1O8LA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 5mm ca2+
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 138
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8lA00
4HWVA 1O8DA 4XQFA 2O1DA 2VJIA 4XLFA 1OGOX 3EQNA 2QX3A 3SUCA 4EW9A 1DBOA 2NTBA 1O8KA 3LMWA 4AVZA 3VMWA 3VSUA 1KCCA 4W8RA 4XLEA 1PLUA 2X6YA 4OJ6A 3B8YA 1JRGA 3B4NA 4PMHA 1H80A 4C2LA 1VBLA 2UVEA 3ZSCA 1EE6A 3GQ8A 2NTQA 3VMVA 4XORA 2PECA 2X85A 1O88A 1O8EA 1DBGA 1PE9A 4XOPA 4XKVA 4OJLA 1RWRA 2QXZA 2IQ7A 2NTPA 1OFLA 4Z06A 2INVA 3FY3A 3GRHA 4YZ0A 4XMYA 2X3HA 4NK6A 1KTWA 1BN8A 3GQ9A 5C1EA 1O8IA 3VSVA 3UW0A 2O04A 2QY1A 5AMVA 1IB4A 2VJJA 2NSTA 1JTAA 4YELA 3EQOA 4XONA 2BSPA 1O8JA 2NT9A 4I84A 1KCDA 2UVFA 4MXNA 1OFMA 2INUA 4W8TA 1IDKA 2PYGA 4XN0A 1WMRA 1IA5A 2O17A 2PYHA 4OZZA 1CZFA 4XOTA 4OJPA 4YEJA 2O0WA 1O8LA 2VBMA 2Z8GA 1XG2A 2X6WA 4W8QA 1OGMX 3ZPPA 4U4BA 4U49A 1O8MA 2EWEA 2O0VA 4XN3A 4OJOA 2NSPA 1RU4A 1PXZA 4MR0A 2VBKA 3T9GA 3GQAA 1X0CA 1O8GA 4XR6A 4NK8A 4XL9A 1HG8A 4XLHA 4XLCA 2ODLA 3VSTA 4XNFA 1O8FA 1O8HA 3KRGA 4YZXA 1OOCA 4Z05A 4OZYA 2NZMA 1QCXA 1AIRA 1RMGA 1BHEA 3GQ7A 4XKWA 1K5CA 1QJVA 4OJ5A 3WWGA 4YZAA 4W8SA 5C1CA 1GQ8A 3JURA 1IDJA 2VBEA 4XLAA 1NHCA 2NT6A 4XM3A 2X6XA 4YZQA 4URRA 3B90A 4Z03A
chains in the Genus database with same CATH superfamily
4HWVA 1O8DA 2O6WA 1TYWA 5JLVC 1QA3A 3AK5A 3SZEA 4XQFA 2O1DA 3SQVA 2VJIA 4XLFA 1OGOX 3RIQA 3EQNA 2QX3A 3SUCA 4EW9A 1DBOA 2NTBA 2BX6A 1O8KA 1LLWA 3LMWA 4AVZA 1QRBA 3VMWA 3VSUA 2VFOA 1KCCA 1L1IA 4W8RA 4XLEA 1PLUA 2X6YA 4YEIA 4OJ6A 3B8YA 1JRGA 3B4NA 3LYCA 1H80A 4PMHA 1VBLA 2V5IA 4C2LA 2UVEA 1LLZA 3ZSCA 1EE6A 3GQ8A 2NTQA 1CLWA 3VMVA 4XORA 2PECA 2X85A 1O88A 4YFOA 1O8EA 1DBGA 1PE9A 4XOPA 1QA1A 3H09A 4XKVA 4OJLA 1RWRA 2VFMA 2BM4A 2IQ7A 2NTPA 2QXZA 3TH0A 2XT2A 1OFLA 4Z06A 2INVA 3ML3A 2J8KA 3FY3A 3BH7B 3GRHA 2B0RA 3NAWA 4YZ0A 4XMYA 5DNSA 2X3HA 3SY2A 2XT4A 4NK6A 1KTWA 1BN8A 1LM1A 3GQ9A 1O8IA 4YC5A 1EZGA 5C1EA 3SYJA 3VSVA 3P4GA 3UW0A 3N90A 2BM6A 2O04A 2QY1A 4V02C 5AMVA 1IB4A 2VJJA 2NSTA 4OPWA 1JTAA 4YELA 3EQOA 4XONA 2J8IA 2BSPA 1O8JA 2NT9A 1OFEA 2XTXA 3JX8A 4OM9A 2IOUG 4I84A 1KCDA 2UVFA 4MXNA 1OFMA 2INUA 4W8TA 1IDKA 2PYGA 2QZAA 4XN0A 1WMRA 1IA5A 2O17A 2PYHA 4OZZA 1CZFA 5JMCB 4XOTA 4OJPA 4JRAC 1WXRA 4YEJA 2O0WA 1O8LA 2VBMA 2Z8GA 1XG2A 2X6WA 4YCQA 2YUHA 4W8QA 1OGMX 2G0YA 1KQ5A 3ZPPA 2QYUA 3PETA 2BM7A 4U4BA 4U49A 1O8MA 1K8FA 2EWEA 2O0VA 2VFPA 1QQ1A 4XN3A 1TYVA 4OJOA 3NB2A 2NSPA 1RU4A 1PXZA 4MR0A 1TYUA 2VBKA 3T9GA 3GQAA 1QRCA 2VFQA 1TSPA 1TYXA 3LJYA 1X0CA 1O8GA 4XR6A 4NK8A 4XL9A 1HG8A 3BH6B 4XLHA 4XLCA 1OFDA 2W7ZA 2ODLA 3VSTA 4XNFA 1O8FA 2XTYA 1O8HA 3KRGA 4YZXA 1OOCA 1HF2A 2XTWA 3PSZA 3PSSA 4Z05A 4OZYA 2NZMA 1QCXA 1AIRA 1RMGA 1BHEA 3GQ7A 4XKWA 1K5CA 1EA0A 1QJVA 4OJ5A 4YDTA 3WWGA 4YZAA 4W8SA 5C1CA 1GQ8A 3JURA 4KH3A 1IDJA 2VBEA 3N6ZA 4XLAA 2NT6A 1NHCA 2BM5A 2XC1A 4XM3A 2X6XA 4YZQA 1QA2A 2F3LA 2VFNA 4URRA 1DABA 3B90A 3DU1X 4Z03A 1K4ZA
chains in the Genus database with same CATH topology
4HWVA 1O8DA 4XQFA 2O1DA 2VJIA 4XLFA 1OGOX 3EQNA 2QX3A 3SUCA 4EW9A 1DBOA 2NTBA 1O8KA 3LMWA 4AVZA 3VMWA 3VSUA 1KCCA 4W8RA 4XLEA 1PLUA 2X6YA 4OJ6A 3B8YA 1JRGA 3B4NA 4PMHA 1H80A 4C2LA 1VBLA 2UVEA 3ZSCA 1EE6A 3GQ8A 2NTQA 3VMVA 4XORA 2PECA 2X85A 1O88A 1O8EA 1DBGA 1PE9A 4XOPA 4XKVA 4OJLA 1RWRA 2QXZA 2IQ7A 2NTPA 1OFLA 4Z06A 2INVA 3FY3A 3GRHA 4YZ0A 4XMYA 2X3HA 4NK6A 1KTWA 1BN8A 3GQ9A 5C1EA 1O8IA 3VSVA 3UW0A 2O04A 2QY1A 5AMVA 1IB4A 2VJJA 2NSTA 1JTAA 4YELA 3EQOA 4XONA 2BSPA 1O8JA 2NT9A 4I84A 1KCDA 2UVFA 4MXNA 1OFMA 2INUA 4W8TA 1IDKA 2PYGA 4XN0A 1WMRA 1IA5A 2O17A 2PYHA 4OZZA 1CZFA 4XOTA 4OJPA 4YEJA 2O0WA 1O8LA 2VBMA 2Z8GA 1XG2A 2X6WA 4W8QA 1OGMX 3ZPPA 4U4BA 4U49A 1O8MA 2EWEA 2O0VA 4XN3A 4OJOA 2NSPA 1RU4A 1PXZA 4MR0A 2VBKA 3T9GA 3GQAA 1X0CA 1O8GA 4XR6A 4NK8A 4XL9A 1HG8A 4XLHA 4XLCA 2ODLA 3VSTA 4XNFA 1O8FA 1O8HA 3KRGA 4YZXA 1OOCA 4Z05A 4OZYA 2NZMA 1QCXA 1AIRA 1RMGA 1BHEA 3GQ7A 4XKWA 1K5CA 1QJVA 4OJ5A 3WWGA 4YZAA 4W8SA 5C1CA 1GQ8A 3JURA 1IDJA 2VBEA 4XLAA 1NHCA 2NT6A 4XM3A 2X6XA 4YZQA 4URRA 3B90A 4Z03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWV A;  1O8D A;  4XQF A;  2O1D A;  2VJI A;  4XLF A;  1OGO X;  3EQN A;  2QX3 A;  3SUC A;  4EW9 A;  1DBO A;  2NTB A;  1O8K A;  3LMW A;  4AVZ A;  3VMW A;  3VSU A;  1KCC A;  4W8R A;  4XLE A;  1PLU A;  2X6Y A;  4OJ6 A;  3B8Y A;  1JRG A;  3B4N A;  4PMH A;  1H80 A;  4C2L A;  1VBL A;  2UVE A;  3ZSC A;  1EE6 A;  3GQ8 A;  2NTQ A;  3VMV A;  4XOR A;  2PEC A;  2X85 A;  1O88 A;  1O8E A;  1DBG A;  1PE9 A;  4XOP A;  4XKV A;  4OJL A;  1RWR A;  2QXZ A;  2IQ7 A;  2NTP A;  1OFL A;  4Z06 A;  2INV A;  3FY3 A;  3GRH A;  4YZ0 A;  4XMY A;  2X3H A;  4NK6 A;  1KTW A;  1BN8 A;  3GQ9 A;  5C1E A;  1O8I A;  3VSV A;  3UW0 A;  2O04 A;  2QY1 A;  5AMV A;  1IB4 A;  2VJJ A;  2NST A;  1JTA A;  4YEL A;  3EQO A;  4XON A;  2BSP A;  1O8J A;  2NT9 A;  4I84 A;  1KCD A;  2UVF A;  4MXN A;  1OFM A;  2INU A;  4W8T A;  1IDK A;  2PYG A;  4XN0 A;  1WMR A;  1IA5 A;  2O17 A;  2PYH A;  4OZZ A;  1CZF A;  4XOT A;  4OJP A;  4YEJ A;  2O0W A;  1O8L A;  2VBM A;  2Z8G A;  1XG2 A;  2X6W A;  4W8Q A;  1OGM X;  3ZPP A;  4U4B A;  4U49 A;  1O8M A;  2EWE A;  2O0V A;  4XN3 A;  4OJO A;  2NSP A;  1RU4 A;  1PXZ A;  4MR0 A;  2VBK A;  3T9G A;  3GQA A;  1X0C A;  1O8G A;  4XR6 A;  4NK8 A;  4XL9 A;  1HG8 A;  4XLH A;  4XLC A;  2ODL A;  3VST A;  4XNF A;  1O8F A;  1O8H A;  3KRG A;  4YZX A;  1OOC A;  4Z05 A;  4OZY A;  2NZM A;  1QCX A;  1AIR A;  1RMG A;  1BHE A;  3GQ7 A;  4XKW A;  1K5C A;  1QJV A;  4OJ5 A;  3WWG A;  4YZA A;  4W8S A;  5C1C A;  1GQ8 A;  3JUR A;  1IDJ A;  2VBE A;  4XLA A;  1NHC A;  2NT6 A;  4XM3 A;  2X6X A;  4YZQ A;  4URR A;  3B90 A;  4Z03 A; 
#chains in the Genus database with same CATH topology
 4HWV A;  1O8D A;  2O6W A;  1TYW A;  5JLV C;  1QA3 A;  3AK5 A;  3SZE A;  4XQF A;  2O1D A;  3SQV A;  2VJI A;  4XLF A;  1OGO X;  3RIQ A;  3EQN A;  2QX3 A;  3SUC A;  4EW9 A;  1DBO A;  2NTB A;  2BX6 A;  1O8K A;  1LLW A;  3LMW A;  4AVZ A;  1QRB A;  3VMW A;  3VSU A;  2VFO A;  1KCC A;  1L1I A;  4W8R A;  4XLE A;  1PLU A;  2X6Y A;  4YEI A;  4OJ6 A;  3B8Y A;  1JRG A;  3B4N A;  3LYC A;  1H80 A;  4PMH A;  1VBL A;  2V5I A;  4C2L A;  2UVE A;  1LLZ A;  3ZSC A;  1EE6 A;  3GQ8 A;  2NTQ A;  1CLW A;  3VMV A;  4XOR A;  2PEC A;  2X85 A;  1O88 A;  4YFO A;  1O8E A;  1DBG A;  1PE9 A;  4XOP A;  1QA1 A;  3H09 A;  4XKV A;  4OJL A;  1RWR A;  2VFM A;  2BM4 A;  2IQ7 A;  2NTP A;  2QXZ A;  3TH0 A;  2XT2 A;  1OFL A;  4Z06 A;  2INV A;  3ML3 A;  2J8K A;  3FY3 A;  3BH7 B;  3GRH A;  2B0R A;  3NAW A;  4YZ0 A;  4XMY A;  5DNS A;  2X3H A;  3SY2 A;  2XT4 A;  4NK6 A;  1KTW A;  1BN8 A;  1LM1 A;  3GQ9 A;  1O8I A;  4YC5 A;  1EZG A;  5C1E A;  3SYJ A;  3VSV A;  3P4G A;  3UW0 A;  3N90 A;  2BM6 A;  2O04 A;  2QY1 A;  4V02 C;  5AMV A;  1IB4 A;  2VJJ A;  2NST A;  4OPW A;  1JTA A;  4YEL A;  3EQO A;  4XON A;  2J8I A;  2BSP A;  1O8J A;  2NT9 A;  1OFE A;  2XTX A;  3JX8 A;  4OM9 A;  2IOU G;  4I84 A;  1KCD A;  2UVF A;  4MXN A;  1OFM A;  2INU A;  4W8T A;  1IDK A;  2PYG A;  2QZA A;  4XN0 A;  1WMR A;  1IA5 A;  2O17 A;  2PYH A;  4OZZ A;  1CZF A;  5JMC B;  4XOT A;  4OJP A;  4JRA C;  1WXR A;  4YEJ A;  2O0W A;  1O8L A;  2VBM A;  2Z8G A;  1XG2 A;  2X6W A;  4YCQ A;  2YUH A;  4W8Q A;  1OGM X;  2G0Y A;  1KQ5 A;  3ZPP A;  2QYU A;  3PET A;  2BM7 A;  4U4B A;  4U49 A;  1O8M A;  1K8F A;  2EWE A;  2O0V A;  2VFP A;  1QQ1 A;  4XN3 A;  1TYV A;  4OJO A;  3NB2 A;  2NSP A;  1RU4 A;  1PXZ A;  4MR0 A;  1TYU A;  2VBK A;  3T9G A;  3GQA A;  1QRC A;  2VFQ A;  1TSP A;  1TYX A;  3LJY A;  1X0C A;  1O8G A;  4XR6 A;  4NK8 A;  4XL9 A;  1HG8 A;  3BH6 B;  4XLH A;  4XLC A;  1OFD A;  2W7Z A;  2ODL A;  3VST A;  4XNF A;  1O8F A;  2XTY A;  1O8H A;  3KRG A;  4YZX A;  1OOC A;  1HF2 A;  2XTW A;  3PSZ A;  3PSS A;  4Z05 A;  4OZY A;  2NZM A;  1QCX A;  1AIR A;  1RMG A;  1BHE A;  3GQ7 A;  4XKW A;  1K5C A;  1EA0 A;  1QJV A;  4OJ5 A;  4YDT A;  3WWG A;  4YZA A;  4W8S A;  5C1C A;  1GQ8 A;  3JUR A;  4KH3 A;  1IDJ A;  2VBE A;  3N6Z A;  4XLA A;  2NT6 A;  1NHC A;  2BM5 A;  2XC1 A;  4XM3 A;  2X6X A;  4YZQ A;  1QA2 A;  2F3L A;  2VFN A;  4URR A;  1DAB A;  3B90 A;  3DU1 X;  4Z03 A;  1K4Z A; 
#chains in the Genus database with same CATH homology
 4HWV A;  1O8D A;  4XQF A;  2O1D A;  2VJI A;  4XLF A;  1OGO X;  3EQN A;  2QX3 A;  3SUC A;  4EW9 A;  1DBO A;  2NTB A;  1O8K A;  3LMW A;  4AVZ A;  3VMW A;  3VSU A;  1KCC A;  4W8R A;  4XLE A;  1PLU A;  2X6Y A;  4OJ6 A;  3B8Y A;  1JRG A;  3B4N A;  4PMH A;  1H80 A;  4C2L A;  1VBL A;  2UVE A;  3ZSC A;  1EE6 A;  3GQ8 A;  2NTQ A;  3VMV A;  4XOR A;  2PEC A;  2X85 A;  1O88 A;  1O8E A;  1DBG A;  1PE9 A;  4XOP A;  4XKV A;  4OJL A;  1RWR A;  2QXZ A;  2IQ7 A;  2NTP A;  1OFL A;  4Z06 A;  2INV A;  3FY3 A;  3GRH A;  4YZ0 A;  4XMY A;  2X3H A;  4NK6 A;  1KTW A;  1BN8 A;  3GQ9 A;  5C1E A;  1O8I A;  3VSV A;  3UW0 A;  2O04 A;  2QY1 A;  5AMV A;  1IB4 A;  2VJJ A;  2NST A;  1JTA A;  4YEL A;  3EQO A;  4XON A;  2BSP A;  1O8J A;  2NT9 A;  4I84 A;  1KCD A;  2UVF A;  4MXN A;  1OFM A;  2INU A;  4W8T A;  1IDK A;  2PYG A;  4XN0 A;  1WMR A;  1IA5 A;  2O17 A;  2PYH A;  4OZZ A;  1CZF A;  4XOT A;  4OJP A;  4YEJ A;  2O0W A;  1O8L A;  2VBM A;  2Z8G A;  1XG2 A;  2X6W A;  4W8Q A;  1OGM X;  3ZPP A;  4U4B A;  4U49 A;  1O8M A;  2EWE A;  2O0V A;  4XN3 A;  4OJO A;  2NSP A;  1RU4 A;  1PXZ A;  4MR0 A;  2VBK A;  3T9G A;  3GQA A;  1X0C A;  1O8G A;  4XR6 A;  4NK8 A;  4XL9 A;  1HG8 A;  4XLH A;  4XLC A;  2ODL A;  3VST A;  4XNF A;  1O8F A;  1O8H A;  3KRG A;  4YZX A;  1OOC A;  4Z05 A;  4OZY A;  2NZM A;  1QCX A;  1AIR A;  1RMG A;  1BHE A;  3GQ7 A;  4XKW A;  1K5C A;  1QJV A;  4OJ5 A;  3WWG A;  4YZA A;  4W8S A;  5C1C A;  1GQ8 A;  3JUR A;  1IDJ A;  2VBE A;  4XLA A;  1NHC A;  2NT6 A;  4XM3 A;  2X6X A;  4YZQ A;  4URR A;  3B90 A;  4Z03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...