3VMVA

Crystal structure of pectate lyase bsp165pela from bacillus sp. n165
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
324
structure length
324
Chain Sequence
b'GPQGYASMNGGTTGGAGGRVEYASTGAQIQQLIDNRSRSNNPDEPLTIYVNGTITQGNSPQSLIDVKNHRGKAHEIKNISIIGVGTNGEFDGIGIRLSNAHNIIIQNVSIHHVREGEGTAIEVTDDSKNVWIDHNEFYSEFPGNGDSDYYDGLVDMKRNAEYITVSWNKFENHWKTMLVGHTDNASLAPDKITYHHNYFNNLNSRVPLIRYADVHMFNNYFKDINDTAINSRVGARVFVENNYFDNVGSGQADPTTGFIKGPVGWFYGSPSTGYWNLRGNVFVNTPNSHLNSTTNFTPPYSYQVQSATQAKSSVEQHSGVGVIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title Crystal structure and substrate-binding mode of a novel pectate lyase from alkaliphilic Bacillus sp. N16-5.
pubmed doi rcsb
source organism Bacillus
molecule tags Lyase
total genus 136
structure length 324
sequence length 324
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vmvA00
4OJ5A 1O8LA 2ODLA 2O0VA 2VBEA 4XLEA 4YZXA 2NTBA 4AVZA 1OOCA 2O17A 3JURA 4OZYA 2UVEA 1DBGA 4W8SA 2NSTA 4YZQA 1KTWA 1OGOX 4XMYA 1X0CA 4XONA 3WWGA 4Z05A 2O0WA 2QX3A 3LMWA 3SUCA 2X6WA 4MR0A 1IDJA 1HG8A 1OFMA 3UW0A 1QJVA 2INVA 1KCDA 1PXZA 1EE6A 3GQ8A 3GQ7A 2NT9A 4OZZA 4XLFA 2IQ7A 2VJIA 5C1CA 4YZAA 2X3HA 3B4NA 4XL9A 1K5CA 2NZMA 3B8YA 3VMWA 2NT6A 1O8MA 1PE9A 4W8TA 4W8RA 3VMVA 2PYGA 3VSUA 2O04A 3VSVA 4YZ0A 2PECA 1O8GA 5C1EA 1OFLA 3GQ9A 4XLCA 1O8FA 2VJJA 4MXNA 2INUA 1WMRA 2X85A 2Z8GA 3FY3A 4XN3A 2O1DA 1BHEA 1PLUA 5AMVA 1O8DA 4XQFA 4HWVA 1O88A 2NSPA 3VSTA 4EW9A 2X6YA 4I84A 1VBLA 4XLAA 1CZFA 3B90A 1O8HA 1H80A 1O8KA 1IDKA 4Z06A 3GRHA 1AIRA 1OGMX 2VBMA 1O8JA 1O8EA 1QCXA 2NTPA 1GQ8A 4PMHA 4XORA 2EWEA 3EQNA 4XOTA 4C2LA 1O8IA 1IA5A 1JRGA 2VBKA 4Z03A 4U4BA 1RU4A 2NTQA 2PYHA 4YELA 1NHCA 4W8QA 3GQAA 1KCCA 1JTAA 3T9GA 4XOPA 1IB4A 3KRGA 4OJLA 4OJ6A 4XM3A 4OJOA 4XN0A 4XLHA 4YEJA 4XR6A 4XKVA 3ZPPA 4OJPA 1XG2A 4URRA 4NK6A 1BN8A 1RMGA 4U49A 3EQOA 3ZSCA 4XNFA 4XKWA 2BSPA 2UVFA 2X6XA 2QXZA 1DBOA 4NK8A 2QY1A 1RWRA
chains in the Genus database with same CATH superfamily
4OJ5A 1O8LA 3PSSA 2ODLA 2O0VA 2VBEA 4XLEA 4YFOA 2NTBA 4YZXA 5DNSA 2VFQA 3BH6B 4AVZA 1OOCA 2O17A 3JURA 4OZYA 2UVEA 1DBGA 4W8SA 2NSTA 3LYCA 4YDTA 1L1IA 1LLWA 4YZQA 2XTYA 1TYWA 1KTWA 1OGOX 3PETA 4XMYA 2VFMA 1X0CA 4XONA 3WWGA 1OFEA 4Z05A 2O0WA 1K4ZA 2BX6A 1OFDA 2J8KA 2QX3A 3LMWA 2BM6A 3SUCA 2X6WA 4MR0A 2XTWA 1IDJA 2O6WA 3BH7B 1HG8A 2XT4A 1OFMA 3UW0A 1QJVA 2INVA 1KCDA 1PXZA 2XT2A 1EE6A 3GQ8A 3GQ7A 3N6ZA 2BM7A 2NT9A 2VFPA 4OZZA 2W7ZA 4XLFA 1DABA 2IQ7A 2VJIA 5C1CA 1LLZA 4YZAA 2X3HA 3B4NA 4XL9A 4YEIA 2NZMA 2QYUA 3B8YA 1K5CA 4YCQA 3VMWA 2NT6A 1HF2A 1O8MA 1TYVA 1PE9A 4W8TA 4W8RA 3VMVA 2PYGA 3VSUA 2O04A 4V02C 3VSVA 4YZ0A 2PECA 1O8GA 1LM1A 5C1EA 1OFLA 2QZAA 3GQ9A 4XLCA 2G0YA 3H09A 3P4GA 1O8FA 5JMCB 1QA1A 2VJJA 3TH0A 4MXNA 2INUA 1WMRA 2BM4A 3RIQA 3SQVA 2X85A 2Z8GA 1CLWA 3FY3A 4XN3A 2O1DA 1BHEA 1PLUA 5AMVA 1O8DA 4XQFA 4HWVA 1O88A 3DU1X 2NSPA 4JRAC 3VSTA 4EW9A 2J8IA 2X6YA 4I84A 1VBLA 4XLAA 3SY2A 1CZFA 3B90A 1O8HA 1QQ1A 1H80A 1O8KA 1IDKA 2XTXA 4OPWA 4Z06A 5JLVC 3GRHA 1QA3A 1AIRA 1OGMX 1O8JA 2VBMA 1O8EA 1QCXA 1KQ5A 1GQ8A 2NTPA 4PMHA 2EWEA 4XORA 3EQNA 4XOTA 4YC5A 3SYJA 4C2LA 2XC1A 1O8IA 3N90A 1IA5A 1JRGA 1EZGA 2BM5A 2VBKA 4Z03A 2IOUG 4U4BA 1RU4A 1QRCA 2NTQA 2PYHA 4YELA 2F3LA 1NHCA 1QA2A 4W8QA 3SZEA 3GQAA 1KCCA 2VFNA 3ML3A 3AK5A 1JTAA 3T9GA 1WXRA 3JX8A 3NAWA 4XOPA 2B0RA 1IB4A 1TYXA 3KRGA 3LJYA 4OJLA 4OJ6A 3PSZA 4OJOA 4XM3A 4XLHA 4XN0A 4YEJA 4OM9A 1QRBA 4XKVA 4KH3A 4XR6A 3ZPPA 1EA0A 4OJPA 1XG2A 1TSPA 3NB2A 1BN8A 4NK6A 4URRA 1RMGA 4U49A 1K8FA 3EQOA 2YUHA 3ZSCA 4XNFA 4XKWA 2BSPA 2UVFA 2X6XA 2QXZA 1DBOA 2V5IA 2VFOA 4NK8A 2QY1A 1TYUA 1RWRA
chains in the Genus database with same CATH topology
4OJ5A 1O8LA 2ODLA 2O0VA 2VBEA 4XLEA 4YZXA 2NTBA 4AVZA 1OOCA 2O17A 3JURA 4OZYA 2UVEA 1DBGA 4W8SA 2NSTA 4YZQA 1KTWA 1OGOX 4XMYA 1X0CA 4XONA 3WWGA 4Z05A 2O0WA 2QX3A 3LMWA 3SUCA 2X6WA 4MR0A 1IDJA 1HG8A 1OFMA 3UW0A 1QJVA 2INVA 1KCDA 1PXZA 1EE6A 3GQ8A 3GQ7A 2NT9A 4OZZA 4XLFA 2IQ7A 2VJIA 5C1CA 4YZAA 2X3HA 3B4NA 4XL9A 1K5CA 2NZMA 3B8YA 3VMWA 2NT6A 1O8MA 1PE9A 4W8TA 4W8RA 3VMVA 2PYGA 3VSUA 2O04A 3VSVA 4YZ0A 2PECA 1O8GA 5C1EA 1OFLA 3GQ9A 4XLCA 1O8FA 2VJJA 4MXNA 2INUA 1WMRA 2X85A 2Z8GA 3FY3A 4XN3A 2O1DA 1BHEA 1PLUA 5AMVA 1O8DA 4XQFA 4HWVA 1O88A 2NSPA 3VSTA 4EW9A 2X6YA 4I84A 1VBLA 4XLAA 1CZFA 3B90A 1O8HA 1H80A 1O8KA 1IDKA 4Z06A 3GRHA 1AIRA 1OGMX 2VBMA 1O8JA 1O8EA 1QCXA 2NTPA 1GQ8A 4PMHA 4XORA 2EWEA 3EQNA 4XOTA 4C2LA 1O8IA 1IA5A 1JRGA 2VBKA 4Z03A 4U4BA 1RU4A 2NTQA 2PYHA 4YELA 1NHCA 4W8QA 3GQAA 1KCCA 1JTAA 3T9GA 4XOPA 1IB4A 3KRGA 4OJLA 4OJ6A 4XM3A 4OJOA 4XN0A 4XLHA 4YEJA 4XR6A 4XKVA 3ZPPA 4OJPA 1XG2A 4URRA 4NK6A 1BN8A 1RMGA 4U49A 3EQOA 3ZSCA 4XNFA 4XKWA 2BSPA 2UVFA 2X6XA 2QXZA 1DBOA 4NK8A 2QY1A 1RWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJ5 A;  1O8L A;  2ODL A;  2O0V A;  2VBE A;  4XLE A;  4YZX A;  2NTB A;  4AVZ A;  1OOC A;  2O17 A;  3JUR A;  4OZY A;  2UVE A;  1DBG A;  4W8S A;  2NST A;  4YZQ A;  1KTW A;  1OGO X;  4XMY A;  1X0C A;  4XON A;  3WWG A;  4Z05 A;  2O0W A;  2QX3 A;  3LMW A;  3SUC A;  2X6W A;  4MR0 A;  1IDJ A;  1HG8 A;  1OFM A;  3UW0 A;  1QJV A;  2INV A;  1KCD A;  1PXZ A;  1EE6 A;  3GQ8 A;  3GQ7 A;  2NT9 A;  4OZZ A;  4XLF A;  2IQ7 A;  2VJI A;  5C1C A;  4YZA A;  2X3H A;  3B4N A;  4XL9 A;  1K5C A;  2NZM A;  3B8Y A;  3VMW A;  2NT6 A;  1O8M A;  1PE9 A;  4W8T A;  4W8R A;  3VMV A;  2PYG A;  3VSU A;  2O04 A;  3VSV A;  4YZ0 A;  2PEC A;  1O8G A;  5C1E A;  1OFL A;  3GQ9 A;  4XLC A;  1O8F A;  2VJJ A;  4MXN A;  2INU A;  1WMR A;  2X85 A;  2Z8G A;  3FY3 A;  4XN3 A;  2O1D A;  1BHE A;  1PLU A;  5AMV A;  1O8D A;  4XQF A;  4HWV A;  1O88 A;  2NSP A;  3VST A;  4EW9 A;  2X6Y A;  4I84 A;  1VBL A;  4XLA A;  1CZF A;  3B90 A;  1O8H A;  1H80 A;  1O8K A;  1IDK A;  4Z06 A;  3GRH A;  1AIR A;  1OGM X;  2VBM A;  1O8J A;  1O8E A;  1QCX A;  2NTP A;  1GQ8 A;  4PMH A;  4XOR A;  2EWE A;  3EQN A;  4XOT A;  4C2L A;  1O8I A;  1IA5 A;  1JRG A;  2VBK A;  4Z03 A;  4U4B A;  1RU4 A;  2NTQ A;  2PYH A;  4YEL A;  1NHC A;  4W8Q A;  3GQA A;  1KCC A;  1JTA A;  3T9G A;  4XOP A;  1IB4 A;  3KRG A;  4OJL A;  4OJ6 A;  4XM3 A;  4OJO A;  4XN0 A;  4XLH A;  4YEJ A;  4XR6 A;  4XKV A;  3ZPP A;  4OJP A;  1XG2 A;  4URR A;  4NK6 A;  1BN8 A;  1RMG A;  4U49 A;  3EQO A;  3ZSC A;  4XNF A;  4XKW A;  2BSP A;  2UVF A;  2X6X A;  2QXZ A;  1DBO A;  4NK8 A;  2QY1 A;  1RWR A; 
#chains in the Genus database with same CATH topology
 4OJ5 A;  1O8L A;  3PSS A;  2ODL A;  2O0V A;  2VBE A;  4XLE A;  4YFO A;  2NTB A;  4YZX A;  5DNS A;  2VFQ A;  3BH6 B;  4AVZ A;  1OOC A;  2O17 A;  3JUR A;  4OZY A;  2UVE A;  1DBG A;  4W8S A;  2NST A;  3LYC A;  4YDT A;  1L1I A;  1LLW A;  4YZQ A;  2XTY A;  1TYW A;  1KTW A;  1OGO X;  3PET A;  4XMY A;  2VFM A;  1X0C A;  4XON A;  3WWG A;  1OFE A;  4Z05 A;  2O0W A;  1K4Z A;  2BX6 A;  1OFD A;  2J8K A;  2QX3 A;  3LMW A;  2BM6 A;  3SUC A;  2X6W A;  4MR0 A;  2XTW A;  1IDJ A;  2O6W A;  3BH7 B;  1HG8 A;  2XT4 A;  1OFM A;  3UW0 A;  1QJV A;  2INV A;  1KCD A;  1PXZ A;  2XT2 A;  1EE6 A;  3GQ8 A;  3GQ7 A;  3N6Z A;  2BM7 A;  2NT9 A;  2VFP A;  4OZZ A;  2W7Z A;  4XLF A;  1DAB A;  2IQ7 A;  2VJI A;  5C1C A;  1LLZ A;  4YZA A;  2X3H A;  3B4N A;  4XL9 A;  4YEI A;  2NZM A;  2QYU A;  3B8Y A;  1K5C A;  4YCQ A;  3VMW A;  2NT6 A;  1HF2 A;  1O8M A;  1TYV A;  1PE9 A;  4W8T A;  4W8R A;  3VMV A;  2PYG A;  3VSU A;  2O04 A;  4V02 C;  3VSV A;  4YZ0 A;  2PEC A;  1O8G A;  1LM1 A;  5C1E A;  1OFL A;  2QZA A;  3GQ9 A;  4XLC A;  2G0Y A;  3H09 A;  3P4G A;  1O8F A;  5JMC B;  1QA1 A;  2VJJ A;  3TH0 A;  4MXN A;  2INU A;  1WMR A;  2BM4 A;  3RIQ A;  3SQV A;  2X85 A;  2Z8G A;  1CLW A;  3FY3 A;  4XN3 A;  2O1D A;  1BHE A;  1PLU A;  5AMV A;  1O8D A;  4XQF A;  4HWV A;  1O88 A;  3DU1 X;  2NSP A;  4JRA C;  3VST A;  4EW9 A;  2J8I A;  2X6Y A;  4I84 A;  1VBL A;  4XLA A;  3SY2 A;  1CZF A;  3B90 A;  1O8H A;  1QQ1 A;  1H80 A;  1O8K A;  1IDK A;  2XTX A;  4OPW A;  4Z06 A;  5JLV C;  3GRH A;  1QA3 A;  1AIR A;  1OGM X;  1O8J A;  2VBM A;  1O8E A;  1QCX A;  1KQ5 A;  1GQ8 A;  2NTP A;  4PMH A;  2EWE A;  4XOR A;  3EQN A;  4XOT A;  4YC5 A;  3SYJ A;  4C2L A;  2XC1 A;  1O8I A;  3N90 A;  1IA5 A;  1JRG A;  1EZG A;  2BM5 A;  2VBK A;  4Z03 A;  2IOU G;  4U4B A;  1RU4 A;  1QRC A;  2NTQ A;  2PYH A;  4YEL A;  2F3L A;  1NHC A;  1QA2 A;  4W8Q A;  3SZE A;  3GQA A;  1KCC A;  2VFN A;  3ML3 A;  3AK5 A;  1JTA A;  3T9G A;  1WXR A;  3JX8 A;  3NAW A;  4XOP A;  2B0R A;  1IB4 A;  1TYX A;  3KRG A;  3LJY A;  4OJL A;  4OJ6 A;  3PSZ A;  4OJO A;  4XM3 A;  4XLH A;  4XN0 A;  4YEJ A;  4OM9 A;  1QRB A;  4XKV A;  4KH3 A;  4XR6 A;  3ZPP A;  1EA0 A;  4OJP A;  1XG2 A;  1TSP A;  3NB2 A;  1BN8 A;  4NK6 A;  4URR A;  1RMG A;  4U49 A;  1K8F A;  3EQO A;  2YUH A;  3ZSC A;  4XNF A;  4XKW A;  2BSP A;  2UVF A;  2X6X A;  2QXZ A;  1DBO A;  2V5I A;  2VFO A;  4NK8 A;  2QY1 A;  1TYU A;  1RWR A; 
#chains in the Genus database with same CATH homology
 4OJ5 A;  1O8L A;  2ODL A;  2O0V A;  2VBE A;  4XLE A;  4YZX A;  2NTB A;  4AVZ A;  1OOC A;  2O17 A;  3JUR A;  4OZY A;  2UVE A;  1DBG A;  4W8S A;  2NST A;  4YZQ A;  1KTW A;  1OGO X;  4XMY A;  1X0C A;  4XON A;  3WWG A;  4Z05 A;  2O0W A;  2QX3 A;  3LMW A;  3SUC A;  2X6W A;  4MR0 A;  1IDJ A;  1HG8 A;  1OFM A;  3UW0 A;  1QJV A;  2INV A;  1KCD A;  1PXZ A;  1EE6 A;  3GQ8 A;  3GQ7 A;  2NT9 A;  4OZZ A;  4XLF A;  2IQ7 A;  2VJI A;  5C1C A;  4YZA A;  2X3H A;  3B4N A;  4XL9 A;  1K5C A;  2NZM A;  3B8Y A;  3VMW A;  2NT6 A;  1O8M A;  1PE9 A;  4W8T A;  4W8R A;  3VMV A;  2PYG A;  3VSU A;  2O04 A;  3VSV A;  4YZ0 A;  2PEC A;  1O8G A;  5C1E A;  1OFL A;  3GQ9 A;  4XLC A;  1O8F A;  2VJJ A;  4MXN A;  2INU A;  1WMR A;  2X85 A;  2Z8G A;  3FY3 A;  4XN3 A;  2O1D A;  1BHE A;  1PLU A;  5AMV A;  1O8D A;  4XQF A;  4HWV A;  1O88 A;  2NSP A;  3VST A;  4EW9 A;  2X6Y A;  4I84 A;  1VBL A;  4XLA A;  1CZF A;  3B90 A;  1O8H A;  1H80 A;  1O8K A;  1IDK A;  4Z06 A;  3GRH A;  1AIR A;  1OGM X;  2VBM A;  1O8J A;  1O8E A;  1QCX A;  2NTP A;  1GQ8 A;  4PMH A;  4XOR A;  2EWE A;  3EQN A;  4XOT A;  4C2L A;  1O8I A;  1IA5 A;  1JRG A;  2VBK A;  4Z03 A;  4U4B A;  1RU4 A;  2NTQ A;  2PYH A;  4YEL A;  1NHC A;  4W8Q A;  3GQA A;  1KCC A;  1JTA A;  3T9G A;  4XOP A;  1IB4 A;  3KRG A;  4OJL A;  4OJ6 A;  4XM3 A;  4OJO A;  4XN0 A;  4XLH A;  4YEJ A;  4XR6 A;  4XKV A;  3ZPP A;  4OJP A;  1XG2 A;  4URR A;  4NK6 A;  1BN8 A;  1RMG A;  4U49 A;  3EQO A;  3ZSC A;  4XNF A;  4XKW A;  2BSP A;  2UVF A;  2X6X A;  2QXZ A;  1DBO A;  4NK8 A;  2QY1 A;  1RWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...