2BM4A

The structure of mfpa (rv3361c, c2 crystal form). the pentapeptide repeat protein from mycobacterium tuberculosis folds as a right- handed quadrilateral beta-helix.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
180
structure length
180
Chain Sequence
b'QQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENTAPEPTIDE REPEAT FAMILY PROTEIN
publication title A Fluroquinolone Resistance Protein from Mycobacterium Tuberculosis that Mimics DNA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Pentapeptide repeat protein
total genus 78
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bm4A00
2BM4A 2W7ZA 5JLVC 2G0YA 2BM7A 2BM5A 2J8IA 3N90A 5JMCB 2BM6A 2F3LA 4JRAC
chains in the Genus database with same CATH superfamily
1O88A 1O8KA 1RMGA 2X6WA 2BM7A 2O1DA 3T9GA 3GQ7A 1TYWA 1CZFA 4MR0A 4XKWA 3SZEA 3SYJA 1WXRA 1BN8A 1VBLA 4W8TA 2INUA 4YEJA 1O8JA 2NT9A 2NZMA 1QA1A 2ODLA 3GQ9A 4U49A 4AVZA 2PYHA 5C1EA 5AMVA 1JRGA 3TH0A 1KTWA 1QCXA 3N6ZA 1EZGA 4OM9A 2X85A 1O8IA 3FY3A 2VFNA 4Z06A 3SUCA 1DABA 1DBGA 2O17A 2YUHA 1AIRA 3AK5A 2XC1A 1TSPA 3SY2A 1PXZA 2NTPA 3B4NA 4XLAA 2J8IA 2IOUG 4YELA 1NHCA 3NAWA 4XL9A 3DU1X 1WMRA 1KCCA 4XM3A 2BX6A 2NTQA 2QX3A 1LM1A 4XR6A 2O0VA 5C1CA 3JX8A 2VBMA 4OJ6A 2QXZA 3ML3A 4YZ0A 1O8DA 4XMYA 4XLFA 4PMHA 3BH6B 4W8RA 2XTYA 4OJLA 4W8QA 3H09A 2BM5A 3NB2A 4YFOA 4NK8A 4OJ5A 3LYCA 4OPWA 2X3HA 4YZXA 1DBOA 1LLWA 3ZPPA 4URRA 1IA5A 2QZAA 3P4GA 1IDKA 2BM4A 3LMWA 2XTWA 4OZZA 2V5IA 3VSTA 3EQNA 1OOCA 1EE6A 3GQAA 3KRGA 4I84A 4JRAC 4XKVA 1CLWA 3BH7B 2XTXA 1K5CA 4XNFA 4MXNA 3LJYA 2PECA 2J8KA 4XLCA 3WWGA 5JLVC 1OFEA 3SQVA 3N90A 1TYXA 3ZSCA 1K8FA 2IQ7A 4YC5A 2VJJA 3GRHA 4EW9A 2VBEA 4YZAA 2VFQA 4YZQA 1K4ZA 1HG8A 4XONA 4Z03A 4HWVA 2VBKA 4OZYA 3B90A 4C2LA 1O8EA 3UW0A 3JURA 2EWEA 3PETA 3VSUA 2UVEA 1IDJA 1JTAA 1OFDA 1LLZA 1X0CA 2O6WA 4NK6A 4XLEA 1QA3A 3B8YA 4OJOA 4XORA 3EQOA 2XT4A 1KQ5A 1O8GA 1QQ1A 1O8MA 2X6YA 1HF2A 2O0WA 2PYGA 2BSPA 4YDTA 4XQFA 2Z8GA 4OJPA 1PLUA 4YCQA 1OFLA 1TYUA 2NSPA 4XN0A 3VMVA 3VSVA 1BHEA 1OGMX 2G0YA 1RWRA 2NTBA 5JMCB 1QJVA 2VFOA 1TYVA 2O04A 1XG2A 2VFPA 4V02C 2UVFA 1GQ8A 4XN3A 3VMWA 1O8HA 2QY1A 4Z05A 1QA2A 3PSZA 4KH3A 3RIQA 1QRCA 2F3LA 1KCDA 4XOPA 2INVA 2NSTA 1PE9A 3PSSA 2W7ZA 1IB4A 1RU4A 4W8SA 4YEIA 1L1IA 2VFMA 2B0RA 1H80A 4XOTA 1O8FA 1QRBA 4XLHA 2NT6A 2VJIA 2BM6A 1OGOX 3GQ8A 2XT2A 2X6XA 1EA0A 2QYUA 1OFMA 1O8LA 4U4BA 5DNSA
chains in the Genus database with same CATH topology
2XC1A 3LJYA 1TSPA 5JLVC 2G0YA 2BM7A 2J8IA 2IOUG 3N90A 1TYXA 5JMCB 2VFOA 1TYVA 1K8FA 2BX6A 2VFPA 4V02C 1TYWA 3JX8A 3SZEA 4OJ6A 2VFQA 1QA2A 1K4ZA 3ML3A 4KH3A 3SYJA 3AK5A 3RIQA 1QRCA 1WXRA 2F3LA 3BH6B 1QA1A 2W7ZA 3BH7B 4OJLA 3H09A 2BM5A 3PETA 4OJ5A 3LYCA 4OPWA 2VFMA 1QA3A 3TH0A 2B0RA 4OJOA 3P4GA 3N6ZA 4OM9A 2BM4A 1QRBA 2VFNA 1KQ5A 1QQ1A 2V5IA 1HF2A 2BM6A 1DABA 4JRAC 4OJPA 2YUHA 1CLWA 1TYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM4 A;  2W7Z A;  5JLV C;  2G0Y A;  2BM7 A;  2BM5 A;  2J8I A;  3N90 A;  5JMC B;  2BM6 A;  2F3L A;  4JRA C; 
#chains in the Genus database with same CATH topology
 1O88 A;  1O8K A;  1RMG A;  2X6W A;  2BM7 A;  2O1D A;  3T9G A;  3GQ7 A;  1TYW A;  1CZF A;  4MR0 A;  4XKW A;  3SZE A;  3SYJ A;  1WXR A;  1BN8 A;  1VBL A;  4W8T A;  2INU A;  4YEJ A;  1O8J A;  2NT9 A;  2NZM A;  1QA1 A;  2ODL A;  3GQ9 A;  4U49 A;  4AVZ A;  2PYH A;  5C1E A;  5AMV A;  1JRG A;  3TH0 A;  1KTW A;  1QCX A;  3N6Z A;  1EZG A;  4OM9 A;  2X85 A;  1O8I A;  3FY3 A;  2VFN A;  4Z06 A;  3SUC A;  1DAB A;  1DBG A;  2O17 A;  2YUH A;  1AIR A;  3AK5 A;  2XC1 A;  1TSP A;  3SY2 A;  1PXZ A;  2NTP A;  3B4N A;  4XLA A;  2J8I A;  2IOU G;  4YEL A;  1NHC A;  3NAW A;  4XL9 A;  3DU1 X;  1WMR A;  1KCC A;  4XM3 A;  2BX6 A;  2NTQ A;  2QX3 A;  1LM1 A;  4XR6 A;  2O0V A;  5C1C A;  3JX8 A;  2VBM A;  4OJ6 A;  2QXZ A;  3ML3 A;  4YZ0 A;  1O8D A;  4XMY A;  4XLF A;  4PMH A;  3BH6 B;  4W8R A;  2XTY A;  4OJL A;  4W8Q A;  3H09 A;  2BM5 A;  3NB2 A;  4YFO A;  4NK8 A;  4OJ5 A;  3LYC A;  4OPW A;  2X3H A;  4YZX A;  1DBO A;  1LLW A;  3ZPP A;  4URR A;  1IA5 A;  2QZA A;  3P4G A;  1IDK A;  2BM4 A;  3LMW A;  2XTW A;  4OZZ A;  2V5I A;  3VST A;  3EQN A;  1OOC A;  1EE6 A;  3GQA A;  3KRG A;  4I84 A;  4JRA C;  4XKV A;  1CLW A;  3BH7 B;  2XTX A;  1K5C A;  4XNF A;  4MXN A;  3LJY A;  2PEC A;  2J8K A;  4XLC A;  3WWG A;  5JLV C;  1OFE A;  3SQV A;  3N90 A;  1TYX A;  3ZSC A;  1K8F A;  2IQ7 A;  4YC5 A;  2VJJ A;  3GRH A;  4EW9 A;  2VBE A;  4YZA A;  2VFQ A;  4YZQ A;  1K4Z A;  1HG8 A;  4XON A;  4Z03 A;  4HWV A;  2VBK A;  4OZY A;  3B90 A;  4C2L A;  1O8E A;  3UW0 A;  3JUR A;  2EWE A;  3PET A;  3VSU A;  2UVE A;  1IDJ A;  1JTA A;  1OFD A;  1LLZ A;  1X0C A;  2O6W A;  4NK6 A;  4XLE A;  1QA3 A;  3B8Y A;  4OJO A;  4XOR A;  3EQO A;  2XT4 A;  1KQ5 A;  1O8G A;  1QQ1 A;  1O8M A;  2X6Y A;  1HF2 A;  2O0W A;  2PYG A;  2BSP A;  4YDT A;  4XQF A;  2Z8G A;  4OJP A;  1PLU A;  4YCQ A;  1OFL A;  1TYU A;  2NSP A;  4XN0 A;  3VMV A;  3VSV A;  1BHE A;  1OGM X;  2G0Y A;  1RWR A;  2NTB A;  5JMC B;  1QJV A;  2VFO A;  1TYV A;  2O04 A;  1XG2 A;  2VFP A;  4V02 C;  2UVF A;  1GQ8 A;  4XN3 A;  3VMW A;  1O8H A;  2QY1 A;  4Z05 A;  1QA2 A;  3PSZ A;  4KH3 A;  3RIQ A;  1QRC A;  2F3L A;  1KCD A;  4XOP A;  2INV A;  2NST A;  1PE9 A;  3PSS A;  2W7Z A;  1IB4 A;  1RU4 A;  4W8S A;  4YEI A;  1L1I A;  2VFM A;  2B0R A;  1H80 A;  4XOT A;  1O8F A;  1QRB A;  4XLH A;  2NT6 A;  2VJI A;  2BM6 A;  1OGO X;  3GQ8 A;  2XT2 A;  2X6X A;  1EA0 A;  2QYU A;  1OFM A;  1O8L A;  4U4B A;  5DNS A; 
#chains in the Genus database with same CATH homology
 2XC1 A;  3LJY A;  1TSP A;  5JLV C;  2G0Y A;  2BM7 A;  2J8I A;  2IOU G;  3N90 A;  1TYX A;  5JMC B;  2VFO A;  1TYV A;  1K8F A;  2BX6 A;  2VFP A;  4V02 C;  1TYW A;  3JX8 A;  3SZE A;  4OJ6 A;  2VFQ A;  1QA2 A;  1K4Z A;  3ML3 A;  4KH3 A;  3SYJ A;  3AK5 A;  3RIQ A;  1QRC A;  1WXR A;  2F3L A;  3BH6 B;  1QA1 A;  2W7Z A;  3BH7 B;  4OJL A;  3H09 A;  2BM5 A;  3PET A;  4OJ5 A;  3LYC A;  4OPW A;  2VFM A;  1QA3 A;  3TH0 A;  2B0R A;  4OJO A;  3P4G A;  3N6Z A;  4OM9 A;  2BM4 A;  1QRB A;  2VFN A;  1KQ5 A;  1QQ1 A;  2V5I A;  1HF2 A;  2BM6 A;  1DAB A;  4JRA C;  4OJP A;  2YUH A;  1CLW A;  1TYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...