4YELA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
molecule keywords Tail spike protein
total genus 228
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yelA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yelA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yelA02
1CZFA 2ODLA 4XOPA 2VJIA 3EQNA 1VBLA 2UVFA 4OJ5A 2NT9A 2X85A 2O17A 1KCDA 3EQOA 5C1EA 1BHEA 3T9GA 2PYHA 1X0CA 2INUA 4U49A 2O04A 2Z8GA 4XONA 1RU4A 4HWVA 3SUCA 3WWGA 1NHCA 1O8GA 3VSTA 1OGMX 1OFMA 1JTAA 1O8IA 3VSUA 4YZ0A 2O0VA 2X3HA 1H80A 4XN0A 2O1DA 4W8TA 4OZYA 2IQ7A 1JRGA 3VMWA 1O8HA 5AMVA 2VBKA 2X6WA 2QX3A 1O8MA 1AIRA 1O8JA 2NSPA 1K5CA 1OOCA 3ZPPA 3JURA 1QCXA 4XN3A 3B90A 4Z06A 1KTWA 1O8DA 5C1CA 4OZZA 4XKWA 4XLFA 1OGOX 4W8SA 2PYGA 1IA5A 1KCCA 2PECA 2NTPA 2NSTA 1PE9A 2BSPA 2EWEA 2QY1A 2X6XA 1BN8A 3VSVA 1RMGA 4XMYA 1O8KA 4XL9A 2O0WA 3GQAA 4Z03A 3ZSCA 4C2LA 1O8FA 3GQ7A 1OFLA 1GQ8A 4XORA 1WMRA 4XNFA 1EE6A 3B4NA 1O8EA 4URRA 2X6YA 4OJLA 4EW9A 2INVA 1HG8A 3B8YA 3LMWA 4YZQA 4XKVA 1PXZA 1RWRA 3GQ9A 4XOTA 4YZXA 4Z05A 4OJ6A 2VBMA 2VJJA 4MXNA 4XM3A 1DBGA 3GQ8A 4U4BA 4W8QA 4YEJA 3UW0A 4YELA 2NTBA 4I84A 2UVEA 1O88A 1QJVA 4YZAA 4XLHA 4OJPA 4XR6A 4XLCA 3FY3A 1IDKA 2QXZA 4XLEA 1XG2A 4NK8A 4OJOA 2NT6A 3VMVA 1DBOA 1IB4A 2VBEA 4XLAA 4AVZA 2NZMA 1IDJA 4MR0A 3KRGA 4W8RA 2NTQA 4PMHA 1O8LA 4XQFA 4NK6A 3GRHA 1PLUA
chains in the Genus database with same CATH superfamily
2MLGA 2YWGA 4PC2A 5DDGA 2RNJA 4CSWA 1I6HJ 2PI0A 1FTTA 3LSHA 3CUQB 3NRVA 2I8DA 1K4SA 2Y0MA 2INUA 1TWCJ 1R9TJ 3OPOA 3OYIA 4A3CJ 3OMYA 3Q0WA 4OU0A 3RCOA 3JCUC 5HOOA 4ZC3A 2UZKA 1LE8B 1UZCA 3FM3A 1A36A 3WNDA 1F43A 2EFOA 5IK2A 1Q7YD 1EXMA 2F4OB 3TOBA 1SD4A 2PX9A 5CVRA 4HDUA 4ESJA 2V7XA 1JTAA 3L2QA 3CF2A 2HOAA 4HA8A 3H3ZA 4LFUA 4RGSA 1QZYA 2O0VA 1U6GA 1Q86D 3B78A 3JTHA 3ZC3A 3VYTB 2C4UA 1RI7A 3G05A 1K7AA 5KW9A 3CCSI 3GLXA 3IKVA 1T5EA 1ITYA 4PK4A 1OOCA 1ZH5A 5DD4A 1P9QC 4BY1J 4HRIA 5FLXK 4RB1A 4QUZA 4Z06A 2DA7A 1VHEA 2LFBA 3TKYA 4BJTA 3IRQA 4N9HA 5DEQA 2NS7A 3W5VA 1J75A 3FISA 1GXQA 5DN6A 2NTPA 1ZN2A 2E2JJ 2NSTA 2BM5A 1QVTA 2K3FA 3O8HA 2O6WA 3BZKA 1VLYA 3V8JA 2E19A 4H0EA 4MTDA 2E5NA 1K78A 1RMGA 3AGQA 2XC1A 3WTZA 3TW6A 4FCYA 5CQEA 3FK7A 1B59A 1KA8A 3CCQI 3AG2H 4OPVA 1UHSA 3LJYA 1O8EA 4ASNA 4URRA 5F1JA 1VQ8I 3FXOA 2N8GA 1R71A 4OJLA 1EF4A 2EV0A 2NOGA 5BQTA 3VNUA 3BZ6A 3VSKA 5EF6A 1MDMA 4PC7A 1L1IA 1T56A 2Q2EA 4R71A 2BM6A 1I27A 2BHYA 1RWRA 2ZL6A 1BIBA 4YFXF 2X1EA 2Q6KA 2CF4A 5TY0A 2XGXA 1S3JA 4OJ6A 2H8RA 2F5DA 4FHTA 4B3XA 1B6AA 4PFPA 2GA2A 1MJ9A 3WGGA 3BH7B 1PJ7A 2LREA 3K4MA 4BDYA 2DMNA 1ZYRF 2O5RA 3X2QH 4C9YA 5DCMB 3ZMUA 2WYRA 3RJPA 1AIPA 1GO2A 2W84A 1G59A 2RREA 1TWHJ 2QBYB 1G8XA 1FOWA 4XR6A 1FIPA 3A2KA 1RETA 3K2AA 1P4MA 3JQQA 1ZKGA 3FF5A 4BQNA 1ETYA 3FJOA 3B82A 2VNJA 3ZZTA 3MMYB 3QOPA 2A05A 1ZAOA 2TRTA 1PJRA 3VR6A 2DW4A 4DZJA 1TZLA 4CCKA 2L9SA 3W5UA 1KU9A 2L4AA 1F1ZA 1F4KA 2OBPA 3E5XA 3A4CA 1QA6A 2IBDA 2XTYA 2IPQX 5FGMA 5D5XB 1UFMA 2R3SA 2GIVA 1POGA 2K02A 2F43A 4FK8A 3WYAA 1NH3A 1XG1A 1KU2A 4ZYDA 3EYYA 3IRRA 2XB5A 3BR0A 2OCEA 1XN7A 2CFXA 2XDVA 4I0AA 1BX1A 2YWFA 1QVGB 5C1EA 3CJRB 4N3GA 1FNNA 2DPDA 3M8FA 4HX8A 3G1OA 1N06A 4L9VA 1Q9SA 1PJ6A 3ISXA 3L7WA 3E6MA 1Q1VA 2V1XA 2XPWA 4PC1A 1QRBA 4LIVA 2VBZA 1MMAA 2MABA 4PDKA 4ZTJA 5J1YA 3I55I 4G1VA 2IGMA 3MCAA 4L8JA 1FRNA 2XT4A 4C3HJ 3S2WA 2E7XA 2HU9A 3E6DA 3K10A 1F5TA 3GTPJ 5JLVC 3HIFA 4UNOA 5ERIA 4XN0A 2V1UA 2PEXA 1DGRM 1SEUA 3TEDA 3A03A 5FKNA 1NDHA 4Y7CA 2HKOA 2XZPA 3LVBA 2FMLA 3QYFA 3VMWA 2AQFA 1ETVA 2QF7A 2ME6A 3SQNA 2EZHA 2CUEA 4ZZDA 3BWGA 1UMQA 3D5LA 3JRDA 2ELJA 1O8JA 4BJ5C 1MSEC 1TVCA 3ZR8X 2M45A 2DA1A 4CCJA 4UZUA 1P4XA 3J81K 2L7FP 3OS1A 1YQAA 1RR7A 4FT8A 3L2UA 3Q0VA 1SM4A 2HTJA 3I1FA 3F6VA 1ORKA 3GBGA 4PJMA 2FE3A 2DQLA 2JSPA 3NQOA 5C3EJ 3OYHA 2QTZA 3VOEA 3ML3A 1W5SA 1FNCA 1JHHA 2UXNA 2X1CA 4RD1A 1WVRA 1VQ9I 1O7LA 3ESWB 3RPUD 4KIFA 2VL8A 4ZCMA 3PQKA 2XAQA 4UB6C 5KNLA 5DM7F 3CCLI 3W5HA 4GGGA 1OR7C 1PUFA 4IHWA 2VKDA 4JX4A 3BG9A 2CW5A 1BI0A 4HBLA 1W1WE 2EFWA 4J00A 1V55H 2WZNA 1VQ7I 4BL0B 2C78A 3VO2A 3D5SC 5KAIC 3IL2A 1J59A 2YSRA 3TP3A 2RVCA 4X7EA 2KZVA 3HTUA 1OJLA 1KQSB 3LMWA 4BACA 1PUEE 2DDAA 1ZARA 3H3VK 3MFKA 5A2QK 4N4NB 3G1LA 2XF7A 4AIDA 4ZCLA 2Z3YA 1BQEA 1AU7A 4MFEA 4HSRA 4Z4WA 2BY0A 2V7VA 3LQEA 3N90A 3B73A 3QP6A 4L5EA 2FX0A 2Q1ZB 1ETXA 2K27A 4JQFA 2PMZN 2BY1A 5JFRA 3ASQA 4RJLA 1IUYA 1ENHA 3BROA 1BR2A 3OJWA 4UZEA 1TL8A 4DYCA 4BEHB 4XICA 4UVBA 1IDKA 1WGXA 4CYCA 4M3FA 1W35A 1NHAA 1DGWY 2IXSA 1LVAA 1OCPA 1KC8D 3Q0UA 1W0TA 4FTHA 4EM0B 2JUGA 1ZM2A 3R60A 3E0JB 5IYPA 3MHPA 2Y9ZA 1W5TA 1KQ8A 3S93A 3R4KA 2WAEA 5DV5A 1E62A 3AKZA 2Z1DA 1N77A 2NVYJ 1JE8A 5ILUA 2ZMEA 4A12A 2VNHA 3GWZA 4QVAA 4NK6A 2P7VB 2DFHA 5H20A 1K78B 2IS2A 1T6SA 2HOSA 2YR2A 3DU1X 2LYCA 2YU9J 3PUMA 1KGSA 1NB9A 5F1RA 2VODA 4N0BA 5E8IA 4BAYA 5L3BA 3B6CA 1QQIA 1DP7P 3HOZJ 3M8JA 4L5JA 5FD6A 5J47A 1U5TB 1W34A 1S7EA 3OS2A 1MMDA 3SUCA 5ED4A 2B7BA 1JI8A 3LQRA 4C3IJ 3MKLA 4XRFA 3ABLH 3WWGA 3VSTA 4E7LA 1J9ZA 4A6DA 3TO7A 1UD2A 1VQ8B 2XGCA 2QQ9A 3D0SA 4RPDA 4N9IA 2CWEA 5FO5A 3HOSA 1XCVA 2KJBA 1D8JA 2H6BA 2ZZFA 4Q48A 4JRAC 3A0BC 2P5VA 5JVGF 3HAGA 2RDPA 1R5BA 3KLNA 1OCOH 4Y7NJ 3AL0C 3HBLA 4G7XA 2F4NA 3WTTC 5KK1A 1GLNA 3HUGA 2QQ8A 4MTEA 3DLLF 4IHXA 4U9UA 1Z0XA 1ON2A 5HNFA 1FEXA 4A6EA 4TT3A 1K73D 1VQ6I 4KIBA 3E5UA 2XNJA 3K2ZA 1T39A 3A3BA 2V6CA 3U6BA 1KJZA 3W3CA 1V5GA 4ENJA 1LNWA 1JXSA 1EFCA 2OBTA 1OFCX 4UVCA 1WRJA 5B66C 4FX4A 3F8MA 5J1UA 1WJBA 4EATA 2W82A 4XBFA 5GAEJ 4MFDA 1IN7A 4RLFA 4F52A 1QX4A 2IS6A 3JW4A 2DFIA 1FX7A 1B9MA 4HNUA 3J7AO 3MEXA 3ERED 4A3MJ 2AHOA 3E97A 3BTCA 1QZZA 5AONA 4P26A 2BN4A 2W6IA 4A69C 4OMZA 3B4NA 4M9ZA 5TJJA 3CMEI 2FXAA 2XVCA 3MCZA 3HDDA 4Z4YA 2X6YA 3AAFA 3F23A 4YALA 2XOKA 3DEWA 1VJSA 1TC3C 2ZJ2A 3P27A 3GUDA 2OK8A 1VQOB 3BR1A 1J09A 3L2RA 2GBYA 3TO6A 2QEXB 4XKVA 2EQRA 1VTNC 1X1BA 3VODA 1IHMA 1GUUA 2M5SA 2W00A 1YI2I 4HIZA 3OOPA 5F27A 2CQNA 1B8IB 4YZXA 1RR8C 4N4OB 4IHTA 5IT9Z 2BW3A 1U9OA 4YEJA 2OQGA 3V8KA 2GLOA 3M1CA 1YITB 2VBWA 2OJED 2JJ2A 2HQAA 3KZIC 2QGGA 5AIQA 2KIMA 4MEXF 4OAYA 1H42A 3F6OA 3JRHA 1KONA 2VZLA 5FROA 5IYBJ 5F0CA 2MBFA 2MA3A 2PN6A 4ANJA 1O3QA 2LKSA 1GVHA 3VDXA 3J7ZI 2VBTA 4E0FA 5IYRA 2DT6A 2RKHA 2PJRA 3LMMA 3UKGA 2ZSIB 4WXDA 4P96A 3DWLE 2LBFB 4WX9A 2LKXA 1ETKA 2VBUA 2DOAA 4HV5A 2P81A 3CC2I 1JJ6C 1LFPA 4ENKA 3W2AA 3U1KA 5CKTA 3NEUA 2VOPA 5BSYA 3E1SA 3HSRA 2QVOA 3LA2A 1TTTA 3P9IA 4MQ9F 1X58A 4AU7A 3ABMH 2BHZA 4GO1A 1IXCA 4U88A 4P22A 5EGOA 3WE2A 1SFKA 3BR6A 1S72B 2QN6A 3VO1A 2O7OA 3OYEA 2OUMA 1HOMA 4CCNA 2X0LA 4NUBA 3JRIA 2TCTA 1XS9A 2WPDA 3RDIA 1DABA 2LF8A 1VQ9B 2M7BA 1JJ8C 2BXZA 4XONA 3SDBA 1KRHA 1IN6A 3CCLB 1DUXC 1MH3A 3MKWB 2ZJPF 1UHMA 2QZ8A 2E1MB 2FD5A 1ZR2A 1W87A 1MH4A 1WKMA 2ZJQF 2P4WA 4V2FA 3OR2C 4M6VA 1ZM9A 4E6KG 1VNDA 4KN4X 5KCMA 2IGKA 3DKWA 4OZYA 2ID6A 2M8EA 5F64A 2F5VA 2GA1A 3OSFA 4YFNF 4BXFA 1JRGA 5D5VB 2JA5J 2M3AA 2ZZEA 3CCJB 1O8HA 2QTLA 1KK0A 2QX3A 2MSYA 2HKXA 4NC6A 4YIFA 5CVUA 1EH7A 4HF2A 4YC5A 2GIZA 2ESNA 2OU2A 4WXCA 4LBYA 2L02A 2ISZA 2HS5A 4BDZA 1D3YA 4Q4ZF 4D7NA 3C7JA 1EFUA 5HDGA 5GTHC 3BQYA 2DYIA 4Q7JB 2JRTA 3WTVC 3I5UA 3W2VA 2K3PA 3OS0A 3BPXA 3BP8A 1FOYA 3AVXA 1GVDA 4G6DA 1CGPA 3ONYA 4GRIA 4B8XA 2HTSA 3IKTA 2HDWA 1ZUNB 4IPAA 1PVEA 2A6TA 2CH0A 2HXIA 3CJTB 1TUIA 3QU6A 3TW7A 2Y75A 1OGJA 4NBQA 1WMRA 5TISC 3CUOA 4WZLA 1T0FA 4A3FJ 1HF2A 2V6EA 3AVTA 3DFGA 1EA3A 1TTYA 1YJWI 5L3CA 1SMYF 3I3LA 2KVOA 3BNWA 3JAMK 4EH1A 1WH7A 2V31A 3OYFA 2V7QA 1LEAA 3A8JA 3N97A 1HG8A 1G7RA 5GAGJ 2PLYA 3HGGA 1MABA 1X3UA 2XAJA 1CQTA 2A5YB 2QSGX 2ZL5A 4ZDOA 2DTZA 3K0LA 3M9AA 2F5FA 4L18B 1DBGA 2JPBA 4C2MJ 1B1BA 2M0MA 4HOBA 3TQNA 5M5WJ 1S9HA 4G6IA 2K9MA 1U5TC 1EH6A 1HDDC 1DARA 4YAOA 1N07A 4YEIA 3IH3A 3Q39A 1RIOH 2VFQA 3GFJA 1I1GA 1ZHFA 3CZ6A 1BOAA 1MD0A 2EH3A 2QYOA 4NC7A 1BJKA 1T6XA 3ECHA 3JREA 2R7TA 5E20A 3AGPA 3PQJA 5A8AA 1JJ2B 1QA1A 1JT6A 2OYNA 4AVZA 4OOXA 1MJAA 2UV1A 1AA7A 1UG2A 3TO9A 2X6OA 1D8TA 3F3XA 1OQYA 3SEZA 5FL7A 3LSGA 1DQUA 1YX5A 3I4NJ 1A5JA 2VE9A 1G4DA 3MKZA 1K6YA 4JBAA 4WZKA 2K9QA 2GXGA 2PFBA 3VWBA 4RDJA 3HOUJ 2CQKA 3H9GA 2B7CA 2E34A 2LOOA 3ELKA 2QMUA 1RUOA 1GHCA 2OAZA 1O3RA 5FD5A 4QSHA 1YS6A 5IYDJ 5AIPA 3SJZA 2BGCA 1X0CA 3LWFA 2ZCWA 3BQJA 3QWLA 4I98B 2J8KA 3BC8A 3LSPA 1M1EB 1XE1A 1VQNI 1TYXA 1YS7A 1HSTA 3Q6RA 3T1BA 4BHPA 5FFZA 1ETWA 3S1NJ 5HKKA 4RGUA 5JBQA 5KVRA 3H3UA 3RYPA 3K1NA 2MH9A 4ZGNB 1X1PA 3OFNA 3ZXSA 3GYHX 2IOUG 2X3HA 4NQWB 3F22A 4P25A 3SZGA 2O1DA 3AVVA 2DA2A 1UD3A 1WHUA 1YHQI 2IQ7A 3HC7A 5LLQA 2DI3A 2E35A 1HW2A 2HDDA 2OQRA 1A8PA 2XKOA 3ASOH 3NARA 2CQQA 1UG0A 3N6ZA 4OPSA 3R61A 2NVQJ 2XEXA 2J5PA 1QPMA 3FK6A 1YHQB 3DBHB 1YITI 5LHHA 3LA7A 1FOXA 3OOCA 2WV0A 4D5CA 5F4MA 3VMFA 4MHGA 1W5CC 3I56I 1QGAA 3OIQA 4MYUA 1NBMA 4RM0A 4Z2YA 4DIQA 3PVDA 4NQWA 3S8PA 1TQMA 3DKYA 2D74A 2W6JA 2XTWA 3C2BA 5E3LA 1D1CA 2HYJA 4XMYA 1RESA 4B44A 2STTA 4NCNA 3SY2A 2MG4A 1W7PB 1Z91A 1OB0A 2VPRA 4A5MA 4XORA 5E3MA 3BG5A 4J19A 3T51B 3CD6B 1KD1D 4KKTA 1TQPA 2CGPA 2KIFA 1Y39A 4KYWA 3S3OA 3RQ4A 1WI3A 2XUBA 3KP5A 3A01B 4E7KA 1JA0A 4KT5C 3RSNA 3W2EA 2WSSA 5F0HA 3EYIA 4B43A 1IN8A 2J5OA 4J01A 3GQ9A 3QFRA 1KK1A 1R4MB 3CCQB 1P4AA 3HRTA 1KQ0A 3CD6I 3LSIA 2W4SA 3H5RA 2VJJA 1E3XA 1HBXG 3WG7H 4A0ZA 3RIRA 2NS8A 2BF4A 1YJ9B 3FHNA 3UW0A 2F5CA 2PIAA 2XAFA 2R7FA 3SZEA 2QSFX 4IRHA 3MZHA 1SD7A 2MGQA 3HKZN 4GQNA 1OKRA 3Q5FA 2BOLA 2F4IA 2CUZA 2E7WA 4XLEA 4Z4UA 4UY8I 2CYYA 1FBUA 1WJFA 4JYKA 2NT6A 2GXBA 1T33A 4ZYGA 4YAFA 3FKJA 3HSFA 5A2QZ 2OTJB 3SFIA 4AIHA 4Z4VA 1ONVA 1IB0A 3NWTA 5C44J 4RD0A 3ZP5A 4F7DA 2XV4S 2JDIA 5B5EC 1OFEA 2ZXHA 3E5QA 1AMOA 1O3SA 2EPFA 4OM9A 1HKQA 1R6RA 1W0UA 4E7IA 1LDJA 4BHCA 2D3NA 1LJ9A 4LG3A 4ZJZA 1BJZA 2HFHA 4MIMA 3PIOF 2CW8A 2WA0A 1SMTA 3LNQA 2V9VA 4XRMA 3MAJA 3S17J 5DTDA 1ZG1A 1TT0A 3OY9A 2IGNA 1WPCA 4IL6C 2QCOA 3AVWA 2IW5A 3ZQHA 3ECOA 4XLNF 3WHBA 1Z7LA 1BL0A 4AF7A 1MW7A 1YJNI 2DCUA 2K86A 1K83J 3DV8A 3CCUI 3FX3A 4AM3A 1YJWB 3KZZA 3LOCA 1SFXA 2P5KA 4LLGF 5L3FA 1CF7A 2XTXA 3OAAA 1EJ9A 2K4BA 3ABKH 1V5EA 1H8HA 2E60A 5EDNA 2LK2A 2FBKA 3GTKJ 1WSVA 2QENA 3QFCA 3SJPA 5EEAA 3K4BA 4NHJA 5F0FA 1XQBA 4CDGA 4DOZA 5E79C 1Y1VJ 2EV6A 4P9UA 4XN3A 3B90A 1K8AD 4A93J 2EFNA 2JK3A 4OPWA 1W0KA 2C6YA 2KIUA 5D5WB 3QPSA 3PA2A 1GDTA 3AG3H 1H0MA 2GPJA 2L01A 5FLXZ 2H1KA 2CW0F 2V1NA 3KEYA 3VNVA 3FZVA 5DS9A 1ETOA 4QPOA 4LK1F 2LD5A 2O0WA 3ZSCA 2B9SA 4ZDPA 3T53B 1WJEA 5HZBA 1YYVA 1JT0A 2ESHA 1N08A 2Y2ZA 1XX5A 1Y0UA 2UXXA 3ZZUA 2IA0A 2L9VA 4DGWB 3SEQA 5HNHA 1AHDP 3RI4A 1JB9A 3L9FA 3PFIA 2X51A 3K6GA 2XROA 1BIAA 2KFDA 2O8XA 3KYLA 3ZBTA 3BQZA 2GAUA 1EWYA 2VIXA 4QIWN 3ZOBA 3ZMVA 2QE7A 5JHFA 1WJ5A 4HAMA 3DLAA 3E6CC 1QVUA 2DDBA 4P1WA 4H9GA 4CCOA 4EM2A 2R7QA 4KA4A 1IRFA 3ZZ0A 1KQ9A 1TWAJ 3HUGB 2HDCA 1SFUA 4M6XA 3IC7A 1D1AA 3W2HA 1VQOI 3KYCB 4RD6A 4GXOA 5THXA 2R5ZA 2O9LA 2V26A 5JHUA 5D4RA 3I64A 1DPUA 3WHCA 2ZFWA 5ICCA 5FO0A 1FY7A 1OISA 2ELHA 3IUOA 1ZQ3P 4P6YA 3W2IA 3ZIAA 2E36A 2H1LA 2OD5A 3CUQA 1G2HA 1N0VC 5IYWA 2BYVE 5LFAA 1XG2A 4XRSA 4IHYA 1QUEA 4I76A 1WJDA 4YIRX 3DP7A 3VMVA 3CCSB 2R92J 2XZOA 2W1OA 1YRNB 1FDRA 2F5EA 2A61A 3C2GA 3OIPA 3H0DA 1KU7A 2KRFA 1TT5B 3HB9A 1YTYA 4KISA 3P26A 2NTQA 1UELB 3GZ6A 2EIXA 1MSFC 3M07A 3AVUA 3LFUA 2QA4I 1WFXA 1W0JA 1BR4A 2LZJA 2V7FA 4CXFA 3OW7A 4AVPA 5B1BH 1OYWA 5E17F 1R5HA 4OJ5A 2LY9A 2JZYA 3GTOJ 2O03A 1CLWA 3SZPA 2HWVA 5E18F 1E3PA 3F8BA 2KP6A 1BPLA 2VXDA 1T08B 2D1VA 3RPUA 5J40A 5DUKA 2DJNA 3CUQC 2L9NA 2M2EA 4UHTA 2QA4B 4TMTA 2FUG2 4C43A 4EQQA 1D5VA 3A3GA 3K4KA 1XD7A 2Z99A 3JRBA 1U9NA 2CW7A 3G71B 1Z05A 1LFUP 1XSDA 3CW2A 3C18A 4YDTA 2IAIA 1FRQA 2R7DA 3K4CA 3CMMA 3CB4A 4XKCA 3TMOA 4ON0A 4EGZA 3WGHA 5LBQA 1V5FA 3C2HA 2XSJC 2X6WA 3K70D 2BVMA 3GTMJ 2W25A 4HQMA 3CRZA 5IYNA 3F0CA 1B8IA 1XB2A 1WXRA 3OL4A 5IP6A 1K5CA 4M71A 4LG0A 2MH2A 5K7ZA 4G6QA 4QVJA 5CVIA 2ZXIA 1BM9A 2KMUA 3F72A 3P5JA 2QKMB 4UUVA 1EP2B 1KZLA 3SYTA 3ABUA 4XKWA 1HCRA 3CCEI 5GPCA 2CQXA 5DD8A 5K5OA 2XNCA 3BCAA 1U0JA 3HHGA 1YLFA 1NG7A 1MBKA 5FKMA 1B9NA 4BYYA 1W36D 1NTCA 2HPMA 4BXXJ 3JQPA 4S0HB 3T0YA 3KP2A 1FYKA 2EWEA 2LG4A 4A0YA 2H6CA 3KETA 3G6EB 1O8KA 3CCVI 3WTYC 2YWHA 2XASA 1LFBA 1LEBA 4AWXB 4M0LA 1M90D 3OOUA 4UZFA 3SLDA 1CNEA 2GWRA 3DTEA 1EP1B 3G2BA 4E70A 2BW3B 2W24A 3DKXA 4RAZA 1ACIA 1W4MA 4UB8C 1G6NA 4QLCU 3ASPA 2E1MC 3CMYA 1IJWC 5LHGA 1I6XA 2B7EA 2IVMA 4DBQA 3WTSC 3PSFA 1X3WB 3KX2A 2Q6OA 4I09A 1FYLA 4EM1A 2OA4A 3UNGC 1ELOA 5A88A 3DDYA 3Q9SA 4RCYA 1EFTA 4JMQA 4FASD 3DPUA 2BZTA 2KLOA 1PP8F 3V8LA 2I1LA 1WOPA 4HEA2 4CZZA 5ICGA 3RKWA 4EGYA 1YRNA 1VQ4B 1O88A 3P9KA 2KKOA 1FYMA 3KEWA 1VQPB 1P2FA 3SFZA 2WJYA 3A0HC 4A3LJ 3K70C 4I0BA 5EGOB 2R7WA 2EZKA 2QSHX 3ISPA 3NB2A 2BV3A 4QV2A 3TP0A 2BEOA 4TKOB 1IZ1A 1E2XA 1XGNA 1SFEA 2Y0SA 3RKQA 2A3SA 4A3BJ 1WWXA 2DO7A 1O4XA 1EP3B 1MZBA 2OCCH 1Z9CA 2R93J 5FIUA 5FRNA 1BN5A 2IS1A 2DMPA 2ODLA 3MZYA 5LMZA 4LLLA 4UUSB 3E7LA 2NT9A 1LQ1A 4ZTFA 2XGDA 1FNDA 2K4JA 4IQ4A 1BHEA 1EKEA 4H4KC 3CDHA 2CRGA 4PJLA 3I71A 4HPQA 2ADUA 4D7MA 1OHHA 5AN9A 1J5YA 4FE4A 5LGUA 5C4XJ 4IVNA 3HOYJ 5M3MJ 3ZBUA 3S2DJ 2QDXA 3ZQFA 2ZBVA 3ZQIA 1IJEA 5L46A 4CH7A 3DCFA 2IA2A 1TQIA 2EA4A 2ETHA 1X19A 1SC7A 4OAZA 4KUMA 2M34A 2LDUA 5JLWA 1D0XA 1I8DA 1RC9A 1ZRDA 1VI0A 2CNDA 3CJQB 3QODA 3BTIA 2XF6A 2VJ4A 3OYGA 4F93B 1TP4A 1I39A 4BGDA 3KEQA 1AKHB 3SHFA 1VQKB 1E0EA 1QCXA 4OIQF 1R1VA 3OZVA 5HVQC 2HQ5A 2CJJA 5JI6A 3KYDB 3KPHA 3LQQA 4XRSG 3CCJI 3WXMA 3BJAA 5J35A 1KCCA 3GIRA 3LAPA 4Y15A 3DF8A 2RQQA 3LSTA 2DT7B 4HNVA 2DFEA 3HXLA 3KCCA 4XK4A 4TN1A 1WJAA 4WCGA 2O3FA 2A69F 3W2WA 4HDVA 1BX0A 2Y31A 4RMNA 4CHUA 1QBJA 2CMPA 3HOTA 2L0KA 4YG2F 3OYCA 3G4SB 4XNFA 2XC7A 2V5IA 1Z6RA 4CGZA 2CUFA 5LEKA 1R36A 4TMWA 2K9LA 1S8NA 3NAWA 1N8RD 4F3QA 1ZLKA 1X4PA 4HX7A 1XB4A 1ZM3A 2INVA 1Y56A 3GLLA 3CMAB 3A1YA 3RQIA 4Z4TA 4PJ0C 1WTHD 4KN7X 2GM4A 3HL2A 4U0VA 3CC4I 4ASUA 3RZOJ 1N05A 4M74A 2DK5A 1K79A 1RZ4A 4RS8A 2E71A 3P4GA 1JKOC 2DK8A 3GQ8A 4HW0A 1ZRCA 2DMTA 1R5OA 4W8QA 3HPGA 2K7LA 3M4OJ 1E64A 2YS9A 2Y30A 2NTBA 2K9NA 2UVEA 2ID3A 3BOQA 2JA6J 1X3ZB 1FC3A 4EMSA 4XLCA 2BGJA 3FXJA 4PGGA 1AOYA 4OIRF 1I3QJ 3K9TA 1IG7A 4MQVA 1WSRA 1YJ9I 2OC6A 3HEFA 5ICEA 2OZUA 1Y8RB 2XAGA 4YRVA 2KPMA 3IH4A 5F08A 2COMA 2O0YA 4RD2A 1IDJA 2PMHA 2F2EA 3ML6A 3S32A 5E1XA 1ZR4A 3BCDA 4NC8A 3DBRB 4ZGQB 3GRHA 4BXUA 3CC7I 3WG9A 3I0TA 4WZEA 4YHBA 2J8IA 2KL4A 1J0RA 1MBGA 2VJIA 1XMXA 4KIGA 2A68F 3CP8A 3VSLA 1JKQC 1N0UA 3KZYA 3AVYA 4YCQA 2HOEA 3EQOA 3VB2A 3ASSA 2R7OA 5CJ9A 4P12A 1XCBA 3CF5F 1TWGJ 3GFLA 1QHHD 3E3VA 1S0UA 3ROUA 2HVQA 2PE3A 1EH8A 2D45A 4IJAA 2LF7A 4HLYA 1G3TA 1X2MA 2RC5A 2EILH 4ESFA 2P6TA 3JR9A 5FA6A 1D2EA 2BVNA 2GJKA 4Z4SA 4YFOA 2TDXA 5FFXA 2ZTNA 2V1DA 2F6CA 3GVLA 3TGNA 3BH4A 3ZN0A 3ASNH 1Z21A 1BMFA 4A5NA 3R0JA 1E3ZA 1R1TA 2X53S 2QEXI 9ANTA 1QGZA 3LO8A 1DDGA 3JSOA 4KMUX 3J80K 2VC1A 4Y4RA 3HSEA 2C2WA 5LHIA 3JURA 1EFRA 2EINH 3BR3A 3V42A 4B4CA 3ZQCA 1IGNA 1VQ5I 2M4KA 2NRAC 2LTPA 4WQMA 2Y9YA 2VI6A 4G5GA 4EJVA 1MNEA 4ACBA 2M0CA 4ZYEA 3EUHC 1J9IA 1BLIA 3GXOA 1NK2P 3DU5A 4HX4A 2XPVA 1HVXA 4IOCF 4KNYA 5EZHA 4LBWA 3CLOA 4ENNA 4LG0B 2HYFA 1BN8A 1K61A 4BY7J 3KP7A 3D5RC 1YX2A 4WWVA 1MBFA 2AS5F 4GDFA 4BQOA 4BQQA 3BJ6A 2HOTA 4RA2A 5F04A 1T95A 1WDTA 1YW7A 1R1UA 4IW3B 3I56B 3HRMA 2LY1A 2FBIA 2AQEA 2ZMEB 5CPRB 4MNUA 1L3LA 2L3DA 2VUMJ 3EDPA 3ZUGA 2LH9A 4QWQA 1ZLJA 1XGOA 4DQKA 3FXRA 4RAYA 2FOKA 4G7WA 4M72A 2HPIA 1PXZA 4LBVA 4PJNA 1WP6A 3ZQQA 5EEHA 3QYBA 3LAJA 2EIKH 2VT3A 3MN2A 5J3LA 3I59A 3ZPLA 2VASA 2V9PA 2V4JC 1VHOA 3A02A 1P6RA 2HNHA 3U1DA 2R7VA 2CU7A 5IP7J 1RPWA 4KFCA 2IRFG 1HZEA 5EMNA 5L3GA 4A3EJ 3OYLA 4TMZA 2R7UA 5IPAA 3PO3J 2VBYA 3W6JB 4U7BA 2Q6IA 3CPWB 4FISA 2VKEA 4A0XA 4M3EA 2WAQA 1X1AA 4U87A 3BY1A 1XPXA 5FLMJ 4ROXA 2DA6A 3WQZA 2C5HA 2VBEA 1IB4A 3ZPNA 4UV8A 2P8TA 4EJTA 2E1NA 4F55A 2RC4A 2ZTGA 2AXTC 1WH5A 4P9FA 4N3NA 4RB2C 1Z6TA 4KT6A 1GT0C 3KRGA 4OP7A 2O61A 2GOXB 2V4DA 4B1RA 1FSEA 2JVHA 4XQFA 4YAWA 2EK5A 1ODDA 5E3OA 5EJCA 1TYWA 2Z16A 4J0QA 3E20A 2ECCA 3J7YJ 1MRZA 1QGYA 4EEFG 3IAS2 2LY2A 2YPRA 2QQAA 2X85A 2VKVA 1RKTA 3BDDA 4L9NA 5FJ8J 2C4TA 2VFNA 1KCDA 1BI1A 2KRCA 2WAFA 1LVKA 1IV6A 2DA4A 2VE8A 1IF1A 2GJPA 3D1NI 3K4JA 1TNTA 4L0ZB 2DMQA 1A31A 1MBHA 2ACJA 2L54A 4TV7A 3W2FA 3QPTA 1USTA 2M4GA 2X48A 3P9CA 4R8HA 2DTRA 2E1BA 3OKXA 2XT2A 2V7WA 5D5UB 3VSUA 3K1PA 2DY1A 3DQVC 4EV0A 2CS3A 1EV7A 3GTQJ 3HM5A 4GCVA 4M2LA 4Q47A 5HLTA 1FP2A 2KT0A 1IRGA 1FWZA 4G8XA 4IEJA 1XFOA 1FBQA 4LJZF 1QFYA 2BX6A 3PSZA 1E63A 1VQMB 1OCRH 4U0WA 5FRMA 4P3IA 4FQGA 3DBLB 2CV2A 1YJNB 2PMZA 1HLVA 3ZPPA 5BPIA 1UAAA 1K4ZA 1MMNA 2G9WA 3CQZJ 2HVSA 1JNYA 1QFJA 2AXLA 2WBMA 4MO7A 3Q9VA 4G7ZF 3FXMA 1COWA 4OINF 4RBOA 3TBIA 1OGOX 3BT9A 1I50J 1Y0NA 5ILSA 2LC2A 4S04A 5FNZA 4PGHA 2PECA 1R00A 3FDYA 3HOWJ 4XSXF 1MMSA 2F3LA 5FKOA 1S7AA 5B3SH 2FOWA 4IZZA 1VQ6B 2NYXA 3KIOA 2LBFA 1RRJA 4ZV4A 3ZN1A 2Y69H 4RB3C 2E1OA 2KIQA 1ZG3A 2V7UA 3GZ5A 3BC9A 1GQ8A 1QNTA 1X1DA 1HW5A 1WI9A 2C5BA 4K1XA 1SVLA 1QA3A 1MMGA 2MD0A 3KFWX 5CVJA 2DQRA 2HYGD 1XGMA 2QLZA 3V7SA 2Q8KA 5IT9K 2R7RA 1Q82D 4DYQA 3G6EI 4KITB 1MKMA 1TWFJ 1Z67A 5DM6F 2EB7A 2DMUA 3QU3A 4HF1A 3S16J 3OP1A 1RQRA 3R0AA 3GEZA 5K7HA 2JPCA 3VYSB 2M9HA 4EJUA 3GVJA 3U21A 2JMWA 3GFIA 4Z05A 3OW2B 3EUAA 2VJ5A 1JTXA 1BOBA 4R1HA 2BGIA 1IAWA 4FXUA 4W1UA 5F4OA 2VBVA 3SEJA 4HYEA 4IHSA 1G7CA 4YELA 2GK7A 1VZ0A 4X7DA 1KYWA 4XLHA 4Y13A 1HKSA 1YI2B 1HF0A 3H0GJ 2WC2A 2XPUA 2UUZA 3FMRA 2QXZA 2B5OA 2RC6A 4ZH4F 2X4HA 4NK8A 5FKLA 5E6TA 5J4YA 2JUCA 4CZCA 3HG9A 1U3EM 2JN9A 3TH0A 1WORA 3ES9A 2YUHA 3P7NA 4P55A 3LSRA 1WOSA 1VQ4I 1DDNA 1WQ2A 3WTWC 4IHVA 1S6LA 2WTEA 4V02C 2GQFA 5JLXA 1H9GA 2NXNB 5BNGA 4LOCA 3WU1B 4Z1MA 5J8FA 2OF7A 5IOYA 2IA1A 2NOJB 1NRKA 2QWWA 1U2RA 1EZGA 5IYCJ 1OMIA 4U0YA 1I7PA 5H5JA 1YG2A 2VFOA 3FXKA 2OTLI 3HKZA 1E1QA 1ZRFA 3CCMI 2E1CA 3EQNA 1VF9A 4CYDA 5TV2A 2JVGA 3JRGA 1VBLA 5IT3A 2O17A 5DS0A 3LFKA 2D9RA 5HZAA 2FVGA 3T9GA 1UJ8A 4X7CA 2KHMA 4IRIA 3BJOA 3GTLJ 5LD2C 3PUFA 4JOMA 1GV5A 3FXLA 2PJPA 4LD5A 3OZWA 4G7OF 3AL0B 3AFHA 1YX3A 1YW9A 2EIMH 2XF5A 1U78A 2M30A 4P2NA 1O8GA 5GP9A 2DA3A 1XTAA 1WZ2A 1OFMA 3MWMA 3N05A 3VYUB 1O57A 4EVIA 2VQGA 4BJ6C 5BMZA 4RD3A 2W7NA 3F8FA 2DCEA 4B09A 5H2FC 1IXRC 2Z33A 1M1KD 3CDLA 5FLVA 3FMSA 3WNBA 4IOAF 2WB1A 2D5VA 4RGRA 1IDZA 4LBZA 5HODA 2ISYA 3CC2B 5GPAA 5F6FA 1HSJA 4ZDLA 2XGJA 3W6KB 1EA0A 2GXAA 5EG0A 2HDNB 2H94A 2CG4A 2JJ7A 3GVKA 2YX7A 1VQLB 1O8DA 5L3EA 4BBRJ 2ME0A 4O5VA 4OZZA 2WY8Q 2DA5A 2W57A 4XLFA 3ZQGA 2DU9A 3T5XA 4G6TB 3JQRA 3GTJJ 2L7KA 1XSXA 2PMUA 3JAMZ 1QFZA 3HRUA 5EEGA 1Y6IA 3CO7C 1JKPC 1VQLI 2GREA 4XKBA 3CESA 3PUNA 1OFLA 2ICWG 3IHUA 2OTJI 1XGSA 1SKYB 3HYIA 3CPXA 3PFYA 2HQRA 1EE6A 2NVXJ 2ZNYA 4LB5A 3VEPA 2LMDA 5HS7A 5J8CA 1TNSA 1W9XA 4I01A 3KP3A 4KICA 4X0CA 3V7AA 4BE2A 1BW6A 4E7HA 3FBIB 1ETQA 2H8WA 2BXYA 2L2OA 2ZZGA 3BY2A 2XHKA 1K4TA 2HI3A 2EFGA 5D4SA 4UVAA 4OOIA 3MKYB 2F4MB 3Q6QA 1Z77A 2DJIA 4JX5A 2QKLB 2R9VA 4L9TA 1RQPA 2LR8A 1IN5A 3AG4H 4XOTA 1GR1A 3ERMA 1JUSA 3GX4X 3PNYA 2OBRA 2AO9A 1HC8A 3BCFA 2H09A 2VT2A 3JRFA 2VBSA 2NPFA 4MXNA 2K85A 3HTSB 4MYTA 1YIJB 5KHDA 3KLOA 5TRDA 3FPPA 2CFOA 2D2WA 2IGOA 2VBXA 3CMAI 2R7SA 3ZQ7A 3S3NA 1LKXA 1MGTA 2EV5A 4IXAA 2HEOA 3M8EA 3PO2J 2IS4A 2ZL7A 3FY3A 2FQ4A 3C1DA 3RIQA 1ON1A 1ZGWA 3REOA 2Q2EB 1FOKA 2MD5A 1DBOA 3NE5B 5IOZA 2FRHA 4UUSA 3J81k 3LL7A 5DNSA 1ZELA 2DPUA 1QGPA 1W7PA 2R5ZB 4BHBA 4LLNA 4HE5A 1S29A 3EUHA 2ZB9A 1F60A 4MR0A 3PA1A 2KZGA 5GADJ 5JR3A 4AIKA 2Z6BD 4PMHA 1DU6A 4HV6A 3E1YE 1GAQA 4Y9RA 5DCFA 1JHFA 2Q0OA 4UUTA 4M3DA 3W6VA 4XOPA 3CCEB 3CDIA 3OYAA 2X8KA 1A6IA 4P1VA 3OJXA 2V79A 4QHYA 1B2RA 1REPC 2PBIA 3ZCOA 3RKXA 3FWEA 4DNRB 1RU4A 3O2PE 1Z3XA 4E7ZA 1WU8A 4E4HA 2CV1A 1BJAA 2W85A 1HQCA 4OWRB 3I58A 2ZSHB 5H6RA 1APLC 3L00A 1O8IA 5HXBA 2BVLA 1AKHA 4PC3A 1H80A 3OSGA 2V9KA 1RNLA 2ZBKA 4KDPA 4G1BA 3QPHA 1XDSA 2MLKA 1H9TA 2XNDA 1IUFA 3DTIA 4W97A 4X0GA 1VQNB 2HZTA 3I54A 1I5ZA 1FX0A 1HW1A 3VFZA 4XD7A 4BH9A 4JX6A 1CNFA 4B3GA 3R6SA 4D5FA 1O8MA 4I02A 4NB5A 3SZTA 2YU3A 1OCCH 4HZFA 1R58A 1LUJB 1QHGA 5C1CA 4M3GA 2CC2A 1NK3P 1L0OC 1MBEA 4PGOA 2WJVA 4BKXA 1R4NB 2VB6A 2ZXJA 3CCRI 3KE2A 1YFHA 3ONUA 1D0ZA 2IEKA 2B0LA 2OZ6A 2PLFA 3A1PA 1OFDA 3MVPA 4E7SA 3OYJA 3W2GA 4HLXA 2X6XA 3K4NA 2ZBUA 2JRMA 3VSVA 1MDMB 4IF4A 2DOEA 2RQPA 4XL9A 4LGWA 1R49A 3S2HJ 1TW2A 3BTLA 3QQAA 2BM4A 3JTGA 1FMVA 3GO5A 5L3DA 4C30A 3OZUA 4M1KA 1FMWA 3J7AY 1G3YA 1W36C 1V5VA 2DOGA 2JA2A 3IP4B 2R5YB 3JRCA 5B6IA 1QO0D 2NAZA 1Q81D 3B8YA 2OTLB 5FO1A 4A3KJ 2JA7J 3PJRA 4II2A 3E6BA 1V4RA 4Y52J 4YZQA 1X1CA 2NVUB 1I18A 1T6YA 4I2OA 2JA8J 4B4DA 1QU3A 2DN0A 3PIPF 4QFMA 1OPCA 1N75A 3H36A 3LQ6A 4HNTA 2O8KA 4X05A 2VBMA 4IQJA 2HGCA 2HQNA 3BTJA 1ZREA 1DPRA 1Y0YA 4L5IA 1SVOA 2F48A 2MFZA 2YX4A 4Z4RA 1UMKA 2HCJB 1QJVA 1FLIA 2QZAA 4E7JA 3HOXJ 4ACAA 1QA2A 5IP9J 3QFTA 4BE1A 2FMYA 4IO9F 1KK3A 4PAAA 2XB0X 4OJOA 1CQXA 4CICA 5EG0B 1D1NA 3O6BB 3RY8A 2X9DA 1YE9A 2COBA 2BY2A 2E1RA 3B8HA 2I5UA 2P7CB 1FP1D 2GQQA 4D1QA 2FU4A 3I53A 1G7TA 4A2UA 3G1MA 4ENMA 1ZGAA 1MNDA 3G73A 2I10A 2Z9OA 2M87A 4CUGA 2XRNA 4RDUA 3H9QA 2YUSA 1U8RA 5CYVA 3L09A 4G7HF 3T8TA 2FEZA 2B0RA 1FNMA 1SAXA 4O3MA 3CCYA 1IJFA 2UVFA 2M1BA 1TYVA 2ZMEC 4UV9A 1TW3A 3OWTA 1W2BB 3Q3AA 2LSOA 2PG4A 4EJWA 1NJID 1ZM4A 4FE7A 3COAC 3GW2A 3JU4A 4U49A 3A01A 4KMFA 4GYGA 3RYRA 4F7ZA 1NB0A 2Z8GA 4HWVA 1O3TA 3CC7B 2DAOA 3OEHA 2IT0A 1F36A 3C3WA 1XMAA 3V7CA 2VC0A 4AF6A 2QM3A 4G12A 2JIZA 2Z2SB 4X07A 4BNCA 5DSZA 4OOVA 4W8TA 5DUIA 2DIEA 1P4WA 2Y48A 3CTAA 1QRCA 1LE8A 4LB6B 1PYVA 4KKSA 2E2HJ 5CVVA 1LLWA 3EQLF 1AIRA 4ESBA 2EBIA 3CCUB 2K40A 2LRDA 2EA2A 2LLKA 3H9JA 3I9V2 3TDUC 4BU2A 1IRXA 1B72A 1TYUA 3LSMA 3ONQA 1UHWA 4RLQA 1BC7C 2VYQA 1KTVA 3AG1H 1IC8A 3R6KA 4RPBA 3TDZC 1HA3A 2G7HA 1VF7A 4YFKF 3WY9A 1IA5A 3BH6B 1VQPI 3U2RA 3L2WA 4OPOA 2QGUA 1FNBA 1VQ5B 1IRZA 1BI2A 3AK5A 3OYKA 2BM7A 4KKUA 2WV1A 4C2LA 3WU2C 2A07F 3FM5A 4BS9A 4DJAA 2HZDA 4F92B 1UD6A 2L4MA 4M9SA 5K1YA 3GQ7A 3L1PA 1NG6A 3A8KA 4TMXA 3BR2A 4XLPF 3OYBA 5EYRA 2JTVA 3EETA 3ZMSA 2FJ1A 1E79A 1WPKA 1HXDA 4CA0A 1BW5A 3GSIA 1O7FA 4M73A 5E3NA 3BLYA 1H89C 1WCMJ 4ZYHA 2J7KA 4U7DA 3QAHA 4EJOA 5LEJA 3SDGA 3QFSA 4P3YA 4Q5SF 3CP2A 2FNAA 2XAHA 3H35A 2ZJRF 4UAJA 5KSWB 4B3AA 1WJCA 3HGYA 1SKQA 4DZPA 1SFOJ 1MIJA 4BPRA 3QP5A 4U4BA 2VQLA 2BSAA 2L7MP 4L9JA 5GTIC 1G7SA 5GV8A 3N4MA 4DYRA 4AYBA 4O6JA 4RCZA 3H92A 4HE6A 4PC6A 4YIIA 3GCMA 4P5OA 1UB9A 5BPDA 3F8NA 2XSDC 4V19K 2RNGA 4RM3A 1KYZA 1OCTC 4XIDA 2EZLA 3I4MJ 3H9NA 1E1RA 1R22A 3K7AJ 4LMYA 2DODA 1S7OA 3OL3A 5FKKA 3MQ0A 2PQ8A 2DYSH 2DYRH 5LRRA 2YWEA 1IDYA 3FKIJ 3I4PA 4PSWA 1BC8C 3J81Z 2F1MA 3DEEA 2DT5A 4NDLA 3FKSA 5JMCB 4Z4ZA 4HQEA 4G94A 2EJRA 2VOOA 1N78A 2MYSA 1CZFA 1ZG5A 1DDIA 1B23P 3TL4X 3VYRB 3CXCB 4Y3OA 1TLLA 3CCRB 5IYQA 5HS8A 2BMWA 5F4JA 2BM0A 2CK3A 4HF0A 3PNTA 4LK0F 1GXPA 4ITVA 4YAUA 3SYJA 2DERA 2M7AA 2O6GE 1I1SA 2WR8A 3LSJA 3ZMDA 3WTXC 1GVJA 3PL8A 2Y0SN 3QOEA 2W7ZA 2LP0A 4JK1X 1E43A 3G4SI 5LRSA 1OGMX 3EUKL 1PKVA 2WZPP 4I6ZA 3GQBA 2QUFA 2VFMA 4WWCA 5CQGA 4MEYF 5HLHA 2ZXWH 1V0FA 4DK1A 2L9RA 2FNPA 1E3OC 3FHZA 5AMVA 4DQ2A 1T8IA 4CCLA 2GZWA 1V54H 3KP6A 2NVTJ 1SD6A 2GK6A 1Y8QB 1QH0A 5EZGA 4TMVA 4B48A 5BOXA 4BEHA 1Z7UA 4D0PA 4WZTA 1TSPA 4TSFA 3A35A 2R6HA 2ZC2A 2EIJH 1B4AA 1X4OA 2D3LA 3OR1C 3WGIA 2X3UA 3ZQLA 1OGIA 1R5GA 4DQLA 2PYGA 5HS9A 1KU3A 2WAQN 3BG3A 1HDPA 4YXWA 1KZHA 2VQCA 3CO6C 2MC3A 1OYYA 2VFPA 3OYNA 4I99C 3QSYA 1S5LC 1OR7A 1U2WA 2M8GX 3GQAA 2ZFUA 4ZYAA 3QRFF 1IW7F 2HVRA 5LGNA 3F9KA 2BBYA 5A89A 3OIOA 6PAXA 4AIJA 1RKWA 2E2IJ 3ULQB 4EW9A 1GJRA 3LNNA 3H94A 2JJ1A 3S14J 3HOVJ 4AC9A 4X1EA 3CCVB 1JUMA 3GVAA 3BY6A 4QTRA 2VONA 3S15J 1KK2A 1V0EA 1V3FA 4M9XA 2V7TA 3HJEA 1JKRC 1H88C 1J2XA 3L2CA 2LNBA 3BR5A 4GFBA 2OPTA 2BM1A 4CO8A 1T98A 5M5YJ 2VPLA 1X2NA 1A04A 2R0QC 1MNMC 3DPLC 4BQAA 3SLNA 5ILVA 2R7XA 4C0SA 2FX3A 2K5CA 3WE3A 5HDKA 5J1RA 1A6QA 1QVFB 3U6KA 3NAUA 3KP4A 1BA5A 3V7RA 3A8IA 3QE2A 4RDKA 4C3JJ 2HMAA 1BR1A 4PZJA 1A35A 2B63J 5BS6A 4RLZA 1YIJI 1B72B 5DYMA 3GTGJ 1LDDA 4S05A 2P5LC 2M5WA 1D1BA 1XDUA 2VKHA 4Y9UA 4RGXA 1FT9A 2CUJA 1PUFB 1VQMI 3SXYA 1K9MD 2CV0A 3CMEB 2DXIA 2EWNA 2XAUA 2VLAA 2Q6LA 4A3DJ 1I3AA 4P9SA 1SAUA 4WXHA 1Y0RA 4AUXA 3K1MA 5E1ZB 1LDKB 3ABTA 1YOVB 1PLUA 3J80Z 1IO2A 3I55B 1FZPB 1YIOA 4AD9A 2QBYA 1UD8A 2L7ZA 3DTKA 1P7IA 3BCBA 2KDZA 4NNJA 3V76A 1T38A 3Q38A 2DETA 1ERDA 2HLDA 3TOAA 2MC4A 1DP3A 1HA8A 2G0YA 3OYMA 3OEEA 2FA5A 1HKTA 2ELKA 3G3ZA 3O8GA 4MGRA 3OE7A 5HLIA 4FWTA 1ZTRA 1YW8A 2LKPA 3ASRA 4YZ0A 1D8KA 1H8AC 1LLZA 2A6HF 3KEOA 5J4VA 4CYCB 1FPQA 5D8LB 3IWZA 5M5XJ 2XZLA 1D5YA 3SKBA 2RAEA 1G3SA 1U5TA 5ICFA 3S3MA 2CSOA 2QQBA 2VBKA 1IN4A 3SJMA 2G7UA 1WOOA 2XIGA 2NS0A 4M3BA 4IX7A 4ZZLA 3HPHA 1K6OA 1GAWA 5H59A 4ABZA 1N25A 3RTRA 3PETA 4PABA 3FPKA 2K9SA 1OLTA 1KTWA 3LYCA 2HXOA 1DU0A 4P6VF 4RAFA 2PJRB 1STZA 4X8IA 1S72I 3BPVA 4W8SA 5E8GA 3EPZA 2F1LA 4FN5A 2RGVA 2CO5A 3RKYA 1FJLA 1VQ7B 3PSIA 1PE9A 4X7FA 2BSPA 4DW6A 2WB1N 3MMPA 1VQKI 2C77A 2H27A 1T0FC 5E1WA 2XGEA 4UXNA 4MLOA 2PMDA 3CLQA 5TR9A 3PM1A 1QG0A 4Z03A 1H8EA 3RPQA 1O8FA 1QUFA 4PUSA 5J6XA 1SANA 3HHHA 2WWYA 1J7KA 2KDOA 2ZO4A 4PCQA 2WADA 2FBHA 4HSTA 3U9GA 1OYIA 4FETA 1JTYA 5K5RA 1QRYA 3GFMA 1UD5A 4KJZA 3DU6A 1PJ5A 3VPRA 2R4GA 2RN7A 1W7PD 3FXUA 4OIPF 2GOMA 2OBSA 1PDNC 4AYBN 5HDNA 1Y1WJ 1QPIA 1K8FA 3FBNB 3KL9A 3IV5A 1ULYA 1IXSB 3GZNB 5H6QA 1UD4A 3WTUC 1PP7U 5B1AH 4DNTB 4C2UA 5IY5H 2CBXA 2JT1A 5GV7A 1H85A 1QQ1A 1OCZH 1E17A 4I84A 4R79A 2ZITA 3WU0A 4G9YA 4A3JJ 3JX8A 4JP0A 1R5NA 1D0YA 3G71I 1BI3A 1LM1A 5D6EA 3WBJA 3UR3C 2DLLA 4LITA 4AC0A 1WSUA 4Z6YA 3PUBA 4GYIA 4B3FX 2DOFA 2ZKZA 4RB0A 3ZRGA 3WNCA 1XSVA 2AHQA 3O3KA 4RDLA 2STWA 2NZMA 1XMKA 5K7FA 2NNYA 2WY7Q 2BY3A 4DBRA 3H5AA 3JRAA 2CRVA 4LC0A 2ZNZA 2IP2A 4OIOF 2A5WA 2CQ7A 4C2TA 1QZEA 1Q1HA 3T8RA 3FMQA 1JGSA 3H5NA 1P7JA 3S1RJ 3CC4B 3GMEA 1G3WA 2PYHA 3WODF 5CDFA 2DBBA 2D1HA 5KAFC 3BG6A 3L2VA 2VQHA 2X0KA 2ECBA 1UCRA 1AWCA 2O04A 4BBSJ 2FSWA 4V2GA 1TLHB 2P6SA 5FB2A 1OB2A 4XSZF 4Y17A 4ETSA 4IRGA 3SQVA 1T6ZA 3BZCA 1NHCA 1S4MA 1SD5A 5K5QA 3T56B 2VXZA 1ZGJA 3OYDA 4KH3A 2JWTA 1JUPA 1R23A 2RV8A 4BE0A 1VFCA 3BG7A 3MZ8A 1LB2A 3MD2A 2R5YA 4ZCIA 4OOSA 4HG2A 4DNCA 1RUNA 1FSHA 3CJNA 3U2QA 4A3GJ 3HZJA 5DCMA 1VLOA 1OB5A 2L5QA 1BBYA 4F91B 1FTZA 2FF4A 4X6AJ 4PSXA 3IH2A 2JQ7A 3DXJF 1SVMA 3H09A 2G0EA 5J3OA 5LGTA 3FXQA 1LPQA 2NSPA 3DEUA 1T2KA 4M4SA 3JSPA 3QPLA 4PJJA 4K2EA 4DK0A 3F8CA 3K4LA 3Q3SA 3PENA 4M53A 3GF2A 4IKFA 3R6JA 1MBJA 5D6FA 1JGGA 1C0WA 2A6EF 4NBSA 3K69A 2QY1A 2XRLA 3DPTA 4X06A 1YLOA 4M6YA 3ZMZA 4I7HA 5HLGA 5C4JJ 1CF7B 1K28D 1Z3YA 4RM2A 4PFOA 3IWFA 4Y33A 1TBXA 2BE5F 2JN6A 3WBKA 5M3FJ 2OV7A 1Z1DA 2DEUA 1R5ID 3D26A 2KRHA 2LVSA 1KQ5A 2KQRA 1DG1G 3PNVA 1YO5C 2QYUA 2BV6A 2P0WA 5D8KB 2VNKA 3HRSA 3M7GA 5GAHJ 2EFQA 2FQ3A 3M1EA 1XC5A 2VN2A 1FIAA 1MJBA 2EFPA 3S1QJ 1P92A 2HR3A 3CCMB 3FIWA 3ASTA 3IAM2 5BSXA 1FBSA 4RD4A 3S1MJ 3F21A 1E3HA 2JSCA 2KJCA 4WK8F 2MW8A 4XM3A 3B02A 3LSKA 2EZIA 2ZZQA 2XKPA 1F9NA 4WF2A 5CLSA 4QPQA 2VNIA 3B6AA 4RAGA 2OK7A 3ZGKA 4YZAA 1ZK8A 4OJPA 1F20A 2NV4A 4CQJA 2P3MA 2GJRA 4A3IJ 1USSA 2IJLA 3RZDJ 1KMHA 4BUPA 5TGTA 5JVTA 4D9JA 2BPOA 2E5ZA 1IV8A 3LA3A 3V4GA 4CCMA 3PSSA 2UWMA 1R7JA 2Z5UA 4OMYA 4XLAA 3M3YJ 3NWSA 4II3A 4LIUA 2KISA 3OV8A 1JA1A 1GV2A 3QYEA 1U8BA 4W8RA 3I59B 3H1CA 4FX0A 1O8LA 2NNNA 2W48A 4B47A 2X1DA 3ZMTA 2DFFA 4L0YB 2R7ZJ
chains in the Genus database with same CATH topology
3H9GA 2LOOA 2KL4A 2VJIA 2UVFA 3CP8A 3VSLA 4CSWA 3EQOA 3OWTA 1X0CA 2R7OA 3LSHA 2I8DA 2INUA 3JU4A 3BC8A 4U49A 3OPOA 1QHHD 3OYIA 2Z8GA 3OMYA 4HWVA 3RCOA 5HOOA 3OEHA 4ZC3A 2HVQA 5IK2A 5HKKA 2GJKA 1JTAA 3L2QA 3CF2A 2ZTNA 2O0VA 2JIZA 2F6CA 2Z2SB 3ZXSA 3GVLA 3BH4A 3OFNA 4NQWB 2X3HA 1Z21A 3SZGA 1BMFA 2O1DA 2DIEA 4W8TA 3VYTB 1UD3A 3G05A 2IQ7A 3HC7A 1E3ZA 2X53S 1PYVA 4KKSA 1UG0A 4Y4RA 1T5EA 1AIRA 4PK4A 1OOCA 3JURA 2LRDA 1P9QC 4BU2A 3H9JA 3I9V2 3V42A 4HRIA 1IRXA 1EFRA 2M4KA 4Z06A 3LSMA 3ONQA 4RLQA 4BJTA 1MNEA 3OOCA 1BLIA 3EUHC 1VF7A 3DU5A 1IA5A 3OIQA 1NBMA 5DN6A 2NTPA 1HVXA 2NSTA 4DIQA 3S8PA 3L2WA 3DKYA 2W6JA 1VLYA 1BN8A 1RMGA 2E5NA 1D1CA 4XMYA 4B44A 3OYKA 4KKUA 3D5RC 4C2LA 1UD6A 5CQEA 4BS9A 4DJAA 2HZDA 4BQOA 4F92B 1OB0A 3GQ7A 4XORA 4BQQA 1NG6A 1T95A 3OYBA 3T51B 1O8EA 4URRA 1E79A 2LY1A 2AQEA 5CPRB 4CA0A 4KKTA 4OJLA 2LH9A 3BLYA 3S3OA 3RQ4A 3VSKA 4E7KA 3RSNA 2WSSA 4G7WA 2HPIA 4B43A 1PXZA 3CP2A 4PJNA 4J01A 1RWRA 3H35A 3GQ9A 1WP6A 2X1EA 3ZQQA 3QYBA 3LSIA 1WJCA 2W4SA 4OJ6A 3H5RA 2VJJA 1E3XA 2VASA 4B3XA 2V4JC 2VQLA 4PFPA 4U4BA 3FHNA 3K4MA 2HNHA 2LREA 4AYBA 2O5RA 4BDYA 2R7VA 4C9YA 3UW0A 1G59A 4P5OA 2RREA 1HZEA 3OYLA 1G8XA 4GQNA 2R7UA 2RNGA 4XR6A 3A2KA 4U7BA 2BOLA 4RM3A 2F4IA 2CUZA 4XLEA 4BQNA 3MMYB 2WAQA 1E1RA 1WJFA 1X1AA 4U87A 3WQZA 1PJRA 2NT6A 3VR6A 1IB4A 2VBEA 3ZPNA 3OL3A 3FKJA 4F55A 2ZTGA 1TZLA 3NWTA 4CCKA 2L9SA 4PSWA 4KT6A 3KRGA 2ZXHA 2F1MA 3DEEA 2V4DA 2GOXB 3A4CA 3FKSA 2JVHA 4XQFA 1N78A 1R6RA 2MYSA 2Z16A 4E7IA 2F43A 1CZFA 3TL4X 3VYRB 2D3NA 4Y3OA 3IAS2 2LY2A 2X85A 4LG3A 4ZJZA 1KCDA 5C1EA 2XDVA 2CK3A 3PNTA 2WAFA 2KRCA 1LVKA 2CW8A 2WA0A 3CJRB 4ITVA 2GJPA 2M7AA 3K4JA 4LIVA 1TT0A 1MMAA 2MABA 2IGNA 3PL8A 2M4GA 3OY9A 3QOEA 4ZTJA 1WPCA 2E1BA 2IGMA 1E43A 4L8JA 1OGMX 1Z7LA 2HU9A 3EUKL 1MW7A 3K10A 1PKVA 2WZPP 3VSUA 3GQBA 3DQVC 2CS3A 4XN0A 1DGRM 5HLTA 5CQGA 1V0FA 2XZPA 3QYFA 3OAAA 4DK1A 3VMWA 2AQFA 5AMVA 1V5EA 1H8HA 2E60A 4CCLA 3D5LA 2GK6A 2ELJA 5FRMA 3K4BA 2CV2A 1O8JA 2PMZA 4B48A 4BJ5C 4BEHA 4DOZA 3ZR8X 3ZPPA 1UAAA 4TSFA 1MMNA 4CCJA 2HVSA 4XN3A 3A35A 4UZUA 3B90A 2WBMA 3OS1A 3L2UA 1X4OA 1COWA 2D3LA 3OR1C 1W0KA 3TBIA 3GBGA 4PJMA 1OGOX 2PYGA 2JSPA 2LC2A 3OYHA 2PECA 4YXWA 3FDYA 2VQCA 2X1CA 2V1NA 3KEYA 4IZZA 3OYNA 3RPUD 2VL8A 2LBFA 4QPOA 2O0WA 3GQAA 5KNLA 3ZSCA 4ZDPA 3T53B 1WJEA 2ZFUA 1OR7C 4ZYAA 3BC9A 2HVRA 1GQ8A 1X1DA 3F9KA 2VKDA 1MMGA 4J00A 2MD0A 4DGWB 3SEQA 5HNHA 4BL0B 3D5SC 2X51A 3K6GA 3KYLA 4EW9A 3LNNA 2R7RA 3H94A 4KITB 2VIXA 2KZVA 2JJ1A 3LMWA 2QE7A 5JHFA 4BACA 1WJ5A 3DLAA 4P1WA 4N4NB 2XF7A 1V0EA 4CCOA 2R7QA 3VYSB 3GVJA 3U21A 4Z05A 4HSRA 3EUAA 2VJ5A 3HUGB 1BOBA 4FXUA 1D1AA 2Q1ZB 2VPLA 4JQFA 3DPLC 4YELA 2GK7A 1VZ0A 2R7XA 2V26A 1BR2A 2K5CA 4XLHA 4BEHB 2UUZA 3IUOA 1IDKA 2QXZA 1BR1A 3ZIAA 1XG2A 4NK8A 4CZCA 5LFAA 3HG9A 1DGWY 3VMVA 2IXSA 1WJDA 1D1BA 2VKHA 2XZOA 2W1OA 2CUJA 2JUGA 3E0JB 3C2GA 3OIPA 3H0DA 2CV0A 3S93A 4Z1MA 2DXIA 2XAUA 2VLAA 2WAEA 4KISA 1UELB 3AKZA 2NOJB 2Z1DA 1N77A 1NRKA 2NTQA 1SAUA 4NK6A 1LDKB 3LFUA 1W0JA 1WFXA 2IS2A 1BR4A 2LZJA 2V7FA 3HKZA 3OW7A 1E1QA 1PLUA 2LYCA 3EQNA 1VBLA 2JVGA 1UD8A 4OJ5A 2O17A 3DTKA 3BCBA 3T9GA 4NNJA 2KHMA 2KP6A 2VXDA 1BPLA 5LD2C 4JOMA 1ERDA 3M8JA 2HLDA 2MC4A 2L9NA 1DP3A 1HA8A 3OS2A 1MMDA 2FUG2 3OYMA 3AL0B 3AFHA 1JI8A 3SUCA 3OEEA 1YX3A 3A3GA 2XF5A 3WWGA 3K4KA 1O8GA 3VSTA 4E7LA 3OE7A 2CW7A 1OFMA 3N05A 3VYUB 1UD2A 4YZ0A 2VQGA 4BJ6C 3HOSA 2W7NA 2ZZFA 2DCEA 3K4CA 3CMMA 2XZLA 4XKCA 3TMOA 3HAGA 3S3MA 1V5FA 2VBKA 3C2HA 2WB1A 2X6WA 2XSJC 2BVMA 3K70D 3AL0C 4G7XA 4IX7A 3OL4A 4ZDLA 1GLNA 2XGJA 3HPHA 1K5CA 5HNFA 3RTRA 4TT3A 1OLTA 3GVKA 1KTWA 3A3BA 2ZXIA 1O8DA 2KMUA 2QKMB 1V5GA 3W3CA 2PJRB 3SYTA 1KZLA 4OZZA 4XKWA 2WY8Q 4XLFA 4W8SA 3BCAA 3EPZA 1U0JA 4G6TB 1W36D 1NG7A 2HPMA 1WJBA 2L7KA 4EATA 2W82A 3PSIA 1PE9A 2BSPA 2EWEA 2LG4A 4RLFA 4F52A 1T0FC 2IS6A 1Y6IA 4MLOA 1O8KA 4HNUA 4Z03A 1H8EA 1O8FA 4XKBA 3CESA 4PUSA 1OFLA 1SKYB 3PFYA 2W6IA 3OOUA 2KDOA 1EE6A 3B4NA 3DTEA 3G2BA 2WADA 2BW3B 2X6YA 3DKXA 1W9XA 4HSTA 2XOKA 4FETA 1VJSA 4BE2A 4E7HA 3FBIB 1J09A 2L2OA 3L2RA 2E1MC 1UD5A 2ZZGA 4XKVA 1X1BA 4KJZA 3DU6A 4DBQA 3MKYB 2M5SA 2DJIA 2R4GA 2W00A 3KX2A 2QKLB 3PSFA 2GOMA 2R9VA 4HIZA 4XOTA 3UNGC 4YZXA 3DDYA 3FBNB 3PNYA 3BCFA 4N4OB 1UD4A 2BW3A 4MXNA 4JMQA 4DNTB 4C2UA 4FASD 5KHDA 4YEJA 3DPUA 2KLOA 3FPPA 2CFOA 2IGOA 4HEA2 3M1CA 2R7SA 4I84A 4R79A 2JJ2A 1O88A 3S3NA 2HQAA 1LKXA 1D0YA 4OAYA 3KEWA 3FY3A 2IS4A 1KONA 2WJYA 3UR3C 5FROA 3K70C 4LITA 4E0FA 4ANJA 3VDXA 2Q2EB 3PUBA 2DT6A 4B3FX 2PJRA 1DBOA 3LMMA 2R7WA 2ZSIB 2LBFB 3NE5B 3DWLE 3ZRGA 3LL7A 1ZELA 2DOAA 2NZMA 3W2AA 1LFPA 4TKOB 2WY7Q 4DBRA 5CKTA 3H5AA 4MR0A 2Z6BD 2Y0SA 3E1SA 4PMHA 4AU7A 2A5WA 4P22A 4C2TA 5FRNA 2IS1A 2ODLA 1SFKA 4XOPA 3OYAA 2X8KA 3H5NA 3OYEA 2NT9A 2OUMA 4ZTFA 4IQ4A 1BHEA 2PYHA 5CDFA 4CCNA 4NUBA 4H4KC 2WPDA 3ZCOA 3BG6A 4PJLA 2M7BA 4HPQA 3L2VA 2VQHA 2O04A 4DNRB 4XONA 3SDBA 1RU4A 1Z3XA 4E7ZA 4E4HA 2CV1A 1OHHA 4OWRB 3MKWB 1NHCA 2ZSHB 2E1MB 3T56B 2VXZA 1O8IA 3OYDA 3OR2C 2BVLA 4CH7A 1H80A 4BE0A 4E6KG 2V9KA 3BG7A 1X19A 3MD2A 2IGKA 4OAZA 5KCMA 2XNDA 4OZYA 4HG2A 3DTIA 1D0XA 1JRGA 2F5VA 4X0GA 1I8DA 4BXFA 1O8HA 2ZZEA 2L5QA 2M3AA 3CJQB 4F91B 3QODA 1FX0A 2XF6A 4PSXA 2VJ4A 3OYGA 4XD7A 4B3GA 4F93B 1O8MA 2QX3A 4BGDA 2NSPA 1E0EA 1QCXA 5HVQC 1QHGA 4BDZA 5C1CA 4PJJA 2WJVA 4DK0A 2VB6A 3K4LA 1D0ZA 4IKFA 1KCCA 3W2VA 2K3PA 4E7SA 3OS0A 3OYJA 2QY1A 3DPTA 2X6XA 2RQQA 3K4NA 2DT7B 3VSVA 3HXLA 4GRIA 1WJAA 1Z3YA 2HDWA 4XL9A 4RM2A 1K28D 4PFOA 3W2WA 2A6TA 2CH0A 4RMNA 4Y33A 2CMPA 3HOTA 1WMRA 3OYCA 1FMVA 2OV7A 4XNFA 2XC7A 4C30A 2V6EA 2K9LA 2KRHA 1FMWA 1EA3A 3J7AY 2KQRA 2KVOA 3I3LA 4F3QA 1W36C 1X4PA 3PNVA 2JA2A 3OYFA 3IP4B 2V31A 2P0WA 2V7QA 1Y56A 1HG8A 2INVA 3B8YA 4YZQA 3PJRA 4II2A 1MABA 1X1CA 3A1YA 1I18A 1WTHD 3IAM2 3HL2A 1QU3A 4ASUA 1N75A 4HNTA 2VBMA 4IQJA 4ZDOA 4XM3A 1DBGA 3GQ8A 4W8QA 3LSKA 2ZZQA 2M0MA 4QPQA 3HPGA 4G6IA 1S9HA 2NTBA 2K9MA 2UVEA 2MFZA 1QJVA 3ZGKA 4YZAA 4OJPA 4E7JA 3CZ6A 4XLCA 2GJRA 4NC7A 4BE1A 1KMHA 4OJOA 4BUPA 5TGTA 4D9JA 2E5ZA 1YE9A 4CCMA 2R7TA 2OC6A 2UWMA 4XLAA 4AVZA 4D1QA 4YRVA 2KPMA 3NWSA 4II3A 4LIUA 2UV1A 1AA7A 5FL7A 1IDJA 3QYEA 1MNDA 3SEZA 3LSGA 3S32A 4W8RA 1DQUA 1YX5A 4CUGA 3BCDA 3H9QA 4NC8A 1O8LA 3MKZA 1K6YA 4B47A 2X1DA 3GRHA 2JDIA 3VWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZF A;  2ODL A;  4XOP A;  2VJI A;  3EQN A;  1VBL A;  2UVF A;  4OJ5 A;  2NT9 A;  2X85 A;  2O17 A;  1KCD A;  3EQO A;  5C1E A;  1BHE A;  3T9G A;  2PYH A;  1X0C A;  2INU A;  4U49 A;  2O04 A;  2Z8G A;  4XON A;  1RU4 A;  4HWV A;  3SUC A;  3WWG A;  1NHC A;  1O8G A;  3VST A;  1OGM X;  1OFM A;  1JTA A;  1O8I A;  3VSU A;  4YZ0 A;  2O0V A;  2X3H A;  1H80 A;  4XN0 A;  2O1D A;  4W8T A;  4OZY A;  2IQ7 A;  1JRG A;  3VMW A;  1O8H A;  5AMV A;  2VBK A;  2X6W A;  2QX3 A;  1O8M A;  1AIR A;  1O8J A;  2NSP A;  1K5C A;  1OOC A;  3ZPP A;  3JUR A;  1QCX A;  4XN3 A;  3B90 A;  4Z06 A;  1KTW A;  1O8D A;  5C1C A;  4OZZ A;  4XKW A;  4XLF A;  1OGO X;  4W8S A;  2PYG A;  1IA5 A;  1KCC A;  2PEC A;  2NTP A;  2NST A;  1PE9 A;  2BSP A;  2EWE A;  2QY1 A;  2X6X A;  1BN8 A;  3VSV A;  1RMG A;  4XMY A;  1O8K A;  4XL9 A;  2O0W A;  3GQA A;  4Z03 A;  3ZSC A;  4C2L A;  1O8F A;  3GQ7 A;  1OFL A;  1GQ8 A;  4XOR A;  1WMR A;  4XNF A;  1EE6 A;  3B4N A;  1O8E A;  4URR A;  2X6Y A;  4OJL A;  4EW9 A;  2INV A;  1HG8 A;  3B8Y A;  3LMW A;  4YZQ A;  4XKV A;  1PXZ A;  1RWR A;  3GQ9 A;  4XOT A;  4YZX A;  4Z05 A;  4OJ6 A;  2VBM A;  2VJJ A;  4MXN A;  4XM3 A;  1DBG A;  3GQ8 A;  4U4B A;  4W8Q A;  4YEJ A;  3UW0 A;  4YEL A;  2NTB A;  4I84 A;  2UVE A;  1O88 A;  1QJV A;  4YZA A;  4XLH A;  4OJP A;  4XR6 A;  4XLC A;  3FY3 A;  1IDK A;  2QXZ A;  4XLE A;  1XG2 A;  4NK8 A;  4OJO A;  2NT6 A;  3VMV A;  1DBO A;  1IB4 A;  2VBE A;  4XLA A;  4AVZ A;  2NZM A;  1IDJ A;  4MR0 A;  3KRG A;  4W8R A;  2NTQ A;  4PMH A;  1O8L A;  4XQF A;  4NK6 A;  3GRH A;  1PLU A; 
#chains in the Genus database with same CATH topology
 2MLG A;  2YWG A;  4PC2 A;  5DDG A;  2RNJ A;  4CSW A;  1I6H J;  2PI0 A;  1FTT A;  3LSH A;  3CUQ B;  3NRV A;  2I8D A;  1K4S A;  2Y0M A;  2INU A;  1TWC J;  1R9T J;  3OPO A;  3OYI A;  4A3C J;  3OMY A;  3Q0W A;  4OU0 A;  3RCO A;  3JCU C;  5HOO A;  4ZC3 A;  2UZK A;  1LE8 B;  1UZC A;  3FM3 A;  1A36 A;  3WND A;  1F43 A;  2EFO A;  5IK2 A;  1Q7Y D;  1EXM A;  2F4O B;  3TOB A;  1SD4 A;  2PX9 A;  5CVR A;  4HDU A;  4ESJ A;  2V7X A;  1JTA A;  3L2Q A;  3CF2 A;  2HOA A;  4HA8 A;  3H3Z A;  4LFU A;  4RGS A;  1QZY A;  2O0V A;  1U6G A;  1Q86 D;  3B78 A;  3JTH A;  3ZC3 A;  3VYT B;  2C4U A;  1RI7 A;  3G05 A;  1K7A A;  5KW9 A;  3CCS I;  3GLX A;  3IKV A;  1T5E A;  1ITY A;  4PK4 A;  1OOC A;  1ZH5 A;  5DD4 A;  1P9Q C;  4BY1 J;  4HRI A;  5FLX K;  4RB1 A;  4QUZ A;  4Z06 A;  2DA7 A;  1VHE A;  2LFB A;  3TKY A;  4BJT A;  3IRQ A;  4N9H A;  5DEQ A;  2NS7 A;  3W5V A;  1J75 A;  3FIS A;  1GXQ A;  5DN6 A;  2NTP A;  1ZN2 A;  2E2J J;  2NST A;  2BM5 A;  1QVT A;  2K3F A;  3O8H A;  2O6W A;  3BZK A;  1VLY A;  3V8J A;  2E19 A;  4H0E A;  4MTD A;  2E5N A;  1K78 A;  1RMG A;  3AGQ A;  2XC1 A;  3WTZ A;  3TW6 A;  4FCY A;  5CQE A;  3FK7 A;  1B59 A;  1KA8 A;  3CCQ I;  3AG2 H;  4OPV A;  1UHS A;  3LJY A;  1O8E A;  4ASN A;  4URR A;  5F1J A;  1VQ8 I;  3FXO A;  2N8G A;  1R71 A;  4OJL A;  1EF4 A;  2EV0 A;  2NOG A;  5BQT A;  3VNU A;  3BZ6 A;  3VSK A;  5EF6 A;  1MDM A;  4PC7 A;  1L1I A;  1T56 A;  2Q2E A;  4R71 A;  2BM6 A;  1I27 A;  2BHY A;  1RWR A;  2ZL6 A;  1BIB A;  4YFX F;  2X1E A;  2Q6K A;  2CF4 A;  5TY0 A;  2XGX A;  1S3J A;  4OJ6 A;  2H8R A;  2F5D A;  4FHT A;  4B3X A;  1B6A A;  4PFP A;  2GA2 A;  1MJ9 A;  3WGG A;  3BH7 B;  1PJ7 A;  2LRE A;  3K4M A;  4BDY A;  2DMN A;  1ZYR F;  2O5R A;  3X2Q H;  4C9Y A;  5DCM B;  3ZMU A;  2WYR A;  3RJP A;  1AIP A;  1GO2 A;  2W84 A;  1G59 A;  2RRE A;  1TWH J;  2QBY B;  1G8X A;  1FOW A;  4XR6 A;  1FIP A;  3A2K A;  1RET A;  3K2A A;  1P4M A;  3JQQ A;  1ZKG A;  3FF5 A;  4BQN A;  1ETY A;  3FJO A;  3B82 A;  2VNJ A;  3ZZT A;  3MMY B;  3QOP A;  2A05 A;  1ZAO A;  2TRT A;  1PJR A;  3VR6 A;  2DW4 A;  4DZJ A;  1TZL A;  4CCK A;  2L9S A;  3W5U A;  1KU9 A;  2L4A A;  1F1Z A;  1F4K A;  2OBP A;  3E5X A;  3A4C A;  1QA6 A;  2IBD A;  2XTY A;  2IPQ X;  5FGM A;  5D5X B;  1UFM A;  2R3S A;  2GIV A;  1POG A;  2K02 A;  2F43 A;  4FK8 A;  3WYA A;  1NH3 A;  1XG1 A;  1KU2 A;  4ZYD A;  3EYY A;  3IRR A;  2XB5 A;  3BR0 A;  2OCE A;  1XN7 A;  2CFX A;  2XDV A;  4I0A A;  1BX1 A;  2YWF A;  1QVG B;  5C1E A;  3CJR B;  4N3G A;  1FNN A;  2DPD A;  3M8F A;  4HX8 A;  3G1O A;  1N06 A;  4L9V A;  1Q9S A;  1PJ6 A;  3ISX A;  3L7W A;  3E6M A;  1Q1V A;  2V1X A;  2XPW A;  4PC1 A;  1QRB A;  4LIV A;  2VBZ A;  1MMA A;  2MAB A;  4PDK A;  4ZTJ A;  5J1Y A;  3I55 I;  4G1V A;  2IGM A;  3MCA A;  4L8J A;  1FRN A;  2XT4 A;  4C3H J;  3S2W A;  2E7X A;  2HU9 A;  3E6D A;  3K10 A;  1F5T A;  3GTP J;  5JLV C;  3HIF A;  4UNO A;  5ERI A;  4XN0 A;  2V1U A;  2PEX A;  1DGR M;  1SEU A;  3TED A;  3A03 A;  5FKN A;  1NDH A;  4Y7C A;  2HKO A;  2XZP A;  3LVB A;  2FML A;  3QYF A;  3VMW A;  2AQF A;  1ETV A;  2QF7 A;  2ME6 A;  3SQN A;  2EZH A;  2CUE A;  4ZZD A;  3BWG A;  1UMQ A;  3D5L A;  3JRD A;  2ELJ A;  1O8J A;  4BJ5 C;  1MSE C;  1TVC A;  3ZR8 X;  2M45 A;  2DA1 A;  4CCJ A;  4UZU A;  1P4X A;  3J81 K;  2L7F P;  3OS1 A;  1YQA A;  1RR7 A;  4FT8 A;  3L2U A;  3Q0V A;  1SM4 A;  2HTJ A;  3I1F A;  3F6V A;  1ORK A;  3GBG A;  4PJM A;  2FE3 A;  2DQL A;  2JSP A;  3NQO A;  5C3E J;  3OYH A;  2QTZ A;  3VOE A;  3ML3 A;  1W5S A;  1FNC A;  1JHH A;  2UXN A;  2X1C A;  4RD1 A;  1WVR A;  1VQ9 I;  1O7L A;  3ESW B;  3RPU D;  4KIF A;  2VL8 A;  4ZCM A;  3PQK A;  2XAQ A;  4UB6 C;  5KNL A;  5DM7 F;  3CCL I;  3W5H A;  4GGG A;  1OR7 C;  1PUF A;  4IHW A;  2VKD A;  4JX4 A;  3BG9 A;  2CW5 A;  1BI0 A;  4HBL A;  1W1W E;  2EFW A;  4J00 A;  1V55 H;  2WZN A;  1VQ7 I;  4BL0 B;  2C78 A;  3VO2 A;  3D5S C;  5KAI C;  3IL2 A;  1J59 A;  2YSR A;  3TP3 A;  2RVC A;  4X7E A;  2KZV A;  3HTU A;  1OJL A;  1KQS B;  3LMW A;  4BAC A;  1PUE E;  2DDA A;  1ZAR A;  3H3V K;  3MFK A;  5A2Q K;  4N4N B;  3G1L A;  2XF7 A;  4AID A;  4ZCL A;  2Z3Y A;  1BQE A;  1AU7 A;  4MFE A;  4HSR A;  4Z4W A;  2BY0 A;  2V7V A;  3LQE A;  3N90 A;  3B73 A;  3QP6 A;  4L5E A;  2FX0 A;  2Q1Z B;  1ETX A;  2K27 A;  4JQF A;  2PMZ N;  2BY1 A;  5JFR A;  3ASQ A;  4RJL A;  1IUY A;  1ENH A;  3BRO A;  1BR2 A;  3OJW A;  4UZE A;  1TL8 A;  4DYC A;  4BEH B;  4XIC A;  4UVB A;  1IDK A;  1WGX A;  4CYC A;  4M3F A;  1W35 A;  1NHA A;  1DGW Y;  2IXS A;  1LVA A;  1OCP A;  1KC8 D;  3Q0U A;  1W0T A;  4FTH A;  4EM0 B;  2JUG A;  1ZM2 A;  3R60 A;  3E0J B;  5IYP A;  3MHP A;  2Y9Z A;  1W5T A;  1KQ8 A;  3S93 A;  3R4K A;  2WAE A;  5DV5 A;  1E62 A;  3AKZ A;  2Z1D A;  1N77 A;  2NVY J;  1JE8 A;  5ILU A;  2ZME A;  4A12 A;  2VNH A;  3GWZ A;  4QVA A;  4NK6 A;  2P7V B;  2DFH A;  5H20 A;  1K78 B;  2IS2 A;  1T6S A;  2HOS A;  2YR2 A;  3DU1 X;  2LYC A;  2YU9 J;  3PUM A;  1KGS A;  1NB9 A;  5F1R A;  2VOD A;  4N0B A;  5E8I A;  4BAY A;  5L3B A;  3B6C A;  1QQI A;  1DP7 P;  3HOZ J;  3M8J A;  4L5J A;  5FD6 A;  5J47 A;  1U5T B;  1W34 A;  1S7E A;  3OS2 A;  1MMD A;  3SUC A;  5ED4 A;  2B7B A;  1JI8 A;  3LQR A;  4C3I J;  3MKL A;  4XRF A;  3ABL H;  3WWG A;  3VST A;  4E7L A;  1J9Z A;  4A6D A;  3TO7 A;  1UD2 A;  1VQ8 B;  2XGC A;  2QQ9 A;  3D0S A;  4RPD A;  4N9I A;  2CWE A;  5FO5 A;  3HOS A;  1XCV A;  2KJB A;  1D8J A;  2H6B A;  2ZZF A;  4Q48 A;  4JRA C;  3A0B C;  2P5V A;  5JVG F;  3HAG A;  2RDP A;  1R5B A;  3KLN A;  1OCO H;  4Y7N J;  3AL0 C;  3HBL A;  4G7X A;  2F4N A;  3WTT C;  5KK1 A;  1GLN A;  3HUG A;  2QQ8 A;  4MTE A;  3DLL F;  4IHX A;  4U9U A;  1Z0X A;  1ON2 A;  5HNF A;  1FEX A;  4A6E A;  4TT3 A;  1K73 D;  1VQ6 I;  4KIB A;  3E5U A;  2XNJ A;  3K2Z A;  1T39 A;  3A3B A;  2V6C A;  3U6B A;  1KJZ A;  3W3C A;  1V5G A;  4ENJ A;  1LNW A;  1JXS A;  1EFC A;  2OBT A;  1OFC X;  4UVC A;  1WRJ A;  5B66 C;  4FX4 A;  3F8M A;  5J1U A;  1WJB A;  4EAT A;  2W82 A;  4XBF A;  5GAE J;  4MFD A;  1IN7 A;  4RLF A;  4F52 A;  1QX4 A;  2IS6 A;  3JW4 A;  2DFI A;  1FX7 A;  1B9M A;  4HNU A;  3J7A O;  3MEX A;  3ERE D;  4A3M J;  2AHO A;  3E97 A;  3BTC A;  1QZZ A;  5AON A;  4P26 A;  2BN4 A;  2W6I A;  4A69 C;  4OMZ A;  3B4N A;  4M9Z A;  5TJJ A;  3CME I;  2FXA A;  2XVC A;  3MCZ A;  3HDD A;  4Z4Y A;  2X6Y A;  3AAF A;  3F23 A;  4YAL A;  2XOK A;  3DEW A;  1VJS A;  1TC3 C;  2ZJ2 A;  3P27 A;  3GUD A;  2OK8 A;  1VQO B;  3BR1 A;  1J09 A;  3L2R A;  2GBY A;  3TO6 A;  2QEX B;  4XKV A;  2EQR A;  1VTN C;  1X1B A;  3VOD A;  1IHM A;  1GUU A;  2M5S A;  2W00 A;  1YI2 I;  4HIZ A;  3OOP A;  5F27 A;  2CQN A;  1B8I B;  4YZX A;  1RR8 C;  4N4O B;  4IHT A;  5IT9 Z;  2BW3 A;  1U9O A;  4YEJ A;  2OQG A;  3V8K A;  2GLO A;  3M1C A;  1YIT B;  2VBW A;  2OJE D;  2JJ2 A;  2HQA A;  3KZI C;  2QGG A;  5AIQ A;  2KIM A;  4MEX F;  4OAY A;  1H42 A;  3F6O A;  3JRH A;  1KON A;  2VZL A;  5FRO A;  5IYB J;  5F0C A;  2MBF A;  2MA3 A;  2PN6 A;  4ANJ A;  1O3Q A;  2LKS A;  1GVH A;  3VDX A;  3J7Z I;  2VBT A;  4E0F A;  5IYR A;  2DT6 A;  2RKH A;  2PJR A;  3LMM A;  3UKG A;  2ZSI B;  4WXD A;  4P96 A;  3DWL E;  2LBF B;  4WX9 A;  2LKX A;  1ETK A;  2VBU A;  2DOA A;  4HV5 A;  2P81 A;  3CC2 I;  1JJ6 C;  1LFP A;  4ENK A;  3W2A A;  3U1K A;  5CKT A;  3NEU A;  2VOP A;  5BSY A;  3E1S A;  3HSR A;  2QVO A;  3LA2 A;  1TTT A;  3P9I A;  4MQ9 F;  1X58 A;  4AU7 A;  3ABM H;  2BHZ A;  4GO1 A;  1IXC A;  4U88 A;  4P22 A;  5EGO A;  3WE2 A;  1SFK A;  3BR6 A;  1S72 B;  2QN6 A;  3VO1 A;  2O7O A;  3OYE A;  2OUM A;  1HOM A;  4CCN A;  2X0L A;  4NUB A;  3JRI A;  2TCT A;  1XS9 A;  2WPD A;  3RDI A;  1DAB A;  2LF8 A;  1VQ9 B;  2M7B A;  1JJ8 C;  2BXZ A;  4XON A;  3SDB A;  1KRH A;  1IN6 A;  3CCL B;  1DUX C;  1MH3 A;  3MKW B;  2ZJP F;  1UHM A;  2QZ8 A;  2E1M B;  2FD5 A;  1ZR2 A;  1W87 A;  1MH4 A;  1WKM A;  2ZJQ F;  2P4W A;  4V2F A;  3OR2 C;  4M6V A;  1ZM9 A;  4E6K G;  1VND A;  4KN4 X;  5KCM A;  2IGK A;  3DKW A;  4OZY A;  2ID6 A;  2M8E A;  5F64 A;  2F5V A;  2GA1 A;  3OSF A;  4YFN F;  4BXF A;  1JRG A;  5D5V B;  2JA5 J;  2M3A A;  2ZZE A;  3CCJ B;  1O8H A;  2QTL A;  1KK0 A;  2QX3 A;  2MSY A;  2HKX A;  4NC6 A;  4YIF A;  5CVU A;  1EH7 A;  4HF2 A;  4YC5 A;  2GIZ A;  2ESN A;  2OU2 A;  4WXC A;  4LBY A;  2L02 A;  2ISZ A;  2HS5 A;  4BDZ A;  1D3Y A;  4Q4Z F;  4D7N A;  3C7J A;  1EFU A;  5HDG A;  5GTH C;  3BQY A;  2DYI A;  4Q7J B;  2JRT A;  3WTV C;  3I5U A;  3W2V A;  2K3P A;  3OS0 A;  3BPX A;  3BP8 A;  1FOY A;  3AVX A;  1GVD A;  4G6D A;  1CGP A;  3ONY A;  4GRI A;  4B8X A;  2HTS A;  3IKT A;  2HDW A;  1ZUN B;  4IPA A;  1PVE A;  2A6T A;  2CH0 A;  2HXI A;  3CJT B;  1TUI A;  3QU6 A;  3TW7 A;  2Y75 A;  1OGJ A;  4NBQ A;  1WMR A;  5TIS C;  3CUO A;  4WZL A;  1T0F A;  4A3F J;  1HF2 A;  2V6E A;  3AVT A;  3DFG A;  1EA3 A;  1TTY A;  1YJW I;  5L3C A;  1SMY F;  3I3L A;  2KVO A;  3BNW A;  3JAM K;  4EH1 A;  1WH7 A;  2V31 A;  3OYF A;  2V7Q A;  1LEA A;  3A8J A;  3N97 A;  1HG8 A;  1G7R A;  5GAG J;  2PLY A;  3HGG A;  1MAB A;  1X3U A;  2XAJ A;  1CQT A;  2A5Y B;  2QSG X;  2ZL5 A;  4ZDO A;  2DTZ A;  3K0L A;  3M9A A;  2F5F A;  4L18 B;  1DBG A;  2JPB A;  4C2M J;  1B1B A;  2M0M A;  4HOB A;  3TQN A;  5M5W J;  1S9H A;  4G6I A;  2K9M A;  1U5T C;  1EH6 A;  1HDD C;  1DAR A;  4YAO A;  1N07 A;  4YEI A;  3IH3 A;  3Q39 A;  1RIO H;  2VFQ A;  3GFJ A;  1I1G A;  1ZHF A;  3CZ6 A;  1BOA A;  1MD0 A;  2EH3 A;  2QYO A;  4NC7 A;  1BJK A;  1T6X A;  3ECH A;  3JRE A;  2R7T A;  5E20 A;  3AGP A;  3PQJ A;  5A8A A;  1JJ2 B;  1QA1 A;  1JT6 A;  2OYN A;  4AVZ A;  4OOX A;  1MJA A;  2UV1 A;  1AA7 A;  1UG2 A;  3TO9 A;  2X6O A;  1D8T A;  3F3X A;  1OQY A;  3SEZ A;  5FL7 A;  3LSG A;  1DQU A;  1YX5 A;  3I4N J;  1A5J A;  2VE9 A;  1G4D A;  3MKZ A;  1K6Y A;  4JBA A;  4WZK A;  2K9Q A;  2GXG A;  2PFB A;  3VWB A;  4RDJ A;  3HOU J;  2CQK A;  3H9G A;  2B7C A;  2E34 A;  2LOO A;  3ELK A;  2QMU A;  1RUO A;  1GHC A;  2OAZ A;  1O3R A;  5FD5 A;  4QSH A;  1YS6 A;  5IYD J;  5AIP A;  3SJZ A;  2BGC A;  1X0C A;  3LWF A;  2ZCW A;  3BQJ A;  3QWL A;  4I98 B;  2J8K A;  3BC8 A;  3LSP A;  1M1E B;  1XE1 A;  1VQN I;  1TYX A;  1YS7 A;  1HST A;  3Q6R A;  3T1B A;  4BHP A;  5FFZ A;  1ETW A;  3S1N J;  5HKK A;  4RGU A;  5JBQ A;  5KVR A;  3H3U A;  3RYP A;  3K1N A;  2MH9 A;  4ZGN B;  1X1P A;  3OFN A;  3ZXS A;  3GYH X;  2IOU G;  2X3H A;  4NQW B;  3F22 A;  4P25 A;  3SZG A;  2O1D A;  3AVV A;  2DA2 A;  1UD3 A;  1WHU A;  1YHQ I;  2IQ7 A;  3HC7 A;  5LLQ A;  2DI3 A;  2E35 A;  1HW2 A;  2HDD A;  2OQR A;  1A8P A;  2XKO A;  3ASO H;  3NAR A;  2CQQ A;  1UG0 A;  3N6Z A;  4OPS A;  3R61 A;  2NVQ J;  2XEX A;  2J5P A;  1QPM A;  3FK6 A;  1YHQ B;  3DBH B;  1YIT I;  5LHH A;  3LA7 A;  1FOX A;  3OOC A;  2WV0 A;  4D5C A;  5F4M A;  3VMF A;  4MHG A;  1W5C C;  3I56 I;  1QGA A;  3OIQ A;  4MYU A;  1NBM A;  4RM0 A;  4Z2Y A;  4DIQ A;  3PVD A;  4NQW A;  3S8P A;  1TQM A;  3DKY A;  2D74 A;  2W6J A;  2XTW A;  3C2B A;  5E3L A;  1D1C A;  2HYJ A;  4XMY A;  1RES A;  4B44 A;  2STT A;  4NCN A;  3SY2 A;  2MG4 A;  1W7P B;  1Z91 A;  1OB0 A;  2VPR A;  4A5M A;  4XOR A;  5E3M A;  3BG5 A;  4J19 A;  3T51 B;  3CD6 B;  1KD1 D;  4KKT A;  1TQP A;  2CGP A;  2KIF A;  1Y39 A;  4KYW A;  3S3O A;  3RQ4 A;  1WI3 A;  2XUB A;  3KP5 A;  3A01 B;  4E7K A;  1JA0 A;  4KT5 C;  3RSN A;  3W2E A;  2WSS A;  5F0H A;  3EYI A;  4B43 A;  1IN8 A;  2J5O A;  4J01 A;  3GQ9 A;  3QFR A;  1KK1 A;  1R4M B;  3CCQ B;  1P4A A;  3HRT A;  1KQ0 A;  3CD6 I;  3LSI A;  2W4S A;  3H5R A;  2VJJ A;  1E3X A;  1HBX G;  3WG7 H;  4A0Z A;  3RIR A;  2NS8 A;  2BF4 A;  1YJ9 B;  3FHN A;  3UW0 A;  2F5C A;  2PIA A;  2XAF A;  2R7F A;  3SZE A;  2QSF X;  4IRH A;  3MZH A;  1SD7 A;  2MGQ A;  3HKZ N;  4GQN A;  1OKR A;  3Q5F A;  2BOL A;  2F4I A;  2CUZ A;  2E7W A;  4XLE A;  4Z4U A;  4UY8 I;  2CYY A;  1FBU A;  1WJF A;  4JYK A;  2NT6 A;  2GXB A;  1T33 A;  4ZYG A;  4YAF A;  3FKJ A;  3HSF A;  5A2Q Z;  2OTJ B;  3SFI A;  4AIH A;  4Z4V A;  1ONV A;  1IB0 A;  3NWT A;  5C44 J;  4RD0 A;  3ZP5 A;  4F7D A;  2XV4 S;  2JDI A;  5B5E C;  1OFE A;  2ZXH A;  3E5Q A;  1AMO A;  1O3S A;  2EPF A;  4OM9 A;  1HKQ A;  1R6R A;  1W0U A;  4E7I A;  1LDJ A;  4BHC A;  2D3N A;  1LJ9 A;  4LG3 A;  4ZJZ A;  1BJZ A;  2HFH A;  4MIM A;  3PIO F;  2CW8 A;  2WA0 A;  1SMT A;  3LNQ A;  2V9V A;  4XRM A;  3MAJ A;  3S17 J;  5DTD A;  1ZG1 A;  1TT0 A;  3OY9 A;  2IGN A;  1WPC A;  4IL6 C;  2QCO A;  3AVW A;  2IW5 A;  3ZQH A;  3ECO A;  4XLN F;  3WHB A;  1Z7L A;  1BL0 A;  4AF7 A;  1MW7 A;  1YJN I;  2DCU A;  2K86 A;  1K83 J;  3DV8 A;  3CCU I;  3FX3 A;  4AM3 A;  1YJW B;  3KZZ A;  3LOC A;  1SFX A;  2P5K A;  4LLG F;  5L3F A;  1CF7 A;  2XTX A;  3OAA A;  1EJ9 A;  2K4B A;  3ABK H;  1V5E A;  1H8H A;  2E60 A;  5EDN A;  2LK2 A;  2FBK A;  3GTK J;  1WSV A;  2QEN A;  3QFC A;  3SJP A;  5EEA A;  3K4B A;  4NHJ A;  5F0F A;  1XQB A;  4CDG A;  4DOZ A;  5E79 C;  1Y1V J;  2EV6 A;  4P9U A;  4XN3 A;  3B90 A;  1K8A D;  4A93 J;  2EFN A;  2JK3 A;  4OPW A;  1W0K A;  2C6Y A;  2KIU A;  5D5W B;  3QPS A;  3PA2 A;  1GDT A;  3AG3 H;  1H0M A;  2GPJ A;  2L01 A;  5FLX Z;  2H1K A;  2CW0 F;  2V1N A;  3KEY A;  3VNV A;  3FZV A;  5DS9 A;  1ETO A;  4QPO A;  4LK1 F;  2LD5 A;  2O0W A;  3ZSC A;  2B9S A;  4ZDP A;  3T53 B;  1WJE A;  5HZB A;  1YYV A;  1JT0 A;  2ESH A;  1N08 A;  2Y2Z A;  1XX5 A;  1Y0U A;  2UXX A;  3ZZU A;  2IA0 A;  2L9V A;  4DGW B;  3SEQ A;  5HNH A;  1AHD P;  3RI4 A;  1JB9 A;  3L9F A;  3PFI A;  2X51 A;  3K6G A;  2XRO A;  1BIA A;  2KFD A;  2O8X A;  3KYL A;  3ZBT A;  3BQZ A;  2GAU A;  1EWY A;  2VIX A;  4QIW N;  3ZOB A;  3ZMV A;  2QE7 A;  5JHF A;  1WJ5 A;  4HAM A;  3DLA A;  3E6C C;  1QVU A;  2DDB A;  4P1W A;  4H9G A;  4CCO A;  4EM2 A;  2R7Q A;  4KA4 A;  1IRF A;  3ZZ0 A;  1KQ9 A;  1TWA J;  3HUG B;  2HDC A;  1SFU A;  4M6X A;  3IC7 A;  1D1A A;  3W2H A;  1VQO I;  3KYC B;  4RD6 A;  4GXO A;  5THX A;  2R5Z A;  2O9L A;  2V26 A;  5JHU A;  5D4R A;  3I64 A;  1DPU A;  3WHC A;  2ZFW A;  5ICC A;  5FO0 A;  1FY7 A;  1OIS A;  2ELH A;  3IUO A;  1ZQ3 P;  4P6Y A;  3W2I A;  3ZIA A;  2E36 A;  2H1L A;  2OD5 A;  3CUQ A;  1G2H A;  1N0V C;  5IYW A;  2BYV E;  5LFA A;  1XG2 A;  4XRS A;  4IHY A;  1QUE A;  4I76 A;  1WJD A;  4YIR X;  3DP7 A;  3VMV A;  3CCS B;  2R92 J;  2XZO A;  2W1O A;  1YRN B;  1FDR A;  2F5E A;  2A61 A;  3C2G A;  3OIP A;  3H0D A;  1KU7 A;  2KRF A;  1TT5 B;  3HB9 A;  1YTY A;  4KIS A;  3P26 A;  2NTQ A;  1UEL B;  3GZ6 A;  2EIX A;  1MSF C;  3M07 A;  3AVU A;  3LFU A;  2QA4 I;  1WFX A;  1W0J A;  1BR4 A;  2LZJ A;  2V7F A;  4CXF A;  3OW7 A;  4AVP A;  5B1B H;  1OYW A;  5E17 F;  1R5H A;  4OJ5 A;  2LY9 A;  2JZY A;  3GTO J;  2O03 A;  1CLW A;  3SZP A;  2HWV A;  5E18 F;  1E3P A;  3F8B A;  2KP6 A;  1BPL A;  2VXD A;  1T08 B;  2D1V A;  3RPU A;  5J40 A;  5DUK A;  2DJN A;  3CUQ C;  2L9N A;  2M2E A;  4UHT A;  2QA4 B;  4TMT A;  2FUG 2;  4C43 A;  4EQQ A;  1D5V A;  3A3G A;  3K4K A;  1XD7 A;  2Z99 A;  3JRB A;  1U9N A;  2CW7 A;  3G71 B;  1Z05 A;  1LFU P;  1XSD A;  3CW2 A;  3C18 A;  4YDT A;  2IAI A;  1FRQ A;  2R7D A;  3K4C A;  3CMM A;  3CB4 A;  4XKC A;  3TMO A;  4ON0 A;  4EGZ A;  3WGH A;  5LBQ A;  1V5F A;  3C2H A;  2XSJ C;  2X6W A;  3K70 D;  2BVM A;  3GTM J;  2W25 A;  4HQM A;  3CRZ A;  5IYN A;  3F0C A;  1B8I A;  1XB2 A;  1WXR A;  3OL4 A;  5IP6 A;  1K5C A;  4M71 A;  4LG0 A;  2MH2 A;  5K7Z A;  4G6Q A;  4QVJ A;  5CVI A;  2ZXI A;  1BM9 A;  2KMU A;  3F72 A;  3P5J A;  2QKM B;  4UUV A;  1EP2 B;  1KZL A;  3SYT A;  3ABU A;  4XKW A;  1HCR A;  3CCE I;  5GPC A;  2CQX A;  5DD8 A;  5K5O A;  2XNC A;  3BCA A;  1U0J A;  3HHG A;  1YLF A;  1NG7 A;  1MBK A;  5FKM A;  1B9N A;  4BYY A;  1W36 D;  1NTC A;  2HPM A;  4BXX J;  3JQP A;  4S0H B;  3T0Y A;  3KP2 A;  1FYK A;  2EWE A;  2LG4 A;  4A0Y A;  2H6C A;  3KET A;  3G6E B;  1O8K A;  3CCV I;  3WTY C;  2YWH A;  2XAS A;  1LFB A;  1LEB A;  4AWX B;  4M0L A;  1M90 D;  3OOU A;  4UZF A;  3SLD A;  1CNE A;  2GWR A;  3DTE A;  1EP1 B;  3G2B A;  4E70 A;  2BW3 B;  2W24 A;  3DKX A;  4RAZ A;  1ACI A;  1W4M A;  4UB8 C;  1G6N A;  4QLC U;  3ASP A;  2E1M C;  3CMY A;  1IJW C;  5LHG A;  1I6X A;  2B7E A;  2IVM A;  4DBQ A;  3WTS C;  3PSF A;  1X3W B;  3KX2 A;  2Q6O A;  4I09 A;  1FYL A;  4EM1 A;  2OA4 A;  3UNG C;  1ELO A;  5A88 A;  3DDY A;  3Q9S A;  4RCY A;  1EFT A;  4JMQ A;  4FAS D;  3DPU A;  2BZT A;  2KLO A;  1PP8 F;  3V8L A;  2I1L A;  1WOP A;  4HEA 2;  4CZZ A;  5ICG A;  3RKW A;  4EGY A;  1YRN A;  1VQ4 B;  1O88 A;  3P9K A;  2KKO A;  1FYM A;  3KEW A;  1VQP B;  1P2F A;  3SFZ A;  2WJY A;  3A0H C;  4A3L J;  3K70 C;  4I0B A;  5EGO B;  2R7W A;  2EZK A;  2QSH X;  3ISP A;  3NB2 A;  2BV3 A;  4QV2 A;  3TP0 A;  2BEO A;  4TKO B;  1IZ1 A;  1E2X A;  1XGN A;  1SFE A;  2Y0S A;  3RKQ A;  2A3S A;  4A3B J;  1WWX A;  2DO7 A;  1O4X A;  1EP3 B;  1MZB A;  2OCC H;  1Z9C A;  2R93 J;  5FIU A;  5FRN A;  1BN5 A;  2IS1 A;  2DMP A;  2ODL A;  3MZY A;  5LMZ A;  4LLL A;  4UUS B;  3E7L A;  2NT9 A;  1LQ1 A;  4ZTF A;  2XGD A;  1FND A;  2K4J A;  4IQ4 A;  1BHE A;  1EKE A;  4H4K C;  3CDH A;  2CRG A;  4PJL A;  3I71 A;  4HPQ A;  2ADU A;  4D7M A;  1OHH A;  5AN9 A;  1J5Y A;  4FE4 A;  5LGU A;  5C4X J;  4IVN A;  3HOY J;  5M3M J;  3ZBU A;  3S2D J;  2QDX A;  3ZQF A;  2ZBV A;  3ZQI A;  1IJE A;  5L46 A;  4CH7 A;  3DCF A;  2IA2 A;  1TQI A;  2EA4 A;  2ETH A;  1X19 A;  1SC7 A;  4OAZ A;  4KUM A;  2M34 A;  2LDU A;  5JLW A;  1D0X A;  1I8D A;  1RC9 A;  1ZRD A;  1VI0 A;  2CND A;  3CJQ B;  3QOD A;  3BTI A;  2XF6 A;  2VJ4 A;  3OYG A;  4F93 B;  1TP4 A;  1I39 A;  4BGD A;  3KEQ A;  1AKH B;  3SHF A;  1VQK B;  1E0E A;  1QCX A;  4OIQ F;  1R1V A;  3OZV A;  5HVQ C;  2HQ5 A;  2CJJ A;  5JI6 A;  3KYD B;  3KPH A;  3LQQ A;  4XRS G;  3CCJ I;  3WXM A;  3BJA A;  5J35 A;  1KCC A;  3GIR A;  3LAP A;  4Y15 A;  3DF8 A;  2RQQ A;  3LST A;  2DT7 B;  4HNV A;  2DFE A;  3HXL A;  3KCC A;  4XK4 A;  4TN1 A;  1WJA A;  4WCG A;  2O3F A;  2A69 F;  3W2W A;  4HDV A;  1BX0 A;  2Y31 A;  4RMN A;  4CHU A;  1QBJ A;  2CMP A;  3HOT A;  2L0K A;  4YG2 F;  3OYC A;  3G4S B;  4XNF A;  2XC7 A;  2V5I A;  1Z6R A;  4CGZ A;  2CUF A;  5LEK A;  1R36 A;  4TMW A;  2K9L A;  1S8N A;  3NAW A;  1N8R D;  4F3Q A;  1ZLK A;  1X4P A;  4HX7 A;  1XB4 A;  1ZM3 A;  2INV A;  1Y56 A;  3GLL A;  3CMA B;  3A1Y A;  3RQI A;  4Z4T A;  4PJ0 C;  1WTH D;  4KN7 X;  2GM4 A;  3HL2 A;  4U0V A;  3CC4 I;  4ASU A;  3RZO J;  1N05 A;  4M74 A;  2DK5 A;  1K79 A;  1RZ4 A;  4RS8 A;  2E71 A;  3P4G A;  1JKO C;  2DK8 A;  3GQ8 A;  4HW0 A;  1ZRC A;  2DMT A;  1R5O A;  4W8Q A;  3HPG A;  2K7L A;  3M4O J;  1E64 A;  2YS9 A;  2Y30 A;  2NTB A;  2K9N A;  2UVE A;  2ID3 A;  3BOQ A;  2JA6 J;  1X3Z B;  1FC3 A;  4EMS A;  4XLC A;  2BGJ A;  3FXJ A;  4PGG A;  1AOY A;  4OIR F;  1I3Q J;  3K9T A;  1IG7 A;  4MQV A;  1WSR A;  1YJ9 I;  2OC6 A;  3HEF A;  5ICE A;  2OZU A;  1Y8R B;  2XAG A;  4YRV A;  2KPM A;  3IH4 A;  5F08 A;  2COM A;  2O0Y A;  4RD2 A;  1IDJ A;  2PMH A;  2F2E A;  3ML6 A;  3S32 A;  5E1X A;  1ZR4 A;  3BCD A;  4NC8 A;  3DBR B;  4ZGQ B;  3GRH A;  4BXU A;  3CC7 I;  3WG9 A;  3I0T A;  4WZE A;  4YHB A;  2J8I A;  2KL4 A;  1J0R A;  1MBG A;  2VJI A;  1XMX A;  4KIG A;  2A68 F;  3CP8 A;  3VSL A;  1JKQ C;  1N0U A;  3KZY A;  3AVY A;  4YCQ A;  2HOE A;  3EQO A;  3VB2 A;  3ASS A;  2R7O A;  5CJ9 A;  4P12 A;  1XCB A;  3CF5 F;  1TWG J;  3GFL A;  1QHH D;  3E3V A;  1S0U A;  3ROU A;  2HVQ A;  2PE3 A;  1EH8 A;  2D45 A;  4IJA A;  2LF7 A;  4HLY A;  1G3T A;  1X2M A;  2RC5 A;  2EIL H;  4ESF A;  2P6T A;  3JR9 A;  5FA6 A;  1D2E A;  2BVN A;  2GJK A;  4Z4S A;  4YFO A;  2TDX A;  5FFX A;  2ZTN A;  2V1D A;  2F6C A;  3GVL A;  3TGN A;  3BH4 A;  3ZN0 A;  3ASN H;  1Z21 A;  1BMF A;  4A5N A;  3R0J A;  1E3Z A;  1R1T A;  2X53 S;  2QEX I;  9ANT A;  1QGZ A;  3LO8 A;  1DDG A;  3JSO A;  4KMU X;  3J80 K;  2VC1 A;  4Y4R A;  3HSE A;  2C2W A;  5LHI A;  3JUR A;  1EFR A;  2EIN H;  3BR3 A;  3V42 A;  4B4C A;  3ZQC A;  1IGN A;  1VQ5 I;  2M4K A;  2NRA C;  2LTP A;  4WQM A;  2Y9Y A;  2VI6 A;  4G5G A;  4EJV A;  1MNE A;  4ACB A;  2M0C A;  4ZYE A;  3EUH C;  1J9I A;  1BLI A;  3GXO A;  1NK2 P;  3DU5 A;  4HX4 A;  2XPV A;  1HVX A;  4IOC F;  4KNY A;  5EZH A;  4LBW A;  3CLO A;  4ENN A;  4LG0 B;  2HYF A;  1BN8 A;  1K61 A;  4BY7 J;  3KP7 A;  3D5R C;  1YX2 A;  4WWV A;  1MBF A;  2AS5 F;  4GDF A;  4BQO A;  4BQQ A;  3BJ6 A;  2HOT A;  4RA2 A;  5F04 A;  1T95 A;  1WDT A;  1YW7 A;  1R1U A;  4IW3 B;  3I56 B;  3HRM A;  2LY1 A;  2FBI A;  2AQE A;  2ZME B;  5CPR B;  4MNU A;  1L3L A;  2L3D A;  2VUM J;  3EDP A;  3ZUG A;  2LH9 A;  4QWQ A;  1ZLJ A;  1XGO A;  4DQK A;  3FXR A;  4RAY A;  2FOK A;  4G7W A;  4M72 A;  2HPI A;  1PXZ A;  4LBV A;  4PJN A;  1WP6 A;  3ZQQ A;  5EEH A;  3QYB A;  3LAJ A;  2EIK H;  2VT3 A;  3MN2 A;  5J3L A;  3I59 A;  3ZPL A;  2VAS A;  2V9P A;  2V4J C;  1VHO A;  3A02 A;  1P6R A;  2HNH A;  3U1D A;  2R7V A;  2CU7 A;  5IP7 J;  1RPW A;  4KFC A;  2IRF G;  1HZE A;  5EMN A;  5L3G A;  4A3E J;  3OYL A;  4TMZ A;  2R7U A;  5IPA A;  3PO3 J;  2VBY A;  3W6J B;  4U7B A;  2Q6I A;  3CPW B;  4FIS A;  2VKE A;  4A0X A;  4M3E A;  2WAQ A;  1X1A A;  4U87 A;  3BY1 A;  1XPX A;  5FLM J;  4ROX A;  2DA6 A;  3WQZ A;  2C5H A;  2VBE A;  1IB4 A;  3ZPN A;  4UV8 A;  2P8T A;  4EJT A;  2E1N A;  4F55 A;  2RC4 A;  2ZTG A;  2AXT C;  1WH5 A;  4P9F A;  4N3N A;  4RB2 C;  1Z6T A;  4KT6 A;  1GT0 C;  3KRG A;  4OP7 A;  2O61 A;  2GOX B;  2V4D A;  4B1R A;  1FSE A;  2JVH A;  4XQF A;  4YAW A;  2EK5 A;  1ODD A;  5E3O A;  5EJC A;  1TYW A;  2Z16 A;  4J0Q A;  3E20 A;  2ECC A;  3J7Y J;  1MRZ A;  1QGY A;  4EEF G;  3IAS 2;  2LY2 A;  2YPR A;  2QQA A;  2X85 A;  2VKV A;  1RKT A;  3BDD A;  4L9N A;  5FJ8 J;  2C4T A;  2VFN A;  1KCD A;  1BI1 A;  2KRC A;  2WAF A;  1LVK A;  1IV6 A;  2DA4 A;  2VE8 A;  1IF1 A;  2GJP A;  3D1N I;  3K4J A;  1TNT A;  4L0Z B;  2DMQ A;  1A31 A;  1MBH A;  2ACJ A;  2L54 A;  4TV7 A;  3W2F A;  3QPT A;  1UST A;  2M4G A;  2X48 A;  3P9C A;  4R8H A;  2DTR A;  2E1B A;  3OKX A;  2XT2 A;  2V7W A;  5D5U B;  3VSU A;  3K1P A;  2DY1 A;  3DQV C;  4EV0 A;  2CS3 A;  1EV7 A;  3GTQ J;  3HM5 A;  4GCV A;  4M2L A;  4Q47 A;  5HLT A;  1FP2 A;  2KT0 A;  1IRG A;  1FWZ A;  4G8X A;  4IEJ A;  1XFO A;  1FBQ A;  4LJZ F;  1QFY A;  2BX6 A;  3PSZ A;  1E63 A;  1VQM B;  1OCR H;  4U0W A;  5FRM A;  4P3I A;  4FQG A;  3DBL B;  2CV2 A;  1YJN B;  2PMZ A;  1HLV A;  3ZPP A;  5BPI A;  1UAA A;  1K4Z A;  1MMN A;  2G9W A;  3CQZ J;  2HVS A;  1JNY A;  1QFJ A;  2AXL A;  2WBM A;  4MO7 A;  3Q9V A;  4G7Z F;  3FXM A;  1COW A;  4OIN F;  4RBO A;  3TBI A;  1OGO X;  3BT9 A;  1I50 J;  1Y0N A;  5ILS A;  2LC2 A;  4S04 A;  5FNZ A;  4PGH A;  2PEC A;  1R00 A;  3FDY A;  3HOW J;  4XSX F;  1MMS A;  2F3L A;  5FKO A;  1S7A A;  5B3S H;  2FOW A;  4IZZ A;  1VQ6 B;  2NYX A;  3KIO A;  2LBF A;  1RRJ A;  4ZV4 A;  3ZN1 A;  2Y69 H;  4RB3 C;  2E1O A;  2KIQ A;  1ZG3 A;  2V7U A;  3GZ5 A;  3BC9 A;  1GQ8 A;  1QNT A;  1X1D A;  1HW5 A;  1WI9 A;  2C5B A;  4K1X A;  1SVL A;  1QA3 A;  1MMG A;  2MD0 A;  3KFW X;  5CVJ A;  2DQR A;  2HYG D;  1XGM A;  2QLZ A;  3V7S A;  2Q8K A;  5IT9 K;  2R7R A;  1Q82 D;  4DYQ A;  3G6E I;  4KIT B;  1MKM A;  1TWF J;  1Z67 A;  5DM6 F;  2EB7 A;  2DMU A;  3QU3 A;  4HF1 A;  3S16 J;  3OP1 A;  1RQR A;  3R0A A;  3GEZ A;  5K7H A;  2JPC A;  3VYS B;  2M9H A;  4EJU A;  3GVJ A;  3U21 A;  2JMW A;  3GFI A;  4Z05 A;  3OW2 B;  3EUA A;  2VJ5 A;  1JTX A;  1BOB A;  4R1H A;  2BGI A;  1IAW A;  4FXU A;  4W1U A;  5F4O A;  2VBV A;  3SEJ A;  4HYE A;  4IHS A;  1G7C A;  4YEL A;  2GK7 A;  1VZ0 A;  4X7D A;  1KYW A;  4XLH A;  4Y13 A;  1HKS A;  1YI2 B;  1HF0 A;  3H0G J;  2WC2 A;  2XPU A;  2UUZ A;  3FMR A;  2QXZ A;  2B5O A;  2RC6 A;  4ZH4 F;  2X4H A;  4NK8 A;  5FKL A;  5E6T A;  5J4Y A;  2JUC A;  4CZC A;  3HG9 A;  1U3E M;  2JN9 A;  3TH0 A;  1WOR A;  3ES9 A;  2YUH A;  3P7N A;  4P55 A;  3LSR A;  1WOS A;  1VQ4 I;  1DDN A;  1WQ2 A;  3WTW C;  4IHV A;  1S6L A;  2WTE A;  4V02 C;  2GQF A;  5JLX A;  1H9G A;  2NXN B;  5BNG A;  4LOC A;  3WU1 B;  4Z1M A;  5J8F A;  2OF7 A;  5IOY A;  2IA1 A;  2NOJ B;  1NRK A;  2QWW A;  1U2R A;  1EZG A;  5IYC J;  1OMI A;  4U0Y A;  1I7P A;  5H5J A;  1YG2 A;  2VFO A;  3FXK A;  2OTL I;  3HKZ A;  1E1Q A;  1ZRF A;  3CCM I;  2E1C A;  3EQN A;  1VF9 A;  4CYD A;  5TV2 A;  2JVG A;  3JRG A;  1VBL A;  5IT3 A;  2O17 A;  5DS0 A;  3LFK A;  2D9R A;  5HZA A;  2FVG A;  3T9G A;  1UJ8 A;  4X7C A;  2KHM A;  4IRI A;  3BJO A;  3GTL J;  5LD2 C;  3PUF A;  4JOM A;  1GV5 A;  3FXL A;  2PJP A;  4LD5 A;  3OZW A;  4G7O F;  3AL0 B;  3AFH A;  1YX3 A;  1YW9 A;  2EIM H;  2XF5 A;  1U78 A;  2M30 A;  4P2N A;  1O8G A;  5GP9 A;  2DA3 A;  1XTA A;  1WZ2 A;  1OFM A;  3MWM A;  3N05 A;  3VYU B;  1O57 A;  4EVI A;  2VQG A;  4BJ6 C;  5BMZ A;  4RD3 A;  2W7N A;  3F8F A;  2DCE A;  4B09 A;  5H2F C;  1IXR C;  2Z33 A;  1M1K D;  3CDL A;  5FLV A;  3FMS A;  3WNB A;  4IOA F;  2WB1 A;  2D5V A;  4RGR A;  1IDZ A;  4LBZ A;  5HOD A;  2ISY A;  3CC2 B;  5GPA A;  5F6F A;  1HSJ A;  4ZDL A;  2XGJ A;  3W6K B;  1EA0 A;  2GXA A;  5EG0 A;  2HDN B;  2H94 A;  2CG4 A;  2JJ7 A;  3GVK A;  2YX7 A;  1VQL B;  1O8D A;  5L3E A;  4BBR J;  2ME0 A;  4O5V A;  4OZZ A;  2WY8 Q;  2DA5 A;  2W57 A;  4XLF A;  3ZQG A;  2DU9 A;  3T5X A;  4G6T B;  3JQR A;  3GTJ J;  2L7K A;  1XSX A;  2PMU A;  3JAM Z;  1QFZ A;  3HRU A;  5EEG A;  1Y6I A;  3CO7 C;  1JKP C;  1VQL I;  2GRE A;  4XKB A;  3CES A;  3PUN A;  1OFL A;  2ICW G;  3IHU A;  2OTJ I;  1XGS A;  1SKY B;  3HYI A;  3CPX A;  3PFY A;  2HQR A;  1EE6 A;  2NVX J;  2ZNY A;  4LB5 A;  3VEP A;  2LMD A;  5HS7 A;  5J8C A;  1TNS A;  1W9X A;  4I01 A;  3KP3 A;  4KIC A;  4X0C A;  3V7A A;  4BE2 A;  1BW6 A;  4E7H A;  3FBI B;  1ETQ A;  2H8W A;  2BXY A;  2L2O A;  2ZZG A;  3BY2 A;  2XHK A;  1K4T A;  2HI3 A;  2EFG A;  5D4S A;  4UVA A;  4OOI A;  3MKY B;  2F4M B;  3Q6Q A;  1Z77 A;  2DJI A;  4JX5 A;  2QKL B;  2R9V A;  4L9T A;  1RQP A;  2LR8 A;  1IN5 A;  3AG4 H;  4XOT A;  1GR1 A;  3ERM A;  1JUS A;  3GX4 X;  3PNY A;  2OBR A;  2AO9 A;  1HC8 A;  3BCF A;  2H09 A;  2VT2 A;  3JRF A;  2VBS A;  2NPF A;  4MXN A;  2K85 A;  3HTS B;  4MYT A;  1YIJ B;  5KHD A;  3KLO A;  5TRD A;  3FPP A;  2CFO A;  2D2W A;  2IGO A;  2VBX A;  3CMA I;  2R7S A;  3ZQ7 A;  3S3N A;  1LKX A;  1MGT A;  2EV5 A;  4IXA A;  2HEO A;  3M8E A;  3PO2 J;  2IS4 A;  2ZL7 A;  3FY3 A;  2FQ4 A;  3C1D A;  3RIQ A;  1ON1 A;  1ZGW A;  3REO A;  2Q2E B;  1FOK A;  2MD5 A;  1DBO A;  3NE5 B;  5IOZ A;  2FRH A;  4UUS A;  3J81 k;  3LL7 A;  5DNS A;  1ZEL A;  2DPU A;  1QGP A;  1W7P A;  2R5Z B;  4BHB A;  4LLN A;  4HE5 A;  1S29 A;  3EUH A;  2ZB9 A;  1F60 A;  4MR0 A;  3PA1 A;  2KZG A;  5GAD J;  5JR3 A;  4AIK A;  2Z6B D;  4PMH A;  1DU6 A;  4HV6 A;  3E1Y E;  1GAQ A;  4Y9R A;  5DCF A;  1JHF A;  2Q0O A;  4UUT A;  4M3D A;  3W6V A;  4XOP A;  3CCE B;  3CDI A;  3OYA A;  2X8K A;  1A6I A;  4P1V A;  3OJX A;  2V79 A;  4QHY A;  1B2R A;  1REP C;  2PBI A;  3ZCO A;  3RKX A;  3FWE A;  4DNR B;  1RU4 A;  3O2P E;  1Z3X A;  4E7Z A;  1WU8 A;  4E4H A;  2CV1 A;  1BJA A;  2W85 A;  1HQC A;  4OWR B;  3I58 A;  2ZSH B;  5H6R A;  1APL C;  3L00 A;  1O8I A;  5HXB A;  2BVL A;  1AKH A;  4PC3 A;  1H80 A;  3OSG A;  2V9K A;  1RNL A;  2ZBK A;  4KDP A;  4G1B A;  3QPH A;  1XDS A;  2MLK A;  1H9T A;  2XND A;  1IUF A;  3DTI A;  4W97 A;  4X0G A;  1VQN B;  2HZT A;  3I54 A;  1I5Z A;  1FX0 A;  1HW1 A;  3VFZ A;  4XD7 A;  4BH9 A;  4JX6 A;  1CNF A;  4B3G A;  3R6S A;  4D5F A;  1O8M A;  4I02 A;  4NB5 A;  3SZT A;  2YU3 A;  1OCC H;  4HZF A;  1R58 A;  1LUJ B;  1QHG A;  5C1C A;  4M3G A;  2CC2 A;  1NK3 P;  1L0O C;  1MBE A;  4PGO A;  2WJV A;  4BKX A;  1R4N B;  2VB6 A;  2ZXJ A;  3CCR I;  3KE2 A;  1YFH A;  3ONU A;  1D0Z A;  2IEK A;  2B0L A;  2OZ6 A;  2PLF A;  3A1P A;  1OFD A;  3MVP A;  4E7S A;  3OYJ A;  3W2G A;  4HLX A;  2X6X A;  3K4N A;  2ZBU A;  2JRM A;  3VSV A;  1MDM B;  4IF4 A;  2DOE A;  2RQP A;  4XL9 A;  4LGW A;  1R49 A;  3S2H J;  1TW2 A;  3BTL A;  3QQA A;  2BM4 A;  3JTG A;  1FMV A;  3GO5 A;  5L3D A;  4C30 A;  3OZU A;  4M1K A;  1FMW A;  3J7A Y;  1G3Y A;  1W36 C;  1V5V A;  2DOG A;  2JA2 A;  3IP4 B;  2R5Y B;  3JRC A;  5B6I A;  1QO0 D;  2NAZ A;  1Q81 D;  3B8Y A;  2OTL B;  5FO1 A;  4A3K J;  2JA7 J;  3PJR A;  4II2 A;  3E6B A;  1V4R A;  4Y52 J;  4YZQ A;  1X1C A;  2NVU B;  1I18 A;  1T6Y A;  4I2O A;  2JA8 J;  4B4D A;  1QU3 A;  2DN0 A;  3PIP F;  4QFM A;  1OPC A;  1N75 A;  3H36 A;  3LQ6 A;  4HNT A;  2O8K A;  4X05 A;  2VBM A;  4IQJ A;  2HGC A;  2HQN A;  3BTJ A;  1ZRE A;  1DPR A;  1Y0Y A;  4L5I A;  1SVO A;  2F48 A;  2MFZ A;  2YX4 A;  4Z4R A;  1UMK A;  2HCJ B;  1QJV A;  1FLI A;  2QZA A;  4E7J A;  3HOX J;  4ACA A;  1QA2 A;  5IP9 J;  3QFT A;  4BE1 A;  2FMY A;  4IO9 F;  1KK3 A;  4PAA A;  2XB0 X;  4OJO A;  1CQX A;  4CIC A;  5EG0 B;  1D1N A;  3O6B B;  3RY8 A;  2X9D A;  1YE9 A;  2COB A;  2BY2 A;  2E1R A;  3B8H A;  2I5U A;  2P7C B;  1FP1 D;  2GQQ A;  4D1Q A;  2FU4 A;  3I53 A;  1G7T A;  4A2U A;  3G1M A;  4ENM A;  1ZGA A;  1MND A;  3G73 A;  2I10 A;  2Z9O A;  2M87 A;  4CUG A;  2XRN A;  4RDU A;  3H9Q A;  2YUS A;  1U8R A;  5CYV A;  3L09 A;  4G7H F;  3T8T A;  2FEZ A;  2B0R A;  1FNM A;  1SAX A;  4O3M A;  3CCY A;  1IJF A;  2UVF A;  2M1B A;  1TYV A;  2ZME C;  4UV9 A;  1TW3 A;  3OWT A;  1W2B B;  3Q3A A;  2LSO A;  2PG4 A;  4EJW A;  1NJI D;  1ZM4 A;  4FE7 A;  3COA C;  3GW2 A;  3JU4 A;  4U49 A;  3A01 A;  4KMF A;  4GYG A;  3RYR A;  4F7Z A;  1NB0 A;  2Z8G A;  4HWV A;  1O3T A;  3CC7 B;  2DAO A;  3OEH A;  2IT0 A;  1F36 A;  3C3W A;  1XMA A;  3V7C A;  2VC0 A;  4AF6 A;  2QM3 A;  4G12 A;  2JIZ A;  2Z2S B;  4X07 A;  4BNC A;  5DSZ A;  4OOV A;  4W8T A;  5DUI A;  2DIE A;  1P4W A;  2Y48 A;  3CTA A;  1QRC A;  1LE8 A;  4LB6 B;  1PYV A;  4KKS A;  2E2H J;  5CVV A;  1LLW A;  3EQL F;  1AIR A;  4ESB A;  2EBI A;  3CCU B;  2K40 A;  2LRD A;  2EA2 A;  2LLK A;  3H9J A;  3I9V 2;  3TDU C;  4BU2 A;  1IRX A;  1B72 A;  1TYU A;  3LSM A;  3ONQ A;  1UHW A;  4RLQ A;  1BC7 C;  2VYQ A;  1KTV A;  3AG1 H;  1IC8 A;  3R6K A;  4RPB A;  3TDZ C;  1HA3 A;  2G7H A;  1VF7 A;  4YFK F;  3WY9 A;  1IA5 A;  3BH6 B;  1VQP I;  3U2R A;  3L2W A;  4OPO A;  2QGU A;  1FNB A;  1VQ5 B;  1IRZ A;  1BI2 A;  3AK5 A;  3OYK A;  2BM7 A;  4KKU A;  2WV1 A;  4C2L A;  3WU2 C;  2A07 F;  3FM5 A;  4BS9 A;  4DJA A;  2HZD A;  4F92 B;  1UD6 A;  2L4M A;  4M9S A;  5K1Y A;  3GQ7 A;  3L1P A;  1NG6 A;  3A8K A;  4TMX A;  3BR2 A;  4XLP F;  3OYB A;  5EYR A;  2JTV A;  3EET A;  3ZMS A;  2FJ1 A;  1E79 A;  1WPK A;  1HXD A;  4CA0 A;  1BW5 A;  3GSI A;  1O7F A;  4M73 A;  5E3N A;  3BLY A;  1H89 C;  1WCM J;  4ZYH A;  2J7K A;  4U7D A;  3QAH A;  4EJO A;  5LEJ A;  3SDG A;  3QFS A;  4P3Y A;  4Q5S F;  3CP2 A;  2FNA A;  2XAH A;  3H35 A;  2ZJR F;  4UAJ A;  5KSW B;  4B3A A;  1WJC A;  3HGY A;  1SKQ A;  4DZP A;  1SFO J;  1MIJ A;  4BPR A;  3QP5 A;  4U4B A;  2VQL A;  2BSA A;  2L7M P;  4L9J A;  5GTI C;  1G7S A;  5GV8 A;  3N4M A;  4DYR A;  4AYB A;  4O6J A;  4RCZ A;  3H92 A;  4HE6 A;  4PC6 A;  4YII A;  3GCM A;  4P5O A;  1UB9 A;  5BPD A;  3F8N A;  2XSD C;  4V19 K;  2RNG A;  4RM3 A;  1KYZ A;  1OCT C;  4XID A;  2EZL A;  3I4M J;  3H9N A;  1E1R A;  1R22 A;  3K7A J;  4LMY A;  2DOD A;  1S7O A;  3OL3 A;  5FKK A;  3MQ0 A;  2PQ8 A;  2DYS H;  2DYR H;  5LRR A;  2YWE A;  1IDY A;  3FKI J;  3I4P A;  4PSW A;  1BC8 C;  3J81 Z;  2F1M A;  3DEE A;  2DT5 A;  4NDL A;  3FKS A;  5JMC B;  4Z4Z A;  4HQE A;  4G94 A;  2EJR A;  2VOO A;  1N78 A;  2MYS A;  1CZF A;  1ZG5 A;  1DDI A;  1B23 P;  3TL4 X;  3VYR B;  3CXC B;  4Y3O A;  1TLL A;  3CCR B;  5IYQ A;  5HS8 A;  2BMW A;  5F4J A;  2BM0 A;  2CK3 A;  4HF0 A;  3PNT A;  4LK0 F;  1GXP A;  4ITV A;  4YAU A;  3SYJ A;  2DER A;  2M7A A;  2O6G E;  1I1S A;  2WR8 A;  3LSJ A;  3ZMD A;  3WTX C;  1GVJ A;  3PL8 A;  2Y0S N;  3QOE A;  2W7Z A;  2LP0 A;  4JK1 X;  1E43 A;  3G4S I;  5LRS A;  1OGM X;  3EUK L;  1PKV A;  2WZP P;  4I6Z A;  3GQB A;  2QUF A;  2VFM A;  4WWC A;  5CQG A;  4MEY F;  5HLH A;  2ZXW H;  1V0F A;  4DK1 A;  2L9R A;  2FNP A;  1E3O C;  3FHZ A;  5AMV A;  4DQ2 A;  1T8I A;  4CCL A;  2GZW A;  1V54 H;  3KP6 A;  2NVT J;  1SD6 A;  2GK6 A;  1Y8Q B;  1QH0 A;  5EZG A;  4TMV A;  4B48 A;  5BOX A;  4BEH A;  1Z7U A;  4D0P A;  4WZT A;  1TSP A;  4TSF A;  3A35 A;  2R6H A;  2ZC2 A;  2EIJ H;  1B4A A;  1X4O A;  2D3L A;  3OR1 C;  3WGI A;  2X3U A;  3ZQL A;  1OGI A;  1R5G A;  4DQL A;  2PYG A;  5HS9 A;  1KU3 A;  2WAQ N;  3BG3 A;  1HDP A;  4YXW A;  1KZH A;  2VQC A;  3CO6 C;  2MC3 A;  1OYY A;  2VFP A;  3OYN A;  4I99 C;  3QSY A;  1S5L C;  1OR7 A;  1U2W A;  2M8G X;  3GQA A;  2ZFU A;  4ZYA A;  3QRF F;  1IW7 F;  2HVR A;  5LGN A;  3F9K A;  2BBY A;  5A89 A;  3OIO A;  6PAX A;  4AIJ A;  1RKW A;  2E2I J;  3ULQ B;  4EW9 A;  1GJR A;  3LNN A;  3H94 A;  2JJ1 A;  3S14 J;  3HOV J;  4AC9 A;  4X1E A;  3CCV B;  1JUM A;  3GVA A;  3BY6 A;  4QTR A;  2VON A;  3S15 J;  1KK2 A;  1V0E A;  1V3F A;  4M9X A;  2V7T A;  3HJE A;  1JKR C;  1H88 C;  1J2X A;  3L2C A;  2LNB A;  3BR5 A;  4GFB A;  2OPT A;  2BM1 A;  4CO8 A;  1T98 A;  5M5Y J;  2VPL A;  1X2N A;  1A04 A;  2R0Q C;  1MNM C;  3DPL C;  4BQA A;  3SLN A;  5ILV A;  2R7X A;  4C0S A;  2FX3 A;  2K5C A;  3WE3 A;  5HDK A;  5J1R A;  1A6Q A;  1QVF B;  3U6K A;  3NAU A;  3KP4 A;  1BA5 A;  3V7R A;  3A8I A;  3QE2 A;  4RDK A;  4C3J J;  2HMA A;  1BR1 A;  4PZJ A;  1A35 A;  2B63 J;  5BS6 A;  4RLZ A;  1YIJ I;  1B72 B;  5DYM A;  3GTG J;  1LDD A;  4S05 A;  2P5L C;  2M5W A;  1D1B A;  1XDU A;  2VKH A;  4Y9U A;  4RGX A;  1FT9 A;  2CUJ A;  1PUF B;  1VQM I;  3SXY A;  1K9M D;  2CV0 A;  3CME B;  2DXI A;  2EWN A;  2XAU A;  2VLA A;  2Q6L A;  4A3D J;  1I3A A;  4P9S A;  1SAU A;  4WXH A;  1Y0R A;  4AUX A;  3K1M A;  5E1Z B;  1LDK B;  3ABT A;  1YOV B;  1PLU A;  3J80 Z;  1IO2 A;  3I55 B;  1FZP B;  1YIO A;  4AD9 A;  2QBY A;  1UD8 A;  2L7Z A;  3DTK A;  1P7I A;  3BCB A;  2KDZ A;  4NNJ A;  3V76 A;  1T38 A;  3Q38 A;  2DET A;  1ERD A;  2HLD A;  3TOA A;  2MC4 A;  1DP3 A;  1HA8 A;  2G0Y A;  3OYM A;  3OEE A;  2FA5 A;  1HKT A;  2ELK A;  3G3Z A;  3O8G A;  4MGR A;  3OE7 A;  5HLI A;  4FWT A;  1ZTR A;  1YW8 A;  2LKP A;  3ASR A;  4YZ0 A;  1D8K A;  1H8A C;  1LLZ A;  2A6H F;  3KEO A;  5J4V A;  4CYC B;  1FPQ A;  5D8L B;  3IWZ A;  5M5X J;  2XZL A;  1D5Y A;  3SKB A;  2RAE A;  1G3S A;  1U5T A;  5ICF A;  3S3M A;  2CSO A;  2QQB A;  2VBK A;  1IN4 A;  3SJM A;  2G7U A;  1WOO A;  2XIG A;  2NS0 A;  4M3B A;  4IX7 A;  4ZZL A;  3HPH A;  1K6O A;  1GAW A;  5H59 A;  4ABZ A;  1N25 A;  3RTR A;  3PET A;  4PAB A;  3FPK A;  2K9S A;  1OLT A;  1KTW A;  3LYC A;  2HXO A;  1DU0 A;  4P6V F;  4RAF A;  2PJR B;  1STZ A;  4X8I A;  1S72 I;  3BPV A;  4W8S A;  5E8G A;  3EPZ A;  2F1L A;  4FN5 A;  2RGV A;  2CO5 A;  3RKY A;  1FJL A;  1VQ7 B;  3PSI A;  1PE9 A;  4X7F A;  2BSP A;  4DW6 A;  2WB1 N;  3MMP A;  1VQK I;  2C77 A;  2H27 A;  1T0F C;  5E1W A;  2XGE A;  4UXN A;  4MLO A;  2PMD A;  3CLQ A;  5TR9 A;  3PM1 A;  1QG0 A;  4Z03 A;  1H8E A;  3RPQ A;  1O8F A;  1QUF A;  4PUS A;  5J6X A;  1SAN A;  3HHH A;  2WWY A;  1J7K A;  2KDO A;  2ZO4 A;  4PCQ A;  2WAD A;  2FBH A;  4HST A;  3U9G A;  1OYI A;  4FET A;  1JTY A;  5K5R A;  1QRY A;  3GFM A;  1UD5 A;  4KJZ A;  3DU6 A;  1PJ5 A;  3VPR A;  2R4G A;  2RN7 A;  1W7P D;  3FXU A;  4OIP F;  2GOM A;  2OBS A;  1PDN C;  4AYB N;  5HDN A;  1Y1W J;  1QPI A;  1K8F A;  3FBN B;  3KL9 A;  3IV5 A;  1ULY A;  1IXS B;  3GZN B;  5H6Q A;  1UD4 A;  3WTU C;  1PP7 U;  5B1A H;  4DNT B;  4C2U A;  5IY5 H;  2CBX A;  2JT1 A;  5GV7 A;  1H85 A;  1QQ1 A;  1OCZ H;  1E17 A;  4I84 A;  4R79 A;  2ZIT A;  3WU0 A;  4G9Y A;  4A3J J;  3JX8 A;  4JP0 A;  1R5N A;  1D0Y A;  3G71 I;  1BI3 A;  1LM1 A;  5D6E A;  3WBJ A;  3UR3 C;  2DLL A;  4LIT A;  4AC0 A;  1WSU A;  4Z6Y A;  3PUB A;  4GYI A;  4B3F X;  2DOF A;  2ZKZ A;  4RB0 A;  3ZRG A;  3WNC A;  1XSV A;  2AHQ A;  3O3K A;  4RDL A;  2STW A;  2NZM A;  1XMK A;  5K7F A;  2NNY A;  2WY7 Q;  2BY3 A;  4DBR A;  3H5A A;  3JRA A;  2CRV A;  4LC0 A;  2ZNZ A;  2IP2 A;  4OIO F;  2A5W A;  2CQ7 A;  4C2T A;  1QZE A;  1Q1H A;  3T8R A;  3FMQ A;  1JGS A;  3H5N A;  1P7J A;  3S1R J;  3CC4 B;  3GME A;  1G3W A;  2PYH A;  3WOD F;  5CDF A;  2DBB A;  2D1H A;  5KAF C;  3BG6 A;  3L2V A;  2VQH A;  2X0K A;  2ECB A;  1UCR A;  1AWC A;  2O04 A;  4BBS J;  2FSW A;  4V2G A;  1TLH B;  2P6S A;  5FB2 A;  1OB2 A;  4XSZ F;  4Y17 A;  4ETS A;  4IRG A;  3SQV A;  1T6Z A;  3BZC A;  1NHC A;  1S4M A;  1SD5 A;  5K5Q A;  3T56 B;  2VXZ A;  1ZGJ A;  3OYD A;  4KH3 A;  2JWT A;  1JUP A;  1R23 A;  2RV8 A;  4BE0 A;  1VFC A;  3BG7 A;  3MZ8 A;  1LB2 A;  3MD2 A;  2R5Y A;  4ZCI A;  4OOS A;  4HG2 A;  4DNC A;  1RUN A;  1FSH A;  3CJN A;  3U2Q A;  4A3G J;  3HZJ A;  5DCM A;  1VLO A;  1OB5 A;  2L5Q A;  1BBY A;  4F91 B;  1FTZ A;  2FF4 A;  4X6A J;  4PSX A;  3IH2 A;  2JQ7 A;  3DXJ F;  1SVM A;  3H09 A;  2G0E A;  5J3O A;  5LGT A;  3FXQ A;  1LPQ A;  2NSP A;  3DEU A;  1T2K A;  4M4S A;  3JSP A;  3QPL A;  4PJJ A;  4K2E A;  4DK0 A;  3F8C A;  3K4L A;  3Q3S A;  3PEN A;  4M53 A;  3GF2 A;  4IKF A;  3R6J A;  1MBJ A;  5D6F A;  1JGG A;  1C0W A;  2A6E F;  4NBS A;  3K69 A;  2QY1 A;  2XRL A;  3DPT A;  4X06 A;  1YLO A;  4M6Y A;  3ZMZ A;  4I7H A;  5HLG A;  5C4J J;  1CF7 B;  1K28 D;  1Z3Y A;  4RM2 A;  4PFO A;  3IWF A;  4Y33 A;  1TBX A;  2BE5 F;  2JN6 A;  3WBK A;  5M3F J;  2OV7 A;  1Z1D A;  2DEU A;  1R5I D;  3D26 A;  2KRH A;  2LVS A;  1KQ5 A;  2KQR A;  1DG1 G;  3PNV A;  1YO5 C;  2QYU A;  2BV6 A;  2P0W A;  5D8K B;  2VNK A;  3HRS A;  3M7G A;  5GAH J;  2EFQ A;  2FQ3 A;  3M1E A;  1XC5 A;  2VN2 A;  1FIA A;  1MJB A;  2EFP A;  3S1Q J;  1P92 A;  2HR3 A;  3CCM B;  3FIW A;  3AST A;  3IAM 2;  5BSX A;  1FBS A;  4RD4 A;  3S1M J;  3F21 A;  1E3H A;  2JSC A;  2KJC A;  4WK8 F;  2MW8 A;  4XM3 A;  3B02 A;  3LSK A;  2EZI A;  2ZZQ A;  2XKP A;  1F9N A;  4WF2 A;  5CLS A;  4QPQ A;  2VNI A;  3B6A A;  4RAG A;  2OK7 A;  3ZGK A;  4YZA A;  1ZK8 A;  4OJP A;  1F20 A;  2NV4 A;  4CQJ A;  2P3M A;  2GJR A;  4A3I J;  1USS A;  2IJL A;  3RZD J;  1KMH A;  4BUP A;  5TGT A;  5JVT A;  4D9J A;  2BPO A;  2E5Z A;  1IV8 A;  3LA3 A;  3V4G A;  4CCM A;  3PSS A;  2UWM A;  1R7J A;  2Z5U A;  4OMY A;  4XLA A;  3M3Y J;  3NWS A;  4II3 A;  4LIU A;  2KIS A;  3OV8 A;  1JA1 A;  1GV2 A;  3QYE A;  1U8B A;  4W8R A;  3I59 B;  3H1C A;  4FX0 A;  1O8L A;  2NNN A;  2W48 A;  4B47 A;  2X1D A;  3ZMT A;  2DFF A;  4L0Y B;  2R7Z J; 
#chains in the Genus database with same CATH homology
 3H9G A;  2LOO A;  2KL4 A;  2VJI A;  2UVF A;  3CP8 A;  3VSL A;  4CSW A;  3EQO A;  3OWT A;  1X0C A;  2R7O A;  3LSH A;  2I8D A;  2INU A;  3JU4 A;  3BC8 A;  4U49 A;  3OPO A;  1QHH D;  3OYI A;  2Z8G A;  3OMY A;  4HWV A;  3RCO A;  5HOO A;  3OEH A;  4ZC3 A;  2HVQ A;  5IK2 A;  5HKK A;  2GJK A;  1JTA A;  3L2Q A;  3CF2 A;  2ZTN A;  2O0V A;  2JIZ A;  2F6C A;  2Z2S B;  3ZXS A;  3GVL A;  3BH4 A;  3OFN A;  4NQW B;  2X3H A;  1Z21 A;  3SZG A;  1BMF A;  2O1D A;  2DIE A;  4W8T A;  3VYT B;  1UD3 A;  3G05 A;  2IQ7 A;  3HC7 A;  1E3Z A;  2X53 S;  1PYV A;  4KKS A;  1UG0 A;  4Y4R A;  1T5E A;  1AIR A;  4PK4 A;  1OOC A;  3JUR A;  2LRD A;  1P9Q C;  4BU2 A;  3H9J A;  3I9V 2;  3V42 A;  4HRI A;  1IRX A;  1EFR A;  2M4K A;  4Z06 A;  3LSM A;  3ONQ A;  4RLQ A;  4BJT A;  1MNE A;  3OOC A;  1BLI A;  3EUH C;  1VF7 A;  3DU5 A;  1IA5 A;  3OIQ A;  1NBM A;  5DN6 A;  2NTP A;  1HVX A;  2NST A;  4DIQ A;  3S8P A;  3L2W A;  3DKY A;  2W6J A;  1VLY A;  1BN8 A;  1RMG A;  2E5N A;  1D1C A;  4XMY A;  4B44 A;  3OYK A;  4KKU A;  3D5R C;  4C2L A;  1UD6 A;  5CQE A;  4BS9 A;  4DJA A;  2HZD A;  4BQO A;  4F92 B;  1OB0 A;  3GQ7 A;  4XOR A;  4BQQ A;  1NG6 A;  1T95 A;  3OYB A;  3T51 B;  1O8E A;  4URR A;  1E79 A;  2LY1 A;  2AQE A;  5CPR B;  4CA0 A;  4KKT A;  4OJL A;  2LH9 A;  3BLY A;  3S3O A;  3RQ4 A;  3VSK A;  4E7K A;  3RSN A;  2WSS A;  4G7W A;  2HPI A;  4B43 A;  1PXZ A;  3CP2 A;  4PJN A;  4J01 A;  1RWR A;  3H35 A;  3GQ9 A;  1WP6 A;  2X1E A;  3ZQQ A;  3QYB A;  3LSI A;  1WJC A;  2W4S A;  4OJ6 A;  3H5R A;  2VJJ A;  1E3X A;  2VAS A;  4B3X A;  2V4J C;  2VQL A;  4PFP A;  4U4B A;  3FHN A;  3K4M A;  2HNH A;  2LRE A;  4AYB A;  2O5R A;  4BDY A;  2R7V A;  4C9Y A;  3UW0 A;  1G59 A;  4P5O A;  2RRE A;  1HZE A;  3OYL A;  1G8X A;  4GQN A;  2R7U A;  2RNG A;  4XR6 A;  3A2K A;  4U7B A;  2BOL A;  4RM3 A;  2F4I A;  2CUZ A;  4XLE A;  4BQN A;  3MMY B;  2WAQ A;  1E1R A;  1WJF A;  1X1A A;  4U87 A;  3WQZ A;  1PJR A;  2NT6 A;  3VR6 A;  1IB4 A;  2VBE A;  3ZPN A;  3OL3 A;  3FKJ A;  4F55 A;  2ZTG A;  1TZL A;  3NWT A;  4CCK A;  2L9S A;  4PSW A;  4KT6 A;  3KRG A;  2ZXH A;  2F1M A;  3DEE A;  2V4D A;  2GOX B;  3A4C A;  3FKS A;  2JVH A;  4XQF A;  1N78 A;  1R6R A;  2MYS A;  2Z16 A;  4E7I A;  2F43 A;  1CZF A;  3TL4 X;  3VYR B;  2D3N A;  4Y3O A;  3IAS 2;  2LY2 A;  2X85 A;  4LG3 A;  4ZJZ A;  1KCD A;  5C1E A;  2XDV A;  2CK3 A;  3PNT A;  2WAF A;  2KRC A;  1LVK A;  2CW8 A;  2WA0 A;  3CJR B;  4ITV A;  2GJP A;  2M7A A;  3K4J A;  4LIV A;  1TT0 A;  1MMA A;  2MAB A;  2IGN A;  3PL8 A;  2M4G A;  3OY9 A;  3QOE A;  4ZTJ A;  1WPC A;  2E1B A;  2IGM A;  1E43 A;  4L8J A;  1OGM X;  1Z7L A;  2HU9 A;  3EUK L;  1MW7 A;  3K10 A;  1PKV A;  2WZP P;  3VSU A;  3GQB A;  3DQV C;  2CS3 A;  4XN0 A;  1DGR M;  5HLT A;  5CQG A;  1V0F A;  2XZP A;  3QYF A;  3OAA A;  4DK1 A;  3VMW A;  2AQF A;  5AMV A;  1V5E A;  1H8H A;  2E60 A;  4CCL A;  3D5L A;  2GK6 A;  2ELJ A;  5FRM A;  3K4B A;  2CV2 A;  1O8J A;  2PMZ A;  4B48 A;  4BJ5 C;  4BEH A;  4DOZ A;  3ZR8 X;  3ZPP A;  1UAA A;  4TSF A;  1MMN A;  4CCJ A;  2HVS A;  4XN3 A;  3A35 A;  4UZU A;  3B90 A;  2WBM A;  3OS1 A;  3L2U A;  1X4O A;  1COW A;  2D3L A;  3OR1 C;  1W0K A;  3TBI A;  3GBG A;  4PJM A;  1OGO X;  2PYG A;  2JSP A;  2LC2 A;  3OYH A;  2PEC A;  4YXW A;  3FDY A;  2VQC A;  2X1C A;  2V1N A;  3KEY A;  4IZZ A;  3OYN A;  3RPU D;  2VL8 A;  2LBF A;  4QPO A;  2O0W A;  3GQA A;  5KNL A;  3ZSC A;  4ZDP A;  3T53 B;  1WJE A;  2ZFU A;  1OR7 C;  4ZYA A;  3BC9 A;  2HVR A;  1GQ8 A;  1X1D A;  3F9K A;  2VKD A;  1MMG A;  4J00 A;  2MD0 A;  4DGW B;  3SEQ A;  5HNH A;  4BL0 B;  3D5S C;  2X51 A;  3K6G A;  3KYL A;  4EW9 A;  3LNN A;  2R7R A;  3H94 A;  4KIT B;  2VIX A;  2KZV A;  2JJ1 A;  3LMW A;  2QE7 A;  5JHF A;  4BAC A;  1WJ5 A;  3DLA A;  4P1W A;  4N4N B;  2XF7 A;  1V0E A;  4CCO A;  2R7Q A;  3VYS B;  3GVJ A;  3U21 A;  4Z05 A;  4HSR A;  3EUA A;  2VJ5 A;  3HUG B;  1BOB A;  4FXU A;  1D1A A;  2Q1Z B;  2VPL A;  4JQF A;  3DPL C;  4YEL A;  2GK7 A;  1VZ0 A;  2R7X A;  2V26 A;  1BR2 A;  2K5C A;  4XLH A;  4BEH B;  2UUZ A;  3IUO A;  1IDK A;  2QXZ A;  1BR1 A;  3ZIA A;  1XG2 A;  4NK8 A;  4CZC A;  5LFA A;  3HG9 A;  1DGW Y;  3VMV A;  2IXS A;  1WJD A;  1D1B A;  2VKH A;  2XZO A;  2W1O A;  2CUJ A;  2JUG A;  3E0J B;  3C2G A;  3OIP A;  3H0D A;  2CV0 A;  3S93 A;  4Z1M A;  2DXI A;  2XAU A;  2VLA A;  2WAE A;  4KIS A;  1UEL B;  3AKZ A;  2NOJ B;  2Z1D A;  1N77 A;  1NRK A;  2NTQ A;  1SAU A;  4NK6 A;  1LDK B;  3LFU A;  1W0J A;  1WFX A;  2IS2 A;  1BR4 A;  2LZJ A;  2V7F A;  3HKZ A;  3OW7 A;  1E1Q A;  1PLU A;  2LYC A;  3EQN A;  1VBL A;  2JVG A;  1UD8 A;  4OJ5 A;  2O17 A;  3DTK A;  3BCB A;  3T9G A;  4NNJ A;  2KHM A;  2KP6 A;  2VXD A;  1BPL A;  5LD2 C;  4JOM A;  1ERD A;  3M8J A;  2HLD A;  2MC4 A;  2L9N A;  1DP3 A;  1HA8 A;  3OS2 A;  1MMD A;  2FUG 2;  3OYM A;  3AL0 B;  3AFH A;  1JI8 A;  3SUC A;  3OEE A;  1YX3 A;  3A3G A;  2XF5 A;  3WWG A;  3K4K A;  1O8G A;  3VST A;  4E7L A;  3OE7 A;  2CW7 A;  1OFM A;  3N05 A;  3VYU B;  1UD2 A;  4YZ0 A;  2VQG A;  4BJ6 C;  3HOS A;  2W7N A;  2ZZF A;  2DCE A;  3K4C A;  3CMM A;  2XZL A;  4XKC A;  3TMO A;  3HAG A;  3S3M A;  1V5F A;  2VBK A;  3C2H A;  2WB1 A;  2X6W A;  2XSJ C;  2BVM A;  3K70 D;  3AL0 C;  4G7X A;  4IX7 A;  3OL4 A;  4ZDL A;  1GLN A;  2XGJ A;  3HPH A;  1K5C A;  5HNF A;  3RTR A;  4TT3 A;  1OLT A;  3GVK A;  1KTW A;  3A3B A;  2ZXI A;  1O8D A;  2KMU A;  2QKM B;  1V5G A;  3W3C A;  2PJR B;  3SYT A;  1KZL A;  4OZZ A;  4XKW A;  2WY8 Q;  4XLF A;  4W8S A;  3BCA A;  3EPZ A;  1U0J A;  4G6T B;  1W36 D;  1NG7 A;  2HPM A;  1WJB A;  2L7K A;  4EAT A;  2W82 A;  3PSI A;  1PE9 A;  2BSP A;  2EWE A;  2LG4 A;  4RLF A;  4F52 A;  1T0F C;  2IS6 A;  1Y6I A;  4MLO A;  1O8K A;  4HNU A;  4Z03 A;  1H8E A;  1O8F A;  4XKB A;  3CES A;  4PUS A;  1OFL A;  1SKY B;  3PFY A;  2W6I A;  3OOU A;  2KDO A;  1EE6 A;  3B4N A;  3DTE A;  3G2B A;  2WAD A;  2BW3 B;  2X6Y A;  3DKX A;  1W9X A;  4HST A;  2XOK A;  4FET A;  1VJS A;  4BE2 A;  4E7H A;  3FBI B;  1J09 A;  2L2O A;  3L2R A;  2E1M C;  1UD5 A;  2ZZG A;  4XKV A;  1X1B A;  4KJZ A;  3DU6 A;  4DBQ A;  3MKY B;  2M5S A;  2DJI A;  2R4G A;  2W00 A;  3KX2 A;  2QKL B;  3PSF A;  2GOM A;  2R9V A;  4HIZ A;  4XOT A;  3UNG C;  4YZX A;  3DDY A;  3FBN B;  3PNY A;  3BCF A;  4N4O B;  1UD4 A;  2BW3 A;  4MXN A;  4JMQ A;  4DNT B;  4C2U A;  4FAS D;  5KHD A;  4YEJ A;  3DPU A;  2KLO A;  3FPP A;  2CFO A;  2IGO A;  4HEA 2;  3M1C A;  2R7S A;  4I84 A;  4R79 A;  2JJ2 A;  1O88 A;  3S3N A;  2HQA A;  1LKX A;  1D0Y A;  4OAY A;  3KEW A;  3FY3 A;  2IS4 A;  1KON A;  2WJY A;  3UR3 C;  5FRO A;  3K70 C;  4LIT A;  4E0F A;  4ANJ A;  3VDX A;  2Q2E B;  3PUB A;  2DT6 A;  4B3F X;  2PJR A;  1DBO A;  3LMM A;  2R7W A;  2ZSI B;  2LBF B;  3NE5 B;  3DWL E;  3ZRG A;  3LL7 A;  1ZEL A;  2DOA A;  2NZM A;  3W2A A;  1LFP A;  4TKO B;  2WY7 Q;  4DBR A;  5CKT A;  3H5A A;  4MR0 A;  2Z6B D;  2Y0S A;  3E1S A;  4PMH A;  4AU7 A;  2A5W A;  4P22 A;  4C2T A;  5FRN A;  2IS1 A;  2ODL A;  1SFK A;  4XOP A;  3OYA A;  2X8K A;  3H5N A;  3OYE A;  2NT9 A;  2OUM A;  4ZTF A;  4IQ4 A;  1BHE A;  2PYH A;  5CDF A;  4CCN A;  4NUB A;  4H4K C;  2WPD A;  3ZCO A;  3BG6 A;  4PJL A;  2M7B A;  4HPQ A;  3L2V A;  2VQH A;  2O04 A;  4DNR B;  4XON A;  3SDB A;  1RU4 A;  1Z3X A;  4E7Z A;  4E4H A;  2CV1 A;  1OHH A;  4OWR B;  3MKW B;  1NHC A;  2ZSH B;  2E1M B;  3T56 B;  2VXZ A;  1O8I A;  3OYD A;  3OR2 C;  2BVL A;  4CH7 A;  1H80 A;  4BE0 A;  4E6K G;  2V9K A;  3BG7 A;  1X19 A;  3MD2 A;  2IGK A;  4OAZ A;  5KCM A;  2XND A;  4OZY A;  4HG2 A;  3DTI A;  1D0X A;  1JRG A;  2F5V A;  4X0G A;  1I8D A;  4BXF A;  1O8H A;  2ZZE A;  2L5Q A;  2M3A A;  3CJQ B;  4F91 B;  3QOD A;  1FX0 A;  2XF6 A;  4PSX A;  2VJ4 A;  3OYG A;  4XD7 A;  4B3G A;  4F93 B;  1O8M A;  2QX3 A;  4BGD A;  2NSP A;  1E0E A;  1QCX A;  5HVQ C;  1QHG A;  4BDZ A;  5C1C A;  4PJJ A;  2WJV A;  4DK0 A;  2VB6 A;  3K4L A;  1D0Z A;  4IKF A;  1KCC A;  3W2V A;  2K3P A;  4E7S A;  3OS0 A;  3OYJ A;  2QY1 A;  3DPT A;  2X6X A;  2RQQ A;  3K4N A;  2DT7 B;  3VSV A;  3HXL A;  4GRI A;  1WJA A;  1Z3Y A;  2HDW A;  4XL9 A;  4RM2 A;  1K28 D;  4PFO A;  3W2W A;  2A6T A;  2CH0 A;  4RMN A;  4Y33 A;  2CMP A;  3HOT A;  1WMR A;  3OYC A;  1FMV A;  2OV7 A;  4XNF A;  2XC7 A;  4C30 A;  2V6E A;  2K9L A;  2KRH A;  1FMW A;  1EA3 A;  3J7A Y;  2KQR A;  2KVO A;  3I3L A;  4F3Q A;  1W36 C;  1X4P A;  3PNV A;  2JA2 A;  3OYF A;  3IP4 B;  2V31 A;  2P0W A;  2V7Q A;  1Y56 A;  1HG8 A;  2INV A;  3B8Y A;  4YZQ A;  3PJR A;  4II2 A;  1MAB A;  1X1C A;  3A1Y A;  1I18 A;  1WTH D;  3IAM 2;  3HL2 A;  1QU3 A;  4ASU A;  1N75 A;  4HNT A;  2VBM A;  4IQJ A;  4ZDO A;  4XM3 A;  1DBG A;  3GQ8 A;  4W8Q A;  3LSK A;  2ZZQ A;  2M0M A;  4QPQ A;  3HPG A;  4G6I A;  1S9H A;  2NTB A;  2K9M A;  2UVE A;  2MFZ A;  1QJV A;  3ZGK A;  4YZA A;  4OJP A;  4E7J A;  3CZ6 A;  4XLC A;  2GJR A;  4NC7 A;  4BE1 A;  1KMH A;  4OJO A;  4BUP A;  5TGT A;  4D9J A;  2E5Z A;  1YE9 A;  4CCM A;  2R7T A;  2OC6 A;  2UWM A;  4XLA A;  4AVZ A;  4D1Q A;  4YRV A;  2KPM A;  3NWS A;  4II3 A;  4LIU A;  2UV1 A;  1AA7 A;  5FL7 A;  1IDJ A;  3QYE A;  1MND A;  3SEZ A;  3LSG A;  3S32 A;  4W8R A;  1DQU A;  1YX5 A;  4CUG A;  3BCD A;  3H9Q A;  4NC8 A;  1O8L A;  3MKZ A;  1K6Y A;  4B47 A;  2X1D A;  3GRH A;  2JDI A;  3VWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...