2VJIA

Tailspike protein of e.coli bacteriophage hk620
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
598
structure length
598
Chain Sequence
b'DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE PROTEIN
publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Bacteriophage hk620
molecule tags Viral protein
total genus 229
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjiA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjiA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjiA02
1O88A 3GQ9A 2ODLA 4Z06A 2O1DA 1X0CA 2PYHA 1OGMX 2UVFA 1JTAA 3VMVA 3EQOA 2PECA 2PYGA 3VMWA 4MXNA 1OOCA 2NTBA 2VBEA 4XN0A 4AVZA 4W8TA 2QX3A 4OJLA 1JRGA 3WWGA 4U4BA 3T9GA 1OFMA 4YEJA 4NK6A 2NTPA 2QXZA 3GQAA 4W8RA 4XLFA 1DBGA 2VJJA 4YZ0A 4YZQA 4YELA 1KCCA 4XONA 4XMYA 4XOTA 3GRHA 1IB4A 4W8SA 4XLCA 2X3HA 3UW0A 1DBOA 3VSVA 1O8HA 1OFLA 1PE9A 2QY1A 3VSUA 1O8EA 1O8FA 1QCXA 4OJOA 1O8DA 2X85A 4Z03A 3B4NA 1O8IA 2X6YA 1IDKA 4I84A 5C1CA 4XM3A 4URRA 2VJIA 2O17A 4NK8A 1QJVA 3KRGA 4OJPA 1CZFA 3LMWA 3GQ8A 2BSPA 4XQFA 2NT9A 3B90A 4XKVA 1BN8A 4PMHA 2VBKA 2NTQA 4XLHA 3ZPPA 1AIRA 4XORA 1O8GA 1PXZA 5C1EA 1KCDA 4XOPA 1IDJA 2Z8GA 4XKWA 1IA5A 3B8YA 2O0VA 1GQ8A 1O8KA 2IQ7A 1BHEA 4XN3A 1NHCA 1K5CA 4XLEA 4HWVA 4YZAA 4U49A 2O04A 2X6WA 2NSPA 1XG2A 1O8MA 1HG8A 1O8JA 2INVA 4XLAA 3EQNA 4XR6A 1WMRA 4W8QA 4Z05A 4EW9A 2UVEA 3FY3A 3GQ7A 4OZYA 2X6XA 2VBMA 1H80A 4MR0A 4XNFA 1RWRA 1O8LA 4OJ6A 1OGOX 2INUA 1EE6A 3SUCA 4OJ5A 5AMVA 4OZZA 1KTWA 4C2LA 1VBLA 2NT6A 4YZXA 1PLUA 2NZMA 3VSTA 1RU4A 2EWEA 2NSTA 4XL9A 3JURA 3ZSCA 1RMGA 2O0WA
chains in the Genus database with same CATH superfamily
2ELKA 4IXAA 2OK8A 2QTZA 4U87A 2Q8KA 1ETVA 4QLCU 3GLLA 3KP5A 2P81A 2OZ6A 1PKVA 4LG0A 3ONYA 2EZIA 3A03A 3LJYA 1MBEA 2CUZA 2X0KA 4B3AA 2LRDA 1G7RA 4HX8A 2F5CA 3U1DA 2MW8A 5JVTA 4ZGNB 2NS7A 3H35A 3ZN0A 1JRGA 3GSIA 4GCVA 5FFXA 2C78A 1D8TA 2J5PA 2CQXA 2ZXWH 4LIUA 1MGTA 5CVUA 2VT3A 2QSFX 4HE6A 2XB5A 1HA3A 2WWYA 3K10A 1D0YA 3ZZTA 4ZTFA 4YZ0A 5IYRA 3BH7B 5HLGA 2P6TA 4F91B 2BM1A 2VUMJ 3PQJA 4C3HJ 3EDPA 1QO0D 4LG3A 3FHZA 2A69F 2DI3A 3RJPA 2VQLA 3W5VA 4KIBA 1R1TA 3J7YJ 4BHCA 2IS6A 4BU2A 1MMSA 3E5UA 5D8LB 1A6QA 1RR7A 1OFDA 4KA4A 4OM9A 2H8WA 3ZN1A 3LQ6A 2XPUA 2RC4A 1ZLKA 3OOCA 2Q6IA 1YJWB 4BGDA 4UZEA 4URRA 4P9FA 3GTLJ 1TQMA 3JQRA 4ANJA 4KITB 3OIPA 3J81K 3IP4B 2W84A 2JA2A 3DU5A 4UUSA 5LHIA 1XTAA 3P5JA 4P26A 1N08A 4F7ZA 2XAUA 3AG2H 3BR1A 3B90A 3I54A 3AAFA 1T6SA 4Y52J 2FNPA 2B7CA 4ZYHA 4M6VA 1FX7A 3DEWA 2K86A 3EQLF 1WCMJ 4XRMA 1JT6A 2OF7A 2QENA 3RIRA 2F43A 4IF4A 4RLZA 1UD4A 2KZVA 1T38A 5JLVC 1BW6A 2VN2A 4HSTA 2DJNA 4PSWA 5CVJA 3DLLF 1J59A 2BHYA 2LZJA 3ERMA 2V31A 1KZHA 3OV8A 1FYMA 1S72I 5DSZA 3M1EA 3ZRGA 2EIKH 4CICA 3SDBA 2O04A 2X6WA 1P4AA 1R7JA 1KYWA 4TV7A 2FA5A 4ABZA 2CV2A 1ETWA 3IUOA 3K2AA 2V7VA 4D9JA 4I02A 4FT8A 3PO2J 4Z05A 2HGCA 2M30A 3TO9A 3ZMDA 2M8EA 2CMPA 2Z3YA 4L9VA 1FSEA 5LHHA 2VPLA 5GAHJ 2EZKA 2PQ8A 2DA3A 4RGSA 1R49A 3H3VK 3ECOA 1KGSA 2DLLA 4R1HA 3I58A 3UKGA 1W0TA 2V6EA 1CNEA 3REOA 4II2A 1T6ZA 2VODA 2IXSA 2P3MA 2EZLA 2L54A 3J80K 4HF2A 1W34A 2BM5A 4FK8A 2KIMA 4WQMA 1EP1B 3TEDA 5J1UA 3V76A 1RU4A 3O2PE 4C9YA 4BHBA 1X3UA 1R4MB 3MEXA 4KJZA 4RB2C 1QU3A 1IC8A 3CJRB 2EINH 2QA4I 1OQYA 1O88A 2K4JA 4C3JJ 3J81k 2VFPA 4CUGA 3GTKJ 1IRZA 4EMSA 4N4NB 2XT2A 1WFXA 2L9SA 1VQ7I 1ZM3A 4PC3A 3FZVA 2LH9A 3IWZA 4L5JA 3F22A 2AHQA 2HVRA 2M8GX 1U0JA 3E0JB 4RBOA 2P5KA 3GTOJ 3JU4A 1ZUNB 3BP8A 3AG3H 1R5OA 3CD6I 2QUFA 5H5JA 2DYRH 3A8IA 3BC8A 2ETHA 2O6WA 1UAAA 1VJSA 2M5SA 4RD2A 2XGJA 1R6RA 2COMA 4AIKA 3OPOA 1DBGA 2TCTA 2W57A 4U0WA 5FLVA 3S3MA 1V3FA 1GVDA 1B23P 4MFDA 2BYVE 1RNLA 2WV1A 3VYSB 3HDDA 1EA0A 3A35A 3ISPA 5EZHA 4HX4A 4UZUA 2VKDA 2KIUA 2VBUA 1TUIA 1UHSA 2V6CA 3L2WA 2FD5A 2VPRA 3HRSA 3A3GA 4RD0A 1B59A 1U9NA 2C5BA 4M1KA 3HHGA 4BPRA 3QAHA 1UMKA 2O17A 4XSXF 5ED4A 4NK8A 2LYCA 2JVGA 2HFHA 2LOOA 2QYOA 3O8HA 1R1VA 4QWQA 3D5SC 3DTIA 4PMHA 1MZBA 1JKPC 2IP2A 3GF2A 3OS0A 2EJRA 1OLTA 2ADUA 3BDDA 3WTWC 2D9RA 4MLOA 4BJ6C 3T1BA 4NB5A 4YAOA 5TY0A 2D5VA 2NS0A 3A1YA 3BR5A 3DKWA 2OTLB 1POGA 2CV0A 2Z8GA 1Z9CA 1X58A 1MBFA 2KQRA 1BHEA 4XN3A 1VQLI 4R79A 1BIBA 2MLGA 4ASNA 1ZRDA 3AVXA 1KU2A 1BR4A 1HW1A 1QZYA 2XGDA 2NS8A 4M9XA 1K61A 1VQPB 4HDUA 2DK5A 1UD5A 1XG2A 1IV8A 2XRLA 2KP6A 1IXRC 1JKRC 2PJRA 2DCEA 4XR6A 3DFGA 1F60A 4ENKA 2R6HA 1IN8A 1Z77A 1BX0A 2LF7A 1TWFJ 4Z4TA 4ZCLA 2VKEA 4NHJA 4YFNF 2VB6A 3QFTA 2YU9J 1O3RA 2XKPA 2BN4A 3ABTA 4RDUA 3CCSI 1JJ8C 1TTYA 2GA1A 1XMKA 2KMUA 3HC7A 4DZJA 4GO1A 1W2BB 4FCYA 5FO5A 1JJ2B 2DMNA 3L2UA 1VBLA 4LLNA 3B73A 2EFOA 4AF7A 2E7WA 2XZOA 5M5YJ 4GGGA 2IPQX 1VNDA 4KKSA 3KP3A 4YAFA 3W6KB 1GV5A 4F55A 3DCFA 3Q38A 1IHMA 2QF7A 3KLOA 3PL8A 2L02A 5CVIA 4LGWA 2WSSA 1GR1A 5TISC 1W36D 3S1NJ 2ECBA 4CYCA 1EXMA 1ETOA 3A01A 1Z91A 1GAQA 2E2HJ 1WH5A 3OYCA 4I01A 1SEUA 3CP8A 2JSPA 3VDXA 3A3BA 5D8KB 4WZKA 1PJRA 5F4OA 2CF4A 3MQ0A 1QA6A 4HBLA 4N9HA 1H89C 3OEHA 1LLZA 3MMYB 1ENHA 2DA2A 2BW3A 4W8TA 4R8HA 1SVLA 3PUNA 1VQMB 3TH0A 1QQIA 4DYRA 1IJEA 2V7WA 1RQRA 1X1AA 3S17J 2EQRA 3CCQB 3TO7A 2I10A 3BH6B 4CYCB 3G6EI 2OK7A 2VL8A 3FK7A 4OOSA 4G6QA 3M1CA 1JJ6C 2EZHA 3JR9A 3LQEA 2VE8A 1ZH5A 1WJ5A 4A2UA 1BQEA 1WKMA 2DO7A 4A3DJ 5E18F 5FNZA 4LK1F 1FC3A 2EBIA 3KIOA 4ZYGA 5E1ZB 1IN5A 4ASUA 2OCCH 1H8HA 3WODF 5GP9A 2LF8A 2HOSA 3GZNB 1TWGJ 4M73A 1O8DA 2X85A 1O7LA 5FLMJ 1FNMA 3QSYA 3VMFA 1O8IA 3MKWB 5C1CA 4XM3A 1YX2A 5E17F 1VQ8I 4OJPA 1LDKB 1RR8C 1SAXA 3CC4B 3HRUA 1VQ6I 4PJLA 2NVYJ 2F4OB 2HCJB 3BQZA 3SFIA 2HVSA 4H9GA 1K8AD 3QYBA 4EJOA 3NE5B 1BN8A 1D5YA 4BHPA 3AVUA 4BQOA 2HYGD 2H1KA 1IDYA 2CQQA 2KJCA 1FOXA 2VC0A 2PG4A 4JMQA 3DDYA 3A02A 2IW5A 2G0EA 3EPZA 1P2FA 2XGEA 2DCUA 3ISXA 4PAAA 3L09A 4D5FA 1OR7C 4NCNA 2K02A 4L9NA 3J7ZI 4Y9RA 5A88A 1BLIA 2R7WA 3MZYA 4UVAA 3I5UA 3QQAA 3FXUA 3IKTA 1HQCA 2CQKA 4CH7A 4Y7NJ 3BCDA 1MBKA 2HOTA 2NXNB 3MZHA 4L18B 1BM9A 4FISA 3VWBA 1E3XA 2B7BA 3W2EA 3LSTA 3ZQLA 2P0WA 2XF6A 1T0FC 3KZYA 2VBMA 4AUXA 4IZZA 5L46A 2L01A 4LC0A 5F6FA 1LDJA 2K7LA 2ZMEA 1FRNA 2PIAA 2K9LA 3V7RA 1PP7U 3OYKA 3C3WA 3BQJA 1GLNA 1XDUA 3IAM2 4DBRA 4WCGA 3FXLA 1RPWA 5L3CA 2JMWA 1QGPA 3BH4A 1DU0A 4EJWA 4CA0A 1PJ5A 3R60A 3GQBA 1LFUP 2GK6A 5TJJA 2XC1A 3CCJB 4KN4X 2QGGA 3ZPNA 3HOZJ 1RMGA 4OIOF 1J7KA 2CO5A 3IH3A 1F20A 1ZR2A 2ZZQA 4DK1A 3BJ6A 1YG2A 3BR0A 1Y0UA 1YIJB 5JFRA 3PIPF 1MNDA 3FXRA 1WSVA 2ODLA 5KAIC 3OYFA 3VEPA 3AGQA 2O1DA 3GMEA 2XVCA 1VLOA 1QFYA 2ZTNA 2A6TA 4UVBA 1YRNB 3A8JA 2UZKA 5IPAA 3LSJA 4PGGA 1NH3A 4OIQF 1DDGA 1JA0A 2ZB9A 5L3DA 2LR8A 1D8KA 3VMWA 3RZDJ 2DT5A 5HDKA 3OYBA 2DYIA 2B0LA 1QGYA 1E1QA 4ZGQB 4G6TB 1J9ZA 4I98B 2BVLA 3SZTA 4PUSA 1KU3A 2BOLA 4HV6A 4DYCA 1JNYA 2YUSA 4M9SA 5EDNA 2FVGA 5K7ZA 3L2CA 2E60A 4X7DA 3OYDA 3WNBA 2YX7A 3D26A 3MMPA 2QEXI 1P7JA 3ZMTA 2P7VB 3ROUA 4OPSA 3CCUB 2BEOA 4Q4ZF 1S6LA 5DD4A 1K78A 2QN6A 4WZTA 3T8RA 5FRNA 1XDSA 4HNTA 4XD7A 1QUEA 5J3LA 2QY1A 4YRVA 2NAZA 1SM4A 3KL9A 4ZYDA 1FNBA 4FETA 3CJTB 1YYVA 2FRHA 1A35A 1WTHD 2VC1A 4ZCIA 3LMMA 3ZBUA 2DMQA 1HLVA 1QJVA 3I71A 2A07F 2YWGA 2QZAA 2V1UA 2BVMA 3I53A 4TMTA 3U6KA 3HRMA 5EEGA 3W6JB 1WOSA 2NT9A 4A93J 4EEFG 4WWCA 5K5RA 4Z4SA 3MZ8A 5DUIA 2EA2A 1SD7A 2FBIA 2OV7A 4UVCA 5HS9A 2NTQA 1K6YA 1FMWA 3DLAA 1K78B 1AIRA 2YUHA 3AK5A 1I3QJ 4KIGA 2LFBA 2QLZA 2VJ4A 1Q1HA 2Y30A 1YQAA 1EP2B 2M7BA 2HTSA 1GQ8A 2E1OA 2FMYA 1F36A 2M34A 4OU0A 4W1UA 5JLWA 2ELJA 5FLXZ 3ELKA 2MFZA 4KMFA 2WZNA 4LOCA 2HZTA 5LFAA 3EUHA 3OYAA 1NG6A 2Y48A 3BG7A 5CKTA 4Y4RA 2OBPA 2V7FA 1U2WA 4BQNA 2R7RA 3A2KA 2UVEA 3C2GA 5HLHA 3TDUC 3H5NA 2Z6BD 2LMDA 3OR1C 1V54H 3AVTA 2LC2A 1D1NA 1UMQA 3FXQA 2DA5A 2ZKZA 4LFUA 3SEZA 2DDBA 3S3NA 3ASSA 2INUA 1XGNA 2QKLB 1YI2I 1D1AA 3SZPA 5GPAA 2OBTA 4C2LA 2RVCA 3QPHA 1P7IA 1FYKA 2W7NA 5EYRA 2PFBA 3WTYC 2EFQA 2R0QC 3RQIA 5FO0A 4RB3C 2V4JC 4BXXJ 2IA2A 4OPWA 3HPHA 4A6EA 1MW7A 5ILUA 3OSFA 2Q2EB 1JTXA 3ABMH 3GTJJ 2LK2A 1T8IA 3HM5A 5B3SH 2DETA 1C0WA 4ACBA 3IKVA 3LVBA 1X0CA 3ML6A 3F8FA 3BJOA 1IUYA 1ZGJA 3EQOA 4OOVA 5TR9A 3FM5A 3H0DA 1QUFA 4PGOA 1Z7LA 2DA6A 5C4XJ 1CGPA 2FU4A 2OC6A 4LJZF 4RGUA 1YITB 1X1DA 3K4CA 1DDNA 2O5RA 4B43A 3J7AY 2CS3A 1QGZA 4X7FA 1P92A 1R9TJ 1X1BA 2Y75A 1OFMA 4YEJA 3JW4A 3TW6A 3ZR8X 2NTPA 4M3BA 2YS9A 4N3GA 4M3EA 3QFCA 4M9ZA 3JAMZ 1HDDC 4RS8A 1HDPA 1U3EM 3GRHA 4N9IA 2GREA 2F6CA 4NUBA 3GBGA 1T33A 2HYJA 2R7QA 4I0BA 1BI0A 1DBOA 2KPMA 3WG9A 4UHTA 1VF7A 3Q3SA 4D7MA 2BGIA 4CO8A 5KK1A 3BR2A 4F52A 3TL4X 2X1DA 3I4MJ 1W7PA 2XAHA 2R7FA 1GV2A 3EETA 3ASPA 1XMAA 2GIVA 3ES9A 1BN5A 2XB0X 3ASOH 3D5LA 1F1ZA 4ZJZA 2KT0A 2FQ3A 5BS6A 2W6JA 3LNNA 2DFHA 1DABA 1N8RD 3LMWA 2K3FA 1BW5A 2W25A 2HQAA 1QHGA 4LMYA 1P4MA 1QRCA 4P22A 1ODDA 5BSXA 3KLNA 5BOXA 3CF5F 1XSDA 1XFOA 5F4MA 1WOOA 3OS2A 2NV4A 1IO2A 3E1SA 4IVNA 3K1MA 1Y0NA 3KPHA 4IW3B 4RDLA 1Y39A 5ILVA 2EV5A 2C4TA 4FHTA 2KKOA 1IJWC 2LD5A 1SFEA 1D2EA 3JAMK 3MKLA 1WWXA 2LY1A 4IO9F 1P9QC 2K9QA 2YX4A 5B5EC 1N07A 4FTHA 2B5OA 3IH4A 1HXDA 2V1DA 2VBTA 2NSPA 1H8AC 3NQOA 3P27A 3F6OA 3H5RA 2P6SA 5JI6A 5DCFA 5HXBA 4UNOA 4YEIA 2BPOA 1QRBA 3T8TA 2VOOA 1KK1A 2PLFA 2INVA 1NDHA 1V5FA 1HCRA 2I8DA 1B4AA 1YJ9B 3PUFA 2HQNA 5HNHA 2VQCA 1JUMA 2IGMA 3OEEA 3ZC3A 2EIXA 4OJ6A 1BJKA 3Q39A 2FSWA 1FWZA 1KMHA 1SAUA 4C43A 2ISYA 4I6ZA 1SFKA 2XSJC 2HR3A 3DKYA 2X1CA 3DEEA 3F0CA 3GWZA 4P3YA 1QA1A 3WGGA 4BDZA 1TLLA 2QKMB 4MHGA 2EFWA 2WB1A 3LA3A 3S2HJ 3JURA 3ZQHA 2EPFA 1K28D 5FD6A 3G73A 2DTRA 4I0AA 4BUPA 6PAXA 1DUXC 2COBA 2QZ8A 4G6DA 4ESBA 2F5VA 1FMVA 2ZL7A 3ZIAA 3CCQI 3WHCA 3VFZA 2K40A 1FRQA 5J1RA 4OINF 1Y8QB 2IGKA 1WPCA 4IQ4A 2BSAA 2V7QA 2V9KA 1G8XA 3K4KA 4C3IJ 3FXJA 2WA0A 4IHWA 2V4DA 2PYGA 4YCQA 2HKXA 4XN0A 3OJXA 4MEXF 1XD7A 4HRIA 1X19A 3ZMSA 4B3XA 4CCJA 4G94A 1K73D 3T9GA 2XDVA 4X07A 2FE3A 4IQJA 2DFFA 4UXNA 2DMPA 3B6CA 2DERA 2PBIA 2JIZA 3CUOA 2JT1A 3CC4I 2DOEA 2LP0A 3GFJA 2K9MA 4DZPA 1IZ1A 1MMGA 2DU9A 2F5EA 2EFPA 3HOYJ 2HXOA 3K0LA 5H20A 1QVTA 1V4RA 5ICGA 2V79A 5J40A 5FRMA 1UD3A 2O7OA 4AC9A 5F0CA 1TVCA 3CCYA 5B1BH 2BXZA 4DQLA 2FNAA 3CC2I 2X0LA 4S04A 4RA2A 2WAEA 4HOBA 1A04A 2CRVA 1QFZA 2WJVA 2XTYA 3K1NA 4E70A 5HNFA 3WTUC 3H9QA 3HOVJ 1MD0A 2GK7A 2Y0SA 2VXDA 1TNSA 2GBYA 2ID6A 1FOKA 1RRJA 2IS4A 2IGOA 2R7ZJ 5IT9Z 2B63J 3E3VA 1WP6A 4Q48A 3F8MA 1AA7A 2DT6A 2ZXJA 1TQPA 3HEFA 3S93A 5GPCA 2BGCA 4X7EA 2R5ZA 2G9WA 4CCKA 3PO3J 5J47A 2GA2A 1FOYA 2QQ8A 1A6IA 4X7CA 3OYNA 1TLHB 1W7PD 3E6CC 1A31A 4LG0B 1QA2A 4XOPA 4HZFA 5E1WA 3G4SI 2M1BA 1K4SA 4EM0B 1ZAOA 1KQ5A 4XKWA 3EUKL 2KISA 4XKCA 2XPWA 2WB1N 3O8GA 1I3AA 4YDTA 3BG9A 3IRRA 2ESHA 2IGNA 2RV8A 2H27A 1OCCH 2GOXB 4YFOA 5LD2C 2ECCA 3GUDA 4E7KA 1PDNC 2GWRA 2VT2A 1ON2A 1MJAA 1ZG1A 2BY2A 3CMEI 2DFEA 5EF6A 2OUMA 1S29A 2A6HF 3GEZA 3PFIA 2R5ZB 4A3GJ 3ONQA 3GQ7A 1S7OA 4DOZA 3HSEA 1QH0A 2HNHA 2W00A 4OMYA 3QU3A 4Y13A 3HUGA 4BYYA 4G8XA 5IYWA 1O3SA 4TSFA 4ACAA 3M9AA 1OYYA 4HF1A 4RB0A 3J7AO 1VZ0A 1SD4A 4PCQA 1YHQB 3OYJA 3LSRA 2ZJRF 1GVHA 3BR3A 1PLUA 4ZYAA 5B1AH 2VASA 4JRAC 2OZUA 4P96A 4IKFA 3S2DJ 4BJTA 2XRNA 1HKQA 4L9JA 2Q6OA 1WZ2A 2XV4S 1G6NA 1MDMA 3X2QH 2ME6A 3SY2A 2R4GA 1WJFA 3KETA 2EWNA 2ZXIA 4UUSB 4Q5SF 1HKSA 1EFTA 1WH7A 5JLXA 1GO2A 3CC7B 2JN6A 4Z06A 1MABA 2PE3A 2NVXJ 1CQXA 2DTZA 2ZZEA 2L9VA 2PYHA 3PETA 3G1OA 5LEKA 1IF1A 3HUGB 1ETYA 1HF2A 1XE1A 4J00A 1JTAA 1YJNB 3EUAA 3K69A 4OAYA 3WTZA 3CCUI 3HHHA 3OL4A 2PEXA 1YOVB 2DMUA 4WX9A 4BBSJ 1NBMA 2NTBA 3W2WA 3BTJA 2XNJA 1E0EA 3SJPA 2Y0SN 1TC3C 2CW8A 5IYBJ 2W4SA 1CQTA 3CDIA 3FF5A 1AMOA 4E6KG 3DXJF 2XAFA 4TMXA 1MDMB 1N78A 2MSYA 3BG6A 3UNGC 1VQ4B 5KAFC 1EWYA 1ZM4A 1WXRA 3DEUA 1UD6A 2VIXA 3I3LA 4LB6B 3NEUA 3PNYA 5DEQA 3RPQA 4DQKA 2VJ5A 4QHYA 5M3MJ 3PSSA 4QPOA 2JRTA 3G2BA 1MMNA 4C2UA 2F1MA 3FISA 1HSTA 5D6EA 5A2QZ 1XGOA 2VLAA 1JE8A 4P6YA 4A5NA 2HDCA 3S3OA 3D1NI 1FEXA 3RIQA 2LKPA 2GM4A 1N06A 4ZDPA 3PA1A 4AIDA 2OTJB 4PJMA 4E7LA 3V4GA 5H6QA 2JTVA 2RDPA 3Q3AA 2W6IA 1R22A 4A69C 3CCRB 1ZHFA 4U7BA 3WGHA 1ZGWA 1J5YA 2GXAA 2AXTC 2FQ4A 4OIPF 4B48A 1MNMC 3Q0WA 2EFGA 5DN6A 3OYEA 1BA5A 5FD5A 4AIJA 2DBBA 1G3YA 3VNVA 1ON1A 3P9CA 1IB0A 2ESNA 2CWEA 2M87A 2WY7Q 2Q6LA 4PC6A 2CUJA 2RREA 4BAYA 1BJAA 1IN4A 3LYCA 1O8GA 3CLQA 3IAS2 2CFOA 2UXNA 2C5HA 2B0RA 4Y33A 1PP8F 3CPXA 1W5SA 3ZQCA 3ESWB 1S9HA 1S8NA 3OIOA 2FJ1A 3QPSA 1AOYA 3V7AA 1P6RA 2QM3A 5A2QK 3WQZA 1EJ9A 2FXAA 3H09A 2LNBA 4EVIA 4RPDA 4ROXA 2KDZA 4M72A 1U8BA 4KT5C 3ZQGA 1HZEA 2V7UA 3W2FA 3TBIA 1O8JA 1UCRA 2E1MB 2R3SA 2BY3A 3ZGKA 3EQNA 4BE1A 2BHZA 1USSA 2UUZA 4RGXA 4Y17A 2L4AA 1BPLA 2FUG2 2C77A 5FKNA 1H80A 3NB2A 3LWFA 1QG0A 3CMMA 1HF0A 2OAZA 3RPUA 3WTXC 2W82A 3QYEA 5LLQA 4QV2A 1SMTA 3OR2C 5GTIC 3JRBA 3BTLA 3CP2A 3H9JA 2V7XA 5F27A 1EH8A 4OJ5A 3SZEA 3SEQA 4A3EJ 1F5TA 2QE7A 3BZKA 4A3FJ 2NT6A 3H3UA 4S05A 2P8TA 2LKSA 3OFNA 4YIFA 2DYSH 1E64A 4ZV4A 2ZZFA 3WNCA 2NSTA 2CFXA 2DA7A 2N8GA 4BKXA 1Y1VJ 2FBHA 2MH9A 4E4HA 4ZYEA 1EZGA 4II3A 1QGAA 3PA2A 2DMTA 1AU7A 3CCVI 2L5QA 4XIDA 2KLOA 3F9KA 3WTTC 2HXIA 2XEXA 3TP0A 3CUQA 3CF2A 3VB2A 5IOZA 3W2GA 1T08B 1B8IA 3SEJA 1IUFA 3QOPA 4E7IA 3BNWA 1VQPI 4M53A 4UUTA 3OOUA 2ZJQF 5FA6A 2PECA 1RKTA 3M8JA 1UHMA 4DBQA 2FF4A 3G71I 2DA4A 1T0FA 3C7JA 3H5AA 3JREA 2D3NA 1RUNA 3RYPA 1TYXA 2O0YA 2QX3A 5CJ9A 1WORA 3ASTA 1XQBA 3KEOA 1SFUA 2PJRB 4WK8F 1OHHA 2VJJA 4YZQA 5J4YA 4XMYA 2XGCA 1VFCA 2C6YA 4JK1X 4BNCA 1VQKB 3GLXA 2QYUA 2VBZA 4MNUA 5DM6F 3CUQB 3SFZA 4CHUA 1OMIA 3T56B 1B8IB 3L9FA 4H4KC 1ZR4A 4NC7A 2O8XA 1YW8A 5FKOA 5J35A 2L2OA 1FX0A 4E7JA 3W5UA 2NOJB 1O8EA 3HOTA 5LGTA 4C30A 3ZCOA 4QVAA 2VNKA 4I84A 4QUZA 2QQ9A 3E20A 3P26A 1VQ9B 5DD8A 1G7SA 4JOMA 3GO5A 3GX4X 1I7PA 2VFOA 3HSFA 4KKUA 3GQ8A 4B3GA 1QZEA 5L3FA 4Y7CA 3KEYA 2W7ZA 4P9SA 4BL0B 5KNLA 5M5XJ 4AC0A 2VBXA 3I1FA 3A01B 2XOKA 4ZC3A 2IRFG 2CYYA 1KJZA 1QBJA 5CLSA 2HOAA 2HTJA 1EH7A 5CQEA 1JGSA 3JCUC 3GTMJ 1NHAA 3V7SA 2DW4A 1WPKA 2GIZA 3IWFA 4XLEA 3M7GA 1VQ5B 3MHPA 2CG4A 3VOEA 1VI0A 5K1YA 2CW5A 5DS0A 1JKOC 2BW3B 4DNTB 4P12A 4U49A 1YX5A 3K4BA 3T0YA 1S7AA 2Z5UA 2Y2ZA 1O8MA 4MEYF 1HG8A 1OB2A 2VBVA 1QZZA 1Z67A 2GLOA 2LY2A 1LE8A 1FTZA 2RAEA 1REPC 4AM3A 4L8JA 1OFEA 2ICWG 2R5YA 1K8FA 5HDGA 3VSKA 3VR6A 2IA1A 3DPUA 3SHFA 4BDYA 1HVXA 2XNDA 2G7UA 2XF7A 3HSRA 4B4DA 1XSXA 1OGOX 1ZTRA 2XROA 3QRFF 2K27A 4IRIA 3S14J 2Y0MA 3W6VA 4HQMA 4MGRA 3CJQB 1MH3A 4GYIA 1DGWY 3Q6RA 2BE5F 2DPUA 4J19A 3K2ZA 4XRSG 5DTDA 1YW9A 2M9HA 4RDKA 3GVLA 1J0RA 2DOAA 1BI2A 2GXGA 3DF8A 3RZOJ 1EFUA 3PSZA 1K4ZA 3CCLI 4L0ZB 4YHBA 2F2EA 2M0MA 1LKXA 3OE7A 3HG9A 3CCEI 4EATA 2O0WA 3KP4A 4HV5A 3JRHA 5GTHC 2VFQA 5F0FA 1LE8B 4Z2YA 4A3CJ 1I1GA 5FKMA 4EV0A 3GQ9A 1X3WB 1ZM2A 2BX6A 4U0YA 3CCMI 3L7WA 5HOOA 3I4PA 1H42A 3KP6A 4I09A 1FIAA 1FBSA 4A6DA 4A0XA 3H0GJ 3U2QA 4F92B 3LOCA 1TBXA 4B8XA 1OJLA 4BEHA 5DS9A 4YIRX 4GRIA 2WV0A 3AG1H 4JX4A 3VYRB 2RNJA 1X1PA 4E7ZA 4RJLA 1JUPA 1GXQA 3WTVC 3A0BC 2CJJA 3N4MA 2H6BA 1T95A 4HG2A 1GJRA 1J75A 1E62A 1TT5B 1Z7UA 2V26A 3FHNA 3QWLA 3PNTA 1YLOA 3W2IA 1Z1DA 3CQZJ 3M8FA 1HSJA 1N25A 3SKBA 5DDGA 1ZREA 4JX5A 5F0HA 1STZA 2M3AA 3ZMUA 1HKTA 3GVJA 4K1XA 1E2XA 2MH2A 3MFKA 1F4KA 4M0LA 4UZFA 2EB7A 3GYHX 2L4MA 2WY8Q 2ZMEB 2XUBA 3MD2A 1TL8A 2HEOA 4Z4RA 4IHSA 1HBXG 4BEHB 4MTDA 3HAGA 3AL0B 1DPRA 2H09A 1KYZA 1YW7A 5DCMA 2E7XA 1LFPA 4G12A 2A5YB 4BE2A 3LFUA 4DJAA 2E1RA 4OJOA 5FKLA 3OY9A 3R0AA 2ZSHB 4B47A 3VO2A 1U5TA 5F04A 3TMOA 1A5JA 3PENA 2ACJA 1I5ZA 1LQ1A 5IT3A 4D0PA 2J8IA 4M6YA 1KONA 3S1QJ 2BSPA 2ME0A 4KYWA 5ICFA 1YJWI 1MNEA 3QP5A 3SLDA 2E5ZA 1RZ4A 2X9DA 3PUBA 2R7SA 1RKWA 1D1CA 5KVRA 4DNCA 4KMUX 1G59A 1S72B 1QPMA 5KHDA 2NVQJ 1E63A 5C1EA 2HI3A 4RAGA 3TO6A 4C2MJ 2AQFA 2VFMA 3CPWB 1FNDA 3RKXA 3F72A 5TRDA 2ZSIB 2CUFA 1EA3A 5JBQA 2XTXA 1ZKGA 4AYBA 5K5OA 1QQ1A 5J4VA 1U5TB 1YHQI 4IHVA 2BM0A 3WY9A 1OGJA 2MD0A 2XNCA 5CYVA 3AVWA 2DJIA 2HDWA 2JK3A 3QPLA 3HGYA 3BTIA 1JHFA 5JMCB 4HAMA 2FX0A 4XLAA 3BC9A 3BY2A 2O61A 1ZRFA 1Z3YA 3BPVA 3H92A 4IX7A 1HOMA 1UD2A 3VYTB 3CRZA 2ZZGA 4HPQA 5E3NA 4YXWA 2E2JJ 1KK2A 4Z4ZA 4RAFA 5FIUA 1LUJB 2NVTJ 1ONVA 3VMVA 2IT0A 2CGPA 1LNWA 5TGTA 5HDNA 2PN6A 4V2GA 2RKHA 2JA6J 3DBHB 3HL2A 1A36A 1OGIA 1OCZH 3U2RA 1E3ZA 2QA4B 4BJ5C 5BQTA 5BPDA 2PMUA 4EJVA 1ELOA 1SKYB 3KEWA 3JX8A 2D1HA 2XAJA 5E3MA 1DQUA 4G1VA 5FROA 5IK2A 1Q7YD 3OS1A 2GJKA 4ZDLA 2JWTA 5ICEA 3B78A 1VQ7B 3SQNA 1W5CC 4FASD 3OW2B 4FWTA 1IXSB 2L0KA 3I4NJ 4MYUA 3DQVC 4E0FA 2QQAA 3B82A 3VPRA 2F5DA 3S32A 3AVYA 4ETSA 4MXNA 1VLYA 4IPAA 1X4OA 1KK0A 2PJPA 1XMXA 4H0EA 3CDLA 2VFNA 1E1RA 2J8KA 1OB5A 4UV9A 3T53B 5JHFA 4IHXA 3EYYA 1NRKA 1KK3A 5B6IA 3QFRA 1VF9A 2V5IA 1ZM9A 3CCRI 3BZ6A 1O7FA 1R5GA 4YELA 1KCCA 4XONA 4UB8C 1QRYA 4D5CA 5CDFA 2V9PA 2K9SA 5IY5H 3DPLC 3KP2A 5FLXK 1WDTA 4L5EA 3OW7A 4J0QA 3Q6QA 4AD9A 1X1CA 2A6EF 3F3XA 1QX4A 4AYBN 3WE3A 1BI1A 1P4XA 4BE0A 3SYJA 2CRGA 2O3FA 1NK3P 2OQRA 2KJBA 2LLKA 2OCEA 1I18A 1ZG5A 1LLWA 3KP7A 5HS7A 1T56A 4OOXA 2X6YA 2Y31A 2GXBA 3G3ZA 4D7NA 5AONA 3LSIA 4LBYA 4V2FA 3TGNA 4EH1A 1KC8D 2DOGA 2MG4A 2YWEA 3S2WA 5GV8A 2JJ7A 4WXCA 2PMHA 1ETXA 3K4NA 4UY8I 1NB9A 1G4DA 5K5QA 4RAYA 2VXZA 4RLQA 4AWXB 4UAJA 3LAPA 1W1WE 3RY8A 4P9UA 3I64A 1VQLB 1IAWA 5J8CA 3D0SA 3OZVA 2VKHA 2NNYA 2L9NA 3E5XA 2HQRA 2GQFA 4YAWA 3SXYA 3CMYA 2STTA 1H8EA 1IN7A 5E3LA 2OTLI 1OYIA 5HS8A 4HWVA 1S4MA 2FX3A 5LGUA 4PFOA 1R5BA 2RC5A 5H59A 1IRFA 1JKQC 2GPJA 2E19A 5DNSA 4X1EA 2L7KA 1GHCA 1W0JA 3AGPA 3I55B 1Y8RB 3OYIA 2IA0A 4W8QA 1WMRA 1T2KA 4DGWB 3FMQA 3HKZN 2O6GE 3MCZA 2V1XA 5CQGA 3TOAA 4XNFA 4DYQA 3QPTA 2M5WA 4NQWA 1ETKA 1TYUA 1O8LA 4ZCMA 2HOEA 3AFHA 2OU2A 1EH6A 2E1NA 4KFCA 2AO9A 1DP3A 3SUCA 1OCPA 5BPIA 2K5CA 1E3OC 4BS9A 2EV6A 3DTKA 5IOYA 3TP3A 1AWCA 2XAGA 4CCNA 1W7PB 3DU6A 4I99C 3FIWA 5HODA 1EP3B 2JJ2A 2EWEA 1UFMA 2HLDA 3FPKA 1DU6A 2ELHA 3R0JA 2W24A 2ZBVA 2WPDA 3SYTA 2Z2SB 1K7AA 3E6BA 2X1EA 4PC1A 2OPTA 1U6GA 4KH3A 3SJMA 4XBFA 3ZQ7A 5F4JA 1KTVA 1ORKA 1BX1A 2DQLA 1WI9A 1QPIA 3BCAA 1L0OC 4CQJA 3ONUA 2J5OA 3BWGA 2QWWA 3Q5FA 1FPQA 1IRGA 2CNDA 1UG2A 4KISA 5D5UB 1T6XA 3GCMA 1MMDA 2C4UA 4PC7A 5THXA 3DV8A 4WXHA 2LBFA 2BF4A 1SD6A 3WWGA 2OA4A 3HZJA 1WOPA 3PFYA 2DXIA 5DV5A 4IJAA 5K7FA 1BIAA 2ZL6A 4JX6A 1Z6TA 4W8RA 1LPQA 1IV6A 1PUFA 1VQMI 2XSDC 3OYGA 2CSOA 1E3HA 4PGHA 4XLFA 5LBQA 2MYSA 1FP2A 1M1EB 3H9GA 1K9MD 1K83J 3QE2A 2JPBA 3RCOA 2VNIA 4XLCA 1ZN2A 4NC8A 1APLC 1PUEE 3CESA 1V55H 2X3HA 5E8IA 2O03A 3WE2A 3K70D 2P5VA 1B9MA 4U88A 3KCCA 4KICA 2ZTGA 4P6VF 1O3QA 1KQ8A 1R00A 4HA8A 1GXPA 4YFKF 2F5FA 4RD3A 2R9VA 5GAGJ 3NWSA 1VQ6B 3B4NA 1R5NA 1IDKA 1V5EA 1SVMA 2W48A 2JUGA 2LBFB 1S0UA 4C0SA 4EJUA 1J2XA 5D5VB 3IH2A 2WZPP 2VYQA 1YIOA 1JTYA 1W87A 1VQOB 5D6FA 5E79C 4BY7J 3H36A 4ZZDA 1AIPA 1N05A 4KT6A 3NWTA 5EEHA 2ZFWA 5LRSA 2X4HA 4QSHA 4ESJA 2QDXA 4IHTA 4XLHA 3AVVA 1UELB 2TRTA 4LBZA 2UXXA 3I0TA 3R4KA 2VKVA 2DN0A 4FX0A 1PJ7A 2QTLA 3B8YA 1FP1D 2LG4A 2ZXHA 4PJNA 1L3LA 1F43A 1D5VA 3ASRA 2E34A 4HYEA 1N77A 3L2QA 3LSHA 4NBQA 3O6BB 1UJ8A 2F4IA 4WZLA 3AG4H 3BROA 1DP7P 3T5XA 1S5LC 3KFWX 3LSGA 2JRMA 1O4XA 1E3PA 2HYFA 2QMUA 2X6OA 2Q0OA 1G3SA 2X6XA 3L1PA 2XGXA 3RQ4A 1ZYRF 1IRXA 3WU0A 1BBYA 4OAZA 2DEUA 4N4OB 3DWLE 3J81Z 1EFCA 2EILH 4BQQA 1GAWA 1QA3A 1IGNA 1KQ9A 2QBYA 1HA8A 1OB0A 3ZPLA 1KTWA 1I27A 5GAEJ 1ACIA 5AN9A 2NZMA 2KZGA 5EEAA 3HPGA 2M2EA 4W97A 3K4JA 1CLWA 3N6ZA 1MKMA 4LLLA 4XL9A 4MIMA 5JHUA 3OSGA 2VBSA 3V42A 1FT9A 2E5NA 1MMAA 4A3IJ 3RDIA 2NVUB 5E3OA 3VNUA 3CCJI 2WBMA 2P4WA 1GUUA 3OZWA 4ENJA 2CBXA 3EYIA 3DBLB 1G3WA 3L2RA 4G7ZF 1YIJI 1TYVA 2M4GA 5GADJ 1FNNA 4GQNA 2OQGA 2BGJA 2DFIA 5IT9K 1BOBA 2QBYB 4Z4VA 1T5EA 1Y1WJ 4HIZA 4EJTA 2ZJPF 4DK0A 2VQGA 3GZ6A 1FYLA 4CYDA 4MTEA 5BMZA 3ZP5A 1COWA 1YLFA 5E1XA 2QEXB 3PUMA 4MFEA 1D0XA 4OJLA 4ZZLA 1UB9A 5F08A 1Z05A 1W4MA 2H1LA 1FY7A 1ZLJA 2HDNB 1ETQA 1W35A 5E20A 3UR3C 3J80Z 3BY1A 1HW2A 3F8NA 1WJCA 3F6VA 3A1PA 2MC3A 3LFKA 1JXSA 2J7KA 4I2OA 3FX3A 3GVAA 4B4CA 3PSIA 4W8SA 1B9NA 2JPCA 3R6JA 3BOQA 1KQ0A 2XZPA 3CO7C 3H3ZA 4ENMA 3SZGA 2CV1A 3MN2A 2D74A 1O8HA 1Q1VA 1OFLA 1BI3A 2CW7A 5L3GA 4XK4A 5FJ8J 5ILSA 5E8GA 2WTEA 5CVRA 4G7HF 3ZZUA 4HX7A 4WXDA 1FBUA 3I56B 1ITYA 4X0GA 2IS2A 2JN9A 4P5OA 3OYHA 4KIFA 1OISA 2VJIA 2IEKA 2NNNA 2RQQA 3FKIJ 3Q0VA 1Q86D 3FXMA 3TDZC 1G7TA 2BZTA 2MD5A 5D5XB 4XQFA 1B6AA 4Q7JB 5C3EJ 3RYRA 4HDVA 3HB9A 4O5VA 2G0YA 3RKWA 5IYQA 2Z9OA 2F4MB 3LSPA 5EGOA 3CW2A 4RD1A 4E7SA 1BC8C 1USTA 2PMZA 1G3TA 5F1RA 4HQEA 1YFHA 1DG1G 4G5GA 5FO1A 1IDJA 3FXKA 2BM7A 1FBQA 1OCOH 1OFCX 2LVSA 4L5IA 1LM1A 2EIMH 2PLYA 1B2RA 3HOWJ 3WHBA 5L3EA 2MLKA 4E7HA 2NRAC 5HLIA 2CC2A 1QVGB 2GAUA 2EH3A 4G7XA 4OP7A 3W2HA 4O6JA 2Q6KA 3LA2A 1QVFB 2RC6A 1LEBA 2LREA 3COAC 4I76A 5J8FA 4TMWA 2L9RA 3L00A 2CQNA 1SMYF 4TN1A 2HMAA 1YI2B 1M1KD 4RM3A 3WXMA 3WU1B 2OBRA 5TV2A 3E5QA 3FXOA 5EGOB 2VZLA 1J9IA 1NJID 2HZDA 2HKOA 4HEA2 2JVHA 4FX4A 1I8DA 1WI3A 4ITVA 4CCLA 5AMVA 2V1NA 4OPOA 3KE2A 4HNUA 4CCOA 2E2IJ 1Q9SA 2NPFA 3LSMA 5AIQA 1FDRA 1FOWA 4AU7A 2K9NA 4OIRF 3VSTA 3FPPA 4G9YA 3O3KA 3ZSCA 3V8JA 1E79A 1S7EA 1MJ9A 2CW0F 1GDTA 3FBIB 1JGGA 4BQAA 3FK6A 4XRFA 4XSZF 3I59A 3BQYA 5M3FJ 1Z6RA 3OAAA 2DIEA 1LEAA 3C1DA 4TT3A 1N75A 4HW0A 1FTTA 3G1LA 3LA7A 4BH9A 1X3ZB 2P7CB 2VONA 2F1LA 1WU8A 2HS5A 2R7OA 4XICA 4NNJA 3RTRA 3ABKH 1BC7C 1U2RA 4MQ9F 3LQQA 4LBVA 2X53S 4F93B 1E17A 2DT7B 3HYIA 5BNGA 2YPRA 5IP7J 3DP7A 1Z21A 4CGZA 1M90D 1WJAA 2GQQA 2ZBUA 2BXYA 4ZTJA 1JA1A 2K85A 4M3FA 3R61A 1YITI 2OBSA 2B9SA 4R71A 2CK3A 5ERIA 5FKKA 4M2LA 1Q81D 2QXZA 4Z4UA 1DGRM 1TYWA 2Z16A 1TSPA 1TWAJ 2YR2A 4RM2A 3BT9A 3I59B 1K4TA 4QIWN 4C2TA 2H8RA 2H6CA 1XG1A 3F8CA 2XASA 5L3BA 3OYMA 1QHHD 2PMZN 3OZUA 4XRSA 4AVPA 1OR7A 4IHYA 1WSUA 2AQEA 3M3YJ 2WADA 4M71A 1W0KA 4QVJA 1G2HA 3UW0A 3QODA 5JVGF 3HGGA 1NK2P 3PVDA 3BCBA 1H9GA 3CB4A 2L3DA 3ABLH 3FDYA 4ZDOA 5HKKA 3Q9SA 5J3OA 3DBRB 5DUKA 2FOWA 4RCZA 1BL0A 1OYWA 1SFXA 1W36C 2XHKA 1XCVA 2Y69H 1AHDP 3KRGA 3TQNA 5D5WB 2XC7A 4MO7A 1V0EA 1YX3A 2EV0A 3OJWA 4N0BA 4U0VA 2VOPA 3HXLA 4G7WA 1RQPA 1SKQA 5BSYA 1SFOJ 2QSHX 5DYMA 3I55I 2XKOA 3CMAB 3I9V2 3HJEA 2FOKA 3BY6A 4IRGA 1UG0A 2A05A 3M07A 2Z33A 2WR8A 1LJ9A 4XLNF 3HOUJ 2KRCA 1RETA 1FSHA 1TP4A 3MCAA 3BTCA 1IA5A 3Q9VA 1CNFA 1DPUA 2A68F 5IYDJ 3JSOA 1UZCA 3GXOA 1LVKA 4D1QA 1K5CA 2QQBA 4BXFA 5EG0A 1MSFC 3GFMA 4P2NA 3SLNA 4DIQA 3WNDA 4YALA 1H88C 2LY9A 2M45A 2HVQA 3CDHA 3ZQFA 4EQQA 3JRAA 4IOAF 3W2AA 2O9LA 1VTNC 4KNYA 4A12A 4LITA 3HRTA 4HNVA 4A3BJ 3K4LA 4U7DA 1R71A 1S3JA 2DAOA 3HTUA 1TWHJ 1YJ9I 1EE6A 2CQ7A 2W85A 2E1MC 5IYCJ 5KCMA 2GJPA 3T51B 4N3NA 4TMZA 4F3QA 3ASQA 1R5ID 1XSVA 2V9VA 3N90A 4UV8A 1X2NA 2PMDA 2JJ1A 5EG0B 2R7DA 4RMNA 1XB2A 1R4NB 2WJYA 1IJFA 4Y15A 4CZCA 4HE5A 3SQVA 3GTPJ 4PSXA 4BY1J 2A3SA 2WAFA 3E1YE 1VQNB 4X05A 4PJJA 4NBSA 3CJNA 3SJZA 4FE7A 4S0HB 1YS7A 4RB1A 3K6GA 2YWFA 1IW7F 2KHMA 3BCFA 4G7OF 3F23A 3CXCB 3CZ6A 1R23A 2ZJ2A 3JRFA 2UVFA 2LTPA 3GFLA 3JTHA 2BVNA 5IYPA 1JHHA 4PJ0C 4FQGA 1TW3A 3CLOA 3K4MA 3PIOF 5HZBA 5IYNA 1XC5A 3H94A 4LD5A 1MRZA 2BV3A 3F21A 2QSGX 2OD5A 4BACA 2VNHA 2EFNA 3PQKA 3LAJA 3B02A 2I5UA 1ZGAA 3PNVA 3W5HA 4F7DA 1TWCJ 2I1LA 3BJAA 4U4BA 3QP6A 3NARA 3ZBTA 4M3GA 2VE9A 4L0YB 1A8PA 1PJ6A 3W2VA 3U6BA 2R7VA 5IP9J 2IBDA 3ML3A 3RPUD 2UWMA 2BMWA 5LRRA 4LK0F 1FLIA 1FIPA 3TKYA 1VQOI 3WG7H 4BXUA 2R5YB 3S15J 4X6AJ 1VHOA 2AS5F 2X51A 4LBWA 2D2WA 3ZXSA 2DPDA 1ZQ3P 1H9TA 4WZEA 4YIIA 3CC2B 5HVQC 1F9NA 4B3FX 1W9XA 5J1YA 2HPMA 4QTRA 2IJLA 3G05A 2KRFA 3VSVA 4CDGA 3A4CA 3VSUA 1NG7A 2VBWA 1MH4A 3IHUA 1O8FA 5D4SA 4DNRB 3BZCA 1QCXA 2CUEA 1I50J 1T6YA 4AF6A 1BMFA 3CUQC 3A0HC 4A3KJ 1G7CA 3A8KA 4P55A 1DARA 2XF5A 5FGMA 4NDLA 2Q1ZB 3G1MA 2OJED 3NRVA 3N05A 1UD8A 2Z99A 3LNQA 2BM6A 3B8HA 3ZMZA 4HLXA 1SD5A 3CTAA 1KD1D 3GTQJ 4XKVA 1KQSB 2MABA 5LEJA 4FXUA 3G4SB 4UB6C 2HQ5A 3LL7A 5EJCA 1RUOA 3OIQA 1YRNA 1YO5C 3ZPPA 2GOMA 3K1PA 2ZITA 1TT0A 4XORA 5H6RA 2XAQA 5F64A 3B6AA 3ULQB 1NB0A 1PXZA 1KCDA 2DY1A 4Z6YA 1IXCA 1LB2A 1R58A 3ZQIA 5A89A 2O0VA 3NAUA 4RD4A 2OYNA 4CZZA 3H1CA 4UUVA 4YZAA 5EMNA 1L1IA 4RGRA 4MYTA 3JRGA 2ID3A 2E71A 3W3CA 3CMEB 4RM0A 3LO8A 1WQ2A 3N97A 2O8KA 2RNGA 3BPXA 3NAWA 1U8RA 4EM1A 4MR0A 2D45A 1JT0A 3GW2A 3FWEA 1QFJA 2DQRA 2MC4A 4J01A 3P9IA 1O57A 4CXFA 2HU9A 2JDIA 4LIVA 2DOFA 3V7CA 3OWTA 4YAUA 3V8KA 4OZZA 2CH0A 4PDKA 5DCMB 1RESA 1T98A 2TDXA 4P25A 1B72A 2AHOA 3K9TA 3IV5A 1JUSA 1EV7A 4OOIA 2WYRA 5HZAA 2YSRA 1N0VC 1OPCA 2HPIA 2DA1A 4YFXF 3MKZA 5LMZA 2MA3A 1MJBA 3ZUGA 4PZJA 1BR2A 4M6XA 4CSWA 4XLPF 3R6KA 1EKEA 1KRHA 2XTWA 2NOGA 1IN6A 4PFPA 4WWVA 5A8AA 1OGMX 2M4KA 5IP6A 2KIFA 3WU2C 4EGZA 1SANA 1X2MA 2L7FP 1RI7A 3CC7I 3RKQA 3FKSA 3KYDB 4RAZA 5H2FC 5M5WJ 2BY0A 3LQRA 1XN7A 1CF7A 1OOCA 4KUMA 3MVPA 5LHGA 1MBHA 1YJNI 3HBLA 1MBGA 1B72B 1RC9A 2FBKA 1TNTA 3D5RC 4IRHA 3S1MJ 2R7TA 1H85A 3AKZA 3U1KA 1LFBA 3WTSC 2B7EA 2KDOA 3FM3A 4NK6A 2DDAA 4A3MJ 2ZCWA 3I56I 4RPBA 3OMYA 2UV1A 4WF2A 3GQAA 4PK4A 1GT0C 4GFBA 3E7LA 1GVJA 2WAQA 2HWVA 5E6TA 3HKZA 4ESFA 1VQ4I 1JB9A 2W1OA 2IAIA 3E6MA 2EA4A 3OYLA 3WBKA 1I6XA 1NTCA 3TW7A 3P4GA 1TQIA 1D0ZA 2A5WA 4QPQA 1Q82D 2NYXA 3KYLA 2KFDA 2BBYA 2RN7A 1VHEA 4A0YA 1ZG3A 1CF7B 4M3DA 3CD6B 1EF4A 4Y9UA 4JP0A 3P9KA 1R1UA 1K6OA 3HTSB 4Z03A 2ZFUA 2JZYA 2ZMEC 5C4JJ 3QU6A 4KKTA 2JQ7A 2OTJI 5CVVA 3U9GA 2D1VA 2LSOA 4ZH4F 3AL0C 1CZFA 4RD6A 4X06A 2Q2EA 5CPRB 3S8PA 2PI0A 2R7UA 1SC7A 4G1BA 2C2WA 5HLTA 3GZ5A 1RIOH 2JA5J 1HW5A 2BM4A 3MKYB 2VBKA 3PJRA 4X0CA 3HIFA 3WBJA 1OCTC 2HDDA 3C2BA 3FMSA 3ZQQA 1D8JA 3U21A 1XX5A 2JA8J 2DK8A 2IQ7A 1NHCA 1ULYA 3PSFA 2Z1DA 1V0FA 1WJDA 3IRQA 1FZPB 1YE9A 1XB4A 2JA7J 2AXLA 1Z0XA 1KZLA 1WJBA 3RKYA 1SVOA 1E43A 2M7AA 2Y9ZA 4JYKA 2E1BA 3L2VA 2WC2A 1ERDA 4EW9A 2ZO4A 3LSKA 1WVRA 1K79A 3VODA 1U9OA 3FY3A 1FJLA 2RQPA 5D4RA 1U5TC 1W5TA 3FMRA 2P5LC 1N0UA 4Z1MA 2XZLA 2VBYA 2CU7A 2K4BA 2DODA 4A3JJ 2BY1A 5FL7A 1WSRA 3KX2A 3FKJA 5EZGA 3V8LA 2FMLA 3ZOBA 1TTTA 2STWA 1XGMA 2VQHA 4X8IA 1XGSA 4LLGF 2E1CA 1PVEA 3ERED 1YTYA 3OOPA 4TMVA 2MBFA 5C44J 1U78A 2IS1A 2IOUG 5FB2A 3GVKA 2BV6A 2ZC2A 4V19K 2A61A 2ZL5A 3QFSA 3CCVB 1AKHA 2GZWA 3QOEA 3DPTA 4YG2F 4DQ2A 3K7AJ 1D3YA 1MSEC 3GTGJ 2QGUA 3OP1A 2M0CA 1ZK8A 4P1WA 3VO1A 4K2EA 2WAQN 5GV7A 3ZMVA 3ASNH 3BR6A 3VYUB 1Y56A 3PM1A 2KVOA 4I7HA 2IVMA 4TKOB 1EFRA 1Y0YA 2VNJA 1W0UA 3CCSB 4DW6A 3JRDA 2XIGA 1MIJA 1PYVA 3RI4A 1I1SA 1WGXA 3G71B 1XCBA 4KDPA 3OL3A 2E35A 3JTGA 4OMZA 1D1BA 3FBNB 3DTEA 3WYAA 1HC8A 3IL2A 3BLYA 2JSCA 4ENNA 2VBEA 3KYCB 2F48A 2LDUA 4BBRJ 3C18A 4AVZA 1JI8A 4NC6A 3P7NA 1AKHB 1OCRH 1O3TA 3KEQA 1Z3XA 3RSNA 4B44A 3JSPA 4GYGA 4IEJA 5F1JA 4PC2A 3S16J 1WRJA 2EIJH 1V5GA 1I39A 4XOTA 4HSRA 1IB4A 2JUCA 4NQWB 3JRIA 2KIQA 4RLFA 2X48A 1WHUA 5K7HA 1ZRCA 2ZNZA 3CMAI 3GIRA 3EUHC 4EM2A 2X8KA 1MBJA 3C2HA 1VQKI 3JQPA 1PE9A 4IOCF 1Y0RA 2EK5A 2ZBKA 2MGQA 2E36A 4IL6C 1IG7A 4OWRB 4OPVA 2QVOA 2Y9YA 2L7MP 4M4SA 4A3LJ 4Q47A 3QYFA 4GXOA 3ABUA 4HF0A 2V7TA 2VI6A 3G6EB 2ISZA 1ZARA 4AIHA 5DM7F 1B1BA 1BJZA 3ECHA 4FN5A 1QVUA 2YWHA 4JBAA 2F4NA 1YS6A 3DU1X 3BG3A 1Y6IA 1T39A 4A0ZA 1VQ9I 3M8EA 5J6XA 3K70C 1X4PA 2XPVA 4L9TA 3R6SA 4B1RA 2LKXA 4PABA 1LDDA 1WJEA 3KZIC 2KRHA 2K3PA 3TOBA 1XPXA 5LGNA 2R7XA 4EGYA 4U9UA 3S1RJ 1H0MA 1I6HJ 9ANTA 2FEZA 1LVAA 5KSWB 4FE4A 1J09A 1O8KA 3GFIA 5FFZA 4CCMA 1R5HA 1IDZA 2D3LA 1VQ8B 3SDGA 1KU7A 2PX9A 4B09A 4LB5A 4MQVA 3H9NA 1TW2A 2ZNYA 4HLYA 4KN7X 3E97A 4XKBA 1VQ5I 3JQQA 1TZLA 3WGIA 4P1VA 4RDJA 2XT4A 1KA8A 3JRCA 1DDIA 1PUFB 3DKXA 5ICCA 4RCYA 4OZYA 4JQFA 1VQNI 3HOXJ 1RWRA 3VSLA 4Z4WA 1FNCA 1UHWA 5JR3A 1OKRA 3MWMA 4O3MA 3ZZ0A 2F3LA 1P4WA 1ZELA 1BOAA 2YU3A 2GJRA 3CO6C 2KL4A 4Y3OA 3F8BA 2R93J 2RGVA 3E6DA 1KU9A 3CCLB 4V02C 4GDFA 3OKXA 4YZXA 4P3IA 3FJOA 3M4OJ 5AIPA 3IC7A 4A5MA 1V5VA 3Q0UA 3CCEB 2R92J 5B66C 1BR1A 3MAJA 4M74A 4Z4YA 4ON0A 3KZZA 2L7ZA 2X3UA 4QFMA 1QNTA 3CCMB 3BG5A 2H94A 2QCOA 5KW9A 3HOSA 4YC5A 4G6IA 1R36A 1XS9A 2G7HA
chains in the Genus database with same CATH topology
2Q2EB 3FBIB 4U87A 3GQ9A 5HOOA 1X0CA 3OAAA 2DIEA 4TT3A 1N75A 1PKVA 4F92B 3EQOA 2R7OA 4NNJA 3RTRA 4BEHA 2CUZA 3H0DA 1Z7LA 4GRIA 2OC6A 2LRDA 3VYRB 4F93B 4E7ZA 2DT7B 2X53S 1X1DA 3K4CA 2O5RA 1Z21A 4B43A 3J7AY 1WJAA 2CS3A 1T95A 3H35A 4HG2A 4ZTJA 1X1BA 2V26A 3FHNA 1JRGA 3PNTA 4YEJA 1OFMA 3ZR8X 2CK3A 2NTPA 2QXZA 4LIUA 1DGRM 2Z16A 4RM2A 3K10A 1D0YA 4YZ0A 4ZTFA 4C2TA 2M3AA 4F91B 3GVJA 3GRHA 3OYMA 1QHHD 2F6CA 3GBGA 4NUBA 1W0KA 2AQEA 2WADA 2WY8Q 3MD2A 4LG3A 2R7QA 3UW0A 2VQLA 1DBOA 2KPMA 3QODA 4BEHB 2IS6A 1VF7A 3HAGA 4BU2A 3AL0B 3BCBA 3FDYA 4ZDOA 1LFPA 5HKKA 4F52A 3LFUA 3TL4X 2X1DA 4DJAA 4BE2A 3OOCA 3OY9A 4B47A 2ZSHB 4OJOA 3TMOA 3D5LA 4BGDA 1W36C 4URRA 4ZJZA 2W6JA 3LNNA 4ANJA 4KITB 3OIPA 1V0EA 3IP4B 2XC7A 3KRGA 3LMWA 1YX3A 2JA2A 3DU5A 2BSPA 1KONA 4G7WA 3HXLA 2HQAA 1QHGA 2XAUA 3B90A 4P22A 1MNEA 2E5ZA 3PUBA 2R7SA 1D1CA 3I9V2 3OS2A 1UG0A 3E1SA 1G59A 2F43A 5KHDA 5C1EA 1UD4A 2KRCA 2KZVA 2AQFA 4PSWA 4HSTA 2LZJA 1IA5A 2LY1A 2V31A 2ZSIB 1P9QC 1EA3A 1LVKA 3ZRGA 4AYBA 4D1QA 4BXFA 1K5CA 3SDBA 4DIQA 2O04A 2X6WA 2CV2A 2NSPA 2MD0A 2HVQA 3IUOA 2DJIA 2HDWA 3H5RA 4D9JA 3W2AA 2INVA 4XLAA 3BC9A 4Z05A 1V5FA 1Z3YA 2I8DA 4LITA 4IX7A 2CMPA 1UD2A 3VYTB 3K4LA 2VPLA 5HNHA 2VQCA 4HPQA 2ZZGA 2IGMA 3OEEA 4YXWA 4OJ6A 2V6EA 1EE6A 2E1MC 1KMHA 4II2A 5KCMA 2GJPA 1SAUA 3T51B 2IXSA 5TGTA 4F3QA 1SFKA 2XSJC 3HL2A 3DKYA 2X1CA 3DEEA 2JJ1A 4BDZA 1E3ZA 4RMNA 1RU4A 2QKMB 4BJ5C 2WJYA 2WB1A 4C9YA 4CZCA 3JURA 4PSXA 1K28D 1SKYB 3KEWA 2WAFA 4KJZA 1QU3A 3CJRB 4BUPA 1DQUA 4PJJA 5FROA 5IK2A 3OS1A 2GJKA 2F5VA 4ZDLA 1FMVA 1O88A 3ZIAA 4CUGA 3K6GA 4FASD 4N4NB 2KHMA 3BCFA 1WFXA 2IGKA 1WPCA 4IQ4A 3DQVC 3CZ6A 2V9KA 2V7QA 4E0FA 2L9SA 2UVFA 1G8XA 3VMVA 3K4KA 3S32A 3K4MA 2LH9A 2WA0A 3H94A 2V4DA 2HVRA 2PYGA 1U0JA 4MXNA 3E0JB 4BACA 1VLYA 1X4OA 4XN0A 3JU4A 3PNVA 1E1RA 4HRIA 3T53B 5JHFA 1X19A 4B3XA 4CCJA 1NRKA 4U4BA 3T9GA 2XDVA 3W2VA 2R7VA 3BC8A 3RPUD 4IQJA 2UWMA 1UAAA 1VJSA 2M5SA 2XGJA 1R6RA 3OPOA 1DBGA 2JIZA 4YELA 1KCCA 4XONA 3S3MA 5CDFA 2K9MA 2X51A 1MMGA 3DPLC 3ZXSA 3OW7A 3VYSB 5HVQC 4B3FX 1X1CA 1W9XA 3A35A 2HPMA 3G05A 1UD3A 5FRMA 3A4CA 4UZUA 3VSVA 2VKDA 3VSUA 1NG7A 4BE0A 1O8FA 4DNRB 1QCXA 1I18A 2WAEA 3L2WA 2WJVA 1BMFA 3A3GA 2X6YA 2XF5A 5HNFA 2GK7A 2Q1ZB 3H9QA 3LSIA 2Y0SA 2VXDA 2IS4A 3N05A 2O17A 4NK8A 1UD8A 2LYCA 2IGOA 2JVGA 1WP6A 2LOOA 1AA7A 2DT6A 3S93A 4XKVA 4CCKA 2MABA 3D5SC 3K4NA 4FXUA 3DTIA 4PMHA 2VXZA 3LL7A 4RLQA 3OS0A 3OYNA 3OIQA 1OLTA 3ZPPA 2GOMA 1TT0A 4MLOA 4XORA 4BJ6C 1PXZA 1KCDA 4XOPA 3A1YA 2Z8GA 2VKHA 2CV0A 2L9NA 2KQRA 4XKWA 3EUKL 4XKCA 2O0VA 1H8EA 1BHEA 4XN3A 4R79A 4HWVA 2IGNA 1BR4A 4YZAA 2GOXB 4PFOA 3W3CA 5LD2C 1UD5A 1XG2A 4E7KA 2KP6A 2L7KA 1W0JA 2PJRA 3OYIA 2DCEA 2RNGA 4W8QA 4XR6A 1WMRA 4DGWB 2OUMA 3GQ7A 3ONQA 4MR0A 5CQGA 4DOZA 4XNFA 2HNHA 2W00A 2VB6A 1O8LA 3AFHA 2MC4A 4J01A 4TSFA 2HU9A 2JDIA 2KMUA 3HC7A 4LIVA 1DP3A 3OWTA 3SUCA 1VZ0A 2K5CA 4BS9A 3OYJA 4OZZA 3L2UA 2CH0A 1VBLA 3DTKA 1PLUA 2XZOA 4ZYAA 4CCNA 3DU6A 2VASA 2JJ2A 4KKSA 2EWEA 4IKFA 4BJTA 4F55A 3PL8A 2HLDA 2HPIA 3MKZA 2R4GA 1WJFA 2WSSA 1W36D 2ZXIA 2WPDA 3SYTA 2Z2SB 1BR2A 4Z06A 4CSWA 2X1EA 1MABA 2ZZEA 2PYHA 1OGMX 4PFPA 3HUGB 2M4KA 4J00A 1JTAA 3OYCA 3FKSA 3CP8A 3EUAA 2JSPA 4OAYA 3VDXA 3A3BA 1PJRA 3OL4A 3BCAA 1NBMA 3OEHA 1OOCA 2NTBA 3MMYB 3W2WA 4KISA 1E0EA 1MMDA 2CW8A 2BW3A 2W4SA 3D5RC 2R7TA 2LBFA 4W8TA 3AKZA 3WWGA 4E6KG 3PFYA 1X1AA 2KDOA 2DXIA 4NK6A 1N78A 3OMYA 2UV1A 3BG6A 3UNGC 3GQAA 4PK4A 4W8RA 2VL8A 3OYGA 1UD6A 4XLFA 2VIXA 3I3LA 3M1CA 3PNYA 2MYSA 2WAQA 2VJ5A 3H9GA 4QPOA 3G2BA 1MMNA 3HKZA 3RCOA 4XLCA 1WJ5A 2W1OA 4C2UA 4NC8A 3OYLA 2VLAA 3CESA 2X3HA 3S3OA 1D0ZA 2A5WA 4QPQA 3KYLA 3K70D 4ASUA 4ZDPA 2ZTGA 1H8HA 4PJMA 4E7LA 1O8DA 2R9VA 2X85A 3NWSA 4Z03A 3B4NA 2ZFUA 2W6IA 1IDKA 1V5EA 2LBFB 3MKWB 2JUGA 4XM3A 1O8IA 5C1CA 4KKTA 2WZPP 4OJPA 1LDKB 3AL0C 1CZFA 4U7BA 5CPRB 4PJLA 3S8PA 2R7UA 4B48A 4KT6A 3NWTA 2HVSA 5HLTA 5DN6A 3OYEA 3QYBA 3NE5B 1BN8A 3MKYB 2VBKA 3PJRA 2WY7Q 4XLHA 1UELB 2CUJA 2RREA 4BQOA 1O8GA 3IAS2 4JMQA 2CFOA 3ZQQA 4Y33A 3U21A 3DDYA 3B8YA 2LG4A 1S9HA 2ZXHA 3PSFA 4PJNA 2Z1DA 3EPZA 2IQ7A 1NHCA 1V0FA 1WJDA 1YE9A 1OR7C 3WQZA 1N77A 3L2QA 3LSHA 1BLIA 2R7WA 1KZLA 1WJBA 2F4IA 1E43A 1HZEA 4CH7A 3TBIA 3BCDA 1O8JA 2M7AA 3LSGA 2E1MB 2E1BA 3ZGKA 3EQNA 3L2VA 1ERDA 4BE1A 4EW9A 3LSKA 3VWBA 2UUZA 1E3XA 1BPLA 3FY3A 2FUG2 2P0WA 2X6XA 1T0FC 2XF6A 2XZLA 1H80A 2VBMA 3RQ4A 4IZZA 4Z1MA 3CMMA 1IRXA 4OAZA 2W82A 3QYEA 4N4OB 5FL7A 3DWLE 3KX2A 3FKJA 3OR2C 2K9LA 3CP2A 3H9JA 4BQQA 3OYKA 1GLNA 2VQHA 4OJ5A 3IAM2 3SEQA 4DBRA 1HA8A 1OB0A 2QE7A 1KTWA 2NT6A 3BH4A 2IS1A 2NZMA 4CA0A 3HPGA 3GVKA 3OFNA 3GQBA 3K4JA 2GK6A 2ZZFA 2NSTA 4XL9A 3QOEA 3DPTA 3V42A 3ZPNA 2E5NA 1RMGA 4E4HA 1MMAA 2ZZQA 4DK1A 4P1WA 4II3A 1MNDA 2L5QA 2KLOA 3F9KA 3VYUB 2WBMA 1Y56A 3OYFA 2KVOA 4TKOB 2O1DA 2ODLA 1EFRA 1PYVA 3CF2A 3L2RA 2A6TA 2ZTNA 2M4GA 4GQNA 3OL3A 4E7IA 2PECA 1D1BA 3FBNB 3DTEA 3OOUA 1BOBA 3VMWA 3M8JA 3BLYA 4DBQA 3OYBA 1T5EA 4HIZA 4DK0A 2VQGA 2VBEA 1E1QA 3H5AA 2O0WA 2D3NA 4G6TB 4AVZA 1JI8A 2BVLA 4PUSA 1COWA 2BOLA 2QX3A 4OJLA 1D0XA 1Z3XA 3RSNA 4B44A 2E60A 2PJRB 3OYDA 3UR3C 1WJCA 1OHHA 2VJJA 4YZQA 4XMYA 1V5GA 4XOTA 4HSRA 1IB4A 3PSIA 4NQWB 4W8SA 4RLFA 2XZPA 3T56B 5FRNA 3EUHC 4H4KC 2X8KA 4NC7A 3SZGA 4HNTA 2CV1A 4XD7A 3C2HA 1O8HA 2L2OA 1FX0A 1OFLA 2CW7A 1PE9A 4E7JA 2QY1A 4YRVA 2NOJB 1O8EA 3HOTA 4FETA 4C30A 4OWRB 3ZCOA 4I84A 4X0GA 2IS2A 1WTHD 3QYFA 4P5OA 3OYHA 2VJIA 3LMMA 1QJVA 2RQQA 4JOMA 3GQ8A 2BVMA 4KKUA 4B3GA 4XQFA 2NT9A 3KEYA 1Y6IA 4BL0B 5KNLA 3K70C 1X4PA 2OV7A 2XOKA 4ZC3A 2NTQA 1K6YA 1FMWA 3DLAA 1WJEA 1AIRA 4E7SA 2KRHA 2K3PA 2R7XA 2PMZA 1IDJA 2VJ4A 5CQEA 2M7BA 1GQ8A 1O8KA 1J09A 2D3LA 4CCMA 4XLEA 2ELJA 4DNTB 4U49A 2BW3B 4E7HA 1YX5A 2MFZA 3K4BA 1O8MA 4G7XA 3OYAA 5LFAA 1HG8A 1NG6A 4XKBA 2LREA 1TZLA 3BG7A 2LY2A 5CKTA 4Y4RA 2V7FA 2R7RA 4BQNA 3A2KA 2F1MA 4L8JA 3DKXA 3C2GA 2UVEA 4OZYA 3H5NA 4JQFA 3OR1C 2Z6BD 2LC2A 4RM3A 3VSKA 1RWRA 3VSLA 3S3NA 3VR6A 3DPUA 3SEZA 4BDYA 1HVXA 2XNDA 2XF7A 2HZDA 1OGOX 2INUA 4HEA2 2JVHA 2QKLB 1I8DA 1D1AA 1ZELA 3CJQB 4ITVA 2GJRA 1DGWY 2KL4A 4Y3OA 4CCLA 5AMVA 2V1NA 4C2LA 4HNUA 4YZXA 4CCOA 3LSMA 3VSTA 4AU7A 3GVLA 2DOAA 1BR1A 2W7NA 3FPPA 2M0MA 3ZSCA 1LKXA 2V4JC 1E79A 3HOSA 3HG9A 3OE7A 4G6IA 4EATA 3HPHA 1MW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O88 A;  3GQ9 A;  2ODL A;  4Z06 A;  2O1D A;  1X0C A;  2PYH A;  1OGM X;  2UVF A;  1JTA A;  3VMV A;  3EQO A;  2PEC A;  2PYG A;  3VMW A;  4MXN A;  1OOC A;  2NTB A;  2VBE A;  4XN0 A;  4AVZ A;  4W8T A;  2QX3 A;  4OJL A;  1JRG A;  3WWG A;  4U4B A;  3T9G A;  1OFM A;  4YEJ A;  4NK6 A;  2NTP A;  2QXZ A;  3GQA A;  4W8R A;  4XLF A;  1DBG A;  2VJJ A;  4YZ0 A;  4YZQ A;  4YEL A;  1KCC A;  4XON A;  4XMY A;  4XOT A;  3GRH A;  1IB4 A;  4W8S A;  4XLC A;  2X3H A;  3UW0 A;  1DBO A;  3VSV A;  1O8H A;  1OFL A;  1PE9 A;  2QY1 A;  3VSU A;  1O8E A;  1O8F A;  1QCX A;  4OJO A;  1O8D A;  2X85 A;  4Z03 A;  3B4N A;  1O8I A;  2X6Y A;  1IDK A;  4I84 A;  5C1C A;  4XM3 A;  4URR A;  2VJI A;  2O17 A;  4NK8 A;  1QJV A;  3KRG A;  4OJP A;  1CZF A;  3LMW A;  3GQ8 A;  2BSP A;  4XQF A;  2NT9 A;  3B90 A;  4XKV A;  1BN8 A;  4PMH A;  2VBK A;  2NTQ A;  4XLH A;  3ZPP A;  1AIR A;  4XOR A;  1O8G A;  1PXZ A;  5C1E A;  1KCD A;  4XOP A;  1IDJ A;  2Z8G A;  4XKW A;  1IA5 A;  3B8Y A;  2O0V A;  1GQ8 A;  1O8K A;  2IQ7 A;  1BHE A;  4XN3 A;  1NHC A;  1K5C A;  4XLE A;  4HWV A;  4YZA A;  4U49 A;  2O04 A;  2X6W A;  2NSP A;  1XG2 A;  1O8M A;  1HG8 A;  1O8J A;  2INV A;  4XLA A;  3EQN A;  4XR6 A;  1WMR A;  4W8Q A;  4Z05 A;  4EW9 A;  2UVE A;  3FY3 A;  3GQ7 A;  4OZY A;  2X6X A;  2VBM A;  1H80 A;  4MR0 A;  4XNF A;  1RWR A;  1O8L A;  4OJ6 A;  1OGO X;  2INU A;  1EE6 A;  3SUC A;  4OJ5 A;  5AMV A;  4OZZ A;  1KTW A;  4C2L A;  1VBL A;  2NT6 A;  4YZX A;  1PLU A;  2NZM A;  3VST A;  1RU4 A;  2EWE A;  2NST A;  4XL9 A;  3JUR A;  3ZSC A;  1RMG A;  2O0W A; 
#chains in the Genus database with same CATH topology
 2ELK A;  4IXA A;  2OK8 A;  2QTZ A;  4U87 A;  2Q8K A;  1ETV A;  4QLC U;  3GLL A;  3KP5 A;  2P81 A;  2OZ6 A;  1PKV A;  4LG0 A;  3ONY A;  2EZI A;  3A03 A;  3LJY A;  1MBE A;  2CUZ A;  2X0K A;  4B3A A;  2LRD A;  1G7R A;  4HX8 A;  2F5C A;  3U1D A;  2MW8 A;  5JVT A;  4ZGN B;  2NS7 A;  3H35 A;  3ZN0 A;  1JRG A;  3GSI A;  4GCV A;  5FFX A;  2C78 A;  1D8T A;  2J5P A;  2CQX A;  2ZXW H;  4LIU A;  1MGT A;  5CVU A;  2VT3 A;  2QSF X;  4HE6 A;  2XB5 A;  1HA3 A;  2WWY A;  3K10 A;  1D0Y A;  3ZZT A;  4ZTF A;  4YZ0 A;  5IYR A;  3BH7 B;  5HLG A;  2P6T A;  4F91 B;  2BM1 A;  2VUM J;  3PQJ A;  4C3H J;  3EDP A;  1QO0 D;  4LG3 A;  3FHZ A;  2A69 F;  2DI3 A;  3RJP A;  2VQL A;  3W5V A;  4KIB A;  1R1T A;  3J7Y J;  4BHC A;  2IS6 A;  4BU2 A;  1MMS A;  3E5U A;  5D8L B;  1A6Q A;  1RR7 A;  1OFD A;  4KA4 A;  4OM9 A;  2H8W A;  3ZN1 A;  3LQ6 A;  2XPU A;  2RC4 A;  1ZLK A;  3OOC A;  2Q6I A;  1YJW B;  4BGD A;  4UZE A;  4URR A;  4P9F A;  3GTL J;  1TQM A;  3JQR A;  4ANJ A;  4KIT B;  3OIP A;  3J81 K;  3IP4 B;  2W84 A;  2JA2 A;  3DU5 A;  4UUS A;  5LHI A;  1XTA A;  3P5J A;  4P26 A;  1N08 A;  4F7Z A;  2XAU A;  3AG2 H;  3BR1 A;  3B90 A;  3I54 A;  3AAF A;  1T6S A;  4Y52 J;  2FNP A;  2B7C A;  4ZYH A;  4M6V A;  1FX7 A;  3DEW A;  2K86 A;  3EQL F;  1WCM J;  4XRM A;  1JT6 A;  2OF7 A;  2QEN A;  3RIR A;  2F43 A;  4IF4 A;  4RLZ A;  1UD4 A;  2KZV A;  1T38 A;  5JLV C;  1BW6 A;  2VN2 A;  4HST A;  2DJN A;  4PSW A;  5CVJ A;  3DLL F;  1J59 A;  2BHY A;  2LZJ A;  3ERM A;  2V31 A;  1KZH A;  3OV8 A;  1FYM A;  1S72 I;  5DSZ A;  3M1E A;  3ZRG A;  2EIK H;  4CIC A;  3SDB A;  2O04 A;  2X6W A;  1P4A A;  1R7J A;  1KYW A;  4TV7 A;  2FA5 A;  4ABZ A;  2CV2 A;  1ETW A;  3IUO A;  3K2A A;  2V7V A;  4D9J A;  4I02 A;  4FT8 A;  3PO2 J;  4Z05 A;  2HGC A;  2M30 A;  3TO9 A;  3ZMD A;  2M8E A;  2CMP A;  2Z3Y A;  4L9V A;  1FSE A;  5LHH A;  2VPL A;  5GAH J;  2EZK A;  2PQ8 A;  2DA3 A;  4RGS A;  1R49 A;  3H3V K;  3ECO A;  1KGS A;  2DLL A;  4R1H A;  3I58 A;  3UKG A;  1W0T A;  2V6E A;  1CNE A;  3REO A;  4II2 A;  1T6Z A;  2VOD A;  2IXS A;  2P3M A;  2EZL A;  2L54 A;  3J80 K;  4HF2 A;  1W34 A;  2BM5 A;  4FK8 A;  2KIM A;  4WQM A;  1EP1 B;  3TED A;  5J1U A;  3V76 A;  1RU4 A;  3O2P E;  4C9Y A;  4BHB A;  1X3U A;  1R4M B;  3MEX A;  4KJZ A;  4RB2 C;  1QU3 A;  1IC8 A;  3CJR B;  2EIN H;  2QA4 I;  1OQY A;  1O88 A;  2K4J A;  4C3J J;  3J81 k;  2VFP A;  4CUG A;  3GTK J;  1IRZ A;  4EMS A;  4N4N B;  2XT2 A;  1WFX A;  2L9S A;  1VQ7 I;  1ZM3 A;  4PC3 A;  3FZV A;  2LH9 A;  3IWZ A;  4L5J A;  3F22 A;  2AHQ A;  2HVR A;  2M8G X;  1U0J A;  3E0J B;  4RBO A;  2P5K A;  3GTO J;  3JU4 A;  1ZUN B;  3BP8 A;  3AG3 H;  1R5O A;  3CD6 I;  2QUF A;  5H5J A;  2DYR H;  3A8I A;  3BC8 A;  2ETH A;  2O6W A;  1UAA A;  1VJS A;  2M5S A;  4RD2 A;  2XGJ A;  1R6R A;  2COM A;  4AIK A;  3OPO A;  1DBG A;  2TCT A;  2W57 A;  4U0W A;  5FLV A;  3S3M A;  1V3F A;  1GVD A;  1B23 P;  4MFD A;  2BYV E;  1RNL A;  2WV1 A;  3VYS B;  3HDD A;  1EA0 A;  3A35 A;  3ISP A;  5EZH A;  4HX4 A;  4UZU A;  2VKD A;  2KIU A;  2VBU A;  1TUI A;  1UHS A;  2V6C A;  3L2W A;  2FD5 A;  2VPR A;  3HRS A;  3A3G A;  4RD0 A;  1B59 A;  1U9N A;  2C5B A;  4M1K A;  3HHG A;  4BPR A;  3QAH A;  1UMK A;  2O17 A;  4XSX F;  5ED4 A;  4NK8 A;  2LYC A;  2JVG A;  2HFH A;  2LOO A;  2QYO A;  3O8H A;  1R1V A;  4QWQ A;  3D5S C;  3DTI A;  4PMH A;  1MZB A;  1JKP C;  2IP2 A;  3GF2 A;  3OS0 A;  2EJR A;  1OLT A;  2ADU A;  3BDD A;  3WTW C;  2D9R A;  4MLO A;  4BJ6 C;  3T1B A;  4NB5 A;  4YAO A;  5TY0 A;  2D5V A;  2NS0 A;  3A1Y A;  3BR5 A;  3DKW A;  2OTL B;  1POG A;  2CV0 A;  2Z8G A;  1Z9C A;  1X58 A;  1MBF A;  2KQR A;  1BHE A;  4XN3 A;  1VQL I;  4R79 A;  1BIB A;  2MLG A;  4ASN A;  1ZRD A;  3AVX A;  1KU2 A;  1BR4 A;  1HW1 A;  1QZY A;  2XGD A;  2NS8 A;  4M9X A;  1K61 A;  1VQP B;  4HDU A;  2DK5 A;  1UD5 A;  1XG2 A;  1IV8 A;  2XRL A;  2KP6 A;  1IXR C;  1JKR C;  2PJR A;  2DCE A;  4XR6 A;  3DFG A;  1F60 A;  4ENK A;  2R6H A;  1IN8 A;  1Z77 A;  1BX0 A;  2LF7 A;  1TWF J;  4Z4T A;  4ZCL A;  2VKE A;  4NHJ A;  4YFN F;  2VB6 A;  3QFT A;  2YU9 J;  1O3R A;  2XKP A;  2BN4 A;  3ABT A;  4RDU A;  3CCS I;  1JJ8 C;  1TTY A;  2GA1 A;  1XMK A;  2KMU A;  3HC7 A;  4DZJ A;  4GO1 A;  1W2B B;  4FCY A;  5FO5 A;  1JJ2 B;  2DMN A;  3L2U A;  1VBL A;  4LLN A;  3B73 A;  2EFO A;  4AF7 A;  2E7W A;  2XZO A;  5M5Y J;  4GGG A;  2IPQ X;  1VND A;  4KKS A;  3KP3 A;  4YAF A;  3W6K B;  1GV5 A;  4F55 A;  3DCF A;  3Q38 A;  1IHM A;  2QF7 A;  3KLO A;  3PL8 A;  2L02 A;  5CVI A;  4LGW A;  2WSS A;  1GR1 A;  5TIS C;  1W36 D;  3S1N J;  2ECB A;  4CYC A;  1EXM A;  1ETO A;  3A01 A;  1Z91 A;  1GAQ A;  2E2H J;  1WH5 A;  3OYC A;  4I01 A;  1SEU A;  3CP8 A;  2JSP A;  3VDX A;  3A3B A;  5D8K B;  4WZK A;  1PJR A;  5F4O A;  2CF4 A;  3MQ0 A;  1QA6 A;  4HBL A;  4N9H A;  1H89 C;  3OEH A;  1LLZ A;  3MMY B;  1ENH A;  2DA2 A;  2BW3 A;  4W8T A;  4R8H A;  1SVL A;  3PUN A;  1VQM B;  3TH0 A;  1QQI A;  4DYR A;  1IJE A;  2V7W A;  1RQR A;  1X1A A;  3S17 J;  2EQR A;  3CCQ B;  3TO7 A;  2I10 A;  3BH6 B;  4CYC B;  3G6E I;  2OK7 A;  2VL8 A;  3FK7 A;  4OOS A;  4G6Q A;  3M1C A;  1JJ6 C;  2EZH A;  3JR9 A;  3LQE A;  2VE8 A;  1ZH5 A;  1WJ5 A;  4A2U A;  1BQE A;  1WKM A;  2DO7 A;  4A3D J;  5E18 F;  5FNZ A;  4LK1 F;  1FC3 A;  2EBI A;  3KIO A;  4ZYG A;  5E1Z B;  1IN5 A;  4ASU A;  2OCC H;  1H8H A;  3WOD F;  5GP9 A;  2LF8 A;  2HOS A;  3GZN B;  1TWG J;  4M73 A;  1O8D A;  2X85 A;  1O7L A;  5FLM J;  1FNM A;  3QSY A;  3VMF A;  1O8I A;  3MKW B;  5C1C A;  4XM3 A;  1YX2 A;  5E17 F;  1VQ8 I;  4OJP A;  1LDK B;  1RR8 C;  1SAX A;  3CC4 B;  3HRU A;  1VQ6 I;  4PJL A;  2NVY J;  2F4O B;  2HCJ B;  3BQZ A;  3SFI A;  2HVS A;  4H9G A;  1K8A D;  3QYB A;  4EJO A;  3NE5 B;  1BN8 A;  1D5Y A;  4BHP A;  3AVU A;  4BQO A;  2HYG D;  2H1K A;  1IDY A;  2CQQ A;  2KJC A;  1FOX A;  2VC0 A;  2PG4 A;  4JMQ A;  3DDY A;  3A02 A;  2IW5 A;  2G0E A;  3EPZ A;  1P2F A;  2XGE A;  2DCU A;  3ISX A;  4PAA A;  3L09 A;  4D5F A;  1OR7 C;  4NCN A;  2K02 A;  4L9N A;  3J7Z I;  4Y9R A;  5A88 A;  1BLI A;  2R7W A;  3MZY A;  4UVA A;  3I5U A;  3QQA A;  3FXU A;  3IKT A;  1HQC A;  2CQK A;  4CH7 A;  4Y7N J;  3BCD A;  1MBK A;  2HOT A;  2NXN B;  3MZH A;  4L18 B;  1BM9 A;  4FIS A;  3VWB A;  1E3X A;  2B7B A;  3W2E A;  3LST A;  3ZQL A;  2P0W A;  2XF6 A;  1T0F C;  3KZY A;  2VBM A;  4AUX A;  4IZZ A;  5L46 A;  2L01 A;  4LC0 A;  5F6F A;  1LDJ A;  2K7L A;  2ZME A;  1FRN A;  2PIA A;  2K9L A;  3V7R A;  1PP7 U;  3OYK A;  3C3W A;  3BQJ A;  1GLN A;  1XDU A;  3IAM 2;  4DBR A;  4WCG A;  3FXL A;  1RPW A;  5L3C A;  2JMW A;  1QGP A;  3BH4 A;  1DU0 A;  4EJW A;  4CA0 A;  1PJ5 A;  3R60 A;  3GQB A;  1LFU P;  2GK6 A;  5TJJ A;  2XC1 A;  3CCJ B;  4KN4 X;  2QGG A;  3ZPN A;  3HOZ J;  1RMG A;  4OIO F;  1J7K A;  2CO5 A;  3IH3 A;  1F20 A;  1ZR2 A;  2ZZQ A;  4DK1 A;  3BJ6 A;  1YG2 A;  3BR0 A;  1Y0U A;  1YIJ B;  5JFR A;  3PIP F;  1MND A;  3FXR A;  1WSV A;  2ODL A;  5KAI C;  3OYF A;  3VEP A;  3AGQ A;  2O1D A;  3GME A;  2XVC A;  1VLO A;  1QFY A;  2ZTN A;  2A6T A;  4UVB A;  1YRN B;  3A8J A;  2UZK A;  5IPA A;  3LSJ A;  4PGG A;  1NH3 A;  4OIQ F;  1DDG A;  1JA0 A;  2ZB9 A;  5L3D A;  2LR8 A;  1D8K A;  3VMW A;  3RZD J;  2DT5 A;  5HDK A;  3OYB A;  2DYI A;  2B0L A;  1QGY A;  1E1Q A;  4ZGQ B;  4G6T B;  1J9Z A;  4I98 B;  2BVL A;  3SZT A;  4PUS A;  1KU3 A;  2BOL A;  4HV6 A;  4DYC A;  1JNY A;  2YUS A;  4M9S A;  5EDN A;  2FVG A;  5K7Z A;  3L2C A;  2E60 A;  4X7D A;  3OYD A;  3WNB A;  2YX7 A;  3D26 A;  3MMP A;  2QEX I;  1P7J A;  3ZMT A;  2P7V B;  3ROU A;  4OPS A;  3CCU B;  2BEO A;  4Q4Z F;  1S6L A;  5DD4 A;  1K78 A;  2QN6 A;  4WZT A;  3T8R A;  5FRN A;  1XDS A;  4HNT A;  4XD7 A;  1QUE A;  5J3L A;  2QY1 A;  4YRV A;  2NAZ A;  1SM4 A;  3KL9 A;  4ZYD A;  1FNB A;  4FET A;  3CJT B;  1YYV A;  2FRH A;  1A35 A;  1WTH D;  2VC1 A;  4ZCI A;  3LMM A;  3ZBU A;  2DMQ A;  1HLV A;  1QJV A;  3I71 A;  2A07 F;  2YWG A;  2QZA A;  2V1U A;  2BVM A;  3I53 A;  4TMT A;  3U6K A;  3HRM A;  5EEG A;  3W6J B;  1WOS A;  2NT9 A;  4A93 J;  4EEF G;  4WWC A;  5K5R A;  4Z4S A;  3MZ8 A;  5DUI A;  2EA2 A;  1SD7 A;  2FBI A;  2OV7 A;  4UVC A;  5HS9 A;  2NTQ A;  1K6Y A;  1FMW A;  3DLA A;  1K78 B;  1AIR A;  2YUH A;  3AK5 A;  1I3Q J;  4KIG A;  2LFB A;  2QLZ A;  2VJ4 A;  1Q1H A;  2Y30 A;  1YQA A;  1EP2 B;  2M7B A;  2HTS A;  1GQ8 A;  2E1O A;  2FMY A;  1F36 A;  2M34 A;  4OU0 A;  4W1U A;  5JLW A;  2ELJ A;  5FLX Z;  3ELK A;  2MFZ A;  4KMF A;  2WZN A;  4LOC A;  2HZT A;  5LFA A;  3EUH A;  3OYA A;  1NG6 A;  2Y48 A;  3BG7 A;  5CKT A;  4Y4R A;  2OBP A;  2V7F A;  1U2W A;  4BQN A;  2R7R A;  3A2K A;  2UVE A;  3C2G A;  5HLH A;  3TDU C;  3H5N A;  2Z6B D;  2LMD A;  3OR1 C;  1V54 H;  3AVT A;  2LC2 A;  1D1N A;  1UMQ A;  3FXQ A;  2DA5 A;  2ZKZ A;  4LFU A;  3SEZ A;  2DDB A;  3S3N A;  3ASS A;  2INU A;  1XGN A;  2QKL B;  1YI2 I;  1D1A A;  3SZP A;  5GPA A;  2OBT A;  4C2L A;  2RVC A;  3QPH A;  1P7I A;  1FYK A;  2W7N A;  5EYR A;  2PFB A;  3WTY C;  2EFQ A;  2R0Q C;  3RQI A;  5FO0 A;  4RB3 C;  2V4J C;  4BXX J;  2IA2 A;  4OPW A;  3HPH A;  4A6E A;  1MW7 A;  5ILU A;  3OSF A;  2Q2E B;  1JTX A;  3ABM H;  3GTJ J;  2LK2 A;  1T8I A;  3HM5 A;  5B3S H;  2DET A;  1C0W A;  4ACB A;  3IKV A;  3LVB A;  1X0C A;  3ML6 A;  3F8F A;  3BJO A;  1IUY A;  1ZGJ A;  3EQO A;  4OOV A;  5TR9 A;  3FM5 A;  3H0D A;  1QUF A;  4PGO A;  1Z7L A;  2DA6 A;  5C4X J;  1CGP A;  2FU4 A;  2OC6 A;  4LJZ F;  4RGU A;  1YIT B;  1X1D A;  3K4C A;  1DDN A;  2O5R A;  4B43 A;  3J7A Y;  2CS3 A;  1QGZ A;  4X7F A;  1P92 A;  1R9T J;  1X1B A;  2Y75 A;  1OFM A;  4YEJ A;  3JW4 A;  3TW6 A;  3ZR8 X;  2NTP A;  4M3B A;  2YS9 A;  4N3G A;  4M3E A;  3QFC A;  4M9Z A;  3JAM Z;  1HDD C;  4RS8 A;  1HDP A;  1U3E M;  3GRH A;  4N9I A;  2GRE A;  2F6C A;  4NUB A;  3GBG A;  1T33 A;  2HYJ A;  2R7Q A;  4I0B A;  1BI0 A;  1DBO A;  2KPM A;  3WG9 A;  4UHT A;  1VF7 A;  3Q3S A;  4D7M A;  2BGI A;  4CO8 A;  5KK1 A;  3BR2 A;  4F52 A;  3TL4 X;  2X1D A;  3I4M J;  1W7P A;  2XAH A;  2R7F A;  1GV2 A;  3EET A;  3ASP A;  1XMA A;  2GIV A;  3ES9 A;  1BN5 A;  2XB0 X;  3ASO H;  3D5L A;  1F1Z A;  4ZJZ A;  2KT0 A;  2FQ3 A;  5BS6 A;  2W6J A;  3LNN A;  2DFH A;  1DAB A;  1N8R D;  3LMW A;  2K3F A;  1BW5 A;  2W25 A;  2HQA A;  1QHG A;  4LMY A;  1P4M A;  1QRC A;  4P22 A;  1ODD A;  5BSX A;  3KLN A;  5BOX A;  3CF5 F;  1XSD A;  1XFO A;  5F4M A;  1WOO A;  3OS2 A;  2NV4 A;  1IO2 A;  3E1S A;  4IVN A;  3K1M A;  1Y0N A;  3KPH A;  4IW3 B;  4RDL A;  1Y39 A;  5ILV A;  2EV5 A;  2C4T A;  4FHT A;  2KKO A;  1IJW C;  2LD5 A;  1SFE A;  1D2E A;  3JAM K;  3MKL A;  1WWX A;  2LY1 A;  4IO9 F;  1P9Q C;  2K9Q A;  2YX4 A;  5B5E C;  1N07 A;  4FTH A;  2B5O A;  3IH4 A;  1HXD A;  2V1D A;  2VBT A;  2NSP A;  1H8A C;  3NQO A;  3P27 A;  3F6O A;  3H5R A;  2P6S A;  5JI6 A;  5DCF A;  5HXB A;  4UNO A;  4YEI A;  2BPO A;  1QRB A;  3T8T A;  2VOO A;  1KK1 A;  2PLF A;  2INV A;  1NDH A;  1V5F A;  1HCR A;  2I8D A;  1B4A A;  1YJ9 B;  3PUF A;  2HQN A;  5HNH A;  2VQC A;  1JUM A;  2IGM A;  3OEE A;  3ZC3 A;  2EIX A;  4OJ6 A;  1BJK A;  3Q39 A;  2FSW A;  1FWZ A;  1KMH A;  1SAU A;  4C43 A;  2ISY A;  4I6Z A;  1SFK A;  2XSJ C;  2HR3 A;  3DKY A;  2X1C A;  3DEE A;  3F0C A;  3GWZ A;  4P3Y A;  1QA1 A;  3WGG A;  4BDZ A;  1TLL A;  2QKM B;  4MHG A;  2EFW A;  2WB1 A;  3LA3 A;  3S2H J;  3JUR A;  3ZQH A;  2EPF A;  1K28 D;  5FD6 A;  3G73 A;  2DTR A;  4I0A A;  4BUP A;  6PAX A;  1DUX C;  2COB A;  2QZ8 A;  4G6D A;  4ESB A;  2F5V A;  1FMV A;  2ZL7 A;  3ZIA A;  3CCQ I;  3WHC A;  3VFZ A;  2K40 A;  1FRQ A;  5J1R A;  4OIN F;  1Y8Q B;  2IGK A;  1WPC A;  4IQ4 A;  2BSA A;  2V7Q A;  2V9K A;  1G8X A;  3K4K A;  4C3I J;  3FXJ A;  2WA0 A;  4IHW A;  2V4D A;  2PYG A;  4YCQ A;  2HKX A;  4XN0 A;  3OJX A;  4MEX F;  1XD7 A;  4HRI A;  1X19 A;  3ZMS A;  4B3X A;  4CCJ A;  4G94 A;  1K73 D;  3T9G A;  2XDV A;  4X07 A;  2FE3 A;  4IQJ A;  2DFF A;  4UXN A;  2DMP A;  3B6C A;  2DER A;  2PBI A;  2JIZ A;  3CUO A;  2JT1 A;  3CC4 I;  2DOE A;  2LP0 A;  3GFJ A;  2K9M A;  4DZP A;  1IZ1 A;  1MMG A;  2DU9 A;  2F5E A;  2EFP A;  3HOY J;  2HXO A;  3K0L A;  5H20 A;  1QVT A;  1V4R A;  5ICG A;  2V79 A;  5J40 A;  5FRM A;  1UD3 A;  2O7O A;  4AC9 A;  5F0C A;  1TVC A;  3CCY A;  5B1B H;  2BXZ A;  4DQL A;  2FNA A;  3CC2 I;  2X0L A;  4S04 A;  4RA2 A;  2WAE A;  4HOB A;  1A04 A;  2CRV A;  1QFZ A;  2WJV A;  2XTY A;  3K1N A;  4E70 A;  5HNF A;  3WTU C;  3H9Q A;  3HOV J;  1MD0 A;  2GK7 A;  2Y0S A;  2VXD A;  1TNS A;  2GBY A;  2ID6 A;  1FOK A;  1RRJ A;  2IS4 A;  2IGO A;  2R7Z J;  5IT9 Z;  2B63 J;  3E3V A;  1WP6 A;  4Q48 A;  3F8M A;  1AA7 A;  2DT6 A;  2ZXJ A;  1TQP A;  3HEF A;  3S93 A;  5GPC A;  2BGC A;  4X7E A;  2R5Z A;  2G9W A;  4CCK A;  3PO3 J;  5J47 A;  2GA2 A;  1FOY A;  2QQ8 A;  1A6I A;  4X7C A;  3OYN A;  1TLH B;  1W7P D;  3E6C C;  1A31 A;  4LG0 B;  1QA2 A;  4XOP A;  4HZF A;  5E1W A;  3G4S I;  2M1B A;  1K4S A;  4EM0 B;  1ZAO A;  1KQ5 A;  4XKW A;  3EUK L;  2KIS A;  4XKC A;  2XPW A;  2WB1 N;  3O8G A;  1I3A A;  4YDT A;  3BG9 A;  3IRR A;  2ESH A;  2IGN A;  2RV8 A;  2H27 A;  1OCC H;  2GOX B;  4YFO A;  5LD2 C;  2ECC A;  3GUD A;  4E7K A;  1PDN C;  2GWR A;  2VT2 A;  1ON2 A;  1MJA A;  1ZG1 A;  2BY2 A;  3CME I;  2DFE A;  5EF6 A;  2OUM A;  1S29 A;  2A6H F;  3GEZ A;  3PFI A;  2R5Z B;  4A3G J;  3ONQ A;  3GQ7 A;  1S7O A;  4DOZ A;  3HSE A;  1QH0 A;  2HNH A;  2W00 A;  4OMY A;  3QU3 A;  4Y13 A;  3HUG A;  4BYY A;  4G8X A;  5IYW A;  1O3S A;  4TSF A;  4ACA A;  3M9A A;  1OYY A;  4HF1 A;  4RB0 A;  3J7A O;  1VZ0 A;  1SD4 A;  4PCQ A;  1YHQ B;  3OYJ A;  3LSR A;  2ZJR F;  1GVH A;  3BR3 A;  1PLU A;  4ZYA A;  5B1A H;  2VAS A;  4JRA C;  2OZU A;  4P96 A;  4IKF A;  3S2D J;  4BJT A;  2XRN A;  1HKQ A;  4L9J A;  2Q6O A;  1WZ2 A;  2XV4 S;  1G6N A;  1MDM A;  3X2Q H;  2ME6 A;  3SY2 A;  2R4G A;  1WJF A;  3KET A;  2EWN A;  2ZXI A;  4UUS B;  4Q5S F;  1HKS A;  1EFT A;  1WH7 A;  5JLX A;  1GO2 A;  3CC7 B;  2JN6 A;  4Z06 A;  1MAB A;  2PE3 A;  2NVX J;  1CQX A;  2DTZ A;  2ZZE A;  2L9V A;  2PYH A;  3PET A;  3G1O A;  5LEK A;  1IF1 A;  3HUG B;  1ETY A;  1HF2 A;  1XE1 A;  4J00 A;  1JTA A;  1YJN B;  3EUA A;  3K69 A;  4OAY A;  3WTZ A;  3CCU I;  3HHH A;  3OL4 A;  2PEX A;  1YOV B;  2DMU A;  4WX9 A;  4BBS J;  1NBM A;  2NTB A;  3W2W A;  3BTJ A;  2XNJ A;  1E0E A;  3SJP A;  2Y0S N;  1TC3 C;  2CW8 A;  5IYB J;  2W4S A;  1CQT A;  3CDI A;  3FF5 A;  1AMO A;  4E6K G;  3DXJ F;  2XAF A;  4TMX A;  1MDM B;  1N78 A;  2MSY A;  3BG6 A;  3UNG C;  1VQ4 B;  5KAF C;  1EWY A;  1ZM4 A;  1WXR A;  3DEU A;  1UD6 A;  2VIX A;  3I3L A;  4LB6 B;  3NEU A;  3PNY A;  5DEQ A;  3RPQ A;  4DQK A;  2VJ5 A;  4QHY A;  5M3M J;  3PSS A;  4QPO A;  2JRT A;  3G2B A;  1MMN A;  4C2U A;  2F1M A;  3FIS A;  1HST A;  5D6E A;  5A2Q Z;  1XGO A;  2VLA A;  1JE8 A;  4P6Y A;  4A5N A;  2HDC A;  3S3O A;  3D1N I;  1FEX A;  3RIQ A;  2LKP A;  2GM4 A;  1N06 A;  4ZDP A;  3PA1 A;  4AID A;  2OTJ B;  4PJM A;  4E7L A;  3V4G A;  5H6Q A;  2JTV A;  2RDP A;  3Q3A A;  2W6I A;  1R22 A;  4A69 C;  3CCR B;  1ZHF A;  4U7B A;  3WGH A;  1ZGW A;  1J5Y A;  2GXA A;  2AXT C;  2FQ4 A;  4OIP F;  4B48 A;  1MNM C;  3Q0W A;  2EFG A;  5DN6 A;  3OYE A;  1BA5 A;  5FD5 A;  4AIJ A;  2DBB A;  1G3Y A;  3VNV A;  1ON1 A;  3P9C A;  1IB0 A;  2ESN A;  2CWE A;  2M87 A;  2WY7 Q;  2Q6L A;  4PC6 A;  2CUJ A;  2RRE A;  4BAY A;  1BJA A;  1IN4 A;  3LYC A;  1O8G A;  3CLQ A;  3IAS 2;  2CFO A;  2UXN A;  2C5H A;  2B0R A;  4Y33 A;  1PP8 F;  3CPX A;  1W5S A;  3ZQC A;  3ESW B;  1S9H A;  1S8N A;  3OIO A;  2FJ1 A;  3QPS A;  1AOY A;  3V7A A;  1P6R A;  2QM3 A;  5A2Q K;  3WQZ A;  1EJ9 A;  2FXA A;  3H09 A;  2LNB A;  4EVI A;  4RPD A;  4ROX A;  2KDZ A;  4M72 A;  1U8B A;  4KT5 C;  3ZQG A;  1HZE A;  2V7U A;  3W2F A;  3TBI A;  1O8J A;  1UCR A;  2E1M B;  2R3S A;  2BY3 A;  3ZGK A;  3EQN A;  4BE1 A;  2BHZ A;  1USS A;  2UUZ A;  4RGX A;  4Y17 A;  2L4A A;  1BPL A;  2FUG 2;  2C77 A;  5FKN A;  1H80 A;  3NB2 A;  3LWF A;  1QG0 A;  3CMM A;  1HF0 A;  2OAZ A;  3RPU A;  3WTX C;  2W82 A;  3QYE A;  5LLQ A;  4QV2 A;  1SMT A;  3OR2 C;  5GTI C;  3JRB A;  3BTL A;  3CP2 A;  3H9J A;  2V7X A;  5F27 A;  1EH8 A;  4OJ5 A;  3SZE A;  3SEQ A;  4A3E J;  1F5T A;  2QE7 A;  3BZK A;  4A3F J;  2NT6 A;  3H3U A;  4S05 A;  2P8T A;  2LKS A;  3OFN A;  4YIF A;  2DYS H;  1E64 A;  4ZV4 A;  2ZZF A;  3WNC A;  2NST A;  2CFX A;  2DA7 A;  2N8G A;  4BKX A;  1Y1V J;  2FBH A;  2MH9 A;  4E4H A;  4ZYE A;  1EZG A;  4II3 A;  1QGA A;  3PA2 A;  2DMT A;  1AU7 A;  3CCV I;  2L5Q A;  4XID A;  2KLO A;  3F9K A;  3WTT C;  2HXI A;  2XEX A;  3TP0 A;  3CUQ A;  3CF2 A;  3VB2 A;  5IOZ A;  3W2G A;  1T08 B;  1B8I A;  3SEJ A;  1IUF A;  3QOP A;  4E7I A;  3BNW A;  1VQP I;  4M53 A;  4UUT A;  3OOU A;  2ZJQ F;  5FA6 A;  2PEC A;  1RKT A;  3M8J A;  1UHM A;  4DBQ A;  2FF4 A;  3G71 I;  2DA4 A;  1T0F A;  3C7J A;  3H5A A;  3JRE A;  2D3N A;  1RUN A;  3RYP A;  1TYX A;  2O0Y A;  2QX3 A;  5CJ9 A;  1WOR A;  3AST A;  1XQB A;  3KEO A;  1SFU A;  2PJR B;  4WK8 F;  1OHH A;  2VJJ A;  4YZQ A;  5J4Y A;  4XMY A;  2XGC A;  1VFC A;  2C6Y A;  4JK1 X;  4BNC A;  1VQK B;  3GLX A;  2QYU A;  2VBZ A;  4MNU A;  5DM6 F;  3CUQ B;  3SFZ A;  4CHU A;  1OMI A;  3T56 B;  1B8I B;  3L9F A;  4H4K C;  1ZR4 A;  4NC7 A;  2O8X A;  1YW8 A;  5FKO A;  5J35 A;  2L2O A;  1FX0 A;  4E7J A;  3W5U A;  2NOJ B;  1O8E A;  3HOT A;  5LGT A;  4C30 A;  3ZCO A;  4QVA A;  2VNK A;  4I84 A;  4QUZ A;  2QQ9 A;  3E20 A;  3P26 A;  1VQ9 B;  5DD8 A;  1G7S A;  4JOM A;  3GO5 A;  3GX4 X;  1I7P A;  2VFO A;  3HSF A;  4KKU A;  3GQ8 A;  4B3G A;  1QZE A;  5L3F A;  4Y7C A;  3KEY A;  2W7Z A;  4P9S A;  4BL0 B;  5KNL A;  5M5X J;  4AC0 A;  2VBX A;  3I1F A;  3A01 B;  2XOK A;  4ZC3 A;  2IRF G;  2CYY A;  1KJZ A;  1QBJ A;  5CLS A;  2HOA A;  2HTJ A;  1EH7 A;  5CQE A;  1JGS A;  3JCU C;  3GTM J;  1NHA A;  3V7S A;  2DW4 A;  1WPK A;  2GIZ A;  3IWF A;  4XLE A;  3M7G A;  1VQ5 B;  3MHP A;  2CG4 A;  3VOE A;  1VI0 A;  5K1Y A;  2CW5 A;  5DS0 A;  1JKO C;  2BW3 B;  4DNT B;  4P12 A;  4U49 A;  1YX5 A;  3K4B A;  3T0Y A;  1S7A A;  2Z5U A;  2Y2Z A;  1O8M A;  4MEY F;  1HG8 A;  1OB2 A;  2VBV A;  1QZZ A;  1Z67 A;  2GLO A;  2LY2 A;  1LE8 A;  1FTZ A;  2RAE A;  1REP C;  4AM3 A;  4L8J A;  1OFE A;  2ICW G;  2R5Y A;  1K8F A;  5HDG A;  3VSK A;  3VR6 A;  2IA1 A;  3DPU A;  3SHF A;  4BDY A;  1HVX A;  2XND A;  2G7U A;  2XF7 A;  3HSR A;  4B4D A;  1XSX A;  1OGO X;  1ZTR A;  2XRO A;  3QRF F;  2K27 A;  4IRI A;  3S14 J;  2Y0M A;  3W6V A;  4HQM A;  4MGR A;  3CJQ B;  1MH3 A;  4GYI A;  1DGW Y;  3Q6R A;  2BE5 F;  2DPU A;  4J19 A;  3K2Z A;  4XRS G;  5DTD A;  1YW9 A;  2M9H A;  4RDK A;  3GVL A;  1J0R A;  2DOA A;  1BI2 A;  2GXG A;  3DF8 A;  3RZO J;  1EFU A;  3PSZ A;  1K4Z A;  3CCL I;  4L0Z B;  4YHB A;  2F2E A;  2M0M A;  1LKX A;  3OE7 A;  3HG9 A;  3CCE I;  4EAT A;  2O0W A;  3KP4 A;  4HV5 A;  3JRH A;  5GTH C;  2VFQ A;  5F0F A;  1LE8 B;  4Z2Y A;  4A3C J;  1I1G A;  5FKM A;  4EV0 A;  3GQ9 A;  1X3W B;  1ZM2 A;  2BX6 A;  4U0Y A;  3CCM I;  3L7W A;  5HOO A;  3I4P A;  1H42 A;  3KP6 A;  4I09 A;  1FIA A;  1FBS A;  4A6D A;  4A0X A;  3H0G J;  3U2Q A;  4F92 B;  3LOC A;  1TBX A;  4B8X A;  1OJL A;  4BEH A;  5DS9 A;  4YIR X;  4GRI A;  2WV0 A;  3AG1 H;  4JX4 A;  3VYR B;  2RNJ A;  1X1P A;  4E7Z A;  4RJL A;  1JUP A;  1GXQ A;  3WTV C;  3A0B C;  2CJJ A;  3N4M A;  2H6B A;  1T95 A;  4HG2 A;  1GJR A;  1J75 A;  1E62 A;  1TT5 B;  1Z7U A;  2V26 A;  3FHN A;  3QWL A;  3PNT A;  1YLO A;  3W2I A;  1Z1D A;  3CQZ J;  3M8F A;  1HSJ A;  1N25 A;  3SKB A;  5DDG A;  1ZRE A;  4JX5 A;  5F0H A;  1STZ A;  2M3A A;  3ZMU A;  1HKT A;  3GVJ A;  4K1X A;  1E2X A;  2MH2 A;  3MFK A;  1F4K A;  4M0L A;  4UZF A;  2EB7 A;  3GYH X;  2L4M A;  2WY8 Q;  2ZME B;  2XUB A;  3MD2 A;  1TL8 A;  2HEO A;  4Z4R A;  4IHS A;  1HBX G;  4BEH B;  4MTD A;  3HAG A;  3AL0 B;  1DPR A;  2H09 A;  1KYZ A;  1YW7 A;  5DCM A;  2E7X A;  1LFP A;  4G12 A;  2A5Y B;  4BE2 A;  3LFU A;  4DJA A;  2E1R A;  4OJO A;  5FKL A;  3OY9 A;  3R0A A;  2ZSH B;  4B47 A;  3VO2 A;  1U5T A;  5F04 A;  3TMO A;  1A5J A;  3PEN A;  2ACJ A;  1I5Z A;  1LQ1 A;  5IT3 A;  4D0P A;  2J8I A;  4M6Y A;  1KON A;  3S1Q J;  2BSP A;  2ME0 A;  4KYW A;  5ICF A;  1YJW I;  1MNE A;  3QP5 A;  3SLD A;  2E5Z A;  1RZ4 A;  2X9D A;  3PUB A;  2R7S A;  1RKW A;  1D1C A;  5KVR A;  4DNC A;  4KMU X;  1G59 A;  1S72 B;  1QPM A;  5KHD A;  2NVQ J;  1E63 A;  5C1E A;  2HI3 A;  4RAG A;  3TO6 A;  4C2M J;  2AQF A;  2VFM A;  3CPW B;  1FND A;  3RKX A;  3F72 A;  5TRD A;  2ZSI B;  2CUF A;  1EA3 A;  5JBQ A;  2XTX A;  1ZKG A;  4AYB A;  5K5O A;  1QQ1 A;  5J4V A;  1U5T B;  1YHQ I;  4IHV A;  2BM0 A;  3WY9 A;  1OGJ A;  2MD0 A;  2XNC A;  5CYV A;  3AVW A;  2DJI A;  2HDW A;  2JK3 A;  3QPL A;  3HGY A;  3BTI A;  1JHF A;  5JMC B;  4HAM A;  2FX0 A;  4XLA A;  3BC9 A;  3BY2 A;  2O61 A;  1ZRF A;  1Z3Y A;  3BPV A;  3H92 A;  4IX7 A;  1HOM A;  1UD2 A;  3VYT B;  3CRZ A;  2ZZG A;  4HPQ A;  5E3N A;  4YXW A;  2E2J J;  1KK2 A;  4Z4Z A;  4RAF A;  5FIU A;  1LUJ B;  2NVT J;  1ONV A;  3VMV A;  2IT0 A;  2CGP A;  1LNW A;  5TGT A;  5HDN A;  2PN6 A;  4V2G A;  2RKH A;  2JA6 J;  3DBH B;  3HL2 A;  1A36 A;  1OGI A;  1OCZ H;  3U2R A;  1E3Z A;  2QA4 B;  4BJ5 C;  5BQT A;  5BPD A;  2PMU A;  4EJV A;  1ELO A;  1SKY B;  3KEW A;  3JX8 A;  2D1H A;  2XAJ A;  5E3M A;  1DQU A;  4G1V A;  5FRO A;  5IK2 A;  1Q7Y D;  3OS1 A;  2GJK A;  4ZDL A;  2JWT A;  5ICE A;  3B78 A;  1VQ7 B;  3SQN A;  1W5C C;  4FAS D;  3OW2 B;  4FWT A;  1IXS B;  2L0K A;  3I4N J;  4MYU A;  3DQV C;  4E0F A;  2QQA A;  3B82 A;  3VPR A;  2F5D A;  3S32 A;  3AVY A;  4ETS A;  4MXN A;  1VLY A;  4IPA A;  1X4O A;  1KK0 A;  2PJP A;  1XMX A;  4H0E A;  3CDL A;  2VFN A;  1E1R A;  2J8K A;  1OB5 A;  4UV9 A;  3T53 B;  5JHF A;  4IHX A;  3EYY A;  1NRK A;  1KK3 A;  5B6I A;  3QFR A;  1VF9 A;  2V5I A;  1ZM9 A;  3CCR I;  3BZ6 A;  1O7F A;  1R5G A;  4YEL A;  1KCC A;  4XON A;  4UB8 C;  1QRY A;  4D5C A;  5CDF A;  2V9P A;  2K9S A;  5IY5 H;  3DPL C;  3KP2 A;  5FLX K;  1WDT A;  4L5E A;  3OW7 A;  4J0Q A;  3Q6Q A;  4AD9 A;  1X1C A;  2A6E F;  3F3X A;  1QX4 A;  4AYB N;  3WE3 A;  1BI1 A;  1P4X A;  4BE0 A;  3SYJ A;  2CRG A;  2O3F A;  1NK3 P;  2OQR A;  2KJB A;  2LLK A;  2OCE A;  1I18 A;  1ZG5 A;  1LLW A;  3KP7 A;  5HS7 A;  1T56 A;  4OOX A;  2X6Y A;  2Y31 A;  2GXB A;  3G3Z A;  4D7N A;  5AON A;  3LSI A;  4LBY A;  4V2F A;  3TGN A;  4EH1 A;  1KC8 D;  2DOG A;  2MG4 A;  2YWE A;  3S2W A;  5GV8 A;  2JJ7 A;  4WXC A;  2PMH A;  1ETX A;  3K4N A;  4UY8 I;  1NB9 A;  1G4D A;  5K5Q A;  4RAY A;  2VXZ A;  4RLQ A;  4AWX B;  4UAJ A;  3LAP A;  1W1W E;  3RY8 A;  4P9U A;  3I64 A;  1VQL B;  1IAW A;  5J8C A;  3D0S A;  3OZV A;  2VKH A;  2NNY A;  2L9N A;  3E5X A;  2HQR A;  2GQF A;  4YAW A;  3SXY A;  3CMY A;  2STT A;  1H8E A;  1IN7 A;  5E3L A;  2OTL I;  1OYI A;  5HS8 A;  4HWV A;  1S4M A;  2FX3 A;  5LGU A;  4PFO A;  1R5B A;  2RC5 A;  5H59 A;  1IRF A;  1JKQ C;  2GPJ A;  2E19 A;  5DNS A;  4X1E A;  2L7K A;  1GHC A;  1W0J A;  3AGP A;  3I55 B;  1Y8R B;  3OYI A;  2IA0 A;  4W8Q A;  1WMR A;  1T2K A;  4DGW B;  3FMQ A;  3HKZ N;  2O6G E;  3MCZ A;  2V1X A;  5CQG A;  3TOA A;  4XNF A;  4DYQ A;  3QPT A;  2M5W A;  4NQW A;  1ETK A;  1TYU A;  1O8L A;  4ZCM A;  2HOE A;  3AFH A;  2OU2 A;  1EH6 A;  2E1N A;  4KFC A;  2AO9 A;  1DP3 A;  3SUC A;  1OCP A;  5BPI A;  2K5C A;  1E3O C;  4BS9 A;  2EV6 A;  3DTK A;  5IOY A;  3TP3 A;  1AWC A;  2XAG A;  4CCN A;  1W7P B;  3DU6 A;  4I99 C;  3FIW A;  5HOD A;  1EP3 B;  2JJ2 A;  2EWE A;  1UFM A;  2HLD A;  3FPK A;  1DU6 A;  2ELH A;  3R0J A;  2W24 A;  2ZBV A;  2WPD A;  3SYT A;  2Z2S B;  1K7A A;  3E6B A;  2X1E A;  4PC1 A;  2OPT A;  1U6G A;  4KH3 A;  3SJM A;  4XBF A;  3ZQ7 A;  5F4J A;  1KTV A;  1ORK A;  1BX1 A;  2DQL A;  1WI9 A;  1QPI A;  3BCA A;  1L0O C;  4CQJ A;  3ONU A;  2J5O A;  3BWG A;  2QWW A;  3Q5F A;  1FPQ A;  1IRG A;  2CND A;  1UG2 A;  4KIS A;  5D5U B;  1T6X A;  3GCM A;  1MMD A;  2C4U A;  4PC7 A;  5THX A;  3DV8 A;  4WXH A;  2LBF A;  2BF4 A;  1SD6 A;  3WWG A;  2OA4 A;  3HZJ A;  1WOP A;  3PFY A;  2DXI A;  5DV5 A;  4IJA A;  5K7F A;  1BIA A;  2ZL6 A;  4JX6 A;  1Z6T A;  4W8R A;  1LPQ A;  1IV6 A;  1PUF A;  1VQM I;  2XSD C;  3OYG A;  2CSO A;  1E3H A;  4PGH A;  4XLF A;  5LBQ A;  2MYS A;  1FP2 A;  1M1E B;  3H9G A;  1K9M D;  1K83 J;  3QE2 A;  2JPB A;  3RCO A;  2VNI A;  4XLC A;  1ZN2 A;  4NC8 A;  1APL C;  1PUE E;  3CES A;  1V55 H;  2X3H A;  5E8I A;  2O03 A;  3WE2 A;  3K70 D;  2P5V A;  1B9M A;  4U88 A;  3KCC A;  4KIC A;  2ZTG A;  4P6V F;  1O3Q A;  1KQ8 A;  1R00 A;  4HA8 A;  1GXP A;  4YFK F;  2F5F A;  4RD3 A;  2R9V A;  5GAG J;  3NWS A;  1VQ6 B;  3B4N A;  1R5N A;  1IDK A;  1V5E A;  1SVM A;  2W48 A;  2JUG A;  2LBF B;  1S0U A;  4C0S A;  4EJU A;  1J2X A;  5D5V B;  3IH2 A;  2WZP P;  2VYQ A;  1YIO A;  1JTY A;  1W87 A;  1VQO B;  5D6F A;  5E79 C;  4BY7 J;  3H36 A;  4ZZD A;  1AIP A;  1N05 A;  4KT6 A;  3NWT A;  5EEH A;  2ZFW A;  5LRS A;  2X4H A;  4QSH A;  4ESJ A;  2QDX A;  4IHT A;  4XLH A;  3AVV A;  1UEL B;  2TRT A;  4LBZ A;  2UXX A;  3I0T A;  3R4K A;  2VKV A;  2DN0 A;  4FX0 A;  1PJ7 A;  2QTL A;  3B8Y A;  1FP1 D;  2LG4 A;  2ZXH A;  4PJN A;  1L3L A;  1F43 A;  1D5V A;  3ASR A;  2E34 A;  4HYE A;  1N77 A;  3L2Q A;  3LSH A;  4NBQ A;  3O6B B;  1UJ8 A;  2F4I A;  4WZL A;  3AG4 H;  3BRO A;  1DP7 P;  3T5X A;  1S5L C;  3KFW X;  3LSG A;  2JRM A;  1O4X A;  1E3P A;  2HYF A;  2QMU A;  2X6O A;  2Q0O A;  1G3S A;  2X6X A;  3L1P A;  2XGX A;  3RQ4 A;  1ZYR F;  1IRX A;  3WU0 A;  1BBY A;  4OAZ A;  2DEU A;  4N4O B;  3DWL E;  3J81 Z;  1EFC A;  2EIL H;  4BQQ A;  1GAW A;  1QA3 A;  1IGN A;  1KQ9 A;  2QBY A;  1HA8 A;  1OB0 A;  3ZPL A;  1KTW A;  1I27 A;  5GAE J;  1ACI A;  5AN9 A;  2NZM A;  2KZG A;  5EEA A;  3HPG A;  2M2E A;  4W97 A;  3K4J A;  1CLW A;  3N6Z A;  1MKM A;  4LLL A;  4XL9 A;  4MIM A;  5JHU A;  3OSG A;  2VBS A;  3V42 A;  1FT9 A;  2E5N A;  1MMA A;  4A3I J;  3RDI A;  2NVU B;  5E3O A;  3VNU A;  3CCJ I;  2WBM A;  2P4W A;  1GUU A;  3OZW A;  4ENJ A;  2CBX A;  3EYI A;  3DBL B;  1G3W A;  3L2R A;  4G7Z F;  1YIJ I;  1TYV A;  2M4G A;  5GAD J;  1FNN A;  4GQN A;  2OQG A;  2BGJ A;  2DFI A;  5IT9 K;  1BOB A;  2QBY B;  4Z4V A;  1T5E A;  1Y1W J;  4HIZ A;  4EJT A;  2ZJP F;  4DK0 A;  2VQG A;  3GZ6 A;  1FYL A;  4CYD A;  4MTE A;  5BMZ A;  3ZP5 A;  1COW A;  1YLF A;  5E1X A;  2QEX B;  3PUM A;  4MFE A;  1D0X A;  4OJL A;  4ZZL A;  1UB9 A;  5F08 A;  1Z05 A;  1W4M A;  2H1L A;  1FY7 A;  1ZLJ A;  2HDN B;  1ETQ A;  1W35 A;  5E20 A;  3UR3 C;  3J80 Z;  3BY1 A;  1HW2 A;  3F8N A;  1WJC A;  3F6V A;  3A1P A;  2MC3 A;  3LFK A;  1JXS A;  2J7K A;  4I2O A;  3FX3 A;  3GVA A;  4B4C A;  3PSI A;  4W8S A;  1B9N A;  2JPC A;  3R6J A;  3BOQ A;  1KQ0 A;  2XZP A;  3CO7 C;  3H3Z A;  4ENM A;  3SZG A;  2CV1 A;  3MN2 A;  2D74 A;  1O8H A;  1Q1V A;  1OFL A;  1BI3 A;  2CW7 A;  5L3G A;  4XK4 A;  5FJ8 J;  5ILS A;  5E8G A;  2WTE A;  5CVR A;  4G7H F;  3ZZU A;  4HX7 A;  4WXD A;  1FBU A;  3I56 B;  1ITY A;  4X0G A;  2IS2 A;  2JN9 A;  4P5O A;  3OYH A;  4KIF A;  1OIS A;  2VJI A;  2IEK A;  2NNN A;  2RQQ A;  3FKI J;  3Q0V A;  1Q86 D;  3FXM A;  3TDZ C;  1G7T A;  2BZT A;  2MD5 A;  5D5X B;  4XQF A;  1B6A A;  4Q7J B;  5C3E J;  3RYR A;  4HDV A;  3HB9 A;  4O5V A;  2G0Y A;  3RKW A;  5IYQ A;  2Z9O A;  2F4M B;  3LSP A;  5EGO A;  3CW2 A;  4RD1 A;  4E7S A;  1BC8 C;  1UST A;  2PMZ A;  1G3T A;  5F1R A;  4HQE A;  1YFH A;  1DG1 G;  4G5G A;  5FO1 A;  1IDJ A;  3FXK A;  2BM7 A;  1FBQ A;  1OCO H;  1OFC X;  2LVS A;  4L5I A;  1LM1 A;  2EIM H;  2PLY A;  1B2R A;  3HOW J;  3WHB A;  5L3E A;  2MLK A;  4E7H A;  2NRA C;  5HLI A;  2CC2 A;  1QVG B;  2GAU A;  2EH3 A;  4G7X A;  4OP7 A;  3W2H A;  4O6J A;  2Q6K A;  3LA2 A;  1QVF B;  2RC6 A;  1LEB A;  2LRE A;  3COA C;  4I76 A;  5J8F A;  4TMW A;  2L9R A;  3L00 A;  2CQN A;  1SMY F;  4TN1 A;  2HMA A;  1YI2 B;  1M1K D;  4RM3 A;  3WXM A;  3WU1 B;  2OBR A;  5TV2 A;  3E5Q A;  3FXO A;  5EGO B;  2VZL A;  1J9I A;  1NJI D;  2HZD A;  2HKO A;  4HEA 2;  2JVH A;  4FX4 A;  1I8D A;  1WI3 A;  4ITV A;  4CCL A;  5AMV A;  2V1N A;  4OPO A;  3KE2 A;  4HNU A;  4CCO A;  2E2I J;  1Q9S A;  2NPF A;  3LSM A;  5AIQ A;  1FDR A;  1FOW A;  4AU7 A;  2K9N A;  4OIR F;  3VST A;  3FPP A;  4G9Y A;  3O3K A;  3ZSC A;  3V8J A;  1E79 A;  1S7E A;  1MJ9 A;  2CW0 F;  1GDT A;  3FBI B;  1JGG A;  4BQA A;  3FK6 A;  4XRF A;  4XSZ F;  3I59 A;  3BQY A;  5M3F J;  1Z6R A;  3OAA A;  2DIE A;  1LEA A;  3C1D A;  4TT3 A;  1N75 A;  4HW0 A;  1FTT A;  3G1L A;  3LA7 A;  4BH9 A;  1X3Z B;  2P7C B;  2VON A;  2F1L A;  1WU8 A;  2HS5 A;  2R7O A;  4XIC A;  4NNJ A;  3RTR A;  3ABK H;  1BC7 C;  1U2R A;  4MQ9 F;  3LQQ A;  4LBV A;  2X53 S;  4F93 B;  1E17 A;  2DT7 B;  3HYI A;  5BNG A;  2YPR A;  5IP7 J;  3DP7 A;  1Z21 A;  4CGZ A;  1M90 D;  1WJA A;  2GQQ A;  2ZBU A;  2BXY A;  4ZTJ A;  1JA1 A;  2K85 A;  4M3F A;  3R61 A;  1YIT I;  2OBS A;  2B9S A;  4R71 A;  2CK3 A;  5ERI A;  5FKK A;  4M2L A;  1Q81 D;  2QXZ A;  4Z4U A;  1DGR M;  1TYW A;  2Z16 A;  1TSP A;  1TWA J;  2YR2 A;  4RM2 A;  3BT9 A;  3I59 B;  1K4T A;  4QIW N;  4C2T A;  2H8R A;  2H6C A;  1XG1 A;  3F8C A;  2XAS A;  5L3B A;  3OYM A;  1QHH D;  2PMZ N;  3OZU A;  4XRS A;  4AVP A;  1OR7 A;  4IHY A;  1WSU A;  2AQE A;  3M3Y J;  2WAD A;  4M71 A;  1W0K A;  4QVJ A;  1G2H A;  3UW0 A;  3QOD A;  5JVG F;  3HGG A;  1NK2 P;  3PVD A;  3BCB A;  1H9G A;  3CB4 A;  2L3D A;  3ABL H;  3FDY A;  4ZDO A;  5HKK A;  3Q9S A;  5J3O A;  3DBR B;  5DUK A;  2FOW A;  4RCZ A;  1BL0 A;  1OYW A;  1SFX A;  1W36 C;  2XHK A;  1XCV A;  2Y69 H;  1AHD P;  3KRG A;  3TQN A;  5D5W B;  2XC7 A;  4MO7 A;  1V0E A;  1YX3 A;  2EV0 A;  3OJW A;  4N0B A;  4U0V A;  2VOP A;  3HXL A;  4G7W A;  1RQP A;  1SKQ A;  5BSY A;  1SFO J;  2QSH X;  5DYM A;  3I55 I;  2XKO A;  3CMA B;  3I9V 2;  3HJE A;  2FOK A;  3BY6 A;  4IRG A;  1UG0 A;  2A05 A;  3M07 A;  2Z33 A;  2WR8 A;  1LJ9 A;  4XLN F;  3HOU J;  2KRC A;  1RET A;  1FSH A;  1TP4 A;  3MCA A;  3BTC A;  1IA5 A;  3Q9V A;  1CNF A;  1DPU A;  2A68 F;  5IYD J;  3JSO A;  1UZC A;  3GXO A;  1LVK A;  4D1Q A;  1K5C A;  2QQB A;  4BXF A;  5EG0 A;  1MSF C;  3GFM A;  4P2N A;  3SLN A;  4DIQ A;  3WND A;  4YAL A;  1H88 C;  2LY9 A;  2M45 A;  2HVQ A;  3CDH A;  3ZQF A;  4EQQ A;  3JRA A;  4IOA F;  3W2A A;  2O9L A;  1VTN C;  4KNY A;  4A12 A;  4LIT A;  3HRT A;  4HNV A;  4A3B J;  3K4L A;  4U7D A;  1R71 A;  1S3J A;  2DAO A;  3HTU A;  1TWH J;  1YJ9 I;  1EE6 A;  2CQ7 A;  2W85 A;  2E1M C;  5IYC J;  5KCM A;  2GJP A;  3T51 B;  4N3N A;  4TMZ A;  4F3Q A;  3ASQ A;  1R5I D;  1XSV A;  2V9V A;  3N90 A;  4UV8 A;  1X2N A;  2PMD A;  2JJ1 A;  5EG0 B;  2R7D A;  4RMN A;  1XB2 A;  1R4N B;  2WJY A;  1IJF A;  4Y15 A;  4CZC A;  4HE5 A;  3SQV A;  3GTP J;  4PSX A;  4BY1 J;  2A3S A;  2WAF A;  3E1Y E;  1VQN B;  4X05 A;  4PJJ A;  4NBS A;  3CJN A;  3SJZ A;  4FE7 A;  4S0H B;  1YS7 A;  4RB1 A;  3K6G A;  2YWF A;  1IW7 F;  2KHM A;  3BCF A;  4G7O F;  3F23 A;  3CXC B;  3CZ6 A;  1R23 A;  2ZJ2 A;  3JRF A;  2UVF A;  2LTP A;  3GFL A;  3JTH A;  2BVN A;  5IYP A;  1JHH A;  4PJ0 C;  4FQG A;  1TW3 A;  3CLO A;  3K4M A;  3PIO F;  5HZB A;  5IYN A;  1XC5 A;  3H94 A;  4LD5 A;  1MRZ A;  2BV3 A;  3F21 A;  2QSG X;  2OD5 A;  4BAC A;  2VNH A;  2EFN A;  3PQK A;  3LAJ A;  3B02 A;  2I5U A;  1ZGA A;  3PNV A;  3W5H A;  4F7D A;  1TWC J;  2I1L A;  3BJA A;  4U4B A;  3QP6 A;  3NAR A;  3ZBT A;  4M3G A;  2VE9 A;  4L0Y B;  1A8P A;  1PJ6 A;  3W2V A;  3U6B A;  2R7V A;  5IP9 J;  2IBD A;  3ML3 A;  3RPU D;  2UWM A;  2BMW A;  5LRR A;  4LK0 F;  1FLI A;  1FIP A;  3TKY A;  1VQO I;  3WG7 H;  4BXU A;  2R5Y B;  3S15 J;  4X6A J;  1VHO A;  2AS5 F;  2X51 A;  4LBW A;  2D2W A;  3ZXS A;  2DPD A;  1ZQ3 P;  1H9T A;  4WZE A;  4YII A;  3CC2 B;  5HVQ C;  1F9N A;  4B3F X;  1W9X A;  5J1Y A;  2HPM A;  4QTR A;  2IJL A;  3G05 A;  2KRF A;  3VSV A;  4CDG A;  3A4C A;  3VSU A;  1NG7 A;  2VBW A;  1MH4 A;  3IHU A;  1O8F A;  5D4S A;  4DNR B;  3BZC A;  1QCX A;  2CUE A;  1I50 J;  1T6Y A;  4AF6 A;  1BMF A;  3CUQ C;  3A0H C;  4A3K J;  1G7C A;  3A8K A;  4P55 A;  1DAR A;  2XF5 A;  5FGM A;  4NDL A;  2Q1Z B;  3G1M A;  2OJE D;  3NRV A;  3N05 A;  1UD8 A;  2Z99 A;  3LNQ A;  2BM6 A;  3B8H A;  3ZMZ A;  4HLX A;  1SD5 A;  3CTA A;  1KD1 D;  3GTQ J;  4XKV A;  1KQS B;  2MAB A;  5LEJ A;  4FXU A;  3G4S B;  4UB6 C;  2HQ5 A;  3LL7 A;  5EJC A;  1RUO A;  3OIQ A;  1YRN A;  1YO5 C;  3ZPP A;  2GOM A;  3K1P A;  2ZIT A;  1TT0 A;  4XOR A;  5H6R A;  2XAQ A;  5F64 A;  3B6A A;  3ULQ B;  1NB0 A;  1PXZ A;  1KCD A;  2DY1 A;  4Z6Y A;  1IXC A;  1LB2 A;  1R58 A;  3ZQI A;  5A89 A;  2O0V A;  3NAU A;  4RD4 A;  2OYN A;  4CZZ A;  3H1C A;  4UUV A;  4YZA A;  5EMN A;  1L1I A;  4RGR A;  4MYT A;  3JRG A;  2ID3 A;  2E71 A;  3W3C A;  3CME B;  4RM0 A;  3LO8 A;  1WQ2 A;  3N97 A;  2O8K A;  2RNG A;  3BPX A;  3NAW A;  1U8R A;  4EM1 A;  4MR0 A;  2D45 A;  1JT0 A;  3GW2 A;  3FWE A;  1QFJ A;  2DQR A;  2MC4 A;  4J01 A;  3P9I A;  1O57 A;  4CXF A;  2HU9 A;  2JDI A;  4LIV A;  2DOF A;  3V7C A;  3OWT A;  4YAU A;  3V8K A;  4OZZ A;  2CH0 A;  4PDK A;  5DCM B;  1RES A;  1T98 A;  2TDX A;  4P25 A;  1B72 A;  2AHO A;  3K9T A;  3IV5 A;  1JUS A;  1EV7 A;  4OOI A;  2WYR A;  5HZA A;  2YSR A;  1N0V C;  1OPC A;  2HPI A;  2DA1 A;  4YFX F;  3MKZ A;  5LMZ A;  2MA3 A;  1MJB A;  3ZUG A;  4PZJ A;  1BR2 A;  4M6X A;  4CSW A;  4XLP F;  3R6K A;  1EKE A;  1KRH A;  2XTW A;  2NOG A;  1IN6 A;  4PFP A;  4WWV A;  5A8A A;  1OGM X;  2M4K A;  5IP6 A;  2KIF A;  3WU2 C;  4EGZ A;  1SAN A;  1X2M A;  2L7F P;  1RI7 A;  3CC7 I;  3RKQ A;  3FKS A;  3KYD B;  4RAZ A;  5H2F C;  5M5W J;  2BY0 A;  3LQR A;  1XN7 A;  1CF7 A;  1OOC A;  4KUM A;  3MVP A;  5LHG A;  1MBH A;  1YJN I;  3HBL A;  1MBG A;  1B72 B;  1RC9 A;  2FBK A;  1TNT A;  3D5R C;  4IRH A;  3S1M J;  2R7T A;  1H85 A;  3AKZ A;  3U1K A;  1LFB A;  3WTS C;  2B7E A;  2KDO A;  3FM3 A;  4NK6 A;  2DDA A;  4A3M J;  2ZCW A;  3I56 I;  4RPB A;  3OMY A;  2UV1 A;  4WF2 A;  3GQA A;  4PK4 A;  1GT0 C;  4GFB A;  3E7L A;  1GVJ A;  2WAQ A;  2HWV A;  5E6T A;  3HKZ A;  4ESF A;  1VQ4 I;  1JB9 A;  2W1O A;  2IAI A;  3E6M A;  2EA4 A;  3OYL A;  3WBK A;  1I6X A;  1NTC A;  3TW7 A;  3P4G A;  1TQI A;  1D0Z A;  2A5W A;  4QPQ A;  1Q82 D;  2NYX A;  3KYL A;  2KFD A;  2BBY A;  2RN7 A;  1VHE A;  4A0Y A;  1ZG3 A;  1CF7 B;  4M3D A;  3CD6 B;  1EF4 A;  4Y9U A;  4JP0 A;  3P9K A;  1R1U A;  1K6O A;  3HTS B;  4Z03 A;  2ZFU A;  2JZY A;  2ZME C;  5C4J J;  3QU6 A;  4KKT A;  2JQ7 A;  2OTJ I;  5CVV A;  3U9G A;  2D1V A;  2LSO A;  4ZH4 F;  3AL0 C;  1CZF A;  4RD6 A;  4X06 A;  2Q2E A;  5CPR B;  3S8P A;  2PI0 A;  2R7U A;  1SC7 A;  4G1B A;  2C2W A;  5HLT A;  3GZ5 A;  1RIO H;  2JA5 J;  1HW5 A;  2BM4 A;  3MKY B;  2VBK A;  3PJR A;  4X0C A;  3HIF A;  3WBJ A;  1OCT C;  2HDD A;  3C2B A;  3FMS A;  3ZQQ A;  1D8J A;  3U21 A;  1XX5 A;  2JA8 J;  2DK8 A;  2IQ7 A;  1NHC A;  1ULY A;  3PSF A;  2Z1D A;  1V0F A;  1WJD A;  3IRQ A;  1FZP B;  1YE9 A;  1XB4 A;  2JA7 J;  2AXL A;  1Z0X A;  1KZL A;  1WJB A;  3RKY A;  1SVO A;  1E43 A;  2M7A A;  2Y9Z A;  4JYK A;  2E1B A;  3L2V A;  2WC2 A;  1ERD A;  4EW9 A;  2ZO4 A;  3LSK A;  1WVR A;  1K79 A;  3VOD A;  1U9O A;  3FY3 A;  1FJL A;  2RQP A;  5D4R A;  1U5T C;  1W5T A;  3FMR A;  2P5L C;  1N0U A;  4Z1M A;  2XZL A;  2VBY A;  2CU7 A;  2K4B A;  2DOD A;  4A3J J;  2BY1 A;  5FL7 A;  1WSR A;  3KX2 A;  3FKJ A;  5EZG A;  3V8L A;  2FML A;  3ZOB A;  1TTT A;  2STW A;  1XGM A;  2VQH A;  4X8I A;  1XGS A;  4LLG F;  2E1C A;  1PVE A;  3ERE D;  1YTY A;  3OOP A;  4TMV A;  2MBF A;  5C44 J;  1U78 A;  2IS1 A;  2IOU G;  5FB2 A;  3GVK A;  2BV6 A;  2ZC2 A;  4V19 K;  2A61 A;  2ZL5 A;  3QFS A;  3CCV B;  1AKH A;  2GZW A;  3QOE A;  3DPT A;  4YG2 F;  4DQ2 A;  3K7A J;  1D3Y A;  1MSE C;  3GTG J;  2QGU A;  3OP1 A;  2M0C A;  1ZK8 A;  4P1W A;  3VO1 A;  4K2E A;  2WAQ N;  5GV7 A;  3ZMV A;  3ASN H;  3BR6 A;  3VYU B;  1Y56 A;  3PM1 A;  2KVO A;  4I7H A;  2IVM A;  4TKO B;  1EFR A;  1Y0Y A;  2VNJ A;  1W0U A;  3CCS B;  4DW6 A;  3JRD A;  2XIG A;  1MIJ A;  1PYV A;  3RI4 A;  1I1S A;  1WGX A;  3G71 B;  1XCB A;  4KDP A;  3OL3 A;  2E35 A;  3JTG A;  4OMZ A;  1D1B A;  3FBN B;  3DTE A;  3WYA A;  1HC8 A;  3IL2 A;  3BLY A;  2JSC A;  4ENN A;  2VBE A;  3KYC B;  2F48 A;  2LDU A;  4BBR J;  3C18 A;  4AVZ A;  1JI8 A;  4NC6 A;  3P7N A;  1AKH B;  1OCR H;  1O3T A;  3KEQ A;  1Z3X A;  3RSN A;  4B44 A;  3JSP A;  4GYG A;  4IEJ A;  5F1J A;  4PC2 A;  3S16 J;  1WRJ A;  2EIJ H;  1V5G A;  1I39 A;  4XOT A;  4HSR A;  1IB4 A;  2JUC A;  4NQW B;  3JRI A;  2KIQ A;  4RLF A;  2X48 A;  1WHU A;  5K7H A;  1ZRC A;  2ZNZ A;  3CMA I;  3GIR A;  3EUH C;  4EM2 A;  2X8K A;  1MBJ A;  3C2H A;  1VQK I;  3JQP A;  1PE9 A;  4IOC F;  1Y0R A;  2EK5 A;  2ZBK A;  2MGQ A;  2E36 A;  4IL6 C;  1IG7 A;  4OWR B;  4OPV A;  2QVO A;  2Y9Y A;  2L7M P;  4M4S A;  4A3L J;  4Q47 A;  3QYF A;  4GXO A;  3ABU A;  4HF0 A;  2V7T A;  2VI6 A;  3G6E B;  2ISZ A;  1ZAR A;  4AIH A;  5DM7 F;  1B1B A;  1BJZ A;  3ECH A;  4FN5 A;  1QVU A;  2YWH A;  4JBA A;  2F4N A;  1YS6 A;  3DU1 X;  3BG3 A;  1Y6I A;  1T39 A;  4A0Z A;  1VQ9 I;  3M8E A;  5J6X A;  3K70 C;  1X4P A;  2XPV A;  4L9T A;  3R6S A;  4B1R A;  2LKX A;  4PAB A;  1LDD A;  1WJE A;  3KZI C;  2KRH A;  2K3P A;  3TOB A;  1XPX A;  5LGN A;  2R7X A;  4EGY A;  4U9U A;  3S1R J;  1H0M A;  1I6H J;  9ANT A;  2FEZ A;  1LVA A;  5KSW B;  4FE4 A;  1J09 A;  1O8K A;  3GFI A;  5FFZ A;  4CCM A;  1R5H A;  1IDZ A;  2D3L A;  1VQ8 B;  3SDG A;  1KU7 A;  2PX9 A;  4B09 A;  4LB5 A;  4MQV A;  3H9N A;  1TW2 A;  2ZNY A;  4HLY A;  4KN7 X;  3E97 A;  4XKB A;  1VQ5 I;  3JQQ A;  1TZL A;  3WGI A;  4P1V A;  4RDJ A;  2XT4 A;  1KA8 A;  3JRC A;  1DDI A;  1PUF B;  3DKX A;  5ICC A;  4RCY A;  4OZY A;  4JQF A;  1VQN I;  3HOX J;  1RWR A;  3VSL A;  4Z4W A;  1FNC A;  1UHW A;  5JR3 A;  1OKR A;  3MWM A;  4O3M A;  3ZZ0 A;  2F3L A;  1P4W A;  1ZEL A;  1BOA A;  2YU3 A;  2GJR A;  3CO6 C;  2KL4 A;  4Y3O A;  3F8B A;  2R93 J;  2RGV A;  3E6D A;  1KU9 A;  3CCL B;  4V02 C;  4GDF A;  3OKX A;  4YZX A;  4P3I A;  3FJO A;  3M4O J;  5AIP A;  3IC7 A;  4A5M A;  1V5V A;  3Q0U A;  3CCE B;  2R92 J;  5B66 C;  1BR1 A;  3MAJ A;  4M74 A;  4Z4Y A;  4ON0 A;  3KZZ A;  2L7Z A;  2X3U A;  4QFM A;  1QNT A;  3CCM B;  3BG5 A;  2H94 A;  2QCO A;  5KW9 A;  3HOS A;  4YC5 A;  4G6I A;  1R36 A;  1XS9 A;  2G7H A; 
#chains in the Genus database with same CATH homology
 2Q2E B;  3FBI B;  4U87 A;  3GQ9 A;  5HOO A;  1X0C A;  3OAA A;  2DIE A;  4TT3 A;  1N75 A;  1PKV A;  4F92 B;  3EQO A;  2R7O A;  4NNJ A;  3RTR A;  4BEH A;  2CUZ A;  3H0D A;  1Z7L A;  4GRI A;  2OC6 A;  2LRD A;  3VYR B;  4F93 B;  4E7Z A;  2DT7 B;  2X53 S;  1X1D A;  3K4C A;  2O5R A;  1Z21 A;  4B43 A;  3J7A Y;  1WJA A;  2CS3 A;  1T95 A;  3H35 A;  4HG2 A;  4ZTJ A;  1X1B A;  2V26 A;  3FHN A;  1JRG A;  3PNT A;  4YEJ A;  1OFM A;  3ZR8 X;  2CK3 A;  2NTP A;  2QXZ A;  4LIU A;  1DGR M;  2Z16 A;  4RM2 A;  3K10 A;  1D0Y A;  4YZ0 A;  4ZTF A;  4C2T A;  2M3A A;  4F91 B;  3GVJ A;  3GRH A;  3OYM A;  1QHH D;  2F6C A;  3GBG A;  4NUB A;  1W0K A;  2AQE A;  2WAD A;  2WY8 Q;  3MD2 A;  4LG3 A;  2R7Q A;  3UW0 A;  2VQL A;  1DBO A;  2KPM A;  3QOD A;  4BEH B;  2IS6 A;  1VF7 A;  3HAG A;  4BU2 A;  3AL0 B;  3BCB A;  3FDY A;  4ZDO A;  1LFP A;  5HKK A;  4F52 A;  3LFU A;  3TL4 X;  2X1D A;  4DJA A;  4BE2 A;  3OOC A;  3OY9 A;  4B47 A;  2ZSH B;  4OJO A;  3TMO A;  3D5L A;  4BGD A;  1W36 C;  4URR A;  4ZJZ A;  2W6J A;  3LNN A;  4ANJ A;  4KIT B;  3OIP A;  1V0E A;  3IP4 B;  2XC7 A;  3KRG A;  3LMW A;  1YX3 A;  2JA2 A;  3DU5 A;  2BSP A;  1KON A;  4G7W A;  3HXL A;  2HQA A;  1QHG A;  2XAU A;  3B90 A;  4P22 A;  1MNE A;  2E5Z A;  3PUB A;  2R7S A;  1D1C A;  3I9V 2;  3OS2 A;  1UG0 A;  3E1S A;  1G59 A;  2F43 A;  5KHD A;  5C1E A;  1UD4 A;  2KRC A;  2KZV A;  2AQF A;  4PSW A;  4HST A;  2LZJ A;  1IA5 A;  2LY1 A;  2V31 A;  2ZSI B;  1P9Q C;  1EA3 A;  1LVK A;  3ZRG A;  4AYB A;  4D1Q A;  4BXF A;  1K5C A;  3SDB A;  4DIQ A;  2O04 A;  2X6W A;  2CV2 A;  2NSP A;  2MD0 A;  2HVQ A;  3IUO A;  2DJI A;  2HDW A;  3H5R A;  4D9J A;  3W2A A;  2INV A;  4XLA A;  3BC9 A;  4Z05 A;  1V5F A;  1Z3Y A;  2I8D A;  4LIT A;  4IX7 A;  2CMP A;  1UD2 A;  3VYT B;  3K4L A;  2VPL A;  5HNH A;  2VQC A;  4HPQ A;  2ZZG A;  2IGM A;  3OEE A;  4YXW A;  4OJ6 A;  2V6E A;  1EE6 A;  2E1M C;  1KMH A;  4II2 A;  5KCM A;  2GJP A;  1SAU A;  3T51 B;  2IXS A;  5TGT A;  4F3Q A;  1SFK A;  2XSJ C;  3HL2 A;  3DKY A;  2X1C A;  3DEE A;  2JJ1 A;  4BDZ A;  1E3Z A;  4RMN A;  1RU4 A;  2QKM B;  4BJ5 C;  2WJY A;  2WB1 A;  4C9Y A;  4CZC A;  3JUR A;  4PSX A;  1K28 D;  1SKY B;  3KEW A;  2WAF A;  4KJZ A;  1QU3 A;  3CJR B;  4BUP A;  1DQU A;  4PJJ A;  5FRO A;  5IK2 A;  3OS1 A;  2GJK A;  2F5V A;  4ZDL A;  1FMV A;  1O88 A;  3ZIA A;  4CUG A;  3K6G A;  4FAS D;  4N4N B;  2KHM A;  3BCF A;  1WFX A;  2IGK A;  1WPC A;  4IQ4 A;  3DQV C;  3CZ6 A;  2V9K A;  2V7Q A;  4E0F A;  2L9S A;  2UVF A;  1G8X A;  3VMV A;  3K4K A;  3S32 A;  3K4M A;  2LH9 A;  2WA0 A;  3H94 A;  2V4D A;  2HVR A;  2PYG A;  1U0J A;  4MXN A;  3E0J B;  4BAC A;  1VLY A;  1X4O A;  4XN0 A;  3JU4 A;  3PNV A;  1E1R A;  4HRI A;  3T53 B;  5JHF A;  1X19 A;  4B3X A;  4CCJ A;  1NRK A;  4U4B A;  3T9G A;  2XDV A;  3W2V A;  2R7V A;  3BC8 A;  3RPU D;  4IQJ A;  2UWM A;  1UAA A;  1VJS A;  2M5S A;  2XGJ A;  1R6R A;  3OPO A;  1DBG A;  2JIZ A;  4YEL A;  1KCC A;  4XON A;  3S3M A;  5CDF A;  2K9M A;  2X51 A;  1MMG A;  3DPL C;  3ZXS A;  3OW7 A;  3VYS B;  5HVQ C;  4B3F X;  1X1C A;  1W9X A;  3A35 A;  2HPM A;  3G05 A;  1UD3 A;  5FRM A;  3A4C A;  4UZU A;  3VSV A;  2VKD A;  3VSU A;  1NG7 A;  4BE0 A;  1O8F A;  4DNR B;  1QCX A;  1I18 A;  2WAE A;  3L2W A;  2WJV A;  1BMF A;  3A3G A;  2X6Y A;  2XF5 A;  5HNF A;  2GK7 A;  2Q1Z B;  3H9Q A;  3LSI A;  2Y0S A;  2VXD A;  2IS4 A;  3N05 A;  2O17 A;  4NK8 A;  1UD8 A;  2LYC A;  2IGO A;  2JVG A;  1WP6 A;  2LOO A;  1AA7 A;  2DT6 A;  3S93 A;  4XKV A;  4CCK A;  2MAB A;  3D5S C;  3K4N A;  4FXU A;  3DTI A;  4PMH A;  2VXZ A;  3LL7 A;  4RLQ A;  3OS0 A;  3OYN A;  3OIQ A;  1OLT A;  3ZPP A;  2GOM A;  1TT0 A;  4MLO A;  4XOR A;  4BJ6 C;  1PXZ A;  1KCD A;  4XOP A;  3A1Y A;  2Z8G A;  2VKH A;  2CV0 A;  2L9N A;  2KQR A;  4XKW A;  3EUK L;  4XKC A;  2O0V A;  1H8E A;  1BHE A;  4XN3 A;  4R79 A;  4HWV A;  2IGN A;  1BR4 A;  4YZA A;  2GOX B;  4PFO A;  3W3C A;  5LD2 C;  1UD5 A;  1XG2 A;  4E7K A;  2KP6 A;  2L7K A;  1W0J A;  2PJR A;  3OYI A;  2DCE A;  2RNG A;  4W8Q A;  4XR6 A;  1WMR A;  4DGW B;  2OUM A;  3GQ7 A;  3ONQ A;  4MR0 A;  5CQG A;  4DOZ A;  4XNF A;  2HNH A;  2W00 A;  2VB6 A;  1O8L A;  3AFH A;  2MC4 A;  4J01 A;  4TSF A;  2HU9 A;  2JDI A;  2KMU A;  3HC7 A;  4LIV A;  1DP3 A;  3OWT A;  3SUC A;  1VZ0 A;  2K5C A;  4BS9 A;  3OYJ A;  4OZZ A;  3L2U A;  2CH0 A;  1VBL A;  3DTK A;  1PLU A;  2XZO A;  4ZYA A;  4CCN A;  3DU6 A;  2VAS A;  2JJ2 A;  4KKS A;  2EWE A;  4IKF A;  4BJT A;  4F55 A;  3PL8 A;  2HLD A;  2HPI A;  3MKZ A;  2R4G A;  1WJF A;  2WSS A;  1W36 D;  2ZXI A;  2WPD A;  3SYT A;  2Z2S B;  1BR2 A;  4Z06 A;  4CSW A;  2X1E A;  1MAB A;  2ZZE A;  2PYH A;  1OGM X;  4PFP A;  3HUG B;  2M4K A;  4J00 A;  1JTA A;  3OYC A;  3FKS A;  3CP8 A;  3EUA A;  2JSP A;  4OAY A;  3VDX A;  3A3B A;  1PJR A;  3OL4 A;  3BCA A;  1NBM A;  3OEH A;  1OOC A;  2NTB A;  3MMY B;  3W2W A;  4KIS A;  1E0E A;  1MMD A;  2CW8 A;  2BW3 A;  2W4S A;  3D5R C;  2R7T A;  2LBF A;  4W8T A;  3AKZ A;  3WWG A;  4E6K G;  3PFY A;  1X1A A;  2KDO A;  2DXI A;  4NK6 A;  1N78 A;  3OMY A;  2UV1 A;  3BG6 A;  3UNG C;  3GQA A;  4PK4 A;  4W8R A;  2VL8 A;  3OYG A;  1UD6 A;  4XLF A;  2VIX A;  3I3L A;  3M1C A;  3PNY A;  2MYS A;  2WAQ A;  2VJ5 A;  3H9G A;  4QPO A;  3G2B A;  1MMN A;  3HKZ A;  3RCO A;  4XLC A;  1WJ5 A;  2W1O A;  4C2U A;  4NC8 A;  3OYL A;  2VLA A;  3CES A;  2X3H A;  3S3O A;  1D0Z A;  2A5W A;  4QPQ A;  3KYL A;  3K70 D;  4ASU A;  4ZDP A;  2ZTG A;  1H8H A;  4PJM A;  4E7L A;  1O8D A;  2R9V A;  2X85 A;  3NWS A;  4Z03 A;  3B4N A;  2ZFU A;  2W6I A;  1IDK A;  1V5E A;  2LBF B;  3MKW B;  2JUG A;  4XM3 A;  1O8I A;  5C1C A;  4KKT A;  2WZP P;  4OJP A;  1LDK B;  3AL0 C;  1CZF A;  4U7B A;  5CPR B;  4PJL A;  3S8P A;  2R7U A;  4B48 A;  4KT6 A;  3NWT A;  2HVS A;  5HLT A;  5DN6 A;  3OYE A;  3QYB A;  3NE5 B;  1BN8 A;  3MKY B;  2VBK A;  3PJR A;  2WY7 Q;  4XLH A;  1UEL B;  2CUJ A;  2RRE A;  4BQO A;  1O8G A;  3IAS 2;  4JMQ A;  2CFO A;  3ZQQ A;  4Y33 A;  3U21 A;  3DDY A;  3B8Y A;  2LG4 A;  1S9H A;  2ZXH A;  3PSF A;  4PJN A;  2Z1D A;  3EPZ A;  2IQ7 A;  1NHC A;  1V0F A;  1WJD A;  1YE9 A;  1OR7 C;  3WQZ A;  1N77 A;  3L2Q A;  3LSH A;  1BLI A;  2R7W A;  1KZL A;  1WJB A;  2F4I A;  1E43 A;  1HZE A;  4CH7 A;  3TBI A;  3BCD A;  1O8J A;  2M7A A;  3LSG A;  2E1M B;  2E1B A;  3ZGK A;  3EQN A;  3L2V A;  1ERD A;  4BE1 A;  4EW9 A;  3LSK A;  3VWB A;  2UUZ A;  1E3X A;  1BPL A;  3FY3 A;  2FUG 2;  2P0W A;  2X6X A;  1T0F C;  2XF6 A;  2XZL A;  1H80 A;  2VBM A;  3RQ4 A;  4IZZ A;  4Z1M A;  3CMM A;  1IRX A;  4OAZ A;  2W82 A;  3QYE A;  4N4O B;  5FL7 A;  3DWL E;  3KX2 A;  3FKJ A;  3OR2 C;  2K9L A;  3CP2 A;  3H9J A;  4BQQ A;  3OYK A;  1GLN A;  2VQH A;  4OJ5 A;  3IAM 2;  3SEQ A;  4DBR A;  1HA8 A;  1OB0 A;  2QE7 A;  1KTW A;  2NT6 A;  3BH4 A;  2IS1 A;  2NZM A;  4CA0 A;  3HPG A;  3GVK A;  3OFN A;  3GQB A;  3K4J A;  2GK6 A;  2ZZF A;  2NST A;  4XL9 A;  3QOE A;  3DPT A;  3V42 A;  3ZPN A;  2E5N A;  1RMG A;  4E4H A;  1MMA A;  2ZZQ A;  4DK1 A;  4P1W A;  4II3 A;  1MND A;  2L5Q A;  2KLO A;  3F9K A;  3VYU B;  2WBM A;  1Y56 A;  3OYF A;  2KVO A;  4TKO B;  2O1D A;  2ODL A;  1EFR A;  1PYV A;  3CF2 A;  3L2R A;  2A6T A;  2ZTN A;  2M4G A;  4GQN A;  3OL3 A;  4E7I A;  2PEC A;  1D1B A;  3FBN B;  3DTE A;  3OOU A;  1BOB A;  3VMW A;  3M8J A;  3BLY A;  4DBQ A;  3OYB A;  1T5E A;  4HIZ A;  4DK0 A;  2VQG A;  2VBE A;  1E1Q A;  3H5A A;  2O0W A;  2D3N A;  4G6T B;  4AVZ A;  1JI8 A;  2BVL A;  4PUS A;  1COW A;  2BOL A;  2QX3 A;  4OJL A;  1D0X A;  1Z3X A;  3RSN A;  4B44 A;  2E60 A;  2PJR B;  3OYD A;  3UR3 C;  1WJC A;  1OHH A;  2VJJ A;  4YZQ A;  4XMY A;  1V5G A;  4XOT A;  4HSR A;  1IB4 A;  3PSI A;  4NQW B;  4W8S A;  4RLF A;  2XZP A;  3T56 B;  5FRN A;  3EUH C;  4H4K C;  2X8K A;  4NC7 A;  3SZG A;  4HNT A;  2CV1 A;  4XD7 A;  3C2H A;  1O8H A;  2L2O A;  1FX0 A;  1OFL A;  2CW7 A;  1PE9 A;  4E7J A;  2QY1 A;  4YRV A;  2NOJ B;  1O8E A;  3HOT A;  4FET A;  4C30 A;  4OWR B;  3ZCO A;  4I84 A;  4X0G A;  2IS2 A;  1WTH D;  3QYF A;  4P5O A;  3OYH A;  2VJI A;  3LMM A;  1QJV A;  2RQQ A;  4JOM A;  3GQ8 A;  2BVM A;  4KKU A;  4B3G A;  4XQF A;  2NT9 A;  3KEY A;  1Y6I A;  4BL0 B;  5KNL A;  3K70 C;  1X4P A;  2OV7 A;  2XOK A;  4ZC3 A;  2NTQ A;  1K6Y A;  1FMW A;  3DLA A;  1WJE A;  1AIR A;  4E7S A;  2KRH A;  2K3P A;  2R7X A;  2PMZ A;  1IDJ A;  2VJ4 A;  5CQE A;  2M7B A;  1GQ8 A;  1O8K A;  1J09 A;  2D3L A;  4CCM A;  4XLE A;  2ELJ A;  4DNT B;  4U49 A;  2BW3 B;  4E7H A;  1YX5 A;  2MFZ A;  3K4B A;  1O8M A;  4G7X A;  3OYA A;  5LFA A;  1HG8 A;  1NG6 A;  4XKB A;  2LRE A;  1TZL A;  3BG7 A;  2LY2 A;  5CKT A;  4Y4R A;  2V7F A;  2R7R A;  4BQN A;  3A2K A;  2F1M A;  4L8J A;  3DKX A;  3C2G A;  2UVE A;  4OZY A;  3H5N A;  4JQF A;  3OR1 C;  2Z6B D;  2LC2 A;  4RM3 A;  3VSK A;  1RWR A;  3VSL A;  3S3N A;  3VR6 A;  3DPU A;  3SEZ A;  4BDY A;  1HVX A;  2XND A;  2XF7 A;  2HZD A;  1OGO X;  2INU A;  4HEA 2;  2JVH A;  2QKL B;  1I8D A;  1D1A A;  1ZEL A;  3CJQ B;  4ITV A;  2GJR A;  1DGW Y;  2KL4 A;  4Y3O A;  4CCL A;  5AMV A;  2V1N A;  4C2L A;  4HNU A;  4YZX A;  4CCO A;  3LSM A;  3VST A;  4AU7 A;  3GVL A;  2DOA A;  1BR1 A;  2W7N A;  3FPP A;  2M0M A;  3ZSC A;  1LKX A;  2V4J C;  1E79 A;  3HOS A;  3HG9 A;  3OE7 A;  4G6I A;  4EAT A;  3HPH A;  1MW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...