3VMVA

Crystal structure of pectate lyase bsp165pela from bacillus sp. n165
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
324
structure length
324
Chain Sequence
GPQGYASMNGGTTGGAGGRVEYASTGAQIQQLIDNRSRSNNPDEPLTIYVNGTITQGNSPQSLIDVKNHRGKAHEIKNISIIGVGTNGEFDGIGIRLSNAHNIIIQNVSIHHVREGEGTAIEVTDDSKNVWIDHNEFYSEFPGNGDSDYYDGLVDMKRNAEYITVSWNKFENHWKTMLVGHTDNASLAPDKITYHHNYFNNLNSRVPLIRYADVHMFNNYFKDINDTAINSRVGARVFVENNYFDNVGSGQADPTTGFIKGPVGWFYGSPSTGYWNLRGNVFVNTPNSHLNSTTNFTPPYSYQVQSATQAKSSVEQHSGVGVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Pectate lyase
publication title Crystal structure and substrate-binding mode of a novel pectate lyase from alkaliphilic Bacillus sp. N16-5.
pubmed doi rcsb
source organism Bacillus
total genus 136
structure length 324
sequence length 324
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vmvA00
3EQOA 4PMHA 4Z05A 4W8SA 2NTBA 1OGOX 1O8FA 1PLUA 4YZXA 3LMWA 3B90A 3WWGA 2VJIA 1X0CA 4OZZA 1K5CA 3VMWA 1WMRA 4NK6A 1EE6A 2X3HA 2NT6A 4U4BA 2X6YA 3GRHA 1O8GA 2PYGA 3EQNA 4XR6A 3UW0A 4W8QA 2O1DA 1PE9A 2VJJA 1JTAA 4XONA 1AIRA 3JURA 1O8KA 4URRA 1O8IA 4OJPA 3VSUA 2QXZA 5C1CA 4Z03A 3GQ7A 1H80A 2BSPA 2VBMA 3B4NA 1BN8A 3VSVA 2X6XA 1OFMA 2UVEA 2NT9A 3VSTA 4XLAA 3KRGA 4XMYA 1IB4A 1BHEA 2NSTA 3GQ8A 3ZPPA 4NK8A 3FY3A 1KCDA 1O8EA 2INUA 2O0WA 2IQ7A 1QCXA 4MXNA 4XLFA 1OOCA 1O8DA 4C2LA 1OGMX 4XOPA 4YZQA 1O8LA 2NTQA 4W8TA 1CZFA 4XN0A 4YELA 4XOTA 1RU4A 2INVA 4YEJA 1O88A 1GQ8A 1KTWA 1XG2A 1JRGA 4XNFA 4U49A 1RWRA 2X85A 1IDKA 2QY1A 1OFLA 3VMVA 3B8YA 4AVZA 4MR0A 4XKWA 4XN3A 4YZ0A 4HWVA 5AMVA 1PXZA 2O17A 5C1EA 1IDJA 3ZSCA 1O8HA 4I84A 2VBKA 4OJ6A 2NTPA 2Z8GA 2EWEA 4OJ5A 4OJOA 2UVFA 4XLEA 3GQ9A 3SUCA 4YZAA 4XLHA 1QJVA 1DBGA 2NSPA 4XKVA 4XQFA 1DBOA 1NHCA 4XL9A 2O0VA 1VBLA 2O04A 2NZMA 2X6WA 2QX3A 1O8JA 3T9GA 4EW9A 4OZYA 1RMGA 2PYHA 1IA5A 4XLCA 2ODLA 1O8MA 4W8RA 1HG8A 4OJLA 1KCCA 2VBEA 2PECA 4XM3A 4Z06A 3GQAA 4XORA
chains in the Genus database with same CATH superfamily
3EQOA 2V5IA 4PMHA 1WXRA 4Z05A 4W8SA 2NTBA 1OGOX 1LLZA 2XTYA 2QYUA 4OPWA 3SYJA 1O8FA 1HF2A 1TSPA 1OFEA 1PLUA 3H09A 4YZXA 3LMWA 2BM5A 2XT2A 3B90A 2VJIA 3WWGA 1X0CA 5DNSA 4OZZA 3TH0A 1K5CA 3VMWA 1WMRA 4NK6A 1EE6A 2X3HA 2XTXA 2NT6A 2QZAA 2VFPA 4U4BA 2X6YA 3GRHA 1O8GA 3DU1X 2PYGA 3EQNA 4YC5A 4XR6A 2XT4A 3UW0A 4W8QA 2O1DA 3PSSA 1PE9A 2VJJA 1JTAA 4XONA 1AIRA 3JURA 1EA0A 2J8KA 3SY2A 1O8KA 3LYCA 1TYVA 5JMCB 4URRA 1CLWA 2YUHA 1O8IA 2BM7A 4OJPA 2J8IA 3VSUA 2QXZA 3SQVA 4Z03A 5C1CA 3GQ7A 2VFOA 1H80A 1QQ1A 2BSPA 4YDTA 2VBMA 3B4NA 1BN8A 3VSVA 2X6XA 3NAWA 1OFMA 2UVEA 1LLWA 2NT9A 3VSTA 2VFMA 4XLAA 3KRGA 1LM1A 4XMYA 1BHEA 1IB4A 2NSTA 3GQ8A 3ZPPA 4NK8A 2W7ZA 2F3LA 3FY3A 1KCDA 1O8EA 2INUA 2O0WA 2IQ7A 1QCXA 2XC1A 2XTWA 3ML3A 4MXNA 4XLFA 1OOCA 1O8DA 4C2LA 1OGMX 4XOPA 4YZQA 1O8LA 2NTQA 4W8TA 2O6WA 1K8FA 1CZFA 1DABA 1L1IA 4XN0A 4YELA 4XOTA 3BH7B 1RU4A 2INVA 4YEJA 1O88A 1GQ8A 1KTWA 2VFNA 1XG2A 1JRGA 3N6ZA 4V02C 4XNFA 5JLVC 4U49A 1RWRA 2X85A 1IDKA 2QY1A 1OFLA 3VMVA 3B8YA 4OM9A 4AVZA 1EZGA 4MR0A 4XKWA 1QA1A 3N90A 3P4GA 4XN3A 4YZ0A 4HWVA 1KQ5A 1PXZA 2O17A 5AMVA 3NB2A 2IOUG 5C1EA 1IDJA 1QA2A 2B0RA 3ZSCA 1O8HA 4I84A 2VBKA 1OFDA 2NTPA 4OJ6A 2Z8GA 2EWEA 4OJ5A 4OJOA 3SZEA 2G0YA 2UVFA 4XLEA 3PETA 3AK5A 1TYXA 2BM4A 3GQ9A 3SUCA 3JX8A 4YZAA 3LJYA 4XLHA 1QJVA 1DBGA 2NSPA 4XKVA 4XQFA 1DBOA 1NHCA 4XL9A 4YFOA 2O0VA 3BH6B 1K4ZA 1VBLA 2O04A 2NZMA 4YCQA 2X6WA 2QX3A 1O8JA 3T9GA 1QA3A 1QRCA 4EW9A 4OZYA 1RMGA 2PYHA 1IA5A 4XLCA 4KH3A 2BX6A 2ODLA 1O8MA 1TYWA 4W8RA 1HG8A 1QRBA 2VFQA 4OJLA 3RIQA 1KCCA 3PSZA 4YEIA 2VBEA 1TYUA 2BM6A 4JRAC 2PECA 4XM3A 4Z06A 3GQAA 4XORA
chains in the Genus database with same CATH topology
3EQOA 4PMHA 4Z05A 4W8SA 2NTBA 1OGOX 1O8FA 1PLUA 4YZXA 3LMWA 3B90A 3WWGA 2VJIA 1X0CA 4OZZA 1K5CA 3VMWA 1WMRA 4NK6A 1EE6A 2X3HA 2NT6A 4U4BA 2X6YA 3GRHA 1O8GA 2PYGA 3EQNA 4XR6A 3UW0A 4W8QA 2O1DA 1PE9A 2VJJA 1JTAA 4XONA 1AIRA 3JURA 1O8KA 4URRA 1O8IA 4OJPA 3VSUA 2QXZA 5C1CA 4Z03A 3GQ7A 1H80A 2BSPA 2VBMA 3B4NA 1BN8A 3VSVA 2X6XA 1OFMA 2UVEA 2NT9A 3VSTA 4XLAA 3KRGA 4XMYA 1IB4A 1BHEA 2NSTA 3GQ8A 3ZPPA 4NK8A 3FY3A 1KCDA 1O8EA 2INUA 2O0WA 2IQ7A 1QCXA 4MXNA 4XLFA 1OOCA 1O8DA 4C2LA 1OGMX 4XOPA 4YZQA 1O8LA 2NTQA 4W8TA 1CZFA 4XN0A 4YELA 4XOTA 1RU4A 2INVA 4YEJA 1O88A 1GQ8A 1KTWA 1XG2A 1JRGA 4XNFA 4U49A 1RWRA 2X85A 1IDKA 2QY1A 1OFLA 3VMVA 3B8YA 4AVZA 4MR0A 4XKWA 4XN3A 4YZ0A 4HWVA 5AMVA 1PXZA 2O17A 5C1EA 1IDJA 3ZSCA 1O8HA 4I84A 2VBKA 4OJ6A 2NTPA 2Z8GA 2EWEA 4OJ5A 4OJOA 2UVFA 4XLEA 3GQ9A 3SUCA 4YZAA 4XLHA 1QJVA 1DBGA 2NSPA 4XKVA 4XQFA 1DBOA 1NHCA 4XL9A 2O0VA 1VBLA 2O04A 2NZMA 2X6WA 2QX3A 1O8JA 3T9GA 4EW9A 4OZYA 1RMGA 2PYHA 1IA5A 4XLCA 2ODLA 1O8MA 4W8RA 1HG8A 4OJLA 1KCCA 2VBEA 2PECA 4XM3A 4Z06A 3GQAA 4XORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQO A;  4PMH A;  4Z05 A;  4W8S A;  2NTB A;  1OGO X;  1O8F A;  1PLU A;  4YZX A;  3LMW A;  3B90 A;  3WWG A;  2VJI A;  1X0C A;  4OZZ A;  1K5C A;  3VMW A;  1WMR A;  4NK6 A;  1EE6 A;  2X3H A;  2NT6 A;  4U4B A;  2X6Y A;  3GRH A;  1O8G A;  2PYG A;  3EQN A;  4XR6 A;  3UW0 A;  4W8Q A;  2O1D A;  1PE9 A;  2VJJ A;  1JTA A;  4XON A;  1AIR A;  3JUR A;  1O8K A;  4URR A;  1O8I A;  4OJP A;  3VSU A;  2QXZ A;  5C1C A;  4Z03 A;  3GQ7 A;  1H80 A;  2BSP A;  2VBM A;  3B4N A;  1BN8 A;  3VSV A;  2X6X A;  1OFM A;  2UVE A;  2NT9 A;  3VST A;  4XLA A;  3KRG A;  4XMY A;  1IB4 A;  1BHE A;  2NST A;  3GQ8 A;  3ZPP A;  4NK8 A;  3FY3 A;  1KCD A;  1O8E A;  2INU A;  2O0W A;  2IQ7 A;  1QCX A;  4MXN A;  4XLF A;  1OOC A;  1O8D A;  4C2L A;  1OGM X;  4XOP A;  4YZQ A;  1O8L A;  2NTQ A;  4W8T A;  1CZF A;  4XN0 A;  4YEL A;  4XOT A;  1RU4 A;  2INV A;  4YEJ A;  1O88 A;  1GQ8 A;  1KTW A;  1XG2 A;  1JRG A;  4XNF A;  4U49 A;  1RWR A;  2X85 A;  1IDK A;  2QY1 A;  1OFL A;  3VMV A;  3B8Y A;  4AVZ A;  4MR0 A;  4XKW A;  4XN3 A;  4YZ0 A;  4HWV A;  5AMV A;  1PXZ A;  2O17 A;  5C1E A;  1IDJ A;  3ZSC A;  1O8H A;  4I84 A;  2VBK A;  4OJ6 A;  2NTP A;  2Z8G A;  2EWE A;  4OJ5 A;  4OJO A;  2UVF A;  4XLE A;  3GQ9 A;  3SUC A;  4YZA A;  4XLH A;  1QJV A;  1DBG A;  2NSP A;  4XKV A;  4XQF A;  1DBO A;  1NHC A;  4XL9 A;  2O0V A;  1VBL A;  2O04 A;  2NZM A;  2X6W A;  2QX3 A;  1O8J A;  3T9G A;  4EW9 A;  4OZY A;  1RMG A;  2PYH A;  1IA5 A;  4XLC A;  2ODL A;  1O8M A;  4W8R A;  1HG8 A;  4OJL A;  1KCC A;  2VBE A;  2PEC A;  4XM3 A;  4Z06 A;  3GQA A;  4XOR A; 
#chains in the Genus database with same CATH topology
 3EQO A;  2V5I A;  4PMH A;  1WXR A;  4Z05 A;  4W8S A;  2NTB A;  1OGO X;  1LLZ A;  2XTY A;  2QYU A;  4OPW A;  3SYJ A;  1O8F A;  1HF2 A;  1TSP A;  1OFE A;  1PLU A;  3H09 A;  4YZX A;  3LMW A;  2BM5 A;  2XT2 A;  3B90 A;  2VJI A;  3WWG A;  1X0C A;  5DNS A;  4OZZ A;  3TH0 A;  1K5C A;  3VMW A;  1WMR A;  4NK6 A;  1EE6 A;  2X3H A;  2XTX A;  2NT6 A;  2QZA A;  2VFP A;  4U4B A;  2X6Y A;  3GRH A;  1O8G A;  3DU1 X;  2PYG A;  3EQN A;  4YC5 A;  4XR6 A;  2XT4 A;  3UW0 A;  4W8Q A;  2O1D A;  3PSS A;  1PE9 A;  2VJJ A;  1JTA A;  4XON A;  1AIR A;  3JUR A;  1EA0 A;  2J8K A;  3SY2 A;  1O8K A;  3LYC A;  1TYV A;  5JMC B;  4URR A;  1CLW A;  2YUH A;  1O8I A;  2BM7 A;  4OJP A;  2J8I A;  3VSU A;  2QXZ A;  3SQV A;  4Z03 A;  5C1C A;  3GQ7 A;  2VFO A;  1H80 A;  1QQ1 A;  2BSP A;  4YDT A;  2VBM A;  3B4N A;  1BN8 A;  3VSV A;  2X6X A;  3NAW A;  1OFM A;  2UVE A;  1LLW A;  2NT9 A;  3VST A;  2VFM A;  4XLA A;  3KRG A;  1LM1 A;  4XMY A;  1BHE A;  1IB4 A;  2NST A;  3GQ8 A;  3ZPP A;  4NK8 A;  2W7Z A;  2F3L A;  3FY3 A;  1KCD A;  1O8E A;  2INU A;  2O0W A;  2IQ7 A;  1QCX A;  2XC1 A;  2XTW A;  3ML3 A;  4MXN A;  4XLF A;  1OOC A;  1O8D A;  4C2L A;  1OGM X;  4XOP A;  4YZQ A;  1O8L A;  2NTQ A;  4W8T A;  2O6W A;  1K8F A;  1CZF A;  1DAB A;  1L1I A;  4XN0 A;  4YEL A;  4XOT A;  3BH7 B;  1RU4 A;  2INV A;  4YEJ A;  1O88 A;  1GQ8 A;  1KTW A;  2VFN A;  1XG2 A;  1JRG A;  3N6Z A;  4V02 C;  4XNF A;  5JLV C;  4U49 A;  1RWR A;  2X85 A;  1IDK A;  2QY1 A;  1OFL A;  3VMV A;  3B8Y A;  4OM9 A;  4AVZ A;  1EZG A;  4MR0 A;  4XKW A;  1QA1 A;  3N90 A;  3P4G A;  4XN3 A;  4YZ0 A;  4HWV A;  1KQ5 A;  1PXZ A;  2O17 A;  5AMV A;  3NB2 A;  2IOU G;  5C1E A;  1IDJ A;  1QA2 A;  2B0R A;  3ZSC A;  1O8H A;  4I84 A;  2VBK A;  1OFD A;  2NTP A;  4OJ6 A;  2Z8G A;  2EWE A;  4OJ5 A;  4OJO A;  3SZE A;  2G0Y A;  2UVF A;  4XLE A;  3PET A;  3AK5 A;  1TYX A;  2BM4 A;  3GQ9 A;  3SUC A;  3JX8 A;  4YZA A;  3LJY A;  4XLH A;  1QJV A;  1DBG A;  2NSP A;  4XKV A;  4XQF A;  1DBO A;  1NHC A;  4XL9 A;  4YFO A;  2O0V A;  3BH6 B;  1K4Z A;  1VBL A;  2O04 A;  2NZM A;  4YCQ A;  2X6W A;  2QX3 A;  1O8J A;  3T9G A;  1QA3 A;  1QRC A;  4EW9 A;  4OZY A;  1RMG A;  2PYH A;  1IA5 A;  4XLC A;  4KH3 A;  2BX6 A;  2ODL A;  1O8M A;  1TYW A;  4W8R A;  1HG8 A;  1QRB A;  2VFQ A;  4OJL A;  3RIQ A;  1KCC A;  3PSZ A;  4YEI A;  2VBE A;  1TYU A;  2BM6 A;  4JRA C;  2PEC A;  4XM3 A;  4Z06 A;  3GQA A;  4XOR A; 
#chains in the Genus database with same CATH homology
 3EQO A;  4PMH A;  4Z05 A;  4W8S A;  2NTB A;  1OGO X;  1O8F A;  1PLU A;  4YZX A;  3LMW A;  3B90 A;  3WWG A;  2VJI A;  1X0C A;  4OZZ A;  1K5C A;  3VMW A;  1WMR A;  4NK6 A;  1EE6 A;  2X3H A;  2NT6 A;  4U4B A;  2X6Y A;  3GRH A;  1O8G A;  2PYG A;  3EQN A;  4XR6 A;  3UW0 A;  4W8Q A;  2O1D A;  1PE9 A;  2VJJ A;  1JTA A;  4XON A;  1AIR A;  3JUR A;  1O8K A;  4URR A;  1O8I A;  4OJP A;  3VSU A;  2QXZ A;  5C1C A;  4Z03 A;  3GQ7 A;  1H80 A;  2BSP A;  2VBM A;  3B4N A;  1BN8 A;  3VSV A;  2X6X A;  1OFM A;  2UVE A;  2NT9 A;  3VST A;  4XLA A;  3KRG A;  4XMY A;  1IB4 A;  1BHE A;  2NST A;  3GQ8 A;  3ZPP A;  4NK8 A;  3FY3 A;  1KCD A;  1O8E A;  2INU A;  2O0W A;  2IQ7 A;  1QCX A;  4MXN A;  4XLF A;  1OOC A;  1O8D A;  4C2L A;  1OGM X;  4XOP A;  4YZQ A;  1O8L A;  2NTQ A;  4W8T A;  1CZF A;  4XN0 A;  4YEL A;  4XOT A;  1RU4 A;  2INV A;  4YEJ A;  1O88 A;  1GQ8 A;  1KTW A;  1XG2 A;  1JRG A;  4XNF A;  4U49 A;  1RWR A;  2X85 A;  1IDK A;  2QY1 A;  1OFL A;  3VMV A;  3B8Y A;  4AVZ A;  4MR0 A;  4XKW A;  4XN3 A;  4YZ0 A;  4HWV A;  5AMV A;  1PXZ A;  2O17 A;  5C1E A;  1IDJ A;  3ZSC A;  1O8H A;  4I84 A;  2VBK A;  4OJ6 A;  2NTP A;  2Z8G A;  2EWE A;  4OJ5 A;  4OJO A;  2UVF A;  4XLE A;  3GQ9 A;  3SUC A;  4YZA A;  4XLH A;  1QJV A;  1DBG A;  2NSP A;  4XKV A;  4XQF A;  1DBO A;  1NHC A;  4XL9 A;  2O0V A;  1VBL A;  2O04 A;  2NZM A;  2X6W A;  2QX3 A;  1O8J A;  3T9G A;  4EW9 A;  4OZY A;  1RMG A;  2PYH A;  1IA5 A;  4XLC A;  2ODL A;  1O8M A;  4W8R A;  1HG8 A;  4OJL A;  1KCC A;  2VBE A;  2PEC A;  4XM3 A;  4Z06 A;  3GQA A;  4XOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...