3ML3A

Crystal structure of the icsa autochaperone region
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
PRGSHMSGTVLINNINAPFLPDPVIVTGNMTLEKNGHVILNNSSSNVGQTYVQKGNWHGKGGILSLGAVLGNDNSKTDRLEIAGHASGITYVAVTNEGGSGDKTLEGVQIISTDSSDKNAFIQKGRIVAGSYDYRLKQGTASGLNTNKWYLTSQMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Autochaperone Region from the Shigella flexneri Autotransporter IcsA
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Protein transport
molecule keywords Outer membrane protein icsA autotransporter
total genus 48
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03212 Pertactin Pertactin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.20 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3ml3A00
1TYXA 1WXRA 1DABA 3ML3A 2V5IA 1TYVA 2VFOA 3AK5A 1QRCA 2VFNA 2IOUG 1TYWA 2VFPA 3SYJA 1QA2A 1QRBA 3H09A 2VFMA 1QA1A 1QA3A 1CLWA 4KH3A 1QQ1A 3TH0A 1TSPA 3SZEA 3RIQA 4OM9A 2XC1A 1TYUA 2VFQA
chains in the Genus database with same CATH superfamily
3NB2A 2X6YA 1WXRA 2NTBA 5DNSA 1O8EA 2BM7A 2V5IA 1PXZA 1IA5A 1KCCA 2G0YA 3B4NA 1OGMX 2VJJA 2YUHA 3AK5A 2J8IA 2F3LA 4YFOA 2VFNA 1TYWA 3KRGA 2BSPA 4W8QA 4XLEA 1OFDA 3SQVA 4OJLA 1K8FA 1K4ZA 2X85A 4Z05A 3H09A 3P4GA 1QA3A 3PSSA 4XLFA 1QQ1A 2ODLA 3B8YA 2O04A 3TH0A 1RWRA 3UW0A 4W8SA 3JX8A 4XKVA 2W7ZA 4XLCA 1BN8A 4PMHA 3VMWA 1KCDA 2QX3A 2NZMA 5C1EA 4HWVA 4XLHA 2XT4A 1DABA 2IQ7A 3LJYA 4XN3A 1TYXA 3NAWA 2B0RA 4Z06A 5C1CA 1RMGA 3ML3A 1IDJA 4YELA 3ZSCA 4XQFA 1IDKA 2UVEA 2VBEA 2O0WA 1NHCA 1JTAA 3EQOA 3N90A 3B90A 4OJ5A 1O8HA 3LMWA 3SY2A 2VFMA 2VJIA 2XTWA 2O0VA 1KQ5A 3PETA 4V02C 4XKWA 4OJ6A 4YDTA 1L1IA 4Z03A 3RIQA 3DU1X 1OOCA 4XOPA 4YCQA 4NK6A 1EZGA 4I84A 3SUCA 3VSVA 2X3HA 1O8JA 2PYHA 4XNFA 1K5CA 1TYUA 1OFEA 4OPWA 1VBLA 4OZYA 3VSTA 2VBMA 1IB4A 4W8TA 2INVA 4XONA 2QZAA 3T9GA 2J8KA 4XN0A 2NSPA 2NTPA 3EQNA 5AMVA 1QRCA 3GQ8A 2O1DA 3GQ7A 1X0CA 2IOUG 2XTYA 2PECA 1O8FA 1EE6A 3GQAA 4YEIA 2NT9A 1O8GA 1QA2A 3LYCA 3WWGA 1RU4A 2VBKA 2BM5A 3VMVA 3N6ZA 1HG8A 2QXZA 2QY1A 4XL9A 4U4BA 1O8DA 2NSTA 2Z8GA 3SZEA 4OM9A 1O8LA 2X6XA 4YZAA 2NTQA 4XR6A 1JRGA 1O88A 1PLUA 1DBGA 2BM4A 4JRAC 4U49A 4OJPA 4YZQA 1QCXA 1AIRA 4MXNA 2O6WA 4YC5A 4MR0A 2VFQA 4URRA 2XT2A 4AVZA 1KTWA 1O8KA 1XG2A 4YZ0A 4OJOA 1OGOX 2X6WA 4XLAA 1EA0A 3VSUA 3JURA 1TYVA 1H80A 2VFOA 4XOTA 3BH6B 4EW9A 1O8IA 1BHEA 2XTXA 2UVFA 3GQ9A 3SYJA 2VFPA 4XORA 4YEJA 3BH7B 1O8MA 1LM1A 1QJVA 2BX6A 4W8RA 4OZZA 2QYUA 1QRBA 3PSZA 1DBOA 2PYGA 5JMCB 1QA1A 1WMRA 1OFLA 1GQ8A 2EWEA 4XM3A 1CLWA 4KH3A 3ZPPA 1CZFA 2NT6A 4YZXA 1TSPA 2O17A 5JLVC 3FY3A 4XMYA 2BM6A 2XC1A 1LLWA 3GRHA 1HF2A 1PE9A 2INUA 1OFMA 1LLZA 4C2LA 4NK8A
chains in the Genus database with same CATH topology
3LJYA 1TYXA 1WXRA 4OJOA 2BM7A 2B0RA 1DABA 3ML3A 2V5IA 1TYVA 2VFOA 2G0YA 3BH6B 2YUHA 1QRCA 3AK5A 2J8IA 2F3LA 2VFNA 2IOUG 1TYWA 2VFPA 3SYJA 1QA2A 3N90A 3LYCA 3BH7B 4OJLA 1K8FA 1K4ZA 2BM5A 2BX6A 4OJ5A 3N6ZA 1QRBA 3H09A 2VFMA 3P4GA 5JMCB 1QA1A 1QA3A 1KQ5A 3PETA 1CLWA 4KH3A 4V02C 1QQ1A 3TH0A 5JLVC 4OJ6A 1TSPA 3SZEA 3RIQA 4OM9A 2BM6A 2XC1A 3JX8A 2W7ZA 2BM4A 1HF2A 4JRAC 4OJPA 1TYUA 4OPWA 2VFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYX A;  1WXR A;  1DAB A;  3ML3 A;  2V5I A;  1TYV A;  2VFO A;  3AK5 A;  1QRC A;  2VFN A;  2IOU G;  1TYW A;  2VFP A;  3SYJ A;  1QA2 A;  1QRB A;  3H09 A;  2VFM A;  1QA1 A;  1QA3 A;  1CLW A;  4KH3 A;  1QQ1 A;  3TH0 A;  1TSP A;  3SZE A;  3RIQ A;  4OM9 A;  2XC1 A;  1TYU A;  2VFQ A; 
#chains in the Genus database with same CATH topology
 3NB2 A;  2X6Y A;  1WXR A;  2NTB A;  5DNS A;  1O8E A;  2BM7 A;  2V5I A;  1PXZ A;  1IA5 A;  1KCC A;  2G0Y A;  3B4N A;  1OGM X;  2VJJ A;  2YUH A;  3AK5 A;  2J8I A;  2F3L A;  4YFO A;  2VFN A;  1TYW A;  3KRG A;  2BSP A;  4W8Q A;  4XLE A;  1OFD A;  3SQV A;  4OJL A;  1K8F A;  1K4Z A;  2X85 A;  4Z05 A;  3H09 A;  3P4G A;  1QA3 A;  3PSS A;  4XLF A;  1QQ1 A;  2ODL A;  3B8Y A;  2O04 A;  3TH0 A;  1RWR A;  3UW0 A;  4W8S A;  3JX8 A;  4XKV A;  2W7Z A;  4XLC A;  1BN8 A;  4PMH A;  3VMW A;  1KCD A;  2QX3 A;  2NZM A;  5C1E A;  4HWV A;  4XLH A;  2XT4 A;  1DAB A;  2IQ7 A;  3LJY A;  4XN3 A;  1TYX A;  3NAW A;  2B0R A;  4Z06 A;  5C1C A;  1RMG A;  3ML3 A;  1IDJ A;  4YEL A;  3ZSC A;  4XQF A;  1IDK A;  2UVE A;  2VBE A;  2O0W A;  1NHC A;  1JTA A;  3EQO A;  3N90 A;  3B90 A;  4OJ5 A;  1O8H A;  3LMW A;  3SY2 A;  2VFM A;  2VJI A;  2XTW A;  2O0V A;  1KQ5 A;  3PET A;  4V02 C;  4XKW A;  4OJ6 A;  4YDT A;  1L1I A;  4Z03 A;  3RIQ A;  3DU1 X;  1OOC A;  4XOP A;  4YCQ A;  4NK6 A;  1EZG A;  4I84 A;  3SUC A;  3VSV A;  2X3H A;  1O8J A;  2PYH A;  4XNF A;  1K5C A;  1TYU A;  1OFE A;  4OPW A;  1VBL A;  4OZY A;  3VST A;  2VBM A;  1IB4 A;  4W8T A;  2INV A;  4XON A;  2QZA A;  3T9G A;  2J8K A;  4XN0 A;  2NSP A;  2NTP A;  3EQN A;  5AMV A;  1QRC A;  3GQ8 A;  2O1D A;  3GQ7 A;  1X0C A;  2IOU G;  2XTY A;  2PEC A;  1O8F A;  1EE6 A;  3GQA A;  4YEI A;  2NT9 A;  1O8G A;  1QA2 A;  3LYC A;  3WWG A;  1RU4 A;  2VBK A;  2BM5 A;  3VMV A;  3N6Z A;  1HG8 A;  2QXZ A;  2QY1 A;  4XL9 A;  4U4B A;  1O8D A;  2NST A;  2Z8G A;  3SZE A;  4OM9 A;  1O8L A;  2X6X A;  4YZA A;  2NTQ A;  4XR6 A;  1JRG A;  1O88 A;  1PLU A;  1DBG A;  2BM4 A;  4JRA C;  4U49 A;  4OJP A;  4YZQ A;  1QCX A;  1AIR A;  4MXN A;  2O6W A;  4YC5 A;  4MR0 A;  2VFQ A;  4URR A;  2XT2 A;  4AVZ A;  1KTW A;  1O8K A;  1XG2 A;  4YZ0 A;  4OJO A;  1OGO X;  2X6W A;  4XLA A;  1EA0 A;  3VSU A;  3JUR A;  1TYV A;  1H80 A;  2VFO A;  4XOT A;  3BH6 B;  4EW9 A;  1O8I A;  1BHE A;  2XTX A;  2UVF A;  3GQ9 A;  3SYJ A;  2VFP A;  4XOR A;  4YEJ A;  3BH7 B;  1O8M A;  1LM1 A;  1QJV A;  2BX6 A;  4W8R A;  4OZZ A;  2QYU A;  1QRB A;  3PSZ A;  1DBO A;  2PYG A;  5JMC B;  1QA1 A;  1WMR A;  1OFL A;  1GQ8 A;  2EWE A;  4XM3 A;  1CLW A;  4KH3 A;  3ZPP A;  1CZF A;  2NT6 A;  4YZX A;  1TSP A;  2O17 A;  5JLV C;  3FY3 A;  4XMY A;  2BM6 A;  2XC1 A;  1LLW A;  3GRH A;  1HF2 A;  1PE9 A;  2INU A;  1OFM A;  1LLZ A;  4C2L A;  4NK8 A; 
#chains in the Genus database with same CATH homology
 3LJY A;  1TYX A;  1WXR A;  4OJO A;  2BM7 A;  2B0R A;  1DAB A;  3ML3 A;  2V5I A;  1TYV A;  2VFO A;  2G0Y A;  3BH6 B;  2YUH A;  1QRC A;  3AK5 A;  2J8I A;  2F3L A;  2VFN A;  2IOU G;  1TYW A;  2VFP A;  3SYJ A;  1QA2 A;  3N90 A;  3LYC A;  3BH7 B;  4OJL A;  1K8F A;  1K4Z A;  2BM5 A;  2BX6 A;  4OJ5 A;  3N6Z A;  1QRB A;  3H09 A;  2VFM A;  3P4G A;  5JMC B;  1QA1 A;  1QA3 A;  1KQ5 A;  3PET A;  1CLW A;  4KH3 A;  4V02 C;  1QQ1 A;  3TH0 A;  5JLV C;  4OJ6 A;  1TSP A;  3SZE A;  3RIQ A;  4OM9 A;  2BM6 A;  2XC1 A;  3JX8 A;  2W7Z A;  2BM4 A;  1HF2 A;  4JRA C;  4OJP A;  1TYU A;  4OPW A;  2VFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...