2W7ZA

Structure of the pentapeptide repeat protein efsqnr, a dna gyrase inhibitor. free amines modified by cyclic pentylation with glutaraldehyde.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
211
structure length
200
Chain Sequence
MITYPLPEQLPLLTNCQLEDEAILENHLYQQIDLPNQEVRNLVFRDAVFDHLSLANGQFASFDCSNVRFEACDFSNVEWLSGSFHRVTFLRCNLTGTNFADSYLDCLFEDCADYASFRFANFNLVHFNQTRLVESEFFEVTWLLLEACDLTESNWLNTSLGLDFSQNTFERLTFSPNYLSGLVTPEQAIYLASALGLVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of a Pentapeptide-Repeat Protein by Reductive Cyclic Pentylation of Free Amines with Glutaraldehyde.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Inhibitor
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
total genus 78
structure length 200
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2w7zA00
2BM6A 2F3LA 2W7ZA 5JMCB 2J8IA 2BM5A 2BM7A 2G0YA 4JRAC 2BM4A 5JLVC 3N90A
chains in the Genus database with same CATH superfamily
3KRGA 1JTAA 1BHEA 1O88A 1KQ5A 4XN3A 3VSVA 4YEIA 1QA1A 4YC5A 4Z05A 4Z03A 2YUHA 1GQ8A 4AVZA 3LYCA 1QCXA 2IQ7A 1EE6A 1O8IA 5DNSA 3SYJA 3UW0A 1X0CA 2QY1A 4MXNA 2UVFA 3GRHA 3RIQA 2XTXA 1OFDA 3VSUA 3T9GA 1QA3A 3WWGA 3DU1X 2NTPA 2X85A 1KCDA 4XM3A 4YCQA 2INUA 3BH6B 1CLWA 4XL9A 1LM1A 4XLEA 4XOTA 4XNFA 4YEJA 3SUCA 1VBLA 4URRA 1IA5A 2V5IA 2VFOA 1QJVA 2J8KA 4XORA 1WMRA 4OJLA 3NAWA 4XLFA 1IDJA 5C1EA 2NSPA 4YELA 1O8MA 1CZFA 4OJ6A 3P4GA 2NZMA 1KCCA 3PSZA 1XG2A 4I84A 2F3LA 3JX8A 4XR6A 2NSTA 2VJJA 1O8GA 2O17A 1QRBA 4XLHA 5AMVA 2O6WA 1H80A 1TYXA 1IDKA 1EZGA 1RWRA 2EWEA 2O0WA 4U49A 2BM5A 2XT2A 3ZSCA 2BM4A 4U4BA 4YZ0A 2VFPA 4XOPA 1TSPA 3B4NA 4XLAA 4XKWA 1OFLA 2XTWA 4PMHA 1K8FA 4Z06A 3GQ8A 1O8LA 3BH7B 3NB2A 2VBMA 2VFNA 2PECA 1BN8A 1OGMX 3PETA 2Z8GA 1IB4A 2NT9A 2BX6A 4HWVA 1LLZA 3FY3A 3LJYA 4OJ5A 4V02C 2XT4A 4OZYA 2QYUA 5JLVC 4KH3A 2B0RA 3VMVA 1PXZA 3GQAA 1L1IA 1HG8A 2BSPA 2BM7A 5JMCB 4MR0A 1QRCA 2NTQA 2X6WA 1OFMA 1OOCA 2J8IA 1O8KA 4JRAC 1O8HA 2XTYA 4YDTA 2QXZA 1NHCA 2INVA 4OZZA 3SZEA 1O8EA 4NK6A 3B90A 2ODLA 3H09A 3SQVA 1QQ1A 2VJIA 2O04A 3ML3A 3N6ZA 3GQ9A 4YFOA 1QA2A 1TYWA 3ZPPA 3N90A 4XMYA 1O8DA 1PLUA 2PYHA 2W7ZA 4XN0A 1RU4A 2XC1A 1WXRA 5C1CA 2UVEA 1O8FA 1K5CA 3B8YA 4XONA 1DABA 2PYGA 1KTWA 1OGOX 2X6YA 4NK8A 4YZXA 3SY2A 4YZAA 1OFEA 3AK5A 2VBEA 3PSSA 1TYVA 2IOUG 4C2LA 3EQOA 2X6XA 3JURA 4XKVA 4W8RA 3GQ7A 1DBOA 1AIRA 1HF2A 1K4ZA 2O1DA 3LMWA 2O0VA 3VSTA 4OPWA 4W8SA 1JRGA 2VFMA 2NTBA 2G0YA 2VFQA 4XQFA 1PE9A 2VBKA 4OJPA 4EW9A 4OJOA 1LLWA 2BM6A 1O8JA 3TH0A 4W8TA 4W8QA 2QZAA 1DBGA 4OM9A 4XLCA 3EQNA 2X3HA 1TYUA 2QX3A 1EA0A 3VMWA 2NT6A 1RMGA 4YZQA
chains in the Genus database with same CATH topology
4KH3A 2B0RA 1KQ5A 2F3LA 3JX8A 1QA1A 2BM7A 2YUHA 3LYCA 1QRBA 5JMCB 3AK5A 3SYJA 1TYVA 1TYXA 2IOUG 1QRCA 2J8IA 2BM5A 3RIQA 1QA3A 4JRAC 1HF2A 1K4ZA 2BM4A 3SZEA 2VFPA 1TSPA 3BH6B 1CLWA 4OPWA 3H09A 1K8FA 1QQ1A 2VFMA 2G0YA 3BH7B 2VFQA 3ML3A 2VFNA 3N6ZA 2V5IA 1TYWA 2VFOA 4OJPA 4OJOA 3PETA 3N90A 1QA2A 2BM6A 4OJLA 2BX6A 3TH0A 2W7ZA 4OM9A 3LJYA 2XC1A 4OJ5A 4V02C 1WXRA 4OJ6A 3P4GA 1TYUA 5JLVC 1DABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM6 A;  2F3L A;  2W7Z A;  5JMC B;  2J8I A;  2BM5 A;  2BM7 A;  2G0Y A;  4JRA C;  2BM4 A;  5JLV C;  3N90 A; 
#chains in the Genus database with same CATH topology
 3KRG A;  1JTA A;  1BHE A;  1O88 A;  1KQ5 A;  4XN3 A;  3VSV A;  4YEI A;  1QA1 A;  4YC5 A;  4Z05 A;  4Z03 A;  2YUH A;  1GQ8 A;  4AVZ A;  3LYC A;  1QCX A;  2IQ7 A;  1EE6 A;  1O8I A;  5DNS A;  3SYJ A;  3UW0 A;  1X0C A;  2QY1 A;  4MXN A;  2UVF A;  3GRH A;  3RIQ A;  2XTX A;  1OFD A;  3VSU A;  3T9G A;  1QA3 A;  3WWG A;  3DU1 X;  2NTP A;  2X85 A;  1KCD A;  4XM3 A;  4YCQ A;  2INU A;  3BH6 B;  1CLW A;  4XL9 A;  1LM1 A;  4XLE A;  4XOT A;  4XNF A;  4YEJ A;  3SUC A;  1VBL A;  4URR A;  1IA5 A;  2V5I A;  2VFO A;  1QJV A;  2J8K A;  4XOR A;  1WMR A;  4OJL A;  3NAW A;  4XLF A;  1IDJ A;  5C1E A;  2NSP A;  4YEL A;  1O8M A;  1CZF A;  4OJ6 A;  3P4G A;  2NZM A;  1KCC A;  3PSZ A;  1XG2 A;  4I84 A;  2F3L A;  3JX8 A;  4XR6 A;  2NST A;  2VJJ A;  1O8G A;  2O17 A;  1QRB A;  4XLH A;  5AMV A;  2O6W A;  1H80 A;  1TYX A;  1IDK A;  1EZG A;  1RWR A;  2EWE A;  2O0W A;  4U49 A;  2BM5 A;  2XT2 A;  3ZSC A;  2BM4 A;  4U4B A;  4YZ0 A;  2VFP A;  4XOP A;  1TSP A;  3B4N A;  4XLA A;  4XKW A;  1OFL A;  2XTW A;  4PMH A;  1K8F A;  4Z06 A;  3GQ8 A;  1O8L A;  3BH7 B;  3NB2 A;  2VBM A;  2VFN A;  2PEC A;  1BN8 A;  1OGM X;  3PET A;  2Z8G A;  1IB4 A;  2NT9 A;  2BX6 A;  4HWV A;  1LLZ A;  3FY3 A;  3LJY A;  4OJ5 A;  4V02 C;  2XT4 A;  4OZY A;  2QYU A;  5JLV C;  4KH3 A;  2B0R A;  3VMV A;  1PXZ A;  3GQA A;  1L1I A;  1HG8 A;  2BSP A;  2BM7 A;  5JMC B;  4MR0 A;  1QRC A;  2NTQ A;  2X6W A;  1OFM A;  1OOC A;  2J8I A;  1O8K A;  4JRA C;  1O8H A;  2XTY A;  4YDT A;  2QXZ A;  1NHC A;  2INV A;  4OZZ A;  3SZE A;  1O8E A;  4NK6 A;  3B90 A;  2ODL A;  3H09 A;  3SQV A;  1QQ1 A;  2VJI A;  2O04 A;  3ML3 A;  3N6Z A;  3GQ9 A;  4YFO A;  1QA2 A;  1TYW A;  3ZPP A;  3N90 A;  4XMY A;  1O8D A;  1PLU A;  2PYH A;  2W7Z A;  4XN0 A;  1RU4 A;  2XC1 A;  1WXR A;  5C1C A;  2UVE A;  1O8F A;  1K5C A;  3B8Y A;  4XON A;  1DAB A;  2PYG A;  1KTW A;  1OGO X;  2X6Y A;  4NK8 A;  4YZX A;  3SY2 A;  4YZA A;  1OFE A;  3AK5 A;  2VBE A;  3PSS A;  1TYV A;  2IOU G;  4C2L A;  3EQO A;  2X6X A;  3JUR A;  4XKV A;  4W8R A;  3GQ7 A;  1DBO A;  1AIR A;  1HF2 A;  1K4Z A;  2O1D A;  3LMW A;  2O0V A;  3VST A;  4OPW A;  4W8S A;  1JRG A;  2VFM A;  2NTB A;  2G0Y A;  2VFQ A;  4XQF A;  1PE9 A;  2VBK A;  4OJP A;  4EW9 A;  4OJO A;  1LLW A;  2BM6 A;  1O8J A;  3TH0 A;  4W8T A;  4W8Q A;  2QZA A;  1DBG A;  4OM9 A;  4XLC A;  3EQN A;  2X3H A;  1TYU A;  2QX3 A;  1EA0 A;  3VMW A;  2NT6 A;  1RMG A;  4YZQ A; 
#chains in the Genus database with same CATH homology
 4KH3 A;  2B0R A;  1KQ5 A;  2F3L A;  3JX8 A;  1QA1 A;  2BM7 A;  2YUH A;  3LYC A;  1QRB A;  5JMC B;  3AK5 A;  3SYJ A;  1TYV A;  1TYX A;  2IOU G;  1QRC A;  2J8I A;  2BM5 A;  3RIQ A;  1QA3 A;  4JRA C;  1HF2 A;  1K4Z A;  2BM4 A;  3SZE A;  2VFP A;  1TSP A;  3BH6 B;  1CLW A;  4OPW A;  3H09 A;  1K8F A;  1QQ1 A;  2VFM A;  2G0Y A;  3BH7 B;  2VFQ A;  3ML3 A;  2VFN A;  3N6Z A;  2V5I A;  1TYW A;  2VFO A;  4OJP A;  4OJO A;  3PET A;  3N90 A;  1QA2 A;  2BM6 A;  4OJL A;  2BX6 A;  3TH0 A;  2W7Z A;  4OM9 A;  3LJY A;  2XC1 A;  4OJ5 A;  4V02 C;  1WXR A;  4OJ6 A;  3P4G A;  1TYU A;  5JLV C;  1DAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...