3ML3A

Crystal structure of the icsa autochaperone region
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
PRGSHMSGTVLINNINAPFLPDPVIVTGNMTLEKNGHVILNNSSSNVGQTYVQKGNWHGKGGILSLGAVLGNDNSKTDRLEIAGHASGITYVAVTNEGGSGDKTLEGVQIISTDSSDKNAFIQKGRIVAGSYDYRLKQGTASGLNTNKWYLTSQMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein icsA autotransporter
publication title Crystal Structure of the Autochaperone Region from the Shigella flexneri Autotransporter IcsA
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Protein transport
total genus 48
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03212 Pertactin Pertactin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.20 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3ml3A00
1QRBA 1WXRA 3TH0A 3SZEA 3ML3A 1CLWA 1TSPA 1QA1A 1QA2A 2VFOA 1QA3A 3RIQA 1TYUA 3AK5A 1TYWA 1DABA 1TYXA 4KH3A 2VFQA 2IOUG 2VFMA 2VFPA 1QRCA 1TYVA 3SYJA 2V5IA 2XC1A 1QQ1A 4OM9A 3H09A 2VFNA
chains in the Genus database with same CATH superfamily
1QRBA 1AIRA 4EW9A 4YZ0A 2VJIA 3SZEA 2X6YA 1CLWA 4OZYA 1EA0A 2NTPA 4OPWA 3NB2A 2ODLA 1OFMA 2NZMA 1QJVA 2J8IA 2G0YA 2O6WA 2QZAA 2BM5A 4XN3A 2VFOA 1BHEA 2B0RA 1QA3A 3RIQA 3SQVA 3VSVA 4YZAA 2X6WA 3AK5A 3JX8A 4XLFA 1GQ8A 4XNFA 3P4GA 1EE6A 1TYWA 2NT9A 4U49A 3VMVA 2XTWA 4XM3A 4NK6A 2QY1A 5DNSA 4XKWA 1KCCA 2PYHA 4XN0A 2NTQA 2VFMA 3B8YA 2INUA 3N6ZA 2BM7A 4XKVA 5C1CA 2J8KA 1OFDA 3GRHA 2BM6A 2F3LA 4YFOA 4OJ6A 1DBOA 4YEIA 3VSUA 4YZQA 1NHCA 2XT2A 4YDTA 3VMWA 1OGOX 2NT6A 1KCDA 3EQNA 3LJYA 1QCXA 2NTBA 1K5CA 2UVEA 2BX6A 2X85A 4XLCA 1OGMX 1O8EA 4XONA 4OJPA 1PE9A 3ZSCA 1JRGA 1QA2A 1BN8A 1IDJA 4XLEA 4YELA 4PMHA 1O8GA 2O17A 2X3HA 3FY3A 4XORA 4YZXA 1OFLA 3GQ8A 4URRA 1O8IA 2XT4A 3PETA 1DABA 4Z06A 1XG2A 1RMGA 3EQOA 4Z03A 2PYGA 2NSTA 3LMWA 4MR0A 4U4BA 4V02C 2XC1A 1O8DA 1PXZA 2YUHA 3GQ9A 1QQ1A 5C1EA 1EZGA 4Z05A 1RU4A 2VBMA 2VBKA 1O8HA 4YEJA 4AVZA 1RWRA 1JTAA 3KRGA 1OOCA 2O0VA 1OFEA 1O8MA 2O0WA 1K4ZA 1O8KA 1WMRA 1CZFA 2O04A 3NAWA 4HWVA 4XLHA 2XTYA 2O1DA 4XOPA 2QX3A 1QA1A 2UVFA 4OJ5A 4W8SA 3T9GA 1KQ5A 4OJOA 4W8TA 2PECA 2VBEA 3B90A 3PSSA 1O88A 2X6XA 2NSPA 2XTXA 2VFQA 4XR6A 2IOUG 2VFPA 3BH7B 1LM1A 4MXNA 2V5IA 4C2LA 2QXZA 3SUCA 1K8FA 4W8RA 3ZPPA 1LLZA 3VSTA 4XQFA 4YC5A 1O8FA 2VFNA 3H09A 1WXRA 4XL9A 3TH0A 2Z8GA 3LYCA 3ML3A 1HG8A 1VBLA 4XOTA 1H80A 5JMCB 2EWEA 4I84A 1HF2A 4JRAC 3GQ7A 4YCQA 1TSPA 1PLUA 2W7ZA 4XMYA 5AMVA 2BSPA 4NK8A 3B4NA 1TYUA 1DBGA 2BM4A 1IDKA 4OJLA 4XLAA 3WWGA 1O8LA 1KTWA 1TYXA 2QYUA 4KH3A 3BH6B 4W8QA 4OZZA 1IA5A 1IB4A 3GQAA 1LLWA 1QRCA 1TYVA 2IQ7A 3SY2A 3SYJA 3UW0A 1L1IA 1X0CA 1O8JA 3JURA 5JLVC 2INVA 2VJJA 4OM9A 3DU1X 3PSZA 3N90A
chains in the Genus database with same CATH topology
1QRBA 3LJYA 3TH0A 3SZEA 3LYCA 3ML3A 5JMCB 1K4ZA 1CLWA 2BX6A 1HF2A 4JRAC 1TSPA 4OPWA 2W7ZA 4OJPA 2J8IA 1QA1A 2G0YA 4OJ5A 1QA2A 2BM5A 2VFOA 1QA3A 2B0RA 3RIQA 1KQ5A 1TYUA 4OJOA 2BM4A 3AK5A 3JX8A 4OJLA 3P4GA 1TYWA 3PETA 1DABA 1TYXA 4KH3A 3BH6B 2VFQA 2IOUG 2VFMA 3N6ZA 2VFPA 1QRCA 1TYVA 2BM7A 3BH7B 4V02C 3SYJA 2V5IA 2XC1A 2YUHA 2BM6A 1QQ1A 2F3LA 1K8FA 3H09A 4OJ6A 5JLVC 4OM9A 2VFNA 1WXRA 3N90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QRB A;  1WXR A;  3TH0 A;  3SZE A;  3ML3 A;  1CLW A;  1TSP A;  1QA1 A;  1QA2 A;  2VFO A;  1QA3 A;  3RIQ A;  1TYU A;  3AK5 A;  1TYW A;  1DAB A;  1TYX A;  4KH3 A;  2VFQ A;  2IOU G;  2VFM A;  2VFP A;  1QRC A;  1TYV A;  3SYJ A;  2V5I A;  2XC1 A;  1QQ1 A;  4OM9 A;  3H09 A;  2VFN A; 
#chains in the Genus database with same CATH topology
 1QRB A;  1AIR A;  4EW9 A;  4YZ0 A;  2VJI A;  3SZE A;  2X6Y A;  1CLW A;  4OZY A;  1EA0 A;  2NTP A;  4OPW A;  3NB2 A;  2ODL A;  1OFM A;  2NZM A;  1QJV A;  2J8I A;  2G0Y A;  2O6W A;  2QZA A;  2BM5 A;  4XN3 A;  2VFO A;  1BHE A;  2B0R A;  1QA3 A;  3RIQ A;  3SQV A;  3VSV A;  4YZA A;  2X6W A;  3AK5 A;  3JX8 A;  4XLF A;  1GQ8 A;  4XNF A;  3P4G A;  1EE6 A;  1TYW A;  2NT9 A;  4U49 A;  3VMV A;  2XTW A;  4XM3 A;  4NK6 A;  2QY1 A;  5DNS A;  4XKW A;  1KCC A;  2PYH A;  4XN0 A;  2NTQ A;  2VFM A;  3B8Y A;  2INU A;  3N6Z A;  2BM7 A;  4XKV A;  5C1C A;  2J8K A;  1OFD A;  3GRH A;  2BM6 A;  2F3L A;  4YFO A;  4OJ6 A;  1DBO A;  4YEI A;  3VSU A;  4YZQ A;  1NHC A;  2XT2 A;  4YDT A;  3VMW A;  1OGO X;  2NT6 A;  1KCD A;  3EQN A;  3LJY A;  1QCX A;  2NTB A;  1K5C A;  2UVE A;  2BX6 A;  2X85 A;  4XLC A;  1OGM X;  1O8E A;  4XON A;  4OJP A;  1PE9 A;  3ZSC A;  1JRG A;  1QA2 A;  1BN8 A;  1IDJ A;  4XLE A;  4YEL A;  4PMH A;  1O8G A;  2O17 A;  2X3H A;  3FY3 A;  4XOR A;  4YZX A;  1OFL A;  3GQ8 A;  4URR A;  1O8I A;  2XT4 A;  3PET A;  1DAB A;  4Z06 A;  1XG2 A;  1RMG A;  3EQO A;  4Z03 A;  2PYG A;  2NST A;  3LMW A;  4MR0 A;  4U4B A;  4V02 C;  2XC1 A;  1O8D A;  1PXZ A;  2YUH A;  3GQ9 A;  1QQ1 A;  5C1E A;  1EZG A;  4Z05 A;  1RU4 A;  2VBM A;  2VBK A;  1O8H A;  4YEJ A;  4AVZ A;  1RWR A;  1JTA A;  3KRG A;  1OOC A;  2O0V A;  1OFE A;  1O8M A;  2O0W A;  1K4Z A;  1O8K A;  1WMR A;  1CZF A;  2O04 A;  3NAW A;  4HWV A;  4XLH A;  2XTY A;  2O1D A;  4XOP A;  2QX3 A;  1QA1 A;  2UVF A;  4OJ5 A;  4W8S A;  3T9G A;  1KQ5 A;  4OJO A;  4W8T A;  2PEC A;  2VBE A;  3B90 A;  3PSS A;  1O88 A;  2X6X A;  2NSP A;  2XTX A;  2VFQ A;  4XR6 A;  2IOU G;  2VFP A;  3BH7 B;  1LM1 A;  4MXN A;  2V5I A;  4C2L A;  2QXZ A;  3SUC A;  1K8F A;  4W8R A;  3ZPP A;  1LLZ A;  3VST A;  4XQF A;  4YC5 A;  1O8F A;  2VFN A;  3H09 A;  1WXR A;  4XL9 A;  3TH0 A;  2Z8G A;  3LYC A;  3ML3 A;  1HG8 A;  1VBL A;  4XOT A;  1H80 A;  5JMC B;  2EWE A;  4I84 A;  1HF2 A;  4JRA C;  3GQ7 A;  4YCQ A;  1TSP A;  1PLU A;  2W7Z A;  4XMY A;  5AMV A;  2BSP A;  4NK8 A;  3B4N A;  1TYU A;  1DBG A;  2BM4 A;  1IDK A;  4OJL A;  4XLA A;  3WWG A;  1O8L A;  1KTW A;  1TYX A;  2QYU A;  4KH3 A;  3BH6 B;  4W8Q A;  4OZZ A;  1IA5 A;  1IB4 A;  3GQA A;  1LLW A;  1QRC A;  1TYV A;  2IQ7 A;  3SY2 A;  3SYJ A;  3UW0 A;  1L1I A;  1X0C A;  1O8J A;  3JUR A;  5JLV C;  2INV A;  2VJJ A;  4OM9 A;  3DU1 X;  3PSZ A;  3N90 A; 
#chains in the Genus database with same CATH homology
 1QRB A;  3LJY A;  3TH0 A;  3SZE A;  3LYC A;  3ML3 A;  5JMC B;  1K4Z A;  1CLW A;  2BX6 A;  1HF2 A;  4JRA C;  1TSP A;  4OPW A;  2W7Z A;  4OJP A;  2J8I A;  1QA1 A;  2G0Y A;  4OJ5 A;  1QA2 A;  2BM5 A;  2VFO A;  1QA3 A;  2B0R A;  3RIQ A;  1KQ5 A;  1TYU A;  4OJO A;  2BM4 A;  3AK5 A;  3JX8 A;  4OJL A;  3P4G A;  1TYW A;  3PET A;  1DAB A;  1TYX A;  4KH3 A;  3BH6 B;  2VFQ A;  2IOU G;  2VFM A;  3N6Z A;  2VFP A;  1QRC A;  1TYV A;  2BM7 A;  3BH7 B;  4V02 C;  3SYJ A;  2V5I A;  2XC1 A;  2YUH A;  2BM6 A;  1QQ1 A;  2F3L A;  1K8F A;  3H09 A;  4OJ6 A;  5JLV C;  4OM9 A;  2VFN A;  1WXR A;  3N90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...