3VMVA

Crystal structure of pectate lyase bsp165pela from bacillus sp. n165
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
324
structure length
324
Chain Sequence
GPQGYASMNGGTTGGAGGRVEYASTGAQIQQLIDNRSRSNNPDEPLTIYVNGTITQGNSPQSLIDVKNHRGKAHEIKNISIIGVGTNGEFDGIGIRLSNAHNIIIQNVSIHHVREGEGTAIEVTDDSKNVWIDHNEFYSEFPGNGDSDYYDGLVDMKRNAEYITVSWNKFENHWKTMLVGHTDNASLAPDKITYHHNYFNNLNSRVPLIRYADVHMFNNYFKDINDTAINSRVGARVFVENNYFDNVGSGQADPTTGFIKGPVGWFYGSPSTGYWNLRGNVFVNTPNSHLNSTTNFTPPYSYQVQSATQAKSSVEQHSGVGVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and substrate-binding mode of a novel pectate lyase from alkaliphilic Bacillus sp. N16-5.
pubmed doi rcsb
source organism Bacillus
molecule tags Lyase
molecule keywords Pectate lyase
total genus 136
structure length 324
sequence length 324
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vmvA00
2VBEA 1CZFA 2QX3A 4XKWA 4YZXA 3GQ8A 1NHCA 4XM3A 4C2LA 2NSTA 4NK8A 1DBGA 5C1CA 4XLAA 1PLUA 4XOTA 2X6XA 1O8DA 1O88A 1IDJA 4XNFA 4OZZA 2QXZA 3EQNA 4XORA 4YELA 1EE6A 1VBLA 4MR0A 1WMRA 2NZMA 4MXNA 5AMVA 2O0WA 4AVZA 1K5CA 1KTWA 1O8KA 2IQ7A 3B4NA 3B8YA 2Z8GA 2EWEA 4U49A 4Z03A 3ZPPA 4XMYA 1H80A 1O8FA 4XKVA 2PYGA 3KRGA 2UVEA 4OJ5A 4U4BA 1JRGA 1OGMX 4XN3A 2NTPA 3SUCA 2INUA 1QJVA 2O0VA 4W8SA 1IDKA 4OJOA 4YZQA 2NSPA 3WWGA 2QY1A 4XONA 4OJPA 4Z06A 2O17A 2VJIA 2X3HA 1BHEA 2O1DA 4W8RA 1KCCA 3VSVA 2INVA 4YEJA 3EQOA 3GQAA 3FY3A 4YZ0A 4XQFA 1RU4A 2NT6A 1OOCA 1O8HA 2ODLA 4YZAA 2NTQA 4Z05A 3T9GA 1RMGA 4OJ6A 2X85A 2X6YA 1HG8A 4HWVA 4XLCA 1OFLA 2PECA 4EW9A 3GQ9A 1O8JA 3GRHA 1DBOA 1OFMA 4XOPA 1RWRA 4W8TA 2O04A 3B90A 1PXZA 2PYHA 1O8EA 1XG2A 3ZSCA 1O8IA 1KCDA 5C1EA 1O8GA 1QCXA 4XN0A 3UW0A 3JURA 4XLHA 3VMWA 1O8MA 1X0CA 4I84A 1O8LA 4XLEA 2BSPA 2UVFA 4OJLA 3VMVA 2X6WA 2NT9A 1OGOX 1IA5A 3GQ7A 4OZYA 1AIRA 1JTAA 2VJJA 3VSUA 3VSTA 4XR6A 1BN8A 4W8QA 2VBKA 4PMHA 4URRA 3LMWA 4XLFA 4XL9A 1IB4A 4NK6A 1GQ8A 2VBMA 1PE9A 2NTBA
chains in the Genus database with same CATH superfamily
2VBEA 1TYXA 1CZFA 2QX3A 4XKWA 2VFOA 4YZXA 3GQ8A 1NHCA 2XTWA 4XM3A 2BM4A 2IOUG 4C2LA 4V02C 2NSTA 4NK8A 1DBGA 5C1CA 4XLAA 1PLUA 4XOTA 2X6XA 1O8DA 1O88A 1OFEA 1IDJA 2XT4A 4XNFA 1QA3A 4OZZA 2J8IA 2W7ZA 2QXZA 3BH7B 3PETA 5JLVC 1HF2A 3EQNA 4XORA 4YELA 1EE6A 3TH0A 1VBLA 4MR0A 1WMRA 2NZMA 4MXNA 5AMVA 2O0WA 4AVZA 1K5CA 1KTWA 1O8KA 2IQ7A 3B4NA 3B8YA 2Z8GA 1TYUA 2EWEA 4U49A 4Z03A 3ZPPA 1L1IA 4XMYA 2VFMA 1H80A 1O8FA 2B0RA 4XKVA 3DU1X 2PYGA 3KRGA 2UVEA 4OJ5A 4U4BA 1JRGA 4KH3A 1OGMX 5JMCB 4XN3A 2NTPA 3SUCA 4YEIA 2INUA 1QJVA 2O0VA 4W8SA 4YC5A 2V5IA 2XTYA 2BM7A 1DABA 1IDKA 1KQ5A 2XC1A 4OJOA 1EA0A 4YCQA 2NSPA 2G0YA 4YZQA 1TYVA 2QY1A 4OJPA 4XONA 3SQVA 1QRCA 4Z06A 2O17A 3SZEA 2VJIA 1EZGA 2X3HA 1BHEA 2O1DA 2YUHA 4W8RA 1KCCA 3VSVA 2INVA 4YEJA 1LLZA 3EQOA 1LM1A 3GQAA 3FY3A 2BM5A 2O6WA 3P4GA 4XQFA 4JRAC 4YZ0A 1RU4A 1K4ZA 2NT6A 1OOCA 1O8HA 2ODLA 4YZAA 2NTQA 4Z05A 3T9GA 1RMGA 3JX8A 4OJ6A 2X85A 3PSSA 2X6YA 1HG8A 4HWVA 4XLCA 1OFLA 1OFDA 2PECA 1LLWA 3GQ9A 1O8JA 2J8KA 3NB2A 4EW9A 3GRHA 1DBOA 1OFMA 4XOPA 1RWRA 4W8TA 2QZAA 2O04A 3B90A 1PXZA 2PYHA 1O8EA 1QA2A 3LJYA 1XG2A 3ZSCA 3N90A 1O8IA 3N6ZA 1KCDA 2XTXA 4YDTA 2BM6A 3PSZA 5C1EA 3RIQA 3AK5A 1O8GA 1QCXA 4XN0A 1TSPA 3UW0A 2VFQA 3JURA 2VFPA 4OM9A 4XLHA 3VMWA 1O8MA 5DNSA 1X0CA 4I84A 1O8LA 4XLEA 1K8FA 2BSPA 3WWGA 1WXRA 2VFNA 4YFOA 2UVFA 4OJLA 3VMVA 2X6WA 2NT9A 1OGOX 3H09A 3ML3A 1IA5A 3GQ7A 4OZYA 1AIRA 2XT2A 1JTAA 1QQ1A 1CLWA 3SY2A 2BX6A 2VJJA 3LYCA 3VSUA 3VSTA 4XR6A 1BN8A 4W8QA 2VBKA 1QRBA 4PMHA 4URRA 1QA1A 3LMWA 3BH6B 4XLFA 4XL9A 1IB4A 4NK6A 1TYWA 1GQ8A 2VBMA 1PE9A 2F3LA 3NAWA 4OPWA 2QYUA 3SYJA 2NTBA
chains in the Genus database with same CATH topology
2VBEA 1CZFA 2QX3A 4XKWA 4YZXA 3GQ8A 1NHCA 4XM3A 4C2LA 2NSTA 4NK8A 1DBGA 5C1CA 4XLAA 1PLUA 4XOTA 2X6XA 1O8DA 1O88A 1IDJA 4XNFA 4OZZA 2QXZA 3EQNA 4XORA 4YELA 1EE6A 1VBLA 4MR0A 1WMRA 2NZMA 4MXNA 5AMVA 2O0WA 4AVZA 1K5CA 1KTWA 1O8KA 2IQ7A 3B4NA 3B8YA 2Z8GA 2EWEA 4U49A 4Z03A 3ZPPA 4XMYA 1H80A 1O8FA 4XKVA 2PYGA 3KRGA 2UVEA 4OJ5A 4U4BA 1JRGA 1OGMX 4XN3A 2NTPA 3SUCA 2INUA 1QJVA 2O0VA 4W8SA 1IDKA 4OJOA 4YZQA 2NSPA 3WWGA 2QY1A 4XONA 4OJPA 4Z06A 2O17A 2VJIA 2X3HA 1BHEA 2O1DA 4W8RA 1KCCA 3VSVA 2INVA 4YEJA 3EQOA 3GQAA 3FY3A 4YZ0A 4XQFA 1RU4A 2NT6A 1OOCA 1O8HA 2ODLA 4YZAA 2NTQA 4Z05A 3T9GA 1RMGA 4OJ6A 2X85A 2X6YA 1HG8A 4HWVA 4XLCA 1OFLA 2PECA 4EW9A 3GQ9A 1O8JA 3GRHA 1DBOA 1OFMA 4XOPA 1RWRA 4W8TA 2O04A 3B90A 1PXZA 2PYHA 1O8EA 1XG2A 3ZSCA 1O8IA 1KCDA 5C1EA 1O8GA 1QCXA 4XN0A 3UW0A 3JURA 4XLHA 3VMWA 1O8MA 1X0CA 4I84A 1O8LA 4XLEA 2BSPA 2UVFA 4OJLA 3VMVA 2X6WA 2NT9A 1OGOX 1IA5A 3GQ7A 4OZYA 1AIRA 1JTAA 2VJJA 3VSUA 3VSTA 4XR6A 1BN8A 4W8QA 2VBKA 4PMHA 4URRA 3LMWA 4XLFA 4XL9A 1IB4A 4NK6A 1GQ8A 2VBMA 1PE9A 2NTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBE A;  1CZF A;  2QX3 A;  4XKW A;  4YZX A;  3GQ8 A;  1NHC A;  4XM3 A;  4C2L A;  2NST A;  4NK8 A;  1DBG A;  5C1C A;  4XLA A;  1PLU A;  4XOT A;  2X6X A;  1O8D A;  1O88 A;  1IDJ A;  4XNF A;  4OZZ A;  2QXZ A;  3EQN A;  4XOR A;  4YEL A;  1EE6 A;  1VBL A;  4MR0 A;  1WMR A;  2NZM A;  4MXN A;  5AMV A;  2O0W A;  4AVZ A;  1K5C A;  1KTW A;  1O8K A;  2IQ7 A;  3B4N A;  3B8Y A;  2Z8G A;  2EWE A;  4U49 A;  4Z03 A;  3ZPP A;  4XMY A;  1H80 A;  1O8F A;  4XKV A;  2PYG A;  3KRG A;  2UVE A;  4OJ5 A;  4U4B A;  1JRG A;  1OGM X;  4XN3 A;  2NTP A;  3SUC A;  2INU A;  1QJV A;  2O0V A;  4W8S A;  1IDK A;  4OJO A;  4YZQ A;  2NSP A;  3WWG A;  2QY1 A;  4XON A;  4OJP A;  4Z06 A;  2O17 A;  2VJI A;  2X3H A;  1BHE A;  2O1D A;  4W8R A;  1KCC A;  3VSV A;  2INV A;  4YEJ A;  3EQO A;  3GQA A;  3FY3 A;  4YZ0 A;  4XQF A;  1RU4 A;  2NT6 A;  1OOC A;  1O8H A;  2ODL A;  4YZA A;  2NTQ A;  4Z05 A;  3T9G A;  1RMG A;  4OJ6 A;  2X85 A;  2X6Y A;  1HG8 A;  4HWV A;  4XLC A;  1OFL A;  2PEC A;  4EW9 A;  3GQ9 A;  1O8J A;  3GRH A;  1DBO A;  1OFM A;  4XOP A;  1RWR A;  4W8T A;  2O04 A;  3B90 A;  1PXZ A;  2PYH A;  1O8E A;  1XG2 A;  3ZSC A;  1O8I A;  1KCD A;  5C1E A;  1O8G A;  1QCX A;  4XN0 A;  3UW0 A;  3JUR A;  4XLH A;  3VMW A;  1O8M A;  1X0C A;  4I84 A;  1O8L A;  4XLE A;  2BSP A;  2UVF A;  4OJL A;  3VMV A;  2X6W A;  2NT9 A;  1OGO X;  1IA5 A;  3GQ7 A;  4OZY A;  1AIR A;  1JTA A;  2VJJ A;  3VSU A;  3VST A;  4XR6 A;  1BN8 A;  4W8Q A;  2VBK A;  4PMH A;  4URR A;  3LMW A;  4XLF A;  4XL9 A;  1IB4 A;  4NK6 A;  1GQ8 A;  2VBM A;  1PE9 A;  2NTB A; 
#chains in the Genus database with same CATH topology
 2VBE A;  1TYX A;  1CZF A;  2QX3 A;  4XKW A;  2VFO A;  4YZX A;  3GQ8 A;  1NHC A;  2XTW A;  4XM3 A;  2BM4 A;  2IOU G;  4C2L A;  4V02 C;  2NST A;  4NK8 A;  1DBG A;  5C1C A;  4XLA A;  1PLU A;  4XOT A;  2X6X A;  1O8D A;  1O88 A;  1OFE A;  1IDJ A;  2XT4 A;  4XNF A;  1QA3 A;  4OZZ A;  2J8I A;  2W7Z A;  2QXZ A;  3BH7 B;  3PET A;  5JLV C;  1HF2 A;  3EQN A;  4XOR A;  4YEL A;  1EE6 A;  3TH0 A;  1VBL A;  4MR0 A;  1WMR A;  2NZM A;  4MXN A;  5AMV A;  2O0W A;  4AVZ A;  1K5C A;  1KTW A;  1O8K A;  2IQ7 A;  3B4N A;  3B8Y A;  2Z8G A;  1TYU A;  2EWE A;  4U49 A;  4Z03 A;  3ZPP A;  1L1I A;  4XMY A;  2VFM A;  1H80 A;  1O8F A;  2B0R A;  4XKV A;  3DU1 X;  2PYG A;  3KRG A;  2UVE A;  4OJ5 A;  4U4B A;  1JRG A;  4KH3 A;  1OGM X;  5JMC B;  4XN3 A;  2NTP A;  3SUC A;  4YEI A;  2INU A;  1QJV A;  2O0V A;  4W8S A;  4YC5 A;  2V5I A;  2XTY A;  2BM7 A;  1DAB A;  1IDK A;  1KQ5 A;  2XC1 A;  4OJO A;  1EA0 A;  4YCQ A;  2NSP A;  2G0Y A;  4YZQ A;  1TYV A;  2QY1 A;  4OJP A;  4XON A;  3SQV A;  1QRC A;  4Z06 A;  2O17 A;  3SZE A;  2VJI A;  1EZG A;  2X3H A;  1BHE A;  2O1D A;  2YUH A;  4W8R A;  1KCC A;  3VSV A;  2INV A;  4YEJ A;  1LLZ A;  3EQO A;  1LM1 A;  3GQA A;  3FY3 A;  2BM5 A;  2O6W A;  3P4G A;  4XQF A;  4JRA C;  4YZ0 A;  1RU4 A;  1K4Z A;  2NT6 A;  1OOC A;  1O8H A;  2ODL A;  4YZA A;  2NTQ A;  4Z05 A;  3T9G A;  1RMG A;  3JX8 A;  4OJ6 A;  2X85 A;  3PSS A;  2X6Y A;  1HG8 A;  4HWV A;  4XLC A;  1OFL A;  1OFD A;  2PEC A;  1LLW A;  3GQ9 A;  1O8J A;  2J8K A;  3NB2 A;  4EW9 A;  3GRH A;  1DBO A;  1OFM A;  4XOP A;  1RWR A;  4W8T A;  2QZA A;  2O04 A;  3B90 A;  1PXZ A;  2PYH A;  1O8E A;  1QA2 A;  3LJY A;  1XG2 A;  3ZSC A;  3N90 A;  1O8I A;  3N6Z A;  1KCD A;  2XTX A;  4YDT A;  2BM6 A;  3PSZ A;  5C1E A;  3RIQ A;  3AK5 A;  1O8G A;  1QCX A;  4XN0 A;  1TSP A;  3UW0 A;  2VFQ A;  3JUR A;  2VFP A;  4OM9 A;  4XLH A;  3VMW A;  1O8M A;  5DNS A;  1X0C A;  4I84 A;  1O8L A;  4XLE A;  1K8F A;  2BSP A;  3WWG A;  1WXR A;  2VFN A;  4YFO A;  2UVF A;  4OJL A;  3VMV A;  2X6W A;  2NT9 A;  1OGO X;  3H09 A;  3ML3 A;  1IA5 A;  3GQ7 A;  4OZY A;  1AIR A;  2XT2 A;  1JTA A;  1QQ1 A;  1CLW A;  3SY2 A;  2BX6 A;  2VJJ A;  3LYC A;  3VSU A;  3VST A;  4XR6 A;  1BN8 A;  4W8Q A;  2VBK A;  1QRB A;  4PMH A;  4URR A;  1QA1 A;  3LMW A;  3BH6 B;  4XLF A;  4XL9 A;  1IB4 A;  4NK6 A;  1TYW A;  1GQ8 A;  2VBM A;  1PE9 A;  2F3L A;  3NAW A;  4OPW A;  2QYU A;  3SYJ A;  2NTB A; 
#chains in the Genus database with same CATH homology
 2VBE A;  1CZF A;  2QX3 A;  4XKW A;  4YZX A;  3GQ8 A;  1NHC A;  4XM3 A;  4C2L A;  2NST A;  4NK8 A;  1DBG A;  5C1C A;  4XLA A;  1PLU A;  4XOT A;  2X6X A;  1O8D A;  1O88 A;  1IDJ A;  4XNF A;  4OZZ A;  2QXZ A;  3EQN A;  4XOR A;  4YEL A;  1EE6 A;  1VBL A;  4MR0 A;  1WMR A;  2NZM A;  4MXN A;  5AMV A;  2O0W A;  4AVZ A;  1K5C A;  1KTW A;  1O8K A;  2IQ7 A;  3B4N A;  3B8Y A;  2Z8G A;  2EWE A;  4U49 A;  4Z03 A;  3ZPP A;  4XMY A;  1H80 A;  1O8F A;  4XKV A;  2PYG A;  3KRG A;  2UVE A;  4OJ5 A;  4U4B A;  1JRG A;  1OGM X;  4XN3 A;  2NTP A;  3SUC A;  2INU A;  1QJV A;  2O0V A;  4W8S A;  1IDK A;  4OJO A;  4YZQ A;  2NSP A;  3WWG A;  2QY1 A;  4XON A;  4OJP A;  4Z06 A;  2O17 A;  2VJI A;  2X3H A;  1BHE A;  2O1D A;  4W8R A;  1KCC A;  3VSV A;  2INV A;  4YEJ A;  3EQO A;  3GQA A;  3FY3 A;  4YZ0 A;  4XQF A;  1RU4 A;  2NT6 A;  1OOC A;  1O8H A;  2ODL A;  4YZA A;  2NTQ A;  4Z05 A;  3T9G A;  1RMG A;  4OJ6 A;  2X85 A;  2X6Y A;  1HG8 A;  4HWV A;  4XLC A;  1OFL A;  2PEC A;  4EW9 A;  3GQ9 A;  1O8J A;  3GRH A;  1DBO A;  1OFM A;  4XOP A;  1RWR A;  4W8T A;  2O04 A;  3B90 A;  1PXZ A;  2PYH A;  1O8E A;  1XG2 A;  3ZSC A;  1O8I A;  1KCD A;  5C1E A;  1O8G A;  1QCX A;  4XN0 A;  3UW0 A;  3JUR A;  4XLH A;  3VMW A;  1O8M A;  1X0C A;  4I84 A;  1O8L A;  4XLE A;  2BSP A;  2UVF A;  4OJL A;  3VMV A;  2X6W A;  2NT9 A;  1OGO X;  1IA5 A;  3GQ7 A;  4OZY A;  1AIR A;  1JTA A;  2VJJ A;  3VSU A;  3VST A;  4XR6 A;  1BN8 A;  4W8Q A;  2VBK A;  4PMH A;  4URR A;  3LMW A;  4XLF A;  4XL9 A;  1IB4 A;  4NK6 A;  1GQ8 A;  2VBM A;  1PE9 A;  2NTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...