2BM4A

The structure of mfpa (rv3361c, c2 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
180
structure length
180
Chain Sequence
QQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
total genus 78
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm4A00
2BM6A 2BM7A 2J8IA 4JRAC 2F3LA 2W7ZA 5JLVC 2G0YA 5JMCB 2BM5A 3N90A 2BM4A
chains in the Genus database with same CATH superfamily
4XKVA 4JRAC 1DBOA 4OM9A 4OZYA 2NSTA 4XLCA 1TYXA 3B90A 2YUHA 3PSSA 2BX6A 3PSZA 1TYVA 3SUCA 2O0WA 1OGMX 4XNFA 1NHCA 2BM4A 4YZ0A 1CLWA 3GQ7A 4YEJA 4AVZA 1OFEA 1K8FA 1O8MA 2QYUA 4MXNA 4YC5A 2PECA 4XL9A 4OJOA 1O8GA 2J8IA 4XLFA 1EA0A 1HF2A 4XLEA 2UVEA 2XT4A 4URRA 1EZGA 4XORA 4W8TA 5JMCB 2BM5A 2B0RA 1QA3A 3B4NA 1IDJA 4OJ5A 1O8IA 5C1EA 1IA5A 5AMVA 5C1CA 1OFLA 1RWRA 1X0CA 2BSPA 2VJIA 2G0YA 1QA2A 1LM1A 2Z8GA 4XR6A 2X6WA 4XN0A 3VSUA 3UW0A 2INVA 2IQ7A 2INUA 3VSVA 1O8KA 4XN3A 1CZFA 1O8JA 2O0VA 2V5IA 4XM3A 4XONA 4Z06A 3VMVA 3AK5A 2QXZA 1VBLA 2J8KA 2XTXA 1QRCA 4V02C 2NSPA 2VBKA 1RU4A 3GRHA 1HG8A 1TYWA 2XT2A 3GQ9A 1OOCA 2NT9A 4XOPA 3SYJA 1DABA 1KCCA 1PXZA 1PLUA 1LLWA 4U49A 4U4BA 1BN8A 1O8HA 1QQ1A 4YDTA 1QRBA 4NK8A 4C2LA 1IB4A 3BH7B 1QA1A 2VBEA 2X85A 3EQOA 4EW9A 2PYHA 1BHEA 2QZAA 4KH3A 2VFNA 2XC1A 3ML3A 2NTPA 4XQFA 1EE6A 3EQNA 3SQVA 2QY1A 3DU1X 1XG2A 3ZPPA 4XOTA 2XTYA 4Z03A 1O8DA 2W7ZA 2VBMA 4XMYA 3H09A 3JX8A 3TH0A 2VFPA 3SZEA 3JURA 4YZAA 1OFMA 1KQ5A 4XLAA 4YFOA 3LYCA 1IDKA 2NTBA 1TSPA 3LMWA 3NAWA 4OZZA 2PYGA 3NB2A 2X6YA 4MR0A 4W8QA 4W8RA 4YCQA 2ODLA 2O17A 1H80A 2X6XA 4XLHA 3VSTA 4HWVA 3ZSCA 2F3LA 2XTWA 1WXRA 4OPWA 1O8EA 2O04A 4YEIA 3GQ8A 1GQ8A 2O6WA 3KRGA 3RIQA 1KTWA 2EWEA 2UVFA 2BM6A 3T9GA 1OGOX 4XKWA 4OJLA 1K5CA 2VFOA 1WMRA 2NZMA 4YZXA 1AIRA 2NT6A 2X3HA 1O8FA 3N90A 3WWGA 1KCDA 4YELA 1DBGA 2BM7A 1LLZA 3N6ZA 3PETA 2QX3A 4PMHA 4I84A 1OFDA 3SY2A 1PE9A 5DNSA 2IOUG 4Z05A 3B8YA 5JLVC 1L1IA 4OJPA 1QCXA 3P4GA 2VJJA 1QJVA 2O1DA 3BH6B 3FY3A 4NK6A 4W8SA 1O88A 3VMWA 2NTQA 1TYUA 4OJ6A 4YZQA 1JRGA 2VFMA 2VFQA 1RMGA 1JTAA 1O8LA 1K4ZA 3GQAA 3LJYA
chains in the Genus database with same CATH topology
2BM6A 4JRAC 4OM9A 2W7ZA 4OJLA 1TYXA 3H09A 3JX8A 3TH0A 2VFPA 3SZEA 2V5IA 2VFOA 2YUHA 2BX6A 3AK5A 1TYVA 3N90A 1KQ5A 2BM4A 1CLWA 2BM7A 3LYCA 1QRCA 4V02C 3N6ZA 3PETA 1K8FA 1TYWA 1TSPA 1DABA 3SYJA 4OJOA 2J8IA 1HF2A 2IOUG 5JLVC 4OJPA 1QQ1A 3P4GA 5JMCB 1QRBA 1QA1A 2BM5A 3BH7B 2B0RA 1QA3A 3BH6B 4OJ5A 4KH3A 2VFNA 1TYUA 2F3LA 2XC1A 3ML3A 4OJ6A 4OPWA 2VFMA 1WXRA 2VFQA 1QA2A 2G0YA 3RIQA 1K4ZA 3LJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM6 A;  2BM7 A;  2J8I A;  4JRA C;  2F3L A;  2W7Z A;  5JLV C;  2G0Y A;  5JMC B;  2BM5 A;  3N90 A;  2BM4 A; 
#chains in the Genus database with same CATH topology
 4XKV A;  4JRA C;  1DBO A;  4OM9 A;  4OZY A;  2NST A;  4XLC A;  1TYX A;  3B90 A;  2YUH A;  3PSS A;  2BX6 A;  3PSZ A;  1TYV A;  3SUC A;  2O0W A;  1OGM X;  4XNF A;  1NHC A;  2BM4 A;  4YZ0 A;  1CLW A;  3GQ7 A;  4YEJ A;  4AVZ A;  1OFE A;  1K8F A;  1O8M A;  2QYU A;  4MXN A;  4YC5 A;  2PEC A;  4XL9 A;  4OJO A;  1O8G A;  2J8I A;  4XLF A;  1EA0 A;  1HF2 A;  4XLE A;  2UVE A;  2XT4 A;  4URR A;  1EZG A;  4XOR A;  4W8T A;  5JMC B;  2BM5 A;  2B0R A;  1QA3 A;  3B4N A;  1IDJ A;  4OJ5 A;  1O8I A;  5C1E A;  1IA5 A;  5AMV A;  5C1C A;  1OFL A;  1RWR A;  1X0C A;  2BSP A;  2VJI A;  2G0Y A;  1QA2 A;  1LM1 A;  2Z8G A;  4XR6 A;  2X6W A;  4XN0 A;  3VSU A;  3UW0 A;  2INV A;  2IQ7 A;  2INU A;  3VSV A;  1O8K A;  4XN3 A;  1CZF A;  1O8J A;  2O0V A;  2V5I A;  4XM3 A;  4XON A;  4Z06 A;  3VMV A;  3AK5 A;  2QXZ A;  1VBL A;  2J8K A;  2XTX A;  1QRC A;  4V02 C;  2NSP A;  2VBK A;  1RU4 A;  3GRH A;  1HG8 A;  1TYW A;  2XT2 A;  3GQ9 A;  1OOC A;  2NT9 A;  4XOP A;  3SYJ A;  1DAB A;  1KCC A;  1PXZ A;  1PLU A;  1LLW A;  4U49 A;  4U4B A;  1BN8 A;  1O8H A;  1QQ1 A;  4YDT A;  1QRB A;  4NK8 A;  4C2L A;  1IB4 A;  3BH7 B;  1QA1 A;  2VBE A;  2X85 A;  3EQO A;  4EW9 A;  2PYH A;  1BHE A;  2QZA A;  4KH3 A;  2VFN A;  2XC1 A;  3ML3 A;  2NTP A;  4XQF A;  1EE6 A;  3EQN A;  3SQV A;  2QY1 A;  3DU1 X;  1XG2 A;  3ZPP A;  4XOT A;  2XTY A;  4Z03 A;  1O8D A;  2W7Z A;  2VBM A;  4XMY A;  3H09 A;  3JX8 A;  3TH0 A;  2VFP A;  3SZE A;  3JUR A;  4YZA A;  1OFM A;  1KQ5 A;  4XLA A;  4YFO A;  3LYC A;  1IDK A;  2NTB A;  1TSP A;  3LMW A;  3NAW A;  4OZZ A;  2PYG A;  3NB2 A;  2X6Y A;  4MR0 A;  4W8Q A;  4W8R A;  4YCQ A;  2ODL A;  2O17 A;  1H80 A;  2X6X A;  4XLH A;  3VST A;  4HWV A;  3ZSC A;  2F3L A;  2XTW A;  1WXR A;  4OPW A;  1O8E A;  2O04 A;  4YEI A;  3GQ8 A;  1GQ8 A;  2O6W A;  3KRG A;  3RIQ A;  1KTW A;  2EWE A;  2UVF A;  2BM6 A;  3T9G A;  1OGO X;  4XKW A;  4OJL A;  1K5C A;  2VFO A;  1WMR A;  2NZM A;  4YZX A;  1AIR A;  2NT6 A;  2X3H A;  1O8F A;  3N90 A;  3WWG A;  1KCD A;  4YEL A;  1DBG A;  2BM7 A;  1LLZ A;  3N6Z A;  3PET A;  2QX3 A;  4PMH A;  4I84 A;  1OFD A;  3SY2 A;  1PE9 A;  5DNS A;  2IOU G;  4Z05 A;  3B8Y A;  5JLV C;  1L1I A;  4OJP A;  1QCX A;  3P4G A;  2VJJ A;  1QJV A;  2O1D A;  3BH6 B;  3FY3 A;  4NK6 A;  4W8S A;  1O88 A;  3VMW A;  2NTQ A;  1TYU A;  4OJ6 A;  4YZQ A;  1JRG A;  2VFM A;  2VFQ A;  1RMG A;  1JTA A;  1O8L A;  1K4Z A;  3GQA A;  3LJY A; 
#chains in the Genus database with same CATH homology
 2BM6 A;  4JRA C;  4OM9 A;  2W7Z A;  4OJL A;  1TYX A;  3H09 A;  3JX8 A;  3TH0 A;  2VFP A;  3SZE A;  2V5I A;  2VFO A;  2YUH A;  2BX6 A;  3AK5 A;  1TYV A;  3N90 A;  1KQ5 A;  2BM4 A;  1CLW A;  2BM7 A;  3LYC A;  1QRC A;  4V02 C;  3N6Z A;  3PET A;  1K8F A;  1TYW A;  1TSP A;  1DAB A;  3SYJ A;  4OJO A;  2J8I A;  1HF2 A;  2IOU G;  5JLV C;  4OJP A;  1QQ1 A;  3P4G A;  5JMC B;  1QRB A;  1QA1 A;  2BM5 A;  3BH7 B;  2B0R A;  1QA3 A;  3BH6 B;  4OJ5 A;  4KH3 A;  2VFN A;  1TYU A;  2F3L A;  2XC1 A;  3ML3 A;  4OJ6 A;  4OPW A;  2VFM A;  1WXR A;  2VFQ A;  1QA2 A;  2G0Y A;  3RIQ A;  1K4Z A;  3LJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...