2BM4A

The structure of mfpa (rv3361c, c2 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
180
structure length
180
Chain Sequence
QQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
total genus 78
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm4A00
2BM6A 3N90A 2F3LA 2J8IA 2BM4A 5JLVC 2BM5A 4JRAC 2W7ZA 2BM7A 5JMCB 2G0YA
chains in the Genus database with same CATH superfamily
3B8YA 3BH7B 2VFNA 4OZYA 4U4BA 4XOTA 3TH0A 2IOUG 4URRA 1KTWA 1PLUA 2XTWA 4XLFA 4YFOA 1TYWA 1QA3A 1L1IA 1QQ1A 3GQ7A 1HG8A 4OJPA 1LLZA 2VFPA 2J8IA 2QYUA 1O8KA 2VFMA 1DBGA 1VBLA 3UW0A 2XT2A 4W8SA 4YZAA 5JMCB 2G0YA 2NT6A 4XMYA 2PYHA 3WWGA 4U49A 1O8FA 2X6WA 1JRGA 1IA5A 1QRBA 3NB2A 2O0WA 1DABA 2VFQA 1LLWA 2VJJA 3JX8A 4XONA 2BX6A 4I84A 1NHCA 1AIRA 2QXZA 4XLAA 4OM9A 3PETA 2XTYA 3SUCA 3GQ8A 2Z8GA 2QZAA 5DNSA 1EE6A 3VSTA 4YEIA 4C2LA 1KCCA 3JURA 2J8KA 1QJVA 1O8IA 3LJYA 1O88A 2NSTA 1OFLA 3GQ9A 2QX3A 4XL9A 3AK5A 4PMHA 2INUA 3B4NA 3FY3A 2XTXA 2X6YA 1O8MA 4YCQA 3GRHA 4XLHA 1QA1A 4HWVA 1TYVA 2XT4A 1PE9A 2VFOA 2BM4A 2IQ7A 2VBMA 4V02C 1OFEA 2NT9A 4NK6A 1OFMA 4W8QA 1K4ZA 2NTPA 1BHEA 1OGMX 1IDKA 4YC5A 1TYUA 4YZ0A 2ODLA 1K8FA 4OZZA 4XM3A 2UVEA 4OPWA 4Z03A 1XG2A 4OJLA 2XC1A 2BM7A 2PYGA 4XN3A 4W8TA 5C1EA 1O8DA 3NAWA 3DU1X 4AVZA 1DBOA 3BH6B 2X3HA 4XLEA 1O8JA 3LMWA 4KH3A 2O6WA 3VMWA 1H80A 1OOCA 4XN0A 2V5IA 1O8GA 2UVFA 4XNFA 5AMVA 1OFDA 2INVA 3N90A 4OJOA 3EQNA 1BN8A 1CZFA 4MR0A 1GQ8A 2VJIA 4Z06A 3VSVA 4XLCA 2VBEA 1QCXA 1RMGA 4XORA 3LYCA 1IB4A 1OGOX 2NTBA 2BM6A 1O8EA 4YDTA 4XQFA 1CLWA 5JLVC 3T9GA 1TSPA 4YZQA 2YUHA 4JRAC 4EW9A 2B0RA 2W7ZA 1EA0A 1KQ5A 4YELA 4NK8A 3EQOA 2VBKA 1K5CA 3SZEA 1X0CA 3PSZA 1HF2A 1PXZA 1QRCA 1WXRA 1RU4A 1QA2A 3SQVA 2O17A 2O1DA 4OJ5A 4XOPA 4W8RA 1O8HA 2EWEA 2NZMA 2PECA 1LM1A 3N6ZA 3RIQA 3ZSCA 2X6XA 3B90A 4MXNA 4XKWA 4YEJA 1EZGA 1KCDA 1TYXA 2NTQA 2O0VA 4XR6A 2O04A 3H09A 3ML3A 3P4GA 4Z05A 2BM5A 3GQAA 3SYJA 3KRGA 4OJ6A 1O8LA 3VSUA 3VMVA 1RWRA 2BSPA 1IDJA 2F3LA 4XKVA 1JTAA 1WMRA 3PSSA 3SY2A 3ZPPA 2X85A 4YZXA 5C1CA 2NSPA 2QY1A
chains in the Genus database with same CATH topology
3BH7B 2VFNA 1KQ5A 3BH6B 3TH0A 2IOUG 1TYWA 4KH3A 1QA3A 3SZEA 1QQ1A 3LJYA 1QRCA 1HF2A 2XC1A 4OJPA 1QA2A 2W7ZA 1WXRA 2VFPA 2J8IA 4OJ5A 3AK5A 2VFMA 2V5IA 3N6ZA 3RIQA 5JMCB 2G0YA 1QA1A 1TYVA 1TYXA 3N90A 4OJOA 2VFOA 2BM4A 3H09A 3ML3A 3P4GA 4V02C 2BM5A 1K4ZA 1QRBA 3SYJA 3LYCA 4OJ6A 1DABA 2VFQA 3JX8A 1TYUA 2BM6A 2BX6A 2F3LA 1K8FA 1CLWA 5JLVC 1TSPA 4OPWA 4OM9A 2YUHA 3PETA 4JRAC 4OJLA 2B0RA 2BM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM6 A;  3N90 A;  2F3L A;  2J8I A;  2BM4 A;  5JLV C;  2BM5 A;  4JRA C;  2W7Z A;  2BM7 A;  5JMC B;  2G0Y A; 
#chains in the Genus database with same CATH topology
 3B8Y A;  3BH7 B;  2VFN A;  4OZY A;  4U4B A;  4XOT A;  3TH0 A;  2IOU G;  4URR A;  1KTW A;  1PLU A;  2XTW A;  4XLF A;  4YFO A;  1TYW A;  1QA3 A;  1L1I A;  1QQ1 A;  3GQ7 A;  1HG8 A;  4OJP A;  1LLZ A;  2VFP A;  2J8I A;  2QYU A;  1O8K A;  2VFM A;  1DBG A;  1VBL A;  3UW0 A;  2XT2 A;  4W8S A;  4YZA A;  5JMC B;  2G0Y A;  2NT6 A;  4XMY A;  2PYH A;  3WWG A;  4U49 A;  1O8F A;  2X6W A;  1JRG A;  1IA5 A;  1QRB A;  3NB2 A;  2O0W A;  1DAB A;  2VFQ A;  1LLW A;  2VJJ A;  3JX8 A;  4XON A;  2BX6 A;  4I84 A;  1NHC A;  1AIR A;  2QXZ A;  4XLA A;  4OM9 A;  3PET A;  2XTY A;  3SUC A;  3GQ8 A;  2Z8G A;  2QZA A;  5DNS A;  1EE6 A;  3VST A;  4YEI A;  4C2L A;  1KCC A;  3JUR A;  2J8K A;  1QJV A;  1O8I A;  3LJY A;  1O88 A;  2NST A;  1OFL A;  3GQ9 A;  2QX3 A;  4XL9 A;  3AK5 A;  4PMH A;  2INU A;  3B4N A;  3FY3 A;  2XTX A;  2X6Y A;  1O8M A;  4YCQ A;  3GRH A;  4XLH A;  1QA1 A;  4HWV A;  1TYV A;  2XT4 A;  1PE9 A;  2VFO A;  2BM4 A;  2IQ7 A;  2VBM A;  4V02 C;  1OFE A;  2NT9 A;  4NK6 A;  1OFM A;  4W8Q A;  1K4Z A;  2NTP A;  1BHE A;  1OGM X;  1IDK A;  4YC5 A;  1TYU A;  4YZ0 A;  2ODL A;  1K8F A;  4OZZ A;  4XM3 A;  2UVE A;  4OPW A;  4Z03 A;  1XG2 A;  4OJL A;  2XC1 A;  2BM7 A;  2PYG A;  4XN3 A;  4W8T A;  5C1E A;  1O8D A;  3NAW A;  3DU1 X;  4AVZ A;  1DBO A;  3BH6 B;  2X3H A;  4XLE A;  1O8J A;  3LMW A;  4KH3 A;  2O6W A;  3VMW A;  1H80 A;  1OOC A;  4XN0 A;  2V5I A;  1O8G A;  2UVF A;  4XNF A;  5AMV A;  1OFD A;  2INV A;  3N90 A;  4OJO A;  3EQN A;  1BN8 A;  1CZF A;  4MR0 A;  1GQ8 A;  2VJI A;  4Z06 A;  3VSV A;  4XLC A;  2VBE A;  1QCX A;  1RMG A;  4XOR A;  3LYC A;  1IB4 A;  1OGO X;  2NTB A;  2BM6 A;  1O8E A;  4YDT A;  4XQF A;  1CLW A;  5JLV C;  3T9G A;  1TSP A;  4YZQ A;  2YUH A;  4JRA C;  4EW9 A;  2B0R A;  2W7Z A;  1EA0 A;  1KQ5 A;  4YEL A;  4NK8 A;  3EQO A;  2VBK A;  1K5C A;  3SZE A;  1X0C A;  3PSZ A;  1HF2 A;  1PXZ A;  1QRC A;  1WXR A;  1RU4 A;  1QA2 A;  3SQV A;  2O17 A;  2O1D A;  4OJ5 A;  4XOP A;  4W8R A;  1O8H A;  2EWE A;  2NZM A;  2PEC A;  1LM1 A;  3N6Z A;  3RIQ A;  3ZSC A;  2X6X A;  3B90 A;  4MXN A;  4XKW A;  4YEJ A;  1EZG A;  1KCD A;  1TYX A;  2NTQ A;  2O0V A;  4XR6 A;  2O04 A;  3H09 A;  3ML3 A;  3P4G A;  4Z05 A;  2BM5 A;  3GQA A;  3SYJ A;  3KRG A;  4OJ6 A;  1O8L A;  3VSU A;  3VMV A;  1RWR A;  2BSP A;  1IDJ A;  2F3L A;  4XKV A;  1JTA A;  1WMR A;  3PSS A;  3SY2 A;  3ZPP A;  2X85 A;  4YZX A;  5C1C A;  2NSP A;  2QY1 A; 
#chains in the Genus database with same CATH homology
 3BH7 B;  2VFN A;  1KQ5 A;  3BH6 B;  3TH0 A;  2IOU G;  1TYW A;  4KH3 A;  1QA3 A;  3SZE A;  1QQ1 A;  3LJY A;  1QRC A;  1HF2 A;  2XC1 A;  4OJP A;  1QA2 A;  2W7Z A;  1WXR A;  2VFP A;  2J8I A;  4OJ5 A;  3AK5 A;  2VFM A;  2V5I A;  3N6Z A;  3RIQ A;  5JMC B;  2G0Y A;  1QA1 A;  1TYV A;  1TYX A;  3N90 A;  4OJO A;  2VFO A;  2BM4 A;  3H09 A;  3ML3 A;  3P4G A;  4V02 C;  2BM5 A;  1K4Z A;  1QRB A;  3SYJ A;  3LYC A;  4OJ6 A;  1DAB A;  2VFQ A;  3JX8 A;  1TYU A;  2BM6 A;  2BX6 A;  2F3L A;  1K8F A;  1CLW A;  5JLV C;  1TSP A;  4OPW A;  4OM9 A;  2YUH A;  3PET A;  4JRA C;  4OJL A;  2B0R A;  2BM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...