2W7ZA

Structure of the pentapeptide repeat protein efsqnr, a dna gyrase inhibitor. free amines modified by cyclic pentylation with glutaraldehyde.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
211
structure length
200
Chain Sequence
MITYPLPEQLPLLTNCQLEDEAILENHLYQQIDLPNQEVRNLVFRDAVFDHLSLANGQFASFDCSNVRFEACDFSNVEWLSGSFHRVTFLRCNLTGTNFADSYLDCLFEDCADYASFRFANFNLVHFNQTRLVESEFFEVTWLLLEACDLTESNWLNTSLGLDFSQNTFERLTFSPNYLSGLVTPEQAIYLASALGLVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of a Pentapeptide-Repeat Protein by Reductive Cyclic Pentylation of Free Amines with Glutaraldehyde.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Inhibitor
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
total genus 78
structure length 200
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2w7zA00
2BM6A 3N90A 5JLVC 2W7ZA 2BM5A 2J8IA 2G0YA 4JRAC 5JMCB 2F3LA 2BM4A 2BM7A
chains in the Genus database with same CATH superfamily
3SUCA 2VFNA 4XN0A 5C1CA 4YZAA 2B0RA 4I84A 3SY2A 5C1EA 4YC5A 2VBKA 1AIRA 4Z05A 1O8KA 4C2LA 4XLHA 4URRA 1DBOA 2QX3A 3H09A 2O17A 1OOCA 2X6XA 3PSSA 4XLAA 5JLVC 4NK8A 4YZQA 1RMGA 5AMVA 4YZ0A 2XTYA 3WWGA 4OJLA 1VBLA 2VBMA 2VFPA 3LJYA 4OPWA 2X6WA 1O8LA 1CLWA 1OGOX 4W8SA 3GRHA 1BHEA 1X0CA 3SQVA 3KRGA 2XTWA 4MXNA 3VMWA 4EW9A 1XG2A 1L1IA 2QZAA 1O8JA 2BM4A 3EQOA 4W8QA 4XL9A 4YDTA 1TYXA 3VSVA 2VJIA 1CZFA 3GQ8A 4OM9A 1OFLA 2BM5A 4XQFA 2YUHA 2INUA 1KQ5A 1OFDA 1TYUA 2O1DA 1TYVA 3N6ZA 4PMHA 4XLFA 4XLEA 4YELA 3PETA 4OJOA 5DNSA 1EZGA 4OJPA 1PXZA 1IB4A 3N90A 2PYHA 1RWRA 3LYCA 1WXRA 2PECA 4OJ5A 1K5CA 2EWEA 4U49A 3NAWA 1GQ8A 1HG8A 2NT9A 1QA1A 5JMCB 4XM3A 4XOPA 1EE6A 1O8IA 1O8EA 1O8MA 2F3LA 2Z8GA 3VSUA 1IA5A 2V5IA 2NT6A 1NHCA 1QCXA 2W7ZA 3DU1X 1TYWA 1H80A 1LLWA 2XT2A 4MR0A 3BH6B 1WMRA 3GQ9A 3P4GA 2BX6A 4YFOA 4U4BA 3VSTA 2IQ7A 2INVA 2NSPA 4XMYA 4Z06A 1KCCA 1O8HA 2VFOA 2BM6A 2IOUG 3VMVA 2NTPA 2UVFA 1JTAA 4YEJA 4XOTA 3SYJA 4YEIA 1IDJA 2XC1A 2QXZA 2O0WA 2XTXA 4W8TA 1O88A 1JRGA 1KTWA 4XORA 1O8GA 1QA3A 1BN8A 2ODLA 4XKVA 2VFQA 4XR6A 2PYGA 1K8FA 4Z03A 3SZEA 3UW0A 2QY1A 2NTQA 4XKWA 4AVZA 3PSZA 4HWVA 4OJ6A 2QYUA 3B8YA 3GQ7A 1K4ZA 1LM1A 4NK6A 3JURA 2O0VA 4W8RA 2VBEA 3FY3A 4XNFA 4OZYA 1OGMX 3EQNA 4V02C 2O6WA 3LMWA 1QRCA 3GQAA 2G0YA 1DBGA 1OFMA 3ZSCA 4XONA 1DABA 1RU4A 2XT4A 2NTBA 2J8IA 1PLUA 3B4NA 2X6YA 3RIQA 3JX8A 1KCDA 1QRBA 3AK5A 1QJVA 2NSTA 2UVEA 3B90A 4XN3A 2VJJA 4YCQA 3NB2A 3BH7B 1O8DA 2J8KA 4YZXA 3ML3A 4XLCA 2X3HA 1HF2A 3T9GA 1QA2A 2BM7A 1TSPA 4OZZA 1LLZA 2BSPA 2VFMA 2O04A 2X85A 3TH0A 4KH3A 1IDKA 1OFEA 1O8FA 4JRAC 1EA0A 3ZPPA 1QQ1A 2NZMA 1PE9A
chains in the Genus database with same CATH topology
2BM6A 2VFNA 4OJPA 1QRCA 2IOUG 3N90A 2B0RA 2G0YA 3LYCA 1WXRA 4OJ5A 3SYJA 2XC1A 3H09A 1DABA 5JLVC 2J8IA 3RIQA 3JX8A 5JMCB 1QA1A 1QRBA 2F3LA 2VFPA 4OPWA 3LJYA 4OJLA 1QA3A 3AK5A 1CLWA 2V5IA 2VFQA 3SZEA 3BH7B 1K8FA 2W7ZA 1TYWA 3ML3A 4OJ6A 3BH6B 2BM4A 1HF2A 1K4ZA 1QA2A 1TYXA 2BM7A 1TSPA 3P4GA 4OJOA 2VFMA 2BM5A 2BX6A 4OM9A 2YUHA 4KH3A 3TH0A 1KQ5A 3N6ZA 1TYUA 4JRAC 1TYVA 1QQ1A 3PETA 2VFOA 4V02C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM6 A;  3N90 A;  5JLV C;  2W7Z A;  2BM5 A;  2J8I A;  2G0Y A;  4JRA C;  5JMC B;  2F3L A;  2BM4 A;  2BM7 A; 
#chains in the Genus database with same CATH topology
 3SUC A;  2VFN A;  4XN0 A;  5C1C A;  4YZA A;  2B0R A;  4I84 A;  3SY2 A;  5C1E A;  4YC5 A;  2VBK A;  1AIR A;  4Z05 A;  1O8K A;  4C2L A;  4XLH A;  4URR A;  1DBO A;  2QX3 A;  3H09 A;  2O17 A;  1OOC A;  2X6X A;  3PSS A;  4XLA A;  5JLV C;  4NK8 A;  4YZQ A;  1RMG A;  5AMV A;  4YZ0 A;  2XTY A;  3WWG A;  4OJL A;  1VBL A;  2VBM A;  2VFP A;  3LJY A;  4OPW A;  2X6W A;  1O8L A;  1CLW A;  1OGO X;  4W8S A;  3GRH A;  1BHE A;  1X0C A;  3SQV A;  3KRG A;  2XTW A;  4MXN A;  3VMW A;  4EW9 A;  1XG2 A;  1L1I A;  2QZA A;  1O8J A;  2BM4 A;  3EQO A;  4W8Q A;  4XL9 A;  4YDT A;  1TYX A;  3VSV A;  2VJI A;  1CZF A;  3GQ8 A;  4OM9 A;  1OFL A;  2BM5 A;  4XQF A;  2YUH A;  2INU A;  1KQ5 A;  1OFD A;  1TYU A;  2O1D A;  1TYV A;  3N6Z A;  4PMH A;  4XLF A;  4XLE A;  4YEL A;  3PET A;  4OJO A;  5DNS A;  1EZG A;  4OJP A;  1PXZ A;  1IB4 A;  3N90 A;  2PYH A;  1RWR A;  3LYC A;  1WXR A;  2PEC A;  4OJ5 A;  1K5C A;  2EWE A;  4U49 A;  3NAW A;  1GQ8 A;  1HG8 A;  2NT9 A;  1QA1 A;  5JMC B;  4XM3 A;  4XOP A;  1EE6 A;  1O8I A;  1O8E A;  1O8M A;  2F3L A;  2Z8G A;  3VSU A;  1IA5 A;  2V5I A;  2NT6 A;  1NHC A;  1QCX A;  2W7Z A;  3DU1 X;  1TYW A;  1H80 A;  1LLW A;  2XT2 A;  4MR0 A;  3BH6 B;  1WMR A;  3GQ9 A;  3P4G A;  2BX6 A;  4YFO A;  4U4B A;  3VST A;  2IQ7 A;  2INV A;  2NSP A;  4XMY A;  4Z06 A;  1KCC A;  1O8H A;  2VFO A;  2BM6 A;  2IOU G;  3VMV A;  2NTP A;  2UVF A;  1JTA A;  4YEJ A;  4XOT A;  3SYJ A;  4YEI A;  1IDJ A;  2XC1 A;  2QXZ A;  2O0W A;  2XTX A;  4W8T A;  1O88 A;  1JRG A;  1KTW A;  4XOR A;  1O8G A;  1QA3 A;  1BN8 A;  2ODL A;  4XKV A;  2VFQ A;  4XR6 A;  2PYG A;  1K8F A;  4Z03 A;  3SZE A;  3UW0 A;  2QY1 A;  2NTQ A;  4XKW A;  4AVZ A;  3PSZ A;  4HWV A;  4OJ6 A;  2QYU A;  3B8Y A;  3GQ7 A;  1K4Z A;  1LM1 A;  4NK6 A;  3JUR A;  2O0V A;  4W8R A;  2VBE A;  3FY3 A;  4XNF A;  4OZY A;  1OGM X;  3EQN A;  4V02 C;  2O6W A;  3LMW A;  1QRC A;  3GQA A;  2G0Y A;  1DBG A;  1OFM A;  3ZSC A;  4XON A;  1DAB A;  1RU4 A;  2XT4 A;  2NTB A;  2J8I A;  1PLU A;  3B4N A;  2X6Y A;  3RIQ A;  3JX8 A;  1KCD A;  1QRB A;  3AK5 A;  1QJV A;  2NST A;  2UVE A;  3B90 A;  4XN3 A;  2VJJ A;  4YCQ A;  3NB2 A;  3BH7 B;  1O8D A;  2J8K A;  4YZX A;  3ML3 A;  4XLC A;  2X3H A;  1HF2 A;  3T9G A;  1QA2 A;  2BM7 A;  1TSP A;  4OZZ A;  1LLZ A;  2BSP A;  2VFM A;  2O04 A;  2X85 A;  3TH0 A;  4KH3 A;  1IDK A;  1OFE A;  1O8F A;  4JRA C;  1EA0 A;  3ZPP A;  1QQ1 A;  2NZM A;  1PE9 A; 
#chains in the Genus database with same CATH homology
 2BM6 A;  2VFN A;  4OJP A;  1QRC A;  2IOU G;  3N90 A;  2B0R A;  2G0Y A;  3LYC A;  1WXR A;  4OJ5 A;  3SYJ A;  2XC1 A;  3H09 A;  1DAB A;  5JLV C;  2J8I A;  3RIQ A;  3JX8 A;  5JMC B;  1QA1 A;  1QRB A;  2F3L A;  2VFP A;  4OPW A;  3LJY A;  4OJL A;  1QA3 A;  3AK5 A;  1CLW A;  2V5I A;  2VFQ A;  3SZE A;  3BH7 B;  1K8F A;  2W7Z A;  1TYW A;  3ML3 A;  4OJ6 A;  3BH6 B;  2BM4 A;  1HF2 A;  1K4Z A;  1QA2 A;  1TYX A;  2BM7 A;  1TSP A;  3P4G A;  4OJO A;  2VFM A;  2BM5 A;  2BX6 A;  4OM9 A;  2YUH A;  4KH3 A;  3TH0 A;  1KQ5 A;  3N6Z A;  1TYU A;  4JRA C;  1TYV A;  1QQ1 A;  3PET A;  2VFO A;  4V02 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...