 1KZHA 3VMVA 1VQ7I 5LLQA 1VQPI 3BH7B 3F8BA 4JBAA 2M5SA 4B09A 3J81Z 3WHCA 5IYNA 3JX8A 1TVCA 3QWLA 3A3GA 2W48A 1Z3XA 3I54A 3CQZJ 4P6VF 2WAQN 3ISXA 1YJ9I 4EGZA 4L0YB 4ZJZA 4OZYA 4YZAA 2RN7A 1ELOA 2FMLA 4YFXF 3GO5A 2K9QA 4HSRA 2I1LA 2XAFA 1R49A 1T39A 4PAAA 3T0YA 4RD2A 2VASA 2BE5F 1UD4A 1OYIA 2X6WA 1QUEA 4XKVA 3V7RA 4RAYA 5LGUA 2X6OA 3MKYB 5E1ZB 3DPTA 1WJBA 1UB9A 5K5OA 2WAFA 4XKWA 1ZYRF 1STZA 3T56B 1K8AD 4I02A 2HOTA 4KITB 3W6VA 1YJNI 2F5EA 2W25A 5TRDA 1IN6A 2MA3A 3CC7B 1XCVA 1QQIA 2FQ3A 1O8HA 3C7JA 3HHHA 4D0PA 4NC8A 3W2AA 1H85A 4UNOA 2J7KA 3G1MA 1TL8A 2ELKA 4RD0A 4CH7A 3OYHA 3W2GA 3TBIA 3IRRA 3VFZA 2O6GE 3BTLA 5BS6A 5LFAA 5ILVA 2E2IJ 2V7UA 1R36A 1CQTA 3HOWJ 1ZHFA 3R0AA 2EZLA 5JFRA 2NVTJ 1VTNC 4BQNA 2GQQA 2K9MA 3PSIA 2ZNZA 1O8GA 2A07F 2NOJB 2EK5A 3CDLA 2DA7A 4AM3A 4OAZA 4ENNA 4LG0B 3OYEA 3OE7A 2OTLI 4G8XA 1OPCA 2W4SA 1ZGAA 2FSWA 1YE9A 1B72A 4KMUX 3DTKA 1FMVA 3KP3A 5HNFA 4BDYA 2VBVA 1QH0A 5J1RA 1HKSA 1YW7A 1WPKA 3I5UA 5FKKA 2BF4A 3HRTA 4M9ZA 5D8KB 4BY1J 2WZNA 2NSPA 5D8LB 5F0HA 1RQRA 4E7LA 5DSZA 3CMMA 3QOEA 2W7NA 3ZCOA 4D5CA 1I6HJ 3E3VA 2GJRA 2INVA 1DDNA 3GWZA 4YELA 3BCDA 4R71A 2GZWA 1I1GA 2LD5A 2W24A 2Y2ZA 4AYBA 1G3YA 4OIOF 3IC7A 3CCMB 5K7ZA 4G7WA 2GXBA 1VLYA 2BY3A 1K6OA 1YIJI 4E7ZA 4ASUA 1BOBA 4IHWA 4OJ5A 3PQJA 4BXUA 3RZOJ 1QU3A 1WJ5A 3KEWA 4YG2F 5JHUA 1WVRA 2O61A 4RAGA 4Z1MA 2P5VA 2WTEA 3VYUB 5JHFA 2IA1A 3DTEA 1VQMB 1RR7A 1H88C 2XOKA 2DERA 2P81A 4KIFA 2NT6A 1IXRC 1EXMA 2CQQA 4RD4A 3CMAB 2NNNA 3JTHA 1VQ4I 3HXLA 4M2LA 4ACBA 3QU6A 4PSWA 4Q48A 1EH6A 5E79C 1PP8F 3M3YJ 3DWLE 4A3JJ 1QNTA 4B3XA 1WWXA 2EINH 2XAQA 2YS9A 2OZ6A 1F4KA 1VQ4B 4CO8A 2KFDA 2KQRA 3GVJA 1DABA 3L9FA 3LL7A 3MZHA 2HS5A 2OBSA 3CMEB 2K5CA 2QZ8A 1VQMI 1NH3A 2BM7A 5FNZA 1XSVA 2Y69H 1POGA 3M8JA 4AYBN 3I9V2 4DQKA 3I4MJ 1X0CA 1IC8A 1T95A 4ENMA 4A3FJ 5J3LA 1K9MD 1ETXA 3VMFA
chains in the Genus database with same CATH topology
3TMOA 2GJKA 3ONQA 5FRMA 3BC9A 2KLOA 3IAS2 4HNUA 4YRVA 1U0JA 3VR6A 4HNTA 3L2QA 4XL9A 4B43A 2R7RA 1JI8A 2ZZFA 1V5GA 3OIPA 2ZTNA 2IS2A 1P9QC 1QCXA 1X1DA 4E7KA 2BSPA 3EPZA 3HUGB 1KCCA 4U49A 3OS0A 2XF7A 1BR4A 2IGKA 4B3FX 2VJIA 3V42A 2V1NA 3OYDA 3S3NA 4BEHA 3BH4A 2L9SA 4XLEA 1VF7A 2WJVA 1E43A 4BL0B 4L8JA 2LYCA 4PSXA 3LSIA 1Z7LA 5CQEA 2VIXA 2MFZA 2VKHA 3HKZA 1BLIA 3HPGA 4J01A 1BPLA 1IA5A 2Z6BD 2KL4A 2DXIA 1PJRA 3L2VA 4DOZA 4XNFA 3OL4A 3EUKL 3K70D 2LH9A 2D3LA 4BS9A 3OYLA 3HC7A 4G6IA 3OL3A 3E1SA 1D1BA 3K4NA 3W2VA 1VBLA 1X1CA 2X51A 2OV7A 3BCBA 1OOCA 1X4OA 3A1YA 1Y56A 3DEEA 4IX7A 1NG7A 1WMRA 2JA2A 4E4HA 1QHGA 1W36D 4FASD 2VQCA 1KCDA 2A6TA 3JU4A 4CCJA 2O0WA 5CPRB 2WB1A 1FX0A 2R7TA 3OOUA 4CCNA 4PK4A 2LC2A 3SZGA 1NG6A 4F91B 3FKJA 3QODA 2W1OA 4W8SA 4P1WA 3VSTA 2CV1A 3W2WA 5HNHA 3ZPPA 2BOLA 1WTHD 3CZ6A 4C2TA 1UAAA 3AFHA 4XQFA 2RQQA 3DLAA 2M4GA 4G6TB 3SDBA 4II3A 4E7SA 4E7IA 1I8DA 2F5VA 3FBIB 1YX3A 3OYIA 3H9QA 1E3XA 1HZEA 2GK6A 1SAUA 1VZ0A 3ZRGA 3L2UA 2KVOA 3A35A 2IQ7A 4DIQA 2DT7B 2L9NA 2HVSA 2R7VA 2X53S 3K4MA 1Y6IA 4GQNA 4HIZA 2ELJA 4DNRB 2VBKA 4E7HA 3VSUA 4PFOA 1O8LA 3G2BA 3OOCA 3BC8A 4XR6A 3D5RC 2R7QA 1HVXA 3G05A 3QYFA 2L5QA 3ZXSA 5LD2C 1ZELA 4U4BA 1WJFA 2MC4A 2UVEA 1X1BA 3PFYA 3S3MA 1E3ZA 2ZXIA 2VJ5A 2JJ1A 3DDYA 3OYKA 3PSFA 1W9XA 2XF6A 4ZYAA 3K70C 2IS6A 1GQ8A 2X1CA 2CUZA 3D5SC 1JTAA 2A5WA 3K4CA 3GVLA 1MMDA 3C2GA 3GQ7A 1BMFA 4OAYA 3CJRB 2Q2EB 2CW8A 2ZZQA 3S3OA 3PNTA 3OEEA 1O8MA 4Z05A 2FUG2 2VQHA 1CZFA 2GOXB 2LZJA 4DK1A 1V0FA 4PMHA 2Z16A 2WY8Q 5DN6A 4KKTA 1FMWA 3VYRB 3SUCA 1IRXA 2WAQA 4P22A 4NC7A 3FBNB 2WBMA 3OWTA 1LFPA 4TSFA 4E7JA 3GQ8A 4XLCA 4UZUA 4C2LA 3K6GA 4CCMA 4HEA2 3RQ4A 4C9YA 3QYEA 2X3HA 2W6IA 4U7BA 2KPMA 1K6YA 2PJRA 1KTWA 4KKSA 1LDKB 4XM3A 4XLFA 2GK7A 4XLAA 1PYVA 2V7QA 1UELB 2W00A 3SEQA 3OYAA 1R6RA 4LIUA 2DT6A 3CP2A 1WJAA 2CV2A 4IQJA 2ZSHB 1UD6A 3EQOA 4KISA 3FPPA 2R7UA 3DQVC 3K4BA 4N4OB 2L2OA 1N75A 2QKLB 3S32A 2JSPA 2D3NA 5FROA 4BJ6C 2OC6A 2WZPP 4PJNA 3VWBA 2JUGA 3OMYA 3PNYA 4XORA 2VXZA 4Y33A 4NQWB 5FRNA 3D5LA 1AA7A 4XKBA 1E1QA 1OB0A 2AQEA 5CKTA 2MD0A 3RCOA 2XC7A 1UD5A 2NTPA 1D0ZA 4URRA 3VMWA 2NSTA 3C2HA 4X0GA 1X4PA 2VB6A 3T51B 2E1MB 1OGOX 1YX5A 4XLHA 2CK3A 3VDXA 3ZQQA 4D1QA 4EW9A 4CA0A 1V0EA 4JQFA 2X6XA 2QX3A 3KEYA 1N77A 3UW0A 2PMZA 2JVGA 2QKMB 2VL8A 3VSVA 1DBOA 2HQAA 4ZTFA 5AMVA 2IXSA 1WJCA 3ZGKA 1COWA 4DK0A 4PJLA 2Y0SA 2VQLA 2KRHA 3J7AY 5KCMA 4LIVA 2I8DA 4PJMA 3PJRA 3AKZA 5HLTA 3HOTA 3K10A 1S9HA 2O17A 4XN0A 3H5NA 3K4LA 3W3CA 4BJTA 4BXFA 1WPCA 4Y3OA 3UR3C 4OWRB 4BQOA 1MMGA 4XMYA 2VQGA 1NRKA 2ZZGA 2IGOA 3DPLC 3OAAA 4DNTB 3DKYA 4YEJA 1W0JA 1X1AA 4ITVA 2ZTGA 1O8IA 3IP4B 2DJIA 3GRHA 4PUSA 3EUHC 1UD2A 2GJPA 4NK8A 3GQ9A 2X1DA 3RTRA 2E1BA 4HWVA 3WWGA 2WPDA 1I18A 2HVQA 1OLTA 3LSKA 2JIZA 2O5RA 3S8PA 1MMNA 4W8RA 1OGMX 2ZZEA 4XONA 2LG4A 3KRGA 4C2UA 1MABA 3OR2C 1O8FA 3H9JA 4YXWA 1J09A 4RMNA 4W8TA 3OS2A 3H5RA 3L2RA 2JDIA 4F52A 2VBMA 3RSNA 2PYGA 2W82A 4DBQA 3K4KA 3OYMA 4HRIA 1OFMA 3NWTA 1QJVA 1HG8A 4BGDA 4MXNA 2BVLA 3VSKA 1D0YA 2XGJA 2V6EA 2V4JC 3VYTB 4XKCA 5HOOA 1MNEA 3PUBA 2WAEA 1PLUA 2M4KA 2QE7A 4Z03A 2ZXHA 3HOSA 3BLYA 4CCOA 1WJEA 2Q1ZB 4KJZA 4Y4RA 2F43A 3GVKA 3IUOA 4OJ6A 1K5CA 1DQUA 3LNNA 4HPQA 2CW7A 2X8KA 4RLFA 2KMUA 2UVFA 1DGWY 2XZOA 3S93A 2NTQA 2KDOA 4XOTA 2RNGA 4PFPA 2M0MA 4RLQA 4NUBA 3TL4X 2M7AA 2F4IA 4BE1A 1UD3A 3VYSB 4MR0A 2M3AA 4QPQA 2X85A 2EWEA 2R7WA 2V26A 2HVRA 1SKYB 2O04A 3GQBA 2XZLA 3OFNA 1DP3A 3NWSA 1HA8A 2BVMA 2F6CA 1WFXA 1AIRA 2CUJA 2KHMA 4ZDOA 3SYTA 3I3LA 2AQFA 4AVZA 1GLNA 2BW3A 2M7BA 4NNJA 4HSTA 1RMGA 4F92B 3CJQB 1N78A 3OR1C 3OYBA 4E0FA 4XD7A 2VLAA 4OZZA 3A4CA 4JOMA 4XN3A 2CH0A 4N4NB 1KMHA 2NT9A 3GBGA 4II2A 4KT6A 4CZCA 1JRGA 2OUMA 2WADA 2MABA 2Z1DA 2WJYA 5CQGA 2R7OA 3L2WA 1O8EA 2E60A 4F3QA 3OYJA 2V7FA 4LITA 3KYLA 3A2KA 2VBEA 4YZQA 3OPOA 3ZSCA 3OIQA 5TGTA 4RM2A 4E6KG 4OJOA 3N05A 2XAUA 4ZTJA 3BG7A 2P0WA 3H94A 4B47A 1WJDA 4KKUA 4DGWB 1BR2A 2E5NA 1D0XA 4H4KC 2V4DA 2WSSA 2XZPA 3HAGA 1OHHA 3FKSA 4QPOA 3OYFA 1RWRA 4PJJA 4TKOB 3CESA 1NBMA 4P5OA 1IB4A 2HNHA 4I84A 1KZLA 2QXZA 1PKVA 3OEHA 1T0FC 1G59A 1O88A 3LSMA 4IQ4A 2X6YA 2CMPA 1DBGA 3ZIAA 3DU6A 1W36C 2V31A 1OR7C 2DIEA 1XG2A 1QHHD 1Z3YA 4U87A 2UUZA 2HPMA 4IZZA 3BG6A 1MW7A 3LFUA 2NTBA 2ZFUA 4CCKA 5C1CA 2QY1A 2IS1A 2LY1A 4LG3A 1D1CA 1EA3A 1SFKA 3E0JB 4C30A 4ANJA 4BE2A 3VMVA 3M1CA 3MKZA 5HVQC 4ZDPA 3QYBA 2R7XA 2M5SA 5C1EA 1TT0A 1UD8A 1G8XA 1V5FA 3A3GA 1Z3XA 1LVKA 3F9KA 1H8HA 5CDFA 2ZSIB 2INUA 3AL0C 2HDWA 2K9LA 1EFRA 4ZJZA 1BN8A 2XSJC 5IK2A 4OZYA 4W8QA 4YZAA 3JURA 1V5EA 3B4NA 2PJRB 2R7SA 4HSRA 3ZR8X 2X1EA 3DU5A 2UWMA 5FL7A 4BJ5C 1X19A 4CUGA 2Z2SB 4EATA 2VASA 3RPUD 1UD4A 3SEZA 4BACA 1E79A 2X6WA 3OYCA 4OJLA 3H5AA 4HG2A 4XKVA 4RM3A 4D9JA 1Z21A 3MKYB 4OJPA 3DPTA 4XOPA 1WJBA 2DOAA 4NK6A 4YZXA 2E5ZA 2WAFA 3EUAA 4XKWA 3T56B 4FETA 4YZ0A 1W0KA 2R4GA 2F1MA 4TT3A 4KITB 3MKWB 4ZDLA 3K4JA 4ZC3A 4Z06A 2NZMA 1RU4A 2XF5A 5KNLA 3CF2A 3HG9A 1O8HA 2Z8GA 4NC8A 3W2AA 2O1DA 3T53B 4AU7A 3OYNA 2HZDA 3ZPNA 3HPHA 2LRDA 4BE0A 4CH7A 3OYHA 2KZVA 1O8KA 2E1MC 3TBIA 2DCEA 2VPLA 1WP6A 3T9GA 1LKXA 2IGNA 2WY7Q 5LFAA 4F55A 2XNDA 4DJAA 3HL2A 1PE9A 1O8DA 4JMQA 3B90A 3FY3A 2VJJA 4FXUA 2HPIA 4BQNA 2KP6A 3MMYB 2UV1A 2LBFB 1NHCA 2K9MA 4B3GA 2WA0A 3PSIA 5KHDA 2IS4A 1O8GA 2NOJB 3DPUA 2W6JA 4BUPA 4BQQA 1IDJA 4DBRA 4OAZA 3MD2A 1ERDA 3OYEA 3OE7A 2LBFA 3LMMA 4MLOA 2W4SA 1BR1A 1YE9A 2CFOA 3DTIA 3DTKA 1FMVA 4J00A 2RREA 5HNFA 3LSGA 4BDYA 3A3BA 1OFLA 2ODLA 4G7XA 1MNDA 3PNVA 2HU9A 1VJSA 3WQZA 4BU2A 1T5EA 2NSPA 3PL8A 4E7LA 2MYSA 3CMMA 3QOEA 2W7NA 3ZCOA 2PECA 2HLDA 2LY2A 1D1AA 2GJRA 3AL0B 2INVA 4R79A 1O8JA 1DGRM 1KONA 4YELA 2VKDA 2IGMA 2JJ2A 3BCDA 3IAM2 4AYBA 2XDVA 1E1RA 4F93B 3LMWA 4G7WA 1BHEA 1VLYA 1UG0A 4ASUA 4E7ZA 3LSHA 1BOBA 4CSWA 2BW3B 2K3PA 3OY9A 1QU3A 3KEWA 1IDKA 1WJ5A 4OJ5A 3BCAA 3U21A 3OS1A 2VJ4A 3NE5B 4Z1MA 1MMAA 3OW7A 3KX2A 3VYUB 2O0VA 2LOOA 3B8YA 5JHFA 5HKKA 1H80A 3DTEA 4IKFA 3GQAA 2V9KA 4B44A 2XOKA 4CCLA 2L7KA 2NT6A 1E0EA 2KRCA 4BEHB 3EQNA 1H8EA 4BDZA 3HXLA 3DKXA 4PSWA 3FHNA 2GOMA 3DWLE 3BCFA 3VSLA 4B3XA 3H0DA 2R9VA 2KQRA 3GVJA 1PXZA 3LL7A 1EE6A 2LREA 1TZLA 2K5CA 3FDYA 4GRIA 3H9GA 2JVHA 2CS3A 3H35A 3M8JA 2PYHA 3OYGA 1K28D 4B48A 3I9V2 1X0CA 3CP8A 2CV0A 1T95A 2VXDA 3UNGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLU A;  3SUC A;  4Z03 A;  2X6W A;  4OJL A;  4XKV A;  4OJP A;  3GQ8 A;  1K5C A;  4C2L A;  4OJ6 A;  4XLC A;  4XOP A;  4NK6 A;  4YZX A;  4XL9 A;  2X3H A;  4XKW A;  4YZ0 A;  2UVF A;  1KTW A;  2NTQ A;  4XM3 A;  4XLF A;  4XOT A;  1QCX A;  4XLA A;  2BSP A;  2NZM A;  4Z06 A;  1RU4 A;  1KCC A;  4U49 A;  4MR0 A;  2VJI A;  2X85 A;  1O8H A;  2EWE A;  2Z8G A;  3EQO A;  2O1D A;  4XLE A;  2O04 A;  1O8K A;  1IA5 A;  1AIR A;  3T9G A;  4XOR A;  4AVZ A;  1PE9 A;  1O8D A;  3B90 A;  3FY3 A;  4XNF A;  2VJJ A;  1RMG A;  1NHC A;  1O8G A;  2NTP A;  4URR A;  3VMW A;  1IDJ A;  1VBL A;  4OZZ A;  4XN3 A;  2NST A;  1OGO X;  1OOC A;  2NT9 A;  4XLH A;  4EW9 A;  1JRG A;  2X6X A;  2QX3 A;  1WMR A;  2ODL A;  1OFL A;  1O8E A;  3UW0 A;  1KCD A;  3VSV A;  2O0W A;  1DBO A;  3ZSC A;  2NSP A;  4YZQ A;  2VBE A;  5AMV A;  2PEC A;  4OJO A;  3VST A;  3ZPP A;  2INV A;  1O8J A;  4YEL A;  4XQF A;  2O17 A;  4PMH A;  4XN0 A;  3LMW A;  1BHE A;  1RWR A;  2IQ7 A;  4W8S A;  4OJ5 A;  4XMY A;  1IDK A;  1IB4 A;  4I84 A;  2VBK A;  4YEJ A;  2QXZ A;  3VSU A;  1O8L A;  1O88 A;  1O8I A;  2O0V A;  3B8Y A;  4XR6 A;  1H80 A;  2X6Y A;  3GRH A;  1DBG A;  3GQA A;  4NK8 A;  3GQ9 A;  2NT6 A;  1XG2 A;  4HWV A;  4U4B A;  3WWG A;  2UVE A;  2NTB A;  3EQN A;  5C1C A;  2QY1 A;  4W8R A;  1OGM X;  4XON A;  1GQ8 A;  1JTA A;  3KRG A;  1O8F A;  3GQ7 A;  3VMV A;  1PXZ A;  4W8T A;  1EE6 A;  5C1E A;  2VBM A;  2PYG A;  2INU A;  1O8M A;  1OFM A;  4Z05 A;  1QJV A;  4MXN A;  1HG8 A;  2PYH A;  4OZY A;  1BN8 A;  4W8Q A;  4YZA A;  1CZF A;  3JUR A;  3B4N A;  1X0C A; 
#chains in the Genus database with same CATH topology
 1ZGW A;  1VQL I;  3OJX A;  1TBX A;  2FRH A;  1BJA A;  3VB2 A;  1A35 A;  1G2H A;  3BC9 A;  2XGC A;  5HZA A;  1RKT A;  4EM1 A;  1GO2 A;  2CW5 A;  3CW2 A;  2VFP A;  1U0J A;  2HQN A;  3VR6 A;  3ZQH A;  3JRI A;  4HNT A;  1A6Q A;  4KIC A;  1QVU A;  4KIG A;  4C3I J;  2FBI A;  4B43 A;  3QPS A;  3GLX A;  2DOF A;  4N0B A;  2JK3 A;  4M53 A;  2DI3 A;  1P9Q C;  5DCM B;  1Q1V A;  1UZC A;  1QCX A;  2VN2 A;  2BSP A;  1KCC A;  2J8K A;  2KKO A;  3OS0 A;  4D7M A;  2ZBV A;  4DYC A;  1LB2 A;  2L9S A;  1FP1 D;  3LWF A;  1VF7 A;  1W34 A;  3W5V A;  4RM0 A;  1W2B B;  3OSG A;  2RGV A;  1G7C A;  1Z7L A;  1TWG J;  1S72 I;  1TC3 C;  3GW2 A;  2C4T A;  2Q6O A;  4QVJ A;  3CCS B;  1HF2 A;  1MBF A;  2DFF A;  4J01 A;  1JKP C;  1BPL A;  2KL4 A;  1IA5 A;  4AC9 A;  1ODD A;  4OOI A;  4Q7J B;  3F8F A;  4IOC F;  1ETW A;  2H8W A;  2Q2E A;  2O8X A;  2XGE A;  3PUF A;  4DOZ A;  3L2V A;  3LVB A;  3OL4 A;  3EUK L;  3K70 D;  2STT A;  1QFZ A;  3ELK A;  2E7W A;  5LEJ A;  2XPV A;  4IRH A;  4I0A A;  3BG9 A;  3VOE A;  2MLG A;  3K4N A;  3W2V A;  1VBL A;  2PFB A;  4I99 C;  2OV7 A;  4XIC A;  2DPU A;  2KIU A;  3CCV I;  2K3F A;  1RR8 C;  3ZMS A;  5EF6 A;  2DCU A;  3A1Y A;  1KYZ A;  3ASN H;  2QTL A;  2O3F A;  2Q6K A;  3Q9S A;  1J7K A;  3K9T A;  3JU4 A;  2O0W A;  1CNF A;  4CCN A;  3SKB A;  2LC2 A;  1NG6 A;  4F91 B;  4P55 A;  3FKJ A;  3QOD A;  4P1W A;  2OPT A;  1S72 B;  3ZPP A;  1WTH D;  4QUZ A;  3L09 A;  1W7P A;  5E8I A;  4L9J A;  1MDM A;  1UAA A;  2LF7 A;  2GIZ A;  2X0K A;  2CRV A;  4E7I A;  3SDB A;  5FLM J;  1I8D A;  1XE1 A;  3AGQ A;  4KKT A;  4PMH A;  3DCF A;  3GZ6 A;  4A3D J;  3ZRG A;  1VZ0 A;  1TTY A;  2AO9 A;  2DT7 B;  2ID3 A;  1FOK A;  4KT5 C;  4HW0 A;  1RQP A;  3ZC3 A;  4LK0 F;  3K4M A;  3A8K A;  4V02 C;  4GQN A;  3QOP A;  5LGN A;  4A3I J;  4DNR B;  3SQN A;  4RB1 A;  1XS9 A;  4XLN F;  4AVP A;  4PFO A;  3COA C;  3AK5 A;  4EJW A;  3OOC A;  2KZG A;  4MHG A;  3I59 A;  1J5Y A;  1ZM2 A;  4A0X A;  5D5X B;  2EH3 A;  2LMD A;  1HVX A;  3QYF A;  2EB7 A;  3ZXS A;  5LD2 C;  2HYJ A;  1MRZ A;  4U4B A;  2BHY A;  2D1H A;  4S0H B;  1F5T A;  2JJ1 A;  2VJ5 A;  1QGY A;  2EIM H;  1VQ7 B;  2EFG A;  4M6V A;  3A03 A;  3HZJ A;  2LDU A;  4ZYA A;  1GQ8 A;  4P9U A;  2X1C A;  3BOQ A;  3D5S C;  3K4C A;  5CYV A;  3S17 J;  3M07 A;  2JA7 J;  4ZGN B;  3C2G A;  4C3H J;  1N08 A;  4M1K A;  2FNA A;  4A2U A;  5J8F A;  5B5E C;  3SLD A;  2R0Q C;  4BXX J;  1MBJ A;  4LG0 A;  3R6K A;  1HW2 A;  3BJ6 A;  4IO9 F;  4LOC A;  3S3O A;  1BN5 A;  2A69 F;  3WTX C;  1ACI A;  2RC6 A;  3OEE A;  5TY0 A;  4U0V A;  1ZAO A;  2FUG 2;  3ECH A;  5IOZ A;  3KIO A;  2BYV E;  2AS5 F;  4UXN A;  1V0F A;  3SZP A;  4RD3 A;  2JMW A;  2CYY A;  2DQR A;  4HV5 A;  2M34 A;  1FMW A;  2K27 A;  3SUC A;  1BI1 A;  1B8I B;  3GTM J;  1VQ6 I;  4P22 A;  3WTS C;  1TQI A;  3K6G A;  5DD4 A;  2DN0 A;  2FBK A;  4HEA 2;  1O3Q A;  1LPQ A;  2QCO A;  5E17 F;  1N05 A;  4M0L A;  2X3H A;  3ZUG A;  1VHE A;  5IYB J;  4U7B A;  2W6I A;  2KPM A;  2QGU A;  1K6Y A;  3BR0 A;  3FZV A;  1B72 B;  4KKS A;  4GYG A;  1P2F A;  4Z2Y A;  4AID A;  3PO2 J;  5F4M A;  5JR3 A;  4XLA A;  1ON2 A;  1PYV A;  4FCY A;  2GK7 A;  2VFO A;  3SEQ A;  3V8K A;  1OQY A;  1R6R A;  1SD7 A;  4L5I A;  2WYR A;  1U5T A;  4RPD A;  3CLQ A;  2DT6 A;  2P3M A;  3CP2 A;  4IQJ A;  2XIG A;  2ZSH B;  5A89 A;  1EH7 A;  1ENH A;  2FBH A;  3DQV C;  1QVG B;  1KA8 A;  1I3A A;  1KTV A;  3FPK A;  3Q9V A;  2L2O A;  1Z05 A;  3BDD A;  1A5J A;  1UST A;  5F27 A;  1IZ1 A;  3RDI A;  2WZP P;  4PJN A;  3IWF A;  2VZL A;  1H8A C;  3VWB A;  4G9Y A;  1IJF A;  2JUG A;  3OMY A;  1Y0R A;  1KD1 D;  4XOR A;  4Y33 A;  4NQW B;  5FRN A;  1AA7 A;  5DV5 A;  5CKT A;  2FMY A;  5J1Y A;  5JLW A;  2ZKZ A;  4CQJ A;  2HGC A;  1R71 A;  4QWQ A;  3OSF A;  1OB2 A;  2Q6L A;  1W7P D;  4ENJ A;  2YU3 A;  3KLO A;  1X4P A;  2VB6 A;  3KFW X;  1JT6 A;  3LQ6 A;  1OGO X;  3PQK A;  4XLH A;  1P92 A;  4D1Q A;  1VQN I;  4CA0 A;  1G3T A;  3CCE B;  1KQ0 A;  2COM A;  2L7M P;  2QA4 B;  4MQV A;  3L7W A;  2PMZ A;  4UY8 I;  5EEH A;  1TLL A;  3HM5 A;  3PSZ A;  1MBG A;  3G3Z A;  1BI2 A;  1WJC A;  3ZGK A;  1BJZ A;  1K83 J;  1QGZ A;  2XHK A;  2XAG A;  1CF7 A;  4AC0 A;  3ES9 A;  1YYV A;  2CJJ A;  4BYY A;  4ZZL A;  4PJM A;  5H20 A;  4Z4S A;  1T2K A;  5IT9 K;  2DA4 A;  1S9H A;  3HEF A;  2BBY A;  3CCU I;  5F08 A;  4BBS J;  3R61 A;  4A0Z A;  1YIO A;  3F8N A;  3H5N A;  4BJT A;  4KYW A;  2NS0 A;  4HLX A;  3DEU A;  4BXF A;  1RI7 A;  1FX7 A;  3SZT A;  3UR3 C;  4BQO A;  1NRK A;  1R58 A;  4XMY A;  2ZZG A;  3VNV A;  5EJC A;  2I10 A;  3OAA A;  1DP7 P;  1W0J A;  4HA8 A;  4HDV A;  1O7F A;  4G7Z F;  3GRH A;  2IA2 A;  1UD2 A;  4HZF A;  4U88 A;  5D5U B;  5C44 J;  4HWV A;  3WWG A;  2WPD A;  1I18 A;  1OLT A;  4HF0 A;  3L00 A;  4ASN A;  2EIK H;  2O5R A;  3FM5 A;  3LNQ A;  4D7N A;  5KSW B;  5E3M A;  1KQS B;  4JYK A;  4AIJ A;  1O8F A;  1JA1 A;  4M3E A;  1J09 A;  4YII A;  3QFT A;  2GM4 A;  3ABU A;  1PJ6 A;  4P3I A;  1I7P A;  3CD6 I;  2DJN A;  4DBQ A;  4DYR A;  2V79 A;  4BGD A;  4WF2 A;  1D0Y A;  1OGJ A;  4YHB A;  1CNE A;  1E17 A;  2EIJ H;  1HBX G;  4XKC A;  4P9S A;  1GAW A;  1MNE A;  1FNN A;  3PUB A;  3G4S B;  3F8C A;  2QF7 A;  5FKN A;  2WAE A;  4JX6 A;  3OZW A;  1C0W A;  2Y0S N;  3HOS A;  1GV2 A;  4CCO A;  3A01 A;  1WJE A;  2V7T A;  1K5C A;  3LSR A;  3O2P E;  3LNN A;  1KQ9 A;  4HPQ A;  2IEK A;  5J8C A;  4RLF A;  2IRF G;  3EYI A;  3BY2 A;  1LLW A;  2KIF A;  1IW7 F;  2K02 A;  5DD8 A;  4ZYD A;  1QGP A;  2A5Y B;  4I7H A;  1NJI D;  2HXO A;  2M0M A;  2ZME B;  3WXM A;  3CDI A;  3I55 B;  1N06 A;  1XMK A;  2RKH A;  5K5R A;  2AXT C;  2CBX A;  4DQ2 A;  2ZC2 A;  4P9F A;  1EA0 A;  2Y9Z A;  3ASS A;  2RVC A;  3R0J A;  1T56 A;  1DP3 A;  1YI2 B;  4NBQ A;  1HA8 A;  3NRV A;  1NK3 P;  2GXA A;  1EJ9 A;  2B5O A;  1SVL A;  5EMN A;  3I3L A;  1MBK A;  5IT3 A;  1QGA A;  2EFO A;  2LSO A;  4NNJ A;  4F92 B;  3OR1 C;  4ABZ A;  2C4U A;  2NT9 A;  3TED A;  1B6A A;  1EWY A;  1S4M A;  4S05 A;  1XN7 A;  3GXO A;  3R6S A;  3J7Z I;  2M87 A;  2ECC A;  2GWR A;  1TTT A;  2E36 A;  4BHC A;  2Z1D A;  1RNL A;  2RAE A;  2NXN B;  2TCT A;  3QRF F;  5DTD A;  4PC6 A;  3TKY A;  2F3L A;  3H3U A;  2V7F A;  3Q0U A;  5TGT A;  4E6K G;  4RM2 A;  1K78 A;  2VBX A;  2QQB A;  4ZTJ A;  5B66 C;  2P0W A;  4KKU A;  4DGW B;  2V4D A;  2WSS A;  4OP7 A;  5B1B H;  1ZG1 A;  3HJE A;  1AKH A;  3I4P A;  1EKE A;  3OYF A;  2DY1 A;  3CES A;  2OAZ A;  1NBM A;  1VQ5 B;  1R23 A;  1FIP A;  4FN5 A;  3I58 A;  2VNJ A;  2V9V A;  4HNV A;  3LQE A;  1KZL A;  1USS A;  3P27 A;  2V1U A;  1U3E M;  2CMP A;  4B8X A;  2FEZ A;  3ZIA A;  2V31 A;  1P4A A;  4FWT A;  2DIE A;  3RPU A;  4HX7 A;  3CPX A;  2ZFU A;  4HX4 A;  3WY9 A;  4LC0 A;  2KIQ A;  2W85 A;  2IS1 A;  3AVY A;  2F4N A;  2LY1 A;  3QPH A;  4L5E A;  4C30 A;  5EEA A;  3E0J B;  1QRC A;  1YJW I;  1ETV A;  1O3S A;  3M1C A;  1FSE A;  2XPW A;  2R7X A;  5GAE J;  2OJE D;  3K7A J;  1TT0 A;  4CIC A;  1G8X A;  2J8I A;  2KJB A;  3ZQI A;  1BC7 C;  2P6T A;  1CQX A;  5CDF A;  4M6Y A;  1IXS B;  3P7N A;  2V1X A;  2HDW A;  2INU A;  3PET A;  1B4A A;  1GAQ A;  1BM9 A;  3KZI C;  2VNI A;  4A3B J;  3CCQ I;  1V5E A;  2K4B A;  2FF4 A;  3E5Q A;  4L5J A;  5H6Q A;  3GYH X;  2PJR B;  5BSX A;  2IOU G;  4B3A A;  2UWM A;  1R1T A;  3A1P A;  4Y7N J;  5EGO B;  3K1M A;  5L3G A;  1X19 A;  3DP7 A;  4CUG A;  2Z2S B;  4I0B A;  4EAT A;  3JQQ A;  3RPU D;  2F1L A;  3S1Q J;  1PP7 U;  3GSI A;  3MMP A;  3WBJ A;  3GTP J;  3MEX A;  3AST A;  2KDZ A;  4HG2 A;  4G6Q A;  1AKH B;  5TV2 A;  1LDJ A;  5FD5 A;  5J40 A;  2GIV A;  2DOA A;  3I1F A;  3CTA A;  3N90 A;  2YUH A;  4LJZ F;  1O3T A;  2DU9 A;  3CCE I;  4I2O A;  2K7L A;  3MKW B;  4OOV A;  4ZC3 A;  4J0Q A;  3VO1 A;  4Z06 A;  1HC8 A;  2ICW G;  2QYU A;  2R92 J;  2HQR A;  2XF5 A;  2MW8 A;  5KNL A;  2V6C A;  4IW3 B;  4C2M J;  4I01 A;  5A2Q K;  1WZ2 A;  1XGS A;  2Z3Y A;  2O1D A;  4F7Z A;  1M1K D;  1MH3 A;  3AG4 H;  4AU7 A;  3OYN A;  2HZD A;  3J7A O;  4Y9U A;  3HPH A;  4IL6 C;  3TW7 A;  1K7A A;  4KDP A;  4TV7 A;  1FBQ A;  3P9I A;  2DCE A;  5K7H A;  1D8J A;  3I56 B;  2Y0M A;  3TDZ C;  1OCR H;  1WP6 A;  4G1V A;  4DNC A;  2CQ7 A;  2VNH A;  1KC8 D;  2RC5 A;  2XND A;  4DJA A;  4PCQ A;  5E20 A;  3JRF A;  3HL2 A;  1PE9 A;  3BY1 A;  4ZV4 A;  5HLI A;  3WGI A;  3RKQ A;  2CU7 A;  3MMY B;  1NHC A;  2XAS A;  5HS7 A;  3W6K B;  1BI0 A;  1S29 A;  5KHD A;  1Q7Y D;  2DA3 A;  1IRF A;  5J35 A;  2QTZ A;  2STW A;  1ZRE A;  5JVG F;  1ERD A;  3LA7 A;  2QGG A;  1YQA A;  1BR1 A;  2DTZ A;  4WCG A;  4UB6 C;  3FM3 A;  2LR8 A;  3G71 B;  4J00 A;  3TO9 A;  2RRE A;  1OYW A;  3A3B A;  1FY7 A;  1MH4 A;  3CCR B;  1MND A;  4WXH A;  4XBF A;  4YEI A;  4IVN A;  4OPS A;  1T5E A;  3Q3A A;  1XC5 A;  2HWV A;  2RDP A;  3BR2 A;  1RPW A;  2PEC A;  3TGN A;  3C1D A;  3RKW A;  1QA2 A;  2EFQ A;  2LLK A;  1GDT A;  2VKD A;  2IGM A;  2K9N A;  1BI3 A;  4AD9 A;  1OFE A;  2Y48 A;  1WHU A;  2VNK A;  3Q6Q A;  4UVC A;  1E1R A;  3ZZT A;  1I27 A;  6PAX A;  2LY9 A;  3OY9 A;  1MSF C;  2BW3 B;  2K3P A;  1P4X A;  2IW5 A;  1IDK A;  3P9K A;  5E3N A;  3U21 A;  3AVU A;  2OBR A;  2VJ4 A;  2PLY A;  4KFC A;  5EYR A;  4EM2 A;  3OW7 A;  3KX2 A;  1IUF A;  1XSX A;  1BIA A;  2X4H A;  1W1W E;  2QEX B;  2XGD A;  2G7H A;  4J19 A;  3KE2 A;  4CCL A;  1O7L A;  1Z7U A;  5D5W B;  1E0E A;  1YIT I;  1MZB A;  2XB0 X;  5FKM A;  3J80 Z;  4BDZ A;  4YAO A;  1UCR A;  3DKX A;  2I5U A;  2YX7 A;  1O4X A;  3FHN A;  4FE7 A;  3Q39 A;  1I6X A;  1R7J A;  1AOY A;  3H0D A;  3HRU A;  5HLG A;  2G0Y A;  5J6X A;  1YOV B;  1TZL A;  2HYG D;  4YFK F;  1U5T B;  3CRZ A;  1DPR A;  3IRQ A;  3JCU C;  3G73 A;  1ZR2 A;  4GRI A;  4LB5 A;  1SD4 A;  1DU0 A;  1Y8R B;  2JVH A;  2CS3 A;  2YUS A;  3B78 A;  2L0K A;  2PYH A;  3N6Z A;  3F6O A;  3CC4 B;  3CC2 B;  2P4W A;  1S7E A;  2CV0 A;  3S2H J;  5IY5 H;  2VXD A;  1SVO A;  3UNG C;  1HQC A;  4V2F A;  1W87 A;  1WOO A;  3EYY A;  3TMO A;  3ONQ A;  1W7P B;  3LSP A;  1MDM B;  1JNY A;  2GJK A;  2KLO A;  3IAS 2;  5EDN A;  2IT0 A;  2OQG A;  3MZ8 A;  4XID A;  3L2Q A;  4IJA A;  2R7R A;  4UUT A;  1Z6T A;  1JI8 A;  1P7I A;  5HDK A;  1U5T C;  4R8H A;  2PMH A;  3SJZ A;  1YJW B;  4E7K A;  3EPZ A;  4XLP F;  1GVD A;  3CO7 C;  3JRG A;  4MTE A;  1A8P A;  4U49 A;  2QEN A;  1H89 C;  2IGK A;  1XB4 A;  3S3N A;  5LBQ A;  3PIO F;  3B82 A;  4XLE A;  3WG9 A;  2FX0 A;  3PFI A;  2WJV A;  3WU2 C;  3OP1 A;  4PSX A;  2NS8 A;  3W6J B;  1E3O C;  2ZNY A;  4L9T A;  4YFO A;  2VIX A;  2PMU A;  3U2R A;  2MFZ A;  2VKH A;  3HKZ A;  1ZM4 A;  4DQL A;  1E3P A;  2R5Z A;  4MEY F;  1WDT A;  2Z6B D;  2VKV A;  5GPC A;  3KLN A;  2PJP A;  2D3L A;  3NB2 A;  2LTP A;  1VQ5 I;  3HC7 A;  2A05 A;  2C6Y A;  1W5T A;  1B1B A;  3KP6 A;  3J81 k;  1OMI A;  2MC3 A;  4OMZ A;  5B3S H;  3CXC B;  3BPX A;  1FP2 A;  3BCB A;  2IVM A;  5D6E A;  3I53 A;  4PC2 A;  2OTJ I;  1EP3 B;  1U8R A;  3DEE A;  2YWH A;  1T08 B;  1WMR A;  1IXC A;  2JPC A;  4E4H A;  4UUV A;  3P5J A;  3BR5 A;  4L0Z B;  4M6X A;  2VQC A;  2V7X A;  5IYQ A;  4CCJ A;  5GPA A;  1PJ5 A;  2A3S A;  1KJZ A;  1VF9 A;  5L3D A;  2JTV A;  2JRT A;  2AXL A;  2W1O A;  3ERE D;  1NHA A;  4PZJ A;  2YWE A;  3PA2 A;  1BX0 A;  1V4R A;  2HOS A;  2L9V A;  2BV3 A;  1F60 A;  1EFC A;  2RQQ A;  4HV6 A;  5E1X A;  2M4G A;  2TDX A;  3FXO A;  3LOC A;  4II3 A;  1K61 A;  1YX3 A;  1D3Y A;  3BJA A;  3H9Q A;  5TIS C;  2IQ7 A;  1TYW A;  1LDD A;  4MFE A;  2DA5 A;  4FQG A;  1WSU A;  2LFB A;  4QIW N;  1KU7 A;  3BQZ A;  2CGP A;  3FJO A;  4LD5 A;  3H09 A;  4Y52 J;  3CJN A;  3VSU A;  3FMS A;  5DS0 A;  1O8L A;  1VQ8 B;  1XSD A;  2CQK A;  1TYU A;  4P3Y A;  4FTH A;  2M45 A;  3RZD J;  3G05 A;  2L5Q A;  1ZEL A;  1RC9 A;  3ZOB A;  3CPW B;  1X1B A;  3DDY A;  1UHM A;  3S3M A;  4NQW A;  1WGX A;  1E3Z A;  3OYK A;  2D9R A;  3CUQ A;  4JX5 A;  2VE8 A;  4R1H A;  2Y9Y A;  3BZ6 A;  2IS6 A;  1JGS A;  4NDL A;  3PA1 A;  1MMD A;  2XGX A;  1D5V A;  4OAY A;  4NBS A;  5F0C A;  3GIR A;  3S1M J;  2Q2E B;  3U1D A;  2ZZQ A;  4PGO A;  5J3O A;  1JT0 A;  1KYW A;  2GXG A;  1V55 H;  3KCC A;  1WH5 A;  2VBZ A;  5EG0 A;  4RGS A;  1GR1 A;  1CZF A;  1FBS A;  2GOX B;  3HHG A;  1PUE E;  4DK1 A;  3D1N I;  4EM0 B;  2DQL A;  1G7T A;  2DDB A;  1F20 A;  1TNS A;  2XTX A;  1OCO H;  4KH3 A;  1ONV A;  4BHP A;  1UHS A;  5TJJ A;  3JR9 A;  3VYR B;  1V54 H;  3A02 A;  1FNB A;  1ETK A;  4NC7 A;  1YLO A;  2X9D A;  3H3Z A;  4UZU A;  3CUQ B;  1JE8 A;  3QYE A;  1T6Z A;  2XVC A;  4RJL A;  1MJA A;  5IYD J;  1KTW A;  1BX1 A;  1FT9 A;  4XRF A;  3CJT B;  4XLF A;  1K4T A;  2AHO A;  1SKQ A;  3SLN A;  2W00 A;  1S0U A;  2QQ9 A;  5FLV A;  3OYA A;  1B9M A;  2COB A;  4BHB A;  1RKW A;  2R3S A;  1UD6 A;  4KIS A;  3FPP A;  2R7U A;  1R00 A;  3FXK A;  3GFI A;  5A8A A;  4Y9R A;  4N4O B;  1N75 A;  4C3J J;  1XGN A;  1JJ2 B;  4UV9 A;  2OC6 A;  1KK1 A;  5F0F A;  2DOG A;  3R60 A;  3CF5 F;  3OKX A;  1K4S A;  2VXZ A;  1M1E B;  1R22 A;  3LFK A;  4M3F A;  4UHT A;  2AQE A;  4DZJ A;  2P5L C;  2XC7 A;  1L0O C;  2M5W A;  2DFH A;  3V4G A;  3CC7 I;  3OJW A;  3KP2 A;  1LLZ A;  2QMU A;  2NST A;  3C2H A;  2HFH A;  1TYX A;  2E1M B;  1HDD C;  1ZQ3 P;  2B63 J;  2BVN A;  3ZQQ A;  1SAX A;  5FKO A;  2F4O B;  2X6X A;  3RJP A;  3OZV A;  1KGS A;  3CCS I;  3HGY A;  1YX2 A;  4OIR F;  2DOD A;  2WC2 A;  3UW0 A;  2JVG A;  2QKM B;  4AF6 A;  3HBL A;  3VSV A;  1LQ1 A;  5DEQ A;  5EEG A;  2YPR A;  2QWW A;  4LGW A;  3T1B A;  1QQ1 A;  2IXS A;  5AMV A;  2EJR A;  1JGG A;  1RUO A;  3BQY A;  2KRH A;  2EFP A;  4O6J A;  5KCM A;  4TMX A;  2JN6 A;  5LHI A;  3AKZ A;  1QA3 A;  3HOT A;  3K10 A;  1IHM A;  1FYM A;  1DG1 G;  3WYA A;  3KP7 A;  5M5W J;  3K4L A;  2PX9 A;  1Z9C A;  3KET A;  1S6L A;  4B4D A;  3VOD A;  2JA8 J;  5IP9 J;  3NEU A;  4PC1 A;  2H1L A;  2M0C A;  1IN5 A;  2EV6 A;  4OWR B;  2VQG A;  5J1U A;  3OW2 B;  5B1A H;  3M8F A;  4DNT B;  3H92 A;  3FK6 A;  3ZMD A;  4PJ0 C;  2YU9 J;  3DKY A;  1VQP B;  4YEJ A;  3K2A A;  3O3K A;  4ESB A;  4V19 K;  4ITV A;  4KNY A;  2P7C B;  3IP4 B;  1B8I A;  2VBW A;  2DMT A;  4EVI A;  4M3D A;  1HCR A;  3RI4 A;  1ZG3 A;  2X1D A;  3RTR A;  3K1N A;  1A36 A;  3P4G A;  5FLX K;  1MJB A;  3CUO A;  1FEX A;  3AVW A;  1OGM X;  1IRZ A;  2NYX A;  2FD5 A;  1KU2 A;  1MAB A;  3CME I;  1ON1 A;  3ERM A;  4YAU A;  3ML3 A;  2DMP A;  1F9N A;  3L2R A;  4GO1 A;  2VBM A;  2L7F P;  1ZRD A;  2JSC A;  2BSA A;  2VKE A;  1L3L A;  1SFE A;  2DMN A;  1VQ8 I;  4WZE A;  4ZZD A;  1OCT C;  1HG8 A;  4A3C J;  3CMA I;  2XGJ A;  1RZ4 A;  1X58 A;  2UXX A;  5FO0 A;  2XT4 A;  2V4J C;  4PC3 A;  1U8B A;  4FK8 A;  2H8R A;  1I1S A;  2DA6 A;  4LBY A;  4Z4W A;  1KQ5 A;  1W5C C;  1KQ8 A;  3G71 I;  3Q0V A;  5F64 A;  1A6I A;  1ETO A;  4A3M J;  2QE7 A;  4Z03 A;  5J4Y A;  2AHQ A;  2ZXH A;  4YIF A;  4N3G A;  4KJZ A;  4Q47 A;  4Y4R A;  2F43 A;  3IUO A;  1DQU A;  5F04 A;  1IUY A;  1YIJ B;  2KJC A;  1GHC A;  4W97 A;  1U2R A;  2VT3 A;  4X0C A;  1U9O A;  5GAD J;  4EJV A;  2HKO A;  3ZQ7 A;  1Z0X A;  3JRB A;  2E2J J;  1DDI A;  5H5J A;  3S93 A;  3HKZ N;  2NTQ A;  2KDO A;  4XOT A;  3V7S A;  2RNG A;  4PFP A;  4RLQ A;  1FSH A;  1QZY A;  3WND A;  1W0U A;  3GFM A;  3VYS B;  3E7L A;  2Q8K A;  4RGU A;  4QPQ A;  2OTJ B;  2EWE A;  2R7W A;  2V26 A;  1E64 A;  4UV8 A;  3U6K A;  4GCV A;  1G7S A;  1SKY B;  2YR2 A;  3QFR A;  3GQB A;  5KK1 A;  5F6F A;  3Q0W A;  3OFN A;  2KIS A;  3I0T A;  3B8H A;  3NWS A;  1IO2 A;  2O6W A;  1YRN B;  1AIR A;  3FKI J;  2AQF A;  1A31 A;  2BM0 A;  4RLZ A;  1GLN A;  1JTX A;  2DW4 A;  3CUQ C;  4JRA C;  2BW3 A;  2M7B A;  4HST A;  4KN4 X;  3MVP A;  4RA2 A;  1WOP A;  2PMD A;  3A4C A;  4JOM A;  2RV8 A;  4XN3 A;  4RB3 C;  1F36 A;  5GTI C;  4KT6 A;  4CZC A;  1E3H A;  4YAW A;  4YCQ A;  2W57 A;  2WAD A;  2RNJ A;  4G7O F;  1XB2 A;  1VQO I;  2QBY B;  2WJY A;  2R7O A;  3HSE A;  3L2W A;  1VI0 A;  3G6E B;  2FJ1 A;  2NVY J;  3E6M A;  2JQ7 A;  1DPU A;  3OPO A;  2F5C A;  5AON A;  2ZME C;  1W4M A;  3E5X A;  3K0L A;  1GVJ A;  1WJD A;  2FOK A;  1ITY A;  1S3J A;  1UFM A;  1TT5 B;  2E5N A;  1D0X A;  3CCV B;  2XZP A;  1OHH A;  1ZUN B;  4QPO A;  1VND A;  1RWR A;  4UUS B;  3LJY A;  2GQF A;  2XNJ A;  2XB5 A;  3CC2 I;  3U9G A;  1VQ9 B;  1ZLK A;  2QXZ A;  1SFO J;  1PKV A;  1YW8 A;  4A3G J;  3RKX A;  1G4D A;  2A68 F;  1G59 A;  5C4J J;  1O88 A;  4LBV A;  3PM1 A;  2ZXJ A;  1DBG A;  4HE6 A;  5CVI A;  1B59 A;  3S15 J;  1W36 C;  5KAI C;  3ZPL A;  1DU6 A;  1QHH D;  1TWF J;  4MYU A;  4IZZ A;  3BG6 A;  1MW7 A;  3LFU A;  4M74 A;  3OIO A;  2NVU B;  4YIR X;  1QA1 A;  2QY1 A;  1ZAR A;  3BG5 A;  3FMQ A;  4PAB A;  1P4M A;  5AN9 A;  2F48 A;  5CVV A;  1SFK A;  1HDP A;  2X0L A;  1VQN B;  2MH9 A;  1SMT A;  3QYB A;  1F43 A;  4JK1 X;  2YWF A;  2MGQ A;  1V5F A;  2QEX I;  1LVK A;  3F9K A;  4EH1 A;  4MIM A;  2ZSI B;  2BM5 A;  4AWX B;  2BY0 A;  2K9L A;  4CXF A;  2Z9O A;  5JMC B;  2FX3 A;  2XSJ C;  1I5Z A;  2QM3 A;  2K86 A;  1JUS A;  3R4K A;  2CQN A;  3HOX J;  3LYC A;  2R7S A;  2LKX A;  2X1E A;  2VFM A;  1HLV A;  4IOA F;  2HCJ B;  3TQN A;  3GTG J;  1PUF A;  4IHV A;  2C5B A;  1XDS A;  3SEZ A;  5FGM A;  4BAC A;  3F23 A;  4OJL A;  2LK2 A;  4OJP A;  1Z21 A;  3S2D J;  2JRM A;  3M9A A;  4JX4 A;  1EFU A;  2FXA A;  4FET A;  2HOA A;  1T6S A;  3GTK J;  1W0K A;  1J2X A;  2R4G A;  2Q0O A;  4ZDL A;  1ETQ A;  2O8K A;  2ZCW A;  2IAI A;  1ULY A;  2G0E A;  3K4J A;  4PGH A;  4RBO A;  3CCR I;  4ZCL A;  1RU4 A;  2NZM A;  4MO7 A;  2MG4 A;  3CF2 A;  2R5Z B;  3GX4 X;  5HS9 A;  1X3U A;  2Z8G A;  1WU8 A;  4BE0 A;  1SMY F;  3H1C A;  2KZV A;  1VQK I;  3CCJ I;  4IF4 A;  5FO1 A;  2VPL A;  3WGH A;  1HF0 A;  3T9G A;  4P26 A;  2IGN A;  4EJO A;  5BMZ A;  3BWG A;  3BZC A;  3B90 A;  1O8D A;  3JAM K;  4HDU A;  3Q5F A;  4OPO A;  4FXU A;  2HPI A;  4IPA A;  2KP6 A;  2UV1 A;  4OU0 A;  3ASO H;  1LUJ B;  1XTA A;  2BY2 A;  3DPU A;  2HEO A;  4BUP A;  1RET A;  3FXJ A;  4BQQ A;  3R6J A;  1D1N A;  1EH8 A;  1JB9 A;  4OPW A;  1Y0U A;  3MD2 A;  5KAF C;  2P7V B;  2LBF A;  3SYJ A;  3LMM A;  1D8K A;  2EIX A;  2CFO A;  3DTI A;  4A12 A;  2ODL A;  4FX4 A;  3LSG A;  1OFL A;  4UZE A;  2B7E A;  2V9P A;  3PNV A;  1T38 A;  1P4W A;  2HU9 A;  1I3Q J;  4BU2 A;  3LSJ A;  2HTS A;  2K9S A;  1R1U A;  4P25 A;  1O57 A;  2LY2 A;  2HLD A;  5EZH A;  3GEZ A;  1D1A A;  4I6Z A;  3AL0 B;  3HIF A;  4A5N A;  1O8J A;  1TNT A;  5THX A;  1DGR M;  3QQA A;  4X7C A;  1GV5 A;  3VEP A;  1LE8 A;  2K4J A;  2DTR A;  3LAJ A;  1FNM A;  1UG0 A;  2ZJR F;  1MD0 A;  3BCA A;  3CO6 C;  3W2E A;  3W2F A;  3NE5 B;  3RKY A;  1IDZ A;  3CCY A;  2XRL A;  2O0V A;  1PVE A;  2LOO A;  3HUG A;  5HKK A;  1H80 A;  3ZMU A;  4IKF A;  1NDH A;  3GQA A;  1L1I A;  2Z5U A;  3HOU J;  2L7K A;  5M3F J;  2KRC A;  2EBI A;  4BEH B;  3I64 A;  3CCQ B;  3EQN A;  1H8E A;  5CVJ A;  5H6R A;  2HDN B;  5ILU A;  1SAN A;  2GOM A;  5BPD A;  2EFW A;  4IHY A;  3BCF A;  2L4M A;  4O3M A;  5C4X J;  4A69 C;  1VLO A;  3AGP A;  3PUM A;  1PXZ A;  2BPO A;  1EE6 A;  3WNC A;  1YTY A;  3E97 A;  1TQM A;  2B7C A;  1V5V A;  3SEJ A;  2VFN A;  3DV8 A;  2V5I A;  1OKR A;  2DFI A;  2GBY A;  3G1O A;  3HRM A;  3H35 A;  4HAM A;  3H36 A;  4QV2 A;  4RDJ A;  3T5X A;  2BHZ A;  3BTJ A;  2P8T A;  3KL9 A;  2Y31 A;  3U6B A;  2M9H A;  3CP8 A;  2HYF A;  4HBL A;  4GFB A;  3IKV A;  3M4O J;  1BQE A;  5FRM A;  2M2E A;  4I98 B;  4OM9 A;  3MKL A;  4HNU A;  4YRV A;  2JZY A;  3C18 A;  5GV8 A;  1IN4 A;  2FNP A;  2HQ5 A;  1QRY A;  4Y15 A;  3ZQC A;  3VPR A;  4DYQ A;  4XL9 A;  1T0F A;  2DDA A;  3ZMZ A;  4CDG A;  2HOE A;  5ICF A;  1R4N B;  1V5G A;  3OIP A;  5IT9 Z;  1EF4 A;  3HTU A;  1WOR A;  3HUG B;  3IHU A;  4C43 A;  3IKT A;  1LVA A;  2XF7 A;  4X6A J;  3WTV C;  1IV8 A;  1UHW A;  4B3F X;  5HXB A;  2VJI A;  3V42 A;  3OYD A;  1PDN C;  3WTY C;  4BEH A;  3BH4 A;  5ICG A;  1SM4 A;  4ON0 A;  3OV8 A;  1E43 A;  4WX9 A;  3LSI A;  1U2W A;  5E3L A;  1IRG A;  5CQE A;  1BLI A;  2PI0 A;  2CG4 A;  5LRS A;  1LJ9 A;  2G7U A;  1HSJ A;  4ESJ A;  1PJR A;  1W35 A;  4ZCM A;  1R9T J;  1J9Z A;  2EZI A;  2FVG A;  3JAM Z;  2ECB A;  1BL0 A;  2XNC A;  2BGI A;  3V76 A;  4G6I A;  2WV1 A;  3E1S A;  5F4J A;  1D1B A;  2FA5 A;  3FXM A;  1X1C A;  3RQI A;  2GA2 A;  3DFG A;  2HZT A;  2XRO A;  5F1R A;  1K8F A;  1UJ8 A;  2R7D A;  5A88 A;  1X4O A;  2R6H A;  3CCL I;  4IX7 A;  1YO5 C;  1OCZ H;  5DCM A;  3GZN B;  4B4C A;  2NRA C;  4TMZ A;  1QHG A;  4FAS D;  3QE2 A;  2IPQ X;  2MD5 A;  2A6T A;  3DXJ F;  1XGO A;  3L2C A;  2BN4 A;  5CPR B;  3CB4 A;  1TYV A;  4PK4 A;  2CQX A;  4AF7 A;  4RAF A;  4X8I A;  3DKW A;  3LO8 A;  3VST A;  4LFU A;  5HNH A;  2ZJP F;  2R5Y B;  2BOL A;  3B6C A;  4EEF G;  2E7X A;  3AFH A;  3HYI A;  5IYP A;  3DLA A;  1TWH J;  4E7S A;  3BR3 A;  2GK6 A;  3OYI A;  3FBI B;  1E3X A;  1HZE A;  4ZH4 F;  3WTT C;  3A35 A;  1SAU A;  3B73 A;  2KVO A;  4X7E A;  2MH2 A;  4DIQ A;  1EFT A;  3BTI A;  2R7V A;  3WG7 H;  5K1Y A;  2ELJ A;  2VBK A;  4E7H A;  3EUH A;  3G2B A;  5ERI A;  4N9H A;  1PJ7 A;  3G4S I;  2CF4 A;  2V7W A;  5FB2 A;  2H27 A;  2R7Q A;  4CYD A;  2CND A;  4GGG A;  2B9S A;  5J47 A;  4DW6 A;  1WJF A;  1CF7 B;  1X1P A;  3PFY A;  4P12 A;  2ZXI A;  4F7D A;  4U0Y A;  1J0R A;  5CLS A;  1HOM A;  1WXR A;  1U6G A;  2XF6 A;  3K70 C;  4WZT A;  3U1K A;  3SFZ A;  1YFH A;  1GXQ A;  2CUZ A;  1Y1V J;  3IH2 A;  3REO A;  1ZR4 A;  2A5W A;  1BA5 A;  3GVL A;  1JTA A;  2D74 A;  1FOX A;  1Z1D A;  1WSR A;  4LLL A;  4CHU A;  1EV7 A;  2ME0 A;  3NAU A;  1LFU P;  4LBZ A;  3AVX A;  4I09 A;  1BOA A;  2ME6 A;  2EFN A;  1OCC H;  3WOD F;  4GDF A;  5DM6 F;  3PNT A;  3ZP5 A;  1Q1H A;  3PSS A;  3K2Z A;  3ZN1 A;  4A3E J;  1JKO C;  2PLF A;  1IG7 A;  1BW5 A;  1S8N A;  1YRN A;  2LZJ A;  1KU3 A;  3H0G J;  2E35 A;  2WY8 Q;  5DN6 A;  2QSF X;  3GFL A;  5B6I A;  5DS9 A;  4QFM A;  5EG0 B;  3CCU B;  1JJ6 C;  2MSY A;  2OU2 A;  3FBN B;  2WBM A;  3OWT A;  1QFY A;  4TSF A;  1Y8Q B;  3QPT A;  4C2L A;  5C3E J;  3RQ4 A;  2WR8 A;  1RUN A;  1XGM A;  2LP0 A;  4D5F A;  5TR9 A;  5D4R A;  1NB9 A;  1FZP B;  2FQ4 A;  1AHD P;  1ZRF A;  1LDK B;  1J59 A;  4XM3 A;  5IP6 A;  2V7Q A;  1ETY A;  3G6E I;  3WBK A;  3JW4 A;  1LNW A;  5K7F A;  3LA2 A;  1WJA A;  5L3F A;  1DUX C;  3EQO A;  2ZO4 A;  2DK8 A;  2ADU A;  1GUU A;  3VNU A;  2JSP A;  5FRO A;  5HZB A;  4BJ6 C;  1RRJ A;  2IBD A;  1X2N A;  2UXN A;  4YFN F;  2CUF A;  3ESW B;  4G7H F;  1YIT B;  1R1V A;  4Z6Y A;  1KK2 A;  4WQM A;  3QFC A;  3D5L A;  1E1Q A;  1OB0 A;  3BR1 A;  2XTW A;  2O7O A;  3F21 A;  1FRQ A;  2MD0 A;  3RCO A;  1UD5 A;  2MBF A;  5AIQ A;  1QUF A;  2NTP A;  1D0Z A;  1XCB A;  2ZIT A;  2L3D A;  3VMW A;  5LMZ A;  2UZK A;  1WKM A;  4MEX F;  3K1P A;  2JA5 J;  4X0G A;  4M3B A;  2EZK A;  5BPI A;  2OA4 A;  1YX5 A;  1ZK8 A;  2QDX A;  3PUN A;  4EW9 A;  2E1C A;  3VDX A;  1FYK A;  1JXS A;  3ASQ A;  3ZZU A;  3IH4 A;  2OYN A;  5L3E A;  3BZK A;  3E5U A;  5M3M J;  4QHY A;  2N8G A;  5K5Q A;  3DU1 X;  1DBO A;  1J9I A;  1ZTR A;  4HYE A;  4ZTF A;  2F5F A;  4HE5 A;  5HDG A;  4MYT A;  3PVD A;  3SQV A;  1COW A;  3W2I A;  2EWN A;  3ZBU A;  4PJL A;  4DK0 A;  1X2M A;  2OD5 A;  2VQL A;  4M9S A;  4WWV A;  4LIV A;  2FU4 A;  5HLT A;  1T6X A;  2XSD C;  1ZM3 A;  4LBW A;  2DA1 A;  2DLL A;  3E1Y E;  1FNC A;  2V1D A;  4XN0 A;  4P6Y A;  3W3C A;  1M90 D;  3A01 B;  4FE4 A;  3AVT A;  3N97 A;  1WPC A;  1S7A A;  1JA0 A;  2CSO A;  1MMG A;  1TQP A;  1MJ9 A;  2IGO A;  3DPL C;  4IHT A;  1XPX A;  2V7V A;  2NOG A;  2L4A A;  3WE2 A;  3A8I A;  4AIH A;  1O8I A;  1ZKG A;  2C77 A;  2ZTG A;  2DJI A;  1WH7 A;  5ICC A;  2XV4 S;  4G5G A;  3GQ9 A;  2E1B A;  1FPQ A;  2HVQ A;  3LSK A;  2VBT A;  3SJM A;  3S8P A;  1MMN A;  3NQO A;  2R7Z J;  4W8R A;  3FXQ A;  2VE9 A;  4XON A;  1YS7 A;  4PC7 A;  3AG1 H;  3SJP A;  1OFD A;  2P6S A;  4C2U A;  3KRG A;  3GLL A;  3OR2 C;  2D5V A;  3H9J A;  4IRI A;  5BQT A;  5DCF A;  3FXU A;  1XX5 A;  4UZF A;  4W8T A;  3ZQF A;  5HOD A;  2F5D A;  2JDI A;  4F52 A;  2CO5 A;  1QBJ A;  3J81 K;  2W82 A;  4HRI A;  3NWT A;  1QJV A;  2DYR H;  1ZGJ A;  2BVL A;  2PQ8 A;  3VSK A;  4UUS A;  4CYC B;  1T8I A;  2VOD A;  3IV5 A;  4EQQ A;  4LMY A;  3ABM H;  3FWE A;  1GJR A;  3S16 J;  1SD5 A;  2BXZ A;  2M4K A;  2ZL6 A;  2R5Y A;  1GT0 C;  2ESH A;  3HSR A;  4M72 A;  5LHG A;  1LFB A;  2ID6 A;  3BLY A;  2Q1Z B;  4RB2 C;  2WWY A;  3BQJ A;  4M3G A;  3ONY A;  3LA3 A;  3ONU A;  2QSH X;  2X8K A;  2KT0 A;  4FT8 A;  3TO7 A;  3FX3 A;  4WZL A;  1FYL A;  3FIW A;  3JRC A;  2XZO A;  4UVA A;  3KZZ A;  4Z4Y A;  2CW0 F;  2ETH A;  2CRG A;  5HDN A;  2DMQ A;  2EV0 A;  2F4I A;  1WOS A;  4Q5S F;  1DDG A;  2M3A A;  2X85 A;  4TN1 A;  3J7Y J;  1BC8 C;  4XSZ F;  3MAJ A;  2O04 A;  2BGJ A;  5E6T A;  2LKP A;  2XZL A;  2F6C A;  3IL2 A;  1WFX A;  2Q6I A;  4U0W A;  2KHM A;  3HSF A;  1HW1 A;  4ZDO A;  2ZJ2 A;  4M9X A;  3W2H A;  4AVZ A;  2QQ8 A;  4OMY A;  1AMO A;  2DET A;  3PIP F;  4WZK A;  2QYO A;  3T8R A;  2M8E A;  3CJQ B;  1OB5 A;  1N78 A;  4BY7 J;  3OYB A;  2DAO A;  1Y1W J;  5H2F C;  4E0F A;  2DA2 A;  4HOB A;  2VLA A;  4OZZ A;  1JUP A;  2CH0 A;  4N4N B;  4XRS G;  1KMH A;  1YW9 A;  3GBG A;  2DOE A;  3D0S A;  1JRG A;  1YS6 A;  4Z4R A;  1T98 A;  2D2W A;  4A0Y A;  3BPV A;  2MAB A;  1WSV A;  2HKX A;  1O8E A;  2XAH A;  3WTZ A;  3ZSC A;  3KYL A;  4LIT A;  3WU0 A;  1N8R D;  4YZQ A;  3KEQ A;  2GPJ A;  1XD7 A;  3OIQ A;  1Q9S A;  4XSX F;  3RYP A;  4OJO A;  3N05 A;  2XAU A;  3GTO J;  2HDD A;  4OIP F;  5L3C A;  3H94 A;  2E1R A;  2F4M B;  2O03 A;  3O6B B;  4BAY A;  3LQR A;  4KMF A;  1B2R A;  1FC3 A;  1WI9 A;  1D2E A;  4H4K C;  2OBT A;  3HAG A;  5FFX A;  3FKS A;  2ZME A;  3WGG A;  5HS8 A;  4ETS A;  4G94 A;  4PJJ A;  5FLX Z;  4TKO B;  5GAH J;  1YLF A;  5DNS A;  3ZMV A;  2M30 A;  2LNB A;  4RD6 A;  3V7A A;  3RPQ A;  2HNH A;  4I84 A;  1S7O A;  3MWM A;  5GAG J;  1XG1 A;  4RB0 A;  1T0F C;  4MFD A;  1IJE A;  1E63 A;  3ZBT A;  3LSM A;  1TLH B;  2X6Y A;  1FOY A;  1B9N A;  3IH3 A;  4UVB A;  3X2Q H;  3DU6 A;  1OR7 C;  1HW5 A;  4U87 A;  1SFU A;  1X3W B;  3MHP A;  1O3R A;  5C1C A;  4GXO A;  1DAR A;  1YI2 I;  1NB0 A;  1QG0 A;  5L46 A;  2DPD A;  3W5H A;  3CCJ B;  4LG3 A;  1EA3 A;  4QSH A;  4ANJ A;  4FX0 A;  5KW9 A;  2BXY A;  2H6B A;  2WB1 N;  1VQ6 B;  3MKZ A;  5HVQ C;  4PGG A;  4ZDP A;  5C1E A;  4U9U A;  1UD8 A;  3ASP A;  3I71 A;  2VPR A;  3NAR A;  1QRB A;  5DUK A;  1H8H A;  1OIS A;  1YHQ B;  3HOV J;  4M4S A;  4RCZ A;  3AL0 C;  4MTD A;  1QPI A;  1EFR A;  1R5N A;  4TMV A;  3TDU C;  1BN8 A;  5GP9 A;  3ZQG A;  5IK2 A;  4W8Q A;  5JI6 A;  3JUR A;  3B4N A;  1MBE A;  2NV4 A;  2VYQ A;  2O9L A;  1JKQ C;  2IA0 A;  3ZR8 X;  5E8G A;  3DU5 A;  3SDG A;  5IPA A;  1G3S A;  3ZMT A;  5IYC J;  4BJ5 C;  1KK3 A;  5FL7 A;  1FIA A;  3ISP A;  1U78 A;  1E79 A;  2BGC A;  3OYC A;  3M7G A;  4JP0 A;  4RDK A;  1EP2 B;  3H5A A;  3TW6 A;  2Y75 A;  1T33 A;  1JTY A;  3A0H C;  4GYI A;  4RM3 A;  4D9J A;  1FTT A;  3I56 I;  4XOP A;  4NK6 A;  4YZX A;  2E5Z A;  2R93 J;  3EUA A;  4QVA A;  4G12 A;  4RAZ A;  2JPB A;  1N0U A;  4YZ0 A;  2A61 A;  2JJ7 A;  2F1M A;  4TT3 A;  2OQR A;  2CUE A;  5J4V A;  2ZBK A;  4CZZ A;  1H9G A;  4B1R A;  3QSY A;  1TUI A;  3MQ0 A;  4E70 A;  3HTS B;  1NTC A;  3TP0 A;  4BBR J;  1R5B A;  1VHO A;  3HG9 A;  1ZN2 A;  4A5M A;  4H9G A;  3U2Q A;  3AG2 H;  5HLH A;  3T53 B;  5FD6 A;  1BW6 A;  3ZPN A;  4YDT A;  3AG3 H;  2LRD A;  4Z4Z A;  2DMU A;  2E1M C;  4WXD A;  1O8K A;  1FDR A;  5LRR A;  1LKX A;  2WY7 Q;  5ICE A;  1HKQ A;  1R5H A;  4F55 A;  2BM4 A;  1EZG A;  2J5O A;  4A93 J;  2IJL A;  5FFZ A;  1D8T A;  1V3F A;  4JMQ A;  4RDL A;  2VJJ A;  5AIP A;  3FY3 A;  3O8G A;  2LBF B;  1SC7 A;  4Y7C A;  4B3G A;  2WA0 A;  3G1L A;  1JHH A;  4OIN F;  2IS4 A;  2FOW A;  2ZBU A;  4TMT A;  3JTG A;  2HXI A;  2W6J A;  1IDJ A;  4DBR A;  1SD6 A;  3OOP A;  1R5I D;  3BNW A;  2BM6 A;  4MLO A;  1UG2 A;  3KZY A;  4KIB A;  3B6A A;  1APL C;  1WQ2 A;  3BT9 A;  1J75 A;  3DBL B;  3KP5 A;  5IYR A;  3QAH A;  3GME A;  5DM7 F;  1K79 A;  1YJN B;  4G7X A;  2H09 A;  3UKG A;  1NK2 P;  4EJT A;  1VJS A;  3WQZ A;  2XTY A;  3JRH A;  1JKR C;  2XKP A;  3RYR A;  3PL8 A;  1U9N A;  2MYS A;  3CDH A;  3F0C A;  1FBU A;  2DBB A;  2M1B A;  1XMX A;  4I76 A;  2C78 A;  1IGN A;  4CGZ A;  4R79 A;  4W1U A;  1KON A;  2JJ2 A;  2IP2 A;  3IAM 2;  2WV0 A;  2XDV A;  4F93 B;  4AIK A;  4ACA A;  5BSY A;  1BHE A;  3LMW A;  3NAW A;  1LEB A;  3C2B A;  3LSH A;  4CSW A;  1VQO B;  1IB0 A;  4W8S A;  2JN9 A;  5CJ9 A;  3OS1 A;  2BZT A;  2OK7 A;  3F3X A;  2D45 A;  4NHJ A;  5JLV C;  3LST A;  2DYI A;  1MMA A;  1X3Z B;  1MGT A;  3B8Y A;  1FTZ A;  1XDU A;  4P2N A;  4HF2 A;  4EGY A;  3ASR A;  2V9K A;  4B44 A;  1ZH5 A;  1OCP A;  5FKL A;  4U7D A;  4K1X A;  1IN8 A;  1AWC A;  2XUB A;  3PEN A;  3HB9 A;  3WU1 B;  2VON A;  4X7F A;  3VSL A;  5KVR A;  2XC1 A;  1ZRC A;  1W5S A;  2R9V A;  3ABK H;  4NCN A;  2LRE A;  4HX8 A;  4Y17 A;  3EQL F;  2QUF A;  3EDP A;  1OJL A;  3FDY A;  4O5V A;  4QLC U;  3GTL J;  3VO2 A;  2QZA A;  2X48 A;  2A6E F;  2Y30 A;  5ED4 A;  3H9G A;  1Y0N A;  1QO0 D;  5IYW A;  1TP4 A;  3OYG A;  3WTU C;  1K28 D;  1QZE A;  2H94 A;  2EIL H;  4B48 A;  3ZQL A;  1Y39 A;  3WNB A;  1I39 A;  3GZ5 A;  2CFX A;  1G3W A;  2XPU A;  3FK7 A;  3TOA A;  3KP4 A;  3BP8 A;  1UMK A;  1Q82 D;  2YX4 A;  3GVA A;  3DBH B;  1SEU A;  1G7R A;  4X07 A;  4G1B A;  5F1J A;  4XRS A;  5FA6 A;  1Z67 A;  9ANT A;  1QVT A;  4RGX A;  3FMR A;  2XT2 A;  1K4Z A;  1BBY A;  1XFO A;  2HTJ A;  2DK5 A;  2DT5 A;  2ZZF A;  3CCL B;  1LEA A;  2ZTN A;  2IS2 A;  1X1D A;  3GF2 A;  3DEW A;  1GXP A;  4HLY A;  1VFC A;  4RGR A;  2L01 A;  1BR4 A;  3HRS A;  5BNG A;  2ZXW H;  2B0L A;  1TWC J;  4EV0 A;  4P1V A;  2V1N A;  5F4O A;  4UAJ A;  1B23 P;  2BY1 A;  5LEK A;  2VT2 A;  4BL0 B;  1IV6 A;  2LYC A;  3WHB A;  4ZYG A;  4L8J A;  2ACJ A;  3OZU A;  2KRF A;  3HPG A;  3KEO A;  2LVS A;  3CCM I;  2YWG A;  2D1V A;  2QBY A;  1MKM A;  2DXI A;  4XNF A;  3DBR B;  1T6Y A;  2LH9 A;  3MFK A;  4BS9 A;  3OYL A;  3ROU A;  5IOY A;  5D4S A;  2F2E A;  3F72 A;  3OL3 A;  3P26 A;  2QLZ A;  1KRH A;  1UMQ A;  4N9I A;  2X51 A;  2JWT A;  4FHT A;  3Q6R A;  1OOC A;  2VFQ A;  1JHF A;  2ZB9 A;  4RDU A;  2PBI A;  1Y56 A;  4A3K J;  1NG7 A;  4YAL A;  4A3L J;  2JA2 A;  1E2X A;  1W36 D;  1KCD A;  5EGO A;  1P7J A;  4KA4 A;  2OTL B;  2ZL7 A;  1HKT A;  2WB1 A;  1FX0 A;  2R7T A;  3OOU A;  3E6D A;  3QP6 A;  3SZG A;  3ULQ B;  2L7Z A;  2VBU A;  4WK8 F;  3H9N A;  2CV1 A;  3W2W A;  1QFJ A;  3CZ6 A;  4C2T A;  3HDD A;  3MCA A;  1ZM9 A;  4XQF A;  4G6T B;  1VQ9 I;  4M73 A;  4G6D A;  2F5V A;  4BQA A;  2KIM A;  2HI3 A;  3L2U A;  4XRM A;  4IRG A;  2L9N A;  2HVS A;  4AUX A;  1N07 A;  1KU9 A;  3LAP A;  2X53 S;  2JT1 A;  1Y6I A;  3SFI A;  1K78 B;  2C5H A;  4HIZ A;  3MZY A;  3GUD A;  4IHS A;  1R5G A;  5GV7 A;  3W5U A;  3BC8 A;  4XR6 A;  3S2W A;  2DEU A;  3D5R C;  4P96 A;  2RC4 A;  3P9C A;  2DFE A;  2MC4 A;  2UVE A;  5JBQ A;  1OYY A;  3K69 A;  3RY8 A;  3J80 K;  2CC2 A;  3PSF A;  1W9X A;  1WCM J;  3BRO A;  2BX6 A;  1FJL A;  4HF1 A;  3FF5 A;  1HST A;  3GTJ J;  3KYC B;  5A2Q Z;  1GVH A;  2QN6 A;  1MIJ A;  1BMF A;  2OK8 A;  3GQ7 A;  3CJR B;  3ML6 A;  1PUF B;  2ISY A;  2QSG X;  2CW8 A;  2Z99 A;  5E18 F;  1EP1 B;  5D6F A;  2QA4 I;  2JA6 J;  2QVO A;  2OF7 A;  3JRD A;  1O8M A;  4Z05 A;  3SZE A;  1Z77 A;  4LLN A;  3QP5 A;  1FLI A;  3GTQ J;  2VQH A;  5DYM A;  1OR7 A;  2HMA A;  3FXR A;  5D5V B;  5E3O A;  2L02 A;  2Z16 A;  2DO7 A;  3PO3 J;  2DYS H;  2PN6 A;  3AVV A;  3S1N J;  5FJ8 J;  1IRX A;  1TW2 A;  2GRE A;  4EJU A;  3F22 A;  1RIO H;  2WAQ A;  4A6E A;  4BNC A;  3SY2 A;  4KN7 X;  3GQ8 A;  1LFP A;  4E7J A;  1OGI A;  4XLC A;  3V8J A;  4CCM A;  1I50 J;  4C9Y A;  4LLG F;  4BKX A;  4Z4V A;  2PJR A;  4XK4 A;  1HXD A;  2FE3 A;  2EA4 A;  3CLO A;  2O0Y A;  1UEL B;  4IHX A;  1VQL B;  1TSP A;  2GA1 A;  4LIU A;  3L1P A;  4L9V A;  2PG4 A;  2ZFW A;  1MBH A;  4L9N A;  2CV2 A;  2E1N A;  4UB8 C;  4FIS A;  3ABL H;  3K4B A;  2QKL B;  3S32 A;  1Z91 A;  2G9W A;  3TOB A;  2D3N A;  3V8L A;  1R5O A;  3I59 B;  4N3N A;  1TWA J;  2BMW A;  1IAW A;  3ABT A;  5FO5 A;  3PNY A;  1IJW C;  1IF1 A;  2B0R A;  2H6C A;  1ORK A;  2L9R A;  5CVU A;  3T8T A;  4XKB A;  4RPB A;  4V2G A;  3JSP A;  1SFX A;  4EMS A;  4S04 A;  4KUM A;  4URR A;  1YHQ I;  2VI6 A;  2J5P A;  1TW3 A;  1RES A;  1WI3 A;  2CWE A;  1D5Y A;  1MMS A;  1OFC X;  3T51 B;  3B02 A;  2NPF A;  5E1W A;  2CK3 A;  2W7Z A;  1V0E A;  4JQF A;  4WWC A;  2QX3 A;  3KEY A;  4QTR A;  1BIB A;  1JUM A;  4HQM A;  3JSO A;  2C2W A;  1N77 A;  2LF8 A;  2VBS A;  3I55 I;  2VL8 A;  1Z6R A;  2VC1 A;  1LE8 B;  2PMZ N;  2HQA A;  3HGG A;  1JJ8 C;  3CMY A;  2HR3 A;  3BR6 A;  5CVR A;  3AAF A;  2PIA A;  2Y0S A;  3E20 A;  3J7A Y;  3SHF A;  1CLW A;  3C3W A;  3PJR A;  2I8D A;  3SXY A;  3S1R J;  3FHZ A;  2ESN A;  2XEX A;  1W0T A;  2HDC A;  2E1O A;  3WTW C;  2VOP A;  1E62 A;  4ROX A;  2O17 A;  1HA3 A;  1IN7 A;  3M8E A;  4PDK A;  2BM1 A;  2NNY A;  2QQA A;  4ESF A;  4YAF A;  1QVF B;  2GLO A;  3I4N J;  4Y3O A;  4MGR A;  1S5L C;  3F8M A;  5EZG A;  4RS8 A;  3TH0 A;  2NS7 A;  3GFJ A;  4M71 A;  4Z4T A;  4Z4U A;  3IWZ A;  1BJK A;  1X1A A;  5ILS A;  4DZP A;  3CD6 B;  2VUM J;  4PUS A;  3EUH C;  2RQP A;  5M5X J;  4OIQ F;  2VC0 A;  1ZG5 A;  2GJP A;  4NK8 A;  4X05 A;  2XAJ A;  2JUC A;  2JIZ A;  4NB5 A;  4K2E A;  1MSE C;  2ZZE A;  4HQE A;  2LG4 A;  2BV6 A;  1F1Z A;  3DLL F;  2PE3 A;  4RD1 A;  4OOS A;  3WE3 A;  4YXW A;  3MN2 A;  2XKO A;  4RMN A;  3OS2 A;  3H5R A;  1AU7 A;  2X3U A;  3M1E A;  1H42 A;  3RSN A;  3LQQ A;  3JRA A;  2PYG A;  5JVT A;  3S14 J;  1QPM A;  3K4K A;  3OYM A;  2K85 A;  3HOZ J;  1OFM A;  4MXN A;  3DF8 A;  2P5K A;  2V6E A;  4RCY A;  5DDG A;  3VYT B;  4MQ9 F;  2MLK A;  4MNU A;  1WRJ A;  1YG2 A;  3QPL A;  5HOO A;  4TMW A;  2K40 A;  4X06 A;  5L3B A;  5JLX A;  3E6B A;  1H9T A;  2R7F A;  1PLU A;  2EQR A;  4BPR A;  3A0B C;  3MCZ A;  3GVK A;  4OJ6 A;  3D26 A;  4ZYH A;  4IEJ A;  1ZLJ A;  2CW7 A;  2B7B A;  5DUI A;  3V7C A;  2KMU A;  2UVF A;  1P6R A;  1DGW Y;  4X1E A;  5LGT A;  3CC4 I;  3BJO A;  3H3V K;  4NUB A;  3TL4 X;  1IDY A;  2M7A A;  4BE1 A;  3JRE A;  1UD3 A;  1LM1 A;  4MR0 A;  1A04 A;  2EZH A;  3EET A;  2Z33 A;  3ZZ0 A;  1Q81 D;  3QU3 A;  4ENK A;  2HVR A;  3FXL A;  2W84 A;  3O8H A;  3Q3S A;  3ZN0 A;  1YJ9 B;  4C0S A;  4H0E A;  2H1K A;  3JQP A;  2BVM A;  5LHH A;  5GTH C;  2CUJ A;  2LKS A;  2PEX A;  2NAZ A;  3BTC A;  3SYT A;  3ECO A;  3E6C C;  3TP3 A;  2ISZ A;  3KPH A;  4Y13 A;  4LB6 B;  1RMG A;  1CGP A;  4YC5 A;  3BY6 A;  2E2H J;  4BH9 A;  4XD7 A;  1N25 A;  2OCE A;  2YSR A;  2TRT A;  1N0V C;  4II2 A;  4OPV A;  1FOW A;  2OUM A;  2XRN A;  3BH6 B;  1VQK B;  5CQG A;  4L18 B;  1AIP A;  1Y0Y A;  2GAU A;  2E60 A;  2ZJQ F;  4F3Q A;  3OYJ A;  3A2K A;  2E34 A;  1QZZ A;  3RIR A;  3HOY J;  4X7D A;  3GCM A;  2VBE A;  3RIQ A;  2E19 A;  1FWZ A;  3BG7 A;  2BEO A;  4B47 A;  4ZCI A;  3KYD B;  3Q38 A;  2EPF A;  2A6H F;  2M8G X;  1BR2 A;  5BOX A;  3JQR A;  2OBP A;  2EV5 A;  3N4M A;  4CYC A;  4ZGQ B;  3FIS A;  4ZYE A;  1Q86 D;  1R4M B;  4LK1 F;  1H0M A;  1FND A;  4P5O A;  1K73 D;  2E71 A;  1QA6 A;  1XQB A;  5M5Y J;  1FRN A;  4NC6 A;  1IB4 A;  1REP C;  3OEH A;  4IXA A;  1MNM C;  4OOX A;  4Q4Z F;  5FIU A;  4IQ4 A;  2OCC H;  1G6N A;  3TO6 A;  3A8J A;  4WXC A;  2ELH A;  2VBY A;  1XG2 A;  2HPM A;  1Z3Y A;  3QFS A;  2UUZ A;  1KK0 A;  1QX4 A;  2ZL5 A;  2NTB A;  4CCK A;  3F6V A;  2NVX J;  1XMA A;  2EA2 A;  2NVQ J;  1SVM A;  3BG3 A;  5IP7 J;  2OZU A;  5H59 A;  4A6D A;  1D1C A;  2VOO A;  2L54 A;  4BE2 A;  1KZH A;  3VMV A;  1VQ7 I;  5LLQ A;  1VQP I;  3BH7 B;  3F8B A;  4JBA A;  2M5S A;  4B09 A;  3J81 Z;  3WHC A;  5IYN A;  3JX8 A;  1TVC A;  3QWL A;  3A3G A;  2W48 A;  1Z3X A;  3I54 A;  3CQZ J;  4P6V F;  2WAQ N;  3ISX A;  1YJ9 I;  4EGZ A;  4L0Y B;  4ZJZ A;  4OZY A;  4YZA A;  2RN7 A;  1ELO A;  2FML A;  4YFX F;  3GO5 A;  2K9Q A;  4HSR A;  2I1L A;  2XAF A;  1R49 A;  1T39 A;  4PAA A;  3T0Y A;  4RD2 A;  2VAS A;  2BE5 F;  1UD4 A;  1OYI A;  2X6W A;  1QUE A;  4XKV A;  3V7R A;  4RAY A;  5LGU A;  2X6O A;  3MKY B;  5E1Z B;  3DPT A;  1WJB A;  1UB9 A;  5K5O A;  2WAF A;  4XKW A;  1ZYR F;  1STZ A;  3T56 B;  1K8A D;  4I02 A;  2HOT A;  4KIT B;  3W6V A;  1YJN I;  2F5E A;  2W25 A;  5TRD A;  1IN6 A;  2MA3 A;  3CC7 B;  1XCV A;  1QQI A;  2FQ3 A;  1O8H A;  3C7J A;  3HHH A;  4D0P A;  4NC8 A;  3W2A A;  1H85 A;  4UNO A;  2J7K A;  3G1M A;  1TL8 A;  2ELK A;  4RD0 A;  4CH7 A;  3OYH A;  3W2G A;  3TBI A;  3IRR A;  3VFZ A;  2O6G E;  3BTL A;  5BS6 A;  5LFA A;  5ILV A;  2E2I J;  2V7U A;  1R36 A;  1CQT A;  3HOW J;  1ZHF A;  3R0A A;  2EZL A;  5JFR A;  2NVT J;  1VTN C;  4BQN A;  2GQQ A;  2K9M A;  3PSI A;  2ZNZ A;  1O8G A;  2A07 F;  2NOJ B;  2EK5 A;  3CDL A;  2DA7 A;  4AM3 A;  4OAZ A;  4ENN A;  4LG0 B;  3OYE A;  3OE7 A;  2OTL I;  4G8X A;  1OPC A;  2W4S A;  1ZGA A;  2FSW A;  1YE9 A;  1B72 A;  4KMU X;  3DTK A;  1FMV A;  3KP3 A;  5HNF A;  4BDY A;  2VBV A;  1QH0 A;  5J1R A;  1HKS A;  1YW7 A;  1WPK A;  3I5U A;  5FKK A;  2BF4 A;  3HRT A;  4M9Z A;  5D8K B;  4BY1 J;  2WZN A;  2NSP A;  5D8L B;  5F0H A;  1RQR A;  4E7L A;  5DSZ A;  3CMM A;  3QOE A;  2W7N A;  3ZCO A;  4D5C A;  1I6H J;  3E3V A;  2GJR A;  2INV A;  1DDN A;  3GWZ A;  4YEL A;  3BCD A;  4R71 A;  2GZW A;  1I1G A;  2LD5 A;  2W24 A;  2Y2Z A;  4AYB A;  1G3Y A;  4OIO F;  3IC7 A;  3CCM B;  5K7Z A;  4G7W A;  2GXB A;  1VLY A;  2BY3 A;  1K6O A;  1YIJ I;  4E7Z A;  4ASU A;  1BOB A;  4IHW A;  4OJ5 A;  3PQJ A;  4BXU A;  3RZO J;  1QU3 A;  1WJ5 A;  3KEW A;  4YG2 F;  5JHU A;  1WVR A;  2O61 A;  4RAG A;  4Z1M A;  2P5V A;  2WTE A;  3VYU B;  5JHF A;  2IA1 A;  3DTE A;  1VQM B;  1RR7 A;  1H88 C;  2XOK A;  2DER A;  2P81 A;  4KIF A;  2NT6 A;  1IXR C;  1EXM A;  2CQQ A;  4RD4 A;  3CMA B;  2NNN A;  3JTH A;  1VQ4 I;  3HXL A;  4M2L A;  4ACB A;  3QU6 A;  4PSW A;  4Q48 A;  1EH6 A;  5E79 C;  1PP8 F;  3M3Y J;  3DWL E;  4A3J J;  1QNT A;  4B3X A;  1WWX A;  2EIN H;  2XAQ A;  2YS9 A;  2OZ6 A;  1F4K A;  1VQ4 B;  4CO8 A;  2KFD A;  2KQR A;  3GVJ A;  1DAB A;  3L9F A;  3LL7 A;  3MZH A;  2HS5 A;  2OBS A;  3CME B;  2K5C A;  2QZ8 A;  1VQM I;  1NH3 A;  2BM7 A;  5FNZ A;  1XSV A;  2Y69 H;  1POG A;  3M8J A;  4AYB N;  3I9V 2;  4DQK A;  3I4M J;  1X0C A;  1IC8 A;  1T95 A;  4ENM A;  4A3F J;  5J3L A;  1K9M D;  1ETX A;  3VMF A; 
#chains in the Genus database with same CATH homology
 3TMO A;  2GJK A;  3ONQ A;  5FRM A;  3BC9 A;  2KLO A;  3IAS 2;  4HNU A;  4YRV A;  1U0J A;  3VR6 A;  4HNT A;  3L2Q A;  4XL9 A;  4B43 A;  2R7R A;  1JI8 A;  2ZZF A;  1V5G A;  3OIP A;  2ZTN A;  2IS2 A;  1P9Q C;  1QCX A;  1X1D A;  4E7K A;  2BSP A;  3EPZ A;  3HUG B;  1KCC A;  4U49 A;  3OS0 A;  2XF7 A;  1BR4 A;  2IGK A;  4B3F X;  2VJI A;  3V42 A;  2V1N A;  3OYD A;  3S3N A;  4BEH A;  3BH4 A;  2L9S A;  4XLE A;  1VF7 A;  2WJV A;  1E43 A;  4BL0 B;  4L8J A;  2LYC A;  4PSX A;  3LSI A;  1Z7L A;  5CQE A;  2VIX A;  2MFZ A;  2VKH A;  3HKZ A;  1BLI A;  3HPG A;  4J01 A;  1BPL A;  1IA5 A;  2Z6B D;  2KL4 A;  2DXI A;  1PJR A;  3L2V A;  4DOZ A;  4XNF A;  3OL4 A;  3EUK L;  3K70 D;  2LH9 A;  2D3L A;  4BS9 A;  3OYL A;  3HC7 A;  4G6I A;  3OL3 A;  3E1S A;  1D1B A;  3K4N A;  3W2V A;  1VBL A;  1X1C A;  2X51 A;  2OV7 A;  3BCB A;  1OOC A;  1X4O A;  3A1Y A;  1Y56 A;  3DEE A;  4IX7 A;  1NG7 A;  1WMR A;  2JA2 A;  4E4H A;  1QHG A;  1W36 D;  4FAS D;  2VQC A;  1KCD A;  2A6T A;  3JU4 A;  4CCJ A;  2O0W A;  5CPR B;  2WB1 A;  1FX0 A;  2R7T A;  3OOU A;  4CCN A;  4PK4 A;  2LC2 A;  3SZG A;  1NG6 A;  4F91 B;  3FKJ A;  3QOD A;  2W1O A;  4W8S A;  4P1W A;  3VST A;  2CV1 A;  3W2W A;  5HNH A;  3ZPP A;  2BOL A;  1WTH D;  3CZ6 A;  4C2T A;  1UAA A;  3AFH A;  4XQF A;  2RQQ A;  3DLA A;  2M4G A;  4G6T B;  3SDB A;  4II3 A;  4E7S A;  4E7I A;  1I8D A;  2F5V A;  3FBI B;  1YX3 A;  3OYI A;  3H9Q A;  1E3X A;  1HZE A;  2GK6 A;  1SAU A;  1VZ0 A;  3ZRG A;  3L2U A;  2KVO A;  3A35 A;  2IQ7 A;  4DIQ A;  2DT7 B;  2L9N A;  2HVS A;  2R7V A;  2X53 S;  3K4M A;  1Y6I A;  4GQN A;  4HIZ A;  2ELJ A;  4DNR B;  2VBK A;  4E7H A;  3VSU A;  4PFO A;  1O8L A;  3G2B A;  3OOC A;  3BC8 A;  4XR6 A;  3D5R C;  2R7Q A;  1HVX A;  3G05 A;  3QYF A;  2L5Q A;  3ZXS A;  5LD2 C;  1ZEL A;  4U4B A;  1WJF A;  2MC4 A;  2UVE A;  1X1B A;  3PFY A;  3S3M A;  1E3Z A;  2ZXI A;  2VJ5 A;  2JJ1 A;  3DDY A;  3OYK A;  3PSF A;  1W9X A;  2XF6 A;  4ZYA A;  3K70 C;  2IS6 A;  1GQ8 A;  2X1C A;  2CUZ A;  3D5S C;  1JTA A;  2A5W A;  3K4C A;  3GVL A;  1MMD A;  3C2G A;  3GQ7 A;  1BMF A;  4OAY A;  3CJR B;  2Q2E B;  2CW8 A;  2ZZQ A;  3S3O A;  3PNT A;  3OEE A;  1O8M A;  4Z05 A;  2FUG 2;  2VQH A;  1CZF A;  2GOX B;  2LZJ A;  4DK1 A;  1V0F A;  4PMH A;  2Z16 A;  2WY8 Q;  5DN6 A;  4KKT A;  1FMW A;  3VYR B;  3SUC A;  1IRX A;  2WAQ A;  4P22 A;  4NC7 A;  3FBN B;  2WBM A;  3OWT A;  1LFP A;  4TSF A;  4E7J A;  3GQ8 A;  4XLC A;  4UZU A;  4C2L A;  3K6G A;  4CCM A;  4HEA 2;  3RQ4 A;  4C9Y A;  3QYE A;  2X3H A;  2W6I A;  4U7B A;  2KPM A;  1K6Y A;  2PJR A;  1KTW A;  4KKS A;  1LDK B;  4XM3 A;  4XLF A;  2GK7 A;  4XLA A;  1PYV A;  2V7Q A;  1UEL B;  2W00 A;  3SEQ A;  3OYA A;  1R6R A;  4LIU A;  2DT6 A;  3CP2 A;  1WJA A;  2CV2 A;  4IQJ A;  2ZSH B;  1UD6 A;  3EQO A;  4KIS A;  3FPP A;  2R7U A;  3DQV C;  3K4B A;  4N4O B;  2L2O A;  1N75 A;  2QKL B;  3S32 A;  2JSP A;  2D3N A;  5FRO A;  4BJ6 C;  2OC6 A;  2WZP P;  4PJN A;  3VWB A;  2JUG A;  3OMY A;  3PNY A;  4XOR A;  2VXZ A;  4Y33 A;  4NQW B;  5FRN A;  3D5L A;  1AA7 A;  4XKB A;  1E1Q A;  1OB0 A;  2AQE A;  5CKT A;  2MD0 A;  3RCO A;  2XC7 A;  1UD5 A;  2NTP A;  1D0Z A;  4URR A;  3VMW A;  2NST A;  3C2H A;  4X0G A;  1X4P A;  2VB6 A;  3T51 B;  2E1M B;  1OGO X;  1YX5 A;  4XLH A;  2CK3 A;  3VDX A;  3ZQQ A;  4D1Q A;  4EW9 A;  4CA0 A;  1V0E A;  4JQF A;  2X6X A;  2QX3 A;  3KEY A;  1N77 A;  3UW0 A;  2PMZ A;  2JVG A;  2QKM B;  2VL8 A;  3VSV A;  1DBO A;  2HQA A;  4ZTF A;  5AMV A;  2IXS A;  1WJC A;  3ZGK A;  1COW A;  4DK0 A;  4PJL A;  2Y0S A;  2VQL A;  2KRH A;  3J7A Y;  5KCM A;  4LIV A;  2I8D A;  4PJM A;  3PJR A;  3AKZ A;  5HLT A;  3HOT A;  3K10 A;  1S9H A;  2O17 A;  4XN0 A;  3H5N A;  3K4L A;  3W3C A;  4BJT A;  4BXF A;  1WPC A;  4Y3O A;  3UR3 C;  4OWR B;  4BQO A;  1MMG A;  4XMY A;  2VQG A;  1NRK A;  2ZZG A;  2IGO A;  3DPL C;  3OAA A;  4DNT B;  3DKY A;  4YEJ A;  1W0J A;  1X1A A;  4ITV A;  2ZTG A;  1O8I A;  3IP4 B;  2DJI A;  3GRH A;  4PUS A;  3EUH C;  1UD2 A;  2GJP A;  4NK8 A;  3GQ9 A;  2X1D A;  3RTR A;  2E1B A;  4HWV A;  3WWG A;  2WPD A;  1I18 A;  2HVQ A;  1OLT A;  3LSK A;  2JIZ A;  2O5R A;  3S8P A;  1MMN A;  4W8R A;  1OGM X;  2ZZE A;  4XON A;  2LG4 A;  3KRG A;  4C2U A;  1MAB A;  3OR2 C;  1O8F A;  3H9J A;  4YXW A;  1J09 A;  4RMN A;  4W8T A;  3OS2 A;  3H5R A;  3L2R A;  2JDI A;  4F52 A;  2VBM A;  3RSN A;  2PYG A;  2W82 A;  4DBQ A;  3K4K A;  3OYM A;  4HRI A;  1OFM A;  3NWT A;  1QJV A;  1HG8 A;  4BGD A;  4MXN A;  2BVL A;  3VSK A;  1D0Y A;  2XGJ A;  2V6E A;  2V4J C;  3VYT B;  4XKC A;  5HOO A;  1MNE A;  3PUB A;  2WAE A;  1PLU A;  2M4K A;  2QE7 A;  4Z03 A;  2ZXH A;  3HOS A;  3BLY A;  4CCO A;  1WJE A;  2Q1Z B;  4KJZ A;  4Y4R A;  2F43 A;  3GVK A;  3IUO A;  4OJ6 A;  1K5C A;  1DQU A;  3LNN A;  4HPQ A;  2CW7 A;  2X8K A;  4RLF A;  2KMU A;  2UVF A;  1DGW Y;  2XZO A;  3S93 A;  2NTQ A;  2KDO A;  4XOT A;  2RNG A;  4PFP A;  2M0M A;  4RLQ A;  4NUB A;  3TL4 X;  2M7A A;  2F4I A;  4BE1 A;  1UD3 A;  3VYS B;  4MR0 A;  2M3A A;  4QPQ A;  2X85 A;  2EWE A;  2R7W A;  2V26 A;  2HVR A;  1SKY B;  2O04 A;  3GQB A;  2XZL A;  3OFN A;  1DP3 A;  3NWS A;  1HA8 A;  2BVM A;  2F6C A;  1WFX A;  1AIR A;  2CUJ A;  2KHM A;  4ZDO A;  3SYT A;  3I3L A;  2AQF A;  4AVZ A;  1GLN A;  2BW3 A;  2M7B A;  4NNJ A;  4HST A;  1RMG A;  4F92 B;  3CJQ B;  1N78 A;  3OR1 C;  3OYB A;  4E0F A;  4XD7 A;  2VLA A;  4OZZ A;  3A4C A;  4JOM A;  4XN3 A;  2CH0 A;  4N4N B;  1KMH A;  2NT9 A;  3GBG A;  4II2 A;  4KT6 A;  4CZC A;  1JRG A;  2OUM A;  2WAD A;  2MAB A;  2Z1D A;  2WJY A;  5CQG A;  2R7O A;  3L2W A;  1O8E A;  2E60 A;  4F3Q A;  3OYJ A;  2V7F A;  4LIT A;  3KYL A;  3A2K A;  2VBE A;  4YZQ A;  3OPO A;  3ZSC A;  3OIQ A;  5TGT A;  4RM2 A;  4E6K G;  4OJO A;  3N05 A;  2XAU A;  4ZTJ A;  3BG7 A;  2P0W A;  3H94 A;  4B47 A;  1WJD A;  4KKU A;  4DGW B;  1BR2 A;  2E5N A;  1D0X A;  4H4K C;  2V4D A;  2WSS A;  2XZP A;  3HAG A;  1OHH A;  3FKS A;  4QPO A;  3OYF A;  1RWR A;  4PJJ A;  4TKO B;  3CES A;  1NBM A;  4P5O A;  1IB4 A;  2HNH A;  4I84 A;  1KZL A;  2QXZ A;  1PKV A;  3OEH A;  1T0F C;  1G59 A;  1O88 A;  3LSM A;  4IQ4 A;  2X6Y A;  2CMP A;  1DBG A;  3ZIA A;  3DU6 A;  1W36 C;  2V31 A;  1OR7 C;  2DIE A;  1XG2 A;  1QHH D;  1Z3Y A;  4U87 A;  2UUZ A;  2HPM A;  4IZZ A;  3BG6 A;  1MW7 A;  3LFU A;  2NTB A;  2ZFU A;  4CCK A;  5C1C A;  2QY1 A;  2IS1 A;  2LY1 A;  4LG3 A;  1D1C A;  1EA3 A;  1SFK A;  3E0J B;  4C30 A;  4ANJ A;  4BE2 A;  3VMV A;  3M1C A;  3MKZ A;  5HVQ C;  4ZDP A;  3QYB A;  2R7X A;  2M5S A;  5C1E A;  1TT0 A;  1UD8 A;  1G8X A;  1V5F A;  3A3G A;  1Z3X A;  1LVK A;  3F9K A;  1H8H A;  5CDF A;  2ZSI B;  2INU A;  3AL0 C;  2HDW A;  2K9L A;  1EFR A;  4ZJZ A;  1BN8 A;  2XSJ C;  5IK2 A;  4OZY A;  4W8Q A;  4YZA A;  3JUR A;  1V5E A;  3B4N A;  2PJR B;  2R7S A;  4HSR A;  3ZR8 X;  2X1E A;  3DU5 A;  2UWM A;  5FL7 A;  4BJ5 C;  1X19 A;  4CUG A;  2Z2S B;  4EAT A;  2VAS A;  3RPU D;  1UD4 A;  3SEZ A;  4BAC A;  1E79 A;  2X6W A;  3OYC A;  4OJL A;  3H5A A;  4HG2 A;  4XKV A;  4RM3 A;  4D9J A;  1Z21 A;  3MKY B;  4OJP A;  3DPT A;  4XOP A;  1WJB A;  2DOA A;  4NK6 A;  4YZX A;  2E5Z A;  2WAF A;  3EUA A;  4XKW A;  3T56 B;  4FET A;  4YZ0 A;  1W0K A;  2R4G A;  2F1M A;  4TT3 A;  4KIT B;  3MKW B;  4ZDL A;  3K4J A;  4ZC3 A;  4Z06 A;  2NZM A;  1RU4 A;  2XF5 A;  5KNL A;  3CF2 A;  3HG9 A;  1O8H A;  2Z8G A;  4NC8 A;  3W2A A;  2O1D A;  3T53 B;  4AU7 A;  3OYN A;  2HZD A;  3ZPN A;  3HPH A;  2LRD A;  4BE0 A;  4CH7 A;  3OYH A;  2KZV A;  1O8K A;  2E1M C;  3TBI A;  2DCE A;  2VPL A;  1WP6 A;  3T9G A;  1LKX A;  2IGN A;  2WY7 Q;  5LFA A;  4F55 A;  2XND A;  4DJA A;  3HL2 A;  1PE9 A;  1O8D A;  4JMQ A;  3B90 A;  3FY3 A;  2VJJ A;  4FXU A;  2HPI A;  4BQN A;  2KP6 A;  3MMY B;  2UV1 A;  2LBF B;  1NHC A;  2K9M A;  4B3G A;  2WA0 A;  3PSI A;  5KHD A;  2IS4 A;  1O8G A;  2NOJ B;  3DPU A;  2W6J A;  4BUP A;  4BQQ A;  1IDJ A;  4DBR A;  4OAZ A;  3MD2 A;  1ERD A;  3OYE A;  3OE7 A;  2LBF A;  3LMM A;  4MLO A;  2W4S A;  1BR1 A;  1YE9 A;  2CFO A;  3DTI A;  3DTK A;  1FMV A;  4J00 A;  2RRE A;  5HNF A;  3LSG A;  4BDY A;  3A3B A;  1OFL A;  2ODL A;  4G7X A;  1MND A;  3PNV A;  2HU9 A;  1VJS A;  3WQZ A;  4BU2 A;  1T5E A;  2NSP A;  3PL8 A;  4E7L A;  2MYS A;  3CMM A;  3QOE A;  2W7N A;  3ZCO A;  2PEC A;  2HLD A;  2LY2 A;  1D1A A;  2GJR A;  3AL0 B;  2INV A;  4R79 A;  1O8J A;  1DGR M;  1KON A;  4YEL A;  2VKD A;  2IGM A;  2JJ2 A;  3BCD A;  3IAM 2;  4AYB A;  2XDV A;  1E1R A;  4F93 B;  3LMW A;  4G7W A;  1BHE A;  1VLY A;  1UG0 A;  4ASU A;  4E7Z A;  3LSH A;  1BOB A;  4CSW A;  2BW3 B;  2K3P A;  3OY9 A;  1QU3 A;  3KEW A;  1IDK A;  1WJ5 A;  4OJ5 A;  3BCA A;  3U21 A;  3OS1 A;  2VJ4 A;  3NE5 B;  4Z1M A;  1MMA A;  3OW7 A;  3KX2 A;  3VYU B;  2O0V A;  2LOO A;  3B8Y A;  5JHF A;  5HKK A;  1H80 A;  3DTE A;  4IKF A;  3GQA A;  2V9K A;  4B44 A;  2XOK A;  4CCL A;  2L7K A;  2NT6 A;  1E0E A;  2KRC A;  4BEH B;  3EQN A;  1H8E A;  4BDZ A;  3HXL A;  3DKX A;  4PSW A;  3FHN A;  2GOM A;  3DWL E;  3BCF A;  3VSL A;  4B3X A;  3H0D A;  2R9V A;  2KQR A;  3GVJ A;  1PXZ A;  3LL7 A;  1EE6 A;  2LRE A;  1TZL A;  2K5C A;  3FDY A;  4GRI A;  3H9G A;  2JVH A;  2CS3 A;  3H35 A;  3M8J A;  2PYH A;  3OYG A;  1K28 D;  4B48 A;  3I9V 2;  1X0C A;  3CP8 A;  2CV0 A;  1T95 A;  2VXD A;  3UNG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...