2W7ZA

Structure of the pentapeptide repeat protein efsqnr, a dna gyrase inhibitor. free amines modified by cyclic pentylation with glutaraldehyde.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
211
structure length
200
Chain Sequence
MITYPLPEQLPLLTNCQLEDEAILENHLYQQIDLPNQEVRNLVFRDAVFDHLSLANGQFASFDCSNVRFEACDFSNVEWLSGSFHRVTFLRCNLTGTNFADSYLDCLFEDCADYASFRFANFNLVHFNQTRLVESEFFEVTWLLLEACDLTESNWLNTSLGLDFSQNTFERLTFSPNYLSGLVTPEQAIYLASALGLVIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Inhibitor
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
publication title Crystallization of a Pentapeptide-Repeat Protein by Reductive Cyclic Pentylation of Free Amines with Glutaraldehyde.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 78
structure length 200
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2w7zA00
2BM4A 3N90A 2J8IA 2BM7A 4JRAC 5JLVC 2F3LA 2W7ZA 2BM5A 2G0YA 2BM6A 5JMCB
chains in the Genus database with same CATH superfamily
3SZEA 3B4NA 4NK8A 3PETA 1TYUA 4OPWA 1QA3A 4MXNA 2IQ7A 4XKVA 2QX3A 4V02C 1RMGA 1JTAA 1HF2A 4XOTA 2VFMA 1PE9A 4XORA 2BM4A 1O88A 3PSZA 4OJ6A 4YEJA 3VSVA 4OJOA 2O0WA 1QJVA 2F3LA 4EW9A 1O8GA 4XMYA 1O8HA 1K8FA 2W7ZA 3H09A 1EA0A 2X6XA 2NTBA 4U49A 5AMVA 2NSTA 3VSTA 3JURA 1K4ZA 4OJ5A 1XG2A 4I84A 1KQ5A 4KH3A 1L1IA 4AVZA 2VBEA 4XLHA 4XL9A 3WWGA 2NSPA 2O04A 4XN3A 3LMWA 2XTYA 2INVA 3N6ZA 3EQOA 1EZGA 3B90A 1IB4A 4Z03A 1EE6A 2BM5A 2NT6A 1QRBA 1O8KA 4YZAA 4XQFA 1OFDA 1DABA 1K5CA 5JMCB 5C1CA 1WXRA 3RIQA 1WMRA 4YC5A 1OFMA 1RWRA 3VSUA 1LLZA 2X6WA 2VFNA 2O17A 2VFQA 2XT2A 3KRGA 1NHCA 1OOCA 2B0RA 3GQAA 1O8IA 4YDTA 1QA2A 2VJJA 3GQ7A 4YZQA 1O8FA 3BH7B 1OGOX 3DU1X 1DBGA 3VMWA 3SYJA 4XLAA 2YUHA 3P4GA 2QY1A 4W8QA 2NTPA 5JLVC 3NAWA 3LYCA 4XR6A 2O6WA 3B8YA 4XNFA 1QCXA 3EQNA 2G0YA 1RU4A 4YZ0A 3ML3A 3JX8A 3FY3A 2NTQA 4JRAC 5DNSA 1TSPA 4W8SA 1O8EA 4YFOA 1OGMX 1VBLA 1AIRA 2IOUG 1OFLA 4XONA 1OFEA 1CZFA 3LJYA 2X85A 3PSSA 1IDKA 3VMVA 3UW0A 1PLUA 4OZZA 4OJPA 2XTWA 3N90A 1PXZA 2PECA 4NK6A 4Z06A 1CLWA 3GRHA 4W8RA 1TYWA 2PYHA 2PYGA 3GQ8A 1KCCA 2QXZA 1DBOA 3SUCA 1X0CA 1O8LA 2QZAA 3T9GA 1HG8A 4OM9A 4MR0A 1QQ1A 2VFPA 2VFOA 1H80A 2XC1A 4XKWA 2J8IA 1GQ8A 1O8MA 1TYVA 1BN8A 4YEIA 1KTWA 2X3HA 1IA5A 3SQVA 3ZSCA 1TYXA 4XLCA 3ZPPA 1KCDA 3NB2A 2V5IA 2VJIA 4HWVA 3AK5A 2ODLA 1LLWA 4Z05A 4YZXA 1JRGA 2XTXA 2BM7A 4OJLA 2BX6A 2QYUA 4W8TA 4XLFA 4XM3A 2BM6A 2NZMA 2O1DA 2UVEA 2J8KA 2XT4A 4PMHA 4XLEA 4XOPA 1QA1A 4C2LA 2VBMA 1O8JA 3GQ9A 4YELA 2BSPA 2O0VA 4OZYA 4URRA 2X6YA 3TH0A 1IDJA 3SY2A 4YCQA 2Z8GA 2NT9A 1LM1A 3BH6B 5C1EA 1BHEA 4U4BA 2INUA 4XN0A 1O8DA 1QRCA 2VBKA 2UVFA 2EWEA
chains in the Genus database with same CATH topology
3SZEA 1WXRA 3PETA 3RIQA 1TYXA 1TYUA 4OPWA 1QA3A 2V5IA 5JMCB 2VFNA 3AK5A 4V02C 2VFQA 1HF2A 2VFMA 4OJPA 2BM4A 2B0RA 3N90A 4OJ6A 1QA2A 2BM7A 4OJOA 2F3LA 4OJLA 1CLWA 1K8FA 2BX6A 2W7ZA 3H09A 2BM6A 3BH7B 1TYWA 1K4ZA 4OJ5A 3SYJA 2YUHA 3P4GA 1QA1A 1KQ5A 4KH3A 5JLVC 3LYCA 3TH0A 2G0YA 1QQ1A 2VFPA 2VFOA 3JX8A 3ML3A 2XC1A 2J8IA 3BH6B 3N6ZA 4JRAC 1TSPA 1TYVA 2BM5A 1QRCA 1QRBA 2IOUG 1DABA 4OM9A 3LJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM4 A;  3N90 A;  2J8I A;  2BM7 A;  4JRA C;  5JLV C;  2F3L A;  2W7Z A;  2BM5 A;  2G0Y A;  2BM6 A;  5JMC B; 
#chains in the Genus database with same CATH topology
 3SZE A;  3B4N A;  4NK8 A;  3PET A;  1TYU A;  4OPW A;  1QA3 A;  4MXN A;  2IQ7 A;  4XKV A;  2QX3 A;  4V02 C;  1RMG A;  1JTA A;  1HF2 A;  4XOT A;  2VFM A;  1PE9 A;  4XOR A;  2BM4 A;  1O88 A;  3PSZ A;  4OJ6 A;  4YEJ A;  3VSV A;  4OJO A;  2O0W A;  1QJV A;  2F3L A;  4EW9 A;  1O8G A;  4XMY A;  1O8H A;  1K8F A;  2W7Z A;  3H09 A;  1EA0 A;  2X6X A;  2NTB A;  4U49 A;  5AMV A;  2NST A;  3VST A;  3JUR A;  1K4Z A;  4OJ5 A;  1XG2 A;  4I84 A;  1KQ5 A;  4KH3 A;  1L1I A;  4AVZ A;  2VBE A;  4XLH A;  4XL9 A;  3WWG A;  2NSP A;  2O04 A;  4XN3 A;  3LMW A;  2XTY A;  2INV A;  3N6Z A;  3EQO A;  1EZG A;  3B90 A;  1IB4 A;  4Z03 A;  1EE6 A;  2BM5 A;  2NT6 A;  1QRB A;  1O8K A;  4YZA A;  4XQF A;  1OFD A;  1DAB A;  1K5C A;  5JMC B;  5C1C A;  1WXR A;  3RIQ A;  1WMR A;  4YC5 A;  1OFM A;  1RWR A;  3VSU A;  1LLZ A;  2X6W A;  2VFN A;  2O17 A;  2VFQ A;  2XT2 A;  3KRG A;  1NHC A;  1OOC A;  2B0R A;  3GQA A;  1O8I A;  4YDT A;  1QA2 A;  2VJJ A;  3GQ7 A;  4YZQ A;  1O8F A;  3BH7 B;  1OGO X;  3DU1 X;  1DBG A;  3VMW A;  3SYJ A;  4XLA A;  2YUH A;  3P4G A;  2QY1 A;  4W8Q A;  2NTP A;  5JLV C;  3NAW A;  3LYC A;  4XR6 A;  2O6W A;  3B8Y A;  4XNF A;  1QCX A;  3EQN A;  2G0Y A;  1RU4 A;  4YZ0 A;  3ML3 A;  3JX8 A;  3FY3 A;  2NTQ A;  4JRA C;  5DNS A;  1TSP A;  4W8S A;  1O8E A;  4YFO A;  1OGM X;  1VBL A;  1AIR A;  2IOU G;  1OFL A;  4XON A;  1OFE A;  1CZF A;  3LJY A;  2X85 A;  3PSS A;  1IDK A;  3VMV A;  3UW0 A;  1PLU A;  4OZZ A;  4OJP A;  2XTW A;  3N90 A;  1PXZ A;  2PEC A;  4NK6 A;  4Z06 A;  1CLW A;  3GRH A;  4W8R A;  1TYW A;  2PYH A;  2PYG A;  3GQ8 A;  1KCC A;  2QXZ A;  1DBO A;  3SUC A;  1X0C A;  1O8L A;  2QZA A;  3T9G A;  1HG8 A;  4OM9 A;  4MR0 A;  1QQ1 A;  2VFP A;  2VFO A;  1H80 A;  2XC1 A;  4XKW A;  2J8I A;  1GQ8 A;  1O8M A;  1TYV A;  1BN8 A;  4YEI A;  1KTW A;  2X3H A;  1IA5 A;  3SQV A;  3ZSC A;  1TYX A;  4XLC A;  3ZPP A;  1KCD A;  3NB2 A;  2V5I A;  2VJI A;  4HWV A;  3AK5 A;  2ODL A;  1LLW A;  4Z05 A;  4YZX A;  1JRG A;  2XTX A;  2BM7 A;  4OJL A;  2BX6 A;  2QYU A;  4W8T A;  4XLF A;  4XM3 A;  2BM6 A;  2NZM A;  2O1D A;  2UVE A;  2J8K A;  2XT4 A;  4PMH A;  4XLE A;  4XOP A;  1QA1 A;  4C2L A;  2VBM A;  1O8J A;  3GQ9 A;  4YEL A;  2BSP A;  2O0V A;  4OZY A;  4URR A;  2X6Y A;  3TH0 A;  1IDJ A;  3SY2 A;  4YCQ A;  2Z8G A;  2NT9 A;  1LM1 A;  3BH6 B;  5C1E A;  1BHE A;  4U4B A;  2INU A;  4XN0 A;  1O8D A;  1QRC A;  2VBK A;  2UVF A;  2EWE A; 
#chains in the Genus database with same CATH homology
 3SZE A;  1WXR A;  3PET A;  3RIQ A;  1TYX A;  1TYU A;  4OPW A;  1QA3 A;  2V5I A;  5JMC B;  2VFN A;  3AK5 A;  4V02 C;  2VFQ A;  1HF2 A;  2VFM A;  4OJP A;  2BM4 A;  2B0R A;  3N90 A;  4OJ6 A;  1QA2 A;  2BM7 A;  4OJO A;  2F3L A;  4OJL A;  1CLW A;  1K8F A;  2BX6 A;  2W7Z A;  3H09 A;  2BM6 A;  3BH7 B;  1TYW A;  1K4Z A;  4OJ5 A;  3SYJ A;  2YUH A;  3P4G A;  1QA1 A;  1KQ5 A;  4KH3 A;  5JLV C;  3LYC A;  3TH0 A;  2G0Y A;  1QQ1 A;  2VFP A;  2VFO A;  3JX8 A;  3ML3 A;  2XC1 A;  2J8I A;  3BH6 B;  3N6Z A;  4JRA C;  1TSP A;  1TYV A;  2BM5 A;  1QRC A;  1QRB A;  2IOU G;  1DAB A;  4OM9 A;  3LJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...