2VJIA

Tailspike protein of e.coli bacteriophage hk620
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE PROTEIN
publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Bacteriophage hk620
molecule tags Viral protein
total genus 229
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjiA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjiA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjiA02
2O0VA 4XNFA 4XORA 4W8SA 4U49A 1EE6A 3ZSCA 1KCDA 4W8TA 4YELA 3GQAA 4PMHA 4YZ0A 1AIRA 2IQ7A 3B8YA 4YZXA 3VMVA 3EQOA 3FY3A 1OFLA 4XKWA 4XR6A 2Z8GA 1O8KA 4OZZA 2PECA 1PE9A 4YZQA 4EW9A 4XN0A 1VBLA 2X6YA 1JRGA 5C1CA 4MXNA 2X3HA 1KTWA 1H80A 2VBMA 4Z06A 4Z03A 3ZPPA 1O8MA 4Z05A 1O8JA 4NK6A 3SUCA 1OGOX 1IDKA 2NSTA 4XL9A 1O8FA 2QX3A 1O8GA 1PXZA 1IB4A 1KCCA 3T9GA 4XLEA 4XOTA 1DBGA 5C1EA 4C2LA 4XLAA 2INVA 1IDJA 1O88A 3JURA 1DBOA 3GQ7A 1CZFA 1QCXA 1OOCA 2O0WA 2QY1A 4I84A 1O8EA 2O1DA 3GQ8A 3GRHA 3VSUA 2VJIA 1BHEA 1WMRA 2NSPA 4XLFA 1K5CA 2BSPA 4YZAA 4XMYA 1GQ8A 1O8LA 2QXZA 2UVFA 1OGMX 2O04A 4U4BA 2EWEA 4XN3A 3VMWA 1O8IA 4NK8A 2PYGA 4OZYA 4XLHA 2INUA 4XLCA 2VBEA 1O8HA 2O17A 2PYHA 4OJPA 4YEJA 4XOPA 4HWVA 3B90A 4OJ6A 2NT9A 2NTQA 1QJVA 3EQNA 4XM3A 3WWGA 3LMWA 1PLUA 1JTAA 1NHCA 1HG8A 3GQ9A 1O8DA 4XQFA 3VSTA 2X6WA 2NTBA 3UW0A 4XONA 4W8RA 2ODLA 2VJJA 4XKVA 4URRA 2UVEA 4OJLA 1IA5A 4OJOA 5AMVA 2X85A 4AVZA 3KRGA 2VBKA 3VSVA 1X0CA 2NTPA 4OJ5A 2NT6A 1RMGA 1RWRA 3B4NA 1XG2A 4W8QA 1BN8A 1OFMA 4MR0A 2X6XA 2NZMA 1RU4A
chains in the Genus database with same CATH superfamily
4G1BA 2HTJA 3T53B 2F5EA 3BR3A 2OCCH 3QPSA 1KYZA 3PNTA 1HC8A 4UVBA 1QZZA 2C4TA 2K4BA 4Y13A 1I18A 1YTYA 3C1DA 2I1LA 3M8JA 5L3GA 2GXGA 2RQPA 2LKSA 1DP3A 3HKZA 2F4NA 2ZFUA 2DXIA 4BQOA 1GXPA 3SZTA 4LMYA 3WNDA 1I1GA 1TYWA 5C1CA 2XZOA 2XT2A 3CUOA 2BMWA 1KTWA 1X2NA 2A68F 1WDTA 3FMSA 4AWXB 1T5EA 4WZKA 4P9FA 3HL2A 1SFEA 3H5NA 2JTVA 1ZQ3P 3GTJJ 3CCEI 5HDGA 6PAXA 4DK1A 1TWFJ 1JKOC 3U1DA 4LB5A 3T9GA 3BY2A 2YWGA 1X19A 2LY2A 4DIQA 2WB1A 2V1XA 2BY2A 3GFMA 1K8FA 1XDUA 1V3FA 4NDLA 4E7JA 1XMAA 4CO8A 1FOYA 1JKRC 2DT6A 4ASUA 1QA3A 3ZP5A 1L3LA 3BTCA 3VYTB 3FKSA 2E34A 2HZTA 1YX5A 5BQTA 2ELJA 2BGJA 1GQ8A 1ZH5A 1AIPA 2K86A 1TP4A 2MC4A 4A6DA 1X1DA 1ZGWA 3CF2A 3LQEA 2O04A 4ASNA 2VFOA 3OEEA 3FF5A 1SMYF 3UNGC 2A6TA 3BR2A 1R5ID 2ZZEA 2ZO4A 3ERMA 2XF6A 4V2FA 4ZC3A 3JRHA 3DP7A 3LSPA 1E17A 2Z6BD 1SFXA 1YI2I 1HBXG 2VKHA 2EFOA 3FM5A 1H8EA 1UMKA 4PFOA 1OCRH 1W0TA 2QTZA 3SYJA 1OCZH 1KQSB 3H0GJ 3D5RC 2F1MA 1D1BA 3K1PA 4ZGQB 1VQ4B 3BH4A 2ELKA 4Q47A 1UG2A 1S9HA 5F4MA 4NBSA 1HDPA 1RPWA 3L09A 2VE8A 5L3FA 2QYUA 1UZCA 2JA2A 1J7KA 2XRNA 4R79A 4BDYA 1E43A 1GV5A 1W9XA 3ZQLA 2QSHX 2HR3A 2VL8A 4U0VA 3OOCA 3MZYA 5L46A 1ZG1A 2XPVA 1BA5A 4RAYA 3VB2A 1OJLA 2FNAA 3QODA 3WTZA 5BPDA 4XRSA 1MMSA 2QEXI 3DV8A 2X48A 1O7LA 2M1BA 3EUKL 3N4MA 2ZZGA 2ID6A 2FD5A 3QPHA 2F4OB 3ASPA 1QA6A 3JCUC 5JI6A 3OWTA 3BCFA 3CCLB 1YO5C 1HW2A 1AWCA 1DGRM 2M7AA 1R5HA 1DU6A 4OIQF 3FWEA 5BMZA 1R9TJ 3I54A 1FP2A 1XSVA 1PUFB 2ZBUA 2DERA 2BYVE 4EMSA 4X0CA 1PVEA 4BJ6C 3GVAA 3R0AA 1XFOA 1LVAA 2XZLA 3O2PE 2B7BA 4LIUA 2YPRA 3FK6A 5FO0A 2K9SA 2QKLB 3BP8A 5GTHC 3T8RA 5HS8A 4UB8C 1D0ZA 4YAWA 1KU9A 3EYIA 3I53A 3ZZUA 1W0UA 4E7SA 4OP7A 4EW9A 1B9NA 4MEYF 4X7CA 1BIAA 1ZREA 2BBYA 5B5EC 1VQOB 1T95A 4ANJA 2WJYA 4IL6C 2VQHA 3KCCA 4U88A 1N78A 3P9CA 3LFKA 3Q6RA 1FIAA 1NBMA 4HX4A 4A6EA 2BX6A 4F93B 1N77A 3IRRA 2E1MC 1WXRA 3LSRA 1TQIA 2UV1A 1OFEA 3P27A 2DMQA 2BM0A 3ONYA 4H4KC 1O8FA 1O8GA 2H27A 3MKYB 4Q48A 2J5PA 2CQQA 2DYIA 4KIFA 5JMCB 2FBHA 2IA2A 1K6OA 1JJ2B 3BC9A 2INVA 1IDJA 3CCRB 1E64A 4YC5A 4IHWA 4RGXA 2RNJA 1FNMA 2ZFWA 5TRDA 3VPRA 2E35A 2GQFA 1QCXA 2VFQA 3GLLA 4A0ZA 1EV7A 2KP6A 2O1DA 1GVJA 1ETQA 2ESHA 1R22A 4IPAA 1G3YA 4BL0B 2YX4A 1ZTRA 2JPCA 2Y0SA 3CJRB 3S93A 4GGGA 4AYBN 4DZPA 3IKTA 3I0TA 3OOUA 3BOQA 3SQVA 1MJBA 2L7KA 2X8KA 1SVLA 5D4SA 1S3JA 1KQ8A 4V2GA 2M8GX 1QQIA 3E5XA 1ACIA 3CJNA 2VXZA 5L3BA 4DQLA 4HEA2 5F6FA 4HW0A 3I1FA 1GXQA 1JB9A 4DQKA 3IH3A 5KVRA 1WJEA 4YIRX 1JTYA 5CVIA 4LB6B 2NT9A 4K1XA 1ELOA 2NTQA 4A3MJ 1AKHB 2EB7A 3T1BA 3ZQGA 2JA7J 3WWGA 1YIJI 1B9MA 3NWSA 1JTAA 3LAJA 4TN1A 1PKVA 1SAXA 2FNPA 3CCJI 1D5VA 3FXOA 1N75A 2FBKA 4P3IA 5FKNA 1VQNI 5FD6A 2ZJPF 3GCMA 2EFNA 1DG1G 4Q7JB 1H85A 3CUQA 1KJZA 4FTHA 2HYGD 4IQ4A 1O4XA 2X85A 4WXHA 1D1AA 1YE9A 1X3UA 3ABLH 4ZJZA 2BPOA 2W24A 1BR2A 1JKQC 1Z67A 2DFEA 2Y48A 4KKUA 2KJBA 5LEJA 1VQ9B 1UD6A 1FY7A 2Y0MA 4BH9A 4LLGF 3KYLA 2JJ1A 3HHHA 4WK8F 5FB2A 3GZNB 3IC7A 5C4XJ 1YFHA 1BI3A 5A2QZ 1B72A 1WPKA 1UB9A 2CJJA 3MQ0A 2CRGA 5DV5A 4M0LA 3K1NA 2CO5A 2IQ7A 3VMVA 5J35A 1W4MA 4I0AA 5HXBA 1VF7A 1J9IA 4UUSB 5BSYA 2QM3A 2FF4A 4XR6A 1GHCA 1JGSA 1BOAA 5FRMA 4C2TA 1EFCA 1NG7A 1FX0A 1W2BB 4CXFA 1MBGA 1F43A 1IV6A 1QUFA 2F5FA 2EWNA 2ZKZA 5DD8A 5DM7F 3L2WA 2OQRA 1AHDP 3D0SA 5F4OA 3ZPNA 4YFKF 2X4HA 3DQVC 2IGKA 4DJAA 3WTYC 3WU1B 2XROA 2HEOA 3S1QJ 3KP7A 2PIAA 1MBJA 4XBFA 4AIHA 1QG0A 4HF0A 1IG7A 2R9VA 1ZGAA 3AVVA 2DQLA 2NSTA 5K7ZA 2WY7Q 3GFLA 4NC7A 2QX3A 2XVCA 1Z77A 2V1DA 3CCSI 1E3HA 2QQBA 1N0UA 5GADJ 2M8EA 1TNTA 2NAZA 2V1UA 1GAQA 1NB0A 1DBGA 4XLAA 1V5EA 2LH9A 5CJ9A 5LEKA 1XB4A 1UD2A 1J0RA 3ASTA 5B66C 3BZCA 2VPRA 2BOLA 1IF1A 2ZBVA 2G0YA 1G3TA 2X1CA 4E4HA 3L2CA 3VFZA 1K9MD 2L4MA 2MD0A 3MKLA 3JSPA 1OLTA 2XNJA 3VSUA 3WY9A 4U7DA 2Z33A 4BKXA 3DPLC 2QSFX 1OFCX 2HDCA 2QGGA 2OZUA 4RAGA 4BJ5C 2HVSA 1E1QA 3A0BC 2JWTA 3IWZA 3H5RA 1RQRA 1FNNA 1Z3XA 4BQQA 3E97A 5FFXA 5F04A 3HM5A 2LK2A 2DA4A 4CQJA 4ZTFA 2EWEA 1L0OC 3K4LA 2L4AA 2HOTA 1W35A 2PYGA 2Z3YA 4C3IJ 4BACA 2BY1A 4RD3A 3QPTA 5E6TA 3BROA 4QHYA 4HA8A 2XC1A 1SD7A 4QVJA 4EJWA 3COAC 1DDNA 1PJRA 3J81k 4QV2A 4XRFA 2ZNYA 3Q0VA 2MC3A 1HZEA 3ZPLA 2E7XA 5L3EA 3K2AA 4HV6A 3EUHA 1X1CA 2XF7A 4B3FX 2C4UA 3CLQA 4KNYA 2UZKA 1T6XA 1F36A 4MYTA 3VYSB 3ES9A 3VSTA 3BR6A 5D8KB 1NTCA 1G7TA 4G8XA 2IGOA 4BEHB 3GEZA 5J8CA 1P4WA 2IT0A 5ICFA 4XKVA 2ZL5A 3R0JA 4QPOA 1IRXA 3F8FA 4RGRA 4BXFA 1RR7A 3JW4A 2PN6A 4WZLA 3E3VA 4CZZA 3S1RJ 3IKVA 2JJ7A 2RC6A 4HF1A 3OR1C 4G7ZF 5IYQA 4PJMA 5AIQA 3DEEA 3TW7A 1B8IA 1SANA 2LD5A 1G59A 3V8KA 4XNFA 1NHAA 2ID3A 2KRCA 3ZRGA 4QFMA 3FM3A 1P6RA 3HEFA 1EXMA 3ZMDA 1YJ9B 2JRTA 2LNBA 2XDVA 2W1OA 1LKXA 5EGOB 4E7LA 2ISYA 2W84A 3SJZA 2QENA 4YZ0A 1XMKA 1K78B 2DYRH 3LA7A 4PK4A 3S2WA 1K4SA 2GM4A 1OB0A 2LSOA 2VQLA 4G1VA 1GLNA 2GIVA 2Q0OA 2XGCA 4DBRA 2EINH 2DMUA 4FASD 5TISC 2H8RA 2F5CA 2PJRA 1JA0A 1MJAA 2F1LA 3AGPA 3ASQA 4MTEA 4U7BA 4HG2A 9ANTA 2M5SA 1IO2A 4A3FJ 1PUEE 3GLXA 1WORA 1OR7C 3ZIAA 3GX4X 2WAFA 4RDUA 4YALA 4EQQA 4Z03A 2EFPA 2PLFA 3FMRA 1D8KA 2QQAA 5JVGF 2O7OA 5HLHA 2NS8A 1T38A 4L5EA 3HUGB 1UMQA 5FROA 1KRHA 3PSZA 4N9IA 1U9OA 3SLDA 4RJLA 2YX7A 1VQ8B 4XLEA 1Y0NA 2IS6A 4L9JA 3SEJA 2MG4A 2XAGA 2B7CA 1W0KA 1HSTA 1XTAA 2B5OA 1U2RA 2LR8A 3HTSB 1TTYA 3H3VK 3E20A 5IOYA 2L5QA 4BNCA 4GYIA 1Z21A 2XV4S 2M7BA 3H1CA 1QGAA 4IX7A 2CWEA 3F72A 2QZAA 3H94A 1ZLJA 2V9VA 2VJIA 3MWMA 3Q3SA 2R4GA 5GV7A 4YZAA 5D5VB 4M6XA 2DODA 3QPLA 3LNQA 2ZL6A 3ZQHA 2HZDA 2QBYB 2L0KA 2Z99A 1AMOA 3CC4B 2VOOA 1BC8C 2Z2SB 1WRJA 5JHFA 1ZYRF 3RSNA 3JRFA 1I1SA 2UWMA 1MH3A 2WR8A 1O8KA 4YFXF 1RC9A 2TRTA 2LZJA 1XD7A 4RB1A 4OJPA 3A8KA 3OPOA 4ABZA 3ZN0A 2BY0A 5FO5A 4HSRA 4NQWA 1SFKA 1A6IA 2BGCA 3T5XA 2ZXHA 3HOSA 1JUPA 2R0QC 5JVTA 4XM3A 4RAZA 5LHIA 1USTA 2STTA 2CSOA 1I6HJ 2OA4A 2K40A 4MEXF 3DPTA 5KHDA 2WYRA 4IHYA 3ELKA 3MKZA 3KEWA 3PENA 2R5ZA 3BH6B 2A3SA 1WOPA 5KSWB 3KP6A 2RV8A 5E17F 2CUJA 4URRA 2FXAA 2UVEA 5IPAA 3KEYA 3QYBA 3BCDA 1IN7A 4BGDA 4I76A 3QU6A 3E7LA 3V4GA 2FBIA 3F8BA 4ZYGA 1E0EA 1XS9A 2VODA 2QLZA 5LMZA 4G94A 1DUXC 2A07F 1QRBA 3BT9A 3LOCA 3OV8A 4L9NA 3W2WA 1EP3B 1JNYA 4X07A 1QNTA 1MBEA 1BN8A 4ITVA 3MFKA 2M2EA 2DPUA 1EKEA 3QFRA 1IN8A 3JSOA 2NS0A 4Z2YA 1VQ7B 3F6OA 1LFUP 5A88A 3MKWB 4EM1A 3R6JA 4O6JA 3Q3AA 2V7TA 5BSXA 2BV3A 1SAUA 1EFRA 4PJ0C 3TDUC 3HPGA 4P1VA 2QQ9A 4O5VA 1XMXA 2Z8GA 4OIPF 1YJWI 3OL3A 3WTVC 5JFRA 2RQQA 3IH2A 2EIXA 1FOXA 1D8JA 2JT1A 4MQVA 4BJTA 3CO6C 3GZ6A 3E6DA 5M5WJ 4A3IJ 2OBRA 4Z06A 1A8PA 3JRAA 1IZ1A 1W36D 4HF2A 1AU7A 1GR1A 3W2FA 1YOVB 2R7UA 4JK1X 3DTIA 2VT2A 2BN4A 2R7OA 5DEQA 5JLWA 2LC2A 3CC2B 3J81Z 1MDMA 3BG7A 4A3BJ 1SD4A 1EP2B 5E18F 3GTOJ 4GXOA 2AS5F 2K7LA 1EH6A 3PFYA 1CF7B 1K4TA 5C1EA 3DKYA 2MYSA 3JRDA 1EF4A 1RKWA 2EV5A 2XSJC 3GFJA 1XC5A 3SDGA 5TGTA 1MNMC 1ZLKA 1Q1VA 1TW3A 4R8HA 2ZL7A 3QYEA 4KA4A 2V6EA 4E6KG 4LG0B 5TV2A 3S3OA 3O6BB 3HSFA 5EEGA 3E1YE 1KD1D 1YITB 2VC1A 3H3ZA 3PUNA 3BH7B 2KVOA 2R7XA 3W2HA 2HQ5A 4B09A 1EFUA 3J80K 5C3EJ 2L9RA 1G2HA 2FOKA 5H5JA 2KRFA 2R7TA 1XB2A 4XN3A 2OTLI 2DK8A 1YS7A 2LREA 2XNCA 2BM7A 1ZRFA 2K3PA 4C2UA 1T2KA 2DDBA 2HKXA 3S2HJ 2GPJA 2VBEA 1ZARA 1LFBA 4CYCA 4IW3B 2KISA 2PJPA 1A31A 2IA0A 2DYSH 3LFUA 2AHQA 4L8JA 3I4PA 4WZTA 2OD5A 2HQAA 3FKIJ 4M9ZA 4LK1F 3CDLA 2PG4A 1QJVA 2GA2A 3P9IA 1CNEA 4BY1J 4OMZA 1GAWA 1QRYA 3PA1A 3QRFF 1VLOA 3K69A 1TYUA 3W2EA 2MGQA 5FKLA 1OGIA 2VQCA 1IXCA 2ZC2A 2Q6IA 2NTBA 2JIZA 2V4JC 5FO1A 1QRCA 1LE8A 2HTSA 3CJQB 1JT0A 3CCEB 4NC6A 4TSFA 4WQMA 1N05A 2Z16A 3KRGA 4RD2A 1A5JA 4MFEA 5KK1A 4CUGA 2H1LA 2L9SA 5EG0B 1U8BA 1QGYA 1XG1A 2V6CA 3KPHA 2VJ4A 4KITB 1U5TB 1XN7A 5HLGA 3L2QA 1FWZA 1J09A 1TLLA 2CNDA 5FIUA 2JVHA 2AXTC 3W2GA 3JX8A 2DI3A 5GAEJ 3WXMA 2FX0A 4KYWA 2BGIA 1ZK8A 4U49A 3ZSCA 4D7NA 1TWAJ 3ONQA 1IRZA 1B59A 4YELA 1QO0D 3WGHA 2HPMA 3GQAA 2JA8J 1Y0YA 1W36C 4YG2F 4PAAA 3ZGKA 4II3A 1QUEA 3GIRA 1X3WB 5J4VA 1H89C 2WV1A 3A0HC 3V7CA 1OFLA 3AG4H 5J3LA 5M3FJ 1HF0A 3KFWX 2QKMB 4IRHA 2C6YA 3M4OJ 3L2VA 3OAAA 3ZBUA 3AG2H 1WOSA 5F0CA 1YI2B 2YWHA 4XN0A 3A02A 3PL8A 4Z6YA 3OFNA 4OM9A 1NG6A 2MA3A 2P6SA 3RTRA 2W48A 3WHCA 2DOEA 5JHUA 3PIOF 3G71I 1MMNA 2DN0A 5D5UB 2CG4A 4P12A 4QTRA 2DPDA 3CPWB 3WHBA 2K27A 1XDSA 4HNUA 4XL9A 2VIXA 1IJEA 4E7IA 2NVTJ 3KL9A 2EQRA 1Y8RB 2HDDA 1R49A 5J47A 1IB4A 2MH9A 2C5HA 1Y0UA 4XOTA 3FPKA 2BW3A 2CW5A 4HV5A 3DU1X 2EZLA 1O88A 3R61A 2GXBA 1HW5A 4NC8A 1ZG3A 4P6VF 3AVXA 2CUEA 3H36A 3ZQIA 4MGRA 4E70A 3OS0A 5L3DA 1B6AA 4IHTA 5IK2A 3RJPA 2O0WA 2QEXB 1UCRA 2R5YB 1Y8QB 2OYNA 1WMRA 3PETA 2YUSA 4WF2A 2WV0A 1S29A 2L3DA 2OBPA 4M6VA 1K6YA 1OPCA 3IRQA 2F3LA 2IOUG 3OOPA 4BQNA 2W7ZA 2HVRA 1BBYA 2LDUA 2R7DA 5F1JA 2BXYA 4P6YA 2DFIA 1GJRA 1SD6A 3FXQA 4RA2A 3ECOA 4ZYAA 2KMUA 4UZUA 1O8HA 1IUFA 1MNEA 5EEAA 1S72I 4RB0A 1XGSA 3CXCB 5DNSA 3VO2A 3H92A 4M4SA 4KISA 4F3QA 4M6YA 4M3GA 1R4NB 3I59B 4D0PA 2IS4A 1KK2A 1QX4A 1OCPA 2PBIA 3PM1A 5CVRA 5ILSA 3TP3A 5LRSA 4N4OB 4NBQA 4A3LJ 3AGQA 5HOOA 1T33A 1NHCA 3S15J 5DCMA 1VF9A 2M4GA 1R6RA 3V7RA 5C44J 3ASSA 1Z6RA 2DFFA 1WGXA 3HRSA 4QSHA 3BCBA 3DPUA 5J6XA 3VODA 3S3NA 3M7GA 4B3AA 3KETA 1PJ7A 3KP2A 5TR9A 3ZN1A 4M53A 1QGPA 1RZ4A 4H9GA 3P9KA 2K9MA 3IUOA 4Z4VA 3J80Z 4DYRA 2R7SA 3BQJA 3B4NA 4B4CA 3BG3A 2XIGA 1MH4A 2LY9A 2HU9A 3ASNH 1WSUA 3OJXA 2B0LA 3OYKA 4FISA 4MR0A 3U21A 5FL7A 3ABKH 1J2XA 2L54A 3A3BA 5F64A 2XGDA 3ROUA 3VNUA 3OS2A 1MJ9A 2W7NA 3TW6A 1JT6A 4QIWN 1EZGA 3K4JA 4C3HJ 4CH7A 2IGNA 1C0WA 5IYWA 4M74A 3RCOA 3C18A 2H6BA 3LQRA 1LB2A 3TO6A 2R7FA 5B1BH 3EQOA 3AFHA 5F0FA 2FVGA 2DA5A 3ULQB 5AN9A 1RUOA 1FOKA 3HC7A 1KGSA 1FT9A 5L3CA 4M72A 1PP8F 5HZAA 3OYBA 2VKVA 1XCVA 3BJAA 1BOBA 2XKPA 1P4XA 1ONVA 1DARA 1W5SA 3JQQA 4Z4WA 3N90A 1ZKGA 1O8MA 1FRNA 3QOEA 4HNVA 1MSEC 1YIJB 3SUCA 1I3AA 3OYFA 4IHXA 1O7FA 1W5CC 4X8IA 1IDKA 4I01A 4RCZA 4HBLA 2VNKA 4M3FA 4FK8A 4RLZA 3CMYA 1I5ZA 2IS2A 1GT0C 1T56A 3QWLA 5TJJA 4CICA 2BV6A 3CCJB 4PJNA 1YX3A 1DDIA 3VDXA 3G6EI 3BZ6A 3E5QA 1VQNB 1BQEA 1R1TA 2L9VA 2VBTA 2Y2ZA 3OR2C 3OJWA 3W5VA 1YQAA 4JX5A 2HOAA 1OOCA 2H1KA 2DU9A 5IT9Z 1VQLB 1SKQA 3GVJA 3GRHA 2DA7A 4MLOA 4FE7A 1BLIA 5J4YA 1V4RA 4ZYHA 4XLFA 3OSGA 5FLXK 5IP6A 3G73A 1PJ5A 1Z6TA 5JLVC 1RNLA 2PE3A 3SZGA 3U6KA 2QXZA 1QVFB 2ZZQA 1BR1A 4IF4A 4RM2A 1QZEA 4G7XA 2CFOA 3GBGA 1S8NA 5M5YJ 3OYJA 1K73D 4A3JJ 3E5UA 3V42A 4I0BA 4NK8A 4UUVA 4DYQA 1I7PA 1ZM3A 4W97A 2NOJB 3ZMTA 1QHGA 2KHMA 1D5YA 4PJLA 3RZDJ 1U5TC 4Z4SA 4IO9F 4YEJA 3TL4X 3C2GA 1V5FA 3ECHA 4GFBA 2XRLA 2XAUA 3F8CA 2JA6J 2WZPP 4G6QA 4KN4X 4OJ6A 3EYYA 4PUSA 4RD4A 2K5CA 1I39A 4AF7A 4G7OF 3N05A 3OYAA 1BI1A 4A3CJ 1QA1A 1FMVA 2O6WA 1RETA 4GQNA 2KLOA 3VSKA 4H0EA 1KTVA 5CDFA 3PSIA 4FETA 4Y15A 1V0FA 4TMTA 3ZMZA 4MTDA 2VZLA 1STZA 1YG2A 1I3QJ 2QF7A 1MABA 2WAQN 2MLKA 4M9SA 1VHOA 4OINF 1YLOA 1VQ5I 4XONA 1IN6A 3AG1H 2A6EF 3ZXSA 2W6IA 1BJKA 2DT5A 4AIDA 5IY5H 1IA5A 3QU3A 2ZSHB 1COWA 2BF4A 3OYIA 5D5XB 1QFZA 3CCSB 3G2BA 1BI0A 2LBFA 2RKHA 5F08A 3RZOJ 2K85A 2JVGA 2NTPA 3HJEA 5KAIC 1HKSA 2XZPA 2VT3A 4A69C 1RWRA 2Q6KA 3M9AA 4P26A 4B3GA 3CCUI 2MFZA 1XG2A 4Q5SF 1ON2A 1W34A 4I2OA 2EBIA 2O5RA 2X51A 3DU6A 3QFTA 4FN5A 3DKWA 4UAJA 3JTHA 3TO9A 2D45A 2J8IA 1F5TA 2D3LA 1RU4A 2HQRA 2COMA 1VQ6I 5FKMA 4AVPA 2V7VA 1OGJA 5DSZA 3PO2J 2FE3A 1GDTA 1EE6A 2BZTA 3KYCB 1T0FC 4G6TB 2VFPA 1AIRA 1RQPA 1QZYA 4UV9A 4EEFG 1MMAA 1U6GA 3GO5A 3DLLF 5DD4A 4M3BA 2DMPA 2Z1DA 1DPUA 1LNWA 4LBVA 5K5OA 2W00A 3H3UA 1VQLI 2KQRA 2MD5A 3W2IA 1WI3A 2VBUA 3RIRA 3VO1A 2W85A 2X6YA 4A93J 3KP5A 1TZLA 1IRFA 1JRGA 4XSXF 5KNLA 4AYBA 3T0YA 2EV0A 1S7EA 3LA2A 4Y9UA 3ASOH 2FX3A 1H88C 2Q1ZB 1H8AC 4ZH4F 3GTPJ 2BVMA 4UY8I 3SJMA 2FMLA 3HSEA 3F23A 3TH0A 2RVCA 3QP5A 2VE9A 3S2DJ 3OKXA 5D8LB 3CP8A 1E3ZA 3SEQA 1U2WA 3BQZA 4NHJA 4IVNA 4X7DA 1R5NA 2RREA 1RESA 1VZ0A 3B73A 2LVSA 4ENMA 3LO8A 2Y30A 1NB9A 1FZPB 2PI0A 1UD5A 2VYQA 2Y69H 3M8FA 4UNOA 1Z9CA 3NAUA 3LSHA 2DFHA 3KIOA 4XMYA 4DZJA 1KQ5A 3PSFA 1M90D 1B4AA 2OCEA 1FSHA 3I5UA 2AQEA 5KCMA 1OGMX 4Z1MA 2BM4A 4ZYDA 2E5ZA 3CC7I 3FXKA 2LMDA 1WPCA 2BXZA 4II2A 1O8IA 4NB5A 4M73A 1GO2A 2RC5A 3TQNA 3OEHA 1R4MB 1KU2A 2JPBA 1ZR4A 4HOBA 3FIWA 4V02C 4XKBA 5H2FC 4OOVA 5B3SH 3SHFA 1QFYA 1KZLA 1FPQA 3IWFA 2CUZA 5K5RA 1EH7A 2FQ3A 4XD7A 1W7PA 2ZMEA 1BX0A 3QAHA 2C78A 3A03A 1Q7YD 2IS1A 2KPMA 4EM2A 1VNDA 4HE5A 4HIZA 4RM0A 1JJ8C 4C3JJ 4CCLA 1G4DA 3LNNA 3TP0A 4D5CA 2RAEA 3ZZTA 2DOAA 2JN6A 2QN6A 2OZ6A 3BR1A 3CTAA 3LSJA 5EZHA 2I10A 3SFZA 4A12A 1BL0A 4ETSA 1S6LA 3U9GA 2WZNA 2XKOA 1O3TA 2X0LA 1F4KA 5FLXZ 2NNNA 4CHUA 3TGNA 4AVZA 2HWVA 1K28D 1JI8A 4ACBA 2Q6OA 1LEAA 1Y56A 4S05A 1WHUA 3L1PA 1KMHA 1Q81D 1OMIA 4W1UA 2GA1A 1VQMI 1K79A 1G7SA 2QDXA 3NE5B 3AVYA 1KONA 3GSIA 2GJPA 5EMNA 2OV7A 1G7CA 4EJOA 2CU7A 4Y3OA 2BM1A 5LD2C 4Z4ZA 3KLNA 2O0VA 2I5UA 5E1XA 3CUQB 2PEXA 1KCDA 4BXUA 2QA4I 3CMMA 4FQGA 3PNYA 4N9HA 1VTNC 4G9YA 4LFUA 2ACJA 3V7AA 1YW8A 4ZGNB 4UZEA 5HKKA 1S7AA 4WXDA 5CQGA 4I09A 3D5SC 4PMHA 2O8KA 2KFDA 1G3WA 3L9FA 5H20A 3RDIA 3CLOA 4M2LA 2XT4A 1TW2A 4XKWA 2MSYA 3L7WA 3VMFA 3EPZA 3A8IA 3HSRA 4M3DA 2PECA 3DFGA 3NB2A 4HE6A 2IXSA 1REPC 2YU9J 5HS7A 3SDBA 2R7RA 1JGGA 5HS9A 4IHVA 1OYIA 2A5WA 2H09A 3K4BA 1SC7A 4E7KA 1T39A 4RLQA 3V8LA 4BY7J 3WODF 3O8GA 3LSMA 4Y4RA 1B72B 2NYXA 5E8IA 5IP9J 5E20A 1OCCH 1V55H 3K7AJ 4J00A 1O8JA 1DU0A 3DCFA 4OAZA 4TMVA 3WYAA 3M8EA 4XLPF 4ZZLA 3Q0WA 4PGOA 4EVIA 3BJ6A 3BLYA 4AM3A 1X58A 1HA3A 3A1PA 2LLKA 1FYKA 1QHHD 3RQIA 2WA0A 3IH4A 4C2LA 1MZBA 1WQ2A 4CSWA 3AK5A 4KUMA 2HNHA 2PFBA 5E3MA 1OB2A 3MMYB 1X4OA 1AOYA 2Y9YA 3FBIB 3QQAA 1G3SA 3WU2C 1YRNA 1QPMA 4BBRJ 1N0VC 1R7JA 4G7HF 5HZBA 2K9QA 2VFNA 4KIBA 2V9PA 2VQGA 1FDRA 3Q6QA 3KEOA 1GV2A 2ETHA 2GK6A 1MBFA 3CMAI 3K4CA 5LLQA 3OYHA 3M3YJ 5F1RA 5LHGA 4UB6C 4I98B 4XLCA 5GPAA 2KIMA 3ABMH 1UELB 1VFCA 3GW2A 3A01A 2K02A 4J01A 2G0EA 3W6JB 3AVTA 1IV8A 3MVPA 4E7HA 1HQCA 3ONUA 1WH7A 1ORKA 2QTLA 2KKOA 1EWYA 2ECBA 1YJWB 4B4DA 1UJ8A 1T08B 1PP7U 2O03A 1PJ6A 2MW8A 2DY1A 4RDKA 1KU7A 3RKXA 2CW0F 2AXLA 2P5LC 2JJ2A 2XAHA 4S0HB 1ULYA 2WJVA 5IYRA 3SZEA 4ACAA 3UW0A 2D1HA 4DNCA 1TC3C 5FLVA 1E79A 1ZELA 2EIJH 4P96A 2Q8KA 4HLYA 2CQNA 3PVDA 2K3FA 4LD5A 5BNGA 5J1RA 1U8RA 1VI0A 3B78A 2VBKA 3B6AA 3ERED 3OP1A 2ZZFA 5GAHJ 1S0UA 4OJ5A 3GTKJ 2V9KA 3FX3A 3HTUA 3H09A 4IOAF 4AC9A 2TDXA 2IPQX 2ZB9A 5FGMA 2IW5A 5FRNA 4MO7A 3UR3C 3I64A 1TYVA 4LBYA 2JUGA 1A04A 4JOMA 3SXYA 5ILVA 1KK0A 3NAWA 4N4NB 4M3EA 3UKGA 2V26A 3BDDA 1ZN2A 2Q2EA 3BC8A 1YHQI 1K61A 3OZWA 1D1NA 2STWA 2GJRA 3HB9A 4KMFA 3WTUC 3HOWJ 1A35A 3K70D 2OTLB 3AVWA 3K2ZA 4Y7CA 3OYGA 4BU2A 4G7WA 2CRVA 3F21A 2COBA 3E0JB 2F4MB 1X3ZB 3S1MJ 3LJYA 1KK3A 1WZ2A 1B8IB 3PUFA 3MAJA 3K4NA 2GZWA 2KL4A 1M1EB 4P9UA 3J7YJ 4RDJA 2VXDA 2LF7A 2LTPA 2EV6A 1OISA 2ZXWH 1ZHFA 3LSGA 3SYTA 3FMQA 1XE1A 3K6GA 2YWEA 2DOFA 2FQ4A 1QH0A 2CC2A 3ZPPA 2XOKA 4B1RA 5GP9A 5J1UA 2VBVA 2JUCA 3I3LA 3VSLA 3LWFA 2LKXA 3QFCA 4IRIA 4B48A 2PJRB 1OHHA 1H42A 3MZHA 3DLAA 1E63A 3P4GA 1IDZA 3FXRA 3E6MA 4PSXA 5B1AH 2WAEA 4BS9A 4ROXA 4YCQA 1TNSA 1Y1VJ 1DBOA 3F8NA 2CW8A 3AL0B 4LIVA 4EJTA 4P25A 2G7HA 1Z7LA 4I84A 2E1OA 1FYMA 1O8EA 5K7FA 3DEUA 3K10A 5D6EA 3BTIA 1UD4A 4OIRF 3M1EA 5E3LA 4CCMA 2A5YB 4P3YA 3SKBA 4OWRB 4HYEA 3HIFA 3S16J 1ETVA 4BE0A 2NXNB 3MEXA 5KAFC 4DNRB 1L1IA 2EFWA 2X6OA 3NQOA 1CQTA 4IQJA 2WBMA 1BM9A 2JK3A 2DCEA 3TOBA 1R5GA 4ZDPA 3VOEA 3ZCOA 1S5LC 4RCYA 2DTZA 5CQEA 2DCUA 4D1QA 3OYEA 1IB0A 3N6ZA 4JX4A 2P6TA 4L9TA 4LK0F 5CPRB 1J59A 1WJ5A 2DJNA 3DBLB 4ZCMA 2PMZN 2B63J 3FPPA 4XOPA 2XAJA 3HGYA 1XGOA 2CUFA 3LAPA 2BVNA 4HRIA 1P7JA 4P55A 3EETA 1XGMA 3AVUA 1VQKI 2NOGA 2R92J 3A3GA 3I56B 4EV0A 3CUQC 2E2JJ 2VUMJ 4PJJA 5JBQA 2ZJQF 2IRFG 2R93J 2X53S 1M1KD 4CCJA 3S3MA 5D6FA 2A05A 1HG8A 2NNYA 2XUBA 3WU0A 5TY0A 3KYDB 1HLVA 2XEXA 3G71B 5DS0A 1MRZA 3K4MA 5AIPA 4RB2C 5IP7J 3OYNA 1IJFA 2HOEA 4JYKA 1ODDA 2DTRA 1I8DA 1ERDA 2V31A 2HVQA 4PFPA 1S4MA 4NQWB 3RKWA 3V76A 2HS5A 1KQ0A 4KDPA 5A8AA 3CD6I 4F92B 1WJAA 3RIQA 1D0XA 1MW7A 2A69F 3ML6A 3PUBA 2P4WA 4LOCA 5CYVA 2OUMA 3CCQI 5CVJA 4LBWA 1X0CA 1RMGA 1FJLA 4WX9A 4W8QA 5FLMJ 2IA1A 3HG9A 5EEHA 5IYDJ 1BPLA 1FNBA 1FNCA 2ME0A 2W25A 5K5QA 2R5ZB 4GO1A 2AQFA 3FKJA 4KIGA 3JR9A 3W2AA 1BMFA 5K7HA 2JSCA 4A2UA 2LF8A 2DA2A 1Z91A 2A61A 2FJ1A 3ABUA 2Y9ZA 1K83J 2RDPA 2F4IA 5BPIA 1FYLA 4XICA 3U1KA 4L0YB 3G1OA 1MD0A 1ZM4A 2X9DA 2HGCA 4C9YA 4JMQA 1EJ9A 2FEZA 1H9TA 3S17J 1OCOH 3RPUA 2JZYA 3MHPA 2F2EA 3A1YA 1D8TA 4ENNA 3WG7H 1FNDA 2G9WA 3C2HA 4ZZDA 4X6AJ 1S72B 1Q1HA 1R36A 1TWHJ 4BAYA 1VBLA 2CV0A 3VR6A 3LQQA 2XF5A 1T6SA 3PJRA 3VNVA 3NARA 1H80A 5LBQA 2VBMA 3LSKA 1JKPC 3GTQJ 2DO7A 3P5JA 2GOMA 2LYCA 2D5VA 4E7ZA 4OMYA 1E3XA 1KYWA 3KZZA 5HDKA 2W6JA 2EK5A 2OC6A 1I50J 3WNCA 2D2WA 2DJIA 1I6XA 2E2HJ 1OGOX 1S7OA 4ZCIA 3JRGA 1Y1WJ 2OK7A 2EILH 4F55A 4TT3A 3CJTB 3DWLE 2JA5J 3PUMA 1W1WE 2PX9A 5HODA 4OPSA 5IYPA 2LFBA 2HYFA 2EFGA 2JN9A 5ILUA 1FBQA 5E1WA 2ZTGA 1QA2A 5DN6A 3JURA 1SFUA 3OW2B 4RS8A 3HKZN 2P5KA 5F27A 2XSDC 3Q0UA 3I56I 2GJKA 3WBKA 3KEQA 1MGTA 2EA4A 3JAMK 3FXMA 4PC7A 5DDGA 2O9LA 2BSPA 1Z1DA 4FCYA 1MDMB 5IYNA 3DBRB 1O3SA 3CMEI 2PMUA 1LLWA 5J3OA 4PDKA 1TT5B 1GVHA 2N8GA 3H9QA 4YFOA 4IRGA 4LLLA 2CK3A 1JTXA 3VMWA 3MCAA 4QVAA 1ETKA 2MLGA 2VI6A 4AU7A 1XPXA 2XC7A 1ENHA 2HXIA 2VBWA 4OZYA 3BQYA 3OL4A 3EUHC 2XTWA 4G6DA 4R1HA 2PYHA 2WB1N 3WE2A 1HDDC 3U2QA 4YEIA 1JJ6C 2EFQA 3G4SI 1CNFA 5DTDA 3CCVI 3CDHA 2YWFA 1D0YA 1BJZA 2CMPA 4MYUA 3PSSA 3B8HA 4RPDA 1NDHA 2DQRA 2MH2A 4LBZA 1MBKA 2VC0A 2V79A 3K0LA 1SD5A 2O3FA 3K9TA 3FXUA 2HI3A 1NRKA 2PMDA 1LDKB 1J9ZA 1SM4A 2X1DA 3J7AY 4IOCF 3J7AO 1G8XA 1X4PA 1KQ9A 1WFXA 4IXAA 4CYCB 3T56B 4KKSA 3QSYA 4UXNA 2HQNA 5A89A 1PUFA 1DABA 2ODLA 1MMGA 2VJ5A 2DA1A 4CDGA 1IRGA 3GXOA 1SKYB 1N8RD 4K2EA 2C2WA 1NK2P 4X05A 2VBXA 4CGZA 1ETWA 3OYDA 4YIIA 4OPOA 2CFXA 2OTJI 4OPVA 3BWGA 2GAUA 2GXAA 3G6EB 4IHSA 2NT6A 2ELHA 2IJLA 3OYCA 5IYCJ 1IJWC 2L9NA 2DDAA 2R7VA 2F43A 1BC7C 2KJCA 2D9RA 5IT3A 3DTKA 4LLNA 1V0EA 1LE8B 3KP3A 3OZVA 3D1NI 3C2BA 5ED4A 1VQPI 3B02A 2DMTA 2V7WA 4W8SA 3HOYJ 3Q5FA 1ON1A 3DKXA 1D3YA 4XKCA 4LITA 3I55I 4OOXA 1X2MA 3O8HA 4S04A 5EDNA 3KX2A 3AG3H 1HW1A 1SVOA 4FE4A 3AL0C 1Q9SA 2D3NA 3QOPA 5DUIA 1OYYA 2X1EA 2O0YA 3TOAA 5GV8A 3QFSA 2WSSA 3OY9A 1LQ1A 4OZZA 1WOOA 1P2FA 4KT6A 1D1CA 4HX7A 2I8DA 4QLCU 2R6HA 1JHFA 4FT8A 2HFHA 4MHGA 1CQXA 4RD1A 1FIPA 1QPIA 1LUJB 4C43A 4HLXA 4JQFA 1IC8A 1I27A 2M0CA 2BEOA 1YJNI 3Q9VA 4HNTA 4WWVA 3CCMI 3ZBTA 4KH3A 5E8GA 4Z4UA 2DBBA 3WBJA 4CA0A 3KLOA 3JRCA 2CF4A 2E19A 4X0GA 3OW7A 4KT5C 1O3QA 1OR7A 2BVLA 1KK1A 3HHGA 3R6SA 1VQ5B 4N3GA 1Z0XA 1A6QA 2XPUA 5ICGA 5A2QK 3E6CC 1RUNA 1YLFA 2V7XA 1H8HA 3ZMSA 2FRHA 3DBHB 2KIUA 4L0ZB 1QVUA 3RYPA 4YDTA 5HNHA 3G1LA 2D1VA 3Q39A 1X1AA 1YW7A 4KN7X 2NVUB 1XGNA 4ENJA 4BYYA 1PDNC 4BQAA 5D4RA 3I4NJ 2HDNB 3SLNA 2XASA 3CCUB 2M4KA 2HCJB 2M87A 1CLWA 2E71A 3HBLA 2IGMA 1AKHA 3CPXA 2BW3B 2VFMA 4I7HA 5BS6A 3OMYA 2R3SA 1Z3YA 2DA6A 1X1BA 2ECCA 1R5OA 5ERIA 1EA0A 1VQ6B 3WGGA 2QCOA 2GREA 2INUA 4HQEA 3DEWA 4PC2A 2BHYA 2VKEA 4G12A 4AD9A 3TKYA 3CO7C 3TBIA 1VLYA 2M45A 2DAOA 2QZ8A 3HRTA 3OIPA 1HVXA 4D7MA 4YHBA 3ZUGA 1WU8A 1FX7A 1POGA 2W57A 2QQ8A 1N25A 5FD5A 5DM6F 4QUZA 1V5VA 1FEXA 5JLXA 4C30A 2Y0SN 1HF2A 4FX0A 1ZAOA 4AIKA 2VKDA 4FWTA 2E2IJ 2X3UA 4CCNA 2UUZA 4XQFA 5THXA 1WJBA 4E0FA 3TMOA 5AONA 5C4JJ 2OPTA 3JAMZ 2XGEA 4GCVA 2HLDA 2FOWA 4OJOA 2NS7A 5BOXA 2E5NA 3S14J 4MIMA 3FBNB 3V8JA 1P9QC 4YRVA 2P7CB 4TKOB 2K9LA 4UUSA 2HKOA 2QUFA 5E1ZB 3RPUD 4RB3C 1Y39A 2QE7A 1DP7P 5DCMB 4P9SA 2KZVA 1OFMA 4GDFA 1H9GA 3OIOA 1RKTA 3IP4B 3EDPA 2QGUA 4MNUA 1IHMA 1ZM9A 2C77A 4DNTB 4KICA 4XORA 4HDVA 2L02A 3F3XA 1EA3A 1P7IA 2F5VA 1K8AD 1FMWA 2RGVA 1WI9A 3B8YA 4YZXA 4B8XA 3CC7B 2L7ZA 2XTXA 3MD2A 2QWWA 4DBQA 3SFIA 2HYJA 2VONA 1IXRC 1QGZA 4I99C 3W2VA 3GVLA 2XTYA 4HQMA 3LMMA 4JBAA 1VQ4I 2NVYJ 4ZV4A 3T51B 3U2RA 5HVQC 2ZJRF 3ZMUA 5EF6A 4HDUA 2ZSIB 3HOXJ 1LEBA 2VBZA 1UHMA 1ZM2A 4Y52J 2K9NA 2UXNA 2K4JA 4F7DA 4AIJA 2DT7B 2GLOA 4TMWA 3HOUJ 1XSXA 1FRQA 1TQPA 3LL7A 2V7QA 3GVKA 3RKYA 3HOZJ 1RIOH 2IVMA 1HSJA 4Z05A 1WJFA 5IYBJ 2F6CA 1W5TA 2FMYA 4WXCA 2VNIA 5FNZA 3BCAA 1PXZA 2E1RA 2CGPA 5IOZA 5HDNA 1F60A 1IUYA 2CV2A 3LSTA 4PZJA 3TEDA 3BG6A 4N3NA 3BG9A 4PCQA 3CCLI 1NH3A 3SQNA 3CW2A 3Q38A 3A4CA 1TVCA 3ASRA 4XRMA 5FA6A 2DK5A 3HRUA 2OK8A 1B1BA 2QY1A 1OCTC 2M0MA 1H0MA 3CRZA 1FOWA 4TMXA 3GQ8A 4JP0A 2NSPA 3SEZA 3PFIA 1NJID 1VQMB 2VNHA 2FU4A 1O8LA 3ZOBA 2Z9OA 1ETYA 3ZZ0A 1MSFC 2WAQA 4UVCA 1U3EM 2XB0X 5EYRA 1JE8A 2H8WA 3MMPA 2QSGX 2V5IA 2EH3A 2OF7A 3PQJA 2Y75A 4FX4A 1D2EA 2QA4B 1UD3A 2NV4A 1QFJA 2EZIA 3W3CA 1R5BA 4BEHA 3C7JA 1VQOI 2IP2A 1MMDA 3BTJA 4BHBA 4F52A 3LYCA 4P22A 1TSPA 4OPWA 1YX2A 2C5BA 3B90A 4HZFA 4CZCA 4CCOA 3IV5A 3PA2A 3S8PA 1FBUA 2PLYA 4X1EA 2DLLA 2P8TA 1HKTA 1U9NA 4RMNA 4XIDA 2GIZA 5ICEA 4UVAA 3KZYA 3ML3A 5CVVA 4BDZA 3GUDA 4ZDOA 2V7UA 3H0DA 1O8DA 1RI7A 3HZJA 1GVDA 4EGZA 4KFCA 2E1NA 3HAGA 1ETXA 3OE7A 1UHSA 4W8RA 1FTZA 3CCRI 2XGXA 4FHTA 1XX5A 4RLFA 1LPQA 1ZRDA 3DDYA 3OYMA 5EGOA 1KU3A 3KZIC 2YUHA 4DW6A 2J5OA 1IN4A 4YIFA 5JR3A 3A35A 5DCFA 2EPFA 4HAMA 4YFNF 1SMTA 1K78A 4X7FA 4LG3A 3JTGA 2DMNA 1GUUA 2JRMA 2BSAA 2BY3A 2ZCWA 2Q6LA 4I6ZA 4OIOF 2R7QA 2H6CA 4BE2A 4B47A 2J7KA 3FK7A 4ZYEA 5HNFA 3LQ6A 2NVXJ 3BY6A 2L7FP 2QMUA 4EJUA 4A5MA 1FP1D 1WKMA 3NWTA 3T8TA 1DPRA 4U87A 4YAUA 4W8TA 2O6GE 4RBOA 2LBFB 2B0RA 5B6IA 3LA3A 5M5XJ 1IXSB 5J1YA 4RDLA 3CMAB 3HUGA 2E60A 2RNGA 4KMUX 2IAIA 3BJOA 1NK3P 1OFDA 1JHHA 2ZXIA 3DXJF 2O61A 4Y17A 1LDDA 2V4DA 1N06A 4XLNF 2PQ8A 3F9KA 4B44A 1PE9A 4QPQA 1BX1A 4G6IA 3QP6A 3S32A 4OU0A 4RD0A 3EQLF 2XNDA 1T6ZA 2FA5A 3ZQFA 2E7WA 3OS1A 5LHHA 4MXNA 3S1NJ 1MKMA 3ZQCA 2IBDA 4AF6A 4I02A 1TWGJ 1AA7A 3PNVA 4PC6A 2LKPA 2ISZA 1UHWA 2CS3A 3SZPA 2OBSA 3W5UA 3SJPA 4HSTA 3HOTA 3IHUA 1E3PA 3FXLA 1WSRA 1ZRCA 2EIMH 4RPBA 4XK4A 3GMEA 1UG0A 4B3XA 4KJZA 3CCYA 1O57A 2QYOA 3W6KB 3M1CA 2QBYA 2VOPA 2B9SA 3HXLA 1VJSA 1EP1B 4U9UA 1LFPA 1VQ9I 1Z05A 3GZ5A 3BY1A 1CZFA 3QYFA 1KZHA 2E36A 3DTEA 1DDGA 4M9XA 3JQRA 2VPLA 3WTXC 4TMZA 1LVKA 4O3MA 2XHKA 2PMHA 4LJZF 3U6BA 5CLSA 4UZFA 3OIQA 3QE2A 5H6QA 3GFIA 2JQ7A 2NVQJ 1LLZA 1WJCA 2FSWA 1APLC 3L2UA 1YHQB 2E1CA 3BR0A 3GYHX 3CF5F 2VN2A 2O17A 2H94A 3FISA 3IAS2 2AO9A 1B2RA 2D74A 4HWVA 3J81K 4D9JA 3GQBA 4BE1A 1BN5A 4EJVA 1W87A 2OU2A 4PGGA 4GRIA 4D5FA 3K4KA 2ZBKA 2L01A 3I71A 5DS9A 1BW5A 3EQNA 1WWXA 2LY1A 1WTHD 4PSWA 2XAQA 2WWYA 5EZGA 1PLUA 1IDYA 3REOA 2DETA 2DW4A 5ICCA 4BPRA 1RR8C 4BUPA 2XAFA 1YS6A 1JUMA 4CCKA 1OYWA 2YU3A 4EGYA 1Y6IA 4A3DJ 3MCZA 4IZZA 3FZVA 2VJJA 3JREA 3DU5A 1WCMJ 3N97A 4ESBA 4OJLA 5DUKA 2R7ZJ 4MQ9F 1W7PB 2ZMEB 4RAFA 3A2KA 3CESA 1WH5A 1IW7F 2BM6A 4EM0B 3I58A 1TWCJ 3B6CA 4UV8A 4ON0A 2E1BA 2KZGA 3H35A 4ZCLA 4UHTA 2CV1A 3IAM2 4WCGA 2M3AA 1ETOA 1B23P 2WTEA 3BTLA 2TCTA 4NNJA 5H59A 3JRBA 3C3WA 2XGJA 3H9JA 4P1WA 3PIPF 2W82A 1V54H 2ZXJA 4ESFA 5CVUA 5FKKA 4A3KJ 1QVGB 3HGGA 4HPQA 3ISPA 4Y7NJ 3JQPA 2BHZA 2ZITA 3BZKA 4RM3A 4DYCA 3CZ6A 2XB5A 1OB5A 2P5VA 3V7SA 3HPHA 4YAOA 1CGPA 2M9HA 3RKQA 2CYYA 5J40A 1F1ZA 2WADA 4BHCA 2J8KA 3I4MJ 2LOOA 2WC2A 4TV7A 1CF7A 4Z4RA 4OAYA 4RGSA 2XPWA 1E3OC 5F0HA 3KP4A 5LGUA 1FC3A 4L5IA 4YXWA 3ZMVA 1EFTA 5LGNA 1KA8A 4LG0A 2JMWA 3WG9A 1A36A 3W6VA 1Z7UA 2RN7A 1DQUA 4ENKA 1VQKB 2ZJ2A 3RY8A 3GWZA 5M3MJ 2G7UA 4NK6A 2IEKA 3WTWC 1MBHA 1ITYA 2M5WA 4L18B 3R4KA 1Q82D 3OZUA 1PYVA 1KCCA 2QVOA 3HRMA 1JUSA 2JSPA 4Z4TA 2ZTNA 4PC1A 2M30A 2EIKH 1DGWY 3VYUB 3WTTC 1K4ZA 3WGIA 5J8FA 4NCNA 3GQ7A 4PC3A 1VHEA 2MBFA 1ZR2A 4JX6A 1QBJA 3BG5A 1XSDA 3K1MA 1G6NA 1MNDA 3CD6B 3NRVA 2VASA 3B82A 1BHEA 3RI4A 1YW9A 3CCQB 2JDIA 3A8JA 3G05A 1YJ9I 2BM5A 1R58A 2A6HF 2EA2A 1YIOA 1JA1A 5H6RA 4AUXA 3BNWA 4C0SA 4U4BA 3EUAA 3Q9SA 4PGHA 1V5GA 2DOGA 5HLTA 1EH8A 4YAFA 3F0CA 3G1MA 3PQKA 2YS9A 3H9NA 2OAZA 4GYGA 1ZG5A 2UXXA 1SFOJ 2ESNA 2HOSA 4HX8A 3E6BA 1UD8A 2NPFA 1OQYA 1HCRA 1YRNB 5CKTA 1QVTA 1E1RA 4LGWA 4J19A 1TT0A 1R00A 5LRRA 2Y31A 5FJ8J 4R71A 2HDWA 2KRHA 1TTTA 3BPXA 4L9VA 4NUBA 4P5OA 4RGUA 1N08A 3ZC3A 5EG0A 4A3EJ 1SVMA 1P4MA 3KE2A 1HA8A 3LMWA 1WP6A 4DOZA 5F4JA 1W7PD 1YYVA 3GF2A 4B43A 5E3NA 1U5TA 3RPQA 1WSVA 2OBTA 2ZNZA 2EZHA 1U78A 4OOSA 1VQ8I 2BE5F 2ICWG 4J0QA 4IJAA 1XCBA 3FXJA 2X6WA 4BHPA 3A01B 2HMAA 1O3RA 1LDJA 4A0XA 2KIFA 3WE3A 1FSEA 1T8IA 1BR4A 1R71A 4F7ZA 3WTSC 4BBSJ 3OSFA 3R60A 1UFMA 5AMVA 4OOIA 3AAFA 2B7EA 5HLIA 1K7AA 1HOMA 1BW6A 2W4SA 1USSA 1QU3A 4CYDA 4AC0A 3ZR8X 2L2OA 2HPIA 4Q4ZF 3G3ZA 1ZGJA 2KT0A 1J75A 1HKQA 3BPVA 3MZ8A 3F8MA 5EJCA 3CC4I 4P2NA 3RYRA 2RC4A 3BR5A 2O8XA 2P7VB 3ESWB 2GBYA 5E79C 3LVBA 3VYRB 3TO7A 3CMEB 1R1VA 4N0BA 1SEUA 4IKFA 3MN2A 4RD6A 4WZEA 2X0KA 1OKRA 5GPCA 2CQXA 1R1UA 3FY3A 1IAWA 1Y0RA 4LC0A 3L00A 2EZKA 1X1PA 3GTLJ 3ISXA 2YSRA 4XRSG 3VWBA 4A3GJ 1G7RA 5LGTA 3L2RA 3FJOA 3X2QH 3ZQ7A 4Y9RA 3P7NA 2AHOA 3JRIA 3H9GA 1WVRA 4YZQA 4A0YA 3K70C 3GTGJ 1T0FA 2OQGA 3GTMJ 4X7EA 3G4SB 3CP2A 1T6YA 2DIEA 3CCVB 2X3HA 2Q2EB 2L7MP 2DEUA 3CQZJ 2R5YA 3P26A 2P81A 2LG4A 2HXOA 3FDYA 1KC8D 2YR2A 4G5GA 3NEUA 2OJED 1IN5A 2P3MA 1BI2A 2EJRA 1N07A 2Z5UA 4A5NA 2KIQA 4U0YA 5GAGJ 1HXDA 4QWQA 3J7ZI 2NRAC 2PMZA 1BJAA 2VLAA 1W0JA 1TYXA 1P92A 2VBSA 4ZDLA 1JXSA 2F5DA 1E62A 1P4AA 3LSIA 1FTTA 4KKTA 3WQZA 5GTIC 2LRDA 3FHNA 1TQMA 2OTJB 4JRAC 2R7WA 1VQ7I 3AKZA 1K5CA 4WWCA 3OYLA 1FBSA 3I9V2 4X06A 3RQ4A 5E3OA 3M07A 1WJDA 1QQ1A 2UVFA 3W5HA 2WY8Q 3I59A 4DQ2A 4DGWB 3HOVJ 3HDDA 1F20A 2DA3A 5K1YA 1XQBA 4XSZF 1TBXA 1IGNA 4M1KA 2ZMEC 2P0WA 1FLIA 2GWRA 2V7FA 4C2MJ 2E1MB 1VQPB 4XLHA 3HYIA 2KDOA 5FFZA 2GK7A 4L5JA 1TL8A 3H5AA 4F91B 3I55B 3IL2A 2GQQA 2CQ7A 3E1SA 3FHZA 2CQKA 3WNBA 3D26A 2LP0A 2WPDA 1LM1A 1TLHB 4IEJA 3F6VA 1U0JA 2VB6A 2KDZA 4ZTJA 5D5WB 3D5LA 2CBXA 4DK0A 1MIJA 2M34A 3CDIA 1RRJA 3CC2I 1LJ9A 4BXXJ 1E2XA 4Z4YA 3R6KA 3GQ9A 5KW9A 5IT9K 5FKOA 3SY2A 4UUTA 3TDZC 4FXUA 1YJNB 2CH0A 4EATA 2VBYA 3JU4A 4EH1A 1F9NA 4V19K 2ME6A 3CCMB 1Q86D 2MABA 4PABA 3VEPA 1T98A 4Y33A 4M71A 1YITI 5LFAA 3F22A 2F48A 4ESJA 3O3KA 1ZUNB 3VSVA 3ZQQA 2VNJA 1R23A 1UAAA 2CW7A 2FUG2 3DF8A 4U0WA 1TUIA 1J5YA 2ADUA 3CB4A 4MFDA 2GOXB 3ABTA 2V1NA 2X6XA 2NZMA 3PO3J 5DYMA 1BIBA
chains in the Genus database with same CATH topology
2O0VA 4DNTB 3T53B 4XORA 3MKWB 1KCDA 3CMMA 3PNTA 3PNYA 1EA3A 2F5VA 5HKKA 1FMWA 1SAUA 5CQGA 1EFRA 3D5SC 4PMHA 1I18A 3HPGA 3B8YA 4YZXA 3MD2A 4DBQA 3M8JA 3GVLA 3W2VA 4XKWA 1DP3A 3LMMA 3EPZA 2Z8GA 3HKZA 2ZFUA 2PECA 2DXIA 3OL3A 4BQOA 3T51B 2IXSA 5HVQC 2RQQA 3SDBA 2R7RA 4BJTA 2A5WA 2ZSIB 3K4BA 4E7KA 5C1CA 2XZOA 4RLQA 2DT7B 3LSMA 4Y4RA 1KTWA 2V7QA 4Z06A 3LL7A 1T5EA 3GVKA 1W36D 3HL2A 4Z05A 1WJFA 3H5NA 4J00A 2R7UA 2F6CA 1O8JA 3DTIA 4DK1A 4OAZA 2R7OA 2LC2A 3BCAA 3BG7A 3BLYA 1PXZA 3T9GA 1QHHD 1X19A 2CV2A 2LY2A 2WA0A 3PFYA 4DIQA 3BG6A 2WB1A 3DKYA 2MYSA 4CSWA 5C1EA 4C2LA 2XSJC 2HNHA 5TGTA 3A4CA 4E7JA 3MMYB 3QYEA 1X4OA 2V6EA 4E6KG 3S3OA 2QY1A 2M0MA 3FBIB 2DT6A 4ASUA 3GQ8A 3VYTB 3FKSA 2KVOA 2NSPA 1YX5A 2R7XA 2ELJA 3SEZA 1GQ8A 1O8LA 2MC4A 1X1DA 2VQGA 2WAQA 3CF2A 2O04A 3OEEA 2R7TA 2GK6A 4XN3A 3K4CA 2LREA 3UNGC 2A6TA 3OYHA 2ZZEA 4C2UA 2K3PA 2XF6A 4ZC3A 1UD3A 2Z6BD 4XLCA 2VBEA 1UELB 3W3CA 2VKHA 1H8EA 4J01A 4PFOA 4BEHA 1MMDA 3D5RC 3LFUA 4F52A 4E7HA 2F1MA 1D1BA 4L8JA 4P22A 3B90A 2HQAA 4CZCA 4CCOA 3S8PA 1QJVA 3BH4A 1S9HA 4RMNA 4BDZA 4ZDOA 3H0DA 1O8DA 2JA2A 4R79A 1E43A 4BDYA 2JJ2A 2VQCA 1W9XA 2WJVA 2VL8A 2NTBA 2JIZA 2V4JC 1E79A 3OOCA 3HAGA 4W8RA 1ZELA 3OE7A 3UW0A 3CJQB 4RLFA 3DDYA 3OYMA 4TSFA 3QODA 2Z16A 3KRGA 2VBKA 3A35A 2ZZFA 3EUKL 4CUGA 2L9SA 2ZZGA 4OJ5A 2V9KA 4LG3A 3OWTA 3BCFA 4KITB 2VJ4A 3L2QA 1J09A 1DGRM 5FRNA 2M7AA 3UR3C 2R7QA 2JVHA 4BE2A 4B47A 2JUGA 4JOMA 5HNFA 4N4NB 3ZSCA 4BJ6C 4U49A 2V26A 3BC8A 3NWTA 3ONQA 4U87A 4W8TA 4YELA 2HPMA 3GQAA 2GJRA 2LBFB 1W36C 2XZLA 3ZGKA 4II3A 3K70D 4LIUA 2E60A 3OYGA 2RNGA 4BU2A 4G7WA 2QKLB 3OAAA 2QKMB 1OFLA 3E0JB 3L2VA 1D0ZA 2ZXIA 2V4DA 1O8KA 3F9KA 1PE9A 4B44A 3K4NA 4QPQA 4E7SA 2KL4A 4G6IA 4EW9A 3S32A 4XN0A 2XNDA 3PL8A 2VXDA 3OFNA 1T95A 4ANJA 1NG6A 3OS1A 2WJYA 4MXNA 3LSGA 2VQHA 3RTRA 3SYTA 1N78A 3K6GA 1NBMA 3ZPPA 1MMNA 1AA7A 3PNVA 4F93B 2E1MC 1N77A 2XOKA 2CS3A 2UV1A 4HNUA 4HSTA 4XL9A 3HOTA 2VIXA 3I3LA 3VSLA 4H4KC 4E7IA 1O8FA 1O8GA 3MKYB 1IB4A 1OHHA 4B48A 2PJRB 1UG0A 4XOTA 3DLAA 4KJZA 4B3XA 2BW3A 3M1CA 3BC9A 4PSXA 2WAEA 4BS9A 2INVA 1IDJA 3HXLA 1VJSA 1O88A 1LFPA 4NC8A 1DBOA 2CW8A 5IK2A 3AL0B 4LIVA 3OS0A 3QYFA 1CZFA 1Z7LA 1QCXA 3DTEA 2O0WA 4I84A 2KP6A 2VPLA 1O8EA 2O1DA 1LVKA 3K10A 1WMRA 4BL0B 3CJRB 2Y0SA 1UD4A 3S93A 4CCMA 1K6YA 4OWRB 3OOUA 4BE0A 2L7KA 4BQNA 2X8KA 2HVRA 4DNRB 3OIQA 4IQJA 2WBMA 1WJCA 2DCEA 4ZDPA 3ZCOA 3L2UA 5CQEA 4D1QA 3OYEA 4ZYAA 2KMUA 4UZUA 1O8HA 5CPRB 2VXZA 2O17A 1MNEA 3IAS2 1WJ5A 4HEA2 3FPPA 4XOPA 4HWVA 4D9JA 3GQBA 4BE1A 4KISA 1WJEA 4F3QA 4HRIA 4GRIA 2NT9A 3K4KA 3A3GA 2IS4A 2NTQA 3EQNA 2LY1A 1WTHD 4PSWA 3WWGA 4PJJA 4N4OB 1PLUA 3NWSA 1JTAA 2X53S 5HOOA 4CCJA 3S3MA 1PKVA 1NHCA 4BUPA 1HG8A 2M4GA 1R6RA 4CCKA 1N75A 1Y6IA 3BCBA 3DPUA 3K4MA 3OYNA 4IZZA 3S3NA 1I8DA 2V31A 2VJJA 3DU5A 1ERDA 2HVQA 4PFPA 4OJLA 4NQWB 4IQ4A 2X85A 1D1AA 4F92B 1WJAA 1YE9A 2K9MA 3IUOA 3A2KA 1D0XA 4ZJZA 1MW7A 3CESA 3PUBA 1X0CA 1BR2A 2OUMA 2R7SA 4KKUA 1RMGA 3B4NA 2E1BA 2HU9A 3H35A 4W8QA 3HG9A 2CV1A 1UD6A 3IAM2 3OYKA 2M3AA 1BPLA 3U21A 5FL7A 4MR0A 3A3BA 4NNJA 3KYLA 2AQFA 3FKJA 3OS2A 2W7NA 3H9JA 2JJ1A 3W2AA 2XGJA 1BMFA 4P1WA 2W82A 3K4JA 4CH7A 2IGNA 2F4IA 3RCOA 4HPQA 2IQ7A 3VMVA 4RM3A 1VF7A 3CZ6A 3AFHA 4C9YA 3EQOA 4JMQA 4XR6A 3HPHA 3HC7A 2WADA 3A1YA 4C2TA 5FRMA 1NG7A 1FX0A 2LOOA 3C2HA 4OAYA 1VBLA 3OYBA 2CV0A 3VR6A 3L2WA 2XF5A 4YXWA 1BOBA 3ZPNA 3PJRA 3DQVC 2IGKA 4DJAA 1H80A 2VBMA 3LSKA 1DQUA 2GOMA 2LYCA 4E7ZA 1E3XA 2W6JA 2R9VA 1O8MA 2OC6A 3QOEA 4NK6A 3SUCA 2DJIA 1OGOX 3OYFA 1IDKA 2NSTA 2WY7Q 4NC7A 2QX3A 1PYVA 1KCCA 2IS2A 2JSPA 4PJNA 4F55A 4TT3A 2ZTNA 1DBGA 3DWLE 1YX3A 3VDXA 4XLAA 1V5EA 1DGWY 2LH9A 3VYUB 2ZTGA 1UD2A 5DN6A 3OR2C 3JURA 3GQ7A 2BOLA 2X1CA 2GJKA 1OOCA 4E4HA 1MNDA 3GVJA 3GRHA 2MD0A 2VASA 4MLOA 1BLIA 1OLTA 1BHEA 3VSUA 4XLFA 2JDIA 2BSPA 3G05A 3DPLC 4BJ5C 2HVSA 1E1QA 3SZGA 2QXZA 3H5RA 2ZZQA 1BR1A 1Z3XA 4RM2A 4BQQA 4G7XA 3H9QA 2CFOA 3EUAA 4U4BA 2CK3A 2EWEA 3VMWA 4ZTFA 3GBGA 3OYJA 1V5GA 4AU7A 3K4LA 3V42A 2XC7A 4NK8A 5HLTA 2PYGA 4OZYA 3OL4A 3EUHC 4BACA 2NOJB 1QHGA 2KHMA 2PYHA 4PJLA 1UD8A 4YEJA 3TL4X 1E1RA 3C2GA 5CKTA 1PJRA 1V5FA 2XAUA 1D0YA 1TT0A 2CMPA 2WZPP 4OJ6A 1HZEA 4PUSA 2HDWA 2KRHA 2K5CA 4NUBA 4P5OA 3N05A 1X1CA 2XF7A 3OYAA 4B3FX 1HA8A 3LMWA 1FMVA 1WP6A 4DOZA 4GQNA 2KLOA 3VSKA 4B43A 1NRKA 5CDFA 1LDKB 3PSIA 4FETA 1V0FA 2X1DA 3J7AY 1G8XA 3VYSB 1X4PA 1MABA 3VSTA 1WFXA 3T56B 4KKSA 2X6WA 4XONA 2W6IA 2IGOA 4BEHB 3ZXSA 2ODLA 1MMGA 2VJ5A 4XKVA 1BR4A 1SKYB 4QPOA 1IA5A 5AMVA 1IRXA 2ZSHB 1COWA 4BXFA 3OYDA 3OYIA 3G2BA 2LBFA 2JVGA 2NTPA 2W4SA 2NT6A 1QU3A 2XZPA 3OR1C 1RWRA 3OYCA 4B3GA 3ZR8X 2L2OA 2MFZA 2HPIA 3DEEA 2L9NA 4PJMA 2R7VA 2F43A 1XG2A 2O5RA 2X51A 3DU6A 1G59A 2D3LA 1RU4A 3DTKA 4XNFA 1V0EA 3ZRGA 2KRCA 4W8SA 1EE6A 4E7LA 2XDVA 2W1OA 1LKXA 1T0FC 4G6TB 3DKXA 3VYRB 4XKCA 4LITA 4IKFA 4YZ0A 1AIRA 3KX2A 2D3NA 3AL0C 4PK4A 3FY3A 1MMAA 1OB0A 2X1EA 2VQLA 1GLNA 4DBRA 3VWBA 3OY9A 2WSSA 2Z1DA 4FASD 3L2RA 2PJRA 4OZZA 2W00A 2KQRA 4U7BA 4KT6A 4YZQA 3H9GA 1D1CA 2I8DA 3K70C 4HG2A 2X6YA 2M5SA 1TZLA 1JRGA 3CP2A 5KNLA 2DIEA 1OR7C 2Q2EB 4AYBA 4JQFA 2WAFA 3ZIAA 2X3HA 4Z03A 2LG4A 3FDYA 4HNTA 2Q1ZB 3HUGB 2BVMA 5FROA 4CA0A 4X0GA 4XLEA 3OW7A 2IS6A 2BVLA 1W0KA 2PMZA 2VLAA 1W0JA 3CP8A 1E3ZA 3SEQA 4ZDLA 2L5QA 2RREA 1VZ0A 1H8HA 1Z21A 3LSIA 4KKTA 3WQZA 2M7BA 2LRDA 3FHNA 4IX7A 5HNHA 1UD5A 3H94A 2VJIA 2R7WA 1X1AA 3AKZA 1K5CA 2R4GA 3LSHA 4YZAA 4XMYA 3I9V2 3OYLA 3PSFA 3RQ4A 2M4KA 2UVFA 1WJDA 5KCMA 2AQEA 2WY8Q 1OGMX 4Z1MA 2IGMA 4DGWB 2E5ZA 2BW3B 2HZDA 1WPCA 3OMYA 4II2A 1Z3YA 1O8IA 1X1BA 2P0WA 2V7FA 2Z2SB 2E1MB 3OEHA 4XLHA 3RSNA 5JHFA 2UWMA 2KDOA 2INUA 2GK7A 4XKBA 2LZJA 3H5AA 4F91B 4OJPA 3E1SA 3TBIA 1VLYA 3OPOA 3OIPA 1HVXA 4HSRA 1KZLA 2WPDA 2CUZA 1SFKA 4XD7A 2ZXHA 1U0JA 2VB6A 4ZTJA 3HOSA 3D5LA 4C30A 4XM3A 2IS1A 2KPMA 4DK0A 4HIZA 4CCLA 3LNNA 3GQ9A 2VKDA 3DPTA 4CCNA 5KHDA 2UUZA 4XQFA 2DOAA 3MKZA 1WJBA 3KEWA 4FXUA 4E0FA 2CH0A 3TMOA 4EATA 3JU4A 2CUJA 2HLDA 4URRA 2MABA 2UVEA 3KEYA 3QYBA 1K28D 4BGDA 3BCDA 4AVZA 4OJOA 1JI8A 2E5NA 4Y33A 1E0EA 5LFAA 1Y56A 3VSVA 3FBNB 3ZQQA 4YRVA 1P9QC 1UAAA 2CW7A 2FUG2 2K9LA 1KMHA 3NE5B 4TKOB 3RPUD 2QE7A 3W2WA 1KONA 2KZVA 2GJPA 1BN8A 2GOXB 4ITVA 2V1NA 1OFMA 2X6XA 2NZMA 2OV7A 3IP4B 4Y3OA 5LD2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0V A;  4XNF A;  4XOR A;  4W8S A;  4U49 A;  1EE6 A;  3ZSC A;  1KCD A;  4W8T A;  4YEL A;  3GQA A;  4PMH A;  4YZ0 A;  1AIR A;  2IQ7 A;  3B8Y A;  4YZX A;  3VMV A;  3EQO A;  3FY3 A;  1OFL A;  4XKW A;  4XR6 A;  2Z8G A;  1O8K A;  4OZZ A;  2PEC A;  1PE9 A;  4YZQ A;  4EW9 A;  4XN0 A;  1VBL A;  2X6Y A;  1JRG A;  5C1C A;  4MXN A;  2X3H A;  1KTW A;  1H80 A;  2VBM A;  4Z06 A;  4Z03 A;  3ZPP A;  1O8M A;  4Z05 A;  1O8J A;  4NK6 A;  3SUC A;  1OGO X;  1IDK A;  2NST A;  4XL9 A;  1O8F A;  2QX3 A;  1O8G A;  1PXZ A;  1IB4 A;  1KCC A;  3T9G A;  4XLE A;  4XOT A;  1DBG A;  5C1E A;  4C2L A;  4XLA A;  2INV A;  1IDJ A;  1O88 A;  3JUR A;  1DBO A;  3GQ7 A;  1CZF A;  1QCX A;  1OOC A;  2O0W A;  2QY1 A;  4I84 A;  1O8E A;  2O1D A;  3GQ8 A;  3GRH A;  3VSU A;  2VJI A;  1BHE A;  1WMR A;  2NSP A;  4XLF A;  1K5C A;  2BSP A;  4YZA A;  4XMY A;  1GQ8 A;  1O8L A;  2QXZ A;  2UVF A;  1OGM X;  2O04 A;  4U4B A;  2EWE A;  4XN3 A;  3VMW A;  1O8I A;  4NK8 A;  2PYG A;  4OZY A;  4XLH A;  2INU A;  4XLC A;  2VBE A;  1O8H A;  2O17 A;  2PYH A;  4OJP A;  4YEJ A;  4XOP A;  4HWV A;  3B90 A;  4OJ6 A;  2NT9 A;  2NTQ A;  1QJV A;  3EQN A;  4XM3 A;  3WWG A;  3LMW A;  1PLU A;  1JTA A;  1NHC A;  1HG8 A;  3GQ9 A;  1O8D A;  4XQF A;  3VST A;  2X6W A;  2NTB A;  3UW0 A;  4XON A;  4W8R A;  2ODL A;  2VJJ A;  4XKV A;  4URR A;  2UVE A;  4OJL A;  1IA5 A;  4OJO A;  5AMV A;  2X85 A;  4AVZ A;  3KRG A;  2VBK A;  3VSV A;  1X0C A;  2NTP A;  4OJ5 A;  2NT6 A;  1RMG A;  1RWR A;  3B4N A;  1XG2 A;  4W8Q A;  1BN8 A;  1OFM A;  4MR0 A;  2X6X A;  2NZM A;  1RU4 A; 
#chains in the Genus database with same CATH topology
 4G1B A;  2HTJ A;  3T53 B;  2F5E A;  3BR3 A;  2OCC H;  3QPS A;  1KYZ A;  3PNT A;  1HC8 A;  4UVB A;  1QZZ A;  2C4T A;  2K4B A;  4Y13 A;  1I18 A;  1YTY A;  3C1D A;  2I1L A;  3M8J A;  5L3G A;  2GXG A;  2RQP A;  2LKS A;  1DP3 A;  3HKZ A;  2F4N A;  2ZFU A;  2DXI A;  4BQO A;  1GXP A;  3SZT A;  4LMY A;  3WND A;  1I1G A;  1TYW A;  5C1C A;  2XZO A;  2XT2 A;  3CUO A;  2BMW A;  1KTW A;  1X2N A;  2A68 F;  1WDT A;  3FMS A;  4AWX B;  1T5E A;  4WZK A;  4P9F A;  3HL2 A;  1SFE A;  3H5N A;  2JTV A;  1ZQ3 P;  3GTJ J;  3CCE I;  5HDG A;  6PAX A;  4DK1 A;  1TWF J;  1JKO C;  3U1D A;  4LB5 A;  3T9G A;  3BY2 A;  2YWG A;  1X19 A;  2LY2 A;  4DIQ A;  2WB1 A;  2V1X A;  2BY2 A;  3GFM A;  1K8F A;  1XDU A;  1V3F A;  4NDL A;  4E7J A;  1XMA A;  4CO8 A;  1FOY A;  1JKR C;  2DT6 A;  4ASU A;  1QA3 A;  3ZP5 A;  1L3L A;  3BTC A;  3VYT B;  3FKS A;  2E34 A;  2HZT A;  1YX5 A;  5BQT A;  2ELJ A;  2BGJ A;  1GQ8 A;  1ZH5 A;  1AIP A;  2K86 A;  1TP4 A;  2MC4 A;  4A6D A;  1X1D A;  1ZGW A;  3CF2 A;  3LQE A;  2O04 A;  4ASN A;  2VFO A;  3OEE A;  3FF5 A;  1SMY F;  3UNG C;  2A6T A;  3BR2 A;  1R5I D;  2ZZE A;  2ZO4 A;  3ERM A;  2XF6 A;  4V2F A;  4ZC3 A;  3JRH A;  3DP7 A;  3LSP A;  1E17 A;  2Z6B D;  1SFX A;  1YI2 I;  1HBX G;  2VKH A;  2EFO A;  3FM5 A;  1H8E A;  1UMK A;  4PFO A;  1OCR H;  1W0T A;  2QTZ A;  3SYJ A;  1OCZ H;  1KQS B;  3H0G J;  3D5R C;  2F1M A;  1D1B A;  3K1P A;  4ZGQ B;  1VQ4 B;  3BH4 A;  2ELK A;  4Q47 A;  1UG2 A;  1S9H A;  5F4M A;  4NBS A;  1HDP A;  1RPW A;  3L09 A;  2VE8 A;  5L3F A;  2QYU A;  1UZC A;  2JA2 A;  1J7K A;  2XRN A;  4R79 A;  4BDY A;  1E43 A;  1GV5 A;  1W9X A;  3ZQL A;  2QSH X;  2HR3 A;  2VL8 A;  4U0V A;  3OOC A;  3MZY A;  5L46 A;  1ZG1 A;  2XPV A;  1BA5 A;  4RAY A;  3VB2 A;  1OJL A;  2FNA A;  3QOD A;  3WTZ A;  5BPD A;  4XRS A;  1MMS A;  2QEX I;  3DV8 A;  2X48 A;  1O7L A;  2M1B A;  3EUK L;  3N4M A;  2ZZG A;  2ID6 A;  2FD5 A;  3QPH A;  2F4O B;  3ASP A;  1QA6 A;  3JCU C;  5JI6 A;  3OWT A;  3BCF A;  3CCL B;  1YO5 C;  1HW2 A;  1AWC A;  1DGR M;  2M7A A;  1R5H A;  1DU6 A;  4OIQ F;  3FWE A;  5BMZ A;  1R9T J;  3I54 A;  1FP2 A;  1XSV A;  1PUF B;  2ZBU A;  2DER A;  2BYV E;  4EMS A;  4X0C A;  1PVE A;  4BJ6 C;  3GVA A;  3R0A A;  1XFO A;  1LVA A;  2XZL A;  3O2P E;  2B7B A;  4LIU A;  2YPR A;  3FK6 A;  5FO0 A;  2K9S A;  2QKL B;  3BP8 A;  5GTH C;  3T8R A;  5HS8 A;  4UB8 C;  1D0Z A;  4YAW A;  1KU9 A;  3EYI A;  3I53 A;  3ZZU A;  1W0U A;  4E7S A;  4OP7 A;  4EW9 A;  1B9N A;  4MEY F;  4X7C A;  1BIA A;  1ZRE A;  2BBY A;  5B5E C;  1VQO B;  1T95 A;  4ANJ A;  2WJY A;  4IL6 C;  2VQH A;  3KCC A;  4U88 A;  1N78 A;  3P9C A;  3LFK A;  3Q6R A;  1FIA A;  1NBM A;  4HX4 A;  4A6E A;  2BX6 A;  4F93 B;  1N77 A;  3IRR A;  2E1M C;  1WXR A;  3LSR A;  1TQI A;  2UV1 A;  1OFE A;  3P27 A;  2DMQ A;  2BM0 A;  3ONY A;  4H4K C;  1O8F A;  1O8G A;  2H27 A;  3MKY B;  4Q48 A;  2J5P A;  2CQQ A;  2DYI A;  4KIF A;  5JMC B;  2FBH A;  2IA2 A;  1K6O A;  1JJ2 B;  3BC9 A;  2INV A;  1IDJ A;  3CCR B;  1E64 A;  4YC5 A;  4IHW A;  4RGX A;  2RNJ A;  1FNM A;  2ZFW A;  5TRD A;  3VPR A;  2E35 A;  2GQF A;  1QCX A;  2VFQ A;  3GLL A;  4A0Z A;  1EV7 A;  2KP6 A;  2O1D A;  1GVJ A;  1ETQ A;  2ESH A;  1R22 A;  4IPA A;  1G3Y A;  4BL0 B;  2YX4 A;  1ZTR A;  2JPC A;  2Y0S A;  3CJR B;  3S93 A;  4GGG A;  4AYB N;  4DZP A;  3IKT A;  3I0T A;  3OOU A;  3BOQ A;  3SQV A;  1MJB A;  2L7K A;  2X8K A;  1SVL A;  5D4S A;  1S3J A;  1KQ8 A;  4V2G A;  2M8G X;  1QQI A;  3E5X A;  1ACI A;  3CJN A;  2VXZ A;  5L3B A;  4DQL A;  4HEA 2;  5F6F A;  4HW0 A;  3I1F A;  1GXQ A;  1JB9 A;  4DQK A;  3IH3 A;  5KVR A;  1WJE A;  4YIR X;  1JTY A;  5CVI A;  4LB6 B;  2NT9 A;  4K1X A;  1ELO A;  2NTQ A;  4A3M J;  1AKH B;  2EB7 A;  3T1B A;  3ZQG A;  2JA7 J;  3WWG A;  1YIJ I;  1B9M A;  3NWS A;  1JTA A;  3LAJ A;  4TN1 A;  1PKV A;  1SAX A;  2FNP A;  3CCJ I;  1D5V A;  3FXO A;  1N75 A;  2FBK A;  4P3I A;  5FKN A;  1VQN I;  5FD6 A;  2ZJP F;  3GCM A;  2EFN A;  1DG1 G;  4Q7J B;  1H85 A;  3CUQ A;  1KJZ A;  4FTH A;  2HYG D;  4IQ4 A;  1O4X A;  2X85 A;  4WXH A;  1D1A A;  1YE9 A;  1X3U A;  3ABL H;  4ZJZ A;  2BPO A;  2W24 A;  1BR2 A;  1JKQ C;  1Z67 A;  2DFE A;  2Y48 A;  4KKU A;  2KJB A;  5LEJ A;  1VQ9 B;  1UD6 A;  1FY7 A;  2Y0M A;  4BH9 A;  4LLG F;  3KYL A;  2JJ1 A;  3HHH A;  4WK8 F;  5FB2 A;  3GZN B;  3IC7 A;  5C4X J;  1YFH A;  1BI3 A;  5A2Q Z;  1B72 A;  1WPK A;  1UB9 A;  2CJJ A;  3MQ0 A;  2CRG A;  5DV5 A;  4M0L A;  3K1N A;  2CO5 A;  2IQ7 A;  3VMV A;  5J35 A;  1W4M A;  4I0A A;  5HXB A;  1VF7 A;  1J9I A;  4UUS B;  5BSY A;  2QM3 A;  2FF4 A;  4XR6 A;  1GHC A;  1JGS A;  1BOA A;  5FRM A;  4C2T A;  1EFC A;  1NG7 A;  1FX0 A;  1W2B B;  4CXF A;  1MBG A;  1F43 A;  1IV6 A;  1QUF A;  2F5F A;  2EWN A;  2ZKZ A;  5DD8 A;  5DM7 F;  3L2W A;  2OQR A;  1AHD P;  3D0S A;  5F4O A;  3ZPN A;  4YFK F;  2X4H A;  3DQV C;  2IGK A;  4DJA A;  3WTY C;  3WU1 B;  2XRO A;  2HEO A;  3S1Q J;  3KP7 A;  2PIA A;  1MBJ A;  4XBF A;  4AIH A;  1QG0 A;  4HF0 A;  1IG7 A;  2R9V A;  1ZGA A;  3AVV A;  2DQL A;  2NST A;  5K7Z A;  2WY7 Q;  3GFL A;  4NC7 A;  2QX3 A;  2XVC A;  1Z77 A;  2V1D A;  3CCS I;  1E3H A;  2QQB A;  1N0U A;  5GAD J;  2M8E A;  1TNT A;  2NAZ A;  2V1U A;  1GAQ A;  1NB0 A;  1DBG A;  4XLA A;  1V5E A;  2LH9 A;  5CJ9 A;  5LEK A;  1XB4 A;  1UD2 A;  1J0R A;  3AST A;  5B66 C;  3BZC A;  2VPR A;  2BOL A;  1IF1 A;  2ZBV A;  2G0Y A;  1G3T A;  2X1C A;  4E4H A;  3L2C A;  3VFZ A;  1K9M D;  2L4M A;  2MD0 A;  3MKL A;  3JSP A;  1OLT A;  2XNJ A;  3VSU A;  3WY9 A;  4U7D A;  2Z33 A;  4BKX A;  3DPL C;  2QSF X;  1OFC X;  2HDC A;  2QGG A;  2OZU A;  4RAG A;  4BJ5 C;  2HVS A;  1E1Q A;  3A0B C;  2JWT A;  3IWZ A;  3H5R A;  1RQR A;  1FNN A;  1Z3X A;  4BQQ A;  3E97 A;  5FFX A;  5F04 A;  3HM5 A;  2LK2 A;  2DA4 A;  4CQJ A;  4ZTF A;  2EWE A;  1L0O C;  3K4L A;  2L4A A;  2HOT A;  1W35 A;  2PYG A;  2Z3Y A;  4C3I J;  4BAC A;  2BY1 A;  4RD3 A;  3QPT A;  5E6T A;  3BRO A;  4QHY A;  4HA8 A;  2XC1 A;  1SD7 A;  4QVJ A;  4EJW A;  3COA C;  1DDN A;  1PJR A;  3J81 k;  4QV2 A;  4XRF A;  2ZNY A;  3Q0V A;  2MC3 A;  1HZE A;  3ZPL A;  2E7X A;  5L3E A;  3K2A A;  4HV6 A;  3EUH A;  1X1C A;  2XF7 A;  4B3F X;  2C4U A;  3CLQ A;  4KNY A;  2UZK A;  1T6X A;  1F36 A;  4MYT A;  3VYS B;  3ES9 A;  3VST A;  3BR6 A;  5D8K B;  1NTC A;  1G7T A;  4G8X A;  2IGO A;  4BEH B;  3GEZ A;  5J8C A;  1P4W A;  2IT0 A;  5ICF A;  4XKV A;  2ZL5 A;  3R0J A;  4QPO A;  1IRX A;  3F8F A;  4RGR A;  4BXF A;  1RR7 A;  3JW4 A;  2PN6 A;  4WZL A;  3E3V A;  4CZZ A;  3S1R J;  3IKV A;  2JJ7 A;  2RC6 A;  4HF1 A;  3OR1 C;  4G7Z F;  5IYQ A;  4PJM A;  5AIQ A;  3DEE A;  3TW7 A;  1B8I A;  1SAN A;  2LD5 A;  1G59 A;  3V8K A;  4XNF A;  1NHA A;  2ID3 A;  2KRC A;  3ZRG A;  4QFM A;  3FM3 A;  1P6R A;  3HEF A;  1EXM A;  3ZMD A;  1YJ9 B;  2JRT A;  2LNB A;  2XDV A;  2W1O A;  1LKX A;  5EGO B;  4E7L A;  2ISY A;  2W84 A;  3SJZ A;  2QEN A;  4YZ0 A;  1XMK A;  1K78 B;  2DYR H;  3LA7 A;  4PK4 A;  3S2W A;  1K4S A;  2GM4 A;  1OB0 A;  2LSO A;  2VQL A;  4G1V A;  1GLN A;  2GIV A;  2Q0O A;  2XGC A;  4DBR A;  2EIN H;  2DMU A;  4FAS D;  5TIS C;  2H8R A;  2F5C A;  2PJR A;  1JA0 A;  1MJA A;  2F1L A;  3AGP A;  3ASQ A;  4MTE A;  4U7B A;  4HG2 A;  9ANT A;  2M5S A;  1IO2 A;  4A3F J;  1PUE E;  3GLX A;  1WOR A;  1OR7 C;  3ZIA A;  3GX4 X;  2WAF A;  4RDU A;  4YAL A;  4EQQ A;  4Z03 A;  2EFP A;  2PLF A;  3FMR A;  1D8K A;  2QQA A;  5JVG F;  2O7O A;  5HLH A;  2NS8 A;  1T38 A;  4L5E A;  3HUG B;  1UMQ A;  5FRO A;  1KRH A;  3PSZ A;  4N9I A;  1U9O A;  3SLD A;  4RJL A;  2YX7 A;  1VQ8 B;  4XLE A;  1Y0N A;  2IS6 A;  4L9J A;  3SEJ A;  2MG4 A;  2XAG A;  2B7C A;  1W0K A;  1HST A;  1XTA A;  2B5O A;  1U2R A;  2LR8 A;  3HTS B;  1TTY A;  3H3V K;  3E20 A;  5IOY A;  2L5Q A;  4BNC A;  4GYI A;  1Z21 A;  2XV4 S;  2M7B A;  3H1C A;  1QGA A;  4IX7 A;  2CWE A;  3F72 A;  2QZA A;  3H94 A;  1ZLJ A;  2V9V A;  2VJI A;  3MWM A;  3Q3S A;  2R4G A;  5GV7 A;  4YZA A;  5D5V B;  4M6X A;  2DOD A;  3QPL A;  3LNQ A;  2ZL6 A;  3ZQH A;  2HZD A;  2QBY B;  2L0K A;  2Z99 A;  1AMO A;  3CC4 B;  2VOO A;  1BC8 C;  2Z2S B;  1WRJ A;  5JHF A;  1ZYR F;  3RSN A;  3JRF A;  1I1S A;  2UWM A;  1MH3 A;  2WR8 A;  1O8K A;  4YFX F;  1RC9 A;  2TRT A;  2LZJ A;  1XD7 A;  4RB1 A;  4OJP A;  3A8K A;  3OPO A;  4ABZ A;  3ZN0 A;  2BY0 A;  5FO5 A;  4HSR A;  4NQW A;  1SFK A;  1A6I A;  2BGC A;  3T5X A;  2ZXH A;  3HOS A;  1JUP A;  2R0Q C;  5JVT A;  4XM3 A;  4RAZ A;  5LHI A;  1UST A;  2STT A;  2CSO A;  1I6H J;  2OA4 A;  2K40 A;  4MEX F;  3DPT A;  5KHD A;  2WYR A;  4IHY A;  3ELK A;  3MKZ A;  3KEW A;  3PEN A;  2R5Z A;  3BH6 B;  2A3S A;  1WOP A;  5KSW B;  3KP6 A;  2RV8 A;  5E17 F;  2CUJ A;  4URR A;  2FXA A;  2UVE A;  5IPA A;  3KEY A;  3QYB A;  3BCD A;  1IN7 A;  4BGD A;  4I76 A;  3QU6 A;  3E7L A;  3V4G A;  2FBI A;  3F8B A;  4ZYG A;  1E0E A;  1XS9 A;  2VOD A;  2QLZ A;  5LMZ A;  4G94 A;  1DUX C;  2A07 F;  1QRB A;  3BT9 A;  3LOC A;  3OV8 A;  4L9N A;  3W2W A;  1EP3 B;  1JNY A;  4X07 A;  1QNT A;  1MBE A;  1BN8 A;  4ITV A;  3MFK A;  2M2E A;  2DPU A;  1EKE A;  3QFR A;  1IN8 A;  3JSO A;  2NS0 A;  4Z2Y A;  1VQ7 B;  3F6O A;  1LFU P;  5A88 A;  3MKW B;  4EM1 A;  3R6J A;  4O6J A;  3Q3A A;  2V7T A;  5BSX A;  2BV3 A;  1SAU A;  1EFR A;  4PJ0 C;  3TDU C;  3HPG A;  4P1V A;  2QQ9 A;  4O5V A;  1XMX A;  2Z8G A;  4OIP F;  1YJW I;  3OL3 A;  3WTV C;  5JFR A;  2RQQ A;  3IH2 A;  2EIX A;  1FOX A;  1D8J A;  2JT1 A;  4MQV A;  4BJT A;  3CO6 C;  3GZ6 A;  3E6D A;  5M5W J;  4A3I J;  2OBR A;  4Z06 A;  1A8P A;  3JRA A;  1IZ1 A;  1W36 D;  4HF2 A;  1AU7 A;  1GR1 A;  3W2F A;  1YOV B;  2R7U A;  4JK1 X;  3DTI A;  2VT2 A;  2BN4 A;  2R7O A;  5DEQ A;  5JLW A;  2LC2 A;  3CC2 B;  3J81 Z;  1MDM A;  3BG7 A;  4A3B J;  1SD4 A;  1EP2 B;  5E18 F;  3GTO J;  4GXO A;  2AS5 F;  2K7L A;  1EH6 A;  3PFY A;  1CF7 B;  1K4T A;  5C1E A;  3DKY A;  2MYS A;  3JRD A;  1EF4 A;  1RKW A;  2EV5 A;  2XSJ C;  3GFJ A;  1XC5 A;  3SDG A;  5TGT A;  1MNM C;  1ZLK A;  1Q1V A;  1TW3 A;  4R8H A;  2ZL7 A;  3QYE A;  4KA4 A;  2V6E A;  4E6K G;  4LG0 B;  5TV2 A;  3S3O A;  3O6B B;  3HSF A;  5EEG A;  3E1Y E;  1KD1 D;  1YIT B;  2VC1 A;  3H3Z A;  3PUN A;  3BH7 B;  2KVO A;  2R7X A;  3W2H A;  2HQ5 A;  4B09 A;  1EFU A;  3J80 K;  5C3E J;  2L9R A;  1G2H A;  2FOK A;  5H5J A;  2KRF A;  2R7T A;  1XB2 A;  4XN3 A;  2OTL I;  2DK8 A;  1YS7 A;  2LRE A;  2XNC A;  2BM7 A;  1ZRF A;  2K3P A;  4C2U A;  1T2K A;  2DDB A;  2HKX A;  3S2H J;  2GPJ A;  2VBE A;  1ZAR A;  1LFB A;  4CYC A;  4IW3 B;  2KIS A;  2PJP A;  1A31 A;  2IA0 A;  2DYS H;  3LFU A;  2AHQ A;  4L8J A;  3I4P A;  4WZT A;  2OD5 A;  2HQA A;  3FKI J;  4M9Z A;  4LK1 F;  3CDL A;  2PG4 A;  1QJV A;  2GA2 A;  3P9I A;  1CNE A;  4BY1 J;  4OMZ A;  1GAW A;  1QRY A;  3PA1 A;  3QRF F;  1VLO A;  3K69 A;  1TYU A;  3W2E A;  2MGQ A;  5FKL A;  1OGI A;  2VQC A;  1IXC A;  2ZC2 A;  2Q6I A;  2NTB A;  2JIZ A;  2V4J C;  5FO1 A;  1QRC A;  1LE8 A;  2HTS A;  3CJQ B;  1JT0 A;  3CCE B;  4NC6 A;  4TSF A;  4WQM A;  1N05 A;  2Z16 A;  3KRG A;  4RD2 A;  1A5J A;  4MFE A;  5KK1 A;  4CUG A;  2H1L A;  2L9S A;  5EG0 B;  1U8B A;  1QGY A;  1XG1 A;  2V6C A;  3KPH A;  2VJ4 A;  4KIT B;  1U5T B;  1XN7 A;  5HLG A;  3L2Q A;  1FWZ A;  1J09 A;  1TLL A;  2CND A;  5FIU A;  2JVH A;  2AXT C;  3W2G A;  3JX8 A;  2DI3 A;  5GAE J;  3WXM A;  2FX0 A;  4KYW A;  2BGI A;  1ZK8 A;  4U49 A;  3ZSC A;  4D7N A;  1TWA J;  3ONQ A;  1IRZ A;  1B59 A;  4YEL A;  1QO0 D;  3WGH A;  2HPM A;  3GQA A;  2JA8 J;  1Y0Y A;  1W36 C;  4YG2 F;  4PAA A;  3ZGK A;  4II3 A;  1QUE A;  3GIR A;  1X3W B;  5J4V A;  1H89 C;  2WV1 A;  3A0H C;  3V7C A;  1OFL A;  3AG4 H;  5J3L A;  5M3F J;  1HF0 A;  3KFW X;  2QKM B;  4IRH A;  2C6Y A;  3M4O J;  3L2V A;  3OAA A;  3ZBU A;  3AG2 H;  1WOS A;  5F0C A;  1YI2 B;  2YWH A;  4XN0 A;  3A02 A;  3PL8 A;  4Z6Y A;  3OFN A;  4OM9 A;  1NG6 A;  2MA3 A;  2P6S A;  3RTR A;  2W48 A;  3WHC A;  2DOE A;  5JHU A;  3PIO F;  3G71 I;  1MMN A;  2DN0 A;  5D5U B;  2CG4 A;  4P12 A;  4QTR A;  2DPD A;  3CPW B;  3WHB A;  2K27 A;  1XDS A;  4HNU A;  4XL9 A;  2VIX A;  1IJE A;  4E7I A;  2NVT J;  3KL9 A;  2EQR A;  1Y8R B;  2HDD A;  1R49 A;  5J47 A;  1IB4 A;  2MH9 A;  2C5H A;  1Y0U A;  4XOT A;  3FPK A;  2BW3 A;  2CW5 A;  4HV5 A;  3DU1 X;  2EZL A;  1O88 A;  3R61 A;  2GXB A;  1HW5 A;  4NC8 A;  1ZG3 A;  4P6V F;  3AVX A;  2CUE A;  3H36 A;  3ZQI A;  4MGR A;  4E70 A;  3OS0 A;  5L3D A;  1B6A A;  4IHT A;  5IK2 A;  3RJP A;  2O0W A;  2QEX B;  1UCR A;  2R5Y B;  1Y8Q B;  2OYN A;  1WMR A;  3PET A;  2YUS A;  4WF2 A;  2WV0 A;  1S29 A;  2L3D A;  2OBP A;  4M6V A;  1K6Y A;  1OPC A;  3IRQ A;  2F3L A;  2IOU G;  3OOP A;  4BQN A;  2W7Z A;  2HVR A;  1BBY A;  2LDU A;  2R7D A;  5F1J A;  2BXY A;  4P6Y A;  2DFI A;  1GJR A;  1SD6 A;  3FXQ A;  4RA2 A;  3ECO A;  4ZYA A;  2KMU A;  4UZU A;  1O8H A;  1IUF A;  1MNE A;  5EEA A;  1S72 I;  4RB0 A;  1XGS A;  3CXC B;  5DNS A;  3VO2 A;  3H92 A;  4M4S A;  4KIS A;  4F3Q A;  4M6Y A;  4M3G A;  1R4N B;  3I59 B;  4D0P A;  2IS4 A;  1KK2 A;  1QX4 A;  1OCP A;  2PBI A;  3PM1 A;  5CVR A;  5ILS A;  3TP3 A;  5LRS A;  4N4O B;  4NBQ A;  4A3L J;  3AGQ A;  5HOO A;  1T33 A;  1NHC A;  3S15 J;  5DCM A;  1VF9 A;  2M4G A;  1R6R A;  3V7R A;  5C44 J;  3ASS A;  1Z6R A;  2DFF A;  1WGX A;  3HRS A;  4QSH A;  3BCB A;  3DPU A;  5J6X A;  3VOD A;  3S3N A;  3M7G A;  4B3A A;  3KET A;  1PJ7 A;  3KP2 A;  5TR9 A;  3ZN1 A;  4M53 A;  1QGP A;  1RZ4 A;  4H9G A;  3P9K A;  2K9M A;  3IUO A;  4Z4V A;  3J80 Z;  4DYR A;  2R7S A;  3BQJ A;  3B4N A;  4B4C A;  3BG3 A;  2XIG A;  1MH4 A;  2LY9 A;  2HU9 A;  3ASN H;  1WSU A;  3OJX A;  2B0L A;  3OYK A;  4FIS A;  4MR0 A;  3U21 A;  5FL7 A;  3ABK H;  1J2X A;  2L54 A;  3A3B A;  5F64 A;  2XGD A;  3ROU A;  3VNU A;  3OS2 A;  1MJ9 A;  2W7N A;  3TW6 A;  1JT6 A;  4QIW N;  1EZG A;  3K4J A;  4C3H J;  4CH7 A;  2IGN A;  1C0W A;  5IYW A;  4M74 A;  3RCO A;  3C18 A;  2H6B A;  3LQR A;  1LB2 A;  3TO6 A;  2R7F A;  5B1B H;  3EQO A;  3AFH A;  5F0F A;  2FVG A;  2DA5 A;  3ULQ B;  5AN9 A;  1RUO A;  1FOK A;  3HC7 A;  1KGS A;  1FT9 A;  5L3C A;  4M72 A;  1PP8 F;  5HZA A;  3OYB A;  2VKV A;  1XCV A;  3BJA A;  1BOB A;  2XKP A;  1P4X A;  1ONV A;  1DAR A;  1W5S A;  3JQQ A;  4Z4W A;  3N90 A;  1ZKG A;  1O8M A;  1FRN A;  3QOE A;  4HNV A;  1MSE C;  1YIJ B;  3SUC A;  1I3A A;  3OYF A;  4IHX A;  1O7F A;  1W5C C;  4X8I A;  1IDK A;  4I01 A;  4RCZ A;  4HBL A;  2VNK A;  4M3F A;  4FK8 A;  4RLZ A;  3CMY A;  1I5Z A;  2IS2 A;  1GT0 C;  1T56 A;  3QWL A;  5TJJ A;  4CIC A;  2BV6 A;  3CCJ B;  4PJN A;  1YX3 A;  1DDI A;  3VDX A;  3G6E I;  3BZ6 A;  3E5Q A;  1VQN B;  1BQE A;  1R1T A;  2L9V A;  2VBT A;  2Y2Z A;  3OR2 C;  3OJW A;  3W5V A;  1YQA A;  4JX5 A;  2HOA A;  1OOC A;  2H1K A;  2DU9 A;  5IT9 Z;  1VQL B;  1SKQ A;  3GVJ A;  3GRH A;  2DA7 A;  4MLO A;  4FE7 A;  1BLI A;  5J4Y A;  1V4R A;  4ZYH A;  4XLF A;  3OSG A;  5FLX K;  5IP6 A;  3G73 A;  1PJ5 A;  1Z6T A;  5JLV C;  1RNL A;  2PE3 A;  3SZG A;  3U6K A;  2QXZ A;  1QVF B;  2ZZQ A;  1BR1 A;  4IF4 A;  4RM2 A;  1QZE A;  4G7X A;  2CFO A;  3GBG A;  1S8N A;  5M5Y J;  3OYJ A;  1K73 D;  4A3J J;  3E5U A;  3V42 A;  4I0B A;  4NK8 A;  4UUV A;  4DYQ A;  1I7P A;  1ZM3 A;  4W97 A;  2NOJ B;  3ZMT A;  1QHG A;  2KHM A;  1D5Y A;  4PJL A;  3RZD J;  1U5T C;  4Z4S A;  4IO9 F;  4YEJ A;  3TL4 X;  3C2G A;  1V5F A;  3ECH A;  4GFB A;  2XRL A;  2XAU A;  3F8C A;  2JA6 J;  2WZP P;  4G6Q A;  4KN4 X;  4OJ6 A;  3EYY A;  4PUS A;  4RD4 A;  2K5C A;  1I39 A;  4AF7 A;  4G7O F;  3N05 A;  3OYA A;  1BI1 A;  4A3C J;  1QA1 A;  1FMV A;  2O6W A;  1RET A;  4GQN A;  2KLO A;  3VSK A;  4H0E A;  1KTV A;  5CDF A;  3PSI A;  4FET A;  4Y15 A;  1V0F A;  4TMT A;  3ZMZ A;  4MTD A;  2VZL A;  1STZ A;  1YG2 A;  1I3Q J;  2QF7 A;  1MAB A;  2WAQ N;  2MLK A;  4M9S A;  1VHO A;  4OIN F;  1YLO A;  1VQ5 I;  4XON A;  1IN6 A;  3AG1 H;  2A6E F;  3ZXS A;  2W6I A;  1BJK A;  2DT5 A;  4AID A;  5IY5 H;  1IA5 A;  3QU3 A;  2ZSH B;  1COW A;  2BF4 A;  3OYI A;  5D5X B;  1QFZ A;  3CCS B;  3G2B A;  1BI0 A;  2LBF A;  2RKH A;  5F08 A;  3RZO J;  2K85 A;  2JVG A;  2NTP A;  3HJE A;  5KAI C;  1HKS A;  2XZP A;  2VT3 A;  4A69 C;  1RWR A;  2Q6K A;  3M9A A;  4P26 A;  4B3G A;  3CCU I;  2MFZ A;  1XG2 A;  4Q5S F;  1ON2 A;  1W34 A;  4I2O A;  2EBI A;  2O5R A;  2X51 A;  3DU6 A;  3QFT A;  4FN5 A;  3DKW A;  4UAJ A;  3JTH A;  3TO9 A;  2D45 A;  2J8I A;  1F5T A;  2D3L A;  1RU4 A;  2HQR A;  2COM A;  1VQ6 I;  5FKM A;  4AVP A;  2V7V A;  1OGJ A;  5DSZ A;  3PO2 J;  2FE3 A;  1GDT A;  1EE6 A;  2BZT A;  3KYC B;  1T0F C;  4G6T B;  2VFP A;  1AIR A;  1RQP A;  1QZY A;  4UV9 A;  4EEF G;  1MMA A;  1U6G A;  3GO5 A;  3DLL F;  5DD4 A;  4M3B A;  2DMP A;  2Z1D A;  1DPU A;  1LNW A;  4LBV A;  5K5O A;  2W00 A;  3H3U A;  1VQL I;  2KQR A;  2MD5 A;  3W2I A;  1WI3 A;  2VBU A;  3RIR A;  3VO1 A;  2W85 A;  2X6Y A;  4A93 J;  3KP5 A;  1TZL A;  1IRF A;  1JRG A;  4XSX F;  5KNL A;  4AYB A;  3T0Y A;  2EV0 A;  1S7E A;  3LA2 A;  4Y9U A;  3ASO H;  2FX3 A;  1H88 C;  2Q1Z B;  1H8A C;  4ZH4 F;  3GTP J;  2BVM A;  4UY8 I;  3SJM A;  2FML A;  3HSE A;  3F23 A;  3TH0 A;  2RVC A;  3QP5 A;  2VE9 A;  3S2D J;  3OKX A;  5D8L B;  3CP8 A;  1E3Z A;  3SEQ A;  1U2W A;  3BQZ A;  4NHJ A;  4IVN A;  4X7D A;  1R5N A;  2RRE A;  1RES A;  1VZ0 A;  3B73 A;  2LVS A;  4ENM A;  3LO8 A;  2Y30 A;  1NB9 A;  1FZP B;  2PI0 A;  1UD5 A;  2VYQ A;  2Y69 H;  3M8F A;  4UNO A;  1Z9C A;  3NAU A;  3LSH A;  2DFH A;  3KIO A;  4XMY A;  4DZJ A;  1KQ5 A;  3PSF A;  1M90 D;  1B4A A;  2OCE A;  1FSH A;  3I5U A;  2AQE A;  5KCM A;  1OGM X;  4Z1M A;  2BM4 A;  4ZYD A;  2E5Z A;  3CC7 I;  3FXK A;  2LMD A;  1WPC A;  2BXZ A;  4II2 A;  1O8I A;  4NB5 A;  4M73 A;  1GO2 A;  2RC5 A;  3TQN A;  3OEH A;  1R4M B;  1KU2 A;  2JPB A;  1ZR4 A;  4HOB A;  3FIW A;  4V02 C;  4XKB A;  5H2F C;  4OOV A;  5B3S H;  3SHF A;  1QFY A;  1KZL A;  1FPQ A;  3IWF A;  2CUZ A;  5K5R A;  1EH7 A;  2FQ3 A;  4XD7 A;  1W7P A;  2ZME A;  1BX0 A;  3QAH A;  2C78 A;  3A03 A;  1Q7Y D;  2IS1 A;  2KPM A;  4EM2 A;  1VND A;  4HE5 A;  4HIZ A;  4RM0 A;  1JJ8 C;  4C3J J;  4CCL A;  1G4D A;  3LNN A;  3TP0 A;  4D5C A;  2RAE A;  3ZZT A;  2DOA A;  2JN6 A;  2QN6 A;  2OZ6 A;  3BR1 A;  3CTA A;  3LSJ A;  5EZH A;  2I10 A;  3SFZ A;  4A12 A;  1BL0 A;  4ETS A;  1S6L A;  3U9G A;  2WZN A;  2XKO A;  1O3T A;  2X0L A;  1F4K A;  5FLX Z;  2NNN A;  4CHU A;  3TGN A;  4AVZ A;  2HWV A;  1K28 D;  1JI8 A;  4ACB A;  2Q6O A;  1LEA A;  1Y56 A;  4S05 A;  1WHU A;  3L1P A;  1KMH A;  1Q81 D;  1OMI A;  4W1U A;  2GA1 A;  1VQM I;  1K79 A;  1G7S A;  2QDX A;  3NE5 B;  3AVY A;  1KON A;  3GSI A;  2GJP A;  5EMN A;  2OV7 A;  1G7C A;  4EJO A;  2CU7 A;  4Y3O A;  2BM1 A;  5LD2 C;  4Z4Z A;  3KLN A;  2O0V A;  2I5U A;  5E1X A;  3CUQ B;  2PEX A;  1KCD A;  4BXU A;  2QA4 I;  3CMM A;  4FQG A;  3PNY A;  4N9H A;  1VTN C;  4G9Y A;  4LFU A;  2ACJ A;  3V7A A;  1YW8 A;  4ZGN B;  4UZE A;  5HKK A;  1S7A A;  4WXD A;  5CQG A;  4I09 A;  3D5S C;  4PMH A;  2O8K A;  2KFD A;  1G3W A;  3L9F A;  5H20 A;  3RDI A;  3CLO A;  4M2L A;  2XT4 A;  1TW2 A;  4XKW A;  2MSY A;  3L7W A;  3VMF A;  3EPZ A;  3A8I A;  3HSR A;  4M3D A;  2PEC A;  3DFG A;  3NB2 A;  4HE6 A;  2IXS A;  1REP C;  2YU9 J;  5HS7 A;  3SDB A;  2R7R A;  1JGG A;  5HS9 A;  4IHV A;  1OYI A;  2A5W A;  2H09 A;  3K4B A;  1SC7 A;  4E7K A;  1T39 A;  4RLQ A;  3V8L A;  4BY7 J;  3WOD F;  3O8G A;  3LSM A;  4Y4R A;  1B72 B;  2NYX A;  5E8I A;  5IP9 J;  5E20 A;  1OCC H;  1V55 H;  3K7A J;  4J00 A;  1O8J A;  1DU0 A;  3DCF A;  4OAZ A;  4TMV A;  3WYA A;  3M8E A;  4XLP F;  4ZZL A;  3Q0W A;  4PGO A;  4EVI A;  3BJ6 A;  3BLY A;  4AM3 A;  1X58 A;  1HA3 A;  3A1P A;  2LLK A;  1FYK A;  1QHH D;  3RQI A;  2WA0 A;  3IH4 A;  4C2L A;  1MZB A;  1WQ2 A;  4CSW A;  3AK5 A;  4KUM A;  2HNH A;  2PFB A;  5E3M A;  1OB2 A;  3MMY B;  1X4O A;  1AOY A;  2Y9Y A;  3FBI B;  3QQA A;  1G3S A;  3WU2 C;  1YRN A;  1QPM A;  4BBR J;  1N0V C;  1R7J A;  4G7H F;  5HZB A;  2K9Q A;  2VFN A;  4KIB A;  2V9P A;  2VQG A;  1FDR A;  3Q6Q A;  3KEO A;  1GV2 A;  2ETH A;  2GK6 A;  1MBF A;  3CMA I;  3K4C A;  5LLQ A;  3OYH A;  3M3Y J;  5F1R A;  5LHG A;  4UB6 C;  4I98 B;  4XLC A;  5GPA A;  2KIM A;  3ABM H;  1UEL B;  1VFC A;  3GW2 A;  3A01 A;  2K02 A;  4J01 A;  2G0E A;  3W6J B;  3AVT A;  1IV8 A;  3MVP A;  4E7H A;  1HQC A;  3ONU A;  1WH7 A;  1ORK A;  2QTL A;  2KKO A;  1EWY A;  2ECB A;  1YJW B;  4B4D A;  1UJ8 A;  1T08 B;  1PP7 U;  2O03 A;  1PJ6 A;  2MW8 A;  2DY1 A;  4RDK A;  1KU7 A;  3RKX A;  2CW0 F;  2AXL A;  2P5L C;  2JJ2 A;  2XAH A;  4S0H B;  1ULY A;  2WJV A;  5IYR A;  3SZE A;  4ACA A;  3UW0 A;  2D1H A;  4DNC A;  1TC3 C;  5FLV A;  1E79 A;  1ZEL A;  2EIJ H;  4P96 A;  2Q8K A;  4HLY A;  2CQN A;  3PVD A;  2K3F A;  4LD5 A;  5BNG A;  5J1R A;  1U8R A;  1VI0 A;  3B78 A;  2VBK A;  3B6A A;  3ERE D;  3OP1 A;  2ZZF A;  5GAH J;  1S0U A;  4OJ5 A;  3GTK J;  2V9K A;  3FX3 A;  3HTU A;  3H09 A;  4IOA F;  4AC9 A;  2TDX A;  2IPQ X;  2ZB9 A;  5FGM A;  2IW5 A;  5FRN A;  4MO7 A;  3UR3 C;  3I64 A;  1TYV A;  4LBY A;  2JUG A;  1A04 A;  4JOM A;  3SXY A;  5ILV A;  1KK0 A;  3NAW A;  4N4N B;  4M3E A;  3UKG A;  2V26 A;  3BDD A;  1ZN2 A;  2Q2E A;  3BC8 A;  1YHQ I;  1K61 A;  3OZW A;  1D1N A;  2STW A;  2GJR A;  3HB9 A;  4KMF A;  3WTU C;  3HOW J;  1A35 A;  3K70 D;  2OTL B;  3AVW A;  3K2Z A;  4Y7C A;  3OYG A;  4BU2 A;  4G7W A;  2CRV A;  3F21 A;  2COB A;  3E0J B;  2F4M B;  1X3Z B;  3S1M J;  3LJY A;  1KK3 A;  1WZ2 A;  1B8I B;  3PUF A;  3MAJ A;  3K4N A;  2GZW A;  2KL4 A;  1M1E B;  4P9U A;  3J7Y J;  4RDJ A;  2VXD A;  2LF7 A;  2LTP A;  2EV6 A;  1OIS A;  2ZXW H;  1ZHF A;  3LSG A;  3SYT A;  3FMQ A;  1XE1 A;  3K6G A;  2YWE A;  2DOF A;  2FQ4 A;  1QH0 A;  2CC2 A;  3ZPP A;  2XOK A;  4B1R A;  5GP9 A;  5J1U A;  2VBV A;  2JUC A;  3I3L A;  3VSL A;  3LWF A;  2LKX A;  3QFC A;  4IRI A;  4B48 A;  2PJR B;  1OHH A;  1H42 A;  3MZH A;  3DLA A;  1E63 A;  3P4G A;  1IDZ A;  3FXR A;  3E6M A;  4PSX A;  5B1A H;  2WAE A;  4BS9 A;  4ROX A;  4YCQ A;  1TNS A;  1Y1V J;  1DBO A;  3F8N A;  2CW8 A;  3AL0 B;  4LIV A;  4EJT A;  4P25 A;  2G7H A;  1Z7L A;  4I84 A;  2E1O A;  1FYM A;  1O8E A;  5K7F A;  3DEU A;  3K10 A;  5D6E A;  3BTI A;  1UD4 A;  4OIR F;  3M1E A;  5E3L A;  4CCM A;  2A5Y B;  4P3Y A;  3SKB A;  4OWR B;  4HYE A;  3HIF A;  3S16 J;  1ETV A;  4BE0 A;  2NXN B;  3MEX A;  5KAF C;  4DNR B;  1L1I A;  2EFW A;  2X6O A;  3NQO A;  1CQT A;  4IQJ A;  2WBM A;  1BM9 A;  2JK3 A;  2DCE A;  3TOB A;  1R5G A;  4ZDP A;  3VOE A;  3ZCO A;  1S5L C;  4RCY A;  2DTZ A;  5CQE A;  2DCU A;  4D1Q A;  3OYE A;  1IB0 A;  3N6Z A;  4JX4 A;  2P6T A;  4L9T A;  4LK0 F;  5CPR B;  1J59 A;  1WJ5 A;  2DJN A;  3DBL B;  4ZCM A;  2PMZ N;  2B63 J;  3FPP A;  4XOP A;  2XAJ A;  3HGY A;  1XGO A;  2CUF A;  3LAP A;  2BVN A;  4HRI A;  1P7J A;  4P55 A;  3EET A;  1XGM A;  3AVU A;  1VQK I;  2NOG A;  2R92 J;  3A3G A;  3I56 B;  4EV0 A;  3CUQ C;  2E2J J;  2VUM J;  4PJJ A;  5JBQ A;  2ZJQ F;  2IRF G;  2R93 J;  2X53 S;  1M1K D;  4CCJ A;  3S3M A;  5D6F A;  2A05 A;  1HG8 A;  2NNY A;  2XUB A;  3WU0 A;  5TY0 A;  3KYD B;  1HLV A;  2XEX A;  3G71 B;  5DS0 A;  1MRZ A;  3K4M A;  5AIP A;  4RB2 C;  5IP7 J;  3OYN A;  1IJF A;  2HOE A;  4JYK A;  1ODD A;  2DTR A;  1I8D A;  1ERD A;  2V31 A;  2HVQ A;  4PFP A;  1S4M A;  4NQW B;  3RKW A;  3V76 A;  2HS5 A;  1KQ0 A;  4KDP A;  5A8A A;  3CD6 I;  4F92 B;  1WJA A;  3RIQ A;  1D0X A;  1MW7 A;  2A69 F;  3ML6 A;  3PUB A;  2P4W A;  4LOC A;  5CYV A;  2OUM A;  3CCQ I;  5CVJ A;  4LBW A;  1X0C A;  1RMG A;  1FJL A;  4WX9 A;  4W8Q A;  5FLM J;  2IA1 A;  3HG9 A;  5EEH A;  5IYD J;  1BPL A;  1FNB A;  1FNC A;  2ME0 A;  2W25 A;  5K5Q A;  2R5Z B;  4GO1 A;  2AQF A;  3FKJ A;  4KIG A;  3JR9 A;  3W2A A;  1BMF A;  5K7H A;  2JSC A;  4A2U A;  2LF8 A;  2DA2 A;  1Z91 A;  2A61 A;  2FJ1 A;  3ABU A;  2Y9Z A;  1K83 J;  2RDP A;  2F4I A;  5BPI A;  1FYL A;  4XIC A;  3U1K A;  4L0Y B;  3G1O A;  1MD0 A;  1ZM4 A;  2X9D A;  2HGC A;  4C9Y A;  4JMQ A;  1EJ9 A;  2FEZ A;  1H9T A;  3S17 J;  1OCO H;  3RPU A;  2JZY A;  3MHP A;  2F2E A;  3A1Y A;  1D8T A;  4ENN A;  3WG7 H;  1FND A;  2G9W A;  3C2H A;  4ZZD A;  4X6A J;  1S72 B;  1Q1H A;  1R36 A;  1TWH J;  4BAY A;  1VBL A;  2CV0 A;  3VR6 A;  3LQQ A;  2XF5 A;  1T6S A;  3PJR A;  3VNV A;  3NAR A;  1H80 A;  5LBQ A;  2VBM A;  3LSK A;  1JKP C;  3GTQ J;  2DO7 A;  3P5J A;  2GOM A;  2LYC A;  2D5V A;  4E7Z A;  4OMY A;  1E3X A;  1KYW A;  3KZZ A;  5HDK A;  2W6J A;  2EK5 A;  2OC6 A;  1I50 J;  3WNC A;  2D2W A;  2DJI A;  1I6X A;  2E2H J;  1OGO X;  1S7O A;  4ZCI A;  3JRG A;  1Y1W J;  2OK7 A;  2EIL H;  4F55 A;  4TT3 A;  3CJT B;  3DWL E;  2JA5 J;  3PUM A;  1W1W E;  2PX9 A;  5HOD A;  4OPS A;  5IYP A;  2LFB A;  2HYF A;  2EFG A;  2JN9 A;  5ILU A;  1FBQ A;  5E1W A;  2ZTG A;  1QA2 A;  5DN6 A;  3JUR A;  1SFU A;  3OW2 B;  4RS8 A;  3HKZ N;  2P5K A;  5F27 A;  2XSD C;  3Q0U A;  3I56 I;  2GJK A;  3WBK A;  3KEQ A;  1MGT A;  2EA4 A;  3JAM K;  3FXM A;  4PC7 A;  5DDG A;  2O9L A;  2BSP A;  1Z1D A;  4FCY A;  1MDM B;  5IYN A;  3DBR B;  1O3S A;  3CME I;  2PMU A;  1LLW A;  5J3O A;  4PDK A;  1TT5 B;  1GVH A;  2N8G A;  3H9Q A;  4YFO A;  4IRG A;  4LLL A;  2CK3 A;  1JTX A;  3VMW A;  3MCA A;  4QVA A;  1ETK A;  2MLG A;  2VI6 A;  4AU7 A;  1XPX A;  2XC7 A;  1ENH A;  2HXI A;  2VBW A;  4OZY A;  3BQY A;  3OL4 A;  3EUH C;  2XTW A;  4G6D A;  4R1H A;  2PYH A;  2WB1 N;  3WE2 A;  1HDD C;  3U2Q A;  4YEI A;  1JJ6 C;  2EFQ A;  3G4S I;  1CNF A;  5DTD A;  3CCV I;  3CDH A;  2YWF A;  1D0Y A;  1BJZ A;  2CMP A;  4MYU A;  3PSS A;  3B8H A;  4RPD A;  1NDH A;  2DQR A;  2MH2 A;  4LBZ A;  1MBK A;  2VC0 A;  2V79 A;  3K0L A;  1SD5 A;  2O3F A;  3K9T A;  3FXU A;  2HI3 A;  1NRK A;  2PMD A;  1LDK B;  1J9Z A;  1SM4 A;  2X1D A;  3J7A Y;  4IOC F;  3J7A O;  1G8X A;  1X4P A;  1KQ9 A;  1WFX A;  4IXA A;  4CYC B;  3T56 B;  4KKS A;  3QSY A;  4UXN A;  2HQN A;  5A89 A;  1PUF A;  1DAB A;  2ODL A;  1MMG A;  2VJ5 A;  2DA1 A;  4CDG A;  1IRG A;  3GXO A;  1SKY B;  1N8R D;  4K2E A;  2C2W A;  1NK2 P;  4X05 A;  2VBX A;  4CGZ A;  1ETW A;  3OYD A;  4YII A;  4OPO A;  2CFX A;  2OTJ I;  4OPV A;  3BWG A;  2GAU A;  2GXA A;  3G6E B;  4IHS A;  2NT6 A;  2ELH A;  2IJL A;  3OYC A;  5IYC J;  1IJW C;  2L9N A;  2DDA A;  2R7V A;  2F43 A;  1BC7 C;  2KJC A;  2D9R A;  5IT3 A;  3DTK A;  4LLN A;  1V0E A;  1LE8 B;  3KP3 A;  3OZV A;  3D1N I;  3C2B A;  5ED4 A;  1VQP I;  3B02 A;  2DMT A;  2V7W A;  4W8S A;  3HOY J;  3Q5F A;  1ON1 A;  3DKX A;  1D3Y A;  4XKC A;  4LIT A;  3I55 I;  4OOX A;  1X2M A;  3O8H A;  4S04 A;  5EDN A;  3KX2 A;  3AG3 H;  1HW1 A;  1SVO A;  4FE4 A;  3AL0 C;  1Q9S A;  2D3N A;  3QOP A;  5DUI A;  1OYY A;  2X1E A;  2O0Y A;  3TOA A;  5GV8 A;  3QFS A;  2WSS A;  3OY9 A;  1LQ1 A;  4OZZ A;  1WOO A;  1P2F A;  4KT6 A;  1D1C A;  4HX7 A;  2I8D A;  4QLC U;  2R6H A;  1JHF A;  4FT8 A;  2HFH A;  4MHG A;  1CQX A;  4RD1 A;  1FIP A;  1QPI A;  1LUJ B;  4C43 A;  4HLX A;  4JQF A;  1IC8 A;  1I27 A;  2M0C A;  2BEO A;  1YJN I;  3Q9V A;  4HNT A;  4WWV A;  3CCM I;  3ZBT A;  4KH3 A;  5E8G A;  4Z4U A;  2DBB A;  3WBJ A;  4CA0 A;  3KLO A;  3JRC A;  2CF4 A;  2E19 A;  4X0G A;  3OW7 A;  4KT5 C;  1O3Q A;  1OR7 A;  2BVL A;  1KK1 A;  3HHG A;  3R6S A;  1VQ5 B;  4N3G A;  1Z0X A;  1A6Q A;  2XPU A;  5ICG A;  5A2Q K;  3E6C C;  1RUN A;  1YLF A;  2V7X A;  1H8H A;  3ZMS A;  2FRH A;  3DBH B;  2KIU A;  4L0Z B;  1QVU A;  3RYP A;  4YDT A;  5HNH A;  3G1L A;  2D1V A;  3Q39 A;  1X1A A;  1YW7 A;  4KN7 X;  2NVU B;  1XGN A;  4ENJ A;  4BYY A;  1PDN C;  4BQA A;  5D4R A;  3I4N J;  2HDN B;  3SLN A;  2XAS A;  3CCU B;  2M4K A;  2HCJ B;  2M87 A;  1CLW A;  2E71 A;  3HBL A;  2IGM A;  1AKH A;  3CPX A;  2BW3 B;  2VFM A;  4I7H A;  5BS6 A;  3OMY A;  2R3S A;  1Z3Y A;  2DA6 A;  1X1B A;  2ECC A;  1R5O A;  5ERI A;  1EA0 A;  1VQ6 B;  3WGG A;  2QCO A;  2GRE A;  2INU A;  4HQE A;  3DEW A;  4PC2 A;  2BHY A;  2VKE A;  4G12 A;  4AD9 A;  3TKY A;  3CO7 C;  3TBI A;  1VLY A;  2M45 A;  2DAO A;  2QZ8 A;  3HRT A;  3OIP A;  1HVX A;  4D7M A;  4YHB A;  3ZUG A;  1WU8 A;  1FX7 A;  1POG A;  2W57 A;  2QQ8 A;  1N25 A;  5FD5 A;  5DM6 F;  4QUZ A;  1V5V A;  1FEX A;  5JLX A;  4C30 A;  2Y0S N;  1HF2 A;  4FX0 A;  1ZAO A;  4AIK A;  2VKD A;  4FWT A;  2E2I J;  2X3U A;  4CCN A;  2UUZ A;  4XQF A;  5THX A;  1WJB A;  4E0F A;  3TMO A;  5AON A;  5C4J J;  2OPT A;  3JAM Z;  2XGE A;  4GCV A;  2HLD A;  2FOW A;  4OJO A;  2NS7 A;  5BOX A;  2E5N A;  3S14 J;  4MIM A;  3FBN B;  3V8J A;  1P9Q C;  4YRV A;  2P7C B;  4TKO B;  2K9L A;  4UUS A;  2HKO A;  2QUF A;  5E1Z B;  3RPU D;  4RB3 C;  1Y39 A;  2QE7 A;  1DP7 P;  5DCM B;  4P9S A;  2KZV A;  1OFM A;  4GDF A;  1H9G A;  3OIO A;  1RKT A;  3IP4 B;  3EDP A;  2QGU A;  4MNU A;  1IHM A;  1ZM9 A;  2C77 A;  4DNT B;  4KIC A;  4XOR A;  4HDV A;  2L02 A;  3F3X A;  1EA3 A;  1P7I A;  2F5V A;  1K8A D;  1FMW A;  2RGV A;  1WI9 A;  3B8Y A;  4YZX A;  4B8X A;  3CC7 B;  2L7Z A;  2XTX A;  3MD2 A;  2QWW A;  4DBQ A;  3SFI A;  2HYJ A;  2VON A;  1IXR C;  1QGZ A;  4I99 C;  3W2V A;  3GVL A;  2XTY A;  4HQM A;  3LMM A;  4JBA A;  1VQ4 I;  2NVY J;  4ZV4 A;  3T51 B;  3U2R A;  5HVQ C;  2ZJR F;  3ZMU A;  5EF6 A;  4HDU A;  2ZSI B;  3HOX J;  1LEB A;  2VBZ A;  1UHM A;  1ZM2 A;  4Y52 J;  2K9N A;  2UXN A;  2K4J A;  4F7D A;  4AIJ A;  2DT7 B;  2GLO A;  4TMW A;  3HOU J;  1XSX A;  1FRQ A;  1TQP A;  3LL7 A;  2V7Q A;  3GVK A;  3RKY A;  3HOZ J;  1RIO H;  2IVM A;  1HSJ A;  4Z05 A;  1WJF A;  5IYB J;  2F6C A;  1W5T A;  2FMY A;  4WXC A;  2VNI A;  5FNZ A;  3BCA A;  1PXZ A;  2E1R A;  2CGP A;  5IOZ A;  5HDN A;  1F60 A;  1IUY A;  2CV2 A;  3LST A;  4PZJ A;  3TED A;  3BG6 A;  4N3N A;  3BG9 A;  4PCQ A;  3CCL I;  1NH3 A;  3SQN A;  3CW2 A;  3Q38 A;  3A4C A;  1TVC A;  3ASR A;  4XRM A;  5FA6 A;  2DK5 A;  3HRU A;  2OK8 A;  1B1B A;  2QY1 A;  1OCT C;  2M0M A;  1H0M A;  3CRZ A;  1FOW A;  4TMX A;  3GQ8 A;  4JP0 A;  2NSP A;  3SEZ A;  3PFI A;  1NJI D;  1VQM B;  2VNH A;  2FU4 A;  1O8L A;  3ZOB A;  2Z9O A;  1ETY A;  3ZZ0 A;  1MSF C;  2WAQ A;  4UVC A;  1U3E M;  2XB0 X;  5EYR A;  1JE8 A;  2H8W A;  3MMP A;  2QSG X;  2V5I A;  2EH3 A;  2OF7 A;  3PQJ A;  2Y75 A;  4FX4 A;  1D2E A;  2QA4 B;  1UD3 A;  2NV4 A;  1QFJ A;  2EZI A;  3W3C A;  1R5B A;  4BEH A;  3C7J A;  1VQO I;  2IP2 A;  1MMD A;  3BTJ A;  4BHB A;  4F52 A;  3LYC A;  4P22 A;  1TSP A;  4OPW A;  1YX2 A;  2C5B A;  3B90 A;  4HZF A;  4CZC A;  4CCO A;  3IV5 A;  3PA2 A;  3S8P A;  1FBU A;  2PLY A;  4X1E A;  2DLL A;  2P8T A;  1HKT A;  1U9N A;  4RMN A;  4XID A;  2GIZ A;  5ICE A;  4UVA A;  3KZY A;  3ML3 A;  5CVV A;  4BDZ A;  3GUD A;  4ZDO A;  2V7U A;  3H0D A;  1O8D A;  1RI7 A;  3HZJ A;  1GVD A;  4EGZ A;  4KFC A;  2E1N A;  3HAG A;  1ETX A;  3OE7 A;  1UHS A;  4W8R A;  1FTZ A;  3CCR I;  2XGX A;  4FHT A;  1XX5 A;  4RLF A;  1LPQ A;  1ZRD A;  3DDY A;  3OYM A;  5EGO A;  1KU3 A;  3KZI C;  2YUH A;  4DW6 A;  2J5O A;  1IN4 A;  4YIF A;  5JR3 A;  3A35 A;  5DCF A;  2EPF A;  4HAM A;  4YFN F;  1SMT A;  1K78 A;  4X7F A;  4LG3 A;  3JTG A;  2DMN A;  1GUU A;  2JRM A;  2BSA A;  2BY3 A;  2ZCW A;  2Q6L A;  4I6Z A;  4OIO F;  2R7Q A;  2H6C A;  4BE2 A;  4B47 A;  2J7K A;  3FK7 A;  4ZYE A;  5HNF A;  3LQ6 A;  2NVX J;  3BY6 A;  2L7F P;  2QMU A;  4EJU A;  4A5M A;  1FP1 D;  1WKM A;  3NWT A;  3T8T A;  1DPR A;  4U87 A;  4YAU A;  4W8T A;  2O6G E;  4RBO A;  2LBF B;  2B0R A;  5B6I A;  3LA3 A;  5M5X J;  1IXS B;  5J1Y A;  4RDL A;  3CMA B;  3HUG A;  2E60 A;  2RNG A;  4KMU X;  2IAI A;  3BJO A;  1NK3 P;  1OFD A;  1JHH A;  2ZXI A;  3DXJ F;  2O61 A;  4Y17 A;  1LDD A;  2V4D A;  1N06 A;  4XLN F;  2PQ8 A;  3F9K A;  4B44 A;  1PE9 A;  4QPQ A;  1BX1 A;  4G6I A;  3QP6 A;  3S32 A;  4OU0 A;  4RD0 A;  3EQL F;  2XND A;  1T6Z A;  2FA5 A;  3ZQF A;  2E7W A;  3OS1 A;  5LHH A;  4MXN A;  3S1N J;  1MKM A;  3ZQC A;  2IBD A;  4AF6 A;  4I02 A;  1TWG J;  1AA7 A;  3PNV A;  4PC6 A;  2LKP A;  2ISZ A;  1UHW A;  2CS3 A;  3SZP A;  2OBS A;  3W5U A;  3SJP A;  4HST A;  3HOT A;  3IHU A;  1E3P A;  3FXL A;  1WSR A;  1ZRC A;  2EIM H;  4RPB A;  4XK4 A;  3GME A;  1UG0 A;  4B3X A;  4KJZ A;  3CCY A;  1O57 A;  2QYO A;  3W6K B;  3M1C A;  2QBY A;  2VOP A;  2B9S A;  3HXL A;  1VJS A;  1EP1 B;  4U9U A;  1LFP A;  1VQ9 I;  1Z05 A;  3GZ5 A;  3BY1 A;  1CZF A;  3QYF A;  1KZH A;  2E36 A;  3DTE A;  1DDG A;  4M9X A;  3JQR A;  2VPL A;  3WTX C;  4TMZ A;  1LVK A;  4O3M A;  2XHK A;  2PMH A;  4LJZ F;  3U6B A;  5CLS A;  4UZF A;  3OIQ A;  3QE2 A;  5H6Q A;  3GFI A;  2JQ7 A;  2NVQ J;  1LLZ A;  1WJC A;  2FSW A;  1APL C;  3L2U A;  1YHQ B;  2E1C A;  3BR0 A;  3GYH X;  3CF5 F;  2VN2 A;  2O17 A;  2H94 A;  3FIS A;  3IAS 2;  2AO9 A;  1B2R A;  2D74 A;  4HWV A;  3J81 K;  4D9J A;  3GQB A;  4BE1 A;  1BN5 A;  4EJV A;  1W87 A;  2OU2 A;  4PGG A;  4GRI A;  4D5F A;  3K4K A;  2ZBK A;  2L01 A;  3I71 A;  5DS9 A;  1BW5 A;  3EQN A;  1WWX A;  2LY1 A;  1WTH D;  4PSW A;  2XAQ A;  2WWY A;  5EZG A;  1PLU A;  1IDY A;  3REO A;  2DET A;  2DW4 A;  5ICC A;  4BPR A;  1RR8 C;  4BUP A;  2XAF A;  1YS6 A;  1JUM A;  4CCK A;  1OYW A;  2YU3 A;  4EGY A;  1Y6I A;  4A3D J;  3MCZ A;  4IZZ A;  3FZV A;  2VJJ A;  3JRE A;  3DU5 A;  1WCM J;  3N97 A;  4ESB A;  4OJL A;  5DUK A;  2R7Z J;  4MQ9 F;  1W7P B;  2ZME B;  4RAF A;  3A2K A;  3CES A;  1WH5 A;  1IW7 F;  2BM6 A;  4EM0 B;  3I58 A;  1TWC J;  3B6C A;  4UV8 A;  4ON0 A;  2E1B A;  2KZG A;  3H35 A;  4ZCL A;  4UHT A;  2CV1 A;  3IAM 2;  4WCG A;  2M3A A;  1ETO A;  1B23 P;  2WTE A;  3BTL A;  2TCT A;  4NNJ A;  5H59 A;  3JRB A;  3C3W A;  2XGJ A;  3H9J A;  4P1W A;  3PIP F;  2W82 A;  1V54 H;  2ZXJ A;  4ESF A;  5CVU A;  5FKK A;  4A3K J;  1QVG B;  3HGG A;  4HPQ A;  3ISP A;  4Y7N J;  3JQP A;  2BHZ A;  2ZIT A;  3BZK A;  4RM3 A;  4DYC A;  3CZ6 A;  2XB5 A;  1OB5 A;  2P5V A;  3V7S A;  3HPH A;  4YAO A;  1CGP A;  2M9H A;  3RKQ A;  2CYY A;  5J40 A;  1F1Z A;  2WAD A;  4BHC A;  2J8K A;  3I4M J;  2LOO A;  2WC2 A;  4TV7 A;  1CF7 A;  4Z4R A;  4OAY A;  4RGS A;  2XPW A;  1E3O C;  5F0H A;  3KP4 A;  5LGU A;  1FC3 A;  4L5I A;  4YXW A;  3ZMV A;  1EFT A;  5LGN A;  1KA8 A;  4LG0 A;  2JMW A;  3WG9 A;  1A36 A;  3W6V A;  1Z7U A;  2RN7 A;  1DQU A;  4ENK A;  1VQK B;  2ZJ2 A;  3RY8 A;  3GWZ A;  5M3M J;  2G7U A;  4NK6 A;  2IEK A;  3WTW C;  1MBH A;  1ITY A;  2M5W A;  4L18 B;  3R4K A;  1Q82 D;  3OZU A;  1PYV A;  1KCC A;  2QVO A;  3HRM A;  1JUS A;  2JSP A;  4Z4T A;  2ZTN A;  4PC1 A;  2M30 A;  2EIK H;  1DGW Y;  3VYU B;  3WTT C;  1K4Z A;  3WGI A;  5J8F A;  4NCN A;  3GQ7 A;  4PC3 A;  1VHE A;  2MBF A;  1ZR2 A;  4JX6 A;  1QBJ A;  3BG5 A;  1XSD A;  3K1M A;  1G6N A;  1MND A;  3CD6 B;  3NRV A;  2VAS A;  3B82 A;  1BHE A;  3RI4 A;  1YW9 A;  3CCQ B;  2JDI A;  3A8J A;  3G05 A;  1YJ9 I;  2BM5 A;  1R58 A;  2A6H F;  2EA2 A;  1YIO A;  1JA1 A;  5H6R A;  4AUX A;  3BNW A;  4C0S A;  4U4B A;  3EUA A;  3Q9S A;  4PGH A;  1V5G A;  2DOG A;  5HLT A;  1EH8 A;  4YAF A;  3F0C A;  3G1M A;  3PQK A;  2YS9 A;  3H9N A;  2OAZ A;  4GYG A;  1ZG5 A;  2UXX A;  1SFO J;  2ESN A;  2HOS A;  4HX8 A;  3E6B A;  1UD8 A;  2NPF A;  1OQY A;  1HCR A;  1YRN B;  5CKT A;  1QVT A;  1E1R A;  4LGW A;  4J19 A;  1TT0 A;  1R00 A;  5LRR A;  2Y31 A;  5FJ8 J;  4R71 A;  2HDW A;  2KRH A;  1TTT A;  3BPX A;  4L9V A;  4NUB A;  4P5O A;  4RGU A;  1N08 A;  3ZC3 A;  5EG0 A;  4A3E J;  1SVM A;  1P4M A;  3KE2 A;  1HA8 A;  3LMW A;  1WP6 A;  4DOZ A;  5F4J A;  1W7P D;  1YYV A;  3GF2 A;  4B43 A;  5E3N A;  1U5T A;  3RPQ A;  1WSV A;  2OBT A;  2ZNZ A;  2EZH A;  1U78 A;  4OOS A;  1VQ8 I;  2BE5 F;  2ICW G;  4J0Q A;  4IJA A;  1XCB A;  3FXJ A;  2X6W A;  4BHP A;  3A01 B;  2HMA A;  1O3R A;  1LDJ A;  4A0X A;  2KIF A;  3WE3 A;  1FSE A;  1T8I A;  1BR4 A;  1R71 A;  4F7Z A;  3WTS C;  4BBS J;  3OSF A;  3R60 A;  1UFM A;  5AMV A;  4OOI A;  3AAF A;  2B7E A;  5HLI A;  1K7A A;  1HOM A;  1BW6 A;  2W4S A;  1USS A;  1QU3 A;  4CYD A;  4AC0 A;  3ZR8 X;  2L2O A;  2HPI A;  4Q4Z F;  3G3Z A;  1ZGJ A;  2KT0 A;  1J75 A;  1HKQ A;  3BPV A;  3MZ8 A;  3F8M A;  5EJC A;  3CC4 I;  4P2N A;  3RYR A;  2RC4 A;  3BR5 A;  2O8X A;  2P7V B;  3ESW B;  2GBY A;  5E79 C;  3LVB A;  3VYR B;  3TO7 A;  3CME B;  1R1V A;  4N0B A;  1SEU A;  4IKF A;  3MN2 A;  4RD6 A;  4WZE A;  2X0K A;  1OKR A;  5GPC A;  2CQX A;  1R1U A;  3FY3 A;  1IAW A;  1Y0R A;  4LC0 A;  3L00 A;  2EZK A;  1X1P A;  3GTL J;  3ISX A;  2YSR A;  4XRS G;  3VWB A;  4A3G J;  1G7R A;  5LGT A;  3L2R A;  3FJO A;  3X2Q H;  3ZQ7 A;  4Y9R A;  3P7N A;  2AHO A;  3JRI A;  3H9G A;  1WVR A;  4YZQ A;  4A0Y A;  3K70 C;  3GTG J;  1T0F A;  2OQG A;  3GTM J;  4X7E A;  3G4S B;  3CP2 A;  1T6Y A;  2DIE A;  3CCV B;  2X3H A;  2Q2E B;  2L7M P;  2DEU A;  3CQZ J;  2R5Y A;  3P26 A;  2P81 A;  2LG4 A;  2HXO A;  3FDY A;  1KC8 D;  2YR2 A;  4G5G A;  3NEU A;  2OJE D;  1IN5 A;  2P3M A;  1BI2 A;  2EJR A;  1N07 A;  2Z5U A;  4A5N A;  2KIQ A;  4U0Y A;  5GAG J;  1HXD A;  4QWQ A;  3J7Z I;  2NRA C;  2PMZ A;  1BJA A;  2VLA A;  1W0J A;  1TYX A;  1P92 A;  2VBS A;  4ZDL A;  1JXS A;  2F5D A;  1E62 A;  1P4A A;  3LSI A;  1FTT A;  4KKT A;  3WQZ A;  5GTI C;  2LRD A;  3FHN A;  1TQM A;  2OTJ B;  4JRA C;  2R7W A;  1VQ7 I;  3AKZ A;  1K5C A;  4WWC A;  3OYL A;  1FBS A;  3I9V 2;  4X06 A;  3RQ4 A;  5E3O A;  3M07 A;  1WJD A;  1QQ1 A;  2UVF A;  3W5H A;  2WY8 Q;  3I59 A;  4DQ2 A;  4DGW B;  3HOV J;  3HDD A;  1F20 A;  2DA3 A;  5K1Y A;  1XQB A;  4XSZ F;  1TBX A;  1IGN A;  4M1K A;  2ZME C;  2P0W A;  1FLI A;  2GWR A;  2V7F A;  4C2M J;  2E1M B;  1VQP B;  4XLH A;  3HYI A;  2KDO A;  5FFZ A;  2GK7 A;  4L5J A;  1TL8 A;  3H5A A;  4F91 B;  3I55 B;  3IL2 A;  2GQQ A;  2CQ7 A;  3E1S A;  3FHZ A;  2CQK A;  3WNB A;  3D26 A;  2LP0 A;  2WPD A;  1LM1 A;  1TLH B;  4IEJ A;  3F6V A;  1U0J A;  2VB6 A;  2KDZ A;  4ZTJ A;  5D5W B;  3D5L A;  2CBX A;  4DK0 A;  1MIJ A;  2M34 A;  3CDI A;  1RRJ A;  3CC2 I;  1LJ9 A;  4BXX J;  1E2X A;  4Z4Y A;  3R6K A;  3GQ9 A;  5KW9 A;  5IT9 K;  5FKO A;  3SY2 A;  4UUT A;  3TDZ C;  4FXU A;  1YJN B;  2CH0 A;  4EAT A;  2VBY A;  3JU4 A;  4EH1 A;  1F9N A;  4V19 K;  2ME6 A;  3CCM B;  1Q86 D;  2MAB A;  4PAB A;  3VEP A;  1T98 A;  4Y33 A;  4M71 A;  1YIT I;  5LFA A;  3F22 A;  2F48 A;  4ESJ A;  3O3K A;  1ZUN B;  3VSV A;  3ZQQ A;  2VNJ A;  1R23 A;  1UAA A;  2CW7 A;  2FUG 2;  3DF8 A;  4U0W A;  1TUI A;  1J5Y A;  2ADU A;  3CB4 A;  4MFD A;  2GOX B;  3ABT A;  2V1N A;  2X6X A;  2NZM A;  3PO3 J;  5DYM A;  1BIB A; 
#chains in the Genus database with same CATH homology
 2O0V A;  4DNT B;  3T53 B;  4XOR A;  3MKW B;  1KCD A;  3CMM A;  3PNT A;  3PNY A;  1EA3 A;  2F5V A;  5HKK A;  1FMW A;  1SAU A;  5CQG A;  1EFR A;  3D5S C;  4PMH A;  1I18 A;  3HPG A;  3B8Y A;  4YZX A;  3MD2 A;  4DBQ A;  3M8J A;  3GVL A;  3W2V A;  4XKW A;  1DP3 A;  3LMM A;  3EPZ A;  2Z8G A;  3HKZ A;  2ZFU A;  2PEC A;  2DXI A;  3OL3 A;  4BQO A;  3T51 B;  2IXS A;  5HVQ C;  2RQQ A;  3SDB A;  2R7R A;  4BJT A;  2A5W A;  2ZSI B;  3K4B A;  4E7K A;  5C1C A;  2XZO A;  4RLQ A;  2DT7 B;  3LSM A;  4Y4R A;  1KTW A;  2V7Q A;  4Z06 A;  3LL7 A;  1T5E A;  3GVK A;  1W36 D;  3HL2 A;  4Z05 A;  1WJF A;  3H5N A;  4J00 A;  2R7U A;  2F6C A;  1O8J A;  3DTI A;  4DK1 A;  4OAZ A;  2R7O A;  2LC2 A;  3BCA A;  3BG7 A;  3BLY A;  1PXZ A;  3T9G A;  1QHH D;  1X19 A;  2CV2 A;  2LY2 A;  2WA0 A;  3PFY A;  4DIQ A;  3BG6 A;  2WB1 A;  3DKY A;  2MYS A;  4CSW A;  5C1E A;  4C2L A;  2XSJ C;  2HNH A;  5TGT A;  3A4C A;  4E7J A;  3MMY B;  3QYE A;  1X4O A;  2V6E A;  4E6K G;  3S3O A;  2QY1 A;  2M0M A;  3FBI B;  2DT6 A;  4ASU A;  3GQ8 A;  3VYT B;  3FKS A;  2KVO A;  2NSP A;  1YX5 A;  2R7X A;  2ELJ A;  3SEZ A;  1GQ8 A;  1O8L A;  2MC4 A;  1X1D A;  2VQG A;  2WAQ A;  3CF2 A;  2O04 A;  3OEE A;  2R7T A;  2GK6 A;  4XN3 A;  3K4C A;  2LRE A;  3UNG C;  2A6T A;  3OYH A;  2ZZE A;  4C2U A;  2K3P A;  2XF6 A;  4ZC3 A;  1UD3 A;  2Z6B D;  4XLC A;  2VBE A;  1UEL B;  3W3C A;  2VKH A;  1H8E A;  4J01 A;  4PFO A;  4BEH A;  1MMD A;  3D5R C;  3LFU A;  4F52 A;  4E7H A;  2F1M A;  1D1B A;  4L8J A;  4P22 A;  3B90 A;  2HQA A;  4CZC A;  4CCO A;  3S8P A;  1QJV A;  3BH4 A;  1S9H A;  4RMN A;  4BDZ A;  4ZDO A;  3H0D A;  1O8D A;  2JA2 A;  4R79 A;  1E43 A;  4BDY A;  2JJ2 A;  2VQC A;  1W9X A;  2WJV A;  2VL8 A;  2NTB A;  2JIZ A;  2V4J C;  1E79 A;  3OOC A;  3HAG A;  4W8R A;  1ZEL A;  3OE7 A;  3UW0 A;  3CJQ B;  4RLF A;  3DDY A;  3OYM A;  4TSF A;  3QOD A;  2Z16 A;  3KRG A;  2VBK A;  3A35 A;  2ZZF A;  3EUK L;  4CUG A;  2L9S A;  2ZZG A;  4OJ5 A;  2V9K A;  4LG3 A;  3OWT A;  3BCF A;  4KIT B;  2VJ4 A;  3L2Q A;  1J09 A;  1DGR M;  5FRN A;  2M7A A;  3UR3 C;  2R7Q A;  2JVH A;  4BE2 A;  4B47 A;  2JUG A;  4JOM A;  5HNF A;  4N4N B;  3ZSC A;  4BJ6 C;  4U49 A;  2V26 A;  3BC8 A;  3NWT A;  3ONQ A;  4U87 A;  4W8T A;  4YEL A;  2HPM A;  3GQA A;  2GJR A;  2LBF B;  1W36 C;  2XZL A;  3ZGK A;  4II3 A;  3K70 D;  4LIU A;  2E60 A;  3OYG A;  2RNG A;  4BU2 A;  4G7W A;  2QKL B;  3OAA A;  2QKM B;  1OFL A;  3E0J B;  3L2V A;  1D0Z A;  2ZXI A;  2V4D A;  1O8K A;  3F9K A;  1PE9 A;  4B44 A;  3K4N A;  4QPQ A;  4E7S A;  2KL4 A;  4G6I A;  4EW9 A;  3S32 A;  4XN0 A;  2XND A;  3PL8 A;  2VXD A;  3OFN A;  1T95 A;  4ANJ A;  1NG6 A;  3OS1 A;  2WJY A;  4MXN A;  3LSG A;  2VQH A;  3RTR A;  3SYT A;  1N78 A;  3K6G A;  1NBM A;  3ZPP A;  1MMN A;  1AA7 A;  3PNV A;  4F93 B;  2E1M C;  1N77 A;  2XOK A;  2CS3 A;  2UV1 A;  4HNU A;  4HST A;  4XL9 A;  3HOT A;  2VIX A;  3I3L A;  3VSL A;  4H4K C;  4E7I A;  1O8F A;  1O8G A;  3MKY B;  1IB4 A;  1OHH A;  4B48 A;  2PJR B;  1UG0 A;  4XOT A;  3DLA A;  4KJZ A;  4B3X A;  2BW3 A;  3M1C A;  3BC9 A;  4PSX A;  2WAE A;  4BS9 A;  2INV A;  1IDJ A;  3HXL A;  1VJS A;  1O88 A;  1LFP A;  4NC8 A;  1DBO A;  2CW8 A;  5IK2 A;  3AL0 B;  4LIV A;  3OS0 A;  3QYF A;  1CZF A;  1Z7L A;  1QCX A;  3DTE A;  2O0W A;  4I84 A;  2KP6 A;  2VPL A;  1O8E A;  2O1D A;  1LVK A;  3K10 A;  1WMR A;  4BL0 B;  3CJR B;  2Y0S A;  1UD4 A;  3S93 A;  4CCM A;  1K6Y A;  4OWR B;  3OOU A;  4BE0 A;  2L7K A;  4BQN A;  2X8K A;  2HVR A;  4DNR B;  3OIQ A;  4IQJ A;  2WBM A;  1WJC A;  2DCE A;  4ZDP A;  3ZCO A;  3L2U A;  5CQE A;  4D1Q A;  3OYE A;  4ZYA A;  2KMU A;  4UZU A;  1O8H A;  5CPR B;  2VXZ A;  2O17 A;  1MNE A;  3IAS 2;  1WJ5 A;  4HEA 2;  3FPP A;  4XOP A;  4HWV A;  4D9J A;  3GQB A;  4BE1 A;  4KIS A;  1WJE A;  4F3Q A;  4HRI A;  4GRI A;  2NT9 A;  3K4K A;  3A3G A;  2IS4 A;  2NTQ A;  3EQN A;  2LY1 A;  1WTH D;  4PSW A;  3WWG A;  4PJJ A;  4N4O B;  1PLU A;  3NWS A;  1JTA A;  2X53 S;  5HOO A;  4CCJ A;  3S3M A;  1PKV A;  1NHC A;  4BUP A;  1HG8 A;  2M4G A;  1R6R A;  4CCK A;  1N75 A;  1Y6I A;  3BCB A;  3DPU A;  3K4M A;  3OYN A;  4IZZ A;  3S3N A;  1I8D A;  2V31 A;  2VJJ A;  3DU5 A;  1ERD A;  2HVQ A;  4PFP A;  4OJL A;  4NQW B;  4IQ4 A;  2X85 A;  1D1A A;  4F92 B;  1WJA A;  1YE9 A;  2K9M A;  3IUO A;  3A2K A;  1D0X A;  4ZJZ A;  1MW7 A;  3CES A;  3PUB A;  1X0C A;  1BR2 A;  2OUM A;  2R7S A;  4KKU A;  1RMG A;  3B4N A;  2E1B A;  2HU9 A;  3H35 A;  4W8Q A;  3HG9 A;  2CV1 A;  1UD6 A;  3IAM 2;  3OYK A;  2M3A A;  1BPL A;  3U21 A;  5FL7 A;  4MR0 A;  3A3B A;  4NNJ A;  3KYL A;  2AQF A;  3FKJ A;  3OS2 A;  2W7N A;  3H9J A;  2JJ1 A;  3W2A A;  2XGJ A;  1BMF A;  4P1W A;  2W82 A;  3K4J A;  4CH7 A;  2IGN A;  2F4I A;  3RCO A;  4HPQ A;  2IQ7 A;  3VMV A;  4RM3 A;  1VF7 A;  3CZ6 A;  3AFH A;  4C9Y A;  3EQO A;  4JMQ A;  4XR6 A;  3HPH A;  3HC7 A;  2WAD A;  3A1Y A;  4C2T A;  5FRM A;  1NG7 A;  1FX0 A;  2LOO A;  3C2H A;  4OAY A;  1VBL A;  3OYB A;  2CV0 A;  3VR6 A;  3L2W A;  2XF5 A;  4YXW A;  1BOB A;  3ZPN A;  3PJR A;  3DQV C;  2IGK A;  4DJA A;  1H80 A;  2VBM A;  3LSK A;  1DQU A;  2GOM A;  2LYC A;  4E7Z A;  1E3X A;  2W6J A;  2R9V A;  1O8M A;  2OC6 A;  3QOE A;  4NK6 A;  3SUC A;  2DJI A;  1OGO X;  3OYF A;  1IDK A;  2NST A;  2WY7 Q;  4NC7 A;  2QX3 A;  1PYV A;  1KCC A;  2IS2 A;  2JSP A;  4PJN A;  4F55 A;  4TT3 A;  2ZTN A;  1DBG A;  3DWL E;  1YX3 A;  3VDX A;  4XLA A;  1V5E A;  1DGW Y;  2LH9 A;  3VYU B;  2ZTG A;  1UD2 A;  5DN6 A;  3OR2 C;  3JUR A;  3GQ7 A;  2BOL A;  2X1C A;  2GJK A;  1OOC A;  4E4H A;  1MND A;  3GVJ A;  3GRH A;  2MD0 A;  2VAS A;  4MLO A;  1BLI A;  1OLT A;  1BHE A;  3VSU A;  4XLF A;  2JDI A;  2BSP A;  3G05 A;  3DPL C;  4BJ5 C;  2HVS A;  1E1Q A;  3SZG A;  2QXZ A;  3H5R A;  2ZZQ A;  1BR1 A;  1Z3X A;  4RM2 A;  4BQQ A;  4G7X A;  3H9Q A;  2CFO A;  3EUA A;  4U4B A;  2CK3 A;  2EWE A;  3VMW A;  4ZTF A;  3GBG A;  3OYJ A;  1V5G A;  4AU7 A;  3K4L A;  3V42 A;  2XC7 A;  4NK8 A;  5HLT A;  2PYG A;  4OZY A;  3OL4 A;  3EUH C;  4BAC A;  2NOJ B;  1QHG A;  2KHM A;  2PYH A;  4PJL A;  1UD8 A;  4YEJ A;  3TL4 X;  1E1R A;  3C2G A;  5CKT A;  1PJR A;  1V5F A;  2XAU A;  1D0Y A;  1TT0 A;  2CMP A;  2WZP P;  4OJ6 A;  1HZE A;  4PUS A;  2HDW A;  2KRH A;  2K5C A;  4NUB A;  4P5O A;  3N05 A;  1X1C A;  2XF7 A;  3OYA A;  4B3F X;  1HA8 A;  3LMW A;  1FMV A;  1WP6 A;  4DOZ A;  4GQN A;  2KLO A;  3VSK A;  4B43 A;  1NRK A;  5CDF A;  1LDK B;  3PSI A;  4FET A;  1V0F A;  2X1D A;  3J7A Y;  1G8X A;  3VYS B;  1X4P A;  1MAB A;  3VST A;  1WFX A;  3T56 B;  4KKS A;  2X6W A;  4XON A;  2W6I A;  2IGO A;  4BEH B;  3ZXS A;  2ODL A;  1MMG A;  2VJ5 A;  4XKV A;  1BR4 A;  1SKY B;  4QPO A;  1IA5 A;  5AMV A;  1IRX A;  2ZSH B;  1COW A;  4BXF A;  3OYD A;  3OYI A;  3G2B A;  2LBF A;  2JVG A;  2NTP A;  2W4S A;  2NT6 A;  1QU3 A;  2XZP A;  3OR1 C;  1RWR A;  3OYC A;  4B3G A;  3ZR8 X;  2L2O A;  2MFZ A;  2HPI A;  3DEE A;  2L9N A;  4PJM A;  2R7V A;  2F43 A;  1XG2 A;  2O5R A;  2X51 A;  3DU6 A;  1G59 A;  2D3L A;  1RU4 A;  3DTK A;  4XNF A;  1V0E A;  3ZRG A;  2KRC A;  4W8S A;  1EE6 A;  4E7L A;  2XDV A;  2W1O A;  1LKX A;  1T0F C;  4G6T B;  3DKX A;  3VYR B;  4XKC A;  4LIT A;  4IKF A;  4YZ0 A;  1AIR A;  3KX2 A;  2D3N A;  3AL0 C;  4PK4 A;  3FY3 A;  1MMA A;  1OB0 A;  2X1E A;  2VQL A;  1GLN A;  4DBR A;  3VWB A;  3OY9 A;  2WSS A;  2Z1D A;  4FAS D;  3L2R A;  2PJR A;  4OZZ A;  2W00 A;  2KQR A;  4U7B A;  4KT6 A;  4YZQ A;  3H9G A;  1D1C A;  2I8D A;  3K70 C;  4HG2 A;  2X6Y A;  2M5S A;  1TZL A;  1JRG A;  3CP2 A;  5KNL A;  2DIE A;  1OR7 C;  2Q2E B;  4AYB A;  4JQF A;  2WAF A;  3ZIA A;  2X3H A;  4Z03 A;  2LG4 A;  3FDY A;  4HNT A;  2Q1Z B;  3HUG B;  2BVM A;  5FRO A;  4CA0 A;  4X0G A;  4XLE A;  3OW7 A;  2IS6 A;  2BVL A;  1W0K A;  2PMZ A;  2VLA A;  1W0J A;  3CP8 A;  1E3Z A;  3SEQ A;  4ZDL A;  2L5Q A;  2RRE A;  1VZ0 A;  1H8H A;  1Z21 A;  3LSI A;  4KKT A;  3WQZ A;  2M7B A;  2LRD A;  3FHN A;  4IX7 A;  5HNH A;  1UD5 A;  3H94 A;  2VJI A;  2R7W A;  1X1A A;  3AKZ A;  1K5C A;  2R4G A;  3LSH A;  4YZA A;  4XMY A;  3I9V 2;  3OYL A;  3PSF A;  3RQ4 A;  2M4K A;  2UVF A;  1WJD A;  5KCM A;  2AQE A;  2WY8 Q;  1OGM X;  4Z1M A;  2IGM A;  4DGW B;  2E5Z A;  2BW3 B;  2HZD A;  1WPC A;  3OMY A;  4II2 A;  1Z3Y A;  1O8I A;  1X1B A;  2P0W A;  2V7F A;  2Z2S B;  2E1M B;  3OEH A;  4XLH A;  3RSN A;  5JHF A;  2UWM A;  2KDO A;  2INU A;  2GK7 A;  4XKB A;  2LZJ A;  3H5A A;  4F91 B;  4OJP A;  3E1S A;  3TBI A;  1VLY A;  3OPO A;  3OIP A;  1HVX A;  4HSR A;  1KZL A;  2WPD A;  2CUZ A;  1SFK A;  4XD7 A;  2ZXH A;  1U0J A;  2VB6 A;  4ZTJ A;  3HOS A;  3D5L A;  4C30 A;  4XM3 A;  2IS1 A;  2KPM A;  4DK0 A;  4HIZ A;  4CCL A;  3LNN A;  3GQ9 A;  2VKD A;  3DPT A;  4CCN A;  5KHD A;  2UUZ A;  4XQF A;  2DOA A;  3MKZ A;  1WJB A;  3KEW A;  4FXU A;  4E0F A;  2CH0 A;  3TMO A;  4EAT A;  3JU4 A;  2CUJ A;  2HLD A;  4URR A;  2MAB A;  2UVE A;  3KEY A;  3QYB A;  1K28 D;  4BGD A;  3BCD A;  4AVZ A;  4OJO A;  1JI8 A;  2E5N A;  4Y33 A;  1E0E A;  5LFA A;  1Y56 A;  3VSV A;  3FBN B;  3ZQQ A;  4YRV A;  1P9Q C;  1UAA A;  2CW7 A;  2FUG 2;  2K9L A;  1KMH A;  3NE5 B;  4TKO B;  3RPU D;  2QE7 A;  3W2W A;  1KON A;  2KZV A;  2GJP A;  1BN8 A;  2GOX B;  4ITV A;  2V1N A;  1OFM A;  2X6X A;  2NZM A;  2OV7 A;  3IP4 B;  4Y3O A;  5LD2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...