2VJIA

Tailspike protein of e.coli bacteriophage hk620
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Bacteriophage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN
total genus 229
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjiA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjiA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjiA02
1QJVA 4XLHA 2O0WA 4XMYA 2IQ7A 4XOPA 2NSTA 4C2LA 4XLEA 1KCDA 2ODLA 2QX3A 2NT6A 1JTAA 4XKWA 1O88A 4W8TA 1O8JA 1O8KA 1OFMA 2X6WA 4YEJA 3LMWA 3UW0A 4XM3A 2NZMA 4XONA 2VJIA 1O8LA 3EQNA 4EW9A 1QCXA 1DBOA 2UVEA 2NTQA 5C1EA 4HWVA 3VSTA 1O8EA 1PXZA 4YZXA 4XQFA 1AIRA 3ZPPA 2Z8GA 3KRGA 4URRA 2O0VA 4NK8A 3VMVA 4OJOA 2NSPA 1JRGA 1H80A 2BSPA 4OJ6A 1RU4A 1IB4A 2VBKA 1PLUA 2O17A 4PMHA 1OGMX 1CZFA 4XOTA 4W8RA 1KTWA 4XLAA 2NT9A 3ZSCA 3VSVA 1O8FA 3FY3A 4Z06A 2X6YA 4XLFA 1EE6A 2INVA 4U49A 1O8IA 1O8HA 1WMRA 1HG8A 2INUA 4XR6A 4XNFA 4XL9A 4XN0A 4XN3A 2X3HA 2EWEA 5AMVA 1X0CA 1OFLA 4AVZA 2NTBA 1RWRA 2PYHA 1OGOX 4XORA 1GQ8A 3VSUA 4YZ0A 1VBLA 3B90A 1IDJA 2NTPA 3JURA 3T9GA 1KCCA 1IA5A 4OJ5A 4Z03A 1PE9A 4Z05A 1RMGA 3GQ8A 3GQ9A 4YZAA 3GQ7A 1OOCA 1DBGA 2O04A 4MR0A 2X85A 2VBEA 4I84A 4U4BA 5C1CA 3SUCA 3B8YA 3VMWA 1BHEA 2QY1A 2VJJA 3GRHA 1K5CA 4W8SA 1XG2A 1IDKA 2O1DA 2VBMA 1O8MA 2PYGA 4MXNA 4XKVA 4OZZA 2PECA 4OJPA 3B4NA 4YZQA 2UVFA 3EQOA 4YELA 2X6XA 4OZYA 4W8QA 1BN8A 3GQAA 1O8GA 1NHCA 2QXZA 4XLCA 4OJLA 3WWGA 1O8DA 4NK6A
chains in the Genus database with same CATH superfamily
4XLHA 1U5TB 5D5VB 3H94A 3CCVI 5K1YA 1SKQA 5AONA 1KJZA 2IQ7A 2ZC2A 2AHOA 1O4XA 3PSZA 3CMEB 3CCEB 3SZEA 3BTLA 1ZRFA 2LH9A 4DK1A 2ME0A 3OPOA 1Z67A 1APLC 5DUKA 2M5WA 4HNTA 3L1PA 2V4DA 3LFKA 2F6CA 5K5QA 3AG2H 5TGTA 1QG0A 3R60A 1T38A 5D5XB 4YEJA 1O8KA 4KMFA 2BMWA 4ZDLA 2K9LA 2IPQX 2HFHA 3RDIA 1XS9A 5FLVA 1MMDA 5BMZA 2DMQA 3NEUA 3SEQA 1WJBA 1BL0A 3DF8A 3O8GA 3CCLB 2HYGD 4YG2F 2OK7A 5F08A 1F4KA 5F0CA 1VQ9I 3BY2A 2D1VA 2ZNYA 3A01A 1Y8QB 1QO0D 3AKZA 3BLYA 3R6KA 3PNVA 1ELOA 1WDTA 3ASSA 4EM0B 4M2LA 2H8RA 1PJ5A 2I8DA 4IF4A 4I0AA 1JTXA 2MC4A 1RKTA 1XX5A 2ELHA 4S05A 5BPIA 3BCBA 2HDWA 4L18B 2D74A 4P25A 4HPQA 3P27A 4BKXA 3QYFA 2JN6A 1EP2B 2BM0A 3WBJA 4PSXA 5A2QK 2MD5A 1O8FA 4P9SA 4L5JA 4DNRB 5BSYA 5CLSA 2EIJH 1W9XA 2FF4A 2EB7A 3VYRB 1DU6A 1E79A 5FKKA 3CCJI 1EFCA 3ISXA 5F4MA 4HE6A 3AL0C 4H4KC 3RJPA 4WWCA 1XB4A 2HPIA 2JT1A 3AK5A 4KYWA 4L0ZB 2JIZA 1CF7A 2VC0A 3OZUA 2IVMA 4Q47A 4EJVA 1QZEA 1BIBA 3KX2A 1PUFB 3OYFA 3ASOH 3GSIA 1X2MA 3WTTC 3ERED 3P9CA 3HTUA 1EJ9A 2Y30A 5GV8A 2WA0A 4L5EA 2L3DA 3M1CA 4UB6C 2CQ7A 1CGPA 3A02A 3GLXA 3IP4B 3A3BA 3PNTA 3M4OJ 3H0DA 5TRDA 2DI3A 2X1EA 1R1VA 3EQLF 1WJDA 1GV5A 2ZL6A 4XKCA 4ABZA 5HNHA 5IYWA 3PUMA 1FZPB 2IGMA 4F93B 2DA5A 1W4MA 1F36A 1FIAA 1G3WA 4MQVA 1ACIA 3IAM2 1TYXA 5C4JJ 1Z77A 4MYTA 5HZAA 1MDMB 4X1EA 3WTSC 1HW5A 2RQPA 2K40A 3AGPA 3JX8A 2X0LA 1A35A 3HJEA 5JMCB 1I1SA 1YJNB 1NTCA 5E3LA 4IVNA 5DEQA 2FBIA 3GWZA 1OCRH 3IWFA 2O3FA 4R79A 3JRDA 2VBWA 1VHOA 2LG4A 1WWXA 3F9KA 2PEXA 1NHCA 2FE3A 4IOCF 4G7ZF 1OFCX 2P0WA 3HOXJ 4IPAA 2JUGA 4ZH4F 3ZPNA 2PMZN 4MFDA 3CP2A 4FASD 3F23A 3R4KA 1U3EM 2VI6A 2O0WA 2Q6KA 1UFMA 4EATA 2L0KA 1BR2A 1XMXA 4FETA 5DCFA 1LEAA 2JA8J 2Q0OA 1ZLKA 2DJIA 2Z3YA 2VQCA 4H0EA 2ELKA 2PBIA 2CH0A 1IAWA 1ONVA 4K2EA 4LLGF 4A3FJ 5EEGA 4Z4ZA 1VQMB 1R22A 2R3SA 5KHDA 4BJTA 2IA0A 4RPBA 1YLFA 4FE4A 3F0CA 5F0HA 4A3GJ 1LUJB 4HG2A 4UHTA 3GUDA 2BN4A 1R58A 2XT4A 4BE1A 2UV1A 5J8FA 2KP6A 2ZFUA 5FGMA 3CCSB 5A2QZ 1JUSA 1WI3A 4C9YA 5L3FA 2IJLA 2LMDA 3PJRA 4YAOA 4HWVA 2DDAA 4LK0F 3T56B 2YWHA 4L5IA 2P5VA 2DA7A 4NDLA 5FLXK 3DTIA 2NSPA 2BV6A 1FC3A 5HVQC 3OYAA 3N97A 3TQNA 3AVUA 4NC6A 4ON0A 5J35A 3S1RJ 1B9MA 1YG2A 2LF7A 5EG0B 4HLYA 1FBQA 2DEUA 3TBIA 1QPIA 2DU9A 3WU2C 2V1DA 3HOWJ 3S2DJ 5E6TA 4UUTA 2K9MA 1KONA 5FKOA 2VE9A 5E17F 3W2GA 4PC2A 4TMXA 1Y1VJ 4OINF 1V54H 1RESA 2DOEA 3VNVA 3ZMZA 1DABA 2X3HA 1GO2A 2VPRA 3QWLA 1LFBA 4LG0A 3OWTA 1RIOH 1YW9A 2G7HA 1YX3A 3A01B 3AAFA 2D3LA 2R4GA 4V19K 4Y7CA 4YZ0A 3BT9A 3CC4B 2C5HA 1VBLA 2DK8A 3ZQIA 4C2MJ 9ANTA 1O3TA 2VODA 4NUBA 4Y4RA 3S3NA 3SEZA 2LOOA 4YFKF 2V1UA 4ACAA 3DKXA 2M5SA 3CO7C 5F1JA 1GR1A 2CJJA 1PJRA 3BG5A 2ZB9A 4FT8A 3CCUI 4BY7J 1WSVA 3GTGJ 4RD6A 4HOBA 2CQQA 1TZLA 2ELJA 2JJ7A 1SFUA 2RGVA 4L9TA 1FNMA 2JJ1A 1BR1A 1LQ1A 4DBQA 2XC7A 4L8JA 2LLKA 1XSDA 3SJZA 2ZBKA 1EH8A 3GVAA 3ZRGA 2V7FA 2HYFA 3BR3A 3VMWA 3HOSA 3PQKA 2RVCA 2OPTA 1U5TA 2WZNA 1XG2A 3RKYA 3J81Z 1K78A 1E1RA 2VQLA 2HYJA 3GX4X 4XKVA 4UVBA 3L2VA 1PUFA 2V7TA 2V4JC 5IY5H 5HODA 3BTIA 4E7HA 1H9TA 4KICA 5LRSA 1T6YA 4RAZA 2GA1A 1RUOA 1H85A 2ZITA 4OOXA 1JUPA 1BN8A 4GXOA 2R5YB 1T98A 2CRGA 1DPUA 4OMYA 2VBXA 4HNVA 4KA4A 1IO2A 2R93J 1XC5A 3HKZN 1R5NA 2PMZA 3K4CA 2BX6A 1SFOJ 3K1NA 5CVVA 2VT3A 1XDUA 2L2OA 3PA1A 3C3WA 4XLEA 3WODF 4RB3C 1XPXA 4AF7A 2JTVA 3E6BA 3ABLH 2KHMA 3H92A 5IP6A 1GT0C 5IT9K 3TOBA 4NC8A 2RDPA 2PLYA 3QYEA 2E60A 4LB5A 4QLCU 2O0YA 4HQMA 1P4XA 4M6VA 2DIEA 2VBUA 2E7WA 1YIJI 3A1PA 3F8FA 3K4NA 3CMAB 1O8JA 1IN7A 3UW0A 3ZC3A 3CJRB 2RKHA 2NZMA 3ZCOA 3T51B 5L3CA 1TTYA 4OIQF 2VJIA 3HRMA 3FMRA 3HSFA 2P3MA 3NRVA 4DYQA 1Y0NA 1STZA 2LREA 1Y0RA 2F2EA 1AKHB 5F0FA 1IB0A 4B1RA 1RI7A 1MBJA 1TP4A 2DAOA 3CCJB 1MBFA 2XPUA 3I3LA 1KTVA 2M87A 4TSFA 1OFEA 1RU4A 4JYKA 1QRYA 4RGXA 2JVGA 2JUCA 4M3EA 3RI4A 3VMFA 3SEJA 3HEFA 3RQ4A 4PMHA 2EIMH 3ZZTA 4GYIA 3BJAA 1AHDP 4N4NB 4RD1A 3DKYA 1Q81D 3Q3SA 1U8BA 3BROA 1FX0A 3GLLA 1Q9SA 3FY3A 4Z06A 4CSWA 2MBFA 3CCSI 5IOZA 2Q2EB 2K9NA 2Q2EA 1W7PB 3LMMA 1O8HA 3LYCA 1PUEE 1TUIA 4OMZA 1OKRA 1Z6TA 2LFBA 1ZELA 2ETHA 4TN1A 3VR6A 4HQEA 1RR7A 1OGOX 3K4LA 4N3GA 1XGMA 3CMMA 5DCMB 4XBFA 2DQRA 1FBUA 2Z6BD 4IHYA 5H59A 4CYDA 2HU9A 1S8NA 4YIRX 4Y7NJ 1VLOA 3Q38A 2OZUA 3BQYA 3SFIA 3F72A 4JBAA 4JX5A 2EIXA 4TMTA 4Z4RA 3JTGA 1SM4A 2KZVA 3K2AA 1U9NA 1SMYF 1MIJA 3HDDA 1MBEA 2YX7A 3T5XA 4IQJA 2DY1A 2OCCH 4UNOA 2KIUA 3HB9A 3MAJA 5K7ZA 3IKVA 1ZGWA 3BH7B 1W5TA 1E3HA 1UZCA 4KNYA 1S29A 3KIOA 5FKMA 4Y52J 3RZOJ 5FKLA 2M9HA 3ABTA 2OBSA 3MFKA 2OQGA 1QVTA 3GRHA 1WVRA 1QFJA 2PLFA 2VBYA 2OC6A 4MEYF 5EZHA 4OJPA 1J2XA 1ORKA 2E36A 1I8DA 1MZBA 1HXDA 3W3CA 4FTHA 1ZRCA 3QYBA 3GMEA 1TW2A 1KK3A 2B7CA 2LC2A 3EQOA 3RPUA 4AD9A 2CK3A 1T56A 3F22A 4HF2A 2GOMA 3AG4H 4OZYA 2Y31A 2BM5A 1ZH5A 2AS5F 3ECHA 3LSMA 3PFIA 1HSTA 1O8DA 4EM2A 2CQKA 4HBLA 4RD4A 4YHBA 2W6IA 3V4GA 1L3LA 2BYVE 1FOKA 4PDKA 5ILUA 1GXPA 3ES9A 4PJNA 2CF4A 1MJAA 4HX8A 2L7KA 1MMAA 5J1RA 2QEXI 1D0ZA 3J7ZI 1FDRA 2JMWA 2IW5A 3W6JB 3ZMVA 5GADJ 4PK4A 1N06A 1K73D 2HWVA 5HZBA 1W7PD 1B1BA 3QQAA 3OYKA 1WXRA 4B47A 2IP2A 1IN4A 3NAUA 4IHSA 3PL8A 1FSEA 1I7PA 1PJ7A 3LMWA 3I59A 4F91B 4MEXF 2VBTA 2K5CA 1TWCJ 1ON1A 1DQUA 4LBWA 5A8AA 3EQNA 1XDSA 2BM7A 2VJ5A 1S72I 1CLWA 1GJRA 1VHEA 4OOSA 3GFLA 1Z7UA 1UHSA 3T8RA 4XQFA 5BQTA 3FHNA 1T8IA 4PJLA 5E3MA 2CNDA 4NK8A 2BV3A 1QQ1A 1Y56A 2X4HA 4G94A 1X1AA 4X0GA 3GZ6A 2XGJA 1IZ1A 2DTRA 4PJMA 2O17A 2XF5A 1R6RA 2PIAA 2XNCA 3KCCA 3S93A 2BZTA 4HDUA 3CDHA 4Y13A 2ZTGA 1S5LC 4XIDA 3IRQA 3OSGA 4OIOF 3E1YE 3MN2A 4PUSA 3CO6C 4B3XA 4KMUX 2QVOA 1ZUNB 4KKUA 2IS4A 3CPWB 4FISA 3ZGKA 3NQOA 2VZLA 4P22A 3U6KA 3BH4A 5J1UA 2HDDA 2B9SA 2P6SA 3I4NJ 1YX5A 3BTCA 2ZSHB 3IAS2 4DJAA 2R7ZJ 1TQIA 2UUZA 3EETA 1IRFA 2BW3A 3ONYA 4RLZA 3OOCA 2H6CA 4KKTA 1EP3B 5HOOA 3PUFA 1JGSA 3BQJA 4OOIA 3BG7A 1LEBA 1JJ2B 2LKXA 3S32A 1OCPA 4UUSB 4CA0A 2VBSA 2DBBA 3QOEA 1G3YA 3PSSA 1TQMA 4ZJZA 1SKYB 1ZM3A 1PE9A 1QA3A 1OISA 2XKPA 1USSA 4IQ4A 1G4DA 4Y9RA 5EEAA 4EJOA 3WNDA 2HS5A 3OY9A 4N9HA 3SHFA 3OZWA 3HAGA 2CUFA 5D8LB 2VYQA 2XGDA 4FQGA 3B8YA 3K4BA 1QRBA 1K6YA 2HNHA 3FBNB 2DFHA 2GIVA 1BHEA 1BW5A 2DT5A 2K7LA 2EK5A 4BH9A 1LE8A 1SD6A 3W6VA 1KRHA 1NHAA 4D7NA 1QA6A 4LBVA 4DOZA 4P6VF 2PMDA 5B6IA 1WHUA 2LBFA 4I99C 4A12A 3R6JA 3K4KA 1A5JA 1XGNA 4F3QA 1GHCA 1UD5A 4DNCA 4YZQA 5IK2A 1I27A 3P9IA 1LKXA 1X2NA 2FSWA 1VQ5B 4AVPA 2KVOA 1KQ5A 5FO5A 2YPRA 5KW9A 2G0EA 3WG7H 2KKOA 4TMWA 4ENKA 4CCNA 2QM3A 2JVHA 1OR7C 4BU2A 4NK6A 3M8FA 1B8IA 4LJZF 1EA3A 5DM7F 3GTPJ 4IHXA 1YS6A 2C77A 4KIBA 4P26A 1UG2A 2HOSA 2V7QA 1X4PA 2YU3A 4PGHA 3I71A 3LAPA 3HSRA 2XIGA 2R7VA 3I58A 5BSXA 1JTAA 3DKWA 1FNCA 4F7DA 4GYGA 1JKPC 4LLNA 3MZYA 1FY7A 3J80K 3MKWB 1IXCA 3WGIA 2KMUA 1BOAA 3E5QA 1A6QA 3LSKA 1FEXA 2CUJA 3WBKA 4DK0A 1YRNB 4ZGNB 2ZZQA 1J9ZA 2NNNA 3S2HJ 1WTHD 5KNLA 2UVEA 1OCZH 2BF4A 1G3SA 2XAHA 3SLDA 1KD1D 2VXDA 3T53B 5FNZA 3ZPPA 3ZMDA 1V55H 4OOVA 2QEXB 1ZREA 3VMVA 2DYIA 4BE0A 2COMA 4LIVA 2WY8Q 1W5CC 2ID6A 2VBKA 4UV9A 4JX6A 2LRDA 4FK8A 1SAXA 4M0LA 4BEHB 3HSEA 1ETWA 4UUSA 4FX4A 1I6HJ 1WI9A 3GXOA 3BJ6A 1E3ZA 1SVMA 4M53A 5L3DA 4A2UA 3Q39A 2LSOA 4ENMA 4IRIA 1PDNC 1LLWA 2CW8A 5BNGA 2WJYA 3DBLB 3KE2A 2JN9A 2F48A 4CCLA 4P12A 4PJ0C 1L0OC 5JLXA 3NARA 5AIQA 2DERA 2OZ6A 4XN0A 1P4MA 1EKEA 4IEJA 2KJCA 5IYCJ 1UB9A 4A3JJ 2DCEA 2GXGA 4ZZDA 1HF2A 2H6BA 1H88C 3VWBA 1K28D 1D8KA 3OMYA 3RSNA 4YFOA 2M8EA 4OAZA 4FN5A 1Q86D 1F5TA 3BPXA 3FZVA 1IDJA 2VFOA 3CUOA 1U78A 3B73A 3MZHA 3JTHA 3LQEA 5HS8A 5BOXA 1VQ6I 4P55A 4OJ5A 2LYCA 3L9FA 4XLPF 2RNJA 1P2FA 3QOPA 3EUHA 1P4WA 1X1PA 2X48A 2V9PA 5J40A 3G71I 2E2IJ 4GO1A 2H1KA 2VONA 1IRZA 1ZKGA 2C78A 3RPQA 4BGDA 2FOWA 1E3PA 2CV1A 1D0XA 1MMNA 3ASRA 4MIMA 3HBLA 4NQWB 1JKQC 4I84A 2YWEA 3TP0A 1P6RA 3CLOA 3KLOA 1T33A 1YX2A 4BBSJ 4G6QA 2ZMEC 3L00A 1WRJA 5FO0A 4AIKA 3EPZA 4A5MA 2CW0F 1BR4A 5ICFA 3SJPA 2NVQJ 4ENJA 3IH3A 4S04A 3PO3J 4BNCA 1LVKA 1BBYA 3I59B 2UVFA 4WZTA 2LTPA 2Y0MA 4NC7A 3BOQA 3AVYA 3CDLA 4QHYA 4EV0A 1NB9A 4A93J 2BGCA 1PKVA 4HNUA 2BOLA 4KKSA 3OZVA 3H5RA 3DDYA 1VQ8I 2X53S 2XVCA 1YJWB 3CC2I 4ZCLA 3BC8A 5GTIC 1V0EA 2Z33A 4UV8A 1BPLA 2K85A 2A5WA 1B72B 3BR5A 1KQ9A 3FXQA 2V7WA 3E1SA 1HKQA 4RGUA 4RD2A 2R7RA 2F4OB 4PZJA 4BXFA 1SEUA 5L3GA 5M5XJ 4A3CJ 1FIPA 4P2NA 1DGWY 4HEA2 4R1HA 4EVIA 3RZDJ 4RMNA 1YO5C 2CGPA 3GQBA 2QX3A 3WTWC 2RQQA 3C7JA 3P9KA 2LK2A 4KUMA 2WBMA 4N9IA 4MO7A 1IN5A 5DD8A 4A3KJ 3RKWA 3NB2A 2VN2A 4NCNA 2GQFA 1OFMA 2ESHA 5EYRA 3KEWA 1ZQ3P 4TT3A 1W2BB 5TR9A 3GTOJ 4NHJA 3CC2B 4ZYDA 1ENHA 2NS0A 3E6DA 3HIFA 4KDPA 4X06A 3H0GJ 3ZZUA 2DXIA 2ID3A 3L7WA 1P9QC 3ELKA 4RAYA 4FCYA 3CC7I 2UXNA 3RYRA 2XF6A 3DXJF 1AKHA 1GAQA 4RDKA 3LAJA 2OV7A 4CQJA 1UMQA 3ERMA 3JW4A 4X0CA 1ZYRF 3DV8A 1QGAA 2DJNA 2QN6A 2WPDA 3ZZ0A 1F20A 2EBIA 3I56B 4JQFA 4E7KA 1UHWA 2KPMA 3IHUA 4AIHA 3BNWA 4RA2A 5TJJA 1O7LA 3FMQA 3FKJA 4E7IA 1I18A 3WGHA 3ZXSA 1VQNB 3HG9A 1T5EA 3GEZA 2BM1A 1W7PA 4G7OF 1HQCA 2INVA 4P6YA 2INUA 5FKNA 1MNMC 1PYVA 4M6XA 3GVKA 1ODDA 4ZV4A 1BI3A 5E8IA 4KFCA 1AMOA 2M3AA 1AWCA 4AM3A 4DNTB 1X0CA 1LVAA 2MLGA 2PYHA 3RIQA 3B6CA 4RDLA 1EFTA 5CKTA 1YW7A 4K1XA 2B7EA 2XB5A 1JHHA 1UHMA 3FDYA 3UNGC 1X1DA 2J5PA 4OPOA 3WNCA 2O8KA 3GVLA 2NAZA 1R5OA 1FWZA 2XAUA 2AXTC 1G6NA 1KMHA 2EV5A 3U1KA 4HLXA 5CPRB 3RKXA 6PAXA 3WTYC 4LC0A 2L5QA 1OOCA 4M3BA 4KT5C 3FJOA 2ZNZA 3HGGA 3J7AY 1B2RA 3Q0VA 2EA2A 4YAUA 5EZGA 2DMPA 4A3IJ 3LOCA 4RAGA 2ZCWA 1N05A 3LA7A 4JRAC 3HHGA 3HGYA 5CQEA 2V26A 4AIDA 1JHFA 2NOGA 1O8MA 2HVQA 1BIAA 4Q4ZF 2LR8A 4Z2YA 4RBOA 3L2CA 2R7WA 2PMHA 3CMAI 2V9VA 3U2RA 4Q48A 4Q7JB 2JPBA 2VBZA 3K7AJ 3RKQA 2VFNA 1ERDA 4Z4SA 1K4TA 1MD0A 2TRTA 3EYIA 3GTJJ 2K86A 2R7SA 1VQMI 1JXSA 3R61A 1N8RD 4QTRA 2ZBVA 1QHGA 5H6RA 3OYHA 3OFNA 1XFOA 1K4SA 3B6AA 3AGQA 4Y9UA 1DDIA 3GTKJ 1UCRA 1NRKA 4LIUA 1S4MA 1YRNA 1SMTA 3A0BC 5FFZA 1QZYA 3BR2A 3OW2B 2OK8A 2IS6A 5FLXZ 3ECOA 5IOYA 3HOVJ 4I6ZA 3VSKA 4Z4UA 3W2WA 1KA8A 2ZL5A 2X1DA 2JSPA 4RM3A 1RRJA 4ROXA 2ZXIA 2HZTA 1N0UA 2XRLA 3KEYA 4BAYA 4EM1A 4ZYGA 4C2UA 1OGIA 1W34A 2BW3B 1UMKA 3V7RA 4ZCMA 5H2FC 5IPAA 3BTJA 1O7FA 3O8HA 4M3FA 2VE8A 3GF2A 2DMUA 1WZ2A 2ME6A 3C2HA 4W8TA 3I64A 1S0UA 2X8KA 4M9ZA 2LP0A 4U87A 2CS3A 1TNTA 2YWGA 4PCQA 2DOGA 3F6VA 2ICWG 2QQBA 1M90D 3DLLF 1K6OA 3ABUA 1JA1A 2CMPA 2MLKA 1L1IA 4DZJA 3K0LA 3CDIA 4M3DA 2XGCA 4KIGA 5LMZA 1JRGA 1K4ZA 3A03A 1IB4A 1MH4A 3HPHA 2XPWA 2WAQA 4E70A 2IGNA 1HF0A 2BVLA 3I4MJ 3ASQA 3PIOF 3Q6RA 4XOTA 5FFXA 3CJTB 3NAWA 2FNAA 2KIFA 5F04A 1YIOA 2Y75A 3OSFA 2HGCA 2NPFA 3VSVA 4WK8F 1HW2A 4BJ6C 2JRMA 2E1NA 4V02C 2CU7A 1N08A 3MMPA 2XDVA 3E5UA 2R7DA 3P7NA 4LITA 4XLFA 4P96A 2PE3A 4NBSA 1H8EA 5B5EC 1A36A 3BPVA 2BM6A 5FIUA 1NDHA 1SD4A 4KT6A 3A8KA 1UELB 1QNTA 5ICEA 4KH3A 4PSWA 5F6FA 1WJEA 3TW6A 1N0VC 2D3NA 1T6SA 2LY9A 3WGGA 3VYUB 3JU4A 4LK1F 5FROA 5CYVA 1EXMA 4UZFA 1ZG3A 1C0WA 1UD6A 4YXWA 3K69A 1IC8A 2HOEA 2BY3A 2P6TA 3P26A 3CMYA 3GTLJ 1WP6A 1P92A 1S7OA 1F60A 2CG4A 1FNBA 3FPPA 3TO7A 4CGZA 4Z05A 1VTNC 4PC6A 5HDGA 4ZGQB 2XSDC 1ZGJA 2A68F 5ILSA 3DTEA 3RCOA 3CMEI 4U9UA 1VQKB 2XT2A 2IAIA 3C18A 3A8IA 3OEHA 1DBGA 2KT0A 2EFNA 1DARA 1QUFA 5HLHA 2R9VA 2L01A 3ZQFA 2BE5F 1VQ7B 2PMUA 2XOKA 1B9NA 3ZPLA 1V5GA 1ZTRA 1NK3P 4Z4VA 1V4RA 4UB8C 3ZR8X 3JSPA 3CCQB 1X3WB 1KU7A 1G7CA 3I9V2 3QSYA 5HS7A 5IYNA 5E1WA 1D2EA 3GO5A 3OYCA 3D0SA 4HA8A 3I4PA 4GGGA 1ZGAA 1R5HA 1T2KA 1JGGA 2B0RA 4E4HA 2DFEA 1W0TA 2GAUA 1HLVA 2D1HA 3CUQC 2FOKA 1W36D 1RKWA 3F21A 1RQPA 4C2TA 2QXZA 2MC3A 2W85A 1QU3A 1RETA 2ZJRF 2WC2A 5DS0A 3WE2A 1YJ9B 2F1LA 3MD2A 2Z5UA 2H8WA 1UAAA 1EF4A 1G2HA 3V7CA 2F5VA 4IHTA 3ZUGA 4HW0A 2Q6OA 2ZZGA 4KIFA 4BDZA 3AL0B 5DTDA 3GFIA 1W87A 4ZC3A 2HKXA 1M1KD 1KYZA 4XKWA 2OBTA 4HX4A 1X3ZB 3QODA 2BY2A 5AN9A 2ZSIB 3VNUA 3LA3A 3H3ZA 2X0KA 3ZBTA 1E0EA 1F9NA 4UVAA 4XM3A 2R0QC 2IRFG 4OPSA 2MW8A 3TEDA 4RPDA 4A69C 3OYIA 1N75A 5H6QA 3O3KA 3ASNH 3CF5F 2FX0A 1I6XA 2UWMA 4UZEA 3CW2A 1HW1A 1OCOH 1Z91A 5JVTA 3D26A 1XSVA 1WU8A 4KN4X 1Z9CA 2L9RA 1BJAA 3CP8A 2VNHA 3BWGA 4G6DA 3GZNB 3G6EI 4CH7A 2H09A 1WJCA 2HMAA 1VLYA 2XAGA 2E1MC 2EV6A 3E7LA 1T6XA 2MH2A 4RCYA 1YI2I 4XLAA 3GTMJ 1JI8A 4WZEA 1V0FA 1B23P 3KP7A 2K9SA 4QPOA 2GWRA 3DBHB 2A6TA 4MFEA 1IUYA 2D2WA 5CVUA 2KDZA 4YFNF 3WYAA 2RREA 5IT3A 1HA8A 4YAFA 1OCCH 2PJRA 3RIRA 1WJAA 1R9TJ 1O8IA 1FOXA 4XN3A 1EFRA 2CBXA 3HKZA 2BXZA 4XKBA 2H94A 2AXLA 3ML3A 3FBIB 4BUPA 4X7DA 1GAWA 2XAFA 3QRFF 3TOAA 3VSUA 2DOAA 5ICCA 1QA1A 2CV2A 2HVSA 3QPSA 1JTYA 4BQOA 4CZZA 5J3LA 4O3MA 4AYBA 2R7TA 3BG9A 2LKSA 1JA0A 5IYBJ 2C5BA 2XZOA 1FRQA 2BPOA 3W2IA 1WSRA 3KEQA 3JREA 2FUG2 1MSFC 5B66C 2VT2A 3CXCB 1OYYA 3P5JA 4OIPF 1GDTA 4G12A 2DCUA 4PFPA 4TKOB 4ACBA 4G7WA 1U2RA 2XAJA 1WJFA 2NVTJ 1QFYA 2A5YB 2O1DA 1W1WE 1VJSA 1MGTA 5DN6A 1IV6A 1HKTA 4EJUA 3K9TA 1EWYA 2BVNA 5A88A 2PG4A 3SQNA 2WV0A 4MHGA 4G6TB 2Y0SN 1VF9A 1RZ4A 3O2PE 5KK1A 2A69F 2DMNA 3GW2A 1FTTA 2BGIA 5H5JA 3CQZJ 2LF8A 4B4CA 3S8PA 2X9DA 1B6AA 2GJKA 3BY6A 1QVGB 2ZXHA 3G1LA 2O7OA 1GLNA 1U6GA 1VNDA 4LG3A 3RYPA 4WZLA 1VQ7I 1PJ6A 2O03A 3S15J 2Y0SA 1LPQA 3PUNA 1ITYA 3CESA 1QJVA 1P7IA 2E5ZA 3M07A 1TQPA 4HF0A 3G71B 5L3EA 3AG1H 3VO1A 4EMSA 2G9WA 3OYMA 2E34A 1YJNI 4Z1MA 4DZPA 4YDTA 4DYCA 3W2AA 3RTRA 3U21A 2NT6A 1TW3A 1ZM4A 4QVJA 3ROUA 4G5GA 1D1BA 1Z7LA 3PQJA 4PJJA 4CYCB 3J81K 1OLTA 1PP8F 1H0MA 4J01A 1VQ5I 1MMGA 2V31A 2L4MA 4WX9A 4P3YA 5EF6A 2TDXA 3S16J 5E20A 2WSSA 3FXUA 3H9QA 4OM9A 4MTDA 3ULQB 3G3ZA 1AA7A 1O8LA 4F52A 2R7OA 2E2JJ 5B1AH 1TL8A 3A0HC 4RGSA 2P5KA 1IXRC 2B63J 5C1EA 2VB6A 2DA1A 1AIPA 1LFUP 5J8CA 1BI1A 2STWA 1ZARA 3V8KA 4XRSA 5JLWA 5LEJA 1HC8A 1R36A 2YWFA 1VQ8B 4M9XA 4HE5A 1MKMA 3DEEA 2Z99A 2EZHA 2RC5A 3T8TA 3B78A 1KYWA 1OMIA 2KIQA 2J8KA 2OJED 5F64A 4U0YA 1YTYA 1Z1DA 5TV2A 2J5OA 4OP7A 3WY9A 1DDGA 1IRGA 4FWTA 3VYTB 4BL0B 2G7UA 1HDPA 2QBYB 3OYDA 3FK7A 3ASTA 3BY1A 2NXNB 3BDDA 4MQ9F 2M1BA 3L2QA 4BACA 3ZMSA 2X6YA 4D7MA 1ZK8A 3KP6A 2V7XA 4ZZLA 2QQ9A 1BC7C 4YAWA 3CD6B 4U49A 4LFUA 3KYDB 2BY0A 3N05A 4ANJA 4B48A 3Q5FA 1UD3A 5F4OA 3LSJA 2ECCA 4MYUA 5K7HA 2GQQA 1S7EA 3K4JA 3KP4A 4XORA 4ETSA 3F3XA 1KZHA 5D4SA 2V6EA 1E3OC 1IGNA 3D5SC 3S3OA 2XF7A 2EFGA 5GTHC 2CQNA 2B0LA 3KPHA 1UD8A 1CNFA 2Y69H 2DN0A 3LL7A 1FX7A 3LNQA 2W48A 4D0PA 5J6XA 4Z03A 4B44A 5CVRA 3AVTA 2F5FA 2F5DA 3JRFA 1MBHA 2HI3A 1VQOI 1JT0A 2JA6J 2HTJA 2R7QA 4ITVA 2FVGA 2DT7B 1N25A 1REPC 2ADUA 5C1CA 2CFXA 2V1XA 1BW6A 2LY2A 2W25A 3SJMA 1K79A 2W6JA 2VJJA 3OS0A 1TWHJ 3REOA 1G8XA 2XAQA 3SXYA 4B4DA 2OBRA 2E7XA 2GXBA 3BZCA 3CLQA 2PYGA 2VFQA 3VO2A 1JJ8C 3AFHA 1DU0A 1QGPA 4ZCIA 3Q0WA 3OJWA 5HLIA 3W2VA 2C2WA 3T0YA 4G7HF 1YHQB 1WJ5A 2JRTA 1DPRA 4CZCA 1O3RA 1IJFA 1XMAA 2DQLA 3FPKA 5IYRA 2AHQA 3F6OA 2DW4A 2JPCA 1I50J 1XGOA 2RN7A 1WSUA 5F1RA 4HV5A 4XLCA 3X2QH 1IJWC 1M1EB 2GJPA 4PABA 3ZN1A 3ZN0A 3M8EA 4ESBA 4B3GA 3JRHA 3G4SI 4XMYA 5HS9A 2MD0A 3IH4A 2K9QA 4I7HA 5DYMA 1FP2A 2OAZA 4ZYHA 5D5UB 1X1CA 3WTVC 1A31A 2QMUA 2L4AA 2XZPA 5LLQA 3V7SA 3OYLA 3KFWX 3OOUA 1TWFJ 3CZ6A 2B5OA 2X1CA 1K61A 1FT9A 2QTZA 2V5IA 2HZDA 5J4VA 4Y17A 1JUMA 3RY8A 2JSCA 3LFUA 3QU3A 3U6BA 1QCXA 2TCTA 3SFZA 3C2GA 2L7FP 3WU0A 3I55I 1VQLB 2FD5A 2X3UA 2XZLA 1X4OA 2VFPA 3HHHA 3I0TA 1V5EA 2HQAA 3QPTA 2F1MA 3HUGA 4IW3B 3WTUC 5ERIA 2FEZA 3AG3H 2RC4A 5FRMA 2HQRA 4RS8A 3WHCA 2O0VA 1NJID 2CFOA 3PNYA 2BSPA 2PN6A 4HSTA 1OJLA 1ZR2A 2QKMB 1D0YA 1R7JA 2NV4A 4LLLA 1YIJB 4E7JA 3CCVB 3ONQA 3CCYA 1Z05A 1ZM9A 1KTWA 2MGQA 1BX1A 1TYUA 1HA3A 1U8RA 1J5YA 1BMFA 3KP2A 1QHHD 3OW7A 1AU7A 1KU9A 3S1MJ 2HLDA 4M1KA 1TSPA 4DQ2A 3K10A 3HOZJ 1LDKB 2GOXB 3GIRA 3IH2A 2DA6A 2GJRA 2XUBA 4U0WA 3JQRA 3RQIA 3CUQA 1OYIA 2FBHA 4A3LJ 2JJ2A 5A89A 3G05A 1VQLI 2VKEA 2NS8A 5LHGA 4LG0B 3GVJA 3H9NA 1Q1HA 1WCMJ 3J7YJ 1B8IB 2Z2SB 3JAMZ 1YI2B 1JT6A 1MW7A 2ZMEB 2EA4A 2P7CB 2OTLB 1LLZA 5E3OA 3OS2A 2JK3A 2L02A 4ZYEA 4X05A 2NNYA 3WE3A 1SANA 2VC1A 2GIZA 3BC9A 1S9HA 2L9NA 2R5ZB 2FX3A 3FKIJ 2W4SA 3R0JA 1IA5A 4XK4A 1OFDA 2YS9A 1TYVA 3HRUA 2CW7A 3U1DA 5K5RA 2D45A 3A3GA 2HOAA 3N90A 2ZXWH 4P3IA 5HDNA 3JRGA 1R4MB 2EQRA 5EMNA 2D5VA 3W5HA 3VODA 2OBPA 1KZLA 3Q6QA 4YIFA 4R71A 1KQ0A 4Z4YA 2XPVA 2QTLA 4G7XA 4YRVA 3SUCA 3KETA 1B59A 1JKRC 3DPTA 3VOEA 4JP0A 4HV6A 3FIWA 1WFXA 1QH0A 2M4KA 4BY1J 3OKXA 3HOUJ 4XD7A 1K78B 3ML6A 1D1AA 1LM1A 2VKDA 1BLIA 2OYNA 3B4NA 4G8XA 3HL2A 3CCMB 4U0VA 2C4TA 4C3HJ 5JI6A 1WKMA 3KP5A 3FWEA 1Q7YD 3QFTA 4E7LA 2PJRB 4X7EA 2HXOA 1SAUA 2ZO4A 4M73A 2VXZA 1ZG1A 3EUKL 1HBXG 4L0YB 4HIZA 5E8GA 1LE8B 5FLMJ 3IUOA 1FYMA 2WAEA 3OYBA 2KQRA 2FBKA 1BN5A 4FX0A 4A0YA 4XOPA 4ZTJA 4RDJA 3QP5A 3UKGA 1BJZA 3DU5A 4ZDPA 3ZQLA 4C2LA 2ODLA 4A6DA 1J75A 1ON2A 1KK2A 3CCQI 3PVDA 3A35A 4P9UA 4LBYA 4FXUA 1O3SA 5LGUA 3WXMA 5E1XA 2XV4S 1VFCA 4QPQA 3JRIA 2FU4A 2IGKA 3GCMA 3I5UA 3I56I 2KRFA 3W6KB 5DM6F 1TNSA 1KU2A 3ZQGA 2Y48A 2CC2A 1FMVA 3H3UA 2NOJB 2BHZA 3N4MA 2E2HJ 4UY8I 4RJLA 1N77A 3CPXA 3TO6A 3VSTA 4II3A 3COAC 1O8EA 4URRA 4RM2A 4YEIA 1F1ZA 3L2RA 2QA4I 2PFBA 4B3AA 4ZTFA 4C3JJ 2W57A 2GZWA 1Y0YA 1OB0A 3LO8A 3ZQCA 3CC4I 1RC9A 4Z6YA 2QLZA 1XB2A 2NT9A 3FXLA 5KVRA 4P5OA 1GVDA 2Z1DA 3G73A 5ILVA 2CYYA 1AOYA 1G7RA 4D1QA 5FD6A 1VQ6B 2CWEA 3DBRB 3I55B 2QF7A 1GUUA 3CJQB 3Q0UA 4A5NA 2XASA 3LSRA 1LJ9A 1MJ9A 1QBJA 4YCQA 3OJXA 1WPCA 2EINH 4BS9A 2HDNB 1FJLA 3S3MA 2OU2A 1J9IA 3TDUC 5AMVA 5LGTA 3W2HA 2EPFA 3HRSA 2X6OA 2DDBA 3CCMI 1PP7U 5M3MJ 4BEHA 2F4NA 1WQ2A 5ED4A 5E79C 3FHZA 5DCMA 2FMLA 1ZG5A 3KL9A 3F8MA 3PM1A 4CCOA 2MABA 3JURA 3OV8A 2VKVA 3IRRA 1SFXA 4Y3OA 1DUXC 2GREA 1XMKA 3OE7A 3E3VA 2LD5A 4MLOA 1LFPA 2EZLA 1YJ9I 3VEPA 5KSWB 3PETA 3WNBA 2DYSH 2E1RA 2P4WA 4AC0A 5IYDJ 2HOTA 3FXKA 2OD5A 5KAIC 5JR3A 3OYEA 4LB6B 4I09A 5FL7A 3U2QA 4YZAA 2O8XA 2ZJQF 4AWXB 1R5GA 2X85A 2KRCA 2DTZA 2KRHA 5LHHA 2CRVA 1MBKA 3S2WA 3OYNA 1ZN2A 3BJOA 2MSYA 2FRHA 3M9AA 4OPWA 4CCJA 5FD5A 5K7FA 2LZJA 4L9NA 4WQMA 3H5AA 4PGGA 5DDGA 1E1QA 2ZZEA 2KLOA 3BZ6A 2DPDA 1TBXA 2QENA 2AO9A 1OCTC 1CQXA 2E19A 3I54A 3PSIA 4D9JA 2P5LC 4EQQA 5GAGJ 1E17A 3IV5A 4WF2A 2STTA 1FRNA 1QVFB 4XSZF 2VKHA 4NQWA 3K70C 2NYXA 1BA5A 3QPLA 3MMYB 4RD0A 2KIMA 5DSZA 1B4AA 1MJBA 3HTSB 1N07A 1QUEA 2BEOA 2JA2A 3SQVA 1E64A 1IHMA 2XTYA 3SZPA 1V3FA 5HDKA 2MA3A 4CHUA 2QGGA 3TP3A 2P7VB 4HSRA 4YALA 2BY1A 2AQEA 2BBYA 3PUBA 3VSLA 3BP8A 1H8HA 2GK6A 3E0JB 3G2BA 2DLLA 5KAFC 1S3JA 3OYGA 2LKPA 2H27A 1Q82D 1J59A 5EDNA 5DV5A 1TT5B 1IN8A 5LHIA 1HCRA 1VQNI 1XSXA 4DGWB 3OP1A 4W1UA 2GBYA 3TDZC 2Y2ZA 1E63A 4WXDA 1IDZA 1VI0A 1VQ4I 3SDBA 1MDMA 2B7BA 3HOYJ 2IOUG 2HEOA 1YLOA 4XRFA 3R6SA 4LGWA 1PXZA 5IP7J 2Z8GA 3ZQ7A 2QYOA 3N6ZA 1KQSB 4OJOA 2NVYJ 2W24A 4JK1X 4CYCA 1JB9A 2DMTA 4M3GA 5IYQA 1H80A 4OJ6A 2GM4A 2Q8KA 3LA2A 4IZZA 3A4CA 1IDYA 1PLUA 4BQQA 1E62A 5FA6A 2K3FA 4W8RA 4PC1A 3KLNA 3CTAA 4QWQA 3ZSCA 4A0XA 4G9YA 2EJRA 3IL2A 3OL4A 2F3LA 2F4IA 2R6HA 4ENNA 2PJPA 3OR2C 2ZKZA 4M71A 3OOPA 3TO9A 2YU9J 3PFYA 1K8AD 1MMSA 1MNDA 3KZYA 2O6WA 1OPCA 2IBDA 4NB5A 4HRIA 4ZDOA 5B1BH 3SKBA 1VQ4B 3ZMTA 1Z3XA 4WCGA 3PO2J 2LVSA 1WPKA 4AVZA 3WU1B 2XNJA 2NTBA 3BZKA 5IYPA 1TWAJ 1GQ8A 1KQ8A 1GVJA 2BGJA 4P1WA 5THXA 4ASUA 4BPRA 4X07A 3DLAA 3U9GA 5DS9A 1ZHFA 2HPMA 2JQ7A 1IG7A 4BHBA 2O9LA 4BQAA 3MEXA 1ETXA 2Y9ZA 1QRCA 4RB0A 3PIPF 3L2WA 4B8XA 1TC3C 2O61A 2NRAC 1UD4A 2AQFA 4W97A 3GYHX 3G4SB 2EIKH 1QFZA 1RMGA 1E2XA 4LOCA 1W0UA 1D5VA 1X19A 4IKFA 4I2OA 3GQ7A 3W5UA 4C43A 4MR0A 3OEEA 2VBEA 4RLQA 3BG3A 4F7ZA 1X58A 4V2GA 3V42A 2PI0A 1ETKA 3DU6A 3EUHC 3BCFA 1T6ZA 4XLNF 1WH5A 3BR0A 2BHYA 3R0AA 3ISPA 3UR3C 4W8SA 2EZKA 3D5RC 1ULYA 4DIQA 3FISA 5J3OA 3FMSA 4IX7A 5D5WB 3G1OA 1CNEA 3I1FA 3ZQQA 5LGNA 5HNFA 5LFAA 2JA5J 5HXBA 4A0ZA 2GA2A 1VQKI 3GTQJ 1O3QA 2IEKA 1FNNA 3SZTA 3E6CC 3QU6A 2XTWA 2DPUA 2FJ1A 2IXSA 3CCRB 1G59A 2EFPA 3WHBA 2D9RA 2M45A 3FM5A 1R23A 2Q6IA 1TWGJ 4OJLA 3H1CA 2BXYA 3S1NJ 3FM3A 3SZGA 3TL4X 4I98B 3JCUC 3KZIC 4UAJA 5DNSA 1IUFA 4BBRJ 2VASA 4J00A 2YR2A 2F5EA 4A6EA 4TMVA 2GK7A 2VIXA 1GXQA 1MRZA 2HQ5A 3KYCB 1TT0A 2FA5A 4E7ZA 1A6IA 1R5ID 3LQQA 2ZMEA 4G1VA 4EH1A 2QSGX 3CB4A 1D5YA 3OIOA 3FXRA 5D8KB 1QZZA 4KISA 4OIRF 3VYSB 2Y9YA 3JQPA 3P4GA 3SYJA 2HVRA 3G6EB 3SDGA 1HZEA 1OR7A 3Q3AA 1J09A 2J7KA 1NB0A 3Q9SA 2QQ8A 4UVCA 2I10A 4XRMA 1WOOA 1W5SA 1G7SA 3HC7A 2QSHX 4RLFA 4GRIA 1K7AA 1I39A 1HOMA 3DEUA 3LSGA 2OTLI 1CF7B 5LBQA 5E3NA 5JFRA 4AF6A 3ZMUA 4HX7A 3NWTA 3CD6I 5D6EA 1KC8D 1XTAA 3VFZA 4PGOA 1T0FA 2OTJI 2EH3A 2ZJ2A 1DP3A 2A07F 2VUMJ 2L7MP 4E6KG 3HM5A 1EH6A 2MG4A 2VQGA 3FXOA 4O6JA 1CZFA 2J8IA 2I1LA 3FX3A 3K2ZA 1ZAOA 3NWSA 5DUIA 2IS2A 3A8JA 5F4JA 2ZBUA 4WWVA 4QV2A 3RPUD 1K83J 3E97A 2VJ4A 1E3XA 2QA4B 1YFHA 1HDDC 1RQRA 1SVOA 2CQXA 3F8BA 5BS6A 2XNDA 4XSXF 5L46A 4E0FA 3HXLA 1S6LA 2XSJC 2OUMA 3WTZA 2OCEA 1DG1G 1OFLA 1VQOB 4R8HA 4MTEA 2EV0A 2XHKA 4U7DA 3CCLI 1H89C 3QP6A 3LSPA 2LBFB 1I3AA 2IA1A 2KFDA 3F8NA 1FYKA 2NTPA 2K02A 2QZ8A 4C0SA 1BI2A 1R71A 3T9GA 2VL8A 1Z3YA 3HYIA 2IS1A 1OGJA 2BVMA 3D5LA 2M7BA 2XRNA 1XN7A 2MH9A 3ASPA 3JSOA 1W36C 2HTSA 1KK1A 2WYRA 2K27A 4II2A 4HAMA 4G1BA 3FKSA 1T95A 2EZIA 3GQ9A 4N4OB 3CCEI 1SFEA 2ECBA 3E20A 3MWMA 2VPLA 4IHWA 3IKTA 1YITI 1JKOC 2DA3A 3L2UA 2EFWA 5AIPA 5LRRA 5FRNA 2ZL7A 2I5UA 2QE7A 3BR6A 4RB2C 1K5CA 3IC7A 2HQNA 2MYSA 5CVIA 1IDKA 3ZP5A 2CSOA 3E6MA 4D5FA 2EWNA 4MXNA 4Q5SF 4PFOA 1LDJA 2YUHA 3GZ5A 4V2FA 1ETOA 2NVXJ 5IT9Z 1VF7A 4ASNA 1OB5A 4W8QA 2VNIA 3S14J 3MKYB 3FXJA 3K70D 3O6BB 3WWGA 3QFSA 2N8GA 1SD7A 5K5OA 2V7VA 3LQRA 4DBRA 1B72A 3V8LA 2ZFWA 2DYRH 1S7AA 5GV7A 2C6YA 3WQZA 4Y33A 2H1LA 2V9KA 4KJZA 4XICA 1OYWA 2M34A 4IHVA 3BCDA 4X7FA 4MNUA 3H35A 4J0QA 4RM0A 1VQPB 4AIJA 2E71A 3M8JA 4IJAA 3J81k 4YC5A 1YS7A 4I01A 2O5RA 1P4AA 2WAFA 2V7UA 1DGRM 4Z4WA 2M7AA 4XONA 3TW7A 4IL6C 2E1MB 2V1NA 1D1CA 4EW9A 4TV7A 3M3YJ 1JNYA 1WOSA 1FOWA 2HXIA 2K4JA 2YSRA 5D6FA 2KDOA 4M72A 4X8IA 1SFKA 2WTEA 2IT0A 1KGSA 1R1TA 4LMYA 3HOTA 1K8FA 2QCOA 3AVWA 1LB2A 1SD5A 1X1BA 1D8TA 4LD5A 3K6GA 1JJ6C 3EYYA 1LNWA 1D3YA 4BE2A 1NH3A 4IRHA 1Z21A 5EJCA 4P1VA 3LQ6A 3DPLC 5C3EJ 3LSHA 1FNDA 3OYJA 1MBGA 1R00A 1QQIA 5HLGA 1PVEA 4IXAA 1IRXA 1W0KA 1EE6A 2ISYA 4CDGA 3GFJA 1WMRA 1MNEA 1J7KA 1YE9A 2RNGA 4XL9A 4PAAA 4HZFA 4ZYAA 3BCAA 5DD4A 1RR8C 4N3NA 4PC3A 1BQEA 5EEHA 1T08B 2ZTNA 3KEOA 2VBVA 3LNNA 3GBGA 1VQ9B 2EFOA 4AC9A 2FNPA 5B3SH 2YX4A 1HKSA 5CJ9A 4BDYA 4GQNA 4B3FX 3VDXA 1FPQA 4S0HB 3CF2A 2QZAA 1V5VA 4BHPA 4CXFA 2R92J 3AVVA 1J0RA 2M30A 4DW6A 2JDIA 2A6EF 4HYEA 3CJNA 5GPCA 2WY7Q 2R5YA 3ABKH 3OL3A 1XE1A 2DFFA 1FP1D 1U5TC 5HLTA 2W7ZA 1QA2A 1Y8RB 2K4BA 1FSHA 2O04A 2QWWA 3H9JA 4U4BA 3H5NA 3WTXC 3SY2A 4EGZA 2GPJA 3G1MA 1QX4A 3OAAA 2DETA 1V5FA 2UXXA 3M7GA 3TMOA 4AYBN 2OA4A 5M5YJ 4BHCA 4KITB 2JA7J 4JX4A 4DQKA 3BG6A 4EGYA 2L54A 4E7SA 2R7UA 2ESNA 3MQ0A 3TH0A 2E1OA 2CUZA 5TY0A 1MSEC 2XROA 3BH6B 3W5VA 4AUXA 2BSAA 4YELA 4F92B 4DYRA 4H9GA 4CUGA 4B09A 3DFGA 1XCVA 3GQAA 2G0YA 3EDPA 3KYLA 3CC7B 1OB2A 1O8GA 1R1UA 5LEKA 3J80Z 1YITB 4IRGA 3QE2A 5JLVC 4QSHA 3DPUA 1BC8C 2CV0A 1NG7A 2V79A 3A1YA 1FOYA 3H3VK 1VZ0A 5GAEJ 3JR9A 1Y6IA 2DOFA 2E5NA 3H09A 1KCDA 4NNJA 1KK0A 3M1EA 5BPDA 2A05A 4F55A 2HDCA 2JZYA 1D1NA 3HPGA 3PENA 2W82A 2Z16A 1H9GA 2FQ3A 2RV8A 4FE7A 1HVXA 5CDFA 1O88A 2R7FA 4I76A 2ZXJA 1WOPA 4OWRB 4UXNA 3V7AA 1E43A 3H36A 4XRSG 2ZZFA 3HRTA 3TGNA 2LDUA 2F43A 4EJTA 1DBOA 1U9OA 1USTA 4OU0A 3ZOBA 5GP9A 3LSIA 4A3BJ 4BXXJ 4RD3A 2A6HF 1OHHA 2Q6LA 3EUAA 4YZXA 2A61A 3V8JA 1AIRA 3HUGB 5JHUA 4WXCA 3S17J 1BM9A 2WB1N 1JE8A 4BXUA 1IV8A 5C4XJ 2A3SA 4DQLA 5EGOB 1MH3A 3DP7A 1X3UA 4AU7A 1XCBA 3JAMK 3B82A 4C3IJ 3ZIAA 3DU1X 1ETVA 1QPMA 2VQHA 1ZLJA 1Z6RA 2L9VA 2PX9A 4CO8A 1A8PA 1O57A 3FF5A 5ICGA 2R5ZA 2VOPA 4JMQA 2LNBA 4QIWN 1S72B 1MABA 1SVLA 3WG9A 1XGSA 4EJWA 2QSFX 3VB2A 5FJ8J 1G7TA 2WJVA 5HKKA 2M2EA 1GV2A 4YFXF 4XR6A 5KCMA 4XNFA 1U2WA 2EWEA 1IN6A 5IP9J 2XKOA 4L9JA 1Y39A 1BOBA 2M8GX 2DA2A 4JOMA 1ETYA 3SYTA 4KN7X 1WGXA 3W2EA 3AVXA 5J1YA 3OS1A 1TYWA 1ETQA 2HR3A 3JRAA 3ZBUA 1GVHA 2Q1ZB 1D8JA 1IJEA 2C4UA 1KU3A 2KZGA 2WWYA 5H20A 3QFCA 1YHQI 1EV7A 3DTKA 1R49A 1P7JA 3DWLE 4PC7A 1KCCA 1YW8A 3H9GA 4B43A 2EILH 4GCVA 1BI0A 3C1DA 4M6YA 2WAQN 2EFQA 3CCRI 2QBYA 1TLHB 4QUZA 2P8TA 4BYYA 3MVPA 1YYVA 1H8AC 4CCKA 3F8CA 4G6IA 2O6GE 3QPHA 1FMWA 2W7NA 1U0JA 1T39A 1I5ZA 3KP3A 1IF1A 2DT6A 3T1BA 2GXAA 2QY1A 1TVCA 1EH7A 2CO5A 1W35A 3JRCA 5M5WJ 2XGEA 3KZZA 1RNLA 4MGRA 1EP1B 3I53A 2VBMA 2XTXA 3DCFA 4OZZA 2QKLB 2PECA 4N0BA 2DODA 1XD7A 3LWFA 2WR8A 2VLAA 3PSFA 3MZ8A 4NBQA 1DDNA 4GDFA 1OQYA 4LBZA 3E5XA 1RPWA 1NG6A 1XG1A 4EEFG 1QVUA 2COBA 3BR1A 4U88A 5EG0A 3JRBA 2HKOA 4ESFA 2R7XA 4YIIA 3NE5B 1UJ8A 3CCUB 4CCMA 2RC6A 1N78A 1EA0A 5EGOA 4IO9F 4GFBA 2BM4A 4BQNA 4WXHA 2QQAA 2W00A 2UZKA 2QUFA 2VFMA 1FLIA 3ESWB 4L9VA 1BX0A 2JWTA 2V6CA 3CUQB 1Q1VA 2WV1A 2NSTA 2F4MB 3PA2A 2MFZA 3ONUA 4RAFA 3ZQHA 2ACJA 1Y1WJ 2HCJB 4HF1A 5FO1A 1COWA 4O5VA 2VNJA 3FXMA 1POGA 3D1NI 1ZR4A 1I1GA 2IGOA 3W2FA 3K1MA 2X6WA 1FYLA 2QDXA 4A3DJ 4Z4TA 3OR1C 4UUVA 2WB1A 4RCZA 3MKZA 1RUNA 1G3TA 2YUSA 1XQBA 1IW7F 1T0FC 2K3PA 4CICA 2IA2A 4U7BA 1BJKA 5F27A 3ABMH 5JHFA 2GLOA 1CQTA 2NTQA 2XC1A 5CQGA 1R5BA 2XB0X 3IWZA 4P9FA 2OQRA 5GAHJ 4X7CA 3BQZA 3KRGA 2P81A 5E18F 1VQPI 4C30A 1I3QJ 1UD2A 4TMZA 2E1BA 2NVUB 2RAEA 4OPVA 5JBQA 3LJYA 2ZJPF 1OGMX 3OIPA 1FTZA 2X51A 2VOOA 4I02A 4BJ5C 1YQAA 2W84A 3HZJA 5CVJA 3J7AO 4RDUA 2L9SA 5C44J 4RGRA 1WH7A 3OIQA 1Z0XA 1W0JA 3MKLA 1A04A 2F5CA 2KL4A 3VPRA 1HG8A 5JVGF 2M0CA 4ESJA 1EZGA 1FBSA 3Q9VA 1IXSB 3L09A 3TKYA 2WADA 3DEWA 3LSTA 5J47A 5L3BA 3LVBA 1RWRA 4A3MJ 2KISA 4OAYA 2FQ4A 5LD2C 2FMYA 1UG0A 2M0MA 4QVAA 1WORA 3C2BA 4M74A 1YOVB 4M9SA 3B90A 2QYUA 3MHPA 2VNKA 2PQ8A 5TISC 1ZRDA 3GFMA 2OTJB 2M4GA 2E1CA 2CUEA 2ISZA 5D4RA 4RB1A 3DQVC 4WZKA 2E35A 2XGXA 5M3FJ 2LY1A 4FHTA 1H42A 1QGYA 3CRZA 3GQ8A 4QFMA 2DFIA 4J19A 2CW5A 5GPAA 1F43A 3MCZA 3S1QJ 1SC7A 5J4YA 2NS7A 2DA4A 1Y0UA 1NK2P 3B8HA 4UZUA 2KJBA 2L7ZA 3QAHA 2DK5A 2QGUA 5E1ZB 1ZM2A 1HSJA 3K1PA 1YJWI 1NBMA 1TLLA 2DO7A 3MCAA 4HDVA 5FB2A 1EFUA 4M4SA 2W1OA 3QFRA 3K4MA 4IOAF 3A2KA 1DP7P 3V76A 3JQQA 4A3EJ 1LDDA 1TTTA 4Y15A 3SLNA 4I0BA 3B02A 4X6AJ 2OF7A 2X6XA 1R4NB 2FXAA 3FK6A 1QGZA 2WZPP 4D5CA 1K9MD 2XEXA 2Z9OA
chains in the Genus database with same CATH topology
2Y0SA 4XLHA 1QJVA 3CESA 1EA3A 3SZGA 2E5ZA 3TL4X 3H94A 2IQ7A 3OYMA 2V7QA 2VASA 1X4PA 4J00A 2GK7A 2LH9A 2VIXA 4Z1MA 3W2AA 2R7VA 3RTRA 1TT0A 3U21A 4E7ZA 3OPOA 4DK1A 2NT6A 1JTAA 1D1BA 1Z7LA 4PJJA 4HNTA 1OLTA 2V4DA 4J01A 1MMGA 2F6CA 4KISA 2V31A 5TGTA 3VYSB 1O8KA 3MKWB 4YEJA 2HVRA 1HZEA 2KMUA 2WSSA 1J09A 3H9QA 2K9LA 3LSKA 4ZDLA 2CUJA 4DK0A 1AA7A 1MMDA 4F52A 2R7OA 1O8LA 3SEQA 2ZZQA 1WJBA 1WTHD 5KNLA 3HC7A 2UVEA 4RLFA 5C1EA 4GRIA 2VB6A 2VXDA 3T53B 3LSGA 3ZPPA 3VMVA 3AKZA 4BE0A 3NWTA 3BLYA 3DEEA 3PNVA 4LIVA 2WY8Q 2VBKA 1DP3A 2I8DA 2LRDA 2MC4A 4E6KG 4BEHB 1CZFA 2VQGA 3VYTB 4BL0B 3BCBA 2HDWA 3OYDA 4HPQA 3QYFA 1O8FA 3NWSA 2IS2A 4PSXA 3L2QA 4BACA 1E3ZA 2X6YA 4DNRB 1W9XA 3RPUD 3VYRB 1E79A 2CW8A 2WJYA 2VJ4A 3AL0C 4H4KC 1E3XA 4U49A 4CCLA 2HPIA 3N05A 4XN0A 4ANJA 4B48A 1UD3A 2XNDA 4E0FA 3HXLA 2XSJC 2JIZA 2OUMA 2DCEA 1OFLA 3K4JA 3VWBA 1K28D 4XORA 3OMYA 3RSNA 3KX2A 4OAZA 3OYFA 2LBFB 4NK6A 2V6EA 1IDJA 3D5SC 3S3OA 2XF7A 2NTPA 2WA0A 3T9GA 2VL8A 1Z3YA 3M1CA 2IS1A 2BVMA 3D5LA 3LL7A 1UD8A 4OJ5A 2LYCA 3IP4B 3A3BA 3PNTA 2M7BA 3H0DA 4Z03A 4B44A 2X1EA 1W36C 1WJDA 4XKCA 4II2A 3FKSA 5HNHA 1T95A 3GQ9A 4N4OB 4BGDA 2IGMA 2R7QA 4ITVA 4F93B 2CV1A 1D0XA 1MMNA 2DT7B 4NQWB 2VPLA 3IAM2 4I84A 5C1CA 3L2UA 2LY2A 2W6JA 5FRNA 2QE7A 2VJJA 3OS0A 3EPZA 1K5CA 1G8XA 2MYSA 1BR4A 1IDKA 2PYGA 4MXNA 4PFOA 1LVKA 3AFHA 2UVFA 4NC7A 3W2VA 1WJ5A 4CZCA 1VF7A 4R79A 1PKVA 4HNUA 4W8QA 2BOLA 4KKSA 2LG4A 3H5RA 3MKYB 3F9KA 2X53S 3DDYA 1NHCA 3K70D 4XLCA 3BC8A 3WWGA 2P0WA 1V0EA 3ZPNA 2JUGA 2GJPA 1BPLA 3CP2A 4FASD 4B3GA 2A5WA 4DBRA 2O0WA 3E1SA 4XMYA 4EATA 2R7RA 1BR2A 2MD0A 4FETA 4BXFA 1DGWY 4HEA2 2DJIA 2XZPA 2QX3A 4RMNA 1X1CA 2VQCA 3GQBA 3WQZA 2RQQA 2CH0A 4Y33A 2V9KA 4KJZA 2WBMA 3OOUA 3OYLA 3BCDA 3CZ6A 3H35A 2X1CA 5KHDA 3M8JA 1OFMA 4TT3A 4BJTA 3KEWA 2HZDA 2O5RA 2WAFA 1DGRM 2M7AA 4XONA 4HG2A 2E1MB 2V1NA 1D1CA 4EW9A 4BE1A 3LFUA 2UV1A 1QCXA 2KP6A 2ZFUA 3C2GA 2DXIA 1P9QC 3PJRA 2XZLA 1X4OA 4C9YA 4HWVA 2F1MA 1V5EA 2HQAA 2KDOA 2XF6A 3T56B 5FRMA 1SFKA 2O0VA 3HOTA 2CFOA 2OV7A 3DTIA 2NSPA 3PNYA 5HVQC 3OYAA 4HSTA 2BSPA 1X1BA 2QKMB 1D0YA 3K6GA 4E7JA 2WPDA 3ONQA 4BE2A 1Z21A 4JQFA 4E7KA 1KTWA 2KPMA 3TBIA 1BMFA 1QHHD 3DPLC 3LSHA 2K9MA 3OW7A 3FKJA 1KONA 3OYJA 4E7IA 2HLDA 1I18A 3ZXSA 3HG9A 3K10A 1LDKB 1IRXA 2GOXB 1T5EA 1W0KA 1EE6A 2GJRA 2INVA 1WMRA 2INUA 1PYVA 3GVKA 1YE9A 1MNEA 4XL9A 2RNGA 2JJ2A 2X3HA 3G05A 2M3AA 4DNTB 4ZYAA 3GVJA 1X0CA 3BCAA 3OWTA 2PYHA 2Z2SB 1MW7A 1YX3A 5CKTA 2D3LA 2ZTNA 3LNNA 3GBGA 2R4GA 3OS2A 4YZ0A 1VBLA 3FDYA 3UNGC 1X1DA 4GQNA 4B3FX 4NUBA 4BDYA 1S9HA 2L9NA 4Y4RA 3SEZA 2LOOA 3VDXA 3CF2A 3S3NA 2W4SA 3GVLA 3DKXA 2M5SA 1IA5A 2JDIA 1PJRA 2XAUA 2CW7A 2WY7Q 3A3GA 1KMHA 3OL3A 1TZLA 2ELJA 5CPRB 2JJ1A 5HLTA 2L5QA 1BR1A 1KZLA 1OOCA 2O04A 4DBQA 2XC7A 3H9JA 4L8JA 4U4BA 3H5NA 3J7AY 4G7XA 4YRVA 3SUCA 3ZRGA 2V7FA 3DPTA 3VMWA 3HOSA 3OAAA 1V5FA 3TMOA 1WFXA 4KITB 5CQEA 2V26A 2M4KA 3BG6A 4XD7A 1XG2A 1E1RA 4E7SA 1O8MA 2HVQA 2VQLA 2R7UA 1D1AA 4XKVA 3L2VA 3BC9A 2R7WA 2VKDA 2V4JC 1BLIA 3B4NA 2CUZA 3HL2A 4E7HA 1ERDA 4YELA 4F92B 2R7SA 4E7LA 4CUGA 2PJRB 1BN8A 1QHGA 3GQAA 1SAUA 3OYHA 3KYLA 2VXZA 1O8GA 3EUKL 3OFNA 4HIZA 1NRKA 4LIUA 3DPUA 3IUOA 1NG7A 2PMZA 2WAEA 3K4CA 2KQRA 3A1YA 3OYBA 2CV0A 2IS6A 1VZ0A 1Y6IA 2E5NA 4XOPA 3VSKA 3W2WA 4ZTJA 2L2OA 2X1DA 4ZDPA 3DU5A 4NNJA 2JSPA 4XLEA 4RM3A 2ODLA 4C2LA 1KCDA 2ZXIA 3A35A 3KEYA 2KHMA 4F55A 4C2UA 2BW3B 3HPGA 4NC8A 2W82A 3QYEA 4FXUA 2E60A 2Z16A 1HVXA 1O88A 5CDFA 2DIEA 4QPQA 3C2HA 4W8TA 3K4NA 2IGKA 1O8JA 3UW0A 3CJRB 4OWRB 2X8KA 2NZMA 3ZCOA 3T51B 4U87A 1FMVA 2VJIA 2CS3A 1E43A 2ZZFA 2F43A 2NOJB 1DBOA 1N77A 3VSTA 3LSIA 2LREA 4II3A 1OHHA 1O8EA 3EUAA 4YZXA 1AIRA 3HUGB 2CMPA 4URRA 4RM2A 3I3LA 4TSFA 3L2RA 1JRGA 1RU4A 1IB4A 4ZTFA 2JVGA 3HPHA 4AU7A 2WAQA 2IGNA 2BVLA 3RQ4A 4PMHA 4XOTA 1OB0A 3ZIAA 4N4NB 2VQHA 2NT9A 4P5OA 2Z1DA 3DKYA 3VSVA 4BJ6C 4D1QA 1FX0A 3FY3A 4Z06A 4CSWA 4JMQA 2XDVA 4XLFA 3CJQB 4LITA 1MABA 2Q2EB 1H8EA 2WJVA 3LMMA 5HKKA 1O8HA 4XR6A 5KCMA 4XNFA 1WPCA 4KT6A 1UELB 4BS9A 4PSWA 2EWEA 1WJEA 3S3MA 1ZELA 1BOBA 5AMVA 4JOMA 3SYTA 2D3NA 3VR6A 1OGOX 3OS1A 4BEHA 3K4LA 3VYUB 3CMMA 3JU4A 5FROA 2Z6BD 2Q1ZB 4CCOA 2HU9A 2MABA 3JURA 1UD6A 4YXWA 3DTKA 3DWLE 1KCCA 4B43A 3H9GA 4Y3OA 1WP6A 3OE7A 4MLOA 3FPPA 1LFPA 2KZVA 4Z05A 5FL7A 3OYEA 4IQJA 4YZAA 3DTEA 3RCOA 4CCKA 3OEHA 1DBGA 2X85A 4G6IA 2KRCA 2KRHA 1FMWA 2W7NA 1U0JA 2R9VA 2DT6A 2XOKA 3OYNA 2QY1A 1V5GA 3ZR8X 4CCJA 2LZJA 3GRHA 3H5AA 1E1QA 3I9V2 2KLOA 2ZZEA 2OC6A 2VBMA 4OZZA 2QKLB 2PECA 4OJPA 1I8DA 3W3CA 2VLAA 3PSIA 3PSFA 4D9JA 3OYCA 3QYBA 2LC2A 3EQOA 2CK3A 1NG6A 4E4HA 4OZYA 2GOMA 2VKHA 3K70C 2R7XA 3NE5B 3MMYB 3LSMA 1W36D 4CCMA 2QXZA 4C2TA 1N78A 1QU3A 1O8DA 2JA2A 4BQNA 2W00A 3MD2A 2W6IA 1UAAA 2F5VA 4PJNA 2L7KA 4HSRA 2NSTA 1MMAA 2ZZGA 1D0ZA 2AQEA 3PUBA 3VSLA 4BDZA 3AL0B 2MFZA 1H8HA 2GK6A 3E0JB 3G2BA 4ZC3A 4PK4A 4XKWA 3OYGA 1COWA 3QODA 3OYKA 4B47A 2IGOA 2ZSIB 3PL8A 2X6WA 3LMWA 4DGWB 4F91B 1E0EA 3OR1C 4XM3A 2WB1A 2K5CA 3MKZA 1DQUA 4U7BA 1T0FC 2K3PA 3EQNA 5JHFA 3OYIA 2VJ5A 1N75A 2NTQA 5CQGA 3SDBA 2UWMA 1PXZA 4XQFA 3FHNA 4PJLA 2Z8GA 3KRGA 4NK8A 4OJOA 1Y56A 4C30A 1UD2A 1H80A 4OJ6A 3CP8A 1X1AA 4X0GA 2E1BA 4CH7A 1WJCA 2XGJA 1VLYA 4IZZA 3A4CA 2E1MC 4PJMA 4BQQA 1PLUA 2XF5A 2O17A 1R6RA 1OGMX 3OIPA 2X51A 4W8RA 3S93A 4XLAA 1JI8A 3ZSCA 4BJ5C 1V0FA 2ZTGA 4QPOA 4PUSA 3OL4A 2A6TA 2F4IA 4B3XA 4KKUA 2IS4A 2L9SA 3OR2C 2RREA 3ZGKA 4P22A 3OIQA 1HA8A 1W0JA 3BH4A 3PFYA 2PJRA 1HG8A 1WJAA 1MNDA 2KL4A 1O8IA 4XN3A 1EFRA 1YX5A 3HKZA 4XKBA 2ZSHB 4HRIA 3IAS2 4ZDOA 2WADA 4DJAA 3FBIB 2UUZA 1Z3XA 4BUPA 4AVZA 2NTBA 1RWRA 2BW3A 1GQ8A 4OAYA 5LD2C 3OOCA 2DOAA 4KKTA 4ASUA 4P1WA 1UG0A 5HOOA 2M0MA 3VSUA 2CV2A 3DLAA 2HPMA 3B90A 2HVSA 4BQOA 3BG7A 2M4GA 3S32A 3L2WA 4CA0A 4AYBA 2R7TA 3QOEA 4ZJZA 1SKYB 1PE9A 3DQVC 1UD4A 2AQFA 4IQ4A 2LY1A 2XZOA 1RMGA 3GQ8A 1X19A 2FUG2 4IKFA 3GQ7A 3OY9A 4MR0A 3OEEA 3HAGA 4RLQA 2VBEA 3V42A 4PFPA 3EUHC 3DU6A 4TKOB 3BCFA 4UZUA 3B8YA 4G7WA 3K4BA 1K6YA 2HNHA 3FBNB 1BHEA 1NBMA 1WJFA 3UR3C 4W8SA 4DOZA 3D5RC 2O1DA 4DIQA 1VJSA 2LBFA 4IX7A 5DN6A 2W1OA 3K4MA 3ZQQA 3A2KA 5HNFA 5LFAA 3K4KA 4YZQA 4F3QA 4G6TB 1UD5A 5IK2A 1LKXA 2KVOA 2X6XA 2GJKA 3S8PA 2IXSA 1G59A 2ZXHA 1GLNA 4CCNA 2WZPP 4OJLA 2JVHA 4LG3A 1OR7C 4BU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJV A;  4XLH A;  2O0W A;  4XMY A;  2IQ7 A;  4XOP A;  2NST A;  4C2L A;  4XLE A;  1KCD A;  2ODL A;  2QX3 A;  2NT6 A;  1JTA A;  4XKW A;  1O88 A;  4W8T A;  1O8J A;  1O8K A;  1OFM A;  2X6W A;  4YEJ A;  3LMW A;  3UW0 A;  4XM3 A;  2NZM A;  4XON A;  2VJI A;  1O8L A;  3EQN A;  4EW9 A;  1QCX A;  1DBO A;  2UVE A;  2NTQ A;  5C1E A;  4HWV A;  3VST A;  1O8E A;  1PXZ A;  4YZX A;  4XQF A;  1AIR A;  3ZPP A;  2Z8G A;  3KRG A;  4URR A;  2O0V A;  4NK8 A;  3VMV A;  4OJO A;  2NSP A;  1JRG A;  1H80 A;  2BSP A;  4OJ6 A;  1RU4 A;  1IB4 A;  2VBK A;  1PLU A;  2O17 A;  4PMH A;  1OGM X;  1CZF A;  4XOT A;  4W8R A;  1KTW A;  4XLA A;  2NT9 A;  3ZSC A;  3VSV A;  1O8F A;  3FY3 A;  4Z06 A;  2X6Y A;  4XLF A;  1EE6 A;  2INV A;  4U49 A;  1O8I A;  1O8H A;  1WMR A;  1HG8 A;  2INU A;  4XR6 A;  4XNF A;  4XL9 A;  4XN0 A;  4XN3 A;  2X3H A;  2EWE A;  5AMV A;  1X0C A;  1OFL A;  4AVZ A;  2NTB A;  1RWR A;  2PYH A;  1OGO X;  4XOR A;  1GQ8 A;  3VSU A;  4YZ0 A;  1VBL A;  3B90 A;  1IDJ A;  2NTP A;  3JUR A;  3T9G A;  1KCC A;  1IA5 A;  4OJ5 A;  4Z03 A;  1PE9 A;  4Z05 A;  1RMG A;  3GQ8 A;  3GQ9 A;  4YZA A;  3GQ7 A;  1OOC A;  1DBG A;  2O04 A;  4MR0 A;  2X85 A;  2VBE A;  4I84 A;  4U4B A;  5C1C A;  3SUC A;  3B8Y A;  3VMW A;  1BHE A;  2QY1 A;  2VJJ A;  3GRH A;  1K5C A;  4W8S A;  1XG2 A;  1IDK A;  2O1D A;  2VBM A;  1O8M A;  2PYG A;  4MXN A;  4XKV A;  4OZZ A;  2PEC A;  4OJP A;  3B4N A;  4YZQ A;  2UVF A;  3EQO A;  4YEL A;  2X6X A;  4OZY A;  4W8Q A;  1BN8 A;  3GQA A;  1O8G A;  1NHC A;  2QXZ A;  4XLC A;  4OJL A;  3WWG A;  1O8D A;  4NK6 A; 
#chains in the Genus database with same CATH topology
 4XLH A;  1U5T B;  5D5V B;  3H94 A;  3CCV I;  5K1Y A;  1SKQ A;  5AON A;  1KJZ A;  2IQ7 A;  2ZC2 A;  2AHO A;  1O4X A;  3PSZ A;  3CME B;  3CCE B;  3SZE A;  3BTL A;  1ZRF A;  2LH9 A;  4DK1 A;  2ME0 A;  3OPO A;  1Z67 A;  1APL C;  5DUK A;  2M5W A;  4HNT A;  3L1P A;  2V4D A;  3LFK A;  2F6C A;  5K5Q A;  3AG2 H;  5TGT A;  1QG0 A;  3R60 A;  1T38 A;  5D5X B;  4YEJ A;  1O8K A;  4KMF A;  2BMW A;  4ZDL A;  2K9L A;  2IPQ X;  2HFH A;  3RDI A;  1XS9 A;  5FLV A;  1MMD A;  5BMZ A;  2DMQ A;  3NEU A;  3SEQ A;  1WJB A;  1BL0 A;  3DF8 A;  3O8G A;  3CCL B;  2HYG D;  4YG2 F;  2OK7 A;  5F08 A;  1F4K A;  5F0C A;  1VQ9 I;  3BY2 A;  2D1V A;  2ZNY A;  3A01 A;  1Y8Q B;  1QO0 D;  3AKZ A;  3BLY A;  3R6K A;  3PNV A;  1ELO A;  1WDT A;  3ASS A;  4EM0 B;  4M2L A;  2H8R A;  1PJ5 A;  2I8D A;  4IF4 A;  4I0A A;  1JTX A;  2MC4 A;  1RKT A;  1XX5 A;  2ELH A;  4S05 A;  5BPI A;  3BCB A;  2HDW A;  4L18 B;  2D74 A;  4P25 A;  4HPQ A;  3P27 A;  4BKX A;  3QYF A;  2JN6 A;  1EP2 B;  2BM0 A;  3WBJ A;  4PSX A;  5A2Q K;  2MD5 A;  1O8F A;  4P9S A;  4L5J A;  4DNR B;  5BSY A;  5CLS A;  2EIJ H;  1W9X A;  2FF4 A;  2EB7 A;  3VYR B;  1DU6 A;  1E79 A;  5FKK A;  3CCJ I;  1EFC A;  3ISX A;  5F4M A;  4HE6 A;  3AL0 C;  4H4K C;  3RJP A;  4WWC A;  1XB4 A;  2HPI A;  2JT1 A;  3AK5 A;  4KYW A;  4L0Z B;  2JIZ A;  1CF7 A;  2VC0 A;  3OZU A;  2IVM A;  4Q47 A;  4EJV A;  1QZE A;  1BIB A;  3KX2 A;  1PUF B;  3OYF A;  3ASO H;  3GSI A;  1X2M A;  3WTT C;  3ERE D;  3P9C A;  3HTU A;  1EJ9 A;  2Y30 A;  5GV8 A;  2WA0 A;  4L5E A;  2L3D A;  3M1C A;  4UB6 C;  2CQ7 A;  1CGP A;  3A02 A;  3GLX A;  3IP4 B;  3A3B A;  3PNT A;  3M4O J;  3H0D A;  5TRD A;  2DI3 A;  2X1E A;  1R1V A;  3EQL F;  1WJD A;  1GV5 A;  2ZL6 A;  4XKC A;  4ABZ A;  5HNH A;  5IYW A;  3PUM A;  1FZP B;  2IGM A;  4F93 B;  2DA5 A;  1W4M A;  1F36 A;  1FIA A;  1G3W A;  4MQV A;  1ACI A;  3IAM 2;  1TYX A;  5C4J J;  1Z77 A;  4MYT A;  5HZA A;  1MDM B;  4X1E A;  3WTS C;  1HW5 A;  2RQP A;  2K40 A;  3AGP A;  3JX8 A;  2X0L A;  1A35 A;  3HJE A;  5JMC B;  1I1S A;  1YJN B;  1NTC A;  5E3L A;  4IVN A;  5DEQ A;  2FBI A;  3GWZ A;  1OCR H;  3IWF A;  2O3F A;  4R79 A;  3JRD A;  2VBW A;  1VHO A;  2LG4 A;  1WWX A;  3F9K A;  2PEX A;  1NHC A;  2FE3 A;  4IOC F;  4G7Z F;  1OFC X;  2P0W A;  3HOX J;  4IPA A;  2JUG A;  4ZH4 F;  3ZPN A;  2PMZ N;  4MFD A;  3CP2 A;  4FAS D;  3F23 A;  3R4K A;  1U3E M;  2VI6 A;  2O0W A;  2Q6K A;  1UFM A;  4EAT A;  2L0K A;  1BR2 A;  1XMX A;  4FET A;  5DCF A;  1LEA A;  2JA8 J;  2Q0O A;  1ZLK A;  2DJI A;  2Z3Y A;  2VQC A;  4H0E A;  2ELK A;  2PBI A;  2CH0 A;  1IAW A;  1ONV A;  4K2E A;  4LLG F;  4A3F J;  5EEG A;  4Z4Z A;  1VQM B;  1R22 A;  2R3S A;  5KHD A;  4BJT A;  2IA0 A;  4RPB A;  1YLF A;  4FE4 A;  3F0C A;  5F0H A;  4A3G J;  1LUJ B;  4HG2 A;  4UHT A;  3GUD A;  2BN4 A;  1R58 A;  2XT4 A;  4BE1 A;  2UV1 A;  5J8F A;  2KP6 A;  2ZFU A;  5FGM A;  3CCS B;  5A2Q Z;  1JUS A;  1WI3 A;  4C9Y A;  5L3F A;  2IJL A;  2LMD A;  3PJR A;  4YAO A;  4HWV A;  2DDA A;  4LK0 F;  3T56 B;  2YWH A;  4L5I A;  2P5V A;  2DA7 A;  4NDL A;  5FLX K;  3DTI A;  2NSP A;  2BV6 A;  1FC3 A;  5HVQ C;  3OYA A;  3N97 A;  3TQN A;  3AVU A;  4NC6 A;  4ON0 A;  5J35 A;  3S1R J;  1B9M A;  1YG2 A;  2LF7 A;  5EG0 B;  4HLY A;  1FBQ A;  2DEU A;  3TBI A;  1QPI A;  2DU9 A;  3WU2 C;  2V1D A;  3HOW J;  3S2D J;  5E6T A;  4UUT A;  2K9M A;  1KON A;  5FKO A;  2VE9 A;  5E17 F;  3W2G A;  4PC2 A;  4TMX A;  1Y1V J;  4OIN F;  1V54 H;  1RES A;  2DOE A;  3VNV A;  3ZMZ A;  1DAB A;  2X3H A;  1GO2 A;  2VPR A;  3QWL A;  1LFB A;  4LG0 A;  3OWT A;  1RIO H;  1YW9 A;  2G7H A;  1YX3 A;  3A01 B;  3AAF A;  2D3L A;  2R4G A;  4V19 K;  4Y7C A;  4YZ0 A;  3BT9 A;  3CC4 B;  2C5H A;  1VBL A;  2DK8 A;  3ZQI A;  4C2M J;  9ANT A;  1O3T A;  2VOD A;  4NUB A;  4Y4R A;  3S3N A;  3SEZ A;  2LOO A;  4YFK F;  2V1U A;  4ACA A;  3DKX A;  2M5S A;  3CO7 C;  5F1J A;  1GR1 A;  2CJJ A;  1PJR A;  3BG5 A;  2ZB9 A;  4FT8 A;  3CCU I;  4BY7 J;  1WSV A;  3GTG J;  4RD6 A;  4HOB A;  2CQQ A;  1TZL A;  2ELJ A;  2JJ7 A;  1SFU A;  2RGV A;  4L9T A;  1FNM A;  2JJ1 A;  1BR1 A;  1LQ1 A;  4DBQ A;  2XC7 A;  4L8J A;  2LLK A;  1XSD A;  3SJZ A;  2ZBK A;  1EH8 A;  3GVA A;  3ZRG A;  2V7F A;  2HYF A;  3BR3 A;  3VMW A;  3HOS A;  3PQK A;  2RVC A;  2OPT A;  1U5T A;  2WZN A;  1XG2 A;  3RKY A;  3J81 Z;  1K78 A;  1E1R A;  2VQL A;  2HYJ A;  3GX4 X;  4XKV A;  4UVB A;  3L2V A;  1PUF A;  2V7T A;  2V4J C;  5IY5 H;  5HOD A;  3BTI A;  4E7H A;  1H9T A;  4KIC A;  5LRS A;  1T6Y A;  4RAZ A;  2GA1 A;  1RUO A;  1H85 A;  2ZIT A;  4OOX A;  1JUP A;  1BN8 A;  4GXO A;  2R5Y B;  1T98 A;  2CRG A;  1DPU A;  4OMY A;  2VBX A;  4HNV A;  4KA4 A;  1IO2 A;  2R93 J;  1XC5 A;  3HKZ N;  1R5N A;  2PMZ A;  3K4C A;  2BX6 A;  1SFO J;  3K1N A;  5CVV A;  2VT3 A;  1XDU A;  2L2O A;  3PA1 A;  3C3W A;  4XLE A;  3WOD F;  4RB3 C;  1XPX A;  4AF7 A;  2JTV A;  3E6B A;  3ABL H;  2KHM A;  3H92 A;  5IP6 A;  1GT0 C;  5IT9 K;  3TOB A;  4NC8 A;  2RDP A;  2PLY A;  3QYE A;  2E60 A;  4LB5 A;  4QLC U;  2O0Y A;  4HQM A;  1P4X A;  4M6V A;  2DIE A;  2VBU A;  2E7W A;  1YIJ I;  3A1P A;  3F8F A;  3K4N A;  3CMA B;  1O8J A;  1IN7 A;  3UW0 A;  3ZC3 A;  3CJR B;  2RKH A;  2NZM A;  3ZCO A;  3T51 B;  5L3C A;  1TTY A;  4OIQ F;  2VJI A;  3HRM A;  3FMR A;  3HSF A;  2P3M A;  3NRV A;  4DYQ A;  1Y0N A;  1STZ A;  2LRE A;  1Y0R A;  2F2E A;  1AKH B;  5F0F A;  1IB0 A;  4B1R A;  1RI7 A;  1MBJ A;  1TP4 A;  2DAO A;  3CCJ B;  1MBF A;  2XPU A;  3I3L A;  1KTV A;  2M87 A;  4TSF A;  1OFE A;  1RU4 A;  4JYK A;  1QRY A;  4RGX A;  2JVG A;  2JUC A;  4M3E A;  3RI4 A;  3VMF A;  3SEJ A;  3HEF A;  3RQ4 A;  4PMH A;  2EIM H;  3ZZT A;  4GYI A;  3BJA A;  1AHD P;  4N4N B;  4RD1 A;  3DKY A;  1Q81 D;  3Q3S A;  1U8B A;  3BRO A;  1FX0 A;  3GLL A;  1Q9S A;  3FY3 A;  4Z06 A;  4CSW A;  2MBF A;  3CCS I;  5IOZ A;  2Q2E B;  2K9N A;  2Q2E A;  1W7P B;  3LMM A;  1O8H A;  3LYC A;  1PUE E;  1TUI A;  4OMZ A;  1OKR A;  1Z6T A;  2LFB A;  1ZEL A;  2ETH A;  4TN1 A;  3VR6 A;  4HQE A;  1RR7 A;  1OGO X;  3K4L A;  4N3G A;  1XGM A;  3CMM A;  5DCM B;  4XBF A;  2DQR A;  1FBU A;  2Z6B D;  4IHY A;  5H59 A;  4CYD A;  2HU9 A;  1S8N A;  4YIR X;  4Y7N J;  1VLO A;  3Q38 A;  2OZU A;  3BQY A;  3SFI A;  3F72 A;  4JBA A;  4JX5 A;  2EIX A;  4TMT A;  4Z4R A;  3JTG A;  1SM4 A;  2KZV A;  3K2A A;  1U9N A;  1SMY F;  1MIJ A;  3HDD A;  1MBE A;  2YX7 A;  3T5X A;  4IQJ A;  2DY1 A;  2OCC H;  4UNO A;  2KIU A;  3HB9 A;  3MAJ A;  5K7Z A;  3IKV A;  1ZGW A;  3BH7 B;  1W5T A;  1E3H A;  1UZC A;  4KNY A;  1S29 A;  3KIO A;  5FKM A;  4Y52 J;  3RZO J;  5FKL A;  2M9H A;  3ABT A;  2OBS A;  3MFK A;  2OQG A;  1QVT A;  3GRH A;  1WVR A;  1QFJ A;  2PLF A;  2VBY A;  2OC6 A;  4MEY F;  5EZH A;  4OJP A;  1J2X A;  1ORK A;  2E36 A;  1I8D A;  1MZB A;  1HXD A;  3W3C A;  4FTH A;  1ZRC A;  3QYB A;  3GME A;  1TW2 A;  1KK3 A;  2B7C A;  2LC2 A;  3EQO A;  3RPU A;  4AD9 A;  2CK3 A;  1T56 A;  3F22 A;  4HF2 A;  2GOM A;  3AG4 H;  4OZY A;  2Y31 A;  2BM5 A;  1ZH5 A;  2AS5 F;  3ECH A;  3LSM A;  3PFI A;  1HST A;  1O8D A;  4EM2 A;  2CQK A;  4HBL A;  4RD4 A;  4YHB A;  2W6I A;  3V4G A;  1L3L A;  2BYV E;  1FOK A;  4PDK A;  5ILU A;  1GXP A;  3ES9 A;  4PJN A;  2CF4 A;  1MJA A;  4HX8 A;  2L7K A;  1MMA A;  5J1R A;  2QEX I;  1D0Z A;  3J7Z I;  1FDR A;  2JMW A;  2IW5 A;  3W6J B;  3ZMV A;  5GAD J;  4PK4 A;  1N06 A;  1K73 D;  2HWV A;  5HZB A;  1W7P D;  1B1B A;  3QQA A;  3OYK A;  1WXR A;  4B47 A;  2IP2 A;  1IN4 A;  3NAU A;  4IHS A;  3PL8 A;  1FSE A;  1I7P A;  1PJ7 A;  3LMW A;  3I59 A;  4F91 B;  4MEX F;  2VBT A;  2K5C A;  1TWC J;  1ON1 A;  1DQU A;  4LBW A;  5A8A A;  3EQN A;  1XDS A;  2BM7 A;  2VJ5 A;  1S72 I;  1CLW A;  1GJR A;  1VHE A;  4OOS A;  3GFL A;  1Z7U A;  1UHS A;  3T8R A;  4XQF A;  5BQT A;  3FHN A;  1T8I A;  4PJL A;  5E3M A;  2CND A;  4NK8 A;  2BV3 A;  1QQ1 A;  1Y56 A;  2X4H A;  4G94 A;  1X1A A;  4X0G A;  3GZ6 A;  2XGJ A;  1IZ1 A;  2DTR A;  4PJM A;  2O17 A;  2XF5 A;  1R6R A;  2PIA A;  2XNC A;  3KCC A;  3S93 A;  2BZT A;  4HDU A;  3CDH A;  4Y13 A;  2ZTG A;  1S5L C;  4XID A;  3IRQ A;  3OSG A;  4OIO F;  3E1Y E;  3MN2 A;  4PUS A;  3CO6 C;  4B3X A;  4KMU X;  2QVO A;  1ZUN B;  4KKU A;  2IS4 A;  3CPW B;  4FIS A;  3ZGK A;  3NQO A;  2VZL A;  4P22 A;  3U6K A;  3BH4 A;  5J1U A;  2HDD A;  2B9S A;  2P6S A;  3I4N J;  1YX5 A;  3BTC A;  2ZSH B;  3IAS 2;  4DJA A;  2R7Z J;  1TQI A;  2UUZ A;  3EET A;  1IRF A;  2BW3 A;  3ONY A;  4RLZ A;  3OOC A;  2H6C A;  4KKT A;  1EP3 B;  5HOO A;  3PUF A;  1JGS A;  3BQJ A;  4OOI A;  3BG7 A;  1LEB A;  1JJ2 B;  2LKX A;  3S32 A;  1OCP A;  4UUS B;  4CA0 A;  2VBS A;  2DBB A;  3QOE A;  1G3Y A;  3PSS A;  1TQM A;  4ZJZ A;  1SKY B;  1ZM3 A;  1PE9 A;  1QA3 A;  1OIS A;  2XKP A;  1USS A;  4IQ4 A;  1G4D A;  4Y9R A;  5EEA A;  4EJO A;  3WND A;  2HS5 A;  3OY9 A;  4N9H A;  3SHF A;  3OZW A;  3HAG A;  2CUF A;  5D8L B;  2VYQ A;  2XGD A;  4FQG A;  3B8Y A;  3K4B A;  1QRB A;  1K6Y A;  2HNH A;  3FBN B;  2DFH A;  2GIV A;  1BHE A;  1BW5 A;  2DT5 A;  2K7L A;  2EK5 A;  4BH9 A;  1LE8 A;  1SD6 A;  3W6V A;  1KRH A;  1NHA A;  4D7N A;  1QA6 A;  4LBV A;  4DOZ A;  4P6V F;  2PMD A;  5B6I A;  1WHU A;  2LBF A;  4I99 C;  4A12 A;  3R6J A;  3K4K A;  1A5J A;  1XGN A;  4F3Q A;  1GHC A;  1UD5 A;  4DNC A;  4YZQ A;  5IK2 A;  1I27 A;  3P9I A;  1LKX A;  1X2N A;  2FSW A;  1VQ5 B;  4AVP A;  2KVO A;  1KQ5 A;  5FO5 A;  2YPR A;  5KW9 A;  2G0E A;  3WG7 H;  2KKO A;  4TMW A;  4ENK A;  4CCN A;  2QM3 A;  2JVH A;  1OR7 C;  4BU2 A;  4NK6 A;  3M8F A;  1B8I A;  4LJZ F;  1EA3 A;  5DM7 F;  3GTP J;  4IHX A;  1YS6 A;  2C77 A;  4KIB A;  4P26 A;  1UG2 A;  2HOS A;  2V7Q A;  1X4P A;  2YU3 A;  4PGH A;  3I71 A;  3LAP A;  3HSR A;  2XIG A;  2R7V A;  3I58 A;  5BSX A;  1JTA A;  3DKW A;  1FNC A;  4F7D A;  4GYG A;  1JKP C;  4LLN A;  3MZY A;  1FY7 A;  3J80 K;  3MKW B;  1IXC A;  3WGI A;  2KMU A;  1BOA A;  3E5Q A;  1A6Q A;  3LSK A;  1FEX A;  2CUJ A;  3WBK A;  4DK0 A;  1YRN B;  4ZGN B;  2ZZQ A;  1J9Z A;  2NNN A;  3S2H J;  1WTH D;  5KNL A;  2UVE A;  1OCZ H;  2BF4 A;  1G3S A;  2XAH A;  3SLD A;  1KD1 D;  2VXD A;  3T53 B;  5FNZ A;  3ZPP A;  3ZMD A;  1V55 H;  4OOV A;  2QEX B;  1ZRE A;  3VMV A;  2DYI A;  4BE0 A;  2COM A;  4LIV A;  2WY8 Q;  1W5C C;  2ID6 A;  2VBK A;  4UV9 A;  4JX6 A;  2LRD A;  4FK8 A;  1SAX A;  4M0L A;  4BEH B;  3HSE A;  1ETW A;  4UUS A;  4FX4 A;  1I6H J;  1WI9 A;  3GXO A;  3BJ6 A;  1E3Z A;  1SVM A;  4M53 A;  5L3D A;  4A2U A;  3Q39 A;  2LSO A;  4ENM A;  4IRI A;  1PDN C;  1LLW A;  2CW8 A;  5BNG A;  2WJY A;  3DBL B;  3KE2 A;  2JN9 A;  2F48 A;  4CCL A;  4P12 A;  4PJ0 C;  1L0O C;  5JLX A;  3NAR A;  5AIQ A;  2DER A;  2OZ6 A;  4XN0 A;  1P4M A;  1EKE A;  4IEJ A;  2KJC A;  5IYC J;  1UB9 A;  4A3J J;  2DCE A;  2GXG A;  4ZZD A;  1HF2 A;  2H6B A;  1H88 C;  3VWB A;  1K28 D;  1D8K A;  3OMY A;  3RSN A;  4YFO A;  2M8E A;  4OAZ A;  4FN5 A;  1Q86 D;  1F5T A;  3BPX A;  3FZV A;  1IDJ A;  2VFO A;  3CUO A;  1U78 A;  3B73 A;  3MZH A;  3JTH A;  3LQE A;  5HS8 A;  5BOX A;  1VQ6 I;  4P55 A;  4OJ5 A;  2LYC A;  3L9F A;  4XLP F;  2RNJ A;  1P2F A;  3QOP A;  3EUH A;  1P4W A;  1X1P A;  2X48 A;  2V9P A;  5J40 A;  3G71 I;  2E2I J;  4GO1 A;  2H1K A;  2VON A;  1IRZ A;  1ZKG A;  2C78 A;  3RPQ A;  4BGD A;  2FOW A;  1E3P A;  2CV1 A;  1D0X A;  1MMN A;  3ASR A;  4MIM A;  3HBL A;  4NQW B;  1JKQ C;  4I84 A;  2YWE A;  3TP0 A;  1P6R A;  3CLO A;  3KLO A;  1T33 A;  1YX2 A;  4BBS J;  4G6Q A;  2ZME C;  3L00 A;  1WRJ A;  5FO0 A;  4AIK A;  3EPZ A;  4A5M A;  2CW0 F;  1BR4 A;  5ICF A;  3SJP A;  2NVQ J;  4ENJ A;  3IH3 A;  4S04 A;  3PO3 J;  4BNC A;  1LVK A;  1BBY A;  3I59 B;  2UVF A;  4WZT A;  2LTP A;  2Y0M A;  4NC7 A;  3BOQ A;  3AVY A;  3CDL A;  4QHY A;  4EV0 A;  1NB9 A;  4A93 J;  2BGC A;  1PKV A;  4HNU A;  2BOL A;  4KKS A;  3OZV A;  3H5R A;  3DDY A;  1VQ8 I;  2X53 S;  2XVC A;  1YJW B;  3CC2 I;  4ZCL A;  3BC8 A;  5GTI C;  1V0E A;  2Z33 A;  4UV8 A;  1BPL A;  2K85 A;  2A5W A;  1B72 B;  3BR5 A;  1KQ9 A;  3FXQ A;  2V7W A;  3E1S A;  1HKQ A;  4RGU A;  4RD2 A;  2R7R A;  2F4O B;  4PZJ A;  4BXF A;  1SEU A;  5L3G A;  5M5X J;  4A3C J;  1FIP A;  4P2N A;  1DGW Y;  4HEA 2;  4R1H A;  4EVI A;  3RZD J;  4RMN A;  1YO5 C;  2CGP A;  3GQB A;  2QX3 A;  3WTW C;  2RQQ A;  3C7J A;  3P9K A;  2LK2 A;  4KUM A;  2WBM A;  4N9I A;  4MO7 A;  1IN5 A;  5DD8 A;  4A3K J;  3RKW A;  3NB2 A;  2VN2 A;  4NCN A;  2GQF A;  1OFM A;  2ESH A;  5EYR A;  3KEW A;  1ZQ3 P;  4TT3 A;  1W2B B;  5TR9 A;  3GTO J;  4NHJ A;  3CC2 B;  4ZYD A;  1ENH A;  2NS0 A;  3E6D A;  3HIF A;  4KDP A;  4X06 A;  3H0G J;  3ZZU A;  2DXI A;  2ID3 A;  3L7W A;  1P9Q C;  3ELK A;  4RAY A;  4FCY A;  3CC7 I;  2UXN A;  3RYR A;  2XF6 A;  3DXJ F;  1AKH A;  1GAQ A;  4RDK A;  3LAJ A;  2OV7 A;  4CQJ A;  1UMQ A;  3ERM A;  3JW4 A;  4X0C A;  1ZYR F;  3DV8 A;  1QGA A;  2DJN A;  2QN6 A;  2WPD A;  3ZZ0 A;  1F20 A;  2EBI A;  3I56 B;  4JQF A;  4E7K A;  1UHW A;  2KPM A;  3IHU A;  4AIH A;  3BNW A;  4RA2 A;  5TJJ A;  1O7L A;  3FMQ A;  3FKJ A;  4E7I A;  1I18 A;  3WGH A;  3ZXS A;  1VQN B;  3HG9 A;  1T5E A;  3GEZ A;  2BM1 A;  1W7P A;  4G7O F;  1HQC A;  2INV A;  4P6Y A;  2INU A;  5FKN A;  1MNM C;  1PYV A;  4M6X A;  3GVK A;  1ODD A;  4ZV4 A;  1BI3 A;  5E8I A;  4KFC A;  1AMO A;  2M3A A;  1AWC A;  4AM3 A;  4DNT B;  1X0C A;  1LVA A;  2MLG A;  2PYH A;  3RIQ A;  3B6C A;  4RDL A;  1EFT A;  5CKT A;  1YW7 A;  4K1X A;  2B7E A;  2XB5 A;  1JHH A;  1UHM A;  3FDY A;  3UNG C;  1X1D A;  2J5P A;  4OPO A;  3WNC A;  2O8K A;  3GVL A;  2NAZ A;  1R5O A;  1FWZ A;  2XAU A;  2AXT C;  1G6N A;  1KMH A;  2EV5 A;  3U1K A;  4HLX A;  5CPR B;  3RKX A;  6PAX A;  3WTY C;  4LC0 A;  2L5Q A;  1OOC A;  4M3B A;  4KT5 C;  3FJO A;  2ZNZ A;  3HGG A;  3J7A Y;  1B2R A;  3Q0V A;  2EA2 A;  4YAU A;  5EZG A;  2DMP A;  4A3I J;  3LOC A;  4RAG A;  2ZCW A;  1N05 A;  3LA7 A;  4JRA C;  3HHG A;  3HGY A;  5CQE A;  2V26 A;  4AID A;  1JHF A;  2NOG A;  1O8M A;  2HVQ A;  1BIA A;  4Q4Z F;  2LR8 A;  4Z2Y A;  4RBO A;  3L2C A;  2R7W A;  2PMH A;  3CMA I;  2V9V A;  3U2R A;  4Q48 A;  4Q7J B;  2JPB A;  2VBZ A;  3K7A J;  3RKQ A;  2VFN A;  1ERD A;  4Z4S A;  1K4T A;  1MD0 A;  2TRT A;  3EYI A;  3GTJ J;  2K86 A;  2R7S A;  1VQM I;  1JXS A;  3R61 A;  1N8R D;  4QTR A;  2ZBV A;  1QHG A;  5H6R A;  3OYH A;  3OFN A;  1XFO A;  1K4S A;  3B6A A;  3AGQ A;  4Y9U A;  1DDI A;  3GTK J;  1UCR A;  1NRK A;  4LIU A;  1S4M A;  1YRN A;  1SMT A;  3A0B C;  5FFZ A;  1QZY A;  3BR2 A;  3OW2 B;  2OK8 A;  2IS6 A;  5FLX Z;  3ECO A;  5IOY A;  3HOV J;  4I6Z A;  3VSK A;  4Z4U A;  3W2W A;  1KA8 A;  2ZL5 A;  2X1D A;  2JSP A;  4RM3 A;  1RRJ A;  4ROX A;  2ZXI A;  2HZT A;  1N0U A;  2XRL A;  3KEY A;  4BAY A;  4EM1 A;  4ZYG A;  4C2U A;  1OGI A;  1W34 A;  2BW3 B;  1UMK A;  3V7R A;  4ZCM A;  5H2F C;  5IPA A;  3BTJ A;  1O7F A;  3O8H A;  4M3F A;  2VE8 A;  3GF2 A;  2DMU A;  1WZ2 A;  2ME6 A;  3C2H A;  4W8T A;  3I64 A;  1S0U A;  2X8K A;  4M9Z A;  2LP0 A;  4U87 A;  2CS3 A;  1TNT A;  2YWG A;  4PCQ A;  2DOG A;  3F6V A;  2ICW G;  2QQB A;  1M90 D;  3DLL F;  1K6O A;  3ABU A;  1JA1 A;  2CMP A;  2MLK A;  1L1I A;  4DZJ A;  3K0L A;  3CDI A;  4M3D A;  2XGC A;  4KIG A;  5LMZ A;  1JRG A;  1K4Z A;  3A03 A;  1IB4 A;  1MH4 A;  3HPH A;  2XPW A;  2WAQ A;  4E70 A;  2IGN A;  1HF0 A;  2BVL A;  3I4M J;  3ASQ A;  3PIO F;  3Q6R A;  4XOT A;  5FFX A;  3CJT B;  3NAW A;  2FNA A;  2KIF A;  5F04 A;  1YIO A;  2Y75 A;  3OSF A;  2HGC A;  2NPF A;  3VSV A;  4WK8 F;  1HW2 A;  4BJ6 C;  2JRM A;  2E1N A;  4V02 C;  2CU7 A;  1N08 A;  3MMP A;  2XDV A;  3E5U A;  2R7D A;  3P7N A;  4LIT A;  4XLF A;  4P96 A;  2PE3 A;  4NBS A;  1H8E A;  5B5E C;  1A36 A;  3BPV A;  2BM6 A;  5FIU A;  1NDH A;  1SD4 A;  4KT6 A;  3A8K A;  1UEL B;  1QNT A;  5ICE A;  4KH3 A;  4PSW A;  5F6F A;  1WJE A;  3TW6 A;  1N0V C;  2D3N A;  1T6S A;  2LY9 A;  3WGG A;  3VYU B;  3JU4 A;  4LK1 F;  5FRO A;  5CYV A;  1EXM A;  4UZF A;  1ZG3 A;  1C0W A;  1UD6 A;  4YXW A;  3K69 A;  1IC8 A;  2HOE A;  2BY3 A;  2P6T A;  3P26 A;  3CMY A;  3GTL J;  1WP6 A;  1P92 A;  1S7O A;  1F60 A;  2CG4 A;  1FNB A;  3FPP A;  3TO7 A;  4CGZ A;  4Z05 A;  1VTN C;  4PC6 A;  5HDG A;  4ZGQ B;  2XSD C;  1ZGJ A;  2A68 F;  5ILS A;  3DTE A;  3RCO A;  3CME I;  4U9U A;  1VQK B;  2XT2 A;  2IAI A;  3C18 A;  3A8I A;  3OEH A;  1DBG A;  2KT0 A;  2EFN A;  1DAR A;  1QUF A;  5HLH A;  2R9V A;  2L01 A;  3ZQF A;  2BE5 F;  1VQ7 B;  2PMU A;  2XOK A;  1B9N A;  3ZPL A;  1V5G A;  1ZTR A;  1NK3 P;  4Z4V A;  1V4R A;  4UB8 C;  3ZR8 X;  3JSP A;  3CCQ B;  1X3W B;  1KU7 A;  1G7C A;  3I9V 2;  3QSY A;  5HS7 A;  5IYN A;  5E1W A;  1D2E A;  3GO5 A;  3OYC A;  3D0S A;  4HA8 A;  3I4P A;  4GGG A;  1ZGA A;  1R5H A;  1T2K A;  1JGG A;  2B0R A;  4E4H A;  2DFE A;  1W0T A;  2GAU A;  1HLV A;  2D1H A;  3CUQ C;  2FOK A;  1W36 D;  1RKW A;  3F21 A;  1RQP A;  4C2T A;  2QXZ A;  2MC3 A;  2W85 A;  1QU3 A;  1RET A;  2ZJR F;  2WC2 A;  5DS0 A;  3WE2 A;  1YJ9 B;  2F1L A;  3MD2 A;  2Z5U A;  2H8W A;  1UAA A;  1EF4 A;  1G2H A;  3V7C A;  2F5V A;  4IHT A;  3ZUG A;  4HW0 A;  2Q6O A;  2ZZG A;  4KIF A;  4BDZ A;  3AL0 B;  5DTD A;  3GFI A;  1W87 A;  4ZC3 A;  2HKX A;  1M1K D;  1KYZ A;  4XKW A;  2OBT A;  4HX4 A;  1X3Z B;  3QOD A;  2BY2 A;  5AN9 A;  2ZSI B;  3VNU A;  3LA3 A;  3H3Z A;  2X0K A;  3ZBT A;  1E0E A;  1F9N A;  4UVA A;  4XM3 A;  2R0Q C;  2IRF G;  4OPS A;  2MW8 A;  3TED A;  4RPD A;  4A69 C;  3OYI A;  1N75 A;  5H6Q A;  3O3K A;  3ASN H;  3CF5 F;  2FX0 A;  1I6X A;  2UWM A;  4UZE A;  3CW2 A;  1HW1 A;  1OCO H;  1Z91 A;  5JVT A;  3D26 A;  1XSV A;  1WU8 A;  4KN4 X;  1Z9C A;  2L9R A;  1BJA A;  3CP8 A;  2VNH A;  3BWG A;  4G6D A;  3GZN B;  3G6E I;  4CH7 A;  2H09 A;  1WJC A;  2HMA A;  1VLY A;  2XAG A;  2E1M C;  2EV6 A;  3E7L A;  1T6X A;  2MH2 A;  4RCY A;  1YI2 I;  4XLA A;  3GTM J;  1JI8 A;  4WZE A;  1V0F A;  1B23 P;  3KP7 A;  2K9S A;  4QPO A;  2GWR A;  3DBH B;  2A6T A;  4MFE A;  1IUY A;  2D2W A;  5CVU A;  2KDZ A;  4YFN F;  3WYA A;  2RRE A;  5IT3 A;  1HA8 A;  4YAF A;  1OCC H;  2PJR A;  3RIR A;  1WJA A;  1R9T J;  1O8I A;  1FOX A;  4XN3 A;  1EFR A;  2CBX A;  3HKZ A;  2BXZ A;  4XKB A;  2H94 A;  2AXL A;  3ML3 A;  3FBI B;  4BUP A;  4X7D A;  1GAW A;  2XAF A;  3QRF F;  3TOA A;  3VSU A;  2DOA A;  5ICC A;  1QA1 A;  2CV2 A;  2HVS A;  3QPS A;  1JTY A;  4BQO A;  4CZZ A;  5J3L A;  4O3M A;  4AYB A;  2R7T A;  3BG9 A;  2LKS A;  1JA0 A;  5IYB J;  2C5B A;  2XZO A;  1FRQ A;  2BPO A;  3W2I A;  1WSR A;  3KEQ A;  3JRE A;  2FUG 2;  1MSF C;  5B66 C;  2VT2 A;  3CXC B;  1OYY A;  3P5J A;  4OIP F;  1GDT A;  4G12 A;  2DCU A;  4PFP A;  4TKO B;  4ACB A;  4G7W A;  1U2R A;  2XAJ A;  1WJF A;  2NVT J;  1QFY A;  2A5Y B;  2O1D A;  1W1W E;  1VJS A;  1MGT A;  5DN6 A;  1IV6 A;  1HKT A;  4EJU A;  3K9T A;  1EWY A;  2BVN A;  5A88 A;  2PG4 A;  3SQN A;  2WV0 A;  4MHG A;  4G6T B;  2Y0S N;  1VF9 A;  1RZ4 A;  3O2P E;  5KK1 A;  2A69 F;  2DMN A;  3GW2 A;  1FTT A;  2BGI A;  5H5J A;  3CQZ J;  2LF8 A;  4B4C A;  3S8P A;  2X9D A;  1B6A A;  2GJK A;  3BY6 A;  1QVG B;  2ZXH A;  3G1L A;  2O7O A;  1GLN A;  1U6G A;  1VND A;  4LG3 A;  3RYP A;  4WZL A;  1VQ7 I;  1PJ6 A;  2O03 A;  3S15 J;  2Y0S A;  1LPQ A;  3PUN A;  1ITY A;  3CES A;  1QJV A;  1P7I A;  2E5Z A;  3M07 A;  1TQP A;  4HF0 A;  3G71 B;  5L3E A;  3AG1 H;  3VO1 A;  4EMS A;  2G9W A;  3OYM A;  2E34 A;  1YJN I;  4Z1M A;  4DZP A;  4YDT A;  4DYC A;  3W2A A;  3RTR A;  3U21 A;  2NT6 A;  1TW3 A;  1ZM4 A;  4QVJ A;  3ROU A;  4G5G A;  1D1B A;  1Z7L A;  3PQJ A;  4PJJ A;  4CYC B;  3J81 K;  1OLT A;  1PP8 F;  1H0M A;  4J01 A;  1VQ5 I;  1MMG A;  2V31 A;  2L4M A;  4WX9 A;  4P3Y A;  5EF6 A;  2TDX A;  3S16 J;  5E20 A;  2WSS A;  3FXU A;  3H9Q A;  4OM9 A;  4MTD A;  3ULQ B;  3G3Z A;  1AA7 A;  1O8L A;  4F52 A;  2R7O A;  2E2J J;  5B1A H;  1TL8 A;  3A0H C;  4RGS A;  2P5K A;  1IXR C;  2B63 J;  5C1E A;  2VB6 A;  2DA1 A;  1AIP A;  1LFU P;  5J8C A;  1BI1 A;  2STW A;  1ZAR A;  3V8K A;  4XRS A;  5JLW A;  5LEJ A;  1HC8 A;  1R36 A;  2YWF A;  1VQ8 B;  4M9X A;  4HE5 A;  1MKM A;  3DEE A;  2Z99 A;  2EZH A;  2RC5 A;  3T8T A;  3B78 A;  1KYW A;  1OMI A;  2KIQ A;  2J8K A;  2OJE D;  5F64 A;  4U0Y A;  1YTY A;  1Z1D A;  5TV2 A;  2J5O A;  4OP7 A;  3WY9 A;  1DDG A;  1IRG A;  4FWT A;  3VYT B;  4BL0 B;  2G7U A;  1HDP A;  2QBY B;  3OYD A;  3FK7 A;  3AST A;  3BY1 A;  2NXN B;  3BDD A;  4MQ9 F;  2M1B A;  3L2Q A;  4BAC A;  3ZMS A;  2X6Y A;  4D7M A;  1ZK8 A;  3KP6 A;  2V7X A;  4ZZL A;  2QQ9 A;  1BC7 C;  4YAW A;  3CD6 B;  4U49 A;  4LFU A;  3KYD B;  2BY0 A;  3N05 A;  4ANJ A;  4B48 A;  3Q5F A;  1UD3 A;  5F4O A;  3LSJ A;  2ECC A;  4MYU A;  5K7H A;  2GQQ A;  1S7E A;  3K4J A;  3KP4 A;  4XOR A;  4ETS A;  3F3X A;  1KZH A;  5D4S A;  2V6E A;  1E3O C;  1IGN A;  3D5S C;  3S3O A;  2XF7 A;  2EFG A;  5GTH C;  2CQN A;  2B0L A;  3KPH A;  1UD8 A;  1CNF A;  2Y69 H;  2DN0 A;  3LL7 A;  1FX7 A;  3LNQ A;  2W48 A;  4D0P A;  5J6X A;  4Z03 A;  4B44 A;  5CVR A;  3AVT A;  2F5F A;  2F5D A;  3JRF A;  1MBH A;  2HI3 A;  1VQO I;  1JT0 A;  2JA6 J;  2HTJ A;  2R7Q A;  4ITV A;  2FVG A;  2DT7 B;  1N25 A;  1REP C;  2ADU A;  5C1C A;  2CFX A;  2V1X A;  1BW6 A;  2LY2 A;  2W25 A;  3SJM A;  1K79 A;  2W6J A;  2VJJ A;  3OS0 A;  1TWH J;  3REO A;  1G8X A;  2XAQ A;  3SXY A;  4B4D A;  2OBR A;  2E7X A;  2GXB A;  3BZC A;  3CLQ A;  2PYG A;  2VFQ A;  3VO2 A;  1JJ8 C;  3AFH A;  1DU0 A;  1QGP A;  4ZCI A;  3Q0W A;  3OJW A;  5HLI A;  3W2V A;  2C2W A;  3T0Y A;  4G7H F;  1YHQ B;  1WJ5 A;  2JRT A;  1DPR A;  4CZC A;  1O3R A;  1IJF A;  1XMA A;  2DQL A;  3FPK A;  5IYR A;  2AHQ A;  3F6O A;  2DW4 A;  2JPC A;  1I50 J;  1XGO A;  2RN7 A;  1WSU A;  5F1R A;  4HV5 A;  4XLC A;  3X2Q H;  1IJW C;  1M1E B;  2GJP A;  4PAB A;  3ZN1 A;  3ZN0 A;  3M8E A;  4ESB A;  4B3G A;  3JRH A;  3G4S I;  4XMY A;  5HS9 A;  2MD0 A;  3IH4 A;  2K9Q A;  4I7H A;  5DYM A;  1FP2 A;  2OAZ A;  4ZYH A;  5D5U B;  1X1C A;  3WTV C;  1A31 A;  2QMU A;  2L4A A;  2XZP A;  5LLQ A;  3V7S A;  3OYL A;  3KFW X;  3OOU A;  1TWF J;  3CZ6 A;  2B5O A;  2X1C A;  1K61 A;  1FT9 A;  2QTZ A;  2V5I A;  2HZD A;  5J4V A;  4Y17 A;  1JUM A;  3RY8 A;  2JSC A;  3LFU A;  3QU3 A;  3U6B A;  1QCX A;  2TCT A;  3SFZ A;  3C2G A;  2L7F P;  3WU0 A;  3I55 I;  1VQL B;  2FD5 A;  2X3U A;  2XZL A;  1X4O A;  2VFP A;  3HHH A;  3I0T A;  1V5E A;  2HQA A;  3QPT A;  2F1M A;  3HUG A;  4IW3 B;  3WTU C;  5ERI A;  2FEZ A;  3AG3 H;  2RC4 A;  5FRM A;  2HQR A;  4RS8 A;  3WHC A;  2O0V A;  1NJI D;  2CFO A;  3PNY A;  2BSP A;  2PN6 A;  4HST A;  1OJL A;  1ZR2 A;  2QKM B;  1D0Y A;  1R7J A;  2NV4 A;  4LLL A;  1YIJ B;  4E7J A;  3CCV B;  3ONQ A;  3CCY A;  1Z05 A;  1ZM9 A;  1KTW A;  2MGQ A;  1BX1 A;  1TYU A;  1HA3 A;  1U8R A;  1J5Y A;  1BMF A;  3KP2 A;  1QHH D;  3OW7 A;  1AU7 A;  1KU9 A;  3S1M J;  2HLD A;  4M1K A;  1TSP A;  4DQ2 A;  3K10 A;  3HOZ J;  1LDK B;  2GOX B;  3GIR A;  3IH2 A;  2DA6 A;  2GJR A;  2XUB A;  4U0W A;  3JQR A;  3RQI A;  3CUQ A;  1OYI A;  2FBH A;  4A3L J;  2JJ2 A;  5A89 A;  3G05 A;  1VQL I;  2VKE A;  2NS8 A;  5LHG A;  4LG0 B;  3GVJ A;  3H9N A;  1Q1H A;  1WCM J;  3J7Y J;  1B8I B;  2Z2S B;  3JAM Z;  1YI2 B;  1JT6 A;  1MW7 A;  2ZME B;  2EA4 A;  2P7C B;  2OTL B;  1LLZ A;  5E3O A;  3OS2 A;  2JK3 A;  2L02 A;  4ZYE A;  4X05 A;  2NNY A;  3WE3 A;  1SAN A;  2VC1 A;  2GIZ A;  3BC9 A;  1S9H A;  2L9N A;  2R5Z B;  2FX3 A;  3FKI J;  2W4S A;  3R0J A;  1IA5 A;  4XK4 A;  1OFD A;  2YS9 A;  1TYV A;  3HRU A;  2CW7 A;  3U1D A;  5K5R A;  2D45 A;  3A3G A;  2HOA A;  3N90 A;  2ZXW H;  4P3I A;  5HDN A;  3JRG A;  1R4M B;  2EQR A;  5EMN A;  2D5V A;  3W5H A;  3VOD A;  2OBP A;  1KZL A;  3Q6Q A;  4YIF A;  4R71 A;  1KQ0 A;  4Z4Y A;  2XPV A;  2QTL A;  4G7X A;  4YRV A;  3SUC A;  3KET A;  1B59 A;  1JKR C;  3DPT A;  3VOE A;  4JP0 A;  4HV6 A;  3FIW A;  1WFX A;  1QH0 A;  2M4K A;  4BY1 J;  3OKX A;  3HOU J;  4XD7 A;  1K78 B;  3ML6 A;  1D1A A;  1LM1 A;  2VKD A;  1BLI A;  2OYN A;  3B4N A;  4G8X A;  3HL2 A;  3CCM B;  4U0V A;  2C4T A;  4C3H J;  5JI6 A;  1WKM A;  3KP5 A;  3FWE A;  1Q7Y D;  3QFT A;  4E7L A;  2PJR B;  4X7E A;  2HXO A;  1SAU A;  2ZO4 A;  4M73 A;  2VXZ A;  1ZG1 A;  3EUK L;  1HBX G;  4L0Y B;  4HIZ A;  5E8G A;  1LE8 B;  5FLM J;  3IUO A;  1FYM A;  2WAE A;  3OYB A;  2KQR A;  2FBK A;  1BN5 A;  4FX0 A;  4A0Y A;  4XOP A;  4ZTJ A;  4RDJ A;  3QP5 A;  3UKG A;  1BJZ A;  3DU5 A;  4ZDP A;  3ZQL A;  4C2L A;  2ODL A;  4A6D A;  1J75 A;  1ON2 A;  1KK2 A;  3CCQ I;  3PVD A;  3A35 A;  4P9U A;  4LBY A;  4FXU A;  1O3S A;  5LGU A;  3WXM A;  5E1X A;  2XV4 S;  1VFC A;  4QPQ A;  3JRI A;  2FU4 A;  2IGK A;  3GCM A;  3I5U A;  3I56 I;  2KRF A;  3W6K B;  5DM6 F;  1TNS A;  1KU2 A;  3ZQG A;  2Y48 A;  2CC2 A;  1FMV A;  3H3U A;  2NOJ B;  2BHZ A;  3N4M A;  2E2H J;  4UY8 I;  4RJL A;  1N77 A;  3CPX A;  3TO6 A;  3VST A;  4II3 A;  3COA C;  1O8E A;  4URR A;  4RM2 A;  4YEI A;  1F1Z A;  3L2R A;  2QA4 I;  2PFB A;  4B3A A;  4ZTF A;  4C3J J;  2W57 A;  2GZW A;  1Y0Y A;  1OB0 A;  3LO8 A;  3ZQC A;  3CC4 I;  1RC9 A;  4Z6Y A;  2QLZ A;  1XB2 A;  2NT9 A;  3FXL A;  5KVR A;  4P5O A;  1GVD A;  2Z1D A;  3G73 A;  5ILV A;  2CYY A;  1AOY A;  1G7R A;  4D1Q A;  5FD6 A;  1VQ6 B;  2CWE A;  3DBR B;  3I55 B;  2QF7 A;  1GUU A;  3CJQ B;  3Q0U A;  4A5N A;  2XAS A;  3LSR A;  1LJ9 A;  1MJ9 A;  1QBJ A;  4YCQ A;  3OJX A;  1WPC A;  2EIN H;  4BS9 A;  2HDN B;  1FJL A;  3S3M A;  2OU2 A;  1J9I A;  3TDU C;  5AMV A;  5LGT A;  3W2H A;  2EPF A;  3HRS A;  2X6O A;  2DDB A;  3CCM I;  1PP7 U;  5M3M J;  4BEH A;  2F4N A;  1WQ2 A;  5ED4 A;  5E79 C;  3FHZ A;  5DCM A;  2FML A;  1ZG5 A;  3KL9 A;  3F8M A;  3PM1 A;  4CCO A;  2MAB A;  3JUR A;  3OV8 A;  2VKV A;  3IRR A;  1SFX A;  4Y3O A;  1DUX C;  2GRE A;  1XMK A;  3OE7 A;  3E3V A;  2LD5 A;  4MLO A;  1LFP A;  2EZL A;  1YJ9 I;  3VEP A;  5KSW B;  3PET A;  3WNB A;  2DYS H;  2E1R A;  2P4W A;  4AC0 A;  5IYD J;  2HOT A;  3FXK A;  2OD5 A;  5KAI C;  5JR3 A;  3OYE A;  4LB6 B;  4I09 A;  5FL7 A;  3U2Q A;  4YZA A;  2O8X A;  2ZJQ F;  4AWX B;  1R5G A;  2X85 A;  2KRC A;  2DTZ A;  2KRH A;  5LHH A;  2CRV A;  1MBK A;  3S2W A;  3OYN A;  1ZN2 A;  3BJO A;  2MSY A;  2FRH A;  3M9A A;  4OPW A;  4CCJ A;  5FD5 A;  5K7F A;  2LZJ A;  4L9N A;  4WQM A;  3H5A A;  4PGG A;  5DDG A;  1E1Q A;  2ZZE A;  2KLO A;  3BZ6 A;  2DPD A;  1TBX A;  2QEN A;  2AO9 A;  1OCT C;  1CQX A;  2E19 A;  3I54 A;  3PSI A;  4D9J A;  2P5L C;  4EQQ A;  5GAG J;  1E17 A;  3IV5 A;  4WF2 A;  2STT A;  1FRN A;  1QVF B;  4XSZ F;  2VKH A;  4NQW A;  3K70 C;  2NYX A;  1BA5 A;  3QPL A;  3MMY B;  4RD0 A;  2KIM A;  5DSZ A;  1B4A A;  1MJB A;  3HTS B;  1N07 A;  1QUE A;  2BEO A;  2JA2 A;  3SQV A;  1E64 A;  1IHM A;  2XTY A;  3SZP A;  1V3F A;  5HDK A;  2MA3 A;  4CHU A;  2QGG A;  3TP3 A;  2P7V B;  4HSR A;  4YAL A;  2BY1 A;  2AQE A;  2BBY A;  3PUB A;  3VSL A;  3BP8 A;  1H8H A;  2GK6 A;  3E0J B;  3G2B A;  2DLL A;  5KAF C;  1S3J A;  3OYG A;  2LKP A;  2H27 A;  1Q82 D;  1J59 A;  5EDN A;  5DV5 A;  1TT5 B;  1IN8 A;  5LHI A;  1HCR A;  1VQN I;  1XSX A;  4DGW B;  3OP1 A;  4W1U A;  2GBY A;  3TDZ C;  2Y2Z A;  1E63 A;  4WXD A;  1IDZ A;  1VI0 A;  1VQ4 I;  3SDB A;  1MDM A;  2B7B A;  3HOY J;  2IOU G;  2HEO A;  1YLO A;  4XRF A;  3R6S A;  4LGW A;  1PXZ A;  5IP7 J;  2Z8G A;  3ZQ7 A;  2QYO A;  3N6Z A;  1KQS B;  4OJO A;  2NVY J;  2W24 A;  4JK1 X;  4CYC A;  1JB9 A;  2DMT A;  4M3G A;  5IYQ A;  1H80 A;  4OJ6 A;  2GM4 A;  2Q8K A;  3LA2 A;  4IZZ A;  3A4C A;  1IDY A;  1PLU A;  4BQQ A;  1E62 A;  5FA6 A;  2K3F A;  4W8R A;  4PC1 A;  3KLN A;  3CTA A;  4QWQ A;  3ZSC A;  4A0X A;  4G9Y A;  2EJR A;  3IL2 A;  3OL4 A;  2F3L A;  2F4I A;  2R6H A;  4ENN A;  2PJP A;  3OR2 C;  2ZKZ A;  4M71 A;  3OOP A;  3TO9 A;  2YU9 J;  3PFY A;  1K8A D;  1MMS A;  1MND A;  3KZY A;  2O6W A;  1OPC A;  2IBD A;  4NB5 A;  4HRI A;  4ZDO A;  5B1B H;  3SKB A;  1VQ4 B;  3ZMT A;  1Z3X A;  4WCG A;  3PO2 J;  2LVS A;  1WPK A;  4AVZ A;  3WU1 B;  2XNJ A;  2NTB A;  3BZK A;  5IYP A;  1TWA J;  1GQ8 A;  1KQ8 A;  1GVJ A;  2BGJ A;  4P1W A;  5THX A;  4ASU A;  4BPR A;  4X07 A;  3DLA A;  3U9G A;  5DS9 A;  1ZHF A;  2HPM A;  2JQ7 A;  1IG7 A;  4BHB A;  2O9L A;  4BQA A;  3MEX A;  1ETX A;  2Y9Z A;  1QRC A;  4RB0 A;  3PIP F;  3L2W A;  4B8X A;  1TC3 C;  2O61 A;  2NRA C;  1UD4 A;  2AQF A;  4W97 A;  3GYH X;  3G4S B;  2EIK H;  1QFZ A;  1RMG A;  1E2X A;  4LOC A;  1W0U A;  1D5V A;  1X19 A;  4IKF A;  4I2O A;  3GQ7 A;  3W5U A;  4C43 A;  4MR0 A;  3OEE A;  2VBE A;  4RLQ A;  3BG3 A;  4F7Z A;  1X58 A;  4V2G A;  3V42 A;  2PI0 A;  1ETK A;  3DU6 A;  3EUH C;  3BCF A;  1T6Z A;  4XLN F;  1WH5 A;  3BR0 A;  2BHY A;  3R0A A;  3ISP A;  3UR3 C;  4W8S A;  2EZK A;  3D5R C;  1ULY A;  4DIQ A;  3FIS A;  5J3O A;  3FMS A;  4IX7 A;  5D5W B;  3G1O A;  1CNE A;  3I1F A;  3ZQQ A;  5LGN A;  5HNF A;  5LFA A;  2JA5 J;  5HXB A;  4A0Z A;  2GA2 A;  1VQK I;  3GTQ J;  1O3Q A;  2IEK A;  1FNN A;  3SZT A;  3E6C C;  3QU6 A;  2XTW A;  2DPU A;  2FJ1 A;  2IXS A;  3CCR B;  1G59 A;  2EFP A;  3WHB A;  2D9R A;  2M45 A;  3FM5 A;  1R23 A;  2Q6I A;  1TWG J;  4OJL A;  3H1C A;  2BXY A;  3S1N J;  3FM3 A;  3SZG A;  3TL4 X;  4I98 B;  3JCU C;  3KZI C;  4UAJ A;  5DNS A;  1IUF A;  4BBR J;  2VAS A;  4J00 A;  2YR2 A;  2F5E A;  4A6E A;  4TMV A;  2GK7 A;  2VIX A;  1GXQ A;  1MRZ A;  2HQ5 A;  3KYC B;  1TT0 A;  2FA5 A;  4E7Z A;  1A6I A;  1R5I D;  3LQQ A;  2ZME A;  4G1V A;  4EH1 A;  2QSG X;  3CB4 A;  1D5Y A;  3OIO A;  3FXR A;  5D8K B;  1QZZ A;  4KIS A;  4OIR F;  3VYS B;  2Y9Y A;  3JQP A;  3P4G A;  3SYJ A;  2HVR A;  3G6E B;  3SDG A;  1HZE A;  1OR7 A;  3Q3A A;  1J09 A;  2J7K A;  1NB0 A;  3Q9S A;  2QQ8 A;  4UVC A;  2I10 A;  4XRM A;  1WOO A;  1W5S A;  1G7S A;  3HC7 A;  2QSH X;  4RLF A;  4GRI A;  1K7A A;  1I39 A;  1HOM A;  3DEU A;  3LSG A;  2OTL I;  1CF7 B;  5LBQ A;  5E3N A;  5JFR A;  4AF6 A;  3ZMU A;  4HX7 A;  3NWT A;  3CD6 I;  5D6E A;  1KC8 D;  1XTA A;  3VFZ A;  4PGO A;  1T0F A;  2OTJ I;  2EH3 A;  2ZJ2 A;  1DP3 A;  2A07 F;  2VUM J;  2L7M P;  4E6K G;  3HM5 A;  1EH6 A;  2MG4 A;  2VQG A;  3FXO A;  4O6J A;  1CZF A;  2J8I A;  2I1L A;  3FX3 A;  3K2Z A;  1ZAO A;  3NWS A;  5DUI A;  2IS2 A;  3A8J A;  5F4J A;  2ZBU A;  4WWV A;  4QV2 A;  3RPU D;  1K83 J;  3E97 A;  2VJ4 A;  1E3X A;  2QA4 B;  1YFH A;  1HDD C;  1RQR A;  1SVO A;  2CQX A;  3F8B A;  5BS6 A;  2XND A;  4XSX F;  5L46 A;  4E0F A;  3HXL A;  1S6L A;  2XSJ C;  2OUM A;  3WTZ A;  2OCE A;  1DG1 G;  1OFL A;  1VQO B;  4R8H A;  4MTE A;  2EV0 A;  2XHK A;  4U7D A;  3CCL I;  1H89 C;  3QP6 A;  3LSP A;  2LBF B;  1I3A A;  2IA1 A;  2KFD A;  3F8N A;  1FYK A;  2NTP A;  2K02 A;  2QZ8 A;  4C0S A;  1BI2 A;  1R71 A;  3T9G A;  2VL8 A;  1Z3Y A;  3HYI A;  2IS1 A;  1OGJ A;  2BVM A;  3D5L A;  2M7B A;  2XRN A;  1XN7 A;  2MH9 A;  3ASP A;  3JSO A;  1W36 C;  2HTS A;  1KK1 A;  2WYR A;  2K27 A;  4II2 A;  4HAM A;  4G1B A;  3FKS A;  1T95 A;  2EZI A;  3GQ9 A;  4N4O B;  3CCE I;  1SFE A;  2ECB A;  3E20 A;  3MWM A;  2VPL A;  4IHW A;  3IKT A;  1YIT I;  1JKO C;  2DA3 A;  3L2U A;  2EFW A;  5AIP A;  5LRR A;  5FRN A;  2ZL7 A;  2I5U A;  2QE7 A;  3BR6 A;  4RB2 C;  1K5C A;  3IC7 A;  2HQN A;  2MYS A;  5CVI A;  1IDK A;  3ZP5 A;  2CSO A;  3E6M A;  4D5F A;  2EWN A;  4MXN A;  4Q5S F;  4PFO A;  1LDJ A;  2YUH A;  3GZ5 A;  4V2F A;  1ETO A;  2NVX J;  5IT9 Z;  1VF7 A;  4ASN A;  1OB5 A;  4W8Q A;  2VNI A;  3S14 J;  3MKY B;  3FXJ A;  3K70 D;  3O6B B;  3WWG A;  3QFS A;  2N8G A;  1SD7 A;  5K5O A;  2V7V A;  3LQR A;  4DBR A;  1B72 A;  3V8L A;  2ZFW A;  2DYR H;  1S7A A;  5GV7 A;  2C6Y A;  3WQZ A;  4Y33 A;  2H1L A;  2V9K A;  4KJZ A;  4XIC A;  1OYW A;  2M34 A;  4IHV A;  3BCD A;  4X7F A;  4MNU A;  3H35 A;  4J0Q A;  4RM0 A;  1VQP B;  4AIJ A;  2E71 A;  3M8J A;  4IJA A;  3J81 k;  4YC5 A;  1YS7 A;  4I01 A;  2O5R A;  1P4A A;  2WAF A;  2V7U A;  1DGR M;  4Z4W A;  2M7A A;  4XON A;  3TW7 A;  4IL6 C;  2E1M B;  2V1N A;  1D1C A;  4EW9 A;  4TV7 A;  3M3Y J;  1JNY A;  1WOS A;  1FOW A;  2HXI A;  2K4J A;  2YSR A;  5D6F A;  2KDO A;  4M72 A;  4X8I A;  1SFK A;  2WTE A;  2IT0 A;  1KGS A;  1R1T A;  4LMY A;  3HOT A;  1K8F A;  2QCO A;  3AVW A;  1LB2 A;  1SD5 A;  1X1B A;  1D8T A;  4LD5 A;  3K6G A;  1JJ6 C;  3EYY A;  1LNW A;  1D3Y A;  4BE2 A;  1NH3 A;  4IRH A;  1Z21 A;  5EJC A;  4P1V A;  3LQ6 A;  3DPL C;  5C3E J;  3LSH A;  1FND A;  3OYJ A;  1MBG A;  1R00 A;  1QQI A;  5HLG A;  1PVE A;  4IXA A;  1IRX A;  1W0K A;  1EE6 A;  2ISY A;  4CDG A;  3GFJ A;  1WMR A;  1MNE A;  1J7K A;  1YE9 A;  2RNG A;  4XL9 A;  4PAA A;  4HZF A;  4ZYA A;  3BCA A;  5DD4 A;  1RR8 C;  4N3N A;  4PC3 A;  1BQE A;  5EEH A;  1T08 B;  2ZTN A;  3KEO A;  2VBV A;  3LNN A;  3GBG A;  1VQ9 B;  2EFO A;  4AC9 A;  2FNP A;  5B3S H;  2YX4 A;  1HKS A;  5CJ9 A;  4BDY A;  4GQN A;  4B3F X;  3VDX A;  1FPQ A;  4S0H B;  3CF2 A;  2QZA A;  1V5V A;  4BHP A;  4CXF A;  2R92 J;  3AVV A;  1J0R A;  2M30 A;  4DW6 A;  2JDI A;  2A6E F;  4HYE A;  3CJN A;  5GPC A;  2WY7 Q;  2R5Y A;  3ABK H;  3OL3 A;  1XE1 A;  2DFF A;  1FP1 D;  1U5T C;  5HLT A;  2W7Z A;  1QA2 A;  1Y8R B;  2K4B A;  1FSH A;  2O04 A;  2QWW A;  3H9J A;  4U4B A;  3H5N A;  3WTX C;  3SY2 A;  4EGZ A;  2GPJ A;  3G1M A;  1QX4 A;  3OAA A;  2DET A;  1V5F A;  2UXX A;  3M7G A;  3TMO A;  4AYB N;  2OA4 A;  5M5Y J;  4BHC A;  4KIT B;  2JA7 J;  4JX4 A;  4DQK A;  3BG6 A;  4EGY A;  2L54 A;  4E7S A;  2R7U A;  2ESN A;  3MQ0 A;  3TH0 A;  2E1O A;  2CUZ A;  5TY0 A;  1MSE C;  2XRO A;  3BH6 B;  3W5V A;  4AUX A;  2BSA A;  4YEL A;  4F92 B;  4DYR A;  4H9G A;  4CUG A;  4B09 A;  3DFG A;  1XCV A;  3GQA A;  2G0Y A;  3EDP A;  3KYL A;  3CC7 B;  1OB2 A;  1O8G A;  1R1U A;  5LEK A;  3J80 Z;  1YIT B;  4IRG A;  3QE2 A;  5JLV C;  4QSH A;  3DPU A;  1BC8 C;  2CV0 A;  1NG7 A;  2V79 A;  3A1Y A;  1FOY A;  3H3V K;  1VZ0 A;  5GAE J;  3JR9 A;  1Y6I A;  2DOF A;  2E5N A;  3H09 A;  1KCD A;  4NNJ A;  1KK0 A;  3M1E A;  5BPD A;  2A05 A;  4F55 A;  2HDC A;  2JZY A;  1D1N A;  3HPG A;  3PEN A;  2W82 A;  2Z16 A;  1H9G A;  2FQ3 A;  2RV8 A;  4FE7 A;  1HVX A;  5CDF A;  1O88 A;  2R7F A;  4I76 A;  2ZXJ A;  1WOP A;  4OWR B;  4UXN A;  3V7A A;  1E43 A;  3H36 A;  4XRS G;  2ZZF A;  3HRT A;  3TGN A;  2LDU A;  2F43 A;  4EJT A;  1DBO A;  1U9O A;  1UST A;  4OU0 A;  3ZOB A;  5GP9 A;  3LSI A;  4A3B J;  4BXX J;  4RD3 A;  2A6H F;  1OHH A;  2Q6L A;  3EUA A;  4YZX A;  2A61 A;  3V8J A;  1AIR A;  3HUG B;  5JHU A;  4WXC A;  3S17 J;  1BM9 A;  2WB1 N;  1JE8 A;  4BXU A;  1IV8 A;  5C4X J;  2A3S A;  4DQL A;  5EGO B;  1MH3 A;  3DP7 A;  1X3U A;  4AU7 A;  1XCB A;  3JAM K;  3B82 A;  4C3I J;  3ZIA A;  3DU1 X;  1ETV A;  1QPM A;  2VQH A;  1ZLJ A;  1Z6R A;  2L9V A;  2PX9 A;  4CO8 A;  1A8P A;  1O57 A;  3FF5 A;  5ICG A;  2R5Z A;  2VOP A;  4JMQ A;  2LNB A;  4QIW N;  1S72 B;  1MAB A;  1SVL A;  3WG9 A;  1XGS A;  4EJW A;  2QSF X;  3VB2 A;  5FJ8 J;  1G7T A;  2WJV A;  5HKK A;  2M2E A;  1GV2 A;  4YFX F;  4XR6 A;  5KCM A;  4XNF A;  1U2W A;  2EWE A;  1IN6 A;  5IP9 J;  2XKO A;  4L9J A;  1Y39 A;  1BOB A;  2M8G X;  2DA2 A;  4JOM A;  1ETY A;  3SYT A;  4KN7 X;  1WGX A;  3W2E A;  3AVX A;  5J1Y A;  3OS1 A;  1TYW A;  1ETQ A;  2HR3 A;  3JRA A;  3ZBU A;  1GVH A;  2Q1Z B;  1D8J A;  1IJE A;  2C4U A;  1KU3 A;  2KZG A;  2WWY A;  5H20 A;  3QFC A;  1YHQ I;  1EV7 A;  3DTK A;  1R49 A;  1P7J A;  3DWL E;  4PC7 A;  1KCC A;  1YW8 A;  3H9G A;  4B43 A;  2EIL H;  4GCV A;  1BI0 A;  3C1D A;  4M6Y A;  2WAQ N;  2EFQ A;  3CCR I;  2QBY A;  1TLH B;  4QUZ A;  2P8T A;  4BYY A;  3MVP A;  1YYV A;  1H8A C;  4CCK A;  3F8C A;  4G6I A;  2O6G E;  3QPH A;  1FMW A;  2W7N A;  1U0J A;  1T39 A;  1I5Z A;  3KP3 A;  1IF1 A;  2DT6 A;  3T1B A;  2GXA A;  2QY1 A;  1TVC A;  1EH7 A;  2CO5 A;  1W35 A;  3JRC A;  5M5W J;  2XGE A;  3KZZ A;  1RNL A;  4MGR A;  1EP1 B;  3I53 A;  2VBM A;  2XTX A;  3DCF A;  4OZZ A;  2QKL B;  2PEC A;  4N0B A;  2DOD A;  1XD7 A;  3LWF A;  2WR8 A;  2VLA A;  3PSF A;  3MZ8 A;  4NBQ A;  1DDN A;  4GDF A;  1OQY A;  4LBZ A;  3E5X A;  1RPW A;  1NG6 A;  1XG1 A;  4EEF G;  1QVU A;  2COB A;  3BR1 A;  4U88 A;  5EG0 A;  3JRB A;  2HKO A;  4ESF A;  2R7X A;  4YII A;  3NE5 B;  1UJ8 A;  3CCU B;  4CCM A;  2RC6 A;  1N78 A;  1EA0 A;  5EGO A;  4IO9 F;  4GFB A;  2BM4 A;  4BQN A;  4WXH A;  2QQA A;  2W00 A;  2UZK A;  2QUF A;  2VFM A;  1FLI A;  3ESW B;  4L9V A;  1BX0 A;  2JWT A;  2V6C A;  3CUQ B;  1Q1V A;  2WV1 A;  2NST A;  2F4M B;  3PA2 A;  2MFZ A;  3ONU A;  4RAF A;  3ZQH A;  2ACJ A;  1Y1W J;  2HCJ B;  4HF1 A;  5FO1 A;  1COW A;  4O5V A;  2VNJ A;  3FXM A;  1POG A;  3D1N I;  1ZR4 A;  1I1G A;  2IGO A;  3W2F A;  3K1M A;  2X6W A;  1FYL A;  2QDX A;  4A3D J;  4Z4T A;  3OR1 C;  4UUV A;  2WB1 A;  4RCZ A;  3MKZ A;  1RUN A;  1G3T A;  2YUS A;  1XQB A;  1IW7 F;  1T0F C;  2K3P A;  4CIC A;  2IA2 A;  4U7B A;  1BJK A;  5F27 A;  3ABM H;  5JHF A;  2GLO A;  1CQT A;  2NTQ A;  2XC1 A;  5CQG A;  1R5B A;  2XB0 X;  3IWZ A;  4P9F A;  2OQR A;  5GAH J;  4X7C A;  3BQZ A;  3KRG A;  2P81 A;  5E18 F;  1VQP I;  4C30 A;  1I3Q J;  1UD2 A;  4TMZ A;  2E1B A;  2NVU B;  2RAE A;  4OPV A;  5JBQ A;  3LJY A;  2ZJP F;  1OGM X;  3OIP A;  1FTZ A;  2X51 A;  2VOO A;  4I02 A;  4BJ5 C;  1YQA A;  2W84 A;  3HZJ A;  5CVJ A;  3J7A O;  4RDU A;  2L9S A;  5C44 J;  4RGR A;  1WH7 A;  3OIQ A;  1Z0X A;  1W0J A;  3MKL A;  1A04 A;  2F5C A;  2KL4 A;  3VPR A;  1HG8 A;  5JVG F;  2M0C A;  4ESJ A;  1EZG A;  1FBS A;  3Q9V A;  1IXS B;  3L09 A;  3TKY A;  2WAD A;  3DEW A;  3LST A;  5J47 A;  5L3B A;  3LVB A;  1RWR A;  4A3M J;  2KIS A;  4OAY A;  2FQ4 A;  5LD2 C;  2FMY A;  1UG0 A;  2M0M A;  4QVA A;  1WOR A;  3C2B A;  4M74 A;  1YOV B;  4M9S A;  3B90 A;  2QYU A;  3MHP A;  2VNK A;  2PQ8 A;  5TIS C;  1ZRD A;  3GFM A;  2OTJ B;  2M4G A;  2E1C A;  2CUE A;  2ISZ A;  5D4R A;  4RB1 A;  3DQV C;  4WZK A;  2E35 A;  2XGX A;  5M3F J;  2LY1 A;  4FHT A;  1H42 A;  1QGY A;  3CRZ A;  3GQ8 A;  4QFM A;  2DFI A;  4J19 A;  2CW5 A;  5GPA A;  1F43 A;  3MCZ A;  3S1Q J;  1SC7 A;  5J4Y A;  2NS7 A;  2DA4 A;  1Y0U A;  1NK2 P;  3B8H A;  4UZU A;  2KJB A;  2L7Z A;  3QAH A;  2DK5 A;  2QGU A;  5E1Z B;  1ZM2 A;  1HSJ A;  3K1P A;  1YJW I;  1NBM A;  1TLL A;  2DO7 A;  3MCA A;  4HDV A;  5FB2 A;  1EFU A;  4M4S A;  2W1O A;  3QFR A;  3K4M A;  4IOA F;  3A2K A;  1DP7 P;  3V76 A;  3JQQ A;  4A3E J;  1LDD A;  1TTT A;  4Y15 A;  3SLN A;  4I0B A;  3B02 A;  4X6A J;  2OF7 A;  2X6X A;  1R4N B;  2FXA A;  3FK6 A;  1QGZ A;  2WZP P;  4D5C A;  1K9M D;  2XEX A;  2Z9O A; 
#chains in the Genus database with same CATH homology
 2Y0S A;  4XLH A;  1QJV A;  3CES A;  1EA3 A;  3SZG A;  2E5Z A;  3TL4 X;  3H94 A;  2IQ7 A;  3OYM A;  2V7Q A;  2VAS A;  1X4P A;  4J00 A;  2GK7 A;  2LH9 A;  2VIX A;  4Z1M A;  3W2A A;  2R7V A;  3RTR A;  1TT0 A;  3U21 A;  4E7Z A;  3OPO A;  4DK1 A;  2NT6 A;  1JTA A;  1D1B A;  1Z7L A;  4PJJ A;  4HNT A;  1OLT A;  2V4D A;  4J01 A;  1MMG A;  2F6C A;  4KIS A;  2V31 A;  5TGT A;  3VYS B;  1O8K A;  3MKW B;  4YEJ A;  2HVR A;  1HZE A;  2KMU A;  2WSS A;  1J09 A;  3H9Q A;  2K9L A;  3LSK A;  4ZDL A;  2CUJ A;  4DK0 A;  1AA7 A;  1MMD A;  4F52 A;  2R7O A;  1O8L A;  3SEQ A;  2ZZQ A;  1WJB A;  1WTH D;  5KNL A;  3HC7 A;  2UVE A;  4RLF A;  5C1E A;  4GRI A;  2VB6 A;  2VXD A;  3T53 B;  3LSG A;  3ZPP A;  3VMV A;  3AKZ A;  4BE0 A;  3NWT A;  3BLY A;  3DEE A;  3PNV A;  4LIV A;  2WY8 Q;  2VBK A;  1DP3 A;  2I8D A;  2LRD A;  2MC4 A;  4E6K G;  4BEH B;  1CZF A;  2VQG A;  3VYT B;  4BL0 B;  3BCB A;  2HDW A;  3OYD A;  4HPQ A;  3QYF A;  1O8F A;  3NWS A;  2IS2 A;  4PSX A;  3L2Q A;  4BAC A;  1E3Z A;  2X6Y A;  4DNR B;  1W9X A;  3RPU D;  3VYR B;  1E79 A;  2CW8 A;  2WJY A;  2VJ4 A;  3AL0 C;  4H4K C;  1E3X A;  4U49 A;  4CCL A;  2HPI A;  3N05 A;  4XN0 A;  4ANJ A;  4B48 A;  1UD3 A;  2XND A;  4E0F A;  3HXL A;  2XSJ C;  2JIZ A;  2OUM A;  2DCE A;  1OFL A;  3K4J A;  3VWB A;  1K28 D;  4XOR A;  3OMY A;  3RSN A;  3KX2 A;  4OAZ A;  3OYF A;  2LBF B;  4NK6 A;  2V6E A;  1IDJ A;  3D5S C;  3S3O A;  2XF7 A;  2NTP A;  2WA0 A;  3T9G A;  2VL8 A;  1Z3Y A;  3M1C A;  2IS1 A;  2BVM A;  3D5L A;  3LL7 A;  1UD8 A;  4OJ5 A;  2LYC A;  3IP4 B;  3A3B A;  3PNT A;  2M7B A;  3H0D A;  4Z03 A;  4B44 A;  2X1E A;  1W36 C;  1WJD A;  4XKC A;  4II2 A;  3FKS A;  5HNH A;  1T95 A;  3GQ9 A;  4N4O B;  4BGD A;  2IGM A;  2R7Q A;  4ITV A;  4F93 B;  2CV1 A;  1D0X A;  1MMN A;  2DT7 B;  4NQW B;  2VPL A;  3IAM 2;  4I84 A;  5C1C A;  3L2U A;  2LY2 A;  2W6J A;  5FRN A;  2QE7 A;  2VJJ A;  3OS0 A;  3EPZ A;  1K5C A;  1G8X A;  2MYS A;  1BR4 A;  1IDK A;  2PYG A;  4MXN A;  4PFO A;  1LVK A;  3AFH A;  2UVF A;  4NC7 A;  3W2V A;  1WJ5 A;  4CZC A;  1VF7 A;  4R79 A;  1PKV A;  4HNU A;  4W8Q A;  2BOL A;  4KKS A;  2LG4 A;  3H5R A;  3MKY B;  3F9K A;  2X53 S;  3DDY A;  1NHC A;  3K70 D;  4XLC A;  3BC8 A;  3WWG A;  2P0W A;  1V0E A;  3ZPN A;  2JUG A;  2GJP A;  1BPL A;  3CP2 A;  4FAS D;  4B3G A;  2A5W A;  4DBR A;  2O0W A;  3E1S A;  4XMY A;  4EAT A;  2R7R A;  1BR2 A;  2MD0 A;  4FET A;  4BXF A;  1DGW Y;  4HEA 2;  2DJI A;  2XZP A;  2QX3 A;  4RMN A;  1X1C A;  2VQC A;  3GQB A;  3WQZ A;  2RQQ A;  2CH0 A;  4Y33 A;  2V9K A;  4KJZ A;  2WBM A;  3OOU A;  3OYL A;  3BCD A;  3CZ6 A;  3H35 A;  2X1C A;  5KHD A;  3M8J A;  1OFM A;  4TT3 A;  4BJT A;  3KEW A;  2HZD A;  2O5R A;  2WAF A;  1DGR M;  2M7A A;  4XON A;  4HG2 A;  2E1M B;  2V1N A;  1D1C A;  4EW9 A;  4BE1 A;  3LFU A;  2UV1 A;  1QCX A;  2KP6 A;  2ZFU A;  3C2G A;  2DXI A;  1P9Q C;  3PJR A;  2XZL A;  1X4O A;  4C9Y A;  4HWV A;  2F1M A;  1V5E A;  2HQA A;  2KDO A;  2XF6 A;  3T56 B;  5FRM A;  1SFK A;  2O0V A;  3HOT A;  2CFO A;  2OV7 A;  3DTI A;  2NSP A;  3PNY A;  5HVQ C;  3OYA A;  4HST A;  2BSP A;  1X1B A;  2QKM B;  1D0Y A;  3K6G A;  4E7J A;  2WPD A;  3ONQ A;  4BE2 A;  1Z21 A;  4JQF A;  4E7K A;  1KTW A;  2KPM A;  3TBI A;  1BMF A;  1QHH D;  3DPL C;  3LSH A;  2K9M A;  3OW7 A;  3FKJ A;  1KON A;  3OYJ A;  4E7I A;  2HLD A;  1I18 A;  3ZXS A;  3HG9 A;  3K10 A;  1LDK B;  1IRX A;  2GOX B;  1T5E A;  1W0K A;  1EE6 A;  2GJR A;  2INV A;  1WMR A;  2INU A;  1PYV A;  3GVK A;  1YE9 A;  1MNE A;  4XL9 A;  2RNG A;  2JJ2 A;  2X3H A;  3G05 A;  2M3A A;  4DNT B;  4ZYA A;  3GVJ A;  1X0C A;  3BCA A;  3OWT A;  2PYH A;  2Z2S B;  1MW7 A;  1YX3 A;  5CKT A;  2D3L A;  2ZTN A;  3LNN A;  3GBG A;  2R4G A;  3OS2 A;  4YZ0 A;  1VBL A;  3FDY A;  3UNG C;  1X1D A;  4GQN A;  4B3F X;  4NUB A;  4BDY A;  1S9H A;  2L9N A;  4Y4R A;  3SEZ A;  2LOO A;  3VDX A;  3CF2 A;  3S3N A;  2W4S A;  3GVL A;  3DKX A;  2M5S A;  1IA5 A;  2JDI A;  1PJR A;  2XAU A;  2CW7 A;  2WY7 Q;  3A3G A;  1KMH A;  3OL3 A;  1TZL A;  2ELJ A;  5CPR B;  2JJ1 A;  5HLT A;  2L5Q A;  1BR1 A;  1KZL A;  1OOC A;  2O04 A;  4DBQ A;  2XC7 A;  3H9J A;  4L8J A;  4U4B A;  3H5N A;  3J7A Y;  4G7X A;  4YRV A;  3SUC A;  3ZRG A;  2V7F A;  3DPT A;  3VMW A;  3HOS A;  3OAA A;  1V5F A;  3TMO A;  1WFX A;  4KIT B;  5CQE A;  2V26 A;  2M4K A;  3BG6 A;  4XD7 A;  1XG2 A;  1E1R A;  4E7S A;  1O8M A;  2HVQ A;  2VQL A;  2R7U A;  1D1A A;  4XKV A;  3L2V A;  3BC9 A;  2R7W A;  2VKD A;  2V4J C;  1BLI A;  3B4N A;  2CUZ A;  3HL2 A;  4E7H A;  1ERD A;  4YEL A;  4F92 B;  2R7S A;  4E7L A;  4CUG A;  2PJR B;  1BN8 A;  1QHG A;  3GQA A;  1SAU A;  3OYH A;  3KYL A;  2VXZ A;  1O8G A;  3EUK L;  3OFN A;  4HIZ A;  1NRK A;  4LIU A;  3DPU A;  3IUO A;  1NG7 A;  2PMZ A;  2WAE A;  3K4C A;  2KQR A;  3A1Y A;  3OYB A;  2CV0 A;  2IS6 A;  1VZ0 A;  1Y6I A;  2E5N A;  4XOP A;  3VSK A;  3W2W A;  4ZTJ A;  2L2O A;  2X1D A;  4ZDP A;  3DU5 A;  4NNJ A;  2JSP A;  4XLE A;  4RM3 A;  2ODL A;  4C2L A;  1KCD A;  2ZXI A;  3A35 A;  3KEY A;  2KHM A;  4F55 A;  4C2U A;  2BW3 B;  3HPG A;  4NC8 A;  2W82 A;  3QYE A;  4FXU A;  2E60 A;  2Z16 A;  1HVX A;  1O88 A;  5CDF A;  2DIE A;  4QPQ A;  3C2H A;  4W8T A;  3K4N A;  2IGK A;  1O8J A;  3UW0 A;  3CJR B;  4OWR B;  2X8K A;  2NZM A;  3ZCO A;  3T51 B;  4U87 A;  1FMV A;  2VJI A;  2CS3 A;  1E43 A;  2ZZF A;  2F43 A;  2NOJ B;  1DBO A;  1N77 A;  3VST A;  3LSI A;  2LRE A;  4II3 A;  1OHH A;  1O8E A;  3EUA A;  4YZX A;  1AIR A;  3HUG B;  2CMP A;  4URR A;  4RM2 A;  3I3L A;  4TSF A;  3L2R A;  1JRG A;  1RU4 A;  1IB4 A;  4ZTF A;  2JVG A;  3HPH A;  4AU7 A;  2WAQ A;  2IGN A;  2BVL A;  3RQ4 A;  4PMH A;  4XOT A;  1OB0 A;  3ZIA A;  4N4N B;  2VQH A;  2NT9 A;  4P5O A;  2Z1D A;  3DKY A;  3VSV A;  4BJ6 C;  4D1Q A;  1FX0 A;  3FY3 A;  4Z06 A;  4CSW A;  4JMQ A;  2XDV A;  4XLF A;  3CJQ B;  4LIT A;  1MAB A;  2Q2E B;  1H8E A;  2WJV A;  3LMM A;  5HKK A;  1O8H A;  4XR6 A;  5KCM A;  4XNF A;  1WPC A;  4KT6 A;  1UEL B;  4BS9 A;  4PSW A;  2EWE A;  1WJE A;  3S3M A;  1ZEL A;  1BOB A;  5AMV A;  4JOM A;  3SYT A;  2D3N A;  3VR6 A;  1OGO X;  3OS1 A;  4BEH A;  3K4L A;  3VYU B;  3CMM A;  3JU4 A;  5FRO A;  2Z6B D;  2Q1Z B;  4CCO A;  2HU9 A;  2MAB A;  3JUR A;  1UD6 A;  4YXW A;  3DTK A;  3DWL E;  1KCC A;  4B43 A;  3H9G A;  4Y3O A;  1WP6 A;  3OE7 A;  4MLO A;  3FPP A;  1LFP A;  2KZV A;  4Z05 A;  5FL7 A;  3OYE A;  4IQJ A;  4YZA A;  3DTE A;  3RCO A;  4CCK A;  3OEH A;  1DBG A;  2X85 A;  4G6I A;  2KRC A;  2KRH A;  1FMW A;  2W7N A;  1U0J A;  2R9V A;  2DT6 A;  2XOK A;  3OYN A;  2QY1 A;  1V5G A;  3ZR8 X;  4CCJ A;  2LZJ A;  3GRH A;  3H5A A;  1E1Q A;  3I9V 2;  2KLO A;  2ZZE A;  2OC6 A;  2VBM A;  4OZZ A;  2QKL B;  2PEC A;  4OJP A;  1I8D A;  3W3C A;  2VLA A;  3PSI A;  3PSF A;  4D9J A;  3OYC A;  3QYB A;  2LC2 A;  3EQO A;  2CK3 A;  1NG6 A;  4E4H A;  4OZY A;  2GOM A;  2VKH A;  3K70 C;  2R7X A;  3NE5 B;  3MMY B;  3LSM A;  1W36 D;  4CCM A;  2QXZ A;  4C2T A;  1N78 A;  1QU3 A;  1O8D A;  2JA2 A;  4BQN A;  2W00 A;  3MD2 A;  2W6I A;  1UAA A;  2F5V A;  4PJN A;  2L7K A;  4HSR A;  2NST A;  1MMA A;  2ZZG A;  1D0Z A;  2AQE A;  3PUB A;  3VSL A;  4BDZ A;  3AL0 B;  2MFZ A;  1H8H A;  2GK6 A;  3E0J B;  3G2B A;  4ZC3 A;  4PK4 A;  4XKW A;  3OYG A;  1COW A;  3QOD A;  3OYK A;  4B47 A;  2IGO A;  2ZSI B;  3PL8 A;  2X6W A;  3LMW A;  4DGW B;  4F91 B;  1E0E A;  3OR1 C;  4XM3 A;  2WB1 A;  2K5C A;  3MKZ A;  1DQU A;  4U7B A;  1T0F C;  2K3P A;  3EQN A;  5JHF A;  3OYI A;  2VJ5 A;  1N75 A;  2NTQ A;  5CQG A;  3SDB A;  2UWM A;  1PXZ A;  4XQF A;  3FHN A;  4PJL A;  2Z8G A;  3KRG A;  4NK8 A;  4OJO A;  1Y56 A;  4C30 A;  1UD2 A;  1H80 A;  4OJ6 A;  3CP8 A;  1X1A A;  4X0G A;  2E1B A;  4CH7 A;  1WJC A;  2XGJ A;  1VLY A;  4IZZ A;  3A4C A;  2E1M C;  4PJM A;  4BQQ A;  1PLU A;  2XF5 A;  2O17 A;  1R6R A;  1OGM X;  3OIP A;  2X51 A;  4W8R A;  3S93 A;  4XLA A;  1JI8 A;  3ZSC A;  4BJ5 C;  1V0F A;  2ZTG A;  4QPO A;  4PUS A;  3OL4 A;  2A6T A;  2F4I A;  4B3X A;  4KKU A;  2IS4 A;  2L9S A;  3OR2 C;  2RRE A;  3ZGK A;  4P22 A;  3OIQ A;  1HA8 A;  1W0J A;  3BH4 A;  3PFY A;  2PJR A;  1HG8 A;  1WJA A;  1MND A;  2KL4 A;  1O8I A;  4XN3 A;  1EFR A;  1YX5 A;  3HKZ A;  4XKB A;  2ZSH B;  4HRI A;  3IAS 2;  4ZDO A;  2WAD A;  4DJA A;  3FBI B;  2UUZ A;  1Z3X A;  4BUP A;  4AVZ A;  2NTB A;  1RWR A;  2BW3 A;  1GQ8 A;  4OAY A;  5LD2 C;  3OOC A;  2DOA A;  4KKT A;  4ASU A;  4P1W A;  1UG0 A;  5HOO A;  2M0M A;  3VSU A;  2CV2 A;  3DLA A;  2HPM A;  3B90 A;  2HVS A;  4BQO A;  3BG7 A;  2M4G A;  3S32 A;  3L2W A;  4CA0 A;  4AYB A;  2R7T A;  3QOE A;  4ZJZ A;  1SKY B;  1PE9 A;  3DQV C;  1UD4 A;  2AQF A;  4IQ4 A;  2LY1 A;  2XZO A;  1RMG A;  3GQ8 A;  1X19 A;  2FUG 2;  4IKF A;  3GQ7 A;  3OY9 A;  4MR0 A;  3OEE A;  3HAG A;  4RLQ A;  2VBE A;  3V42 A;  4PFP A;  3EUH C;  3DU6 A;  4TKO B;  3BCF A;  4UZU A;  3B8Y A;  4G7W A;  3K4B A;  1K6Y A;  2HNH A;  3FBN B;  1BHE A;  1NBM A;  1WJF A;  3UR3 C;  4W8S A;  4DOZ A;  3D5R C;  2O1D A;  4DIQ A;  1VJS A;  2LBF A;  4IX7 A;  5DN6 A;  2W1O A;  3K4M A;  3ZQQ A;  3A2K A;  5HNF A;  5LFA A;  3K4K A;  4YZQ A;  4F3Q A;  4G6T B;  1UD5 A;  5IK2 A;  1LKX A;  2KVO A;  2X6X A;  2GJK A;  3S8P A;  2IXS A;  1G59 A;  2ZXH A;  1GLN A;  4CCN A;  2WZP P;  4OJL A;  2JVH A;  4LG3 A;  1OR7 C;  4BU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...