1O8LA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 5mm ca2+
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 138
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8lA00
4OJ5A 2VBKA 3SUCA 2INUA 2VBMA 2X3HA 4XLEA 2UVEA 1VBLA 2NSTA 1BN8A 2UVFA 1BHEA 2NSPA 1OGMX 2NTQA 1O8MA 1O8FA 1RWRA 1RMGA 3GQAA 1EE6A 3EQOA 3GRHA 4U49A 1JRGA 1IDJA 2IQ7A 1CZFA 1RU4A 3GQ7A 1O8IA 1QJVA 4XORA 2O04A 1IA5A 1AIRA 2X85A 5C1EA 4XR6A 2X6WA 2NTBA 3JURA 4OJOA 4C2LA 4XLFA 4OZYA 1OGOX 3B90A 4EW9A 4HWVA 4MR0A 2QXZA 1H80A 4URRA 4YEJA 2NTPA 4MXNA 2PYGA 1OFLA 3B4NA 4XLCA 2ODLA 1PE9A 4OJLA 4OJPA 1DBOA 1JTAA 4W8QA 2INVA 4YZAA 1O8KA 3LMWA 1WMRA 2VJIA 1O8LA 2X6YA 3GQ9A 4AVZA 4U4BA 1OFMA 1O88A 1IDKA 3T9GA 3KRGA 1OOCA 4YZXA 5AMVA 2O0VA 1NHCA 4W8TA 1HG8A 1O8DA 3WWGA 1X0CA 1KCCA 4XQFA 2BSPA 3FY3A 1O8JA 3EQNA 4XL9A 1K5CA 2O17A 3B8YA 4PMHA 1KCDA 1O8EA 2O0WA 4W8SA 3VSVA 2VJJA 4XN0A 4XONA 3VMVA 4OJ6A 1KTWA 4XNFA 4XN3A 2QX3A 4OZZA 3VMWA 4YZQA 1PLUA 2PECA 2QY1A 4YZ0A 4NK6A 4XOPA 4W8RA 1XG2A 4Z06A 3UW0A 2VBEA 4I84A 4YELA 4XOTA 3VSTA 4Z05A 2PYHA 4Z03A 1QCXA 1IB4A 2NT9A 2NZMA 2O1DA 4XKVA 2X6XA 1O8GA 4XM3A 1PXZA 2Z8GA 1O8HA 1DBGA 2EWEA 5C1CA 1GQ8A 4XKWA 3ZPPA 2NT6A 4NK8A 4XMYA 4XLHA 4XLAA 3GQ8A 3ZSCA 3VSUA
chains in the Genus database with same CATH superfamily
4OJ5A 2VBKA 4JRAC 3SUCA 2INUA 1EA0A 2XT4A 2VBMA 2X3HA 4XLEA 2UVEA 1VBLA 2NSTA 3SZEA 1BN8A 2UVFA 3H09A 1QRBA 2O6WA 1BHEA 2NSPA 1OGMX 2NTQA 2XTXA 1O8MA 1O8FA 1RWRA 3TH0A 1RMGA 3GQAA 1EE6A 3EQOA 3GRHA 4U49A 1JRGA 2XTWA 5JLVC 1IDJA 2IQ7A 3NAWA 1CZFA 1OFEA 1RU4A 2J8KA 3GQ7A 1O8IA 1QJVA 2B0RA 2VFQA 2O04A 3ML3A 4XORA 3SQVA 1IA5A 1AIRA 2X85A 2F3LA 5C1EA 3P4GA 1TYXA 4XR6A 2X6WA 2NTBA 3JURA 4OJOA 4C2LA 4YC5A 4XLFA 4OZYA 1OGOX 1QA2A 3JX8A 2YUHA 3B90A 4EW9A 4OM9A 4HWVA 2BM7A 2IOUG 2V5IA 4MR0A 2QXZA 2BM6A 1H80A 4URRA 4YEJA 1HF2A 2NTPA 3PSZA 4YCQA 4YDTA 4MXNA 2PYGA 1CLWA 1OFLA 3B4NA 4XLCA 2ODLA 1PE9A 1OFDA 4OJPA 3BH7B 4OJLA 3LJYA 1DBOA 1JTAA 4W8QA 3LYCA 1L1IA 2INVA 3DU1X 1QQ1A 4YZAA 1O8KA 3LMWA 1WMRA 2VJIA 3BH6B 3PSSA 1O8LA 2X6YA 2VFOA 3GQ9A 4AVZA 4U4BA 4V02C 1OFMA 1O88A 2QYUA 4KH3A 1IDKA 3PETA 3T9GA 3KRGA 1OOCA 4YZXA 2QZAA 2O0VA 1TYVA 4W8TA 5AMVA 1NHCA 1HG8A 1O8DA 3WWGA 2G0YA 1X0CA 1QA3A 1QRCA 1KCCA 3AK5A 2XTYA 2BSPA 1KQ5A 1O8JA 3EQNA 3FY3A 3NB2A 2O17A 4XL9A 4XQFA 1LLWA 3B8YA 1K5CA 1K4ZA 4PMHA 1KCDA 1TSPA 1O8EA 2O0WA 4W8SA 3N6ZA 2W7ZA 2J8IA 2VJJA 4XN0A 3VSVA 1QA1A 4XONA 3VMVA 4OJ6A 1KTWA 4XNFA 4XN3A 2QX3A 4OZZA 1WXRA 3VMWA 4YZQA 1PLUA 2BM4A 2PECA 2QY1A 4YZ0A 4NK6A 4XOPA 4W8RA 1XG2A 4Z06A 3UW0A 3RIQA 2VBEA 4I84A 2VFPA 3SYJA 4YELA 4XOTA 2BM5A 3VSTA 4Z05A 2PYHA 4Z03A 1QCXA 3SY2A 1IB4A 2VFNA 2NT9A 2NZMA 1TYUA 2O1DA 4OPWA 4XKVA 2X6XA 2BX6A 5JMCB 1O8GA 2XT2A 4XM3A 1PXZA 2Z8GA 1O8HA 2VFMA 1DBGA 1LM1A 5DNSA 4YFOA 2EWEA 1LLZA 5C1CA 1GQ8A 4XKWA 1EZGA 3ZPPA 2NT6A 3N90A 1TYWA 2XC1A 4NK8A 1DABA 4XMYA 4XLHA 4XLAA 3GQ8A 3ZSCA 4YEIA 1K8FA 3VSUA
chains in the Genus database with same CATH topology
4OJ5A 2VBKA 3SUCA 2INUA 2VBMA 2X3HA 4XLEA 2UVEA 1VBLA 2NSTA 1BN8A 2UVFA 1BHEA 2NSPA 1OGMX 2NTQA 1O8MA 1O8FA 1RWRA 1RMGA 3GQAA 1EE6A 3EQOA 3GRHA 4U49A 1JRGA 1IDJA 2IQ7A 1CZFA 1RU4A 3GQ7A 1O8IA 1QJVA 4XORA 2O04A 1IA5A 1AIRA 2X85A 5C1EA 4XR6A 2X6WA 2NTBA 3JURA 4OJOA 4C2LA 4XLFA 4OZYA 1OGOX 3B90A 4EW9A 4HWVA 4MR0A 2QXZA 1H80A 4URRA 4YEJA 2NTPA 4MXNA 2PYGA 1OFLA 3B4NA 4XLCA 2ODLA 1PE9A 4OJLA 4OJPA 1DBOA 1JTAA 4W8QA 2INVA 4YZAA 1O8KA 3LMWA 1WMRA 2VJIA 1O8LA 2X6YA 3GQ9A 4AVZA 4U4BA 1OFMA 1O88A 1IDKA 3T9GA 3KRGA 1OOCA 4YZXA 5AMVA 2O0VA 1NHCA 4W8TA 1HG8A 1O8DA 3WWGA 1X0CA 1KCCA 4XQFA 2BSPA 3FY3A 1O8JA 3EQNA 4XL9A 1K5CA 2O17A 3B8YA 4PMHA 1KCDA 1O8EA 2O0WA 4W8SA 3VSVA 2VJJA 4XN0A 4XONA 3VMVA 4OJ6A 1KTWA 4XNFA 4XN3A 2QX3A 4OZZA 3VMWA 4YZQA 1PLUA 2PECA 2QY1A 4YZ0A 4NK6A 4XOPA 4W8RA 1XG2A 4Z06A 3UW0A 2VBEA 4I84A 4YELA 4XOTA 3VSTA 4Z05A 2PYHA 4Z03A 1QCXA 1IB4A 2NT9A 2NZMA 2O1DA 4XKVA 2X6XA 1O8GA 4XM3A 1PXZA 2Z8GA 1O8HA 1DBGA 2EWEA 5C1CA 1GQ8A 4XKWA 3ZPPA 2NT6A 4NK8A 4XMYA 4XLHA 4XLAA 3GQ8A 3ZSCA 3VSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJ5 A;  2VBK A;  3SUC A;  2INU A;  2VBM A;  2X3H A;  4XLE A;  2UVE A;  1VBL A;  2NST A;  1BN8 A;  2UVF A;  1BHE A;  2NSP A;  1OGM X;  2NTQ A;  1O8M A;  1O8F A;  1RWR A;  1RMG A;  3GQA A;  1EE6 A;  3EQO A;  3GRH A;  4U49 A;  1JRG A;  1IDJ A;  2IQ7 A;  1CZF A;  1RU4 A;  3GQ7 A;  1O8I A;  1QJV A;  4XOR A;  2O04 A;  1IA5 A;  1AIR A;  2X85 A;  5C1E A;  4XR6 A;  2X6W A;  2NTB A;  3JUR A;  4OJO A;  4C2L A;  4XLF A;  4OZY A;  1OGO X;  3B90 A;  4EW9 A;  4HWV A;  4MR0 A;  2QXZ A;  1H80 A;  4URR A;  4YEJ A;  2NTP A;  4MXN A;  2PYG A;  1OFL A;  3B4N A;  4XLC A;  2ODL A;  1PE9 A;  4OJL A;  4OJP A;  1DBO A;  1JTA A;  4W8Q A;  2INV A;  4YZA A;  1O8K A;  3LMW A;  1WMR A;  2VJI A;  1O8L A;  2X6Y A;  3GQ9 A;  4AVZ A;  4U4B A;  1OFM A;  1O88 A;  1IDK A;  3T9G A;  3KRG A;  1OOC A;  4YZX A;  5AMV A;  2O0V A;  1NHC A;  4W8T A;  1HG8 A;  1O8D A;  3WWG A;  1X0C A;  1KCC A;  4XQF A;  2BSP A;  3FY3 A;  1O8J A;  3EQN A;  4XL9 A;  1K5C A;  2O17 A;  3B8Y A;  4PMH A;  1KCD A;  1O8E A;  2O0W A;  4W8S A;  3VSV A;  2VJJ A;  4XN0 A;  4XON A;  3VMV A;  4OJ6 A;  1KTW A;  4XNF A;  4XN3 A;  2QX3 A;  4OZZ A;  3VMW A;  4YZQ A;  1PLU A;  2PEC A;  2QY1 A;  4YZ0 A;  4NK6 A;  4XOP A;  4W8R A;  1XG2 A;  4Z06 A;  3UW0 A;  2VBE A;  4I84 A;  4YEL A;  4XOT A;  3VST A;  4Z05 A;  2PYH A;  4Z03 A;  1QCX A;  1IB4 A;  2NT9 A;  2NZM A;  2O1D A;  4XKV A;  2X6X A;  1O8G A;  4XM3 A;  1PXZ A;  2Z8G A;  1O8H A;  1DBG A;  2EWE A;  5C1C A;  1GQ8 A;  4XKW A;  3ZPP A;  2NT6 A;  4NK8 A;  4XMY A;  4XLH A;  4XLA A;  3GQ8 A;  3ZSC A;  3VSU A; 
#chains in the Genus database with same CATH topology
 4OJ5 A;  2VBK A;  4JRA C;  3SUC A;  2INU A;  1EA0 A;  2XT4 A;  2VBM A;  2X3H A;  4XLE A;  2UVE A;  1VBL A;  2NST A;  3SZE A;  1BN8 A;  2UVF A;  3H09 A;  1QRB A;  2O6W A;  1BHE A;  2NSP A;  1OGM X;  2NTQ A;  2XTX A;  1O8M A;  1O8F A;  1RWR A;  3TH0 A;  1RMG A;  3GQA A;  1EE6 A;  3EQO A;  3GRH A;  4U49 A;  1JRG A;  2XTW A;  5JLV C;  1IDJ A;  2IQ7 A;  3NAW A;  1CZF A;  1OFE A;  1RU4 A;  2J8K A;  3GQ7 A;  1O8I A;  1QJV A;  2B0R A;  2VFQ A;  2O04 A;  3ML3 A;  4XOR A;  3SQV A;  1IA5 A;  1AIR A;  2X85 A;  2F3L A;  5C1E A;  3P4G A;  1TYX A;  4XR6 A;  2X6W A;  2NTB A;  3JUR A;  4OJO A;  4C2L A;  4YC5 A;  4XLF A;  4OZY A;  1OGO X;  1QA2 A;  3JX8 A;  2YUH A;  3B90 A;  4EW9 A;  4OM9 A;  4HWV A;  2BM7 A;  2IOU G;  2V5I A;  4MR0 A;  2QXZ A;  2BM6 A;  1H80 A;  4URR A;  4YEJ A;  1HF2 A;  2NTP A;  3PSZ A;  4YCQ A;  4YDT A;  4MXN A;  2PYG A;  1CLW A;  1OFL A;  3B4N A;  4XLC A;  2ODL A;  1PE9 A;  1OFD A;  4OJP A;  3BH7 B;  4OJL A;  3LJY A;  1DBO A;  1JTA A;  4W8Q A;  3LYC A;  1L1I A;  2INV A;  3DU1 X;  1QQ1 A;  4YZA A;  1O8K A;  3LMW A;  1WMR A;  2VJI A;  3BH6 B;  3PSS A;  1O8L A;  2X6Y A;  2VFO A;  3GQ9 A;  4AVZ A;  4U4B A;  4V02 C;  1OFM A;  1O88 A;  2QYU A;  4KH3 A;  1IDK A;  3PET A;  3T9G A;  3KRG A;  1OOC A;  4YZX A;  2QZA A;  2O0V A;  1TYV A;  4W8T A;  5AMV A;  1NHC A;  1HG8 A;  1O8D A;  3WWG A;  2G0Y A;  1X0C A;  1QA3 A;  1QRC A;  1KCC A;  3AK5 A;  2XTY A;  2BSP A;  1KQ5 A;  1O8J A;  3EQN A;  3FY3 A;  3NB2 A;  2O17 A;  4XL9 A;  4XQF A;  1LLW A;  3B8Y A;  1K5C A;  1K4Z A;  4PMH A;  1KCD A;  1TSP A;  1O8E A;  2O0W A;  4W8S A;  3N6Z A;  2W7Z A;  2J8I A;  2VJJ A;  4XN0 A;  3VSV A;  1QA1 A;  4XON A;  3VMV A;  4OJ6 A;  1KTW A;  4XNF A;  4XN3 A;  2QX3 A;  4OZZ A;  1WXR A;  3VMW A;  4YZQ A;  1PLU A;  2BM4 A;  2PEC A;  2QY1 A;  4YZ0 A;  4NK6 A;  4XOP A;  4W8R A;  1XG2 A;  4Z06 A;  3UW0 A;  3RIQ A;  2VBE A;  4I84 A;  2VFP A;  3SYJ A;  4YEL A;  4XOT A;  2BM5 A;  3VST A;  4Z05 A;  2PYH A;  4Z03 A;  1QCX A;  3SY2 A;  1IB4 A;  2VFN A;  2NT9 A;  2NZM A;  1TYU A;  2O1D A;  4OPW A;  4XKV A;  2X6X A;  2BX6 A;  5JMC B;  1O8G A;  2XT2 A;  4XM3 A;  1PXZ A;  2Z8G A;  1O8H A;  2VFM A;  1DBG A;  1LM1 A;  5DNS A;  4YFO A;  2EWE A;  1LLZ A;  5C1C A;  1GQ8 A;  4XKW A;  1EZG A;  3ZPP A;  2NT6 A;  3N90 A;  1TYW A;  2XC1 A;  4NK8 A;  1DAB A;  4XMY A;  4XLH A;  4XLA A;  3GQ8 A;  3ZSC A;  4YEI A;  1K8F A;  3VSU A; 
#chains in the Genus database with same CATH homology
 4OJ5 A;  2VBK A;  3SUC A;  2INU A;  2VBM A;  2X3H A;  4XLE A;  2UVE A;  1VBL A;  2NST A;  1BN8 A;  2UVF A;  1BHE A;  2NSP A;  1OGM X;  2NTQ A;  1O8M A;  1O8F A;  1RWR A;  1RMG A;  3GQA A;  1EE6 A;  3EQO A;  3GRH A;  4U49 A;  1JRG A;  1IDJ A;  2IQ7 A;  1CZF A;  1RU4 A;  3GQ7 A;  1O8I A;  1QJV A;  4XOR A;  2O04 A;  1IA5 A;  1AIR A;  2X85 A;  5C1E A;  4XR6 A;  2X6W A;  2NTB A;  3JUR A;  4OJO A;  4C2L A;  4XLF A;  4OZY A;  1OGO X;  3B90 A;  4EW9 A;  4HWV A;  4MR0 A;  2QXZ A;  1H80 A;  4URR A;  4YEJ A;  2NTP A;  4MXN A;  2PYG A;  1OFL A;  3B4N A;  4XLC A;  2ODL A;  1PE9 A;  4OJL A;  4OJP A;  1DBO A;  1JTA A;  4W8Q A;  2INV A;  4YZA A;  1O8K A;  3LMW A;  1WMR A;  2VJI A;  1O8L A;  2X6Y A;  3GQ9 A;  4AVZ A;  4U4B A;  1OFM A;  1O88 A;  1IDK A;  3T9G A;  3KRG A;  1OOC A;  4YZX A;  5AMV A;  2O0V A;  1NHC A;  4W8T A;  1HG8 A;  1O8D A;  3WWG A;  1X0C A;  1KCC A;  4XQF A;  2BSP A;  3FY3 A;  1O8J A;  3EQN A;  4XL9 A;  1K5C A;  2O17 A;  3B8Y A;  4PMH A;  1KCD A;  1O8E A;  2O0W A;  4W8S A;  3VSV A;  2VJJ A;  4XN0 A;  4XON A;  3VMV A;  4OJ6 A;  1KTW A;  4XNF A;  4XN3 A;  2QX3 A;  4OZZ A;  3VMW A;  4YZQ A;  1PLU A;  2PEC A;  2QY1 A;  4YZ0 A;  4NK6 A;  4XOP A;  4W8R A;  1XG2 A;  4Z06 A;  3UW0 A;  2VBE A;  4I84 A;  4YEL A;  4XOT A;  3VST A;  4Z05 A;  2PYH A;  4Z03 A;  1QCX A;  1IB4 A;  2NT9 A;  2NZM A;  2O1D A;  4XKV A;  2X6X A;  1O8G A;  4XM3 A;  1PXZ A;  2Z8G A;  1O8H A;  1DBG A;  2EWE A;  5C1C A;  1GQ8 A;  4XKW A;  3ZPP A;  2NT6 A;  4NK8 A;  4XMY A;  4XLH A;  4XLA A;  3GQ8 A;  3ZSC A;  3VSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...