2BM4A

The structure of mfpa (rv3361c, c2 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
180
structure length
180
Chain Sequence
QQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pentapeptide repeat protein
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 78
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm4A00
2W7ZA 2BM7A 2BM6A 2J8IA 3N90A 2F3LA 5JLVC 4JRAC 2BM5A 2BM4A 2G0YA 5JMCB
chains in the Genus database with same CATH superfamily
4YEIA 3NAWA 2BM6A 3N6ZA 1DABA 1TSPA 1PLUA 3VMWA 4AVZA 2NSTA 1O8FA 4XL9A 4OZYA 4NK6A 2VJIA 1XG2A 4HWVA 2QY1A 1K4ZA 1EZGA 5AMVA 1DBOA 1KQ5A 2QXZA 2Z8GA 3B8YA 2NZMA 3VSTA 3B4NA 1H80A 1DBGA 2PECA 4XMYA 4YC5A 1RWRA 2J8IA 1O8IA 2XT4A 4W8TA 2VFQA 1QJVA 3ZPPA 4XN0A 4XLEA 1KCDA 2B0RA 2QYUA 3KRGA 1RMGA 1GQ8A 2UVEA 2NT9A 4Z06A 3WWGA 3AK5A 2VBEA 2INUA 1IDJA 2INVA 3EQOA 1IA5A 1BN8A 2XTWA 2J8KA 2X85A 2IQ7A 1OFMA 4OM9A 3SY2A 1O8MA 2O6WA 1IB4A 2F3LA 2VBKA 4YZQA 2UVFA 5C1CA 1WMRA 1K5CA 2XTYA 3NB2A 2X6WA 4U4BA 2G0YA 1AIRA 3VSVA 3LMWA 4YCQA 4EW9A 4XLAA 4Z05A 3DU1X 3BH6B 4MR0A 2BSPA 2BM7A 3VMVA 4YZXA 4XR6A 4JRAC 1EE6A 3UW0A 1QA3A 1CZFA 4OJLA 4W8SA 1PE9A 1X0CA 3GQ8A 2EWEA 4YEJA 4XNFA 1O8JA 1VBLA 4URRA 1OFEA 1O8EA 4KH3A 1CLWA 4C2LA 2XTXA 1RU4A 1LLWA 2O17A 4XM3A 4YZAA 3LJYA 4XLHA 3B90A 3GQAA 3N90A 1LM1A 2NTBA 2O04A 2O0WA 4MXNA 4XOTA 2X3HA 3GQ7A 3VSUA 1O8LA 2NTQA 1KTWA 2PYGA 4XONA 1BHEA 2IOUG 2PYHA 3P4GA 3H09A 2YUHA 2BX6A 1O8KA 4NK8A 1JTAA 2VFNA 2X6XA 3SYJA 2BM4A 4YFOA 4XLFA 4XN3A 1KCCA 3FY3A 2XC1A 1EA0A 1O88A 2ODLA 1PXZA 2VFMA 1LLZA 1O8DA 1OGMX 1HF2A 2VFOA 3GRHA 3JURA 4V02C 4XKVA 4XOPA 3EQNA 1QRBA 3PSSA 1IDKA 3ZSCA 3RIQA 4YZ0A 1OGOX 2VFPA 3SZEA 1QQ1A 2VJJA 1L1IA 5JMCB 2W7ZA 1QA1A 1WXRA 4OZZA 3LYCA 1O8GA 2O0VA 5DNSA 4OPWA 4YDTA 3BH7B 1OOCA 3SQVA 2V5IA 4OJOA 1JRGA 2NT6A 4OJ5A 1TYVA 1K8FA 1OFDA 2BM5A 3SUCA 4OJ6A 4XORA 1NHCA 2VBMA 3ML3A 4PMHA 2QX3A 4W8QA 4XKWA 2QZAA 1TYWA 2O1DA 1TYXA 2X6YA 3PETA 3GQ9A 4I84A 3PSZA 5C1EA 1HG8A 4YELA 4OJPA 2NSPA 4W8RA 1TYUA 4XLCA 5JLVC 3JX8A 3T9GA 3TH0A 4XQFA 1QA2A 1QRCA 1O8HA 1QCXA 1OFLA 4U49A 2NTPA 2XT2A 4Z03A
chains in the Genus database with same CATH topology
2W7ZA 4OM9A 1DABA 2BM6A 3LYCA 3N90A 1TSPA 3N6ZA 2F3LA 1QA1A 4OPWA 3BH7B 1K4ZA 2V5IA 4OJOA 2G0YA 4OJ5A 1TYVA 1KQ5A 2IOUG 1K8FA 2BM5A 3P4GA 3H09A 2YUHA 2BX6A 4OJ6A 3BH6B 2VFNA 3SYJA 2BM4A 2J8IA 1WXRA 2XC1A 2BM7A 3ML3A 3SZEA 1TYWA 2VFMA 1TYXA 2VFOA 2VFQA 1HF2A 2B0RA 3PETA 4JRAC 4OJLA 4V02C 1QA3A 3AK5A 1QRBA 4OJPA 1TYUA 4KH3A 3JX8A 5JLVC 1CLWA 3RIQA 3TH0A 1QA2A 1QRCA 2VFPA 3LJYA 1QQ1A 5JMCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7Z A;  2BM7 A;  2BM6 A;  2J8I A;  3N90 A;  2F3L A;  5JLV C;  4JRA C;  2BM5 A;  2BM4 A;  2G0Y A;  5JMC B; 
#chains in the Genus database with same CATH topology
 4YEI A;  3NAW A;  2BM6 A;  3N6Z A;  1DAB A;  1TSP A;  1PLU A;  3VMW A;  4AVZ A;  2NST A;  1O8F A;  4XL9 A;  4OZY A;  4NK6 A;  2VJI A;  1XG2 A;  4HWV A;  2QY1 A;  1K4Z A;  1EZG A;  5AMV A;  1DBO A;  1KQ5 A;  2QXZ A;  2Z8G A;  3B8Y A;  2NZM A;  3VST A;  3B4N A;  1H80 A;  1DBG A;  2PEC A;  4XMY A;  4YC5 A;  1RWR A;  2J8I A;  1O8I A;  2XT4 A;  4W8T A;  2VFQ A;  1QJV A;  3ZPP A;  4XN0 A;  4XLE A;  1KCD A;  2B0R A;  2QYU A;  3KRG A;  1RMG A;  1GQ8 A;  2UVE A;  2NT9 A;  4Z06 A;  3WWG A;  3AK5 A;  2VBE A;  2INU A;  1IDJ A;  2INV A;  3EQO A;  1IA5 A;  1BN8 A;  2XTW A;  2J8K A;  2X85 A;  2IQ7 A;  1OFM A;  4OM9 A;  3SY2 A;  1O8M A;  2O6W A;  1IB4 A;  2F3L A;  2VBK A;  4YZQ A;  2UVF A;  5C1C A;  1WMR A;  1K5C A;  2XTY A;  3NB2 A;  2X6W A;  4U4B A;  2G0Y A;  1AIR A;  3VSV A;  3LMW A;  4YCQ A;  4EW9 A;  4XLA A;  4Z05 A;  3DU1 X;  3BH6 B;  4MR0 A;  2BSP A;  2BM7 A;  3VMV A;  4YZX A;  4XR6 A;  4JRA C;  1EE6 A;  3UW0 A;  1QA3 A;  1CZF A;  4OJL A;  4W8S A;  1PE9 A;  1X0C A;  3GQ8 A;  2EWE A;  4YEJ A;  4XNF A;  1O8J A;  1VBL A;  4URR A;  1OFE A;  1O8E A;  4KH3 A;  1CLW A;  4C2L A;  2XTX A;  1RU4 A;  1LLW A;  2O17 A;  4XM3 A;  4YZA A;  3LJY A;  4XLH A;  3B90 A;  3GQA A;  3N90 A;  1LM1 A;  2NTB A;  2O04 A;  2O0W A;  4MXN A;  4XOT A;  2X3H A;  3GQ7 A;  3VSU A;  1O8L A;  2NTQ A;  1KTW A;  2PYG A;  4XON A;  1BHE A;  2IOU G;  2PYH A;  3P4G A;  3H09 A;  2YUH A;  2BX6 A;  1O8K A;  4NK8 A;  1JTA A;  2VFN A;  2X6X A;  3SYJ A;  2BM4 A;  4YFO A;  4XLF A;  4XN3 A;  1KCC A;  3FY3 A;  2XC1 A;  1EA0 A;  1O88 A;  2ODL A;  1PXZ A;  2VFM A;  1LLZ A;  1O8D A;  1OGM X;  1HF2 A;  2VFO A;  3GRH A;  3JUR A;  4V02 C;  4XKV A;  4XOP A;  3EQN A;  1QRB A;  3PSS A;  1IDK A;  3ZSC A;  3RIQ A;  4YZ0 A;  1OGO X;  2VFP A;  3SZE A;  1QQ1 A;  2VJJ A;  1L1I A;  5JMC B;  2W7Z A;  1QA1 A;  1WXR A;  4OZZ A;  3LYC A;  1O8G A;  2O0V A;  5DNS A;  4OPW A;  4YDT A;  3BH7 B;  1OOC A;  3SQV A;  2V5I A;  4OJO A;  1JRG A;  2NT6 A;  4OJ5 A;  1TYV A;  1K8F A;  1OFD A;  2BM5 A;  3SUC A;  4OJ6 A;  4XOR A;  1NHC A;  2VBM A;  3ML3 A;  4PMH A;  2QX3 A;  4W8Q A;  4XKW A;  2QZA A;  1TYW A;  2O1D A;  1TYX A;  2X6Y A;  3PET A;  3GQ9 A;  4I84 A;  3PSZ A;  5C1E A;  1HG8 A;  4YEL A;  4OJP A;  2NSP A;  4W8R A;  1TYU A;  4XLC A;  5JLV C;  3JX8 A;  3T9G A;  3TH0 A;  4XQF A;  1QA2 A;  1QRC A;  1O8H A;  1QCX A;  1OFL A;  4U49 A;  2NTP A;  2XT2 A;  4Z03 A; 
#chains in the Genus database with same CATH homology
 2W7Z A;  4OM9 A;  1DAB A;  2BM6 A;  3LYC A;  3N90 A;  1TSP A;  3N6Z A;  2F3L A;  1QA1 A;  4OPW A;  3BH7 B;  1K4Z A;  2V5I A;  4OJO A;  2G0Y A;  4OJ5 A;  1TYV A;  1KQ5 A;  2IOU G;  1K8F A;  2BM5 A;  3P4G A;  3H09 A;  2YUH A;  2BX6 A;  4OJ6 A;  3BH6 B;  2VFN A;  3SYJ A;  2BM4 A;  2J8I A;  1WXR A;  2XC1 A;  2BM7 A;  3ML3 A;  3SZE A;  1TYW A;  2VFM A;  1TYX A;  2VFO A;  2VFQ A;  1HF2 A;  2B0R A;  3PET A;  4JRA C;  4OJL A;  4V02 C;  1QA3 A;  3AK5 A;  1QRB A;  4OJP A;  1TYU A;  4KH3 A;  3JX8 A;  5JLV C;  1CLW A;  3RIQ A;  3TH0 A;  1QA2 A;  1QRC A;  2VFP A;  3LJY A;  1QQ1 A;  5JMC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...