3ML3A

Crystal structure of the icsa autochaperone region
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
b'PRGSHMSGTVLINNINAPFLPDPVIVTGNMTLEKNGHVILNNSSSNVGQTYVQKGNWHGKGGILSLGAVLGNDNSKTDRLEIAGHASGITYVAVTNEGGSGDKTLEGVQIISTDSSDKNAFIQKGRIVAGSYDYRLKQGTASGLNTNKWYLTSQMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein icsA autotransporter
publication title Crystal Structure of the Autochaperone Region from the Shigella flexneri Autotransporter IcsA
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Protein transport
total genus 48
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03212 Pertactin Pertactin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.20 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3ml3A00
1TYVA 3RIQA 1QRBA 1TYWA 2VFMA 2VFNA 3TH0A 1CLWA 4KH3A 1WXRA 1DABA 2VFOA 1QA1A 2VFPA 2IOUG 1QA3A 1TYUA 3SYJA 1QQ1A 3SZEA 3ML3A 2V5IA 2XC1A 1TSPA 1QRCA 3H09A 3AK5A 1TYXA 1QA2A 2VFQA 4OM9A
chains in the Genus database with same CATH superfamily
4Z03A 2UVFA 4OJLA 1O8DA 1QRBA 4MXNA 1TYWA 4XNFA 3SUCA 4W8RA 3ZPPA 2W7ZA 1BN8A 2VFNA 3BH7B 2XTYA 4YC5A 5DNSA 3B4NA 3ZSCA 1CLWA 1O8LA 1X0CA 4KH3A 3P4GA 4XOTA 1PXZA 4YZXA 1DABA 4YELA 2O0VA 1RWRA 1JRGA 3WWGA 1WMRA 1O8GA 1HF2A 1QCXA 2BM4A 2BM6A 2XTWA 3VSTA 2BX6A 4XLEA 1QA3A 4XONA 2EWEA 3EQNA 1PE9A 1QQ1A 4XMYA 4XORA 3SZEA 3ML3A 1QRCA 3PSZA 4U49A 4AVZA 1KCDA 5JLVC 4OZZA 4URRA 1OFEA 1AIRA 1KTWA 1OGOX 2QZAA 3PSSA 1O8KA 3N90A 4OM9A 1OOCA 2QYUA 2NTPA 4XN3A 3T9GA 1CZFA 3GRHA 3RIQA 5C1CA 4YEJA 1KQ5A 2NSPA 1O8JA 1L1IA 1WXRA 1LLWA 2NZMA 1EZGA 5C1EA 3JURA 4OZYA 4XLAA 3N6ZA 4XOPA 4HWVA 2QX3A 2X6YA 4OPWA 3VSUA 2J8KA 2VFPA 4NK6A 3GQ8A 3VMVA 3EQOA 2X6XA 3LMWA 4XN0A 1TYUA 3SQVA 1OFLA 3SY2A 4OJOA 4YCQA 2V5IA 2XC1A 2O17A 2YUHA 1O8HA 4XLFA 1IA5A 1IB4A 3B8YA 5JMCB 1OGMX 2O6WA 2VBKA 2VFQA 3FY3A 1QA2A 2J8IA 1K5CA 4XQFA 3GQAA 4YZQA 1OFMA 3PETA 4V02C 3GQ9A 4W8SA 4EW9A 1EA0A 2QXZA 4YZAA 2NSTA 1O8FA 2VFMA 1DBOA 4MR0A 2F3LA 3TH0A 1KCCA 2VBEA 2X6WA 1PLUA 1O8IA 3KRGA 2XT2A 1O8EA 4YEIA 1VBLA 4YFOA 4XKVA 4XM3A 1H80A 3NB2A 1LM1A 1IDJA 2INVA 2NTQA 3DU1X 4XKWA 4XLHA 3VSVA 4Z05A 4OJ6A 4W8TA 2ODLA 1K8FA 1TSPA 3NAWA 4PMHA 1TYXA 4NK8A 4YZ0A 4OJ5A 2O04A 4Z06A 3SYJA 2XTXA 2O0WA 1TYVA 2NTBA 4W8QA 2QY1A 1RU4A 4XLCA 1DBGA 2PECA 1EE6A 2XT4A 1NHCA 3UW0A 2G0YA 1JTAA 2IQ7A 2VJJA 2X85A 1RMGA 4YDTA 3B90A 4I84A 2UVEA 2BM7A 2VFOA 2Z8GA 1O8MA 2VJIA 1QA1A 1K4ZA 1HG8A 1BHEA 3BH6B 4U4BA 3VMWA 2INUA 4OJPA 1IDKA 1QJVA 4JRAC 3GQ7A 2X3HA 4C2LA 2IOUG 2O1DA 2PYHA 5AMVA 2B0RA 2NT9A 3LJYA 4XR6A 2VBMA 1OFDA 3JX8A 3AK5A 3H09A 2PYGA 4XL9A 2NT6A 1GQ8A 1O88A 1XG2A 1LLZA 2BSPA 2BM5A 3LYCA
chains in the Genus database with same CATH topology
1TYVA 4V02C 3PETA 3RIQA 4OJLA 1QRBA 1TYWA 2VFMA 2W7ZA 2VFNA 3BH7B 2F3LA 1KQ5A 2G0YA 3TH0A 1CLWA 4KH3A 1WXRA 3P4GA 1DABA 2BM7A 2VFOA 3N6ZA 1QA1A 1K4ZA 3BH6B 4OPWA 3N90A 4OJPA 2BM4A 1HF2A 2BM6A 2VFPA 4JRAC 2BX6A 2IOUG 4OJ6A 4OM9A 1QA3A 1TYUA 2B0RA 3LJYA 3SYJA 1QQ1A 4OJOA 3JX8A 3SZEA 1TSPA 1QRCA 1K8FA 2V5IA 2XC1A 2YUHA 3H09A 3ML3A 3AK5A 5JMCB 1TYXA 5JLVC 1QA2A 2VFQA 2J8IA 4OJ5A 2BM5A 3LYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYV A;  3RIQ A;  1QRB A;  1TYW A;  2VFM A;  2VFN A;  3TH0 A;  1CLW A;  4KH3 A;  1WXR A;  1DAB A;  2VFO A;  1QA1 A;  2VFP A;  2IOU G;  1QA3 A;  1TYU A;  3SYJ A;  1QQ1 A;  3SZE A;  3ML3 A;  2V5I A;  2XC1 A;  1TSP A;  1QRC A;  3H09 A;  3AK5 A;  1TYX A;  1QA2 A;  2VFQ A;  4OM9 A; 
#chains in the Genus database with same CATH topology
 4Z03 A;  2UVF A;  4OJL A;  1O8D A;  1QRB A;  4MXN A;  1TYW A;  4XNF A;  3SUC A;  4W8R A;  3ZPP A;  2W7Z A;  1BN8 A;  2VFN A;  3BH7 B;  2XTY A;  4YC5 A;  5DNS A;  3B4N A;  3ZSC A;  1CLW A;  1O8L A;  1X0C A;  4KH3 A;  3P4G A;  4XOT A;  1PXZ A;  4YZX A;  1DAB A;  4YEL A;  2O0V A;  1RWR A;  1JRG A;  3WWG A;  1WMR A;  1O8G A;  1HF2 A;  1QCX A;  2BM4 A;  2BM6 A;  2XTW A;  3VST A;  2BX6 A;  4XLE A;  1QA3 A;  4XON A;  2EWE A;  3EQN A;  1PE9 A;  1QQ1 A;  4XMY A;  4XOR A;  3SZE A;  3ML3 A;  1QRC A;  3PSZ A;  4U49 A;  4AVZ A;  1KCD A;  5JLV C;  4OZZ A;  4URR A;  1OFE A;  1AIR A;  1KTW A;  1OGO X;  2QZA A;  3PSS A;  1O8K A;  3N90 A;  4OM9 A;  1OOC A;  2QYU A;  2NTP A;  4XN3 A;  3T9G A;  1CZF A;  3GRH A;  3RIQ A;  5C1C A;  4YEJ A;  1KQ5 A;  2NSP A;  1O8J A;  1L1I A;  1WXR A;  1LLW A;  2NZM A;  1EZG A;  5C1E A;  3JUR A;  4OZY A;  4XLA A;  3N6Z A;  4XOP A;  4HWV A;  2QX3 A;  2X6Y A;  4OPW A;  3VSU A;  2J8K A;  2VFP A;  4NK6 A;  3GQ8 A;  3VMV A;  3EQO A;  2X6X A;  3LMW A;  4XN0 A;  1TYU A;  3SQV A;  1OFL A;  3SY2 A;  4OJO A;  4YCQ A;  2V5I A;  2XC1 A;  2O17 A;  2YUH A;  1O8H A;  4XLF A;  1IA5 A;  1IB4 A;  3B8Y A;  5JMC B;  1OGM X;  2O6W A;  2VBK A;  2VFQ A;  3FY3 A;  1QA2 A;  2J8I A;  1K5C A;  4XQF A;  3GQA A;  4YZQ A;  1OFM A;  3PET A;  4V02 C;  3GQ9 A;  4W8S A;  4EW9 A;  1EA0 A;  2QXZ A;  4YZA A;  2NST A;  1O8F A;  2VFM A;  1DBO A;  4MR0 A;  2F3L A;  3TH0 A;  1KCC A;  2VBE A;  2X6W A;  1PLU A;  1O8I A;  3KRG A;  2XT2 A;  1O8E A;  4YEI A;  1VBL A;  4YFO A;  4XKV A;  4XM3 A;  1H80 A;  3NB2 A;  1LM1 A;  1IDJ A;  2INV A;  2NTQ A;  3DU1 X;  4XKW A;  4XLH A;  3VSV A;  4Z05 A;  4OJ6 A;  4W8T A;  2ODL A;  1K8F A;  1TSP A;  3NAW A;  4PMH A;  1TYX A;  4NK8 A;  4YZ0 A;  4OJ5 A;  2O04 A;  4Z06 A;  3SYJ A;  2XTX A;  2O0W A;  1TYV A;  2NTB A;  4W8Q A;  2QY1 A;  1RU4 A;  4XLC A;  1DBG A;  2PEC A;  1EE6 A;  2XT4 A;  1NHC A;  3UW0 A;  2G0Y A;  1JTA A;  2IQ7 A;  2VJJ A;  2X85 A;  1RMG A;  4YDT A;  3B90 A;  4I84 A;  2UVE A;  2BM7 A;  2VFO A;  2Z8G A;  1O8M A;  2VJI A;  1QA1 A;  1K4Z A;  1HG8 A;  1BHE A;  3BH6 B;  4U4B A;  3VMW A;  2INU A;  4OJP A;  1IDK A;  1QJV A;  4JRA C;  3GQ7 A;  2X3H A;  4C2L A;  2IOU G;  2O1D A;  2PYH A;  5AMV A;  2B0R A;  2NT9 A;  3LJY A;  4XR6 A;  2VBM A;  1OFD A;  3JX8 A;  3AK5 A;  3H09 A;  2PYG A;  4XL9 A;  2NT6 A;  1GQ8 A;  1O88 A;  1XG2 A;  1LLZ A;  2BSP A;  2BM5 A;  3LYC A; 
#chains in the Genus database with same CATH homology
 1TYV A;  4V02 C;  3PET A;  3RIQ A;  4OJL A;  1QRB A;  1TYW A;  2VFM A;  2W7Z A;  2VFN A;  3BH7 B;  2F3L A;  1KQ5 A;  2G0Y A;  3TH0 A;  1CLW A;  4KH3 A;  1WXR A;  3P4G A;  1DAB A;  2BM7 A;  2VFO A;  3N6Z A;  1QA1 A;  1K4Z A;  3BH6 B;  4OPW A;  3N90 A;  4OJP A;  2BM4 A;  1HF2 A;  2BM6 A;  2VFP A;  4JRA C;  2BX6 A;  2IOU G;  4OJ6 A;  4OM9 A;  1QA3 A;  1TYU A;  2B0R A;  3LJY A;  3SYJ A;  1QQ1 A;  4OJO A;  3JX8 A;  3SZE A;  1TSP A;  1QRC A;  1K8F A;  2V5I A;  2XC1 A;  2YUH A;  3H09 A;  3ML3 A;  3AK5 A;  5JMC B;  1TYX A;  5JLV C;  1QA2 A;  2VFQ A;  2J8I A;  4OJ5 A;  2BM5 A;  3LYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...