2VJIA

Tailspike protein of e.coli bacteriophage hk620
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Escherichia Coli Phage Hk620 Tailspike: Podoviral Tailspike Endoglycosidase Modules are Evolutionarily Related.
pubmed doi rcsb
source organism Bacteriophage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN
total genus 229
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vjiA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2vjiA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vjiA02
4XLCA 1O8FA 4XOTA 3B90A 4MR0A 4XM3A 4U49A 4OZZA 4XLEA 2QY1A 4YZAA 4W8SA 1H80A 4HWVA 2O17A 4XOPA 5C1CA 1CZFA 4W8TA 3VSUA 1OGOX 4XKWA 2X3HA 4YZQA 4C2LA 4XNFA 4AVZA 4YZ0A 4URRA 3VMVA 4OZYA 3VSVA 2VBMA 2NT6A 1WMRA 3GQAA 1O8HA 2VBEA 3EQOA 3FY3A 2O1DA 2Z8GA 4OJLA 1RMGA 4YEJA 3LMWA 1PE9A 4U4BA 4XLAA 1QJVA 1OFMA 1O8MA 1O88A 1IB4A 1O8EA 2INUA 1DBOA 1OFLA 1KTWA 1O8JA 1RWRA 4YELA 3T9GA 1BN8A 4XLFA 1O8DA 4Z03A 1K5CA 4OJOA 3VSTA 1EE6A 2X6XA 2NSTA 3GQ7A 2NT9A 3JURA 3KRGA 4MXNA 1O8LA 1NHCA 4XR6A 1AIRA 4W8RA 2X6YA 2NSPA 1KCDA 4XONA 2X85A 2UVEA 1JTAA 2X6WA 2QX3A 4OJPA 2NTPA 4XLHA 4XQFA 2INVA 1O8GA 1KCCA 2NTBA 1DBGA 1OGMX 4NK6A 1QCXA 3SUCA 4PMHA 1PLUA 2ODLA 3ZSCA 1RU4A 5C1EA 2NTQA 4YZXA 1O8KA 1BHEA 1IDKA 4XN3A 4XORA 2UVFA 4I84A 1IA5A 1XG2A 2PYGA 2PECA 2PYHA 1PXZA 3VMWA 2O0WA 2O04A 3GRHA 4OJ6A 4EW9A 1VBLA 1IDJA 5AMVA 2VJIA 3GQ8A 3B8YA 4OJ5A 2VBKA 2QXZA 4XN0A 4W8QA 3EQNA 1OOCA 1X0CA 4NK8A 2IQ7A 4Z06A 3ZPPA 2NZMA 2O0VA 2BSPA 3GQ9A 2VJJA 1O8IA 1JRGA 1HG8A 3B4NA 4XL9A 2EWEA 3UW0A 4XKVA 3WWGA 4Z05A 1GQ8A 4XMYA
chains in the Genus database with same CATH superfamily
4IJAA 3B90A 3N90A 2BM1A 3GVLA 2BSAA 3CDIA 3K2ZA 3K4CA 2ACJA 1AMOA 4CQJA 2CS3A 3OEEA 2A6TA 2PG4A 2VT3A 4E7IA 2R7XA 4P26A 1BR2A 1T95A 2O8KA 1Z1DA 1MGTA 1WORA 2IA1A 4W1UA 3MEXA 2DJNA 4E7LA 2GJKA 3GTGJ 2P5LC 3VMVA 2L9RA 3H9GA 4ENJA 5D8KB 2DMQA 2VBMA 3BR6A 1QUFA 4A69C 1R4NB 3SJMA 4C3JJ 1BI3A 4ZYHA 2LD5A 9ANTA 4HG2A 1T56A 3OYBA 4L5EA 2Z9OA 4CCLA 1ZR2A 2E60A 1HDDC 1LKXA 5CKTA 1QZYA 2E1CA 3IAM2 2QQAA 5B1BH 4DQKA 2P8TA 1YJWB 5DEQA 1BL0A 1HBXG 4NC8A 4Y13A 1ZGWA 3RY8A 4OOXA 4RB1A 2IS6A 1Z77A 5E20A 1YHQB 2FOKA 4L5JA 3S1NJ 4KISA 5L3GA 1K4ZA 3OYHA 1W5CC 1TVCA 1QH0A 1R1UA 4A6DA 5DD8A 4B4CA 3FHZA 1O3TA 4C2TA 3AK5A 1JTAA 2VQCA 3CCSI 3GSIA 4BDZA 1YW8A 3A02A 2JJ1A 4Y9UA 4NBQA 4RS8A 2HEOA 4IHWA 2A6EF 4HSRA 1DUXC 4DNCA 1LLZA 3KX2A 2D2WA 4M4SA 2NTBA 4J00A 1EKEA 3WGHA 1SMTA 4RD1A 5FO5A 1GXPA 1XMAA 1E79A 3IL2A 3ZSCA 4OMZA 3GIRA 2IW5A 1GO2A 2LP0A 2DOFA 5FNZA 3OYAA 1EFTA 3KYDB 3CRZA 5ED4A 2VLAA 3BP8A 1ZRDA 4LFUA 4P6YA 1QFJA 1I18A 3SJZA 2VN2A 1R5ID 1XGOA 1AWCA 3DCFA 1MBFA 2GM4A 3I4NJ 2YPRA 3G2BA 5DCMA 2VJIA 3K70C 3SXYA 1N78A 2Y0MA 3HUGA 3JRIA 3HOSA 3ZMUA 3F8CA 3CMAI 3ECHA 3NB2A 2CFOA 1K78B 3I0TA 1H9GA 4XN0A 2J5OA 5AN9A 2ZNZA 2W6IA 5HODA 2WR8A 4YHBA 1UG2A 2FNPA 3MZ8A 3GMEA 2K9SA 3E3VA 3DKXA 4IL6C 3S17J 3H0DA 2O7OA 4L8JA 3ZPPA 4UUTA 3AVUA 4YC5A 3ERMA 3U6BA 3UW0A 2HQ5A 1J09A 2A61A 2HS5A 2LKPA 4Y33A 4A3IJ 1UD5A 4AIDA 4BH9A 3HOWJ 2GQFA 2BE5F 2JIZA 2EZKA 1GVHA 3CUQB 2STTA 2DMPA 5KVRA 1QG0A 3WQZA 3RKWA 4IPAA 1X19A 1Q9SA 1XMXA 4ZC3A 2DERA 2RC4A 4X1EA 1YJNI 2M7BA 3SZTA 5J1YA 2MC3A 2EIKH 1HKQA 2NNYA 1BN5A 2C5BA 2F5CA 4X0CA 1E3XA 1H8HA 5JLVC 3OYJA 3FM3A 4Y15A 1U5TB 3ONQA 4FE7A 1MJAA 5GAHJ 3M3YJ 5EEAA 5HKKA 4E4HA 1F5TA 1HA3A 1F36A 4IRHA 1FNBA 4RCZA 3AVTA 3HHGA 1K73D 1ETXA 1I5ZA 3L9FA 1U8BA 2NT6A 2JWTA 3PSFA 4BACA 2F4OB 5F04A 5D4SA 3G71B 3GQAA 2KHMA 2UZKA 1W0UA 4UUSB 3I71A 2HVRA 1OMIA 1RMGA 1G7RA 3ZZUA 2FU4A 3QQAA 4BQNA 2AO9A 3OSFA 4O3MA 3R0AA 1E3PA 2QBYB 1TW3A 1WRJA 3HRUA 3M8JA 3OKXA 2Y75A 2E2JJ 4G6IA 4E70A 3K2AA 5IYQA 2KIQA 2H94A 4TKOB 1X2NA 1LDJA 2OZ6A 2KRFA 4M3BA 1TWGJ 4UVCA 2QEXB 1RESA 2CYYA 4DYQA 4A5MA 3ASNH 1VI0A 5D6EA 1USSA 3K1PA 1T6XA 5F27A 3K1MA 2C2WA 1LB2A 1JJ8C 2VBTA 2E35A 2R7VA 2IOUG 1XX5A 3MHPA 2ZJQF 3CPWB 2IS2A 3LSRA 3OAAA 4FE4A 4X7EA 5H6QA 1P92A 1NH3A 2NV4A 1DARA 5DSZA 1ZK8A 1ZM2A 2YU9J 1ZRCA 3DDYA 3FF5A 4YG2F 2VODA 3K4BA 4IHTA 4V19K 2C77A 2NTPA 5C44J 3MQ0A 5FJ8J 2ZMEB 1B8IB 5JMCB 3ASTA 2QQ8A 4AIKA 4AF6A 1EFCA 1JTXA 3OPOA 3LSTA 4YCQA 1SVMA 5K7FA 2KZVA 4WZKA 3BZKA 1G3SA 2W4SA 1V5VA 3ZPNA 3OL3A 1Y8RB 5F6FA 1ACIA 3I4PA 5EG0B 2NVTJ 2C4TA 1TT5B 3ASOH 2GWRA 3PNTA 2V1NA 1PUEE 3NQOA 4EJUA 1ETKA 3JSOA 2FMYA 3WODF 2CH0A 3FKSA 4NUBA 1B59A 1GJRA 1QNTA 4PC3A 3T8TA 4NQWB 1MDMB 5GAGJ 2O3FA 2HLDA 2NS8A 4IO9F 1KK1A 3W5VA 2IGOA 3E20A 1KQSB 3CJTB 1Q86D 4B48A 4M0LA 4OINF 2LF8A 3REOA 1YI2I 1VHEA 1BOAA 4PFOA 2VQGA 1YS6A 1HF2A 3GZNB 2HNHA 3ZQLA 2B9SA 4UAJA 3PUMA 2NS7A 2KVOA 1JT6A 4YAWA 2CW7A 4HOBA 1CF7A 1ZM3A 3C7JA 2LY2A 4HYEA 3DTKA 1RUOA 2NVQJ 3LO8A 1HA8A 4KDPA 1VQ8I 3BG7A 4MNUA 1H85A 1FNCA 1LDKB 4X7CA 1WJEA 1O57A 1QO0D 1T0FA 1IUFA 2OTLI 2FBHA 4M73A 3BROA 4MTEA 4GQNA 2GA2A 2ME0A 2UUZA 3Q3AA 1FSEA 3BCAA 3TGNA 3V8LA 3E6DA 4A3GJ 4YZAA 2ZZFA 1HC8A 3CCUI 4V02C 4JX5A 3CXCB 5H6RA 4CZCA 1FBQA 2M34A 2XROA 3WNBA 5L46A 3AVVA 2OBTA 1PP7U 3GVKA 4DIQA 2FXAA 4LG0B 1JA1A 2GAUA 4XRSG 1VQMB 1ETVA 2F4NA 2QSHX 3K9TA 2DFEA 2ECCA 4BNCA 3FMSA 2JQ7A 1I7PA 5FROA 2XC7A 5IYPA 1GT0C 1VQ6B 1O8HA 3IKVA 3M8FA 1ELOA 4V2FA 1ZTRA 4LITA 4OJLA 2PQ8A 4ZCMA 4RB0A 5J6XA 2I10A 3CZ6A 1YHQI 2A07F 1LUJB 4KA4A 1OFMA 1A8PA 4KT5C 1JKOC 4YXWA 3V76A 3Q0VA 1FRNA 1BM9A 3NWSA 3TH0A 3J7YJ 2FBKA 5IK2A 4HBLA 2MC4A 2H8RA 4F7DA 2QKMB 4BJ6C 5E1XA 2BXYA 3RSNA 1RR8C 2VKEA 5A2QK 4C9YA 4I98B 1EXMA 3ROUA 3DU6A 4M9XA 2CNDA 2M5WA 5J4VA 1T98A 2JPCA 4W8RA 1QA2A 2P6TA 2DA2A 5E1ZB 5BOXA 4KITB 4TT3A 4E0FA 4QWQA 4HX8A 3U9GA 1J9ZA 2LY9A 3ESWB 2VL8A 5HNHA 1VQLI 1W4MA 1GAQA 1WDTA 3H1CA 3W2EA 2XGEA 3H5AA 3BR3A 1H8EA 4OU0A 5E3OA 2VBSA 1SVLA 3GTOJ 2LY1A 2M4KA 2W85A 4G6QA 3T53B 1K83J 3KP2A 1MJ9A 1S29A 3EPZA 4KFCA 2ADUA 3DWLE 2CK3A 1KCCA 1H89C 1LVKA 2WZPP 2R7DA 4I0AA 3I59A 3PA1A 3VO2A 3E0JB 2KRCA 5LHHA 3RKQA 4YZXA 5GP9A 4XN3A 2LOOA 1APLC 2CC2A 3CC2I 4KKTA 1X58A 4MHGA 5IOZA 5HLGA 4CUGA 1D8TA 2O0WA 3KP3A 1B8IA 1JI8A 2CQQA 2HTSA 5HVQC 2F1MA 1F20A 1NHAA 1POGA 5IPAA 3FPPA 2HVQA 2JA6J 3IUOA 4HF2A 1VQ5B 1J75A 4N4OB 1KQ5A 4LK1F 1R1VA 4Y4RA 4PSXA 2ZXHA 2P4WA 4DQ2A 1X2MA 1XSVA 4CCOA 4G6DA 3WU1B 4A3EJ 2JVHA 3SLNA 1X0CA 4G6TB 4S05A 4RA2A 3GTJJ 1AU7A 2GQQA 2HDDA 1K9MD 3FX3A 2OV7A 3BQYA 3CCLI 1O8IA 1L3LA 2XAUA 5C3EJ 1XQBA 2QVOA 1CLWA 2XNJA 3ES9A 4I99C 3AGQA 1FZPB 2BN4A 5LHGA 2DMTA 4RM3A 2NOGA 1F9NA 4HIZA 3GZ5A 4P22A 2DU9A 4UVBA 3ELKA 3OYCA 3HAGA 4AYBA 1TNSA 3KP6A 4XRMA 2HYJA 2C6YA 2HKXA 1HZEA 3K4NA 1Y0RA 3COAC 3GFLA 4BKXA 5K7ZA 4XOPA 5C1CA 1R5BA 4ZGNB 3AAFA 1XPXA 2EH3A 4N9IA 1ZGJA 2RC6A 2DQRA 2ESNA 2XKPA 5TR9A 1LVAA 5E1WA 1ZM9A 4DNRB 2QA4B 1MIJA 3AL0C 1YE9A 2PMHA 3W5UA 1H42A 2QUFA 5IP9J 2BGCA 4C0SA 3HOXJ 4GFBA 2XB0X 2FNAA 1EF4A 3ZC3A 3QU3A 4G1VA 3GWZA 2XUBA 1QGPA 3M7GA 3MZYA 2V6EA 2BOLA 2QLZA 1MMSA 4D1QA 4N3NA 4EJWA 3IH2A 2ZTGA 2D5VA 2V9KA 4ZDLA 1T38A 1T6ZA 1MSFC 4RD2A 3OEHA 4WXCA 2IJLA 1OCRH 5L3EA 2ISZA 4RLFA 3I55I 2HOTA 2Y9YA 1E1QA 3HC7A 1STZA 5IP7J 2MYSA 3GF2A 4DZJA 3VWBA 1U9NA 2IGKA 2ZBUA 4P3IA 3SY2A 5HS9A 3FPKA 2X6XA 1Z6RA 1SAXA 3JURA 2O8XA 1UELB 1YG2A 4QVAA 2E1MC 4WK8F 2DA7A 1IRGA 2BW3A 4NCNA 4Y7NJ 1ENHA 2HTJA 5F1JA 2R7WA 4XONA 4J01A 3P27A 1Z67A 3LJYA 3WU2C 4FETA 4LLGF 1KK0A 2XAGA 1XGSA 1XB2A 3LFUA 4OJPA 2A68F 2ESHA 1QZZA 1DGWY 1BI0A 3SFIA 4P2NA 1VLOA 3CCQB 1TZLA 4QUZA 2EFQA 3W6VA 4Z4WA 1DPRA 1K8FA 4NBSA 3CD6I 1HW5A 4KJZA 3KYCB 2NNNA 2B7EA 1B6AA 1WJDA 4D9JA 1SMYF 4ZYDA 4LG3A 1QCXA 1TWAJ 3F8BA 3S93A 4BU2A 2VBVA 3SUCA 4PC2A 4B1RA 4G7HF 1ZG1A 2BMWA 2ZJPF 3BQJA 4XD7A 1EA3A 3JAMZ 5J47A 1IAWA 1PJ7A 2M0MA 1VHOA 5FKKA 5J8FA 1Y39A 4TMWA 1J7KA 2PYGA 3P7NA 3WTTC 2OUMA 2ZKZA 4LD5A 1IV8A 2LG4A 5LLQA 2V26A 5ICCA 1BI2A 2W1OA 2RKHA 4PJLA 3WBKA 3ECOA 3QOEA 1Z3YA 5GTHC 3I5UA 4OJ5A 4LGWA 1FNNA 4KIFA 4CA0A 5GPCA 4YFOA 2XTYA 1OYIA 1RQPA 4BY7J 4EM0B 3BCFA 1GUUA 4FISA 2QQ9A 3VR6A 5DNSA 4JK1X 3X2QH 2NS0A 3GLXA 4BJ5C 2A5WA 3D5SC 1V5FA 3L09A 5L3CA 2C4UA 1W87A 4PABA 5FLXK 2PX9A 3RQ4A 1FX7A 2IQ7A 3LSJA 4II3A 1H9TA 3AL0B 5IT9K 2MLKA 3QAHA 2GXBA 4HE6A 1FTTA 1X1PA 2M9HA 1H88C 2VYQA 2HXOA 1QA1A 3R6JA 3R4KA 4B09A 1ZREA 3GQBA 5KW9A 3CC4I 1E43A 5EDNA 5L3BA 3F22A 3NAWA 1IW7F 1NG6A 2OPTA 5GTIC 3A03A 1W9XA 1CZFA 5BPIA 3S32A 3RKXA 1BJAA 2ZXJA 1KQ8A 1S7AA 5CQGA 1YTYA 5AIPA 2B63J 1W0KA 3A0HC 3HHHA 4UXNA 3CCMI 4MLOA 3BR5A 4HQEA 1DPUA 2JT1A 4NC7A 4H0EA 1Q82D 2PI0A 2DMNA 1FYMA 5M3FJ 2X6OA 1PUFB 3ZQGA 1TYVA 1G3WA 1B72A 3OYDA 3V7AA 3T8RA 2VC1A 3G1LA 2WJVA 1D1NA 1V0FA 3IP4B 4TMTA 1TTYA 1VQKI 5DM7F 3E7LA 2INUA 2M30A 4FX4A 2DDAA 4Z2YA 2VFQA 4MIMA 1VQOI 4LB5A 1YX5A 1K4TA 2NPFA 3D5RC 2UXNA 3P9IA 2FE3A 2A6HF 4PZJA 1I50J 3P26A 4XR6A 2BY3A 2Z3YA 5CDFA 2WAQN 3KEYA 2DOAA 1ORKA 3A2KA 1ODDA 1UD2A 1I1GA 2HQRA 1VF9A 2GPJA 2QX3A 1VQ9B 1D2EA 2DPUA 3IRQA 2JTVA 2M4GA 4DNTB 4QHYA 1V54H 2O5RA 4ZDPA 1LDDA 2LMDA 2D9RA 1MMAA 4RM0A 1T6YA 4CDGA 1U3EM 4NK6A 1WPKA 2L4MA 1K8AD 4PCQA 2MH9A 2Q6KA 4MYTA 2QEXI 3CCVI 3FMQA 1FSHA 3C3WA 4I0BA 4XK4A 4S0HB 3E5QA 4XKBA 2FD5A 1N07A 2UVFA 1N8RD 2XKOA 3ZXSA 2NOJB 3OFNA 4UNOA 1S7OA 3N4MA 1Z9CA 4F3QA 1K4SA 2IT0A 1EFUA 1OFEA 2JPBA 1O7LA 5C4JJ 4FK8A 3K69A 3PETA 1B9NA 2K86A 4ZJZA 4WZEA 4AC0A 3EQNA 3CJNA 5JR3A 3CCJI 1VF7A 3H3VK 2RDPA 3LNQA 1SD5A 5K5QA 3M1CA 1S4MA 3CC2B 2QQBA 2DT6A 2ELHA 4Z1MA 1RZ4A 2NZMA 1RRJA 2VT2A 2KLOA 4UZUA 2BY2A 2CUFA 1BPLA 3ABUA 5CJ9A 3TOAA 2KDOA 1LFPA 2R7UA 2QYOA 2WPDA 3B73A 1TYUA 2R6HA 3A1YA 1AKHB 2OQGA 2XSDC 1W34A 3KYLA 3MKWB 3IAS2 3BOQA 3RI4A 3AGPA 4XOTA 2MSYA 4LIUA 1G4DA 3D0SA 3J80K 1P9QC 3LSIA 3OW7A 2VKDA 2KIFA 4Y3OA 1OB2A 1SFUA 3E5XA 1XB4A 3HRSA 1GAWA 4N0BA 2VZLA 3G1OA 3TO7A 3AG4H 3GTQJ 4UZEA 1OGOX 2PEXA 1FPQA 3BH7B 3WTXC 1I3AA 1Y1VJ 2WWYA 2X9DA 3ZR8X 1ONVA 4G1BA 2ZMEC 3CMEI 2Z33A 1MMNA 2RREA 3PNYA 3PIOF 1Z7LA 1MNEA 3T1BA 3ZBTA 4RGXA 4N4NB 1QX4A 2Q6IA 2GIVA 2ZMEA 1MBKA 2FRHA 2VBEA 5D5XB 2ZXWH 3EDPA 2Q1ZB 1BR4A 3DFGA 5DYMA 2I8DA 3WTSC 1E64A 4RAYA 2VPLA 2RV8A 2XZLA 5LD2C 3VFZA 3ASRA 5EG0A 5CVJA 1RWRA 5FKOA 2ZL7A 1Y6IA 4YFKF 2AXLA 3OZWA 4I2OA 2W57A 5D5WB 1YJWI 4WXDA 1J0RA 5EJCA 1W1WE 2GIZA 2E2IJ 1BIAA 4O6JA 2GXAA 2YX7A 4G5GA 2K9LA 2ZBKA 3I53A 4F92B 3JU4A 2LBFB 5J1UA 3MWMA 5EGOB 1VQMI 2GLOA 2OTJI 4ZDOA 4HE5A 2X6YA 3KLNA 1TBXA 2OZUA 4IRGA 1ERDA 2K3FA 4BDYA 4HLYA 2BF4A 1J59A 1KZLA 4RBOA 1YIOA 1DGRM 2X6WA 3NRVA 2J8KA 3CESA 1W2BB 2LFBA 1HKTA 1J5YA 4LJZF 3L2RA 1VQPI 3MKLA 3QYEA 2Y2ZA 2DA4A 2Y31A 4F52A 3ZRGA 4U7DA 4JP0A 2EFWA 3F3XA 3S14J 1N25A 1IRZA 2CUEA 1FOKA 1D5YA 3F0CA 3FWEA 1WJFA 4IQ4A 2HKOA 4MGRA 1ZG3A 4UB8C 2QWWA 2TRTA 1IDYA 3DBHB 1RIOH 4ABZA 1TSPA 3O2PE 4M71A 1JNYA 4JX4A 4A3LJ 3GFIA 4JX6A 5LEKA 4BBSJ 4M2LA 4HQMA 1E17A 5GADJ 2AQFA 3F6OA 3K7AJ 5H2FC 4YAOA 2R0QC 3WTWC 4KIBA 3V7RA 1BX0A 3DTIA 1I27A 2KRHA 4LMYA 1E0EA 4Q4ZF 1YX2A 3BH4A 4BPRA 2QXZA 4OWRB 2DCUA 2MABA 1YIJB 2OTLB 1B9MA 4UV9A 3ZQCA 3B02A 5CYVA 2OD5A 3FDYA 5JI6A 2OAZA 3VOEA 1UB9A 1JUSA 1F1ZA 1XSXA 5TJJA 3CW2A 1GLNA 4Y17A 3PFIA 2DMUA 4M72A 1HG8A 2ELKA 1VQNB 2R7TA 3Q39A 1AHDP 1YITI 1OGJA 1DDGA 3WWGA 2EIJH 5IOYA 2NAZA 2X53S 4P1VA 1VQ7I 3CCRB 4Z05A 3VPRA 1B4AA 2P81A 5LFAA 1BX1A 1BOBA 2QM3A 2HZTA 2E7WA 4RAFA 2QSFX 2BM5A 2EJRA 2NYXA 5F0FA 4D5CA 3H5RA 2PMUA 1WJCA 1XFOA 1QRCA 3SLDA 1UCRA 4OPSA 4W8SA 5CVVA 2GK6A 2WA0A 3CC7B 1Z91A 4PAAA 1IRXA 2FOWA 4B3FX 2V31A 4FXUA 1MKMA 4IQJA 2LNBA 2XHKA 4LOCA 2XGJA 3Q6RA 1K61A 2UV1A 2RC5A 4A3MJ 2KL4A 1VJSA 1Z21A 4R1HA 1WMRA 2XAQA 1XS9A 5DUIA 1W7PA 5E3LA 1FBUA 3L7WA 2F5FA 3HKZA 1UAAA 2O9LA 3QPTA 5ICEA 2D1VA 1VQNI 4V2GA 1UHMA 1FMWA 5DS0A 1QJVA 3JRBA 1OCTC 1BC8C 3BJOA 1TLLA 3CMMA 1Z0XA 3CF5F 3KETA 4IXAA 1SFXA 2R7OA 2K7LA 1JUMA 5E18F 3MKZA 2GJRA 2XZPA 4OJOA 2L9NA 4ASUA 4M3EA 1JB9A 2WBMA 2VNHA 2XNDA 2V9VA 1YO5C 1MH3A 3JQQA 3WE2A 2V7QA 5IYDJ 4X8IA 3U6KA 3JREA 2F4IA 3KCCA 1EP1B 3RJPA 3A3BA 3GO5A 4X05A 3TQNA 1AIRA 3KE2A 3VNUA 1T8IA 1Q1HA 2WC2A 1A36A 2K5CA 5JVGF 1MH4A 4Z4UA 1XN7A 4OP7A 1SD6A 1UJ8A 2HWVA 2XEXA 2FUG2 2QZAA 3CCEI 1ZGAA 3IWZA 4RAGA 1KZHA 3SDGA 4BE1A 4P9UA 2FA5A 2CU7A 3KEQA 2W82A 4YFXF 1WHUA 1FLIA 3TEDA 1JXSA 2VOOA 2W24A 2LK2A 2YWHA 2HOEA 1D8JA 3F9KA 2X8KA 4MFEA 1IJFA 2QTZA 3ZCOA 4DZPA 3S2DJ 2EFOA 4KMFA 1OGMX 4Z6YA 1Y0NA 3L2UA 1IV6A 3BG9A 1QU3A 3ZN0A 2CGPA 1FBSA 2QZ8A 2VXZA 1UHWA 5F64A 1ZN2A 1U2RA 2KKOA 3BY6A 3V4GA 1XGMA 2OA4A 2LVSA 1FYLA 1KD1D 4IW3B 1LEBA 1DP7P 4A2UA 2ZJ2A 2IBDA 4M9ZA 4RDKA 3OYKA 3VDXA 2JA5J 3M4OJ 1PJ5A 3CO7C 2KFDA 1FEXA 2DJIA 2K9NA 4E7HA 1ON1A 5IT3A 4RPDA 4FT8A 2VBKA 3HYIA 1Y8QB 2K9MA 1CNEA 3RZDJ 2R4GA 5TY0A 2VFOA 2R5YA 1IDZA 2AQEA 3O8GA 3DXJF 5FRNA 3N05A 2DPDA 2BW3B 1ZM4A 1WJAA 2PMZN 3FBIB 4XL9A 2VBWA 3DEUA 1Q1VA 4F55A 5BMZA 4XRSA 2FJ1A 1OLTA 3TDZC 1YRNB 4OIPF 2CQKA 2R9VA 3LSGA 3CMEB 3BJ6A 2WAFA 4JBAA 2OTJB 1XDSA 4WF2A 5L3DA 1QPIA 2XTWA 4O5VA 2WV0A 2VUMJ 3W2HA 1YW9A 3QPHA 1QVGB 4PFPA 4GCVA 4UUVA 1O7FA 3S15J 2V7TA 4A12A 2XRNA 3HUGB 1OYWA 1KONA 3RPUA 4B8XA 5B5EC 3J81Z 4C2MJ 2EFNA 4RGUA 5FLVA 3K10A 1BIBA 2WAEA 3DBRB 1DQUA 1IN7A 3FXRA 3K4LA 5IYCJ 2E5NA 2JUGA 2CQ7A 2EV5A 2ME6A 2DO7A 2MG4A 1I1SA 4G94A 2YR2A 1RKTA 1WXRA 3OV8A 4ACBA 3I56I 3HOUJ 2Y0SN 2VXDA 4WWVA 2QGGA 5ILSA 3LMWA 1B1BA 2K85A 2WTEA 4PGHA 3NARA 5F0HA 4DK0A 1W7PD 3IV5A 4U9UA 3K4JA 4ZGQB 3ABKH 4E6KG 2ZJRF 1YLOA 1HKSA 1OCCH 5FFXA 5E8GA 4E7SA 3GTPJ 1IB4A 4NHJA 2XF7A 2BY1A 1P7JA 1U78A 1H0MA 3SEZA 3CCJB 1QHHD 1MABA 5D5UB 1TTTA 4HF1A 4M1KA 2CQNA 3BTIA 2F1LA 3ZIAA 4CYCA 1P7IA 3QE2A 4RD0A 2OK8A 2HCJB 4R71A 1TWHJ 2FF4A 3IC7A 4G9YA 1NHCA 1R49A 4DYCA 3MD2A 3DF8A 1JJ2B 3OIOA 4CCJA 1KU9A 3HG9A 3K6GA 4C30A 2ID6A 2H6BA 1IXSB 1SAUA 3IH4A 4A0YA 3JX8A 1Y56A 2ZITA 2EZLA 4UB6C 3M07A 3OYNA 1WGXA 2Y48A 2PFBA 1IHMA 4OAZA 3JR9A 2V7WA 2E36A 2PJRA 2B5OA 3W2IA 1VNDA 1N05A 3H09A 2VNKA 1VQKB 2VOPA 2FQ3A 2XGXA 3HDDA 3GFMA 3Q9SA 1I6HJ 3BG3A 4EM1A 4RD3A 3LSHA 2O61A 3I55B 3F6VA 1D1CA 4I6ZA 3LQEA 4UHTA 2KJCA 4XKCA 4BXXJ 4A3DJ 1DG1G 4HZFA 3QFSA 1RU4A 1R6RA 2YSRA 2RQPA 3SFZA 1S72I 5C1EA 2FX3A 2KDZA 2XGCA 2DA1A 3BTJA 4J19A 3U1KA 2VFMA 3VSLA 5K7HA 1XG2A 4I01A 4L0ZB 2V4JC 2VIXA 3A8KA 3WE3A 1RUNA 2HDNB 1XMKA 3LYCA 3H9NA 4ITVA 1FOWA 2CJJA 3RYPA 1K6OA 2L7MP 5E3MA 2HDCA 1P6RA 1Q7YD 3EUKL 2DYSH 1FNDA 3NEUA 2UXXA 2X4HA 1OOCA 1TQIA 4FQGA 5FLXZ 1QA6A 5D5VB 3OYEA 2QCOA 2OF7A 1JKPC 3S3MA 4IOCF 3IKTA 2YUSA 2BEOA 4IEJA 2VE9A 2VNIA 4A5NA 1REPC 4HA8A 4N9HA 2KT0A 2VI6A 2BGJA 3B6AA 4HAMA 3U2RA 1IJWC 2XNCA 1U8RA 1MMDA 3CP2A 3VNVA 3FIWA 1W36D 3OYFA 1UFMA 1BI1A 1QZEA 4TN1A 3I56B 4CCMA 3JAMK 1RI7A 2L7KA 2OBPA 2BHYA 6PAXA 3DU1X 3FHNA 1WTHD 4FCYA 2LR8A 2VFPA 4YEIA 3L2WA 4FX0A 3A01B 2O6WA 2E1NA 3JRDA 4BXUA 1UD6A 4KYWA 1COWA 4YZ0A 3JRAA 4URRA 4M3GA 5J40A 3HOZJ 3BDDA 1HOMA 2H1LA 1P2FA 4EEFG 2VC0A 2XVCA 4P5OA 3TP0A 3V42A 2K9QA 5FLMJ 2K4BA 2DFIA 3FKIJ 5DD4A 3UKGA 1RKWA 4CSWA 4ACAA 2GXGA 2JZYA 4AYBN 1CF7B 4QV2A 3BTLA 5LMZA 3N6ZA 3DEEA 5KAIC 4XLAA 5EZGA 1R23A 5HLTA 2XOKA 3WNCA 4G7WA 2OU2A 3BC8A 3OOUA 1YQAA 4M6VA 4DJAA 3CF2A 1T2KA 4NNJA 4BGDA 3E6CC 3LSPA 3H35A 2DCEA 1X3UA 2M3AA 4WWCA 1SFEA 3TOBA 1K28D 3T51B 4BE2A 4M6YA 2L3DA 1YJNB 1QFZA 2GOMA 3N97A 3W5HA 3TW7A 5E17F 3FXQA 2DIEA 1C0WA 4GYIA 5LRRA 2BM4A 5AONA 3IH3A 2COMA 4ASNA 5DV5A 5DM6F 2HXIA 2OQRA 2R7QA 4JOMA 4TMVA 3ASQA 4ANJA 4CYDA 2VBUA 4AIHA 2NSPA 3PUBA 3HL2A 4KKUA 2CO5A 5ICFA 2UVEA 3QU6A 2XSJC 4EVIA 2X0KA 3LQ6A 2JRMA 1K6YA 3K4KA 4XLHA 2RN7A 4C3HJ 1W5TA 5EGOA 3C18A 3JQRA 5HZBA 5J3LA 4JMQA 2DA6A 5JVTA 2PBIA 1OJLA 2WY8Q 3KEOA 1P4XA 2LDUA 3V7CA 3OYLA 3R0JA 5DCMB 3CCSB 2Z2SB 1H8AC 3W2FA 2WYRA 2JN9A 3GLLA 3NWTA 1GHCA 1ZAOA 3MAJA 2V6CA 2LREA 3ISPA 4Q7JB 1MD0A 3PO3J 3ZMZA 3BCBA 3HIFA 4EATA 4LBWA 4EH1A 3HTSB 5HXBA 4G7ZF 1UMKA 2ID3A 5KSWB 5IYWA 4I84A 1UD4A 2DEUA 1K7AA 3AVWA 2PECA 3J7AY 1O3QA 3JQPA 2LC2A 2Q6LA 5B3SH 4L18B 3GQ8A 3S1RJ 2WZNA 5L3FA 4KMUX 4IF4A 5LGUA 4XBFA 2NVYJ 1QGZA 1JGSA 4IHSA 1S0UA 3E1YE 1R1TA 1ZLJA 3PQKA 2M5SA 1RR7A 2XDVA 5E3NA 4MO7A 2R93J 2Q6OA 4OAYA 4I76A 3F21A 3O6BB 3GW2A 2AXTC 3BQZA 2WY7Q 4EQQA 1MBEA 2LYCA 1T0FC 4P55A 1G7CA 1JRGA 3B4NA 4E7ZA 1WP6A 3HSRA 3HOYJ 4F93B 4XMYA 3WY9A 4RD4A 2QENA 4OOSA 3AG2H 3FMRA 3LOCA 4ESBA 3G05A 4MR0A 4QTRA 4W97A 1DU6A 4U49A 2KPMA 3W6KB 4XLEA 4OMYA 4DQLA 4I02A 3QYFA 4HWVA 2ICWG 1ULYA 3PENA 3VSUA 1X3WB 5J35A 3ML6A 5EEGA 4B44A 1RNLA 3IHUA 2LKSA 2IS4A 4U0WA 1WH5A 4YFNF 2BVLA 2M8EA 4YRVA 3GZ6A 2VFNA 4OZYA 4WCGA 4KNYA 3H9QA 2BBYA 1BW5A 2ZXIA 1R71A 4PSWA 1BR1A 3OL4A 1OYYA 2V1DA 5JLWA 3CCLB 1EZGA 2O1DA 3WTVC 4RDLA 1TWFJ 3GCMA 3VB2A 1X4OA 1D1BA 1FP2A 4PK4A 2EQRA 4X06A 5THXA 3F23A 1KGSA 1MJBA 3FISA 3OY9A 2Y0SA 3SEJA 4YDTA 1KTWA 4B3GA 2H6CA 2QGUA 3ML3A 2DXIA 1FX0A 2L0KA 2CUZA 4RLQA 2CUJA 1WI9A 1OKRA 2V9PA 3DU5A 3DLLF 3CTAA 4OOVA 1G2HA 1O8LA 1Z05A 2M0CA 3ZMTA 4J0QA 1TW2A 4BYYA 2EZHA 1I3QJ 3HOTA 1KK3A 4R79A 1V55H 4HNTA 3BNWA 3RKYA 1KCDA 4Y52J 3SEQA 2I1LA 4OIRF 2K4JA 2MD5A 4JYKA 1P4WA 4I09A 4DGWB 2BV6A 3LSKA 3WTZA 2HYFA 1L0OC 2X1EA 4A3JJ 1S8NA 5BNGA 2CQXA 3KZIC 2WAQA 2L54A 2A3SA 4CH7A 4LC0A 2DQLA 2MD0A 1IG7A 1O8GA 1KYZA 4ZCLA 3I54A 3FXUA 3AG3H 1LJ9A 1JT0A 4OIOF 4CCKA 1TNTA 1TLHB 2MH2A 3LQQA 2R7RA 1OCPA 3O8HA 3QRFF 1EJ9A 1ZUNB 4FASD 2R3SA 1K79A 2DFHA 2J7KA 3EUAA 1R5OA 1G59A 4N3GA 4XORA 2XC1A 2PN6A 1KTVA 2YUHA 1WJ5A 1KJZA 3SQVA 4BBRJ 2X48A 3AVYA 2PYHA 2IRFG 1JA0A 1FYKA 1IXRC 1S5LC 1R58A 4NDLA 3OJXA 3A35A 2ZBVA 2VB6A 2M2EA 4IZZA 2HOAA 2YWFA 3JW4A 4KN4X 3QYBA 1ETWA 1KC8D 1JTYA 3TMOA 2ELJA 1LFBA 2JK3A 4MFDA 2RQQA 4QSHA 1WZ2A 3VYTB 1OGIA 1A04A 1ZKGA 2KJBA 2X1DA 4HX4A 3I4MJ 3CO6C 3TO9A 5H20A 4NK8A 5FKLA 2YWGA 2YX4A 3CLQA 2DTRA 1U6GA 4RDJA 5JBQA 4HSTA 3OMYA 1OISA 4YIIA 2XPWA 1MDMA 2KZGA 1Y0UA 2XT4A 1IN5A 5B66C 4BL0B 1UD8A 1IGNA 1O8FA 1B2RA 3CUQC 1ETOA 1NTCA 1ZG5A 2B0RA 1OPCA 2HMAA 2X51A 4LIVA 1VQLB 3PVDA 1T33A 1WJBA 3E5UA 4YAFA 2QY1A 2RVCA 3HSEA 3ZMSA 1MMGA 2CW8A 3QOPA 2PJRB 2WJYA 4Y9RA 1MBHA 5JHFA 2Q0OA 4L9NA 4QPOA 4CHUA 2QN6A 2ZB9A 4PJ0C 4R8HA 4YZQA 4AM3A 4RCYA 4E7KA 5LBQA 1E63A 1SFOJ 2H1KA 3K1NA 4IHXA 4AVZA 1B72B 1HW2A 4LLLA 2GJPA 5EMNA 4KT6A 2NVUB 3CCUB 4P6VF 1XE1A 2RNJA 1UHSA 4IOAF 3DPTA 1GV2A 5KHDA 3JRFA 2ZZEA 3C1DA 2R7SA 2E19A 2NRAC 1GXQA 1WSUA 1FWZA 3OS0A 3AG1H 1IN8A 2DI3A 2JMWA 4PJJA 1BBYA 3RDIA 3SKBA 3G4SB 5M5YJ 1RETA 2YU3A 1S9HA 1WWXA 3CCEB 3DV8A 3S16J 1A31A 3HTUA 3SHFA 1PVEA 4A6EA 1KU7A 4M9SA 4HDVA 2CG4A 3HJEA 3BG6A 3OR2C 2E1MB 3D1NI 5F0CA 1VFCA 2BVMA 2E1RA 5BSXA 2LKXA 2BHZA 3R6KA 3ZQ7A 1A5JA 3UR3C 4RB2C 2FQ4A 3K0LA 4PGGA 3JTGA 1JKRC 4DK1A 2P5KA 1W0JA 3PM1A 2W00A 4CCNA 1RPWA 3A0BC 3KIOA 4GO1A 3TBIA 1OCZH 3OSGA 2OYNA 2XZOA 4X7FA 2XAJA 1FIPA 4LBZA 1W0TA 2E34A 3CUOA 3SZGA 2Z99A 2L01A 2L7FP 4A0XA 1JUPA 2HGCA 4AUXA 3L1PA 2INVA 2OBRA 2CV2A 2QA4I 3WYAA 5CVRA 5CPRB 1CQXA 3OW2B 3ASPA 5B6IA 3GBGA 3CQZJ 2XPUA 4L9TA 1O3RA 1NBMA 2K02A 4Y7CA 3DQVC 2XIGA 4E7JA 3K70D 2LH9A 1LE8B 3FM5A 3QODA 2WB1A 2FMLA 1B23P 4DBRA 2Y9ZA 1WU8A 1BHEA 2JA8J 1IDKA 3W6JB 1IJEA 5BQTA 3DTEA 3RCOA 1GVJA 3B82A 2K3PA 4P3YA 4UZFA 1N75A 1I6XA 5F4JA 1WKMA 2P0WA 1ZRFA 5H59A 5FL7A 2WADA 1JE8A 2F5EA 1NG7A 1E1RA 1XCBA 5E8IA 3B8YA 1BJZA 4XIDA 2VKVA 1TQPA 1QQIA 3HB9A 5DS9A 2Q8KA 1VTNC 4GDFA 1MZBA 2W6JA 1ZELA 2KMUA 3GVAA 1L1IA 2IAIA 1EWYA 3A8JA 2COBA 3CP8A 5EEHA 3L2VA 4PC6A 4KIGA 1RC9A 1YITB 1VQ4I 2EK5A 3Q0UA 1VLYA 3ZQIA 2GREA 4WX9A 1T5EA 3MMYB 4F91B 4AC9A 2DA3A 4BUPA 3BG5A 1WCMJ 2XRLA 1QPMA 2L2OA 3OZUA 1FNMA 3DEWA 1MNMC 1ZYRF 4D7MA 3WHBA 1Y1WJ 1LM1A 2ZL6A 1QQ1A 1X1BA 3CC7I 3JRHA 3AKZA 2XTXA 3S8PA 3SZEA 2EILH 1LQ1A 3HGYA 3M9AA 2HQAA 2A69F 2GOXB 2BXZA 1KQ0A 2Y69H 5JLXA 3U21A 1OR7A 3E6MA 4RJLA 1FY7A 2C5HA 4XNFA 4AU7A 2VBXA 2CBXA 2QDXA 1MW7A 2OBSA 3MZHA 1TYXA 2OK7A 2DFFA 3VSVA 3L2CA 1KU3A 2GBYA 2JRTA 3PIPF 3EYYA 1GDTA 4Z4RA 4I7HA 5E6TA 3LMMA 2CSOA 4CO8A 3RYRA 5CVIA 5LHIA 3Q3SA 2M87A 1FIAA 2KIUA 3E6BA 3MCZA 4OPWA 2GK7A 1O8MA 3P4GA 3BY1A 2F48A 1YIJI 4ZYGA 4B3AA 2WSSA 3WNDA 4B3XA 5DN6A 1P4AA 3LFKA 1BN8A 4HRIA 1K5CA 5CQEA 5FKMA 1PKVA 1QHGA 2XASA 3AVXA 2P7CB 1ZH5A 3DP7A 4ON0A 2IVMA 2K27A 2CFXA 1HVXA 3ONUA 5K5RA 1I39A 5M3MJ 1LFUP 3D5LA 4EJTA 1QGYA 2F5DA 1XSDA 3QFCA 3H3UA 1VQ7B 3KP7A 1NK2P 1EH8A 3W3CA 2BM6A 2EV6A 4KUMA 3ZPLA 2ZSIB 3E1SA 3QFRA 1V3FA 2G0EA 3BZCA 4YIRX 4MQ9F 2HI3A 2O03A 4L9VA 1AOYA 1HF0A 2D3LA 4ENKA 1KMHA 1DDIA 4P96A 2P3MA 4JRAC 3W2WA 1KU2A 3BR2A 2FBIA 2MBFA 2W7ZA 5M5XJ 1VZ0A 2N8GA 3LQRA 1N0VC 4LK0F 5BSYA 1WFXA 1UD3A 3BPVA 3BT9A 1YJ9I 2ZNYA 3EUHA 1D0XA 5JFRA 1GV5A 4PMHA 1PLUA 4KICA 4U7BA 1N77A 1CGPA 4P9SA 1WI3A 2DOEA 2FEZA 1UZCA 3P5JA 2R5YB 3CCMB 3A3GA 1W36C 1BQEA 1SFKA 3C2GA 3ABMH 3KLOA 4C43A 2VQHA 2AHOA 3MVPA 1IUYA 5IYNA 1D0YA 4EW9A 1Z6TA 4Q47A 1YRNA 3P9KA 2HVSA 1NDHA 1VBLA 5HOOA 5EYRA 1BW6A 3CJQB 4XLNF 2LF7A 5KNLA 4Z4SA 4BQAA 2HDWA 4ENMA 4YAUA 3U1DA 4BE0A 4D5FA 4HDUA 1WOOA 1BJKA 4IRIA 5HDGA 3HPHA 4NC6A 3ZBUA 2XPVA 4KH3A 2VASA 3P9CA 2IXSA 2GZWA 2DYRH 3VSKA 2DETA 3VYSB 2V7UA 3OE7A 2JUCA 2EB7A 4MEXF 3PQJA 2VJJA 3RPUD 4TV7A 5FA6A 3VO1A 2EWEA 1XCVA 4DYRA 3HZJA 1R22A 1M1KD 2L4AA 3HXLA 3NAUA 3PFYA 4CGZA 2H8WA 3FJOA 4HNUA 2QTLA 2CWEA 2OCEA 3I3LA 5GPAA 4LLNA 2BPOA 2YWEA 4EGZA 2W48A 1FMVA 2DBBA 3QWLA 1HSJA 4H4KC 3VYRB 4S04A 1G7TA 3OOCA 4Q5SF 1H80A 3CCQI 3ABTA 3ZMVA 2V4DA 2PLYA 4W8TA 2BM7A 3ZGKA 2QBYA 3MCAA 3B8HA 3C2BA 1R5NA 4QFMA 3H5NA 5B1AH 1S7EA 4RGSA 1R5GA 5FGMA 2XV4S 3OR1C 2LBFA 3A1PA 1TT0A 5D8LB 5D4RA 1GVDA 2AHQA 1M90D 1NB9A 4BEHA 3LVBA 4IHVA 5LGNA 4EJVA 1WSVA 2XB5A 1X1DA 1SC7A 3QFTA 2W84A 1ZHFA 3B6CA 2ETHA 3FY3A 3PO2J 1XC5A 4U4BA 1J9IA 3PJRA 3OYIA 2JDIA 3EUHC 1WOPA 4Z4VA 1M1EB 3I1FA 2HU9A 2PMZA 3O3KA 4FHTA 4M6XA 3JCUC 2ECBA 2IP2A 3LA7A 4C3IJ 2QMUA 1OFDA 1HDPA 5F4MA 4RGRA 5BPDA 1EFRA 3H9JA 3FXOA 1EH7A 2NT9A 3LWFA 3GTKJ 1OFCX 2VBYA 3FXKA 3TP3A 3CMYA 3RPQA 2H27A 5CLSA 1RQRA 1NK3P 3J7ZI 2H09A 3WTUC 2G7HA 3GFJA 4ZH4F 1BLIA 4FTHA 5DDGA 3TO6A 2J5PA 3BR0A 2M8GX 2HYGD 3FZVA 4RM2A 1FDRA 1VQOB 2E2HJ 2D3NA 1E3OC 5FO1A 4HV5A 3R60A 1Y0YA 2EFPA 4XSZF 2E71A 2JVGA 5DUKA 4A3BJ 4TMXA 4OM9A 4AWXB 1YS7A 1ZARA 3BZ6A 1G8XA 1D1AA 4CXFA 2V1UA 1SKQA 4GYGA 5FIUA 2L9SA 3C2HA 1IN4A 3BPXA 3PNVA 4K2EA 2IGMA 1DBGA 2DLLA 5HLHA 1CQTA 1IB0A 3WBJA 4TMZA 2F6CA 2DYIA 2B7BA 2O0YA 4YALA 1YW7A 2TDXA 1W7PB 1IA5A 2XAHA 4LB6B 1VQ5I 3CJRB 2A5YB 1XTAA 4QIWN 1X3ZB 1IDJA 5FFZA 1AKHA 5F1RA 1PUFA 5HNFA 3RIQA 4U0VA 5J4YA 1OR7C 2V79A 4JQFA 2R5ZB 5GV8A 2DT7B 2MGQA 3JSPA 1QVTA 1JGGA 5IT9Z 1FOXA 2EA2A 2VKHA 2BGIA 2K40A 4IVNA 4HV6A 4Q48A 4PJNA 1HCRA 4ZCIA 5K1YA 5TRDA 2HZDA 1P4MA 5FRMA 4RAZA 4XICA 2WB1N 3RTRA 2M45A 2MA3A 2WV1A 1S6LA 4P12A 3GXOA 2DK5A 1V4RA 5HS8A 1FJLA 2CV1A 1KQ9A 2QSGX 1KRHA 1G7SA 4A3KJ 2F43A 3H0GJ 4LBYA 2JA2A 4P1WA 3M8EA 3FXMA 3FXLA 3WGGA 4BXFA 1V0EA 2V7VA 2DDBA 1OB5A 3Q6QA 2ISYA 5ILVA 4M53A 3JTHA 2X3HA 1IZ1A 1U5TC 4ZV4A 1AA7A 3I64A 3V8JA 4A93J 1SD7A 2PMDA 2J8IA 4G12A 4ZYAA 1N06A 3KP5A 2F2EA 4ESFA 2ZO4A 2OJED 1D5VA 2Z5UA 4XRFA 4HEA2 4HPQA 1WSRA 4RLZA 2RNGA 4G7OF 2KQRA 1FC3A 3GX4X 2IPQX 3PUFA 3L00A 2XAFA 4HX7A 2B7CA 4BAYA 2ZL5A 4YEJA 3DPUA 4ESJA 2LSOA 3S3OA 2UWMA 3GVJA 3J81k 5EZHA 1QRYA 4H9GA 1PE9A 5ICGA 2V1XA 2EWNA 3BC9A 3OS1A 1OFLA 2G9WA 2F5VA 4QPQA 1D0ZA 1EE6A 1FRQA 1VQ6I 3Q38A 4X07A 4ZYEA 5K5OA 1DU0A 4HLXA 1DDNA 3I58A 2PE3A 1VQPB 4WZLA 3HOVJ 5KCMA 4BEHB 5D6FA 3ERED 3S2HJ 2ZCWA 3RQIA 2Q2EA 3J7AO 2BVNA 2R7FA 1ZQ3P 2VQLA 4OIQF 5LGTA 3S3NA 1NJID 3GYHX 2X85A 1FTZA 5A88A 2PIAA 1MBJA 3BWGA 2KISA 2XGDA 1FOYA 5FB2A 4X6AJ 2JSCA 2W7NA 3OOPA 4NB5A 2JA7J 1R36A 4A0ZA 3W2AA 3H94A 3W2VA 5LRSA 2QYUA 4CICA 3PSSA 3DBLB 3W2GA 1ZR4A 5HZAA 1KYWA 2FX0A 5FO0A 4EJOA 3G73A 1ETYA 4DBQA 3OS2A 1WOSA 3PL8A 1TUIA 1EH6A 4PDKA 2XF5A 3H36A 3CB4A 2V7XA 4KN7X 1QVFB 2OC6A 3TW6A 5J1RA 1J2XA 1HXDA 3KP4A 4U88A 4ZZLA 4QLCU 1WPCA 2W25A 2EFGA 2X1CA 1G6NA 4UV8A 3R6SA 4RDUA 2VE8A 2IGNA 5FD5A 2E1OA 1NRKA 2ZZQA 3OJWA 3DKWA 5KK1A 1XD7A 4XLPF 2LLKA 5J8CA 3G1MA 1KA8A 3GRHA 4OJ6A 1O3SA 1IXCA 1DP3A 4HW0A 1XGNA 4MQVA 4Z4TA 4Z4ZA 4Z4YA 1A6QA 1Z7UA 3TDUC 1YJ9B 3KEWA 3VMFA 1U5TA 1LEAA 4BS9A 3VEPA 3G6EI 3GTMJ 3KFWX 3DLAA 2V5IA 2IA0A 1I8DA 1JHFA 1EA0A 2JSPA 4ETSA 3A8IA 5E79C 3CCRI 5ERIA 3ZMDA 5ILUA 3Q0WA 2HPIA 3E97A 3V7SA 5HDKA 3J81K 3CUQA 3GQ9A 2EZIA 1FP1D 2CW0F 2G0YA 1QBJA 4HNVA 2EIXA 3KL9A 1X1AA 2Z1DA 3QP6A 1F4KA 4BY1J 3L2QA 2E1BA 4XKVA 5AIQA 4EV0A 3OIPA 1GQ8A 3HRTA 4XLCA 3ZQQA 3J80Z 3OIQA 2DODA 4IHYA 3U2QA 2M1BA 2HFHA 2M7AA 3A01A 2P5VA 3LA2A 3ZN1A 1EP2B 4L0YB 2NSTA 2BZTA 1SANA 5DCFA 2STWA 2HOSA 2VJ4A 4IKFA 2O17A 1DABA 5HS7A 4AF7A 3FKJA 3ONYA 3SYTA 4XKWA 1TL8A 5LEJA 2E7XA 4IX7A 2X3UA 2DOGA 3OP1A 4KKSA 2CRGA 2BV3A 3ZQHA 2JJ7A 1YFHA 1SKYB 3HM5A 2IS1A 1YOVB 3BH6B 1D8KA 1R4MB 1IO2A 1ON2A 2HPMA 1VQ4B 4X0GA 2B0LA 3OWTA 1TWCJ 3TL4X 2BX6A 1NB0A 1XDUA 4G7XA 1EV7A 3GEZA 3EQOA 1MRZA 4CZZA 3Q9VA 3EETA 4MEYF 2P6SA 2ZFWA 2RGVA 4II2A 1SEUA 4P25A 3CCYA 2MLGA 3PSIA 4EMSA 3HKZN 2BYVE 2ZSHB 1DBOA 2DAOA 4UUSA 2AS5F 3HBLA 2DT5A 2PJPA 1BMFA 4TSFA 3UNGC 1Q81D 1O8DA 4X7DA 2I5UA 2DTZA 2VBZA 4GGGA 5BS6A 1JHHA 3T56B 2A05A 3PA2A 5J3OA 1WQ2A 1PP8F 4MXNA 3ASSA 5HLIA 1TYWA 4QVJA 5GAEJ 2DK8A 4U0YA 3JRCA 2DY1A 2HR3A 3WHCA 4D0PA 1E62A 1U2WA 3SZPA 2D45A 1X4PA 3LL7A 3M1EA 3FBNB 3ZOBA 1A35A 4BQQA 4YIFA 1R9TJ 3RZOJ 2QE7A 2ZZGA 3WGIA 3KPHA 1SD4A 3F8FA 2ZTNA 4XQFA 3VYUB 3GTLJ 3AFHA 1PJ6A 1W35A 3ZZ0A 2Y30A 5CVUA 5TGTA 3CLOA 3HEFA 4RB3C 4FN5A 3K4MA 1LPQA 4BHCA 3F8MA 1TC3C 2CW5A 2BY0A 3NE5B 4K1XA 2D74A 4WQMA 3IRRA 4BJTA 1ETQA 3H92A 3G6EB 1CNFA 1TP4A 1V5EA 3BR1A 4UVAA 3CDLA 1U0JA 2VPRA 4L5IA 1W5SA 3R61A 2EBIA 2MFZA 1O8KA 2DN0A 1T08B 3CPXA 1JJ6C 3FK6A 1G3TA 3CMAB 3SQNA 3KZZA 4ROXA 3VMWA 1UG0A 1BC7C 2YS9A 1YX3A 3G4SI 4ZTFA 1MSEC 5JHUA 1OCOH 3WXMA 3QP5A 4BQOA 1PDNC 2LZJA 1IN6A 3TKYA 2CF4A 1YLFA 4ZTJA 3BJAA 1XG1A 2MW8A 3ABLH 4WXHA 2R5ZA 1QVUA 1K78A 3LSMA 1MNDA 3HPGA 2Q2EB 1WVRA 2V7FA 4LG0A 2NVXJ 1LLWA 2CMPA 3ZZTA 1QUEA 5F4OA 4A3FJ 3BLYA 3SDBA 5DTDA 4AIJA 2BSPA 2O0VA 3CC4B 4G8XA 3LA3A 1MBGA 2L02A 4UY8I 5A8AA 4BHPA 2CRVA 5KAFC 4MTDA 1Z3XA 1F43A 1EP3B 3BCDA 1YYVA 1R7JA 2G7UA 2KIMA 3FK7A 3Q5FA 2QF7A 2L5QA 4XM3A 4PC1A 4OZZA 3LAPA 3CD6B 2C78A 5EF6A 5TISC 1HLVA 4FWTA 2ZC2A 3SJPA 2Z6BD 4ZZDA 4LBVA 3DPLC 3MMPA 1LE8A 1N08A 1E3HA 4B43A 2NXNB 3BTCA 4C2LA 1HSTA 2FSWA 3MN2A 1TQMA 1S3JA 5FD6A 1R5HA 1U9OA 4RMNA 3CDHA 3B78A 3JRGA 3T0YA 2F3LA 2DW4A 3I9V2 4CYCB 1JKQC 2QKLB 3OZVA 2L7ZA 2P7VB 2Z8GA 2DA5A 2X0LA 3HGGA 3ZUGA 2R7ZJ 4MYUA 1AIPA 5FKNA 2IEKA 1X1CA 4D7NA 4A3CJ 3PUNA 4RD6A 3S1QJ 3T5XA 1O88A 1UMQA 1O8EA 3V8KA 1PJRA 1ZLKA 1V5GA 1O8JA 3T9GA 2ZFUA 4YELA 4XLFA 1OB0A 4Z03A 3F72A 3VSTA 1VQ9I 2EINH 3I59B 2LRDA 5A2QZ 2VNJA 5TV2A 4C2UA 4U87A 2VJ5A 3F8NA 2Z16A 2EPFA 1R00A 3WG7H 3GQ7A 2FVGA 3KRGA 4B47A 4PC7A 4RPBA 1D3YA 1A6IA 3EQLF 1T39A 2L9VA 3FXJA 1OHHA 4GXOA 1BA5A 4M3FA 3KZYA 4AD9A 3BY2A 3GUDA 1VQ8B 4EM2A 1GR1A 3EYIA 1N0UA 1IRFA 3H3ZA 3ZQFA 1LNWA 1PYVA 3MFKA 1ITYA 4OPVA 3G3ZA 1USTA 4DOZA 3PSZA 1QRBA 2BM0A 4PGOA 3S1MJ 3DKYA 5IYBJ 3QSYA 2VONA 1S72B 5IP6A 2EV0A 2GA1A 3IWFA 2RAEA 2IA2A 1G3YA 2EA4A 2OCCH 4AVPA 4F7ZA 5IY5H 3OYGA 1YI2B 3OYMA 3RIRA 5IYRA 2D1HA 2ODLA 3WG9A 4M3DA 4ENNA 4B4DA 4PUSA 5F08A 4DW6A 1IC8A 4EGYA 2NTQA 3ULQB 3ZP5A 1KK2A 5HDNA 4HF0A 3D26A 5H5JA 4BHBA 1PXZA 4GRIA 1O4XA 2O04A 1OQYA 4L9JA 3WU0A 5M5WJ 2F4MB 3MKYB 2XF6A 1HQCA 5AMVA 2EIMH 4PJMA 1SVOA 4OOIA 5A89A 2JN6A 1F60A 1WH7A 2JJ2A 2PLFA 5GV7A 3A4CA 2CV0A 2KP6A 1E3ZA 3CCVB 4P9FA 4W8QA 3SYJA 2R92J 2LTPA 1FT9A 1QFYA 2HQNA 4M74A 1QGAA 3S2WA 2XT2A 2E5ZA 4NQWA 4Z06A 1IF1A 3QPSA 3QPLA 3LAJA 3G71I 1T6SA 4XSXF 1HW1A 4OPOA 4WZTA 3HRMA 1E2XA 3VODA 3WTYC 1SM4A 1QA3A 2O6GE 5C4XJ 2TCTA 3ISXA 3LNNA 3HSFA
chains in the Genus database with same CATH topology
3PFYA 3B90A 3GQBA 3GVLA 1E43A 4HNUA 1MMDA 3CP2A 3I3LA 1W36D 3OYFA 3K4CA 1NG6A 2CS3A 1FMVA 2A6TA 4CCMA 4E7IA 2R7XA 3OEEA 2L7KA 4H4KC 3VYRB 3OOCA 1H80A 1BR2A 1T95A 1W9XA 1CZFA 2V4DA 4W8TA 3FHNA 3S32A 3ZGKA 1WTHD 3L2WA 5CQGA 3H5NA 1W0KA 4E7LA 1UD6A 2GJKA 1COWA 4YZ0A 4MLOA 4URRA 4NC7A 3VMVA 3OR1C 2LBFA 3H9GA 1TT0A 3V42A 4P5OA 2VBMA 4BEHA 4CSWA 1X1DA 3FY3A 3OYDA 4HG2A 4U4BA 3DEEA 2XOKA 4XLAA 3OYBA 5HLTA 2WJVA 4CCLA 2E60A 4G7WA 1LKXA 5CKTA 3PJRA 3OYIA 1V0FA 3BC8A 3IAM2 3IP4B 3EUHC 3OOUA 4DJAA 3CF2A 2JDIA 4NNJA 4BGDA 2INUA 2HU9A 3H35A 2PMZA 2DCEA 2M3AA 1K28D 3T51B 4NC8A 4BE2A 1YX5A 2GOMA 3D5RC 1EFRA 3H9JA 2DIEA 2NT9A 2IS6A 4XR6A 4KISA 3OYHA 2R7QA 4JOMA 5CDFA 4ANJA 2NSPA 3PUBA 1BLIA 3KEYA 2DOAA 3HL2A 3A2KA 4KKUA 4C2TA 1UD2A 2UVEA 2XSJC 1JTAA 4RM2A 2QX3A 2VQCA 1K6YA 3K4KA 4XLHA 2D3NA 4BDZA 2M4GA 2JJ1A 4DNTB 2JVGA 4JMQA 4HSRA 2WY8Q 2O5RA 4ZDPA 1G8XA 1D1AA 3OYLA 3KX2A 2L9SA 3C2HA 2Z2SB 3PNVA 1MMAA 2NTBA 2IGMA 4J00A 1DBGA 4NK6A 3NWTA 2LREA 1E79A 3ZSCA 2F6CA 4EATA 3BCBA 3OYAA 2VLAA 4XKBA 2UVFA 4I84A 1IA5A 1UD4A 1I18A 3CJRB 2PECA 3J7AY 3ZXSA 2LC2A 2NOJB 3OFNA 1IDJA 3G2BA 3K70C 2VJIA 1N78A 3GQ8A 4F3QA 3HOSA 5HNFA 1OR7C 4JQFA 2CFOA 4XN0A 4ZJZA 2M5SA 2DT7B 3EQNA 2XDVA 2W6IA 3SUCA 1VF7A 4OAYA 3M1CA 3DKXA 2VKHA 2DT6A 4PJNA 3H0DA 4L8JA 2WY7Q 2NZMA 3ZPPA 2HZDA 2KLOA 2LYCA 1T0FC 4UZUA 5FRMA 1BPLA 1JRGA 3B4NA 2KDOA 1LFPA 3RTRA 4E7ZA 2R7UA 1WP6A 2WPDA 3UW0A 3A1YA 1J09A 4Y33A 4F93B 4XMYA 3MKWB 3IAS2 3KYLA 2CV1A 1UD5A 2JIZA 4XOTA 4LIUA 3G05A 4MR0A 1P9QC 3LSIA 2F43A 4U49A 3OW7A 2KPMA 2VKDA 4Y3OA 2JA2A 4XLEA 3WQZA 1X19A 4P1WA 4ZC3A 4BXFA 1V0EA 3QYFA 4HWVA 2M7BA 3VSUA 1OGOX 4B44A 1E3XA 1H8HA 2X3HA 3OYJA 2IS4A 1AA7A 3ONQA 3ZR8X 4ZYAA 5HKKA 2BVLA 4E4HA 4YRVA 4OZYA 1MMNA 2RREA 3H9QA 3PNYA 1Z7LA 1MNEA 4HEA2 4HPQA 2ZXIA 2NT6A 3PSFA 4BACA 2RNGA 4N4NB 2KQRA 1BR1A 3OL4A 2KHMA 4PSWA 3GQAA 2VBEA 2O1DA 2HVRA 1RMGA 4YEJA 3DPUA 2Q1ZB 1BR4A 3S3OA 2UWMA 1X4OA 2I8DA 3GVJA 1PE9A 4BQNA 1D1BA 2VPLA 4PK4A 3BC9A 4G6IA 3M8JA 5LD2C 2XZLA 3OY9A 2Y0SA 3OS1A 1KTWA 1OFLA 4B3GA 1RWRA 2F5VA 4QPQA 1D0ZA 2DXIA 4TKOB 1Y6IA 1FX0A 1EE6A 2CUZA 4RLQA 2NSTA 2CUJA 3DU5A 5KCMA 2R7VA 1O8LA 4BEHB 2K9LA 3HOTA 4F92B 3JU4A 4R79A 2LBFB 2IS2A 3OAAA 4HNTA 2VQLA 4ZDOA 2X6YA 3S3NA 1KCDA 3SEQA 1ERDA 2X85A 4BDYA 3DDYA 1KZLA 1DGRM 2X6WA 3K4BA 3CESA 4DGWB 2NTPA 2W7NA 3LSKA 3W2AA 3H94A 2X1EA 3W2VA 3L2RA 3OPOA 3QYEA 2WAQA 2KZVA 4CH7A 2W4SA 4F52A 3ZRGA 3ZPNA 3OL3A 2MD0A 1O8GA 4DBQA 3OS2A 3PL8A 2XF5A 4CCKA 4IQ4A 1WJFA 3PNTA 2V1NA 2R7RA 2OC6A 1WPCA 2CH0A 3FKSA 4FASD 4Z1MA 4NUBA 2X1CA 1NRKA 3EUAA 1G59A 2IGNA 4XORA 2ZZQA 4NQWB 1WJ5A 2HLDA 2PYHA 3GRHA 2AQFA 2IGOA 4OJ6A 1DP3A 4B48A 3A35A 2VB6A 3DTIA 4IZZA 2KRHA 4BS9A 1E0EA 3BH4A 3KEWA 2QXZA 3QYBA 4OWRB 3DLAA 4PFOA 2MABA 2VQGA 3TMOA 2ELJA 2HNHA 2RQQA 1I8DA 3VYTB 2JSPA 2X1DA 2KVOA 3FDYA 4NK8A 2HPIA 2CW7A 2LY2A 1GLNA 3DTKA 3GQ9A 1HA8A 4HSTA 3OMYA 1HG8A 3BG7A 2R7TA 1X1AA 2Z1DA 2E1BA 3L2QA 4XKVA 1LDKB 3WWGA 4Z05A 1WJEA 3OIPA 2X53S 1GQ8A 4XLCA 3ZQQA 4BL0B 3OIQA 1UD8A 1O8FA 5LFAA 1BOBA 2M7AA 4GQNA 2X51A 4LIVA 1WJBA 2UUZA 2QY1A 3H5RA 3BCAA 4YZAA 1WJCA 4W8SA 1MMGA 2CW8A 2VJ4A 2PJRB 4IKFA 2WJYA 2ZZFA 5JHFA 2O17A 4QPOA 3FKJA 3SYTA 4XKWA 2GK6A 2WA0A 4CZCA 4IX7A 4KKSA 1IRXA 4B3FX 4YZQA 2V31A 4E7KA 4FXUA 1SKYB 4AVZA 4IQJA 2IS1A 2GJPA 3GVKA 2XGJA 4KT6A 4DIQA 2UV1A 2KL4A 2HPMA 4X0GA 3DPTA 1VJSA 5KHDA 1Z21A 3OWTA 3TL4X 2ZZEA 1WMRA 5FROA 2XC7A 2R7SA 1O8HA 4G7XA 3EQOA 4LITA 3HKZA 3OS0A 1UAAA 4OJLA 3CZ6A 1FMWA 1QJVA 1OFMA 4YXWA 4II2A 4PJJA 3CMMA 3PSIA 1DBOA 2ZSHB 3NWSA 1BMFA 2R7OA 4TSFA 1S9HA 3UNGC 5IK2A 1O8DA 2MC4A 3MKZA 2GJRA 2XZPA 4OJOA 2QKMB 2L9NA 4BJ6C 3T56B 4ASUA 2WBMA 2XNDA 3RSNA 2V7QA 4C9YA 3BG6A 4MXNA 2F4IA 3DU6A 3OR2C 2E1MB 3A3BA 1AIRA 2BVMA 4W8RA 4TT3A 2K5CA 4KITB 1X4PA 3LL7A 3UR3C 4E0FA 3FBNB 4DK1A 2VL8A 5HNHA 1W0JA 4BQQA 2FUG2 2W00A 2QE7A 4CCNA 2ZZGA 3TBIA 4BE1A 2ZTNA 2XZOA 3H5AA 3VYUB 4XQFA 3AFHA 1H8EA 2W82A 3SZGA 2LY1A 2M4KA 5TGTA 3T53B 2INVA 3K4MA 3EPZA 2CK3A 3F9KA 3DWLE 2CV2A 3NE5B 1KCCA 2X8KA 1LVKA 5CPRB 3ZCOA 2WZPP 1OGMX 4BJTA 3GBGA 3L2UA 1QU3A 1V5EA 1NBMA 3DQVC 4E7JA 2VXZA 3K70D 3E0JB 2LH9A 1U0JA 2KRCA 3QODA 2MFZA 2WB1A 4YZXA 4DBRA 1O8KA 1BHEA 1IDKA 4XN3A 2LOOA 3DTEA 3RCOA 4KKTA 2K3PA 3VMWA 4CUGA 2O0WA 1UG0A 1N75A 1JI8A 1YX3A 2P0WA 4ZTFA 5HVQC 3VDXA 3OYKA 5FL7A 2WADA 2F1MA 1E1RA 1NG7A 4BQOA 3B8YA 2DJIA 2LZJA 4E7HA 2HVQA 3FPPA 2VBKA 3IUOA 2W6JA 4N4OB 1ZELA 4ZTJA 2KMUA 4Y4RA 4PSXA 2ZXHA 3LSMA 1MNDA 3HPGA 3CP8A 2K9MA 2Q2EB 2V7FA 2R4GA 4CCOA 3L2VA 2CMPA 2JVHA 1X0CA 4G6TB 2AQEA 5FRNA 1VLYA 3BLYA 3SDBA 1T5EA 3MMYB 2BSPA 2O0VA 3N05A 4F91B 2BW3B 2OV7A 1O8IA 1WJAA 4BUPA 3FBIB 4XL9A 2XAUA 2L2OA 4F55A 1Z3XA 1OLTA 2R9VA 3BCDA 3LSGA 4RM3A 2WAFA 4HIZA 4P22A 1X1BA 2L5QA 4XM3A 3AKZA 3OYCA 3HAGA 3S8PA 4OZZA 4AYBA 1HZEA 3K4NA 2HQAA 2GOXB 2Z6BD 4XOPA 3DPLC 5C1CA 4PFPA 3U21A 4B43A 3HUGB 1O8JA 4C2LA 1KONA 4XNFA 4AU7A 4DNRB 1MW7A 3K10A 2WAEA 4RMNA 3AL0C 1DQUA 1YE9A 3K4LA 2E5NA 2JUGA 3I9V2 3VSVA 2QKLB 3LMMA 2Z8GA 2V6EA 2VXDA 2BOLA 3LMWA 4D1QA 4DK0A 1X1CA 2GK7A 2ZTGA 2V9KA 3K4JA 4ZDLA 4E6KG 1O8MA 3OEHA 4E7SA 1O88A 1IB4A 1O8EA 1PJRA 2XF7A 1V5GA 2WSSA 4RLFA 3SEZA 1QHHD 2ZFUA 4YELA 4B3XA 1MABA 5DN6A 1BN8A 4XLFA 4HRIA 1E1QA 3HC7A 1OB0A 4Z03A 5CQEA 3VSTA 1K5CA 2MYSA 3VWBA 1PKVA 1QHGA 2IGKA 2LRDA 3ZIAA 4C2UA 4U87A 2VJ5A 2X6XA 2Z16A 1HVXA 3GQ7A 3JURA 3KRGA 1UELB 4B47A 1NHCA 2E1MC 3D5LA 3MD2A 1OHHA 2BW3A 4CCJA 3HG9A 3K6GA 4C30A 2R7WA 1SAUA 4XONA 4J01A 3W3CA 1Y56A 4FETA 2ZSIB 3E1SA 3LFUA 4OJPA 1PYVA 1DGWY 3OYNA 4OAZA 1TZLA 4DOZA 2PJRA 2D3LA 1KMHA 3DKYA 3W2WA 1VZ0A 4KJZA 3LSHA 1WFXA 1UD3A 3T9GA 3OYGA 1WJDA 4D9JA 3OYMA 1QCXA 1D0XA 1D1CA 4LG3A 4PMHA 3S93A 4BU2A 4XKCA 4U7BA 1N77A 1PLUA 2ODLA 1RU4A 1R6RA 5C1EA 4PUSA 4XD7A 1EA3A 2NTQA 3A3GA 2M0MA 1W36C 3VSLA 1XG2A 2PYGA 1SFKA 2OUMA 3C2GA 2V4JC 2VIXA 2VQHA 4GRIA 1PXZA 2LG4A 2O04A 1D0YA 2V26A 4EW9A 2HVSA 1VBLA 2W1OA 3MKYB 4ITVA 4PJLA 2XF6A 5HOOA 5AMVA 3QOEA 1Z3YA 3CJQB 5KNLA 4OJ5A 4PJMA 2HDWA 4CA0A 2JJ2A 3EUKL 4BE0A 3A4CA 2CV0A 2KP6A 1E3ZA 3BCFA 3VR6A 4W8QA 3HPHA 1OOCA 4BJ5C 2A5WA 3D5SC 1V5FA 2VASA 2IXSA 3VSKA 3RQ4A 3OYEA 2IQ7A 2E5ZA 3VYSB 4II3A 3OE7A 4Z06A 3AL0B 3S3MA 2VJJA 3RPUD 2EWEA 3LNNA 3HXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLC A;  1O8F A;  4XOT A;  3B90 A;  4MR0 A;  4XM3 A;  4U49 A;  4OZZ A;  4XLE A;  2QY1 A;  4YZA A;  4W8S A;  1H80 A;  4HWV A;  2O17 A;  4XOP A;  5C1C A;  1CZF A;  4W8T A;  3VSU A;  1OGO X;  4XKW A;  2X3H A;  4YZQ A;  4C2L A;  4XNF A;  4AVZ A;  4YZ0 A;  4URR A;  3VMV A;  4OZY A;  3VSV A;  2VBM A;  2NT6 A;  1WMR A;  3GQA A;  1O8H A;  2VBE A;  3EQO A;  3FY3 A;  2O1D A;  2Z8G A;  4OJL A;  1RMG A;  4YEJ A;  3LMW A;  1PE9 A;  4U4B A;  4XLA A;  1QJV A;  1OFM A;  1O8M A;  1O88 A;  1IB4 A;  1O8E A;  2INU A;  1DBO A;  1OFL A;  1KTW A;  1O8J A;  1RWR A;  4YEL A;  3T9G A;  1BN8 A;  4XLF A;  1O8D A;  4Z03 A;  1K5C A;  4OJO A;  3VST A;  1EE6 A;  2X6X A;  2NST A;  3GQ7 A;  2NT9 A;  3JUR A;  3KRG A;  4MXN A;  1O8L A;  1NHC A;  4XR6 A;  1AIR A;  4W8R A;  2X6Y A;  2NSP A;  1KCD A;  4XON A;  2X85 A;  2UVE A;  1JTA A;  2X6W A;  2QX3 A;  4OJP A;  2NTP A;  4XLH A;  4XQF A;  2INV A;  1O8G A;  1KCC A;  2NTB A;  1DBG A;  1OGM X;  4NK6 A;  1QCX A;  3SUC A;  4PMH A;  1PLU A;  2ODL A;  3ZSC A;  1RU4 A;  5C1E A;  2NTQ A;  4YZX A;  1O8K A;  1BHE A;  1IDK A;  4XN3 A;  4XOR A;  2UVF A;  4I84 A;  1IA5 A;  1XG2 A;  2PYG A;  2PEC A;  2PYH A;  1PXZ A;  3VMW A;  2O0W A;  2O04 A;  3GRH A;  4OJ6 A;  4EW9 A;  1VBL A;  1IDJ A;  5AMV A;  2VJI A;  3GQ8 A;  3B8Y A;  4OJ5 A;  2VBK A;  2QXZ A;  4XN0 A;  4W8Q A;  3EQN A;  1OOC A;  1X0C A;  4NK8 A;  2IQ7 A;  4Z06 A;  3ZPP A;  2NZM A;  2O0V A;  2BSP A;  3GQ9 A;  2VJJ A;  1O8I A;  1JRG A;  1HG8 A;  3B4N A;  4XL9 A;  2EWE A;  3UW0 A;  4XKV A;  3WWG A;  4Z05 A;  1GQ8 A;  4XMY A; 
#chains in the Genus database with same CATH topology
 4IJA A;  3B90 A;  3N90 A;  2BM1 A;  3GVL A;  2BSA A;  3CDI A;  3K2Z A;  3K4C A;  2ACJ A;  1AMO A;  4CQJ A;  2CS3 A;  3OEE A;  2A6T A;  2PG4 A;  2VT3 A;  4E7I A;  2R7X A;  4P26 A;  1BR2 A;  1T95 A;  2O8K A;  1Z1D A;  1MGT A;  1WOR A;  2IA1 A;  4W1U A;  3MEX A;  2DJN A;  4E7L A;  2GJK A;  3GTG J;  2P5L C;  3VMV A;  2L9R A;  3H9G A;  4ENJ A;  5D8K B;  2DMQ A;  2VBM A;  3BR6 A;  1QUF A;  4A69 C;  1R4N B;  3SJM A;  4C3J J;  1BI3 A;  4ZYH A;  2LD5 A;  9ANT A;  4HG2 A;  1T56 A;  3OYB A;  4L5E A;  2Z9O A;  4CCL A;  1ZR2 A;  2E60 A;  1HDD C;  1LKX A;  5CKT A;  1QZY A;  2E1C A;  3IAM 2;  2QQA A;  5B1B H;  4DQK A;  2P8T A;  1YJW B;  5DEQ A;  1BL0 A;  1HBX G;  4NC8 A;  4Y13 A;  1ZGW A;  3RY8 A;  4OOX A;  4RB1 A;  2IS6 A;  1Z77 A;  5E20 A;  1YHQ B;  2FOK A;  4L5J A;  3S1N J;  4KIS A;  5L3G A;  1K4Z A;  3OYH A;  1W5C C;  1TVC A;  1QH0 A;  1R1U A;  4A6D A;  5DD8 A;  4B4C A;  3FHZ A;  1O3T A;  4C2T A;  3AK5 A;  1JTA A;  2VQC A;  3CCS I;  3GSI A;  4BDZ A;  1YW8 A;  3A02 A;  2JJ1 A;  4Y9U A;  4NBQ A;  4RS8 A;  2HEO A;  4IHW A;  2A6E F;  4HSR A;  1DUX C;  4DNC A;  1LLZ A;  3KX2 A;  2D2W A;  4M4S A;  2NTB A;  4J00 A;  1EKE A;  3WGH A;  1SMT A;  4RD1 A;  5FO5 A;  1GXP A;  1XMA A;  1E79 A;  3IL2 A;  3ZSC A;  4OMZ A;  3GIR A;  2IW5 A;  1GO2 A;  2LP0 A;  2DOF A;  5FNZ A;  3OYA A;  1EFT A;  3KYD B;  3CRZ A;  5ED4 A;  2VLA A;  3BP8 A;  1ZRD A;  4LFU A;  4P6Y A;  1QFJ A;  1I18 A;  3SJZ A;  2VN2 A;  1R5I D;  1XGO A;  1AWC A;  3DCF A;  1MBF A;  2GM4 A;  3I4N J;  2YPR A;  3G2B A;  5DCM A;  2VJI A;  3K70 C;  3SXY A;  1N78 A;  2Y0M A;  3HUG A;  3JRI A;  3HOS A;  3ZMU A;  3F8C A;  3CMA I;  3ECH A;  3NB2 A;  2CFO A;  1K78 B;  3I0T A;  1H9G A;  4XN0 A;  2J5O A;  5AN9 A;  2ZNZ A;  2W6I A;  5HOD A;  2WR8 A;  4YHB A;  1UG2 A;  2FNP A;  3MZ8 A;  3GME A;  2K9S A;  3E3V A;  3DKX A;  4IL6 C;  3S17 J;  3H0D A;  2O7O A;  4L8J A;  3ZPP A;  4UUT A;  3AVU A;  4YC5 A;  3ERM A;  3U6B A;  3UW0 A;  2HQ5 A;  1J09 A;  2A61 A;  2HS5 A;  2LKP A;  4Y33 A;  4A3I J;  1UD5 A;  4AID A;  4BH9 A;  3HOW J;  2GQF A;  2BE5 F;  2JIZ A;  2EZK A;  1GVH A;  3CUQ B;  2STT A;  2DMP A;  5KVR A;  1QG0 A;  3WQZ A;  3RKW A;  4IPA A;  1X19 A;  1Q9S A;  1XMX A;  4ZC3 A;  2DER A;  2RC4 A;  4X1E A;  1YJN I;  2M7B A;  3SZT A;  5J1Y A;  2MC3 A;  2EIK H;  1HKQ A;  2NNY A;  1BN5 A;  2C5B A;  2F5C A;  4X0C A;  1E3X A;  1H8H A;  5JLV C;  3OYJ A;  3FM3 A;  4Y15 A;  1U5T B;  3ONQ A;  4FE7 A;  1MJA A;  5GAH J;  3M3Y J;  5EEA A;  5HKK A;  4E4H A;  1F5T A;  1HA3 A;  1F36 A;  4IRH A;  1FNB A;  4RCZ A;  3AVT A;  3HHG A;  1K73 D;  1ETX A;  1I5Z A;  3L9F A;  1U8B A;  2NT6 A;  2JWT A;  3PSF A;  4BAC A;  2F4O B;  5F04 A;  5D4S A;  3G71 B;  3GQA A;  2KHM A;  2UZK A;  1W0U A;  4UUS B;  3I71 A;  2HVR A;  1OMI A;  1RMG A;  1G7R A;  3ZZU A;  2FU4 A;  3QQA A;  4BQN A;  2AO9 A;  3OSF A;  4O3M A;  3R0A A;  1E3P A;  2QBY B;  1TW3 A;  1WRJ A;  3HRU A;  3M8J A;  3OKX A;  2Y75 A;  2E2J J;  4G6I A;  4E70 A;  3K2A A;  5IYQ A;  2KIQ A;  2H94 A;  4TKO B;  1X2N A;  1LDJ A;  2OZ6 A;  2KRF A;  4M3B A;  1TWG J;  4UVC A;  2QEX B;  1RES A;  2CYY A;  4DYQ A;  4A5M A;  3ASN H;  1VI0 A;  5D6E A;  1USS A;  3K1P A;  1T6X A;  5F27 A;  3K1M A;  2C2W A;  1LB2 A;  1JJ8 C;  2VBT A;  2E35 A;  2R7V A;  2IOU G;  1XX5 A;  3MHP A;  2ZJQ F;  3CPW B;  2IS2 A;  3LSR A;  3OAA A;  4FE4 A;  4X7E A;  5H6Q A;  1P92 A;  1NH3 A;  2NV4 A;  1DAR A;  5DSZ A;  1ZK8 A;  1ZM2 A;  2YU9 J;  1ZRC A;  3DDY A;  3FF5 A;  4YG2 F;  2VOD A;  3K4B A;  4IHT A;  4V19 K;  2C77 A;  2NTP A;  5C44 J;  3MQ0 A;  5FJ8 J;  2ZME B;  1B8I B;  5JMC B;  3AST A;  2QQ8 A;  4AIK A;  4AF6 A;  1EFC A;  1JTX A;  3OPO A;  3LST A;  4YCQ A;  1SVM A;  5K7F A;  2KZV A;  4WZK A;  3BZK A;  1G3S A;  2W4S A;  1V5V A;  3ZPN A;  3OL3 A;  1Y8R B;  5F6F A;  1ACI A;  3I4P A;  5EG0 B;  2NVT J;  2C4T A;  1TT5 B;  3ASO H;  2GWR A;  3PNT A;  2V1N A;  1PUE E;  3NQO A;  4EJU A;  1ETK A;  3JSO A;  2FMY A;  3WOD F;  2CH0 A;  3FKS A;  4NUB A;  1B59 A;  1GJR A;  1QNT A;  4PC3 A;  3T8T A;  4NQW B;  1MDM B;  5GAG J;  2O3F A;  2HLD A;  2NS8 A;  4IO9 F;  1KK1 A;  3W5V A;  2IGO A;  3E20 A;  1KQS B;  3CJT B;  1Q86 D;  4B48 A;  4M0L A;  4OIN F;  2LF8 A;  3REO A;  1YI2 I;  1VHE A;  1BOA A;  4PFO A;  2VQG A;  1YS6 A;  1HF2 A;  3GZN B;  2HNH A;  3ZQL A;  2B9S A;  4UAJ A;  3PUM A;  2NS7 A;  2KVO A;  1JT6 A;  4YAW A;  2CW7 A;  4HOB A;  1CF7 A;  1ZM3 A;  3C7J A;  2LY2 A;  4HYE A;  3DTK A;  1RUO A;  2NVQ J;  3LO8 A;  1HA8 A;  4KDP A;  1VQ8 I;  3BG7 A;  4MNU A;  1H85 A;  1FNC A;  1LDK B;  4X7C A;  1WJE A;  1O57 A;  1QO0 D;  1T0F A;  1IUF A;  2OTL I;  2FBH A;  4M73 A;  3BRO A;  4MTE A;  4GQN A;  2GA2 A;  2ME0 A;  2UUZ A;  3Q3A A;  1FSE A;  3BCA A;  3TGN A;  3V8L A;  3E6D A;  4A3G J;  4YZA A;  2ZZF A;  1HC8 A;  3CCU I;  4V02 C;  4JX5 A;  3CXC B;  5H6R A;  4CZC A;  1FBQ A;  2M34 A;  2XRO A;  3WNB A;  5L46 A;  3AVV A;  2OBT A;  1PP7 U;  3GVK A;  4DIQ A;  2FXA A;  4LG0 B;  1JA1 A;  2GAU A;  4XRS G;  1VQM B;  1ETV A;  2F4N A;  2QSH X;  3K9T A;  2DFE A;  2ECC A;  4BNC A;  3FMS A;  2JQ7 A;  1I7P A;  5FRO A;  2XC7 A;  5IYP A;  1GT0 C;  1VQ6 B;  1O8H A;  3IKV A;  3M8F A;  1ELO A;  4V2F A;  1ZTR A;  4LIT A;  4OJL A;  2PQ8 A;  4ZCM A;  4RB0 A;  5J6X A;  2I10 A;  3CZ6 A;  1YHQ I;  2A07 F;  1LUJ B;  4KA4 A;  1OFM A;  1A8P A;  4KT5 C;  1JKO C;  4YXW A;  3V76 A;  3Q0V A;  1FRN A;  1BM9 A;  3NWS A;  3TH0 A;  3J7Y J;  2FBK A;  5IK2 A;  4HBL A;  2MC4 A;  2H8R A;  4F7D A;  2QKM B;  4BJ6 C;  5E1X A;  2BXY A;  3RSN A;  1RR8 C;  2VKE A;  5A2Q K;  4C9Y A;  4I98 B;  1EXM A;  3ROU A;  3DU6 A;  4M9X A;  2CND A;  2M5W A;  5J4V A;  1T98 A;  2JPC A;  4W8R A;  1QA2 A;  2P6T A;  2DA2 A;  5E1Z B;  5BOX A;  4KIT B;  4TT3 A;  4E0F A;  4QWQ A;  4HX8 A;  3U9G A;  1J9Z A;  2LY9 A;  3ESW B;  2VL8 A;  5HNH A;  1VQL I;  1W4M A;  1GAQ A;  1WDT A;  3H1C A;  3W2E A;  2XGE A;  3H5A A;  3BR3 A;  1H8E A;  4OU0 A;  5E3O A;  2VBS A;  1SVL A;  3GTO J;  2LY1 A;  2M4K A;  2W85 A;  4G6Q A;  3T53 B;  1K83 J;  3KP2 A;  1MJ9 A;  1S29 A;  3EPZ A;  4KFC A;  2ADU A;  3DWL E;  2CK3 A;  1KCC A;  1H89 C;  1LVK A;  2WZP P;  2R7D A;  4I0A A;  3I59 A;  3PA1 A;  3VO2 A;  3E0J B;  2KRC A;  5LHH A;  3RKQ A;  4YZX A;  5GP9 A;  4XN3 A;  2LOO A;  1APL C;  2CC2 A;  3CC2 I;  4KKT A;  1X58 A;  4MHG A;  5IOZ A;  5HLG A;  4CUG A;  1D8T A;  2O0W A;  3KP3 A;  1B8I A;  1JI8 A;  2CQQ A;  2HTS A;  5HVQ C;  2F1M A;  1F20 A;  1NHA A;  1POG A;  5IPA A;  3FPP A;  2HVQ A;  2JA6 J;  3IUO A;  4HF2 A;  1VQ5 B;  1J75 A;  4N4O B;  1KQ5 A;  4LK1 F;  1R1V A;  4Y4R A;  4PSX A;  2ZXH A;  2P4W A;  4DQ2 A;  1X2M A;  1XSV A;  4CCO A;  4G6D A;  3WU1 B;  4A3E J;  2JVH A;  3SLN A;  1X0C A;  4G6T B;  4S05 A;  4RA2 A;  3GTJ J;  1AU7 A;  2GQQ A;  2HDD A;  1K9M D;  3FX3 A;  2OV7 A;  3BQY A;  3CCL I;  1O8I A;  1L3L A;  2XAU A;  5C3E J;  1XQB A;  2QVO A;  1CLW A;  2XNJ A;  3ES9 A;  4I99 C;  3AGQ A;  1FZP B;  2BN4 A;  5LHG A;  2DMT A;  4RM3 A;  2NOG A;  1F9N A;  4HIZ A;  3GZ5 A;  4P22 A;  2DU9 A;  4UVB A;  3ELK A;  3OYC A;  3HAG A;  4AYB A;  1TNS A;  3KP6 A;  4XRM A;  2HYJ A;  2C6Y A;  2HKX A;  1HZE A;  3K4N A;  1Y0R A;  3COA C;  3GFL A;  4BKX A;  5K7Z A;  4XOP A;  5C1C A;  1R5B A;  4ZGN B;  3AAF A;  1XPX A;  2EH3 A;  4N9I A;  1ZGJ A;  2RC6 A;  2DQR A;  2ESN A;  2XKP A;  5TR9 A;  1LVA A;  5E1W A;  1ZM9 A;  4DNR B;  2QA4 B;  1MIJ A;  3AL0 C;  1YE9 A;  2PMH A;  3W5U A;  1H42 A;  2QUF A;  5IP9 J;  2BGC A;  4C0S A;  3HOX J;  4GFB A;  2XB0 X;  2FNA A;  1EF4 A;  3ZC3 A;  3QU3 A;  4G1V A;  3GWZ A;  2XUB A;  1QGP A;  3M7G A;  3MZY A;  2V6E A;  2BOL A;  2QLZ A;  1MMS A;  4D1Q A;  4N3N A;  4EJW A;  3IH2 A;  2ZTG A;  2D5V A;  2V9K A;  4ZDL A;  1T38 A;  1T6Z A;  1MSF C;  4RD2 A;  3OEH A;  4WXC A;  2IJL A;  1OCR H;  5L3E A;  2ISZ A;  4RLF A;  3I55 I;  2HOT A;  2Y9Y A;  1E1Q A;  3HC7 A;  1STZ A;  5IP7 J;  2MYS A;  3GF2 A;  4DZJ A;  3VWB A;  1U9N A;  2IGK A;  2ZBU A;  4P3I A;  3SY2 A;  5HS9 A;  3FPK A;  2X6X A;  1Z6R A;  1SAX A;  3JUR A;  2O8X A;  1UEL B;  1YG2 A;  4QVA A;  2E1M C;  4WK8 F;  2DA7 A;  1IRG A;  2BW3 A;  4NCN A;  4Y7N J;  1ENH A;  2HTJ A;  5F1J A;  2R7W A;  4XON A;  4J01 A;  3P27 A;  1Z67 A;  3LJY A;  3WU2 C;  4FET A;  4LLG F;  1KK0 A;  2XAG A;  1XGS A;  1XB2 A;  3LFU A;  4OJP A;  2A68 F;  2ESH A;  1QZZ A;  1DGW Y;  1BI0 A;  3SFI A;  4P2N A;  1VLO A;  3CCQ B;  1TZL A;  4QUZ A;  2EFQ A;  3W6V A;  4Z4W A;  1DPR A;  1K8F A;  4NBS A;  3CD6 I;  1HW5 A;  4KJZ A;  3KYC B;  2NNN A;  2B7E A;  1B6A A;  1WJD A;  4D9J A;  1SMY F;  4ZYD A;  4LG3 A;  1QCX A;  1TWA J;  3F8B A;  3S93 A;  4BU2 A;  2VBV A;  3SUC A;  4PC2 A;  4B1R A;  4G7H F;  1ZG1 A;  2BMW A;  2ZJP F;  3BQJ A;  4XD7 A;  1EA3 A;  3JAM Z;  5J47 A;  1IAW A;  1PJ7 A;  2M0M A;  1VHO A;  5FKK A;  5J8F A;  1Y39 A;  4TMW A;  1J7K A;  2PYG A;  3P7N A;  3WTT C;  2OUM A;  2ZKZ A;  4LD5 A;  1IV8 A;  2LG4 A;  5LLQ A;  2V26 A;  5ICC A;  1BI2 A;  2W1O A;  2RKH A;  4PJL A;  3WBK A;  3ECO A;  3QOE A;  1Z3Y A;  5GTH C;  3I5U A;  4OJ5 A;  4LGW A;  1FNN A;  4KIF A;  4CA0 A;  5GPC A;  4YFO A;  2XTY A;  1OYI A;  1RQP A;  4BY7 J;  4EM0 B;  3BCF A;  1GUU A;  4FIS A;  2QQ9 A;  3VR6 A;  5DNS A;  4JK1 X;  3X2Q H;  2NS0 A;  3GLX A;  4BJ5 C;  2A5W A;  3D5S C;  1V5F A;  3L09 A;  5L3C A;  2C4U A;  1W87 A;  4PAB A;  5FLX K;  2PX9 A;  3RQ4 A;  1FX7 A;  2IQ7 A;  3LSJ A;  4II3 A;  1H9T A;  3AL0 B;  5IT9 K;  2MLK A;  3QAH A;  2GXB A;  4HE6 A;  1FTT A;  1X1P A;  2M9H A;  1H88 C;  2VYQ A;  2HXO A;  1QA1 A;  3R6J A;  3R4K A;  4B09 A;  1ZRE A;  3GQB A;  5KW9 A;  3CC4 I;  1E43 A;  5EDN A;  5L3B A;  3F22 A;  3NAW A;  1IW7 F;  1NG6 A;  2OPT A;  5GTI C;  3A03 A;  1W9X A;  1CZF A;  5BPI A;  3S32 A;  3RKX A;  1BJA A;  2ZXJ A;  1KQ8 A;  1S7A A;  5CQG A;  1YTY A;  5AIP A;  2B63 J;  1W0K A;  3A0H C;  3HHH A;  4UXN A;  3CCM I;  4MLO A;  3BR5 A;  4HQE A;  1DPU A;  2JT1 A;  4NC7 A;  4H0E A;  1Q82 D;  2PI0 A;  2DMN A;  1FYM A;  5M3F J;  2X6O A;  1PUF B;  3ZQG A;  1TYV A;  1G3W A;  1B72 A;  3OYD A;  3V7A A;  3T8R A;  2VC1 A;  3G1L A;  2WJV A;  1D1N A;  1V0F A;  3IP4 B;  4TMT A;  1TTY A;  1VQK I;  5DM7 F;  3E7L A;  2INU A;  2M30 A;  4FX4 A;  2DDA A;  4Z2Y A;  2VFQ A;  4MIM A;  1VQO I;  4LB5 A;  1YX5 A;  1K4T A;  2NPF A;  3D5R C;  2UXN A;  3P9I A;  2FE3 A;  2A6H F;  4PZJ A;  1I50 J;  3P26 A;  4XR6 A;  2BY3 A;  2Z3Y A;  5CDF A;  2WAQ N;  3KEY A;  2DOA A;  1ORK A;  3A2K A;  1ODD A;  1UD2 A;  1I1G A;  2HQR A;  1VF9 A;  2GPJ A;  2QX3 A;  1VQ9 B;  1D2E A;  2DPU A;  3IRQ A;  2JTV A;  2M4G A;  4DNT B;  4QHY A;  1V54 H;  2O5R A;  4ZDP A;  1LDD A;  2LMD A;  2D9R A;  1MMA A;  4RM0 A;  1T6Y A;  4CDG A;  1U3E M;  4NK6 A;  1WPK A;  2L4M A;  1K8A D;  4PCQ A;  2MH9 A;  2Q6K A;  4MYT A;  2QEX I;  3CCV I;  3FMQ A;  1FSH A;  3C3W A;  4I0B A;  4XK4 A;  4S0H B;  3E5Q A;  4XKB A;  2FD5 A;  1N07 A;  2UVF A;  1N8R D;  2XKO A;  3ZXS A;  2NOJ B;  3OFN A;  4UNO A;  1S7O A;  3N4M A;  1Z9C A;  4F3Q A;  1K4S A;  2IT0 A;  1EFU A;  1OFE A;  2JPB A;  1O7L A;  5C4J J;  4FK8 A;  3K69 A;  3PET A;  1B9N A;  2K86 A;  4ZJZ A;  4WZE A;  4AC0 A;  3EQN A;  3CJN A;  5JR3 A;  3CCJ I;  1VF7 A;  3H3V K;  2RDP A;  3LNQ A;  1SD5 A;  5K5Q A;  3M1C A;  1S4M A;  3CC2 B;  2QQB A;  2DT6 A;  2ELH A;  4Z1M A;  1RZ4 A;  2NZM A;  1RRJ A;  2VT2 A;  2KLO A;  4UZU A;  2BY2 A;  2CUF A;  1BPL A;  3ABU A;  5CJ9 A;  3TOA A;  2KDO A;  1LFP A;  2R7U A;  2QYO A;  2WPD A;  3B73 A;  1TYU A;  2R6H A;  3A1Y A;  1AKH B;  2OQG A;  2XSD C;  1W34 A;  3KYL A;  3MKW B;  3IAS 2;  3BOQ A;  3RI4 A;  3AGP A;  4XOT A;  2MSY A;  4LIU A;  1G4D A;  3D0S A;  3J80 K;  1P9Q C;  3LSI A;  3OW7 A;  2VKD A;  2KIF A;  4Y3O A;  1OB2 A;  1SFU A;  3E5X A;  1XB4 A;  3HRS A;  1GAW A;  4N0B A;  2VZL A;  3G1O A;  3TO7 A;  3AG4 H;  3GTQ J;  4UZE A;  1OGO X;  2PEX A;  1FPQ A;  3BH7 B;  3WTX C;  1I3A A;  1Y1V J;  2WWY A;  2X9D A;  3ZR8 X;  1ONV A;  4G1B A;  2ZME C;  3CME I;  2Z33 A;  1MMN A;  2RRE A;  3PNY A;  3PIO F;  1Z7L A;  1MNE A;  3T1B A;  3ZBT A;  4RGX A;  4N4N B;  1QX4 A;  2Q6I A;  2GIV A;  2ZME A;  1MBK A;  2FRH A;  2VBE A;  5D5X B;  2ZXW H;  3EDP A;  2Q1Z B;  1BR4 A;  3DFG A;  5DYM A;  2I8D A;  3WTS C;  1E64 A;  4RAY A;  2VPL A;  2RV8 A;  2XZL A;  5LD2 C;  3VFZ A;  3ASR A;  5EG0 A;  5CVJ A;  1RWR A;  5FKO A;  2ZL7 A;  1Y6I A;  4YFK F;  2AXL A;  3OZW A;  4I2O A;  2W57 A;  5D5W B;  1YJW I;  4WXD A;  1J0R A;  5EJC A;  1W1W E;  2GIZ A;  2E2I J;  1BIA A;  4O6J A;  2GXA A;  2YX7 A;  4G5G A;  2K9L A;  2ZBK A;  3I53 A;  4F92 B;  3JU4 A;  2LBF B;  5J1U A;  3MWM A;  5EGO B;  1VQM I;  2GLO A;  2OTJ I;  4ZDO A;  4HE5 A;  2X6Y A;  3KLN A;  1TBX A;  2OZU A;  4IRG A;  1ERD A;  2K3F A;  4BDY A;  4HLY A;  2BF4 A;  1J59 A;  1KZL A;  4RBO A;  1YIO A;  1DGR M;  2X6W A;  3NRV A;  2J8K A;  3CES A;  1W2B B;  2LFB A;  1HKT A;  1J5Y A;  4LJZ F;  3L2R A;  1VQP I;  3MKL A;  3QYE A;  2Y2Z A;  2DA4 A;  2Y31 A;  4F52 A;  3ZRG A;  4U7D A;  4JP0 A;  2EFW A;  3F3X A;  3S14 J;  1N25 A;  1IRZ A;  2CUE A;  1FOK A;  1D5Y A;  3F0C A;  3FWE A;  1WJF A;  4IQ4 A;  2HKO A;  4MGR A;  1ZG3 A;  4UB8 C;  2QWW A;  2TRT A;  1IDY A;  3DBH B;  1RIO H;  4ABZ A;  1TSP A;  3O2P E;  4M71 A;  1JNY A;  4JX4 A;  4A3L J;  3GFI A;  4JX6 A;  5LEK A;  4BBS J;  4M2L A;  4HQM A;  1E17 A;  5GAD J;  2AQF A;  3F6O A;  3K7A J;  5H2F C;  4YAO A;  2R0Q C;  3WTW C;  4KIB A;  3V7R A;  1BX0 A;  3DTI A;  1I27 A;  2KRH A;  4LMY A;  1E0E A;  4Q4Z F;  1YX2 A;  3BH4 A;  4BPR A;  2QXZ A;  4OWR B;  2DCU A;  2MAB A;  1YIJ B;  2OTL B;  1B9M A;  4UV9 A;  3ZQC A;  3B02 A;  5CYV A;  2OD5 A;  3FDY A;  5JI6 A;  2OAZ A;  3VOE A;  1UB9 A;  1JUS A;  1F1Z A;  1XSX A;  5TJJ A;  3CW2 A;  1GLN A;  4Y17 A;  3PFI A;  2DMU A;  4M72 A;  1HG8 A;  2ELK A;  1VQN B;  2R7T A;  3Q39 A;  1AHD P;  1YIT I;  1OGJ A;  1DDG A;  3WWG A;  2EIJ H;  5IOY A;  2NAZ A;  2X53 S;  4P1V A;  1VQ7 I;  3CCR B;  4Z05 A;  3VPR A;  1B4A A;  2P81 A;  5LFA A;  1BX1 A;  1BOB A;  2QM3 A;  2HZT A;  2E7W A;  4RAF A;  2QSF X;  2BM5 A;  2EJR A;  2NYX A;  5F0F A;  4D5C A;  3H5R A;  2PMU A;  1WJC A;  1XFO A;  1QRC A;  3SLD A;  1UCR A;  4OPS A;  4W8S A;  5CVV A;  2GK6 A;  2WA0 A;  3CC7 B;  1Z91 A;  4PAA A;  1IRX A;  2FOW A;  4B3F X;  2V31 A;  4FXU A;  1MKM A;  4IQJ A;  2LNB A;  2XHK A;  4LOC A;  2XGJ A;  3Q6R A;  1K61 A;  2UV1 A;  2RC5 A;  4A3M J;  2KL4 A;  1VJS A;  1Z21 A;  4R1H A;  1WMR A;  2XAQ A;  1XS9 A;  5DUI A;  1W7P A;  5E3L A;  1FBU A;  3L7W A;  2F5F A;  3HKZ A;  1UAA A;  2O9L A;  3QPT A;  5ICE A;  2D1V A;  1VQN I;  4V2G A;  1UHM A;  1FMW A;  5DS0 A;  1QJV A;  3JRB A;  1OCT C;  1BC8 C;  3BJO A;  1TLL A;  3CMM A;  1Z0X A;  3CF5 F;  3KET A;  4IXA A;  1SFX A;  2R7O A;  2K7L A;  1JUM A;  5E18 F;  3MKZ A;  2GJR A;  2XZP A;  4OJO A;  2L9N A;  4ASU A;  4M3E A;  1JB9 A;  2WBM A;  2VNH A;  2XND A;  2V9V A;  1YO5 C;  1MH3 A;  3JQQ A;  3WE2 A;  2V7Q A;  5IYD J;  4X8I A;  3U6K A;  3JRE A;  2F4I A;  3KCC A;  1EP1 B;  3RJP A;  3A3B A;  3GO5 A;  4X05 A;  3TQN A;  1AIR A;  3KE2 A;  3VNU A;  1T8I A;  1Q1H A;  2WC2 A;  1A36 A;  2K5C A;  5JVG F;  1MH4 A;  4Z4U A;  1XN7 A;  4OP7 A;  1SD6 A;  1UJ8 A;  2HWV A;  2XEX A;  2FUG 2;  2QZA A;  3CCE I;  1ZGA A;  3IWZ A;  4RAG A;  1KZH A;  3SDG A;  4BE1 A;  4P9U A;  2FA5 A;  2CU7 A;  3KEQ A;  2W82 A;  4YFX F;  1WHU A;  1FLI A;  3TED A;  1JXS A;  2VOO A;  2W24 A;  2LK2 A;  2YWH A;  2HOE A;  1D8J A;  3F9K A;  2X8K A;  4MFE A;  1IJF A;  2QTZ A;  3ZCO A;  4DZP A;  3S2D J;  2EFO A;  4KMF A;  1OGM X;  4Z6Y A;  1Y0N A;  3L2U A;  1IV6 A;  3BG9 A;  1QU3 A;  3ZN0 A;  2CGP A;  1FBS A;  2QZ8 A;  2VXZ A;  1UHW A;  5F64 A;  1ZN2 A;  1U2R A;  2KKO A;  3BY6 A;  3V4G A;  1XGM A;  2OA4 A;  2LVS A;  1FYL A;  1KD1 D;  4IW3 B;  1LEB A;  1DP7 P;  4A2U A;  2ZJ2 A;  2IBD A;  4M9Z A;  4RDK A;  3OYK A;  3VDX A;  2JA5 J;  3M4O J;  1PJ5 A;  3CO7 C;  2KFD A;  1FEX A;  2DJI A;  2K9N A;  4E7H A;  1ON1 A;  5IT3 A;  4RPD A;  4FT8 A;  2VBK A;  3HYI A;  1Y8Q B;  2K9M A;  1CNE A;  3RZD J;  2R4G A;  5TY0 A;  2VFO A;  2R5Y A;  1IDZ A;  2AQE A;  3O8G A;  3DXJ F;  5FRN A;  3N05 A;  2DPD A;  2BW3 B;  1ZM4 A;  1WJA A;  2PMZ N;  3FBI B;  4XL9 A;  2VBW A;  3DEU A;  1Q1V A;  4F55 A;  5BMZ A;  4XRS A;  2FJ1 A;  1OLT A;  3TDZ C;  1YRN B;  4OIP F;  2CQK A;  2R9V A;  3LSG A;  3CME B;  3BJ6 A;  2WAF A;  4JBA A;  2OTJ B;  1XDS A;  4WF2 A;  5L3D A;  1QPI A;  2XTW A;  4O5V A;  2WV0 A;  2VUM J;  3W2H A;  1YW9 A;  3QPH A;  1QVG B;  4PFP A;  4GCV A;  4UUV A;  1O7F A;  3S15 J;  2V7T A;  4A12 A;  2XRN A;  3HUG B;  1OYW A;  1KON A;  3RPU A;  4B8X A;  5B5E C;  3J81 Z;  4C2M J;  2EFN A;  4RGU A;  5FLV A;  3K10 A;  1BIB A;  2WAE A;  3DBR B;  1DQU A;  1IN7 A;  3FXR A;  3K4L A;  5IYC J;  2E5N A;  2JUG A;  2CQ7 A;  2EV5 A;  2ME6 A;  2DO7 A;  2MG4 A;  1I1S A;  4G94 A;  2YR2 A;  1RKT A;  1WXR A;  3OV8 A;  4ACB A;  3I56 I;  3HOU J;  2Y0S N;  2VXD A;  4WWV A;  2QGG A;  5ILS A;  3LMW A;  1B1B A;  2K85 A;  2WTE A;  4PGH A;  3NAR A;  5F0H A;  4DK0 A;  1W7P D;  3IV5 A;  4U9U A;  3K4J A;  4ZGQ B;  3ABK H;  4E6K G;  2ZJR F;  1YLO A;  1HKS A;  1OCC H;  5FFX A;  5E8G A;  4E7S A;  3GTP J;  1IB4 A;  4NHJ A;  2XF7 A;  2BY1 A;  1P7J A;  1U78 A;  1H0M A;  3SEZ A;  3CCJ B;  1QHH D;  1MAB A;  5D5U B;  1TTT A;  4HF1 A;  4M1K A;  2CQN A;  3BTI A;  2F1L A;  3ZIA A;  4CYC A;  1P7I A;  3QE2 A;  4RD0 A;  2OK8 A;  2HCJ B;  4R71 A;  1TWH J;  2FF4 A;  3IC7 A;  4G9Y A;  1NHC A;  1R49 A;  4DYC A;  3MD2 A;  3DF8 A;  1JJ2 B;  3OIO A;  4CCJ A;  1KU9 A;  3HG9 A;  3K6G A;  4C30 A;  2ID6 A;  2H6B A;  1IXS B;  1SAU A;  3IH4 A;  4A0Y A;  3JX8 A;  1Y56 A;  2ZIT A;  2EZL A;  4UB6 C;  3M07 A;  3OYN A;  1WGX A;  2Y48 A;  2PFB A;  1IHM A;  4OAZ A;  3JR9 A;  2V7W A;  2E36 A;  2PJR A;  2B5O A;  3W2I A;  1VND A;  1N05 A;  3H09 A;  2VNK A;  1VQK B;  2VOP A;  2FQ3 A;  2XGX A;  3HDD A;  3GFM A;  3Q9S A;  1I6H J;  3BG3 A;  4EM1 A;  4RD3 A;  3LSH A;  2O61 A;  3I55 B;  3F6V A;  1D1C A;  4I6Z A;  3LQE A;  4UHT A;  2KJC A;  4XKC A;  4BXX J;  4A3D J;  1DG1 G;  4HZF A;  3QFS A;  1RU4 A;  1R6R A;  2YSR A;  2RQP A;  3SFZ A;  1S72 I;  5C1E A;  2FX3 A;  2KDZ A;  2XGC A;  2DA1 A;  3BTJ A;  4J19 A;  3U1K A;  2VFM A;  3VSL A;  5K7H A;  1XG2 A;  4I01 A;  4L0Z B;  2V4J C;  2VIX A;  3A8K A;  3WE3 A;  1RUN A;  2HDN B;  1XMK A;  3LYC A;  3H9N A;  4ITV A;  1FOW A;  2CJJ A;  3RYP A;  1K6O A;  2L7M P;  5E3M A;  2HDC A;  1P6R A;  1Q7Y D;  3EUK L;  2DYS H;  1FND A;  3NEU A;  2UXX A;  2X4H A;  1OOC A;  1TQI A;  4FQG A;  5FLX Z;  1QA6 A;  5D5V B;  3OYE A;  2QCO A;  2OF7 A;  1JKP C;  3S3M A;  4IOC F;  3IKT A;  2YUS A;  2BEO A;  4IEJ A;  2VE9 A;  2VNI A;  4A5N A;  1REP C;  4HA8 A;  4N9H A;  2KT0 A;  2VI6 A;  2BGJ A;  3B6A A;  4HAM A;  3U2R A;  1IJW C;  2XNC A;  1U8R A;  1MMD A;  3CP2 A;  3VNV A;  3FIW A;  1W36 D;  3OYF A;  1UFM A;  1BI1 A;  1QZE A;  4TN1 A;  3I56 B;  4CCM A;  3JAM K;  1RI7 A;  2L7K A;  2OBP A;  2BHY A;  6PAX A;  3DU1 X;  3FHN A;  1WTH D;  4FCY A;  2LR8 A;  2VFP A;  4YEI A;  3L2W A;  4FX0 A;  3A01 B;  2O6W A;  2E1N A;  3JRD A;  4BXU A;  1UD6 A;  4KYW A;  1COW A;  4YZ0 A;  3JRA A;  4URR A;  4M3G A;  5J40 A;  3HOZ J;  3BDD A;  1HOM A;  2H1L A;  1P2F A;  4EEF G;  2VC0 A;  2XVC A;  4P5O A;  3TP0 A;  3V42 A;  2K9Q A;  5FLM J;  2K4B A;  2DFI A;  3FKI J;  5DD4 A;  3UKG A;  1RKW A;  4CSW A;  4ACA A;  2GXG A;  2JZY A;  4AYB N;  1CF7 B;  4QV2 A;  3BTL A;  5LMZ A;  3N6Z A;  3DEE A;  5KAI C;  4XLA A;  5EZG A;  1R23 A;  5HLT A;  2XOK A;  3WNC A;  4G7W A;  2OU2 A;  3BC8 A;  3OOU A;  1YQA A;  4M6V A;  4DJA A;  3CF2 A;  1T2K A;  4NNJ A;  4BGD A;  3E6C C;  3LSP A;  3H35 A;  2DCE A;  1X3U A;  2M3A A;  4WWC A;  1SFE A;  3TOB A;  1K28 D;  3T51 B;  4BE2 A;  4M6Y A;  2L3D A;  1YJN B;  1QFZ A;  2GOM A;  3N97 A;  3W5H A;  3TW7 A;  5E17 F;  3FXQ A;  2DIE A;  1C0W A;  4GYI A;  5LRR A;  2BM4 A;  5AON A;  3IH3 A;  2COM A;  4ASN A;  5DV5 A;  5DM6 F;  2HXI A;  2OQR A;  2R7Q A;  4JOM A;  4TMV A;  3ASQ A;  4ANJ A;  4CYD A;  2VBU A;  4AIH A;  2NSP A;  3PUB A;  3HL2 A;  4KKU A;  2CO5 A;  5ICF A;  2UVE A;  3QU6 A;  2XSJ C;  4EVI A;  2X0K A;  3LQ6 A;  2JRM A;  1K6Y A;  3K4K A;  4XLH A;  2RN7 A;  4C3H J;  1W5T A;  5EGO A;  3C18 A;  3JQR A;  5HZB A;  5J3L A;  4JMQ A;  2DA6 A;  5JVT A;  2PBI A;  1OJL A;  2WY8 Q;  3KEO A;  1P4X A;  2LDU A;  3V7C A;  3OYL A;  3R0J A;  5DCM B;  3CCS B;  2Z2S B;  1H8A C;  3W2F A;  2WYR A;  2JN9 A;  3GLL A;  3NWT A;  1GHC A;  1ZAO A;  3MAJ A;  2V6C A;  2LRE A;  3ISP A;  4Q7J B;  1MD0 A;  3PO3 J;  3ZMZ A;  3BCB A;  3HIF A;  4EAT A;  4LBW A;  4EH1 A;  3HTS B;  5HXB A;  4G7Z F;  1UMK A;  2ID3 A;  5KSW B;  5IYW A;  4I84 A;  1UD4 A;  2DEU A;  1K7A A;  3AVW A;  2PEC A;  3J7A Y;  1O3Q A;  3JQP A;  2LC2 A;  2Q6L A;  5B3S H;  4L18 B;  3GQ8 A;  3S1R J;  2WZN A;  5L3F A;  4KMU X;  4IF4 A;  5LGU A;  4XBF A;  2NVY J;  1QGZ A;  1JGS A;  4IHS A;  1S0U A;  3E1Y E;  1R1T A;  1ZLJ A;  3PQK A;  2M5S A;  1RR7 A;  2XDV A;  5E3N A;  4MO7 A;  2R93 J;  2Q6O A;  4OAY A;  4I76 A;  3F21 A;  3O6B B;  3GW2 A;  2AXT C;  3BQZ A;  2WY7 Q;  4EQQ A;  1MBE A;  2LYC A;  1T0F C;  4P55 A;  1G7C A;  1JRG A;  3B4N A;  4E7Z A;  1WP6 A;  3HSR A;  3HOY J;  4F93 B;  4XMY A;  3WY9 A;  4RD4 A;  2QEN A;  4OOS A;  3AG2 H;  3FMR A;  3LOC A;  4ESB A;  3G05 A;  4MR0 A;  4QTR A;  4W97 A;  1DU6 A;  4U49 A;  2KPM A;  3W6K B;  4XLE A;  4OMY A;  4DQL A;  4I02 A;  3QYF A;  4HWV A;  2ICW G;  1ULY A;  3PEN A;  3VSU A;  1X3W B;  5J35 A;  3ML6 A;  5EEG A;  4B44 A;  1RNL A;  3IHU A;  2LKS A;  2IS4 A;  4U0W A;  1WH5 A;  4YFN F;  2BVL A;  2M8E A;  4YRV A;  3GZ6 A;  2VFN A;  4OZY A;  4WCG A;  4KNY A;  3H9Q A;  2BBY A;  1BW5 A;  2ZXI A;  1R71 A;  4PSW A;  1BR1 A;  3OL4 A;  1OYY A;  2V1D A;  5JLW A;  3CCL B;  1EZG A;  2O1D A;  3WTV C;  4RDL A;  1TWF J;  3GCM A;  3VB2 A;  1X4O A;  1D1B A;  1FP2 A;  4PK4 A;  2EQR A;  4X06 A;  5THX A;  3F23 A;  1KGS A;  1MJB A;  3FIS A;  3OY9 A;  2Y0S A;  3SEJ A;  4YDT A;  1KTW A;  4B3G A;  2H6C A;  2QGU A;  3ML3 A;  2DXI A;  1FX0 A;  2L0K A;  2CUZ A;  4RLQ A;  2CUJ A;  1WI9 A;  1OKR A;  2V9P A;  3DU5 A;  3DLL F;  3CTA A;  4OOV A;  1G2H A;  1O8L A;  1Z05 A;  2M0C A;  3ZMT A;  4J0Q A;  1TW2 A;  4BYY A;  2EZH A;  1I3Q J;  3HOT A;  1KK3 A;  4R79 A;  1V55 H;  4HNT A;  3BNW A;  3RKY A;  1KCD A;  4Y52 J;  3SEQ A;  2I1L A;  4OIR F;  2K4J A;  2MD5 A;  4JYK A;  1P4W A;  4I09 A;  4DGW B;  2BV6 A;  3LSK A;  3WTZ A;  2HYF A;  1L0O C;  2X1E A;  4A3J J;  1S8N A;  5BNG A;  2CQX A;  3KZI C;  2WAQ A;  2L54 A;  2A3S A;  4CH7 A;  4LC0 A;  2DQL A;  2MD0 A;  1IG7 A;  1O8G A;  1KYZ A;  4ZCL A;  3I54 A;  3FXU A;  3AG3 H;  1LJ9 A;  1JT0 A;  4OIO F;  4CCK A;  1TNT A;  1TLH B;  2MH2 A;  3LQQ A;  2R7R A;  1OCP A;  3O8H A;  3QRF F;  1EJ9 A;  1ZUN B;  4FAS D;  2R3S A;  1K79 A;  2DFH A;  2J7K A;  3EUA A;  1R5O A;  1G59 A;  4N3G A;  4XOR A;  2XC1 A;  2PN6 A;  1KTV A;  2YUH A;  1WJ5 A;  1KJZ A;  3SQV A;  4BBR J;  2X48 A;  3AVY A;  2PYH A;  2IRF G;  1JA0 A;  1FYK A;  1IXR C;  1S5L C;  1R58 A;  4NDL A;  3OJX A;  3A35 A;  2ZBV A;  2VB6 A;  2M2E A;  4IZZ A;  2HOA A;  2YWF A;  3JW4 A;  4KN4 X;  3QYB A;  1ETW A;  1KC8 D;  1JTY A;  3TMO A;  2ELJ A;  1LFB A;  2JK3 A;  4MFD A;  2RQQ A;  4QSH A;  1WZ2 A;  3VYT B;  1OGI A;  1A04 A;  1ZKG A;  2KJB A;  2X1D A;  4HX4 A;  3I4M J;  3CO6 C;  3TO9 A;  5H20 A;  4NK8 A;  5FKL A;  2YWG A;  2YX4 A;  3CLQ A;  2DTR A;  1U6G A;  4RDJ A;  5JBQ A;  4HST A;  3OMY A;  1OIS A;  4YII A;  2XPW A;  1MDM A;  2KZG A;  1Y0U A;  2XT4 A;  1IN5 A;  5B66 C;  4BL0 B;  1UD8 A;  1IGN A;  1O8F A;  1B2R A;  3CUQ C;  1ETO A;  1NTC A;  1ZG5 A;  2B0R A;  1OPC A;  2HMA A;  2X51 A;  4LIV A;  1VQL B;  3PVD A;  1T33 A;  1WJB A;  3E5U A;  4YAF A;  2QY1 A;  2RVC A;  3HSE A;  3ZMS A;  1MMG A;  2CW8 A;  3QOP A;  2PJR B;  2WJY A;  4Y9R A;  1MBH A;  5JHF A;  2Q0O A;  4L9N A;  4QPO A;  4CHU A;  2QN6 A;  2ZB9 A;  4PJ0 C;  4R8H A;  4YZQ A;  4AM3 A;  4RCY A;  4E7K A;  5LBQ A;  1E63 A;  1SFO J;  2H1K A;  3K1N A;  4IHX A;  4AVZ A;  1B72 B;  1HW2 A;  4LLL A;  2GJP A;  5EMN A;  4KT6 A;  2NVU B;  3CCU B;  4P6V F;  1XE1 A;  2RNJ A;  1UHS A;  4IOA F;  3DPT A;  1GV2 A;  5KHD A;  3JRF A;  2ZZE A;  3C1D A;  2R7S A;  2E19 A;  2NRA C;  1GXQ A;  1WSU A;  1FWZ A;  3OS0 A;  3AG1 H;  1IN8 A;  2DI3 A;  2JMW A;  4PJJ A;  1BBY A;  3RDI A;  3SKB A;  3G4S B;  5M5Y J;  1RET A;  2YU3 A;  1S9H A;  1WWX A;  3CCE B;  3DV8 A;  3S16 J;  1A31 A;  3HTU A;  3SHF A;  1PVE A;  4A6E A;  1KU7 A;  4M9S A;  4HDV A;  2CG4 A;  3HJE A;  3BG6 A;  3OR2 C;  2E1M B;  3D1N I;  5F0C A;  1VFC A;  2BVM A;  2E1R A;  5BSX A;  2LKX A;  2BHZ A;  3R6K A;  3ZQ7 A;  1A5J A;  3UR3 C;  4RB2 C;  2FQ4 A;  3K0L A;  4PGG A;  3JTG A;  1JKR C;  4DK1 A;  2P5K A;  1W0J A;  3PM1 A;  2W00 A;  4CCN A;  1RPW A;  3A0B C;  3KIO A;  4GO1 A;  3TBI A;  1OCZ H;  3OSG A;  2OYN A;  2XZO A;  4X7F A;  2XAJ A;  1FIP A;  4LBZ A;  1W0T A;  2E34 A;  3CUO A;  3SZG A;  2Z99 A;  2L01 A;  2L7F P;  4A0X A;  1JUP A;  2HGC A;  4AUX A;  3L1P A;  2INV A;  2OBR A;  2CV2 A;  2QA4 I;  3WYA A;  5CVR A;  5CPR B;  1CQX A;  3OW2 B;  3ASP A;  5B6I A;  3GBG A;  3CQZ J;  2XPU A;  4L9T A;  1O3R A;  1NBM A;  2K02 A;  4Y7C A;  3DQV C;  2XIG A;  4E7J A;  3K70 D;  2LH9 A;  1LE8 B;  3FM5 A;  3QOD A;  2WB1 A;  2FML A;  1B23 P;  4DBR A;  2Y9Z A;  1WU8 A;  1BHE A;  2JA8 J;  1IDK A;  3W6J B;  1IJE A;  5BQT A;  3DTE A;  3RCO A;  1GVJ A;  3B82 A;  2K3P A;  4P3Y A;  4UZF A;  1N75 A;  1I6X A;  5F4J A;  1WKM A;  2P0W A;  1ZRF A;  5H59 A;  5FL7 A;  2WAD A;  1JE8 A;  2F5E A;  1NG7 A;  1E1R A;  1XCB A;  5E8I A;  3B8Y A;  1BJZ A;  4XID A;  2VKV A;  1TQP A;  1QQI A;  3HB9 A;  5DS9 A;  2Q8K A;  1VTN C;  4GDF A;  1MZB A;  2W6J A;  1ZEL A;  2KMU A;  3GVA A;  1L1I A;  2IAI A;  1EWY A;  3A8J A;  2COB A;  3CP8 A;  5EEH A;  3L2V A;  4PC6 A;  4KIG A;  1RC9 A;  1YIT B;  1VQ4 I;  2EK5 A;  3Q0U A;  1VLY A;  3ZQI A;  2GRE A;  4WX9 A;  1T5E A;  3MMY B;  4F91 B;  4AC9 A;  2DA3 A;  4BUP A;  3BG5 A;  1WCM J;  2XRL A;  1QPM A;  2L2O A;  3OZU A;  1FNM A;  3DEW A;  1MNM C;  1ZYR F;  4D7M A;  3WHB A;  1Y1W J;  1LM1 A;  2ZL6 A;  1QQ1 A;  1X1B A;  3CC7 I;  3JRH A;  3AKZ A;  2XTX A;  3S8P A;  3SZE A;  2EIL H;  1LQ1 A;  3HGY A;  3M9A A;  2HQA A;  2A69 F;  2GOX B;  2BXZ A;  1KQ0 A;  2Y69 H;  5JLX A;  3U21 A;  1OR7 A;  3E6M A;  4RJL A;  1FY7 A;  2C5H A;  4XNF A;  4AU7 A;  2VBX A;  2CBX A;  2QDX A;  1MW7 A;  2OBS A;  3MZH A;  1TYX A;  2OK7 A;  2DFF A;  3VSV A;  3L2C A;  1KU3 A;  2GBY A;  2JRT A;  3PIP F;  3EYY A;  1GDT A;  4Z4R A;  4I7H A;  5E6T A;  3LMM A;  2CSO A;  4CO8 A;  3RYR A;  5CVI A;  5LHI A;  3Q3S A;  2M87 A;  1FIA A;  2KIU A;  3E6B A;  3MCZ A;  4OPW A;  2GK7 A;  1O8M A;  3P4G A;  3BY1 A;  2F48 A;  1YIJ I;  4ZYG A;  4B3A A;  2WSS A;  3WND A;  4B3X A;  5DN6 A;  1P4A A;  3LFK A;  1BN8 A;  4HRI A;  1K5C A;  5CQE A;  5FKM A;  1PKV A;  1QHG A;  2XAS A;  3AVX A;  2P7C B;  1ZH5 A;  3DP7 A;  4ON0 A;  2IVM A;  2K27 A;  2CFX A;  1HVX A;  3ONU A;  5K5R A;  1I39 A;  5M3M J;  1LFU P;  3D5L A;  4EJT A;  1QGY A;  2F5D A;  1XSD A;  3QFC A;  3H3U A;  1VQ7 B;  3KP7 A;  1NK2 P;  1EH8 A;  3W3C A;  2BM6 A;  2EV6 A;  4KUM A;  3ZPL A;  2ZSI B;  3E1S A;  3QFR A;  1V3F A;  2G0E A;  3BZC A;  4YIR X;  4MQ9 F;  2HI3 A;  2O03 A;  4L9V A;  1AOY A;  1HF0 A;  2D3L A;  4ENK A;  1KMH A;  1DDI A;  4P96 A;  2P3M A;  4JRA C;  3W2W A;  1KU2 A;  3BR2 A;  2FBI A;  2MBF A;  2W7Z A;  5M5X J;  1VZ0 A;  2N8G A;  3LQR A;  1N0V C;  4LK0 F;  5BSY A;  1WFX A;  1UD3 A;  3BPV A;  3BT9 A;  1YJ9 I;  2ZNY A;  3EUH A;  1D0X A;  5JFR A;  1GV5 A;  4PMH A;  1PLU A;  4KIC A;  4U7B A;  1N77 A;  1CGP A;  4P9S A;  1WI3 A;  2DOE A;  2FEZ A;  1UZC A;  3P5J A;  2R5Y B;  3CCM B;  3A3G A;  1W36 C;  1BQE A;  1SFK A;  3C2G A;  3ABM H;  3KLO A;  4C43 A;  2VQH A;  2AHO A;  3MVP A;  1IUY A;  5IYN A;  1D0Y A;  4EW9 A;  1Z6T A;  4Q47 A;  1YRN A;  3P9K A;  2HVS A;  1NDH A;  1VBL A;  5HOO A;  5EYR A;  1BW6 A;  3CJQ B;  4XLN F;  2LF7 A;  5KNL A;  4Z4S A;  4BQA A;  2HDW A;  4ENM A;  4YAU A;  3U1D A;  4BE0 A;  4D5F A;  4HDU A;  1WOO A;  1BJK A;  4IRI A;  5HDG A;  3HPH A;  4NC6 A;  3ZBU A;  2XPV A;  4KH3 A;  2VAS A;  3P9C A;  2IXS A;  2GZW A;  2DYR H;  3VSK A;  2DET A;  3VYS B;  2V7U A;  3OE7 A;  2JUC A;  2EB7 A;  4MEX F;  3PQJ A;  2VJJ A;  3RPU D;  4TV7 A;  5FA6 A;  3VO1 A;  2EWE A;  1XCV A;  4DYR A;  3HZJ A;  1R22 A;  1M1K D;  2L4A A;  3HXL A;  3NAU A;  3PFY A;  4CGZ A;  2H8W A;  3FJO A;  4HNU A;  2QTL A;  2CWE A;  2OCE A;  3I3L A;  5GPA A;  4LLN A;  2BPO A;  2YWE A;  4EGZ A;  2W48 A;  1FMV A;  2DBB A;  3QWL A;  1HSJ A;  4H4K C;  3VYR B;  4S04 A;  1G7T A;  3OOC A;  4Q5S F;  1H80 A;  3CCQ I;  3ABT A;  3ZMV A;  2V4D A;  2PLY A;  4W8T A;  2BM7 A;  3ZGK A;  2QBY A;  3MCA A;  3B8H A;  3C2B A;  1R5N A;  4QFM A;  3H5N A;  5B1A H;  1S7E A;  4RGS A;  1R5G A;  5FGM A;  2XV4 S;  3OR1 C;  2LBF A;  3A1P A;  1TT0 A;  5D8L B;  5D4R A;  1GVD A;  2AHQ A;  1M90 D;  1NB9 A;  4BEH A;  3LVB A;  4IHV A;  5LGN A;  4EJV A;  1WSV A;  2XB5 A;  1X1D A;  1SC7 A;  3QFT A;  2W84 A;  1ZHF A;  3B6C A;  2ETH A;  3FY3 A;  3PO2 J;  1XC5 A;  4U4B A;  1J9I A;  3PJR A;  3OYI A;  2JDI A;  3EUH C;  1WOP A;  4Z4V A;  1M1E B;  3I1F A;  2HU9 A;  2PMZ A;  3O3K A;  4FHT A;  4M6X A;  3JCU C;  2ECB A;  2IP2 A;  3LA7 A;  4C3I J;  2QMU A;  1OFD A;  1HDP A;  5F4M A;  4RGR A;  5BPD A;  1EFR A;  3H9J A;  3FXO A;  1EH7 A;  2NT9 A;  3LWF A;  3GTK J;  1OFC X;  2VBY A;  3FXK A;  3TP3 A;  3CMY A;  3RPQ A;  2H27 A;  5CLS A;  1RQR A;  1NK3 P;  3J7Z I;  2H09 A;  3WTU C;  2G7H A;  3GFJ A;  4ZH4 F;  1BLI A;  4FTH A;  5DDG A;  3TO6 A;  2J5P A;  3BR0 A;  2M8G X;  2HYG D;  3FZV A;  4RM2 A;  1FDR A;  1VQO B;  2E2H J;  2D3N A;  1E3O C;  5FO1 A;  4HV5 A;  3R60 A;  1Y0Y A;  2EFP A;  4XSZ F;  2E71 A;  2JVG A;  5DUK A;  4A3B J;  4TMX A;  4OM9 A;  4AWX B;  1YS7 A;  1ZAR A;  3BZ6 A;  1G8X A;  1D1A A;  4CXF A;  2V1U A;  1SKQ A;  4GYG A;  5FIU A;  2L9S A;  3C2H A;  1IN4 A;  3BPX A;  3PNV A;  4K2E A;  2IGM A;  1DBG A;  2DLL A;  5HLH A;  1CQT A;  1IB0 A;  3WBJ A;  4TMZ A;  2F6C A;  2DYI A;  2B7B A;  2O0Y A;  4YAL A;  1YW7 A;  2TDX A;  1W7P B;  1IA5 A;  2XAH A;  4LB6 B;  1VQ5 I;  3CJR B;  2A5Y B;  1XTA A;  4QIW N;  1X3Z B;  1IDJ A;  5FFZ A;  1AKH A;  5F1R A;  1PUF A;  5HNF A;  3RIQ A;  4U0V A;  5J4Y A;  1OR7 C;  2V79 A;  4JQF A;  2R5Z B;  5GV8 A;  2DT7 B;  2MGQ A;  3JSP A;  1QVT A;  1JGG A;  5IT9 Z;  1FOX A;  2EA2 A;  2VKH A;  2BGI A;  2K40 A;  4IVN A;  4HV6 A;  4Q48 A;  4PJN A;  1HCR A;  4ZCI A;  5K1Y A;  5TRD A;  2HZD A;  1P4M A;  5FRM A;  4RAZ A;  4XIC A;  2WB1 N;  3RTR A;  2M45 A;  2MA3 A;  2WV1 A;  1S6L A;  4P12 A;  3GXO A;  2DK5 A;  1V4R A;  5HS8 A;  1FJL A;  2CV1 A;  1KQ9 A;  2QSG X;  1KRH A;  1G7S A;  4A3K J;  2F43 A;  3H0G J;  4LBY A;  2JA2 A;  4P1W A;  3M8E A;  3FXM A;  3FXL A;  3WGG A;  4BXF A;  1V0E A;  2V7V A;  2DDB A;  1OB5 A;  3Q6Q A;  2ISY A;  5ILV A;  4M53 A;  3JTH A;  2X3H A;  1IZ1 A;  1U5T C;  4ZV4 A;  1AA7 A;  3I64 A;  3V8J A;  4A93 J;  1SD7 A;  2PMD A;  2J8I A;  4G12 A;  4ZYA A;  1N06 A;  3KP5 A;  2F2E A;  4ESF A;  2ZO4 A;  2OJE D;  1D5V A;  2Z5U A;  4XRF A;  4HEA 2;  4HPQ A;  1WSR A;  4RLZ A;  2RNG A;  4G7O F;  2KQR A;  1FC3 A;  3GX4 X;  2IPQ X;  3PUF A;  3L00 A;  2XAF A;  4HX7 A;  2B7C A;  4BAY A;  2ZL5 A;  4YEJ A;  3DPU A;  4ESJ A;  2LSO A;  3S3O A;  2UWM A;  3GVJ A;  3J81 k;  5EZH A;  1QRY A;  4H9G A;  1PE9 A;  5ICG A;  2V1X A;  2EWN A;  3BC9 A;  3OS1 A;  1OFL A;  2G9W A;  2F5V A;  4QPQ A;  1D0Z A;  1EE6 A;  1FRQ A;  1VQ6 I;  3Q38 A;  4X07 A;  4ZYE A;  5K5O A;  1DU0 A;  4HLX A;  1DDN A;  3I58 A;  2PE3 A;  1VQP B;  4WZL A;  3HOV J;  5KCM A;  4BEH B;  5D6F A;  3ERE D;  3S2H J;  2ZCW A;  3RQI A;  2Q2E A;  3J7A O;  2BVN A;  2R7F A;  1ZQ3 P;  2VQL A;  4OIQ F;  5LGT A;  3S3N A;  1NJI D;  3GYH X;  2X85 A;  1FTZ A;  5A88 A;  2PIA A;  1MBJ A;  3BWG A;  2KIS A;  2XGD A;  1FOY A;  5FB2 A;  4X6A J;  2JSC A;  2W7N A;  3OOP A;  4NB5 A;  2JA7 J;  1R36 A;  4A0Z A;  3W2A A;  3H94 A;  3W2V A;  5LRS A;  2QYU A;  4CIC A;  3PSS A;  3DBL B;  3W2G A;  1ZR4 A;  5HZA A;  1KYW A;  2FX0 A;  5FO0 A;  4EJO A;  3G73 A;  1ETY A;  4DBQ A;  3OS2 A;  1WOS A;  3PL8 A;  1TUI A;  1EH6 A;  4PDK A;  2XF5 A;  3H36 A;  3CB4 A;  2V7X A;  4KN7 X;  1QVF B;  2OC6 A;  3TW6 A;  5J1R A;  1J2X A;  1HXD A;  3KP4 A;  4U88 A;  4ZZL A;  4QLC U;  1WPC A;  2W25 A;  2EFG A;  2X1C A;  1G6N A;  4UV8 A;  3R6S A;  4RDU A;  2VE8 A;  2IGN A;  5FD5 A;  2E1O A;  1NRK A;  2ZZQ A;  3OJW A;  3DKW A;  5KK1 A;  1XD7 A;  4XLP F;  2LLK A;  5J8C A;  3G1M A;  1KA8 A;  3GRH A;  4OJ6 A;  1O3S A;  1IXC A;  1DP3 A;  4HW0 A;  1XGN A;  4MQV A;  4Z4T A;  4Z4Z A;  4Z4Y A;  1A6Q A;  1Z7U A;  3TDU C;  1YJ9 B;  3KEW A;  3VMF A;  1U5T A;  1LEA A;  4BS9 A;  3VEP A;  3G6E I;  3GTM J;  3KFW X;  3DLA A;  2V5I A;  2IA0 A;  1I8D A;  1JHF A;  1EA0 A;  2JSP A;  4ETS A;  3A8I A;  5E79 C;  3CCR I;  5ERI A;  3ZMD A;  5ILU A;  3Q0W A;  2HPI A;  3E97 A;  3V7S A;  5HDK A;  3J81 K;  3CUQ A;  3GQ9 A;  2EZI A;  1FP1 D;  2CW0 F;  2G0Y A;  1QBJ A;  4HNV A;  2EIX A;  3KL9 A;  1X1A A;  2Z1D A;  3QP6 A;  1F4K A;  4BY1 J;  3L2Q A;  2E1B A;  4XKV A;  5AIQ A;  4EV0 A;  3OIP A;  1GQ8 A;  3HRT A;  4XLC A;  3ZQQ A;  3J80 Z;  3OIQ A;  2DOD A;  4IHY A;  3U2Q A;  2M1B A;  2HFH A;  2M7A A;  3A01 A;  2P5V A;  3LA2 A;  3ZN1 A;  1EP2 B;  4L0Y B;  2NST A;  2BZT A;  1SAN A;  5DCF A;  2STW A;  2HOS A;  2VJ4 A;  4IKF A;  2O17 A;  1DAB A;  5HS7 A;  4AF7 A;  3FKJ A;  3ONY A;  3SYT A;  4XKW A;  1TL8 A;  5LEJ A;  2E7X A;  4IX7 A;  2X3U A;  2DOG A;  3OP1 A;  4KKS A;  2CRG A;  2BV3 A;  3ZQH A;  2JJ7 A;  1YFH A;  1SKY B;  3HM5 A;  2IS1 A;  1YOV B;  3BH6 B;  1D8K A;  1R4M B;  1IO2 A;  1ON2 A;  2HPM A;  1VQ4 B;  4X0G A;  2B0L A;  3OWT A;  1TWC J;  3TL4 X;  2BX6 A;  1NB0 A;  1XDU A;  4G7X A;  1EV7 A;  3GEZ A;  3EQO A;  1MRZ A;  4CZZ A;  3Q9V A;  3EET A;  4MEY F;  2P6S A;  2ZFW A;  2RGV A;  4II2 A;  1SEU A;  4P25 A;  3CCY A;  2MLG A;  3PSI A;  4EMS A;  3HKZ N;  2BYV E;  2ZSH B;  1DBO A;  2DAO A;  4UUS A;  2AS5 F;  3HBL A;  2DT5 A;  2PJP A;  1BMF A;  4TSF A;  3UNG C;  1Q81 D;  1O8D A;  4X7D A;  2I5U A;  2DTZ A;  2VBZ A;  4GGG A;  5BS6 A;  1JHH A;  3T56 B;  2A05 A;  3PA2 A;  5J3O A;  1WQ2 A;  1PP8 F;  4MXN A;  3ASS A;  5HLI A;  1TYW A;  4QVJ A;  5GAE J;  2DK8 A;  4U0Y A;  3JRC A;  2DY1 A;  2HR3 A;  3WHC A;  4D0P A;  1E62 A;  1U2W A;  3SZP A;  2D45 A;  1X4P A;  3LL7 A;  3M1E A;  3FBN B;  3ZOB A;  1A35 A;  4BQQ A;  4YIF A;  1R9T J;  3RZO J;  2QE7 A;  2ZZG A;  3WGI A;  3KPH A;  1SD4 A;  3F8F A;  2ZTN A;  4XQF A;  3VYU B;  3GTL J;  3AFH A;  1PJ6 A;  1W35 A;  3ZZ0 A;  2Y30 A;  5CVU A;  5TGT A;  3CLO A;  3HEF A;  4RB3 C;  4FN5 A;  3K4M A;  1LPQ A;  4BHC A;  3F8M A;  1TC3 C;  2CW5 A;  2BY0 A;  3NE5 B;  4K1X A;  2D74 A;  4WQM A;  3IRR A;  4BJT A;  1ETQ A;  3H92 A;  3G6E B;  1CNF A;  1TP4 A;  1V5E A;  3BR1 A;  4UVA A;  3CDL A;  1U0J A;  2VPR A;  4L5I A;  1W5S A;  3R61 A;  2EBI A;  2MFZ A;  1O8K A;  2DN0 A;  1T08 B;  3CPX A;  1JJ6 C;  3FK6 A;  1G3T A;  3CMA B;  3SQN A;  3KZZ A;  4ROX A;  3VMW A;  1UG0 A;  1BC7 C;  2YS9 A;  1YX3 A;  3G4S I;  4ZTF A;  1MSE C;  5JHU A;  1OCO H;  3WXM A;  3QP5 A;  4BQO A;  1PDN C;  2LZJ A;  1IN6 A;  3TKY A;  2CF4 A;  1YLF A;  4ZTJ A;  3BJA A;  1XG1 A;  2MW8 A;  3ABL H;  4WXH A;  2R5Z A;  1QVU A;  1K78 A;  3LSM A;  1MND A;  3HPG A;  2Q2E B;  1WVR A;  2V7F A;  4LG0 A;  2NVX J;  1LLW A;  2CMP A;  3ZZT A;  1QUE A;  5F4O A;  4A3F J;  3BLY A;  3SDB A;  5DTD A;  4AIJ A;  2BSP A;  2O0V A;  3CC4 B;  4G8X A;  3LA3 A;  1MBG A;  2L02 A;  4UY8 I;  5A8A A;  4BHP A;  2CRV A;  5KAF C;  4MTD A;  1Z3X A;  1F43 A;  1EP3 B;  3BCD A;  1YYV A;  1R7J A;  2G7U A;  2KIM A;  3FK7 A;  3Q5F A;  2QF7 A;  2L5Q A;  4XM3 A;  4PC1 A;  4OZZ A;  3LAP A;  3CD6 B;  2C78 A;  5EF6 A;  5TIS C;  1HLV A;  4FWT A;  2ZC2 A;  3SJP A;  2Z6B D;  4ZZD A;  4LBV A;  3DPL C;  3MMP A;  1LE8 A;  1N08 A;  1E3H A;  4B43 A;  2NXN B;  3BTC A;  4C2L A;  1HST A;  2FSW A;  3MN2 A;  1TQM A;  1S3J A;  5FD6 A;  1R5H A;  1U9O A;  4RMN A;  3CDH A;  3B78 A;  3JRG A;  3T0Y A;  2F3L A;  2DW4 A;  3I9V 2;  4CYC B;  1JKQ C;  2QKL B;  3OZV A;  2L7Z A;  2P7V B;  2Z8G A;  2DA5 A;  2X0L A;  3HGG A;  3ZUG A;  2R7Z J;  4MYU A;  1AIP A;  5FKN A;  2IEK A;  1X1C A;  4D7N A;  4A3C J;  3PUN A;  4RD6 A;  3S1Q J;  3T5X A;  1O88 A;  1UMQ A;  1O8E A;  3V8K A;  1PJR A;  1ZLK A;  1V5G A;  1O8J A;  3T9G A;  2ZFU A;  4YEL A;  4XLF A;  1OB0 A;  4Z03 A;  3F72 A;  3VST A;  1VQ9 I;  2EIN H;  3I59 B;  2LRD A;  5A2Q Z;  2VNJ A;  5TV2 A;  4C2U A;  4U87 A;  2VJ5 A;  3F8N A;  2Z16 A;  2EPF A;  1R00 A;  3WG7 H;  3GQ7 A;  2FVG A;  3KRG A;  4B47 A;  4PC7 A;  4RPB A;  1D3Y A;  1A6I A;  3EQL F;  1T39 A;  2L9V A;  3FXJ A;  1OHH A;  4GXO A;  1BA5 A;  4M3F A;  3KZY A;  4AD9 A;  3BY2 A;  3GUD A;  1VQ8 B;  4EM2 A;  1GR1 A;  3EYI A;  1N0U A;  1IRF A;  3H3Z A;  3ZQF A;  1LNW A;  1PYV A;  3MFK A;  1ITY A;  4OPV A;  3G3Z A;  1UST A;  4DOZ A;  3PSZ A;  1QRB A;  2BM0 A;  4PGO A;  3S1M J;  3DKY A;  5IYB J;  3QSY A;  2VON A;  1S72 B;  5IP6 A;  2EV0 A;  2GA1 A;  3IWF A;  2RAE A;  2IA2 A;  1G3Y A;  2EA4 A;  2OCC H;  4AVP A;  4F7Z A;  5IY5 H;  3OYG A;  1YI2 B;  3OYM A;  3RIR A;  5IYR A;  2D1H A;  2ODL A;  3WG9 A;  4M3D A;  4ENN A;  4B4D A;  4PUS A;  5F08 A;  4DW6 A;  1IC8 A;  4EGY A;  2NTQ A;  3ULQ B;  3ZP5 A;  1KK2 A;  5HDN A;  4HF0 A;  3D26 A;  5H5J A;  4BHB A;  1PXZ A;  4GRI A;  1O4X A;  2O04 A;  1OQY A;  4L9J A;  3WU0 A;  5M5W J;  2F4M B;  3MKY B;  2XF6 A;  1HQC A;  5AMV A;  2EIM H;  4PJM A;  1SVO A;  4OOI A;  5A89 A;  2JN6 A;  1F60 A;  1WH7 A;  2JJ2 A;  2PLF A;  5GV7 A;  3A4C A;  2CV0 A;  2KP6 A;  1E3Z A;  3CCV B;  4P9F A;  4W8Q A;  3SYJ A;  2R92 J;  2LTP A;  1FT9 A;  1QFY A;  2HQN A;  4M74 A;  1QGA A;  3S2W A;  2XT2 A;  2E5Z A;  4NQW A;  4Z06 A;  1IF1 A;  3QPS A;  3QPL A;  3LAJ A;  3G71 I;  1T6S A;  4XSX F;  1HW1 A;  4OPO A;  4WZT A;  3HRM A;  1E2X A;  3VOD A;  3WTY C;  1SM4 A;  1QA3 A;  2O6G E;  5C4X J;  2TCT A;  3ISX A;  3LNN A;  3HSF A; 
#chains in the Genus database with same CATH homology
 3PFY A;  3B90 A;  3GQB A;  3GVL A;  1E43 A;  4HNU A;  1MMD A;  3CP2 A;  3I3L A;  1W36 D;  3OYF A;  3K4C A;  1NG6 A;  2CS3 A;  1FMV A;  2A6T A;  4CCM A;  4E7I A;  2R7X A;  3OEE A;  2L7K A;  4H4K C;  3VYR B;  3OOC A;  1H80 A;  1BR2 A;  1T95 A;  1W9X A;  1CZF A;  2V4D A;  4W8T A;  3FHN A;  3S32 A;  3ZGK A;  1WTH D;  3L2W A;  5CQG A;  3H5N A;  1W0K A;  4E7L A;  1UD6 A;  2GJK A;  1COW A;  4YZ0 A;  4MLO A;  4URR A;  4NC7 A;  3VMV A;  3OR1 C;  2LBF A;  3H9G A;  1TT0 A;  3V42 A;  4P5O A;  2VBM A;  4BEH A;  4CSW A;  1X1D A;  3FY3 A;  3OYD A;  4HG2 A;  4U4B A;  3DEE A;  2XOK A;  4XLA A;  3OYB A;  5HLT A;  2WJV A;  4CCL A;  2E60 A;  4G7W A;  1LKX A;  5CKT A;  3PJR A;  3OYI A;  1V0F A;  3BC8 A;  3IAM 2;  3IP4 B;  3EUH C;  3OOU A;  4DJA A;  3CF2 A;  2JDI A;  4NNJ A;  4BGD A;  2INU A;  2HU9 A;  3H35 A;  2PMZ A;  2DCE A;  2M3A A;  1K28 D;  3T51 B;  4NC8 A;  4BE2 A;  1YX5 A;  2GOM A;  3D5R C;  1EFR A;  3H9J A;  2DIE A;  2NT9 A;  2IS6 A;  4XR6 A;  4KIS A;  3OYH A;  2R7Q A;  4JOM A;  5CDF A;  4ANJ A;  2NSP A;  3PUB A;  1BLI A;  3KEY A;  2DOA A;  3HL2 A;  3A2K A;  4KKU A;  4C2T A;  1UD2 A;  2UVE A;  2XSJ C;  1JTA A;  4RM2 A;  2QX3 A;  2VQC A;  1K6Y A;  3K4K A;  4XLH A;  2D3N A;  4BDZ A;  2M4G A;  2JJ1 A;  4DNT B;  2JVG A;  4JMQ A;  4HSR A;  2WY8 Q;  2O5R A;  4ZDP A;  1G8X A;  1D1A A;  3OYL A;  3KX2 A;  2L9S A;  3C2H A;  2Z2S B;  3PNV A;  1MMA A;  2NTB A;  2IGM A;  4J00 A;  1DBG A;  4NK6 A;  3NWT A;  2LRE A;  1E79 A;  3ZSC A;  2F6C A;  4EAT A;  3BCB A;  3OYA A;  2VLA A;  4XKB A;  2UVF A;  4I84 A;  1IA5 A;  1UD4 A;  1I18 A;  3CJR B;  2PEC A;  3J7A Y;  3ZXS A;  2LC2 A;  2NOJ B;  3OFN A;  1IDJ A;  3G2B A;  3K70 C;  2VJI A;  1N78 A;  3GQ8 A;  4F3Q A;  3HOS A;  5HNF A;  1OR7 C;  4JQF A;  2CFO A;  4XN0 A;  4ZJZ A;  2M5S A;  2DT7 B;  3EQN A;  2XDV A;  2W6I A;  3SUC A;  1VF7 A;  4OAY A;  3M1C A;  3DKX A;  2VKH A;  2DT6 A;  4PJN A;  3H0D A;  4L8J A;  2WY7 Q;  2NZM A;  3ZPP A;  2HZD A;  2KLO A;  2LYC A;  1T0F C;  4UZU A;  5FRM A;  1BPL A;  1JRG A;  3B4N A;  2KDO A;  1LFP A;  3RTR A;  4E7Z A;  2R7U A;  1WP6 A;  2WPD A;  3UW0 A;  3A1Y A;  1J09 A;  4Y33 A;  4F93 B;  4XMY A;  3MKW B;  3IAS 2;  3KYL A;  2CV1 A;  1UD5 A;  2JIZ A;  4XOT A;  4LIU A;  3G05 A;  4MR0 A;  1P9Q C;  3LSI A;  2F43 A;  4U49 A;  3OW7 A;  2KPM A;  2VKD A;  4Y3O A;  2JA2 A;  4XLE A;  3WQZ A;  1X19 A;  4P1W A;  4ZC3 A;  4BXF A;  1V0E A;  3QYF A;  4HWV A;  2M7B A;  3VSU A;  1OGO X;  4B44 A;  1E3X A;  1H8H A;  2X3H A;  3OYJ A;  2IS4 A;  1AA7 A;  3ONQ A;  3ZR8 X;  4ZYA A;  5HKK A;  2BVL A;  4E4H A;  4YRV A;  4OZY A;  1MMN A;  2RRE A;  3H9Q A;  3PNY A;  1Z7L A;  1MNE A;  4HEA 2;  4HPQ A;  2ZXI A;  2NT6 A;  3PSF A;  4BAC A;  2RNG A;  4N4N B;  2KQR A;  1BR1 A;  3OL4 A;  2KHM A;  4PSW A;  3GQA A;  2VBE A;  2O1D A;  2HVR A;  1RMG A;  4YEJ A;  3DPU A;  2Q1Z B;  1BR4 A;  3S3O A;  2UWM A;  1X4O A;  2I8D A;  3GVJ A;  1PE9 A;  4BQN A;  1D1B A;  2VPL A;  4PK4 A;  3BC9 A;  4G6I A;  3M8J A;  5LD2 C;  2XZL A;  3OY9 A;  2Y0S A;  3OS1 A;  1KTW A;  1OFL A;  4B3G A;  1RWR A;  2F5V A;  4QPQ A;  1D0Z A;  2DXI A;  4TKO B;  1Y6I A;  1FX0 A;  1EE6 A;  2CUZ A;  4RLQ A;  2NST A;  2CUJ A;  3DU5 A;  5KCM A;  2R7V A;  1O8L A;  4BEH B;  2K9L A;  3HOT A;  4F92 B;  3JU4 A;  4R79 A;  2LBF B;  2IS2 A;  3OAA A;  4HNT A;  2VQL A;  4ZDO A;  2X6Y A;  3S3N A;  1KCD A;  3SEQ A;  1ERD A;  2X85 A;  4BDY A;  3DDY A;  1KZL A;  1DGR M;  2X6W A;  3K4B A;  3CES A;  4DGW B;  2NTP A;  2W7N A;  3LSK A;  3W2A A;  3H94 A;  2X1E A;  3W2V A;  3L2R A;  3OPO A;  3QYE A;  2WAQ A;  2KZV A;  4CH7 A;  2W4S A;  4F52 A;  3ZRG A;  3ZPN A;  3OL3 A;  2MD0 A;  1O8G A;  4DBQ A;  3OS2 A;  3PL8 A;  2XF5 A;  4CCK A;  4IQ4 A;  1WJF A;  3PNT A;  2V1N A;  2R7R A;  2OC6 A;  1WPC A;  2CH0 A;  3FKS A;  4FAS D;  4Z1M A;  4NUB A;  2X1C A;  1NRK A;  3EUA A;  1G59 A;  2IGN A;  4XOR A;  2ZZQ A;  4NQW B;  1WJ5 A;  2HLD A;  2PYH A;  3GRH A;  2AQF A;  2IGO A;  4OJ6 A;  1DP3 A;  4B48 A;  3A35 A;  2VB6 A;  3DTI A;  4IZZ A;  2KRH A;  4BS9 A;  1E0E A;  3BH4 A;  3KEW A;  2QXZ A;  3QYB A;  4OWR B;  3DLA A;  4PFO A;  2MAB A;  2VQG A;  3TMO A;  2ELJ A;  2HNH A;  2RQQ A;  1I8D A;  3VYT B;  2JSP A;  2X1D A;  2KVO A;  3FDY A;  4NK8 A;  2HPI A;  2CW7 A;  2LY2 A;  1GLN A;  3DTK A;  3GQ9 A;  1HA8 A;  4HST A;  3OMY A;  1HG8 A;  3BG7 A;  2R7T A;  1X1A A;  2Z1D A;  2E1B A;  3L2Q A;  4XKV A;  1LDK B;  3WWG A;  4Z05 A;  1WJE A;  3OIP A;  2X53 S;  1GQ8 A;  4XLC A;  3ZQQ A;  4BL0 B;  3OIQ A;  1UD8 A;  1O8F A;  5LFA A;  1BOB A;  2M7A A;  4GQN A;  2X51 A;  4LIV A;  1WJB A;  2UUZ A;  2QY1 A;  3H5R A;  3BCA A;  4YZA A;  1WJC A;  4W8S A;  1MMG A;  2CW8 A;  2VJ4 A;  2PJR B;  4IKF A;  2WJY A;  2ZZF A;  5JHF A;  2O17 A;  4QPO A;  3FKJ A;  3SYT A;  4XKW A;  2GK6 A;  2WA0 A;  4CZC A;  4IX7 A;  4KKS A;  1IRX A;  4B3F X;  4YZQ A;  2V31 A;  4E7K A;  4FXU A;  1SKY B;  4AVZ A;  4IQJ A;  2IS1 A;  2GJP A;  3GVK A;  2XGJ A;  4KT6 A;  4DIQ A;  2UV1 A;  2KL4 A;  2HPM A;  4X0G A;  3DPT A;  1VJS A;  5KHD A;  1Z21 A;  3OWT A;  3TL4 X;  2ZZE A;  1WMR A;  5FRO A;  2XC7 A;  2R7S A;  1O8H A;  4G7X A;  3EQO A;  4LIT A;  3HKZ A;  3OS0 A;  1UAA A;  4OJL A;  3CZ6 A;  1FMW A;  1QJV A;  1OFM A;  4YXW A;  4II2 A;  4PJJ A;  3CMM A;  3PSI A;  1DBO A;  2ZSH B;  3NWS A;  1BMF A;  2R7O A;  4TSF A;  1S9H A;  3UNG C;  5IK2 A;  1O8D A;  2MC4 A;  3MKZ A;  2GJR A;  2XZP A;  4OJO A;  2QKM B;  2L9N A;  4BJ6 C;  3T56 B;  4ASU A;  2WBM A;  2XND A;  3RSN A;  2V7Q A;  4C9Y A;  3BG6 A;  4MXN A;  2F4I A;  3DU6 A;  3OR2 C;  2E1M B;  3A3B A;  1AIR A;  2BVM A;  4W8R A;  4TT3 A;  2K5C A;  4KIT B;  1X4P A;  3LL7 A;  3UR3 C;  4E0F A;  3FBN B;  4DK1 A;  2VL8 A;  5HNH A;  1W0J A;  4BQQ A;  2FUG 2;  2W00 A;  2QE7 A;  4CCN A;  2ZZG A;  3TBI A;  4BE1 A;  2ZTN A;  2XZO A;  3H5A A;  3VYU B;  4XQF A;  3AFH A;  1H8E A;  2W82 A;  3SZG A;  2LY1 A;  2M4K A;  5TGT A;  3T53 B;  2INV A;  3K4M A;  3EPZ A;  2CK3 A;  3F9K A;  3DWL E;  2CV2 A;  3NE5 B;  1KCC A;  2X8K A;  1LVK A;  5CPR B;  3ZCO A;  2WZP P;  1OGM X;  4BJT A;  3GBG A;  3L2U A;  1QU3 A;  1V5E A;  1NBM A;  3DQV C;  4E7J A;  2VXZ A;  3K70 D;  3E0J B;  2LH9 A;  1U0J A;  2KRC A;  3QOD A;  2MFZ A;  2WB1 A;  4YZX A;  4DBR A;  1O8K A;  1BHE A;  1IDK A;  4XN3 A;  2LOO A;  3DTE A;  3RCO A;  4KKT A;  2K3P A;  3VMW A;  4CUG A;  2O0W A;  1UG0 A;  1N75 A;  1JI8 A;  1YX3 A;  2P0W A;  4ZTF A;  5HVQ C;  3VDX A;  3OYK A;  5FL7 A;  2WAD A;  2F1M A;  1E1R A;  1NG7 A;  4BQO A;  3B8Y A;  2DJI A;  2LZJ A;  4E7H A;  2HVQ A;  3FPP A;  2VBK A;  3IUO A;  2W6J A;  4N4O B;  1ZEL A;  4ZTJ A;  2KMU A;  4Y4R A;  4PSX A;  2ZXH A;  3LSM A;  1MND A;  3HPG A;  3CP8 A;  2K9M A;  2Q2E B;  2V7F A;  2R4G A;  4CCO A;  3L2V A;  2CMP A;  2JVH A;  1X0C A;  4G6T B;  2AQE A;  5FRN A;  1VLY A;  3BLY A;  3SDB A;  1T5E A;  3MMY B;  2BSP A;  2O0V A;  3N05 A;  4F91 B;  2BW3 B;  2OV7 A;  1O8I A;  1WJA A;  4BUP A;  3FBI B;  4XL9 A;  2XAU A;  2L2O A;  4F55 A;  1Z3X A;  1OLT A;  2R9V A;  3BCD A;  3LSG A;  4RM3 A;  2WAF A;  4HIZ A;  4P22 A;  1X1B A;  2L5Q A;  4XM3 A;  3AKZ A;  3OYC A;  3HAG A;  3S8P A;  4OZZ A;  4AYB A;  1HZE A;  3K4N A;  2HQA A;  2GOX B;  2Z6B D;  4XOP A;  3DPL C;  5C1C A;  4PFP A;  3U21 A;  4B43 A;  3HUG B;  1O8J A;  4C2L A;  1KON A;  4XNF A;  4AU7 A;  4DNR B;  1MW7 A;  3K10 A;  2WAE A;  4RMN A;  3AL0 C;  1DQU A;  1YE9 A;  3K4L A;  2E5N A;  2JUG A;  3I9V 2;  3VSV A;  2QKL B;  3LMM A;  2Z8G A;  2V6E A;  2VXD A;  2BOL A;  3LMW A;  4D1Q A;  4DK0 A;  1X1C A;  2GK7 A;  2ZTG A;  2V9K A;  3K4J A;  4ZDL A;  4E6K G;  1O8M A;  3OEH A;  4E7S A;  1O88 A;  1IB4 A;  1O8E A;  1PJR A;  2XF7 A;  1V5G A;  2WSS A;  4RLF A;  3SEZ A;  1QHH D;  2ZFU A;  4YEL A;  4B3X A;  1MAB A;  5DN6 A;  1BN8 A;  4XLF A;  4HRI A;  1E1Q A;  3HC7 A;  1OB0 A;  4Z03 A;  5CQE A;  3VST A;  1K5C A;  2MYS A;  3VWB A;  1PKV A;  1QHG A;  2IGK A;  2LRD A;  3ZIA A;  4C2U A;  4U87 A;  2VJ5 A;  2X6X A;  2Z16 A;  1HVX A;  3GQ7 A;  3JUR A;  3KRG A;  1UEL B;  4B47 A;  1NHC A;  2E1M C;  3D5L A;  3MD2 A;  1OHH A;  2BW3 A;  4CCJ A;  3HG9 A;  3K6G A;  4C30 A;  2R7W A;  1SAU A;  4XON A;  4J01 A;  3W3C A;  1Y56 A;  4FET A;  2ZSI B;  3E1S A;  3LFU A;  4OJP A;  1PYV A;  1DGW Y;  3OYN A;  4OAZ A;  1TZL A;  4DOZ A;  2PJR A;  2D3L A;  1KMH A;  3DKY A;  3W2W A;  1VZ0 A;  4KJZ A;  3LSH A;  1WFX A;  1UD3 A;  3T9G A;  3OYG A;  1WJD A;  4D9J A;  3OYM A;  1QCX A;  1D0X A;  1D1C A;  4LG3 A;  4PMH A;  3S93 A;  4BU2 A;  4XKC A;  4U7B A;  1N77 A;  1PLU A;  2ODL A;  1RU4 A;  1R6R A;  5C1E A;  4PUS A;  4XD7 A;  1EA3 A;  2NTQ A;  3A3G A;  2M0M A;  1W36 C;  3VSL A;  1XG2 A;  2PYG A;  1SFK A;  2OUM A;  3C2G A;  2V4J C;  2VIX A;  2VQH A;  4GRI A;  1PXZ A;  2LG4 A;  2O04 A;  1D0Y A;  2V26 A;  4EW9 A;  2HVS A;  1VBL A;  2W1O A;  3MKY B;  4ITV A;  4PJL A;  2XF6 A;  5HOO A;  5AMV A;  3QOE A;  1Z3Y A;  3CJQ B;  5KNL A;  4OJ5 A;  4PJM A;  2HDW A;  4CA0 A;  2JJ2 A;  3EUK L;  4BE0 A;  3A4C A;  2CV0 A;  2KP6 A;  1E3Z A;  3BCF A;  3VR6 A;  4W8Q A;  3HPH A;  1OOC A;  4BJ5 C;  2A5W A;  3D5S C;  1V5F A;  2VAS A;  2IXS A;  3VSK A;  3RQ4 A;  3OYE A;  2IQ7 A;  2E5Z A;  3VYS B;  4II3 A;  3OE7 A;  4Z06 A;  3AL0 B;  3S3M A;  2VJJ A;  3RPU D;  2EWE A;  3LNN A;  3HXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...