1O8LA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 5mm ca2+
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 138
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8lA00
2VJIA 1JTAA 4PMHA 4MXNA 2UVEA 2PYGA 3KRGA 2VBEA 1X0CA 3WWGA 4OZZA 4XMYA 1OOCA 4XKWA 3VMWA 1OGOX 4YZAA 1DBGA 2VBKA 3VMVA 1IA5A 3GQ9A 1HG8A 2O17A 1QCXA 4OJ5A 1O8HA 3VSTA 3B4NA 4YZ0A 2NSPA 1RWRA 2IQ7A 1O8LA 4URRA 1O8MA 3T9GA 4W8RA 4W8QA 4XKVA 4OJPA 4OJOA 4NK6A 2NTQA 2INUA 3UW0A 1XG2A 2NTPA 4OJLA 1BHEA 4NK8A 1PXZA 4XQFA 2VJJA 4XL9A 1PLUA 1AIRA 1PE9A 2QXZA 4W8SA 1OFMA 5C1CA 2EWEA 4XLHA 2PYHA 4U4BA 3VSVA 3EQNA 4MR0A 1IDJA 3SUCA 4XLCA 2PECA 1O8DA 2NSTA 1DBOA 4XN0A 2X6XA 3VSUA 1O8FA 2X85A 5C1EA 1VBLA 4Z05A 4XONA 4Z03A 4YEJA 2INVA 2BSPA 1O8EA 3GRHA 4XLFA 3EQOA 2X3HA 4YZXA 1RMGA 1GQ8A 1NHCA 1IDKA 2QX3A 3GQ8A 4U49A 5AMVA 2Z8GA 3B90A 1IB4A 1O8IA 1EE6A 1H80A 3ZPPA 2O1DA 2ODLA 4XOTA 4XORA 4OJ6A 2O0VA 1CZFA 3GQAA 1K5CA 2O04A 4EW9A 1O8KA 4XN3A 3ZSCA 4YELA 4XLEA 1OFLA 4XOPA 3FY3A 4W8TA 4Z06A 2O0WA 1O88A 1O8GA 4HWVA 2UVFA 1JRGA 2VBMA 2NT6A 1BN8A 4C2LA 2NTBA 1RU4A 2X6YA 1O8JA 3JURA 2X6WA 4AVZA 4XR6A 1KCDA 1KTWA 2QY1A 3LMWA 1KCCA 4XNFA 2NZMA 4YZQA 3GQ7A 1WMRA 4I84A 2NT9A 4XLAA 4XM3A 1OGMX 3B8YA 4OZYA 1QJVA
chains in the Genus database with same CATH superfamily
1EZGA 1JTAA 2QYUA 2VJIA 1LLWA 2BM4A 4PMHA 2W7ZA 4MXNA 2UVEA 2PYGA 3TH0A 3KRGA 3SYJA 1TYUA 2VBEA 1X0CA 3WWGA 4OZZA 2XT2A 4XMYA 1OOCA 4XKWA 1OFEA 4XM3A 3VMWA 1OGOX 4YZAA 1DBGA 2VBKA 3VMVA 4YCQA 5JMCB 1IA5A 3P4GA 3SY2A 3GQ9A 1HG8A 2O17A 3NB2A 1QCXA 3N6ZA 4OJ5A 1O8HA 3VSTA 3BH6B 2BX6A 3B4NA 1K8FA 2J8IA 2NSPA 1RWRA 3H09A 2IQ7A 4YZ0A 1O8LA 4URRA 1O8MA 3T9GA 2YUHA 4KH3A 3SQVA 4W8RA 4W8QA 2QZAA 4XKVA 1TYVA 1QRBA 4OJPA 4OJOA 2BM6A 2O6WA 4NK6A 1TYWA 2NTQA 2B0RA 2BM7A 2INUA 2XT4A 1XG2A 3UW0A 1HF2A 2NTPA 4OJLA 1BHEA 4OM9A 1KQ5A 4NK8A 1PXZA 4XQFA 2VJJA 4XL9A 1PLUA 1AIRA 1PE9A 2QXZA 4JRAC 4W8SA 1OFMA 5C1CA 2EWEA 4XLHA 3BH7B 2PYHA 4U4BA 2BM5A 2G0YA 3VSVA 3EQNA 4MR0A 1IDJA 3SUCA 3N90A 3PETA 1EA0A 4XLCA 2PECA 1O8DA 3LJYA 2NSTA 2XTYA 1DBOA 4XN0A 2VFMA 2X6XA 3PSZA 4OPWA 3VSUA 5JLVC 1O8FA 2F3LA 2X85A 4YEIA 5C1EA 1VBLA 2IOUG 4Z05A 4XONA 4Z03A 4YEJA 2INVA 2BSPA 3LYCA 1O8EA 3GRHA 4XLFA 2V5IA 3EQOA 2X3HA 4V02C 4YZXA 1QQ1A 1RMGA 1GQ8A 3PSSA 3AK5A 1NHCA 1TYXA 1QRCA 1IDKA 2QX3A 3GQ8A 4U49A 1LLZA 2Z8GA 3B90A 4YFOA 5AMVA 1O8IA 1IB4A 1EE6A 1H80A 3ZPPA 2VFQA 2O1DA 2ODLA 3DU1X 4XOTA 4XORA 5DNSA 2XC1A 4OJ6A 1WXRA 2O0VA 1CZFA 1L1IA 3ML3A 3GQAA 1K5CA 2O04A 4EW9A 1LM1A 1O8KA 4XN3A 2VFPA 3NAWA 4YELA 2VFOA 3ZSCA 2XTXA 4XLEA 1OFLA 4XOPA 3FY3A 4W8TA 4Z06A 1OFDA 2O0WA 1O88A 3SZEA 1O8GA 4HWVA 2UVFA 1JRGA 2VBMA 2NT6A 1BN8A 4C2LA 2J8KA 1CLWA 2NTBA 1RU4A 2X6YA 1O8JA 1TSPA 2VFNA 4YDTA 3JURA 2X6WA 4AVZA 3JX8A 4XR6A 1KTWA 1KCDA 1QA1A 1QA2A 2QY1A 4YC5A 3LMWA 1KCCA 1DABA 4XNFA 2NZMA 1QA3A 3RIQA 1K4ZA 4YZQA 3GQ7A 1WMRA 4I84A 2NT9A 4XLAA 2XTWA 1OGMX 3B8YA 4OZYA 1QJVA
chains in the Genus database with same CATH topology
2VJIA 1JTAA 4PMHA 4MXNA 2UVEA 2PYGA 3KRGA 2VBEA 1X0CA 3WWGA 4OZZA 4XMYA 1OOCA 4XKWA 3VMWA 1OGOX 4YZAA 1DBGA 2VBKA 3VMVA 1IA5A 3GQ9A 1HG8A 2O17A 1QCXA 4OJ5A 1O8HA 3VSTA 3B4NA 4YZ0A 2NSPA 1RWRA 2IQ7A 1O8LA 4URRA 1O8MA 3T9GA 4W8RA 4W8QA 4XKVA 4OJPA 4OJOA 4NK6A 2NTQA 2INUA 3UW0A 1XG2A 2NTPA 4OJLA 1BHEA 4NK8A 1PXZA 4XQFA 2VJJA 4XL9A 1PLUA 1AIRA 1PE9A 2QXZA 4W8SA 1OFMA 5C1CA 2EWEA 4XLHA 2PYHA 4U4BA 3VSVA 3EQNA 4MR0A 1IDJA 3SUCA 4XLCA 2PECA 1O8DA 2NSTA 1DBOA 4XN0A 2X6XA 3VSUA 1O8FA 2X85A 5C1EA 1VBLA 4Z05A 4XONA 4Z03A 4YEJA 2INVA 2BSPA 1O8EA 3GRHA 4XLFA 3EQOA 2X3HA 4YZXA 1RMGA 1GQ8A 1NHCA 1IDKA 2QX3A 3GQ8A 4U49A 5AMVA 2Z8GA 3B90A 1IB4A 1O8IA 1EE6A 1H80A 3ZPPA 2O1DA 2ODLA 4XOTA 4XORA 4OJ6A 2O0VA 1CZFA 3GQAA 1K5CA 2O04A 4EW9A 1O8KA 4XN3A 3ZSCA 4YELA 4XLEA 1OFLA 4XOPA 3FY3A 4W8TA 4Z06A 2O0WA 1O88A 1O8GA 4HWVA 2UVFA 1JRGA 2VBMA 2NT6A 1BN8A 4C2LA 2NTBA 1RU4A 2X6YA 1O8JA 3JURA 2X6WA 4AVZA 4XR6A 1KCDA 1KTWA 2QY1A 3LMWA 1KCCA 4XNFA 2NZMA 4YZQA 3GQ7A 1WMRA 4I84A 2NT9A 4XLAA 4XM3A 1OGMX 3B8YA 4OZYA 1QJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJI A;  1JTA A;  4PMH A;  4MXN A;  2UVE A;  2PYG A;  3KRG A;  2VBE A;  1X0C A;  3WWG A;  4OZZ A;  4XMY A;  1OOC A;  4XKW A;  3VMW A;  1OGO X;  4YZA A;  1DBG A;  2VBK A;  3VMV A;  1IA5 A;  3GQ9 A;  1HG8 A;  2O17 A;  1QCX A;  4OJ5 A;  1O8H A;  3VST A;  3B4N A;  4YZ0 A;  2NSP A;  1RWR A;  2IQ7 A;  1O8L A;  4URR A;  1O8M A;  3T9G A;  4W8R A;  4W8Q A;  4XKV A;  4OJP A;  4OJO A;  4NK6 A;  2NTQ A;  2INU A;  3UW0 A;  1XG2 A;  2NTP A;  4OJL A;  1BHE A;  4NK8 A;  1PXZ A;  4XQF A;  2VJJ A;  4XL9 A;  1PLU A;  1AIR A;  1PE9 A;  2QXZ A;  4W8S A;  1OFM A;  5C1C A;  2EWE A;  4XLH A;  2PYH A;  4U4B A;  3VSV A;  3EQN A;  4MR0 A;  1IDJ A;  3SUC A;  4XLC A;  2PEC A;  1O8D A;  2NST A;  1DBO A;  4XN0 A;  2X6X A;  3VSU A;  1O8F A;  2X85 A;  5C1E A;  1VBL A;  4Z05 A;  4XON A;  4Z03 A;  4YEJ A;  2INV A;  2BSP A;  1O8E A;  3GRH A;  4XLF A;  3EQO A;  2X3H A;  4YZX A;  1RMG A;  1GQ8 A;  1NHC A;  1IDK A;  2QX3 A;  3GQ8 A;  4U49 A;  5AMV A;  2Z8G A;  3B90 A;  1IB4 A;  1O8I A;  1EE6 A;  1H80 A;  3ZPP A;  2O1D A;  2ODL A;  4XOT A;  4XOR A;  4OJ6 A;  2O0V A;  1CZF A;  3GQA A;  1K5C A;  2O04 A;  4EW9 A;  1O8K A;  4XN3 A;  3ZSC A;  4YEL A;  4XLE A;  1OFL A;  4XOP A;  3FY3 A;  4W8T A;  4Z06 A;  2O0W A;  1O88 A;  1O8G A;  4HWV A;  2UVF A;  1JRG A;  2VBM A;  2NT6 A;  1BN8 A;  4C2L A;  2NTB A;  1RU4 A;  2X6Y A;  1O8J A;  3JUR A;  2X6W A;  4AVZ A;  4XR6 A;  1KCD A;  1KTW A;  2QY1 A;  3LMW A;  1KCC A;  4XNF A;  2NZM A;  4YZQ A;  3GQ7 A;  1WMR A;  4I84 A;  2NT9 A;  4XLA A;  4XM3 A;  1OGM X;  3B8Y A;  4OZY A;  1QJV A; 
#chains in the Genus database with same CATH topology
 1EZG A;  1JTA A;  2QYU A;  2VJI A;  1LLW A;  2BM4 A;  4PMH A;  2W7Z A;  4MXN A;  2UVE A;  2PYG A;  3TH0 A;  3KRG A;  3SYJ A;  1TYU A;  2VBE A;  1X0C A;  3WWG A;  4OZZ A;  2XT2 A;  4XMY A;  1OOC A;  4XKW A;  1OFE A;  4XM3 A;  3VMW A;  1OGO X;  4YZA A;  1DBG A;  2VBK A;  3VMV A;  4YCQ A;  5JMC B;  1IA5 A;  3P4G A;  3SY2 A;  3GQ9 A;  1HG8 A;  2O17 A;  3NB2 A;  1QCX A;  3N6Z A;  4OJ5 A;  1O8H A;  3VST A;  3BH6 B;  2BX6 A;  3B4N A;  1K8F A;  2J8I A;  2NSP A;  1RWR A;  3H09 A;  2IQ7 A;  4YZ0 A;  1O8L A;  4URR A;  1O8M A;  3T9G A;  2YUH A;  4KH3 A;  3SQV A;  4W8R A;  4W8Q A;  2QZA A;  4XKV A;  1TYV A;  1QRB A;  4OJP A;  4OJO A;  2BM6 A;  2O6W A;  4NK6 A;  1TYW A;  2NTQ A;  2B0R A;  2BM7 A;  2INU A;  2XT4 A;  1XG2 A;  3UW0 A;  1HF2 A;  2NTP A;  4OJL A;  1BHE A;  4OM9 A;  1KQ5 A;  4NK8 A;  1PXZ A;  4XQF A;  2VJJ A;  4XL9 A;  1PLU A;  1AIR A;  1PE9 A;  2QXZ A;  4JRA C;  4W8S A;  1OFM A;  5C1C A;  2EWE A;  4XLH A;  3BH7 B;  2PYH A;  4U4B A;  2BM5 A;  2G0Y A;  3VSV A;  3EQN A;  4MR0 A;  1IDJ A;  3SUC A;  3N90 A;  3PET A;  1EA0 A;  4XLC A;  2PEC A;  1O8D A;  3LJY A;  2NST A;  2XTY A;  1DBO A;  4XN0 A;  2VFM A;  2X6X A;  3PSZ A;  4OPW A;  3VSU A;  5JLV C;  1O8F A;  2F3L A;  2X85 A;  4YEI A;  5C1E A;  1VBL A;  2IOU G;  4Z05 A;  4XON A;  4Z03 A;  4YEJ A;  2INV A;  2BSP A;  3LYC A;  1O8E A;  3GRH A;  4XLF A;  2V5I A;  3EQO A;  2X3H A;  4V02 C;  4YZX A;  1QQ1 A;  1RMG A;  1GQ8 A;  3PSS A;  3AK5 A;  1NHC A;  1TYX A;  1QRC A;  1IDK A;  2QX3 A;  3GQ8 A;  4U49 A;  1LLZ A;  2Z8G A;  3B90 A;  4YFO A;  5AMV A;  1O8I A;  1IB4 A;  1EE6 A;  1H80 A;  3ZPP A;  2VFQ A;  2O1D A;  2ODL A;  3DU1 X;  4XOT A;  4XOR A;  5DNS A;  2XC1 A;  4OJ6 A;  1WXR A;  2O0V A;  1CZF A;  1L1I A;  3ML3 A;  3GQA A;  1K5C A;  2O04 A;  4EW9 A;  1LM1 A;  1O8K A;  4XN3 A;  2VFP A;  3NAW A;  4YEL A;  2VFO A;  3ZSC A;  2XTX A;  4XLE A;  1OFL A;  4XOP A;  3FY3 A;  4W8T A;  4Z06 A;  1OFD A;  2O0W A;  1O88 A;  3SZE A;  1O8G A;  4HWV A;  2UVF A;  1JRG A;  2VBM A;  2NT6 A;  1BN8 A;  4C2L A;  2J8K A;  1CLW A;  2NTB A;  1RU4 A;  2X6Y A;  1O8J A;  1TSP A;  2VFN A;  4YDT A;  3JUR A;  2X6W A;  4AVZ A;  3JX8 A;  4XR6 A;  1KTW A;  1KCD A;  1QA1 A;  1QA2 A;  2QY1 A;  4YC5 A;  3LMW A;  1KCC A;  1DAB A;  4XNF A;  2NZM A;  1QA3 A;  3RIQ A;  1K4Z A;  4YZQ A;  3GQ7 A;  1WMR A;  4I84 A;  2NT9 A;  4XLA A;  2XTW A;  1OGM X;  3B8Y A;  4OZY A;  1QJV A; 
#chains in the Genus database with same CATH homology
 2VJI A;  1JTA A;  4PMH A;  4MXN A;  2UVE A;  2PYG A;  3KRG A;  2VBE A;  1X0C A;  3WWG A;  4OZZ A;  4XMY A;  1OOC A;  4XKW A;  3VMW A;  1OGO X;  4YZA A;  1DBG A;  2VBK A;  3VMV A;  1IA5 A;  3GQ9 A;  1HG8 A;  2O17 A;  1QCX A;  4OJ5 A;  1O8H A;  3VST A;  3B4N A;  4YZ0 A;  2NSP A;  1RWR A;  2IQ7 A;  1O8L A;  4URR A;  1O8M A;  3T9G A;  4W8R A;  4W8Q A;  4XKV A;  4OJP A;  4OJO A;  4NK6 A;  2NTQ A;  2INU A;  3UW0 A;  1XG2 A;  2NTP A;  4OJL A;  1BHE A;  4NK8 A;  1PXZ A;  4XQF A;  2VJJ A;  4XL9 A;  1PLU A;  1AIR A;  1PE9 A;  2QXZ A;  4W8S A;  1OFM A;  5C1C A;  2EWE A;  4XLH A;  2PYH A;  4U4B A;  3VSV A;  3EQN A;  4MR0 A;  1IDJ A;  3SUC A;  4XLC A;  2PEC A;  1O8D A;  2NST A;  1DBO A;  4XN0 A;  2X6X A;  3VSU A;  1O8F A;  2X85 A;  5C1E A;  1VBL A;  4Z05 A;  4XON A;  4Z03 A;  4YEJ A;  2INV A;  2BSP A;  1O8E A;  3GRH A;  4XLF A;  3EQO A;  2X3H A;  4YZX A;  1RMG A;  1GQ8 A;  1NHC A;  1IDK A;  2QX3 A;  3GQ8 A;  4U49 A;  5AMV A;  2Z8G A;  3B90 A;  1IB4 A;  1O8I A;  1EE6 A;  1H80 A;  3ZPP A;  2O1D A;  2ODL A;  4XOT A;  4XOR A;  4OJ6 A;  2O0V A;  1CZF A;  3GQA A;  1K5C A;  2O04 A;  4EW9 A;  1O8K A;  4XN3 A;  3ZSC A;  4YEL A;  4XLE A;  1OFL A;  4XOP A;  3FY3 A;  4W8T A;  4Z06 A;  2O0W A;  1O88 A;  1O8G A;  4HWV A;  2UVF A;  1JRG A;  2VBM A;  2NT6 A;  1BN8 A;  4C2L A;  2NTB A;  1RU4 A;  2X6Y A;  1O8J A;  3JUR A;  2X6W A;  4AVZ A;  4XR6 A;  1KCD A;  1KTW A;  2QY1 A;  3LMW A;  1KCC A;  4XNF A;  2NZM A;  4YZQ A;  3GQ7 A;  1WMR A;  4I84 A;  2NT9 A;  4XLA A;  4XM3 A;  1OGM X;  3B8Y A;  4OZY A;  1QJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...