3VMVA

Crystal structure of pectate lyase bsp165pela from bacillus sp. n165
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
324
structure length
324
Chain Sequence
GPQGYASMNGGTTGGAGGRVEYASTGAQIQQLIDNRSRSNNPDEPLTIYVNGTITQGNSPQSLIDVKNHRGKAHEIKNISIIGVGTNGEFDGIGIRLSNAHNIIIQNVSIHHVREGEGTAIEVTDDSKNVWIDHNEFYSEFPGNGDSDYYDGLVDMKRNAEYITVSWNKFENHWKTMLVGHTDNASLAPDKITYHHNYFNNLNSRVPLIRYADVHMFNNYFKDINDTAINSRVGARVFVENNYFDNVGSGQADPTTGFIKGPVGWFYGSPSTGYWNLRGNVFVNTPNSHLNSTTNFTPPYSYQVQSATQAKSSVEQHSGVGVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title Crystal structure and substrate-binding mode of a novel pectate lyase from alkaliphilic Bacillus sp. N16-5.
pubmed doi rcsb
source organism Bacillus
molecule tags Lyase
total genus 136
structure length 324
sequence length 324
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vmvA00
4MR0A 1O8GA 4C2LA 4XLCA 4Z05A 1KCCA 1IDJA 1AIRA 1CZFA 2X3HA 3JURA 1DBGA 1K5CA 1OGOX 4XN3A 4EW9A 2PYGA 4YZXA 2VJJA 2NT9A 1H80A 1BHEA 4XONA 4XR6A 2QX3A 4W8SA 1PLUA 3VMVA 1QCXA 2VBMA 4W8QA 4XOPA 2O0WA 2X6XA 2NTBA 1XG2A 3B90A 4YZ0A 2BSPA 4XMYA 4XKVA 3WWGA 1O8JA 3GRHA 2X6YA 1JTAA 4OJLA 4OZZA 3GQ9A 4OJOA 1O8HA 5AMVA 2UVEA 2INUA 3T9GA 2EWEA 4Z06A 3KRGA 4XORA 1RU4A 5C1EA 4YEJA 3VSUA 3FY3A 2INVA 1X0CA 3B4NA 4XLFA 2O17A 3VMWA 1OFLA 4OJ6A 1O8IA 3GQ8A 4HWVA 4XKWA 4XLEA 1O8LA 4Z03A 1WMRA 4PMHA 1OGMX 1BN8A 4U49A 2NSPA 2NTPA 1EE6A 2X85A 1HG8A 4MXNA 2VBEA 4NK6A 3ZPPA 1RMGA 4OZYA 1O8MA 2IQ7A 2X6WA 3B8YA 2UVFA 2NT6A 2VJIA 4XM3A 1O8FA 3GQ7A 4U4BA 2NZMA 1DBOA 3LMWA 4XLHA 1JRGA 2Z8GA 2QY1A 4AVZA 3UW0A 2O04A 3EQOA 4URRA 4XNFA 2QXZA 3EQNA 4YZAA 1KTWA 2PYHA 1IB4A 4NK8A 1O88A 3GQAA 1O8DA 4XLAA 1OOCA 3SUCA 1PE9A 5C1CA 1KCDA 1RWRA 1O8KA 2ODLA 2VBKA 4XN0A 3VSVA 1VBLA 2NTQA 1QJVA 4OJ5A 4W8TA 1IDKA 1IA5A 1GQ8A 4XL9A 1O8EA 2O0VA 2O1DA 4YZQA 4OJPA 4YELA 2NSTA 2PECA 3ZSCA 1NHCA 4XQFA 1PXZA 1OFMA 4XOTA 4I84A 3VSTA 4W8RA
chains in the Genus database with same CATH superfamily
1LLWA 4MR0A 1O8GA 2VFPA 3DU1X 1L1IA 4C2LA 4XLCA 4Z05A 2V5IA 1KCCA 1IDJA 1AIRA 1CZFA 2X3HA 3JURA 1DBGA 3SY2A 1OGOX 4XN3A 4EW9A 1K5CA 3P4GA 1QRBA 2PYGA 2XC1A 4YZXA 4YC5A 1TYXA 2VJJA 2NT9A 2IOUG 1H80A 1BHEA 4XONA 4XR6A 2QX3A 4W8SA 1PLUA 5DNSA 3SYJA 3VMVA 3SZEA 1QA3A 1OFDA 4YDTA 1QCXA 2VBMA 4W8QA 4XOPA 2O0WA 2X6XA 3NB2A 2BM5A 1TYWA 2NTBA 4YFOA 4OPWA 1XG2A 3B90A 4YZ0A 2BSPA 4YCQA 4XMYA 3AK5A 4XKVA 3WWGA 2G0YA 1CLWA 1O8JA 3N90A 3GRHA 2X6YA 1JTAA 4OJLA 5JMCB 1QA1A 3JX8A 4JRAC 3GQ9A 4OZZA 4OJOA 1HF2A 1KQ5A 1O8HA 5AMVA 2UVEA 2INUA 1TYUA 3SQVA 3T9GA 2EWEA 4Z06A 3KRGA 4YEIA 2VFNA 4XORA 1RU4A 5C1EA 4YEJA 1K4ZA 3BH7B 3PSZA 3VSUA 5JLVC 1QA2A 2W7ZA 3FY3A 2INVA 1X0CA 3B4NA 2BM4A 2O17A 4XLFA 3VMWA 1OFLA 4OJ6A 3RIQA 2BM7A 1O8IA 1TYVA 2BX6A 3GQ8A 4HWVA 4XKWA 4XLEA 3PSSA 1EZGA 3LYCA 1LM1A 1O8LA 2O6WA 3PETA 4Z03A 2F3LA 1EA0A 4KH3A 1WMRA 4PMHA 3BH6B 1OGMX 1BN8A 4U49A 2NSPA 2NTPA 1EE6A 2X85A 1HG8A 4MXNA 2VBEA 4NK6A 3ZPPA 1K8FA 1RMGA 4OZYA 1O8MA 2IQ7A 2X6WA 3B8YA 2UVFA 2XT4A 2NT6A 2VJIA 1DABA 3NAWA 1O8FA 2B0RA 4XM3A 3GQ7A 4U4BA 2NZMA 3H09A 1DBOA 3LMWA 4XLHA 1JRGA 2Z8GA 2QY1A 4AVZA 3UW0A 2O04A 2VFMA 3EQOA 4URRA 4XNFA 1OFEA 2QXZA 2XTXA 2XTWA 3EQNA 4YZAA 1KTWA 2PYHA 1WXRA 1QQ1A 2J8IA 1IB4A 4NK8A 1O88A 3GQAA 1O8DA 1TSPA 2VFOA 4XLAA 2BM6A 1OOCA 3SUCA 1PE9A 5C1CA 3TH0A 1KCDA 2XT2A 2XTYA 1RWRA 1O8KA 2ODLA 2VBKA 4XN0A 3VSVA 1VBLA 2NTQA 1QJVA 4OJ5A 4W8TA 1IDKA 4OM9A 1IA5A 1GQ8A 2YUHA 2VFQA 4XL9A 2QZAA 2J8KA 1O8EA 3LJYA 2O0VA 2O1DA 2QYUA 3ML3A 3N6ZA 4OJPA 1QRCA 2NSTA 2PECA 4V02C 4YZQA 4YELA 1LLZA 3ZSCA 4XQFA 1NHCA 1PXZA 1OFMA 4XOTA 4I84A 3VSTA 4W8RA
chains in the Genus database with same CATH topology
4MR0A 1O8GA 4C2LA 4XLCA 4Z05A 1KCCA 1IDJA 1AIRA 1CZFA 2X3HA 3JURA 1DBGA 1K5CA 1OGOX 4XN3A 4EW9A 2PYGA 4YZXA 2VJJA 2NT9A 1H80A 1BHEA 4XONA 4XR6A 2QX3A 4W8SA 1PLUA 3VMVA 1QCXA 2VBMA 4W8QA 4XOPA 2O0WA 2X6XA 2NTBA 1XG2A 3B90A 4YZ0A 2BSPA 4XMYA 4XKVA 3WWGA 1O8JA 3GRHA 2X6YA 1JTAA 4OJLA 4OZZA 3GQ9A 4OJOA 1O8HA 5AMVA 2UVEA 2INUA 3T9GA 2EWEA 4Z06A 3KRGA 4XORA 1RU4A 5C1EA 4YEJA 3VSUA 3FY3A 2INVA 1X0CA 3B4NA 4XLFA 2O17A 3VMWA 1OFLA 4OJ6A 1O8IA 3GQ8A 4HWVA 4XKWA 4XLEA 1O8LA 4Z03A 1WMRA 4PMHA 1OGMX 1BN8A 4U49A 2NSPA 2NTPA 1EE6A 2X85A 1HG8A 4MXNA 2VBEA 4NK6A 3ZPPA 1RMGA 4OZYA 1O8MA 2IQ7A 2X6WA 3B8YA 2UVFA 2NT6A 2VJIA 4XM3A 1O8FA 3GQ7A 4U4BA 2NZMA 1DBOA 3LMWA 4XLHA 1JRGA 2Z8GA 2QY1A 4AVZA 3UW0A 2O04A 3EQOA 4URRA 4XNFA 2QXZA 3EQNA 4YZAA 1KTWA 2PYHA 1IB4A 4NK8A 1O88A 3GQAA 1O8DA 4XLAA 1OOCA 3SUCA 1PE9A 5C1CA 1KCDA 1RWRA 1O8KA 2ODLA 2VBKA 4XN0A 3VSVA 1VBLA 2NTQA 1QJVA 4OJ5A 4W8TA 1IDKA 1IA5A 1GQ8A 4XL9A 1O8EA 2O0VA 2O1DA 4YZQA 4OJPA 4YELA 2NSTA 2PECA 3ZSCA 1NHCA 4XQFA 1PXZA 1OFMA 4XOTA 4I84A 3VSTA 4W8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MR0 A;  1O8G A;  4C2L A;  4XLC A;  4Z05 A;  1KCC A;  1IDJ A;  1AIR A;  1CZF A;  2X3H A;  3JUR A;  1DBG A;  1K5C A;  1OGO X;  4XN3 A;  4EW9 A;  2PYG A;  4YZX A;  2VJJ A;  2NT9 A;  1H80 A;  1BHE A;  4XON A;  4XR6 A;  2QX3 A;  4W8S A;  1PLU A;  3VMV A;  1QCX A;  2VBM A;  4W8Q A;  4XOP A;  2O0W A;  2X6X A;  2NTB A;  1XG2 A;  3B90 A;  4YZ0 A;  2BSP A;  4XMY A;  4XKV A;  3WWG A;  1O8J A;  3GRH A;  2X6Y A;  1JTA A;  4OJL A;  4OZZ A;  3GQ9 A;  4OJO A;  1O8H A;  5AMV A;  2UVE A;  2INU A;  3T9G A;  2EWE A;  4Z06 A;  3KRG A;  4XOR A;  1RU4 A;  5C1E A;  4YEJ A;  3VSU A;  3FY3 A;  2INV A;  1X0C A;  3B4N A;  4XLF A;  2O17 A;  3VMW A;  1OFL A;  4OJ6 A;  1O8I A;  3GQ8 A;  4HWV A;  4XKW A;  4XLE A;  1O8L A;  4Z03 A;  1WMR A;  4PMH A;  1OGM X;  1BN8 A;  4U49 A;  2NSP A;  2NTP A;  1EE6 A;  2X85 A;  1HG8 A;  4MXN A;  2VBE A;  4NK6 A;  3ZPP A;  1RMG A;  4OZY A;  1O8M A;  2IQ7 A;  2X6W A;  3B8Y A;  2UVF A;  2NT6 A;  2VJI A;  4XM3 A;  1O8F A;  3GQ7 A;  4U4B A;  2NZM A;  1DBO A;  3LMW A;  4XLH A;  1JRG A;  2Z8G A;  2QY1 A;  4AVZ A;  3UW0 A;  2O04 A;  3EQO A;  4URR A;  4XNF A;  2QXZ A;  3EQN A;  4YZA A;  1KTW A;  2PYH A;  1IB4 A;  4NK8 A;  1O88 A;  3GQA A;  1O8D A;  4XLA A;  1OOC A;  3SUC A;  1PE9 A;  5C1C A;  1KCD A;  1RWR A;  1O8K A;  2ODL A;  2VBK A;  4XN0 A;  3VSV A;  1VBL A;  2NTQ A;  1QJV A;  4OJ5 A;  4W8T A;  1IDK A;  1IA5 A;  1GQ8 A;  4XL9 A;  1O8E A;  2O0V A;  2O1D A;  4YZQ A;  4OJP A;  4YEL A;  2NST A;  2PEC A;  3ZSC A;  1NHC A;  4XQF A;  1PXZ A;  1OFM A;  4XOT A;  4I84 A;  3VST A;  4W8R A; 
#chains in the Genus database with same CATH topology
 1LLW A;  4MR0 A;  1O8G A;  2VFP A;  3DU1 X;  1L1I A;  4C2L A;  4XLC A;  4Z05 A;  2V5I A;  1KCC A;  1IDJ A;  1AIR A;  1CZF A;  2X3H A;  3JUR A;  1DBG A;  3SY2 A;  1OGO X;  4XN3 A;  4EW9 A;  1K5C A;  3P4G A;  1QRB A;  2PYG A;  2XC1 A;  4YZX A;  4YC5 A;  1TYX A;  2VJJ A;  2NT9 A;  2IOU G;  1H80 A;  1BHE A;  4XON A;  4XR6 A;  2QX3 A;  4W8S A;  1PLU A;  5DNS A;  3SYJ A;  3VMV A;  3SZE A;  1QA3 A;  1OFD A;  4YDT A;  1QCX A;  2VBM A;  4W8Q A;  4XOP A;  2O0W A;  2X6X A;  3NB2 A;  2BM5 A;  1TYW A;  2NTB A;  4YFO A;  4OPW A;  1XG2 A;  3B90 A;  4YZ0 A;  2BSP A;  4YCQ A;  4XMY A;  3AK5 A;  4XKV A;  3WWG A;  2G0Y A;  1CLW A;  1O8J A;  3N90 A;  3GRH A;  2X6Y A;  1JTA A;  4OJL A;  5JMC B;  1QA1 A;  3JX8 A;  4JRA C;  3GQ9 A;  4OZZ A;  4OJO A;  1HF2 A;  1KQ5 A;  1O8H A;  5AMV A;  2UVE A;  2INU A;  1TYU A;  3SQV A;  3T9G A;  2EWE A;  4Z06 A;  3KRG A;  4YEI A;  2VFN A;  4XOR A;  1RU4 A;  5C1E A;  4YEJ A;  1K4Z A;  3BH7 B;  3PSZ A;  3VSU A;  5JLV C;  1QA2 A;  2W7Z A;  3FY3 A;  2INV A;  1X0C A;  3B4N A;  2BM4 A;  2O17 A;  4XLF A;  3VMW A;  1OFL A;  4OJ6 A;  3RIQ A;  2BM7 A;  1O8I A;  1TYV A;  2BX6 A;  3GQ8 A;  4HWV A;  4XKW A;  4XLE A;  3PSS A;  1EZG A;  3LYC A;  1LM1 A;  1O8L A;  2O6W A;  3PET A;  4Z03 A;  2F3L A;  1EA0 A;  4KH3 A;  1WMR A;  4PMH A;  3BH6 B;  1OGM X;  1BN8 A;  4U49 A;  2NSP A;  2NTP A;  1EE6 A;  2X85 A;  1HG8 A;  4MXN A;  2VBE A;  4NK6 A;  3ZPP A;  1K8F A;  1RMG A;  4OZY A;  1O8M A;  2IQ7 A;  2X6W A;  3B8Y A;  2UVF A;  2XT4 A;  2NT6 A;  2VJI A;  1DAB A;  3NAW A;  1O8F A;  2B0R A;  4XM3 A;  3GQ7 A;  4U4B A;  2NZM A;  3H09 A;  1DBO A;  3LMW A;  4XLH A;  1JRG A;  2Z8G A;  2QY1 A;  4AVZ A;  3UW0 A;  2O04 A;  2VFM A;  3EQO A;  4URR A;  4XNF A;  1OFE A;  2QXZ A;  2XTX A;  2XTW A;  3EQN A;  4YZA A;  1KTW A;  2PYH A;  1WXR A;  1QQ1 A;  2J8I A;  1IB4 A;  4NK8 A;  1O88 A;  3GQA A;  1O8D A;  1TSP A;  2VFO A;  4XLA A;  2BM6 A;  1OOC A;  3SUC A;  1PE9 A;  5C1C A;  3TH0 A;  1KCD A;  2XT2 A;  2XTY A;  1RWR A;  1O8K A;  2ODL A;  2VBK A;  4XN0 A;  3VSV A;  1VBL A;  2NTQ A;  1QJV A;  4OJ5 A;  4W8T A;  1IDK A;  4OM9 A;  1IA5 A;  1GQ8 A;  2YUH A;  2VFQ A;  4XL9 A;  2QZA A;  2J8K A;  1O8E A;  3LJY A;  2O0V A;  2O1D A;  2QYU A;  3ML3 A;  3N6Z A;  4OJP A;  1QRC A;  2NST A;  2PEC A;  4V02 C;  4YZQ A;  4YEL A;  1LLZ A;  3ZSC A;  4XQF A;  1NHC A;  1PXZ A;  1OFM A;  4XOT A;  4I84 A;  3VST A;  4W8R A; 
#chains in the Genus database with same CATH homology
 4MR0 A;  1O8G A;  4C2L A;  4XLC A;  4Z05 A;  1KCC A;  1IDJ A;  1AIR A;  1CZF A;  2X3H A;  3JUR A;  1DBG A;  1K5C A;  1OGO X;  4XN3 A;  4EW9 A;  2PYG A;  4YZX A;  2VJJ A;  2NT9 A;  1H80 A;  1BHE A;  4XON A;  4XR6 A;  2QX3 A;  4W8S A;  1PLU A;  3VMV A;  1QCX A;  2VBM A;  4W8Q A;  4XOP A;  2O0W A;  2X6X A;  2NTB A;  1XG2 A;  3B90 A;  4YZ0 A;  2BSP A;  4XMY A;  4XKV A;  3WWG A;  1O8J A;  3GRH A;  2X6Y A;  1JTA A;  4OJL A;  4OZZ A;  3GQ9 A;  4OJO A;  1O8H A;  5AMV A;  2UVE A;  2INU A;  3T9G A;  2EWE A;  4Z06 A;  3KRG A;  4XOR A;  1RU4 A;  5C1E A;  4YEJ A;  3VSU A;  3FY3 A;  2INV A;  1X0C A;  3B4N A;  4XLF A;  2O17 A;  3VMW A;  1OFL A;  4OJ6 A;  1O8I A;  3GQ8 A;  4HWV A;  4XKW A;  4XLE A;  1O8L A;  4Z03 A;  1WMR A;  4PMH A;  1OGM X;  1BN8 A;  4U49 A;  2NSP A;  2NTP A;  1EE6 A;  2X85 A;  1HG8 A;  4MXN A;  2VBE A;  4NK6 A;  3ZPP A;  1RMG A;  4OZY A;  1O8M A;  2IQ7 A;  2X6W A;  3B8Y A;  2UVF A;  2NT6 A;  2VJI A;  4XM3 A;  1O8F A;  3GQ7 A;  4U4B A;  2NZM A;  1DBO A;  3LMW A;  4XLH A;  1JRG A;  2Z8G A;  2QY1 A;  4AVZ A;  3UW0 A;  2O04 A;  3EQO A;  4URR A;  4XNF A;  2QXZ A;  3EQN A;  4YZA A;  1KTW A;  2PYH A;  1IB4 A;  4NK8 A;  1O88 A;  3GQA A;  1O8D A;  4XLA A;  1OOC A;  3SUC A;  1PE9 A;  5C1C A;  1KCD A;  1RWR A;  1O8K A;  2ODL A;  2VBK A;  4XN0 A;  3VSV A;  1VBL A;  2NTQ A;  1QJV A;  4OJ5 A;  4W8T A;  1IDK A;  1IA5 A;  1GQ8 A;  4XL9 A;  1O8E A;  2O0V A;  2O1D A;  4YZQ A;  4OJP A;  4YEL A;  2NST A;  2PEC A;  3ZSC A;  1NHC A;  4XQF A;  1PXZ A;  1OFM A;  4XOT A;  4I84 A;  3VST A;  4W8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...