3VMVA

Crystal structure of pectate lyase bsp165pela from bacillus sp. n165
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
324
structure length
324
Chain Sequence
GPQGYASMNGGTTGGAGGRVEYASTGAQIQQLIDNRSRSNNPDEPLTIYVNGTITQGNSPQSLIDVKNHRGKAHEIKNISIIGVGTNGEFDGIGIRLSNAHNIIIQNVSIHHVREGEGTAIEVTDDSKNVWIDHNEFYSEFPGNGDSDYYDGLVDMKRNAEYITVSWNKFENHWKTMLVGHTDNASLAPDKITYHHNYFNNLNSRVPLIRYADVHMFNNYFKDINDTAINSRVGARVFVENNYFDNVGSGQADPTTGFIKGPVGWFYGSPSTGYWNLRGNVFVNTPNSHLNSTTNFTPPYSYQVQSATQAKSSVEQHSGVGVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title Crystal structure and substrate-binding mode of a novel pectate lyase from alkaliphilic Bacillus sp. N16-5.
pubmed doi rcsb
source organism Bacillus
molecule tags Lyase
total genus 136
structure length 324
sequence length 324
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vmvA00
3SUCA 3VSUA 1O8EA 4XLFA 1GQ8A 2O17A 1RMGA 1PXZA 1OOCA 4OJLA 1VBLA 3ZPPA 2QXZA 3UW0A 3WWGA 2NSPA 4XKWA 3EQOA 4XMYA 4XN0A 4Z03A 1QCXA 1KCCA 3LMWA 4XOTA 4U4BA 3GRHA 4XM3A 2IQ7A 1IDJA 4YZAA 2O1DA 4OJ5A 2VBKA 2ODLA 2PYHA 4XLAA 1OFMA 5C1EA 4XLCA 1JRGA 4XNFA 4OJ6A 3VSVA 4YELA 4Z05A 2Z8GA 1RU4A 3JURA 4XKVA 4AVZA 2VJJA 1JTAA 2NSTA 4OZYA 1H80A 1O8IA 1BN8A 1RWRA 4W8TA 3GQAA 4OJOA 4YZQA 1IB4A 4EW9A 1O8MA 1AIRA 1EE6A 4XQFA 2X85A 2EWEA 2NTPA 4W8QA 4XLEA 4YZXA 2X6XA 1WMRA 2VJIA 2X6WA 4XOPA 1IDKA 2X3HA 4HWVA 4XR6A 1CZFA 1KCDA 1QJVA 1O8DA 4PMHA 1O8HA 4YZ0A 2NZMA 1O8FA 4XONA 4XL9A 2NT9A 1DBGA 4MXNA 5C1CA 1PLUA 1NHCA 4MR0A 2NTBA 1IA5A 2O0VA 1O88A 4OJPA 3FY3A 3GQ7A 5AMVA 3GQ8A 3B90A 4YEJA 3B8YA 4W8SA 3VMWA 3B4NA 1O8GA 4URRA 4XORA 4C2LA 2O04A 4W8RA 1X0CA 2QY1A 4NK6A 4U49A 4XN3A 4NK8A 1OGOX 4OZZA 2X6YA 2INUA 3KRGA 1DBOA 2PECA 1O8KA 1OGMX 2BSPA 2UVFA 3T9GA 3VMVA 2O0WA 2NTQA 2NT6A 3VSTA 1PE9A 1O8LA 4Z06A 2INVA 4XLHA 1KTWA 1O8JA 2PYGA 2QX3A 2VBMA 1BHEA 2VBEA 3EQNA 1XG2A 4I84A 2UVEA 1K5CA 3ZSCA 3GQ9A 1HG8A 1OFLA
chains in the Genus database with same CATH superfamily
3SUCA 3VSUA 2BX6A 1O8EA 2XTXA 4XLFA 2XTWA 5DNSA 1GQ8A 2O17A 1RMGA 1PXZA 1OOCA 4OJLA 2YUHA 2VFPA 2XC1A 3DU1X 1DABA 1VBLA 1EA0A 3ZPPA 2QXZA 3UW0A 1TYVA 3WWGA 1WXRA 1EZGA 3NB2A 4YC5A 4YDTA 2NSPA 4XKWA 3EQOA 4XMYA 4XN0A 4Z03A 1QCXA 1TYWA 1KCCA 2BM5A 3LMWA 4XOTA 4U4BA 3GRHA 2QZAA 4XM3A 2IQ7A 1IDJA 3PSSA 4YZAA 2O1DA 4OJ5A 1L1IA 2VBKA 2ODLA 2PYHA 4XLAA 2BM6A 4V02C 1OFMA 1QRCA 2VFMA 5C1EA 4XLCA 1JRGA 4XNFA 4OJ6A 3VSVA 4YELA 4Z05A 2Z8GA 1RU4A 3JURA 2J8IA 4XKVA 4AVZA 3N90A 2VJJA 3JX8A 1JTAA 1CLWA 2NSTA 4OZYA 4YCQA 1H80A 1O8IA 1BN8A 1RWRA 4W8TA 3GQAA 2V5IA 4OJOA 2XT2A 4YZQA 4EW9A 1QA3A 1KQ5A 1O8MA 1AIRA 1EE6A 4XQFA 2X85A 2EWEA 2J8KA 2W7ZA 2NTPA 1TYXA 4W8QA 4XLEA 2X6XA 4YZXA 3LJYA 1WMRA 2VJIA 2X6WA 4XOPA 1IDKA 2X3HA 4HWVA 4JRAC 1K8FA 4XR6A 1CZFA 1QQ1A 1KCDA 1QJVA 3SQVA 4KH3A 1O8DA 4PMHA 1O8HA 2XTYA 4YZ0A 2NZMA 1O8FA 4YFOA 3BH7B 4XONA 4XL9A 2NT9A 1DBGA 2QYUA 4MXNA 5C1CA 1TYUA 2VFOA 3ML3A 5JLVC 1PLUA 1OFDA 2VFQA 3LYCA 3PSZA 2NTBA 4MR0A 1IA5A 1NHCA 3AK5A 2O0VA 1O88A 4OJPA 3SYJA 1HF2A 3FY3A 3GQ7A 5AMVA 2BM7A 3GQ8A 3B90A 4YEJA 3TH0A 3SY2A 3B8YA 2O6WA 4W8SA 3VMWA 3NAWA 2B0RA 3B4NA 1LLZA 1O8GA 4URRA 3RIQA 1IB4A 1QA2A 4XORA 4C2LA 2O04A 4W8RA 1X0CA 2QY1A 4NK6A 4U49A 1OFEA 4NK8A 4XN3A 1OGOX 4OZZA 2X6YA 2INUA 4OM9A 4OPWA 2F3LA 3KRGA 1DBOA 2PECA 4YEIA 2BM4A 1O8KA 1OGMX 2BSPA 2UVFA 5JMCB 3T9GA 3VMVA 2O0WA 2NTQA 2XT4A 3PETA 1TSPA 2NT6A 3VSTA 1PE9A 3P4GA 1O8LA 4Z06A 2INVA 4XLHA 1KTWA 2VFNA 1K4ZA 1O8JA 2PYGA 2QX3A 2VBMA 1BHEA 2VBEA 1QRBA 3H09A 3EQNA 1XG2A 4I84A 2UVEA 1QA1A 3SZEA 1LM1A 1K5CA 2G0YA 3N6ZA 3ZSCA 3GQ9A 3BH6B 1HG8A 1LLWA 1OFLA 2IOUG
chains in the Genus database with same CATH topology
3SUCA 3VSUA 1O8EA 4XLFA 1GQ8A 2O17A 1RMGA 1PXZA 1OOCA 4OJLA 1VBLA 3ZPPA 2QXZA 3UW0A 3WWGA 2NSPA 4XKWA 3EQOA 4XMYA 4XN0A 4Z03A 1QCXA 1KCCA 3LMWA 4XOTA 4U4BA 3GRHA 4XM3A 2IQ7A 1IDJA 4YZAA 2O1DA 4OJ5A 2VBKA 2ODLA 2PYHA 4XLAA 1OFMA 5C1EA 4XLCA 1JRGA 4XNFA 4OJ6A 3VSVA 4YELA 4Z05A 2Z8GA 1RU4A 3JURA 4XKVA 4AVZA 2VJJA 1JTAA 2NSTA 4OZYA 1H80A 1O8IA 1BN8A 1RWRA 4W8TA 3GQAA 4OJOA 4YZQA 1IB4A 4EW9A 1O8MA 1AIRA 1EE6A 4XQFA 2X85A 2EWEA 2NTPA 4W8QA 4XLEA 4YZXA 2X6XA 1WMRA 2VJIA 2X6WA 4XOPA 1IDKA 2X3HA 4HWVA 4XR6A 1CZFA 1KCDA 1QJVA 1O8DA 4PMHA 1O8HA 4YZ0A 2NZMA 1O8FA 4XONA 4XL9A 2NT9A 1DBGA 4MXNA 5C1CA 1PLUA 1NHCA 4MR0A 2NTBA 1IA5A 2O0VA 1O88A 4OJPA 3FY3A 3GQ7A 5AMVA 3GQ8A 3B90A 4YEJA 3B8YA 4W8SA 3VMWA 3B4NA 1O8GA 4URRA 4XORA 4C2LA 2O04A 4W8RA 1X0CA 2QY1A 4NK6A 4U49A 4XN3A 4NK8A 1OGOX 4OZZA 2X6YA 2INUA 3KRGA 1DBOA 2PECA 1O8KA 1OGMX 2BSPA 2UVFA 3T9GA 3VMVA 2O0WA 2NTQA 2NT6A 3VSTA 1PE9A 1O8LA 4Z06A 2INVA 4XLHA 1KTWA 1O8JA 2PYGA 2QX3A 2VBMA 1BHEA 2VBEA 3EQNA 1XG2A 4I84A 2UVEA 1K5CA 3ZSCA 3GQ9A 1HG8A 1OFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUC A;  3VSU A;  1O8E A;  4XLF A;  1GQ8 A;  2O17 A;  1RMG A;  1PXZ A;  1OOC A;  4OJL A;  1VBL A;  3ZPP A;  2QXZ A;  3UW0 A;  3WWG A;  2NSP A;  4XKW A;  3EQO A;  4XMY A;  4XN0 A;  4Z03 A;  1QCX A;  1KCC A;  3LMW A;  4XOT A;  4U4B A;  3GRH A;  4XM3 A;  2IQ7 A;  1IDJ A;  4YZA A;  2O1D A;  4OJ5 A;  2VBK A;  2ODL A;  2PYH A;  4XLA A;  1OFM A;  5C1E A;  4XLC A;  1JRG A;  4XNF A;  4OJ6 A;  3VSV A;  4YEL A;  4Z05 A;  2Z8G A;  1RU4 A;  3JUR A;  4XKV A;  4AVZ A;  2VJJ A;  1JTA A;  2NST A;  4OZY A;  1H80 A;  1O8I A;  1BN8 A;  1RWR A;  4W8T A;  3GQA A;  4OJO A;  4YZQ A;  1IB4 A;  4EW9 A;  1O8M A;  1AIR A;  1EE6 A;  4XQF A;  2X85 A;  2EWE A;  2NTP A;  4W8Q A;  4XLE A;  4YZX A;  2X6X A;  1WMR A;  2VJI A;  2X6W A;  4XOP A;  1IDK A;  2X3H A;  4HWV A;  4XR6 A;  1CZF A;  1KCD A;  1QJV A;  1O8D A;  4PMH A;  1O8H A;  4YZ0 A;  2NZM A;  1O8F A;  4XON A;  4XL9 A;  2NT9 A;  1DBG A;  4MXN A;  5C1C A;  1PLU A;  1NHC A;  4MR0 A;  2NTB A;  1IA5 A;  2O0V A;  1O88 A;  4OJP A;  3FY3 A;  3GQ7 A;  5AMV A;  3GQ8 A;  3B90 A;  4YEJ A;  3B8Y A;  4W8S A;  3VMW A;  3B4N A;  1O8G A;  4URR A;  4XOR A;  4C2L A;  2O04 A;  4W8R A;  1X0C A;  2QY1 A;  4NK6 A;  4U49 A;  4XN3 A;  4NK8 A;  1OGO X;  4OZZ A;  2X6Y A;  2INU A;  3KRG A;  1DBO A;  2PEC A;  1O8K A;  1OGM X;  2BSP A;  2UVF A;  3T9G A;  3VMV A;  2O0W A;  2NTQ A;  2NT6 A;  3VST A;  1PE9 A;  1O8L A;  4Z06 A;  2INV A;  4XLH A;  1KTW A;  1O8J A;  2PYG A;  2QX3 A;  2VBM A;  1BHE A;  2VBE A;  3EQN A;  1XG2 A;  4I84 A;  2UVE A;  1K5C A;  3ZSC A;  3GQ9 A;  1HG8 A;  1OFL A; 
#chains in the Genus database with same CATH topology
 3SUC A;  3VSU A;  2BX6 A;  1O8E A;  2XTX A;  4XLF A;  2XTW A;  5DNS A;  1GQ8 A;  2O17 A;  1RMG A;  1PXZ A;  1OOC A;  4OJL A;  2YUH A;  2VFP A;  2XC1 A;  3DU1 X;  1DAB A;  1VBL A;  1EA0 A;  3ZPP A;  2QXZ A;  3UW0 A;  1TYV A;  3WWG A;  1WXR A;  1EZG A;  3NB2 A;  4YC5 A;  4YDT A;  2NSP A;  4XKW A;  3EQO A;  4XMY A;  4XN0 A;  4Z03 A;  1QCX A;  1TYW A;  1KCC A;  2BM5 A;  3LMW A;  4XOT A;  4U4B A;  3GRH A;  2QZA A;  4XM3 A;  2IQ7 A;  1IDJ A;  3PSS A;  4YZA A;  2O1D A;  4OJ5 A;  1L1I A;  2VBK A;  2ODL A;  2PYH A;  4XLA A;  2BM6 A;  4V02 C;  1OFM A;  1QRC A;  2VFM A;  5C1E A;  4XLC A;  1JRG A;  4XNF A;  4OJ6 A;  3VSV A;  4YEL A;  4Z05 A;  2Z8G A;  1RU4 A;  3JUR A;  2J8I A;  4XKV A;  4AVZ A;  3N90 A;  2VJJ A;  3JX8 A;  1JTA A;  1CLW A;  2NST A;  4OZY A;  4YCQ A;  1H80 A;  1O8I A;  1BN8 A;  1RWR A;  4W8T A;  3GQA A;  2V5I A;  4OJO A;  2XT2 A;  4YZQ A;  4EW9 A;  1QA3 A;  1KQ5 A;  1O8M A;  1AIR A;  1EE6 A;  4XQF A;  2X85 A;  2EWE A;  2J8K A;  2W7Z A;  2NTP A;  1TYX A;  4W8Q A;  4XLE A;  2X6X A;  4YZX A;  3LJY A;  1WMR A;  2VJI A;  2X6W A;  4XOP A;  1IDK A;  2X3H A;  4HWV A;  4JRA C;  1K8F A;  4XR6 A;  1CZF A;  1QQ1 A;  1KCD A;  1QJV A;  3SQV A;  4KH3 A;  1O8D A;  4PMH A;  1O8H A;  2XTY A;  4YZ0 A;  2NZM A;  1O8F A;  4YFO A;  3BH7 B;  4XON A;  4XL9 A;  2NT9 A;  1DBG A;  2QYU A;  4MXN A;  5C1C A;  1TYU A;  2VFO A;  3ML3 A;  5JLV C;  1PLU A;  1OFD A;  2VFQ A;  3LYC A;  3PSZ A;  2NTB A;  4MR0 A;  1IA5 A;  1NHC A;  3AK5 A;  2O0V A;  1O88 A;  4OJP A;  3SYJ A;  1HF2 A;  3FY3 A;  3GQ7 A;  5AMV A;  2BM7 A;  3GQ8 A;  3B90 A;  4YEJ A;  3TH0 A;  3SY2 A;  3B8Y A;  2O6W A;  4W8S A;  3VMW A;  3NAW A;  2B0R A;  3B4N A;  1LLZ A;  1O8G A;  4URR A;  3RIQ A;  1IB4 A;  1QA2 A;  4XOR A;  4C2L A;  2O04 A;  4W8R A;  1X0C A;  2QY1 A;  4NK6 A;  4U49 A;  1OFE A;  4NK8 A;  4XN3 A;  1OGO X;  4OZZ A;  2X6Y A;  2INU A;  4OM9 A;  4OPW A;  2F3L A;  3KRG A;  1DBO A;  2PEC A;  4YEI A;  2BM4 A;  1O8K A;  1OGM X;  2BSP A;  2UVF A;  5JMC B;  3T9G A;  3VMV A;  2O0W A;  2NTQ A;  2XT4 A;  3PET A;  1TSP A;  2NT6 A;  3VST A;  1PE9 A;  3P4G A;  1O8L A;  4Z06 A;  2INV A;  4XLH A;  1KTW A;  2VFN A;  1K4Z A;  1O8J A;  2PYG A;  2QX3 A;  2VBM A;  1BHE A;  2VBE A;  1QRB A;  3H09 A;  3EQN A;  1XG2 A;  4I84 A;  2UVE A;  1QA1 A;  3SZE A;  1LM1 A;  1K5C A;  2G0Y A;  3N6Z A;  3ZSC A;  3GQ9 A;  3BH6 B;  1HG8 A;  1LLW A;  1OFL A;  2IOU G; 
#chains in the Genus database with same CATH homology
 3SUC A;  3VSU A;  1O8E A;  4XLF A;  1GQ8 A;  2O17 A;  1RMG A;  1PXZ A;  1OOC A;  4OJL A;  1VBL A;  3ZPP A;  2QXZ A;  3UW0 A;  3WWG A;  2NSP A;  4XKW A;  3EQO A;  4XMY A;  4XN0 A;  4Z03 A;  1QCX A;  1KCC A;  3LMW A;  4XOT A;  4U4B A;  3GRH A;  4XM3 A;  2IQ7 A;  1IDJ A;  4YZA A;  2O1D A;  4OJ5 A;  2VBK A;  2ODL A;  2PYH A;  4XLA A;  1OFM A;  5C1E A;  4XLC A;  1JRG A;  4XNF A;  4OJ6 A;  3VSV A;  4YEL A;  4Z05 A;  2Z8G A;  1RU4 A;  3JUR A;  4XKV A;  4AVZ A;  2VJJ A;  1JTA A;  2NST A;  4OZY A;  1H80 A;  1O8I A;  1BN8 A;  1RWR A;  4W8T A;  3GQA A;  4OJO A;  4YZQ A;  1IB4 A;  4EW9 A;  1O8M A;  1AIR A;  1EE6 A;  4XQF A;  2X85 A;  2EWE A;  2NTP A;  4W8Q A;  4XLE A;  4YZX A;  2X6X A;  1WMR A;  2VJI A;  2X6W A;  4XOP A;  1IDK A;  2X3H A;  4HWV A;  4XR6 A;  1CZF A;  1KCD A;  1QJV A;  1O8D A;  4PMH A;  1O8H A;  4YZ0 A;  2NZM A;  1O8F A;  4XON A;  4XL9 A;  2NT9 A;  1DBG A;  4MXN A;  5C1C A;  1PLU A;  1NHC A;  4MR0 A;  2NTB A;  1IA5 A;  2O0V A;  1O88 A;  4OJP A;  3FY3 A;  3GQ7 A;  5AMV A;  3GQ8 A;  3B90 A;  4YEJ A;  3B8Y A;  4W8S A;  3VMW A;  3B4N A;  1O8G A;  4URR A;  4XOR A;  4C2L A;  2O04 A;  4W8R A;  1X0C A;  2QY1 A;  4NK6 A;  4U49 A;  4XN3 A;  4NK8 A;  1OGO X;  4OZZ A;  2X6Y A;  2INU A;  3KRG A;  1DBO A;  2PEC A;  1O8K A;  1OGM X;  2BSP A;  2UVF A;  3T9G A;  3VMV A;  2O0W A;  2NTQ A;  2NT6 A;  3VST A;  1PE9 A;  1O8L A;  4Z06 A;  2INV A;  4XLH A;  1KTW A;  1O8J A;  2PYG A;  2QX3 A;  2VBM A;  1BHE A;  2VBE A;  3EQN A;  1XG2 A;  4I84 A;  2UVE A;  1K5C A;  3ZSC A;  3GQ9 A;  1HG8 A;  1OFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...