1O8LA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 5mm ca2+
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 138
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8lA00
2INVA 4HWVA 3VMVA 3T9GA 4I84A 4NK8A 4XKVA 2NTQA 4W8SA 1PE9A 4XLEA 2QXZA 5C1EA 4U49A 1OFLA 3EQNA 1IA5A 4AVZA 1PLUA 4URRA 1KTWA 1QJVA 1BN8A 3JURA 3GQ7A 2NSPA 4XOPA 4YELA 1RWRA 4XL9A 5AMVA 1HG8A 2PECA 1IDKA 3GQAA 3GQ8A 2VBEA 3FY3A 4Z03A 4Z05A 4W8TA 3VSVA 1O8FA 1JRGA 2PYHA 4OJOA 3ZSCA 2O0VA 3B90A 1O8HA 1PXZA 1O88A 2BSPA 3VSTA 4XLHA 2NT9A 3KRGA 2VJIA 4U4BA 4NK6A 4OJ5A 1IB4A 2X3HA 2O0WA 2UVFA 2VJJA 4XMYA 1NHCA 1AIRA 2VBKA 4YZ0A 2O1DA 4XLAA 4XLFA 1KCCA 4XKWA 4YZQA 1X0CA 2X6XA 4W8RA 1RU4A 1O8LA 1XG2A 3B8YA 3WWGA 4OJ6A 1H80A 2X6YA 2PYGA 4MXNA 1O8DA 4XN3A 1O8KA 2VBMA 1IDJA 4YEJA 1JTAA 1OGMX 1O8JA 4XQFA 2EWEA 4Z06A 1DBOA 2X85A 3UW0A 1OOCA 1QCXA 4OJLA 2INUA 4W8QA 2QY1A 4YZXA 3EQOA 4XLCA 1GQ8A 1OGOX 3VMWA 2NT6A 4MR0A 1RMGA 4XOTA 3VSUA 2X6WA 4XR6A 4EW9A 1WMRA 1EE6A 4XM3A 4XN0A 1OFMA 3B4NA 4C2LA 1O8GA 3SUCA 4XNFA 2QX3A 3GQ9A 3ZPPA 1O8IA 2ODLA 1KCDA 2NTBA 2NTPA 2UVEA 2NSTA 2Z8GA 1O8MA 4OJPA 4YZAA 2NZMA 3LMWA 4OZYA 1CZFA 3GRHA 4OZZA 1BHEA 2O04A 1O8EA 2IQ7A 1K5CA 1DBGA 1VBLA 4PMHA 5C1CA 2O17A 4XONA 4XORA
chains in the Genus database with same CATH superfamily
2INVA 4HWVA 3P4GA 3VMVA 3T9GA 4I84A 4NK8A 4XKVA 2NTQA 4W8SA 1PE9A 4XLEA 2QXZA 1L1IA 5C1EA 3SZEA 4U49A 4V02C 1OFLA 3EQNA 1IA5A 3LYCA 4AVZA 1PLUA 1EA0A 4URRA 1KTWA 1QJVA 1BN8A 3JURA 3GQ7A 2NSPA 4XOPA 1K4ZA 3SQVA 4YELA 1QA2A 1RWRA 2G0YA 4XL9A 1TYUA 5AMVA 1HG8A 2PECA 1IDKA 3GQAA 3GQ8A 2VBEA 2IOUG 3FY3A 4Z03A 2BX6A 2BM7A 4Z05A 4W8TA 3VSVA 1O8FA 1JRGA 2PYHA 4OJOA 2J8KA 3ZSCA 2O0VA 3B90A 1O8HA 1PXZA 1O88A 2BSPA 1TYXA 3VSTA 4XLHA 2NT9A 3BH7B 4OPWA 4YC5A 1DABA 3KRGA 3JX8A 5DNSA 4YCQA 2VJIA 4U4BA 4YDTA 2B0RA 3PSSA 4NK6A 4OJ5A 1IB4A 2X3HA 2XC1A 2O0WA 1HF2A 2UVFA 3PETA 2XT4A 3ML3A 2VJJA 2F3LA 2VFPA 4XMYA 1TYVA 1NHCA 1AIRA 1QA1A 2VBKA 3N90A 2BM6A 2XTYA 3PSZA 4YZ0A 5JLVC 2O1DA 1QQ1A 4XLAA 4XLFA 4XKWA 4YZQA 1KCCA 1X0CA 3DU1X 2QYUA 2X6XA 2W7ZA 4W8RA 1RU4A 1O8LA 1XG2A 1TSPA 3B8YA 3WWGA 4OJ6A 1QA3A 1H80A 1OFDA 2X6YA 2PYGA 4MXNA 2XTXA 1O8DA 1LLWA 2O6WA 3TH0A 4JRAC 4XN3A 1O8KA 2VBMA 1IDJA 4YEJA 1JTAA 1OGMX 1O8JA 3NB2A 4XQFA 2EWEA 4Z06A 1DBOA 1KQ5A 2X85A 1K8FA 4YEIA 3N6ZA 3UW0A 2VFNA 1OOCA 1QCXA 1LLZA 4OJLA 2J8IA 1QRCA 1OFEA 2INUA 4W8QA 2QY1A 4YZXA 3EQOA 4XLCA 2V5IA 1GQ8A 1OGOX 3SYJA 3VMWA 2NT6A 4MR0A 1RMGA 3H09A 4XOTA 3VSUA 2X6WA 4XR6A 4EW9A 1WMRA 1EE6A 2QZAA 4XM3A 3AK5A 4XN0A 1OFMA 3B4NA 5JMCB 3BH6B 1O8GA 4C2LA 3RIQA 3SUCA 1EZGA 3LJYA 2VFQA 3NAWA 4XNFA 2VFOA 2XT2A 2QX3A 4OM9A 3GQ9A 3ZPPA 1O8IA 2ODLA 1WXRA 1KCDA 2NTBA 2NTPA 2UVEA 2NSTA 2Z8GA 4KH3A 1O8MA 4OJPA 4YZAA 2NZMA 1CLWA 1TYWA 2XTWA 4YFOA 3LMWA 4OZYA 1CZFA 3GRHA 4OZZA 1BHEA 2BM5A 2O04A 3SY2A 1O8EA 2IQ7A 1QRBA 1K5CA 1DBGA 1VBLA 1LM1A 2BM4A 4PMHA 5C1CA 2YUHA 2VFMA 2O17A 4XONA 4XORA
chains in the Genus database with same CATH topology
2INVA 4HWVA 3VMVA 3T9GA 4I84A 4NK8A 4XKVA 2NTQA 4W8SA 1PE9A 4XLEA 2QXZA 5C1EA 4U49A 1OFLA 3EQNA 1IA5A 4AVZA 1PLUA 4URRA 1KTWA 1QJVA 1BN8A 3JURA 3GQ7A 2NSPA 4XOPA 4YELA 1RWRA 4XL9A 5AMVA 1HG8A 2PECA 1IDKA 3GQAA 3GQ8A 2VBEA 3FY3A 4Z03A 4Z05A 4W8TA 3VSVA 1O8FA 1JRGA 2PYHA 4OJOA 3ZSCA 2O0VA 3B90A 1O8HA 1PXZA 1O88A 2BSPA 3VSTA 4XLHA 2NT9A 3KRGA 2VJIA 4U4BA 4NK6A 4OJ5A 1IB4A 2X3HA 2O0WA 2UVFA 2VJJA 4XMYA 1NHCA 1AIRA 2VBKA 4YZ0A 2O1DA 4XLAA 4XLFA 1KCCA 4XKWA 4YZQA 1X0CA 2X6XA 4W8RA 1RU4A 1O8LA 1XG2A 3B8YA 3WWGA 4OJ6A 1H80A 2X6YA 2PYGA 4MXNA 1O8DA 4XN3A 1O8KA 2VBMA 1IDJA 4YEJA 1JTAA 1OGMX 1O8JA 4XQFA 2EWEA 4Z06A 1DBOA 2X85A 3UW0A 1OOCA 1QCXA 4OJLA 2INUA 4W8QA 2QY1A 4YZXA 3EQOA 4XLCA 1GQ8A 1OGOX 3VMWA 2NT6A 4MR0A 1RMGA 4XOTA 3VSUA 2X6WA 4XR6A 4EW9A 1WMRA 1EE6A 4XM3A 4XN0A 1OFMA 3B4NA 4C2LA 1O8GA 3SUCA 4XNFA 2QX3A 3GQ9A 3ZPPA 1O8IA 2ODLA 1KCDA 2NTBA 2NTPA 2UVEA 2NSTA 2Z8GA 1O8MA 4OJPA 4YZAA 2NZMA 3LMWA 4OZYA 1CZFA 3GRHA 4OZZA 1BHEA 2O04A 1O8EA 2IQ7A 1K5CA 1DBGA 1VBLA 4PMHA 5C1CA 2O17A 4XONA 4XORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INV A;  4HWV A;  3VMV A;  3T9G A;  4I84 A;  4NK8 A;  4XKV A;  2NTQ A;  4W8S A;  1PE9 A;  4XLE A;  2QXZ A;  5C1E A;  4U49 A;  1OFL A;  3EQN A;  1IA5 A;  4AVZ A;  1PLU A;  4URR A;  1KTW A;  1QJV A;  1BN8 A;  3JUR A;  3GQ7 A;  2NSP A;  4XOP A;  4YEL A;  1RWR A;  4XL9 A;  5AMV A;  1HG8 A;  2PEC A;  1IDK A;  3GQA A;  3GQ8 A;  2VBE A;  3FY3 A;  4Z03 A;  4Z05 A;  4W8T A;  3VSV A;  1O8F A;  1JRG A;  2PYH A;  4OJO A;  3ZSC A;  2O0V A;  3B90 A;  1O8H A;  1PXZ A;  1O88 A;  2BSP A;  3VST A;  4XLH A;  2NT9 A;  3KRG A;  2VJI A;  4U4B A;  4NK6 A;  4OJ5 A;  1IB4 A;  2X3H A;  2O0W A;  2UVF A;  2VJJ A;  4XMY A;  1NHC A;  1AIR A;  2VBK A;  4YZ0 A;  2O1D A;  4XLA A;  4XLF A;  1KCC A;  4XKW A;  4YZQ A;  1X0C A;  2X6X A;  4W8R A;  1RU4 A;  1O8L A;  1XG2 A;  3B8Y A;  3WWG A;  4OJ6 A;  1H80 A;  2X6Y A;  2PYG A;  4MXN A;  1O8D A;  4XN3 A;  1O8K A;  2VBM A;  1IDJ A;  4YEJ A;  1JTA A;  1OGM X;  1O8J A;  4XQF A;  2EWE A;  4Z06 A;  1DBO A;  2X85 A;  3UW0 A;  1OOC A;  1QCX A;  4OJL A;  2INU A;  4W8Q A;  2QY1 A;  4YZX A;  3EQO A;  4XLC A;  1GQ8 A;  1OGO X;  3VMW A;  2NT6 A;  4MR0 A;  1RMG A;  4XOT A;  3VSU A;  2X6W A;  4XR6 A;  4EW9 A;  1WMR A;  1EE6 A;  4XM3 A;  4XN0 A;  1OFM A;  3B4N A;  4C2L A;  1O8G A;  3SUC A;  4XNF A;  2QX3 A;  3GQ9 A;  3ZPP A;  1O8I A;  2ODL A;  1KCD A;  2NTB A;  2NTP A;  2UVE A;  2NST A;  2Z8G A;  1O8M A;  4OJP A;  4YZA A;  2NZM A;  3LMW A;  4OZY A;  1CZF A;  3GRH A;  4OZZ A;  1BHE A;  2O04 A;  1O8E A;  2IQ7 A;  1K5C A;  1DBG A;  1VBL A;  4PMH A;  5C1C A;  2O17 A;  4XON A;  4XOR A; 
#chains in the Genus database with same CATH topology
 2INV A;  4HWV A;  3P4G A;  3VMV A;  3T9G A;  4I84 A;  4NK8 A;  4XKV A;  2NTQ A;  4W8S A;  1PE9 A;  4XLE A;  2QXZ A;  1L1I A;  5C1E A;  3SZE A;  4U49 A;  4V02 C;  1OFL A;  3EQN A;  1IA5 A;  3LYC A;  4AVZ A;  1PLU A;  1EA0 A;  4URR A;  1KTW A;  1QJV A;  1BN8 A;  3JUR A;  3GQ7 A;  2NSP A;  4XOP A;  1K4Z A;  3SQV A;  4YEL A;  1QA2 A;  1RWR A;  2G0Y A;  4XL9 A;  1TYU A;  5AMV A;  1HG8 A;  2PEC A;  1IDK A;  3GQA A;  3GQ8 A;  2VBE A;  2IOU G;  3FY3 A;  4Z03 A;  2BX6 A;  2BM7 A;  4Z05 A;  4W8T A;  3VSV A;  1O8F A;  1JRG A;  2PYH A;  4OJO A;  2J8K A;  3ZSC A;  2O0V A;  3B90 A;  1O8H A;  1PXZ A;  1O88 A;  2BSP A;  1TYX A;  3VST A;  4XLH A;  2NT9 A;  3BH7 B;  4OPW A;  4YC5 A;  1DAB A;  3KRG A;  3JX8 A;  5DNS A;  4YCQ A;  2VJI A;  4U4B A;  4YDT A;  2B0R A;  3PSS A;  4NK6 A;  4OJ5 A;  1IB4 A;  2X3H A;  2XC1 A;  2O0W A;  1HF2 A;  2UVF A;  3PET A;  2XT4 A;  3ML3 A;  2VJJ A;  2F3L A;  2VFP A;  4XMY A;  1TYV A;  1NHC A;  1AIR A;  1QA1 A;  2VBK A;  3N90 A;  2BM6 A;  2XTY A;  3PSZ A;  4YZ0 A;  5JLV C;  2O1D A;  1QQ1 A;  4XLA A;  4XLF A;  4XKW A;  4YZQ A;  1KCC A;  1X0C A;  3DU1 X;  2QYU A;  2X6X A;  2W7Z A;  4W8R A;  1RU4 A;  1O8L A;  1XG2 A;  1TSP A;  3B8Y A;  3WWG A;  4OJ6 A;  1QA3 A;  1H80 A;  1OFD A;  2X6Y A;  2PYG A;  4MXN A;  2XTX A;  1O8D A;  1LLW A;  2O6W A;  3TH0 A;  4JRA C;  4XN3 A;  1O8K A;  2VBM A;  1IDJ A;  4YEJ A;  1JTA A;  1OGM X;  1O8J A;  3NB2 A;  4XQF A;  2EWE A;  4Z06 A;  1DBO A;  1KQ5 A;  2X85 A;  1K8F A;  4YEI A;  3N6Z A;  3UW0 A;  2VFN A;  1OOC A;  1QCX A;  1LLZ A;  4OJL A;  2J8I A;  1QRC A;  1OFE A;  2INU A;  4W8Q A;  2QY1 A;  4YZX A;  3EQO A;  4XLC A;  2V5I A;  1GQ8 A;  1OGO X;  3SYJ A;  3VMW A;  2NT6 A;  4MR0 A;  1RMG A;  3H09 A;  4XOT A;  3VSU A;  2X6W A;  4XR6 A;  4EW9 A;  1WMR A;  1EE6 A;  2QZA A;  4XM3 A;  3AK5 A;  4XN0 A;  1OFM A;  3B4N A;  5JMC B;  3BH6 B;  1O8G A;  4C2L A;  3RIQ A;  3SUC A;  1EZG A;  3LJY A;  2VFQ A;  3NAW A;  4XNF A;  2VFO A;  2XT2 A;  2QX3 A;  4OM9 A;  3GQ9 A;  3ZPP A;  1O8I A;  2ODL A;  1WXR A;  1KCD A;  2NTB A;  2NTP A;  2UVE A;  2NST A;  2Z8G A;  4KH3 A;  1O8M A;  4OJP A;  4YZA A;  2NZM A;  1CLW A;  1TYW A;  2XTW A;  4YFO A;  3LMW A;  4OZY A;  1CZF A;  3GRH A;  4OZZ A;  1BHE A;  2BM5 A;  2O04 A;  3SY2 A;  1O8E A;  2IQ7 A;  1QRB A;  1K5C A;  1DBG A;  1VBL A;  1LM1 A;  2BM4 A;  4PMH A;  5C1C A;  2YUH A;  2VFM A;  2O17 A;  4XON A;  4XOR A; 
#chains in the Genus database with same CATH homology
 2INV A;  4HWV A;  3VMV A;  3T9G A;  4I84 A;  4NK8 A;  4XKV A;  2NTQ A;  4W8S A;  1PE9 A;  4XLE A;  2QXZ A;  5C1E A;  4U49 A;  1OFL A;  3EQN A;  1IA5 A;  4AVZ A;  1PLU A;  4URR A;  1KTW A;  1QJV A;  1BN8 A;  3JUR A;  3GQ7 A;  2NSP A;  4XOP A;  4YEL A;  1RWR A;  4XL9 A;  5AMV A;  1HG8 A;  2PEC A;  1IDK A;  3GQA A;  3GQ8 A;  2VBE A;  3FY3 A;  4Z03 A;  4Z05 A;  4W8T A;  3VSV A;  1O8F A;  1JRG A;  2PYH A;  4OJO A;  3ZSC A;  2O0V A;  3B90 A;  1O8H A;  1PXZ A;  1O88 A;  2BSP A;  3VST A;  4XLH A;  2NT9 A;  3KRG A;  2VJI A;  4U4B A;  4NK6 A;  4OJ5 A;  1IB4 A;  2X3H A;  2O0W A;  2UVF A;  2VJJ A;  4XMY A;  1NHC A;  1AIR A;  2VBK A;  4YZ0 A;  2O1D A;  4XLA A;  4XLF A;  1KCC A;  4XKW A;  4YZQ A;  1X0C A;  2X6X A;  4W8R A;  1RU4 A;  1O8L A;  1XG2 A;  3B8Y A;  3WWG A;  4OJ6 A;  1H80 A;  2X6Y A;  2PYG A;  4MXN A;  1O8D A;  4XN3 A;  1O8K A;  2VBM A;  1IDJ A;  4YEJ A;  1JTA A;  1OGM X;  1O8J A;  4XQF A;  2EWE A;  4Z06 A;  1DBO A;  2X85 A;  3UW0 A;  1OOC A;  1QCX A;  4OJL A;  2INU A;  4W8Q A;  2QY1 A;  4YZX A;  3EQO A;  4XLC A;  1GQ8 A;  1OGO X;  3VMW A;  2NT6 A;  4MR0 A;  1RMG A;  4XOT A;  3VSU A;  2X6W A;  4XR6 A;  4EW9 A;  1WMR A;  1EE6 A;  4XM3 A;  4XN0 A;  1OFM A;  3B4N A;  4C2L A;  1O8G A;  3SUC A;  4XNF A;  2QX3 A;  3GQ9 A;  3ZPP A;  1O8I A;  2ODL A;  1KCD A;  2NTB A;  2NTP A;  2UVE A;  2NST A;  2Z8G A;  1O8M A;  4OJP A;  4YZA A;  2NZM A;  3LMW A;  4OZY A;  1CZF A;  3GRH A;  4OZZ A;  1BHE A;  2O04 A;  1O8E A;  2IQ7 A;  1K5C A;  1DBG A;  1VBL A;  4PMH A;  5C1C A;  2O17 A;  4XON A;  4XOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...