4YELA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
molecule keywords Tail spike protein
total genus 228
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yelA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yelA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yelA02
1KCDA 3EQOA 2NTPA 3FY3A 1GQ8A 1CZFA 1PXZA 4YZAA 2QX3A 2NZMA 3T9GA 3ZPPA 1PLUA 1PE9A 2X6YA 4XMYA 4NK6A 4XLEA 1RMGA 2VJJA 1X0CA 3GQ9A 2IQ7A 4XN3A 1EE6A 4XQFA 3GQ8A 4YEJA 1DBOA 4XORA 4AVZA 1OFLA 2VBKA 1K5CA 2O17A 4XOTA 4W8SA 2ODLA 1OFMA 4XN0A 2QY1A 3LMWA 4XLAA 1IDKA 1QJVA 3GQAA 3B4NA 1H80A 1OGMX 3B90A 4C2LA 2X85A 5AMVA 3KRGA 4OJ5A 4MR0A 4PMHA 4MXNA 4XOPA 4OJLA 4URRA 4HWVA 2VBMA 2NSPA 2PYHA 4XNFA 2O1DA 4Z03A 4U49A 2VJIA 3UW0A 4EW9A 1BN8A 1WMRA 2UVEA 2O04A 1O8HA 4OJPA 1IDJA 3ZSCA 2NSTA 3VMWA 1JRGA 1AIRA 4XKWA 4OJOA 4OZYA 2NT6A 1O8DA 4YZ0A 1KCCA 4XR6A 2NTBA 2PECA 3SUCA 1NHCA 1BHEA 2BSPA 4XLCA 4YZQA 4Z05A 4XLHA 2INUA 2O0WA 2X6XA 4XLFA 3VSVA 4I84A 1OOCA 2O0VA 4NK8A 1O8FA 4W8RA 1OGOX 1RU4A 2NT9A 1IA5A 4Z06A 4OJ6A 3VMVA 3B8YA 4U4BA 2VBEA 4OZZA 4XONA 3VSUA 1O8EA 1QCXA 1IB4A 4YZXA 2EWEA 2INVA 1VBLA 3GRHA 5C1EA 4W8QA 3WWGA 1O8KA 1O8GA 1RWRA 2Z8GA 3JURA 2PYGA 2X6WA 2UVFA 1HG8A 4YELA 4W8TA 3GQ7A 2X3HA 1O8JA 4XL9A 1O8LA 3VSTA 4XM3A 5C1CA 1O88A 1JTAA 1O8MA 2QXZA 2NTQA 1O8IA 3EQNA 1DBGA 1KTWA 1XG2A 4XKVA
chains in the Genus database with same CATH superfamily
3J81Z 2DA6A 4M73A 1SD5A 3DPUA 3CPWB 4HDUA 4KN7X 1GQ8A 1ETYA 1IG7A 1HW1A 4NC7A 3DCFA 3PUBA 1IDYA 3ULQB 3ZRGA 5J4VA 3JR9A 3KYLA 1XPXA 1ZRDA 3T9GA 4PC7A 1T2KA 4B44A 1DGRM 3RJPA 2X4HA 5HNFA 3BZ6A 3L7WA 2FNPA 2ZB9A 4A5NA 4LBZA 4GYIA 4DZJA 5DS9A 2BPOA 5J3OA 1UELB 4JRAC 5E3NA 2DOEA 5BPDA 4XN3A 4LG0A 1VZ0A 2XB0X 3SLNA 5E79C 3IL2A 5D4SA 3IHUA 3FBNB 1PKVA 3ASQA 1LUJB 2KZVA 4ZZLA 1H85A 3KP7A 4RAZA 3DBLB 4HG2A 2V1UA 1R5NA 1WI9A 1ZLJA 1FY7A 3BJOA 2P7VB 3I53A 4Y9RA 1FBSA 5IYQA 4FHTA 1BI0A 4Q4ZF 2IA1A 3GQAA 1RR7A 4R8HA 4M9XA 2YS9A 3BC9A 2C4TA 1YS6A 3IRQA 1QVUA 1X1CA 1E3HA 2W00A 2X85A 2NV4A 3A8KA 1QA1A 2Q2EB 1EA0A 3SFZA 3HKZA 1HSJA 2LLKA 3CCYA 3GXOA 4B1RA 2KKOA 4IW3B 1IXCA 4ZDLA 1E17A 4BE2A 4CCOA 5LHHA 5DM7F 4P1VA 4PJMA 4BU2A 4J00A 1BW5A 3DBRB 3M07A 3FPKA 5J35A 2J8IA 5M5YJ 3BR1A 3HHGA 4B3AA 2V4DA 1O8HA 1D1CA 1ZN2A 3ONYA 2RNGA 3S15J 3ZOBA 4EVIA 1K78A 1W2BB 2F5EA 1S7EA 3S3MA 1B59A 2JA7J 3QP5A 4BH9A 4RBOA 3QQAA 5J47A 3GFLA 3CMYA 1T8IA 1LNWA 2QGGA 2O6WA 4OZYA 3K4JA 3HYIA 3BDDA 3I56B 4ESJA 5EEHA 2BEOA 3OYFA 2PLFA 2CWEA 3F21A 3FKJA 4II2A 2E2HJ 1LM1A 3OYMA 2VIXA 3OEHA 2R7FA 3AG1H 2VNIA 2M1BA 3LO8A 2HQ5A 3KZZA 3FPPA 5IY5H 2XPVA 1ENHA 3LNQA 1UHSA 4LGWA 4KITB 1K83J 3LA7A 4MQVA 2MSYA 4NNJA 3WU2C 2OK8A 3HOVJ 2VQHA 3I59A 3OYLA 4Y13A 5J4YA 4FX4A 3W5VA 1WORA 1OCOH 2KDOA 3ZP5A 3CP2A 1BJKA 1G3YA 4A0YA 2DOAA 3WWGA 3VFZA 1S7AA 1VQ7I 2V9VA 5J40A 5ERIA 4BL0B 3BG9A 4NQWA 1H9TA 2O5RA 2WC2A 4G6DA 1ERDA 3DEUA 5GADJ 3G71B 1Q86D 2XTWA 1FTTA 2GK7A 5LD2C 3FXRA 3R0JA 1ZUNB 3W2EA 1RRJA 2QUFA 3R4KA 3R6KA 1XGSA 5C1CA 3RTRA 1O88A 3GTLJ 4BUPA 3HAGA 4D5FA 3S8PA 3U2QA 3OSGA 3FHZA 2HNHA 4PABA 1KYWA 1B9MA 1IN6A 2A69F 2IS6A 2XNDA 1DBGA 1WJ5A 4KICA 4UVAA 4IHYA 1WWXA 2W84A 3O2PE 1GXQA 2CMPA 3RDIA 1PDNC 2X48A 4UUSA 1TTYA 1RQRA 3LQ6A 2XF7A 3FY3A 1N05A 4QHYA 4RPDA 2JTVA 1W34A 2CC2A 1B4AA 2W4SA 3ABTA 4W1UA 2JRMA 3SYTA 5CPRB 3LL7A 2X1CA 3ZGKA 1PLUA 2DYRH 3I71A 1YW7A 2W57A 2WZNA 3RY8A 5HS9A 4P6VF 3DV8A 2EZHA 1IHMA 2IJLA 3MQ0A 4KIBA 4LIUA 5B5EC 1PVEA 4U9UA 5A89A 1QFYA 3OW7A 4YXWA 1VQPB 2VB6A 4J01A 1SAXA 1SD6A 2STWA 1YHQI 1ETWA 1J0RA 3SZPA 4RGUA 1VTNC 2MYSA 1BC8C 1T5EA 3ZZTA 1UD4A 3CC7B 5GP9A 3O6BB 3J80K 3CPXA 3C18A 1PUFA 2Q8KA 1FOXA 1O57A 5FO5A 5JHUA 1FNCA 3NE5B 3OPOA 4JMQA 1VQMB 4GFBA 2BN4A 3NEUA 3FXLA 1AHDP 4C3JJ 2XTXA 3CUOA 4XLAA 2DXIA 1QH0A 2GBYA 3B4NA 3L2VA 1I1SA 3RSNA 1A6QA 3BQZA 3MAJA 3KRGA 4UXNA 4OJ5A 4IHWA 3TDZC 2CO5A 3CDIA 4ZYDA 2ZJRF 2X0KA 1FP1D 4BGDA 1D8JA 1ZTRA 4PMHA 4KH3A 1ZHFA 2JSPA 2F4IA 1HF0A 1T33A 1HA8A 4LIVA 2JA6J 2RN7A 3V8KA 3J80Z 3GZ5A 4LLLA 2WY8Q 5FIUA 4OJPA 3K4MA 2MD0A 2XGCA 4CUGA 2IGNA 3OZVA 4P26A 4GYGA 1JRGA 3BQJA 4CDGA 4BS9A 4QVJA 5KVRA 3OJXA 1OFEA 5D6EA 2F1MA 1SMTA 2V7TA 4BNCA 3OIQA 1Z91A 4WXDA 1H8AC 3FF5A 1QZYA 1FOKA 2YWFA 2GIVA 2RVCA 4XLCA 2MA3A 2DCUA 3SZEA 5DEQA 1LEBA 3ISXA 2CQXA 3HOYJ 5B6IA 2HU9A 2CRGA 2F6CA 1QFZA 4Q48A 1ULYA 4HOBA 1T95A 2NT9A 2JMWA 1FX7A 3U1DA 2LKSA 4RD2A 4N9IA 3B8YA 3E20A 3JCUC 4OZZA 1Q82D 2HTSA 1Y1VJ 1Z7UA 3CCLB 2IW5A 4ROXA 4W8QA 4M3BA 1W5CC 1WSRA 4X06A 3EPZA 1J7KA 1I6XA 3CCEB 1MMDA 5HXBA 4Z4UA 3BR6A 1VQ8I 5A88A 3IAS2 2JPCA 4PK4A 2LY9A 1U2RA 2YWHA 1GUUA 1KRHA 4Z4WA 2QE7A 2EA4A 3HRTA 2D9RA 2X3HA 3BCBA 1IRZA 3CCRB 2M2EA 2OV7A 4C2MJ 1REPC 4FE7A 1TYWA 1EP2B 2PMDA 2XZPA 4ZCLA 4XKCA 5HNHA 4F7DA 4P22A 4S0HB 5J6XA 4YAUA 1TNSA 1B8IB 3ERED 1W7PA 5KCMA 3CCRI 3JSOA 2OD5A 3WG7H 4ESBA 3ABMH 3Q0UA 5F1JA 1OFCX 2MG4A 2NNNA 3PJRA 4HLYA 1KTVA 3AFHA 4RA2A 2D1VA 3KZIC 4A69C 4U7DA 3K1NA 3V42A 5LEJA 2J5PA 2R7OA 3ZCOA 2UUZA 4E7SA 2DPUA 1TWFJ 3BJ6A 3FKSA 3QWLA 1LKXA 3TW6A 1Z0XA 2BZTA 3FMSA 3HG9A 1Z77A 1E1QA 1NDHA 3DU1X 2EFPA 4Y33A 2G0YA 4X6AJ 1E3ZA 2MC4A 3JSPA 5F64A 2PEXA 4XORA 1OFLA 4MFDA 2I5UA 3VYRB 3I58A 3PQJA 3K70D 1KC8D 4W8SA 2XHKA 3OL4A 1IW7F 3I9V2 1FJLA 1FEXA 3LMWA 2XKPA 2IGMA 1J75A 4F93B 1W36D 4Y7CA 2M30A 5EDNA 4BJ5C 3LOCA 2DPDA 1AA7A 4GQNA 1WDTA 1W1WE 2R7ZJ 1KU3A 4KJZA 3E7LA 1F1ZA 1HF2A 1QQ1A 4B3FX 2WV0A 1VI0A 3OW2B 3CRZA 1YYVA 4OJLA 2LBFA 1ON2A 5FLVA 2KIMA 2BGJA 2QTLA 4HWVA 3WE2A 1GV5A 2EPFA 5M5XJ 3GTJJ 1WVRA 1XSVA 2L7MP 2PYHA 3L09A 2CW8A 2ZZGA 4L9NA 2ZCWA 2XSJC 1A35A 2X53S 2ZXJA 1KA8A 1DG1G 1GT0C 3HJEA 1AIRA 2DA5A 1OCCH 2CUZA 1I50J 4HRIA 3ZMDA 1B72A 1UG2A 4MGRA 3UKGA 1Y39A 4BKXA 2DYIA 3OL3A 4YALA 3U6BA 1O8DA 4BJTA 4UY8I 4M4SA 5CLSA 3KP4A 5D8LB 3N05A 2R5ZA 2ZJQF 4E4HA 4OPVA 4AVPA 1MJ9A 2VT3A 5IYCJ 3OYBA 1VQMI 3CCSI 3IH2A 1Q1HA 2O0WA 5CQEA 1FWZA 3QAHA 1W36C 4NC8A 2GAUA 2XKOA 3QFTA 2R93J 2VBWA 3U9GA 2EZKA 2IXSA 2VC0A 3L2QA 3OKXA 4YFKF 2F5CA 1OLTA 1BX1A 5FD6A 1O3RA 2AXTC 2DY1A 4K1XA 1Q7YD 3ASOH 2A6TA 3T53B 3LSKA 4B4DA 1Y56A 3OOPA 2HI3A 2LKXA 2O9LA 1SKYB 1X1AA 1KU7A 4L5JA 1DU0A 3S17J 1TW2A 3O8HA 3KPHA 4CICA 2OBPA 1D5VA 2GJPA 1VQ4B 5JLVC 2P0WA 5E3LA 2PE3A 3BY2A 2IS4A 3P9KA 4MLOA 3EQLF 3WNCA 1GXPA 1RETA 2HYGD 3WTWC 3VR6A 4X05A 1B6AA 4PAAA 2H8RA 1WJAA 2L3DA 3L1PA 4HF1A 1O8IA 1NK2P 4E7ZA 2NTQA 4RD1A 4M0LA 1V4RA 2FOKA 1VQ4I 2HVSA 4YDTA 1K79A 4PC1A 2XZOA 2XF5A 2EQRA 2PFBA 1U78A 4KISA 2FBKA 3BLYA 1X3WB 2NVXJ 1X4OA 2IAIA 1FBQA 1HSTA 4B3XA 3PO3J 1YIOA 1J59A 2VUMJ 1AKHA 3JU4A 5AONA 3VB2A 4QFMA 5F04A 1X1BA 3HC7A 1CNFA 1FIPA 3D0SA 4F3QA 1ZRFA 2Q6LA 3MVPA 4V2FA 2W6IA 3GQ9A 4Z4VA 4DBRA 3V7CA 4TN1A 3BC8A 3AVUA 3ZN0A 2E5NA 3OYHA 2AS5F 2EV5A 4ENMA 1QVFB 3LA3A 3OR2C 2VBKA 3GLLA 3OWTA 3ZPLA 1Z9CA 1JT6A 4MO7A 4FT8A 1TZLA 4XN0A 3H9GA 4P55A 4CYCB 1HOMA 2QKMB 5BSYA 3BTIA 3PSSA 5J1RA 1FP2A 1LDJA 1ZM4A 4K2EA 3BR2A 1D1BA 2EB7A 3B90A 1H8HA 4PJNA 5AMVA 2KFDA 4M3EA 1D8TA 3PUMA 4E7KA 2LP0A 1R4NB 1JJ2B 4BPRA 3BTCA 1UJ8A 3K4BA 3TP3A 2L7KA 3CMMA 4A3GJ 4GCVA 3LAPA 4UHTA 5HDKA 2UXXA 5D6FA 1ZQ3P 4Z03A 3HPHA 4MYUA 2ID3A 4M71A 2VOOA 1R1UA 1U5TA 3N90A 3DKWA 3FMQA 1JKPC 1FYKA 5A2QK 2C5HA 3LSMA 3GVKA 3ZMZA 5FD5A 2EV0A 2QBYB 4OJOA 2W85A 2RAEA 1JHFA 2V7FA 3QP6A 2TDXA 3CO6C 2HWVA 4Z1MA 1IDZA 3KL9A 5H6QA 2K9MA 4L9TA 4PFPA 1USTA 1SFOJ 2LZJA 5ILSA 1BHEA 2M5WA 2PBIA 4L8JA 4XLHA 3WG9A 2VKVA 3J7ZI 5LGNA 1MDMA 1E63A 2O0VA 4W8RA 4QV2A 2IGKA 3UNGC 1A36A 2Z6BD 3RIQA 1VQ7B 1YLOA 2CUFA 3DWLE 3K4LA 1APLC 4OIPF 5H2FC 2O7OA 4OIOF 2L2OA 5HLIA 3VSUA 3HRSA 4FQGA 2R0QC 4HX7A 1V5VA 2XTYA 1U5TC 2FBHA 2PMZN 2MC3A 2QSFX 2R7DA 2XSDC 1HW5A 4ZJZA 2VL8A 2ZMEB 1Q9SA 4FX0A 1ZREA 1MBGA 3DQVC 4Y3OA 3JURA 2FA5A 1AU7A 3PUNA 3ABKH 1HG8A 1X3UA 1TYVA 2E36A 3HOXJ 5KNLA 2DTZA 4N9HA 4CZZA 4XD7A 4QPOA 3LFUA 4G7OF 1HW2A 2DOFA 1S3JA 4GO1A 3OS0A 1MZBA 3HOZJ 2AXLA 2KRHA 3KIOA 2FUG2 3BTLA 2A68F 4U0WA 3EQNA 2LNBA 2X0LA 4B3GA 4A5MA 3W2GA 5LHIA 1F60A 5FKMA 4XKVA 1QNTA 4YFNF 1ZG3A 2OTJB 2HGCA 5TY0A 3J81k 3W2IA 1OJLA 3SQNA 2R7XA 4DNTB 1CZFA 4RDKA 1PXZA 4DIQA 4ZYAA 1VQNB 2QZAA 3HSRA 4BE1A 2A3SA 4IZZA 1K9MD 3FXUA 5HOOA 3GTPJ 1JA0A 2JJ7A 3FX3A 3GTQJ 5K7HA 2CW5A 4G5GA 2IOUG 1FOYA 3GBGA 2R92J 3BJAA 3K1MA 2BBYA 1PUEE 1FNMA 5E8GA 1IZ1A 2VBYA 3PNTA 2M8EA 3N6ZA 3HDDA 2WAQN 3LQEA 4YEJA 2HKOA 1R71A 4RB0A 4EV0A 4CYCA 3U2RA 3PO2J 4X7EA 4Z4SA 2VXDA 1Z3YA 1WJCA 2HQNA 1YX5A 4JX4A 4M6YA 2XV4S 2FE3A 1U3EM 3BP8A 3G6EI 1KQSB 3OS1A 1IDKA 1RESA 2LR8A 2R7WA 1BR2A 4PJJA 4L9VA 2QSGX 1W0JA 2WYRA 4UZEA 3GLXA 2M8GX 3S2WA 1KZHA 3Q3SA 1W0UA 5FRMA 5HS7A 3KX2A 3SKBA 3L2UA 2BV3A 4Z4ZA 2C6YA 2XGEA 3K0LA 3LVBA 3R61A 4MFEA 4A3CJ 4G7WA 4XNFA 3VYTB 1AOYA 3A03A 3UW0A 5TV2A 2ME0A 2IPQX 1FMVA 1O3SA 1RUNA 3JRIA 1YX3A 2YUSA 2WWYA 2UZKA 2FX3A 1IO2A 1FTZA 5JMCB 4ZYHA 4NCNA 5KHDA 5DD8A 1JGGA 1LDKB 1IJWC 1DDIA 1WJFA 1ODDA 2NVUB 3H94A 1NG7A 1MD0A 3P9IA 5C3EJ 5F4JA 3P4GA 3H5NA 2DJIA 1QRBA 2IS2A 3S93A 4II3A 4A3LJ 1IN4A 2K9SA 1WH7A 2BM7A 2DK5A 3KCCA 3PA2A 2DQLA 2WY7Q 1LE8B 5EJCA 5FB2A 5DCFA 1LVKA 1CNEA 2KVOA 1N75A 1RR8C 2LKPA 2XOKA 4HYEA 2ECCA 1SFEA 4EM1A 1ZARA 1RU4A 1Z3XA 4HSTA 3VYUB 3L9FA 3A01A 5DCMA 1ZM9A 1ZGAA 2A6HF 3Q6RA 4U4BA 4FETA 3NQOA 2XAQA 2CBXA 4TKOB 2E5ZA 4V2GA 3ZQFA 1NB9A 2DA7A 3V4GA 4CCKA 4M53A 3KFWX 4KN4X 4RAYA 2VBTA 1O4XA 1CGPA 1KGSA 5HS8A 4FXUA 5F08A 3AG3H 3GZNB 3OY9A 2F3LA 4YAWA 1N25A 3LSHA 2QSHX 5JVGF 4ENNA 3GTKJ 3WNDA 1EP3B 3PVDA 3GYHX 1ON1A 4AIJA 3ZQQA 3A8JA 4UAJA 1DGWY 4TMWA 1Q81D 2V9PA 2RREA 1TQMA 3ZMVA 2ZZQA 5DSZA 1I18A 1NTCA 1R5OA 2DAOA 3IH4A 1MNEA 1ZR2A 2JUCA 4LOCA 2JVHA 3L2RA 4XKBA 3A8IA 2FSWA 1K73D 5LGTA 2CJJA 2XGXA 2HOEA 4LMYA 4B48A 3G2BA 1R49A 1SAUA 1R58A 3MD2A 4LBYA 1FZPB 1RKWA 2M87A 1FNNA 3E0JB 2ZJ2A 1G3SA 4DNCA 1P7JA 1R5HA 2XF6A 3K4KA 2MABA 2EH3A 3C2BA 1D5YA 3GTOJ 3SDBA 3FM5A 4A93J 2AO9A 3ML6A 2BF4A 3WQZA 1LLZA 1WXRA 3A4CA 1X58A 2B7EA 4AF7A 1FNDA 1CF7A 5L3CA 1EE6A 2VBUA 3I5UA 5F0HA 4Z4RA 1VLYA 3ABLH 1WOOA 3AL0C 2C5BA 2MD5A 3J7AO 3ISPA 1PJ7A 2Y0SN 2LVSA 2ZZEA 2JZYA 4IX7A 1QRYA 3MFKA 1FSEA 4A0ZA 2B63J 4UVCA 3H3VK 3VO1A 1HKSA 2UXNA 1G7RA 4C0SA 1WJEA 3FWEA 1HKQA 3MHPA 3ELKA 1XGMA 2AHOA 3K10A 4PUSA 5HKKA 3HGYA 2Y75A 2BMWA 4F7ZA 4XSXF 1KQ8A 3RI4A 2YSRA 3LSRA 5CJ9A 1UMKA 1ZLKA 3CMEB 1XGOA 5F0FA 2FU4A 4B8XA 2CFOA 1KONA 4ZGNB 1IF1A 1BJAA 2ZBKA 3F72A 3WY9A 3M1EA 4HIZA 4HBLA 3LA2A 1U8RA 2CNDA 3G4SB 3W5HA 4EW9A 4KKTA 3I56I 3GUDA 1GAQA 1IDJA 3T1BA 1IUFA 2NSTA 2BM0A 4C9YA 1H42A 1S7OA 3HZJA 2HKXA 4AWXB 3KEOA 3IC7A 2VBSA 2K85A 1SVMA 5E20A 4CXFA 2JRTA 2NVQJ 4Q7JB 3QU6A 3TOAA 1GLNA 3BCAA 2LSOA 1E62A 4XR6A 3ZQHA 2X1DA 3K4CA 2KJBA 2X1EA 3B78A 3CLQA 2M45A 3WODF 2H09A 4QIWN 2L4AA 4HZFA 1W0TA 2E1RA 4YAOA 2NPFA 3ECOA 4CYDA 2QA4B 3E97A 4EH1A 2XAJA 2QBYA 3CCMI 1IA5A 4HEA2 4A3IJ 1N0UA 3JRHA 3I3LA 4I01A 4JX5A 4IKFA 2BM6A 4BXFA 5D8KB 4X0CA 3O3KA 4ZTJA 3PQKA 1J9ZA 3DLLF 3WHBA 2HVRA 2F5VA 2PMUA 3QE2A 2INVA 2J8KA 1M1EB 5A8AA 2CQKA 2FQ4A 3PENA 1G8XA 3E1SA 3G1LA 5B1AH 3ASTA 1D0XA 2RDPA 1AWCA 2UVFA 1Y8RB 3G3ZA 5DYMA 1ETQA 1TWHJ 3JAMZ 1SVOA 2E1NA 4Y4RA 1HVXA 3Q9VA 1JXSA 2L4MA 1TQPA 1TLHB 4JOMA 1O8JA 1YLFA 4UV8A 3T8RA 3VSTA 4XM3A 2DFFA 4XRSG 3OYIA 1VQOB 3QFRA 2ZXHA 3ZQLA 2WA0A 2FF4A 3OYNA 4YFXF 3M9AA 5HDNA 3LNNA 1OYWA 3Q39A 4J0QA 2Z9OA 1SD7A 2XZLA 1WTHD 3OAAA 3DU5A 2QENA 2VASA 1NRKA 3ROUA 1BX0A 3EQOA 1G7SA 2CQNA 3P7NA 4A12A 3KLNA 5CYVA 5E8IA 2D5VA 4HV6A 2WTEA 2GPJA 1O3QA 2FRHA 1O7LA 2GWRA 1VQKB 4A0XA 1XB2A 2NZMA 5LFAA 2OUMA 4QTRA 2ACJA 1Y6IA 2VOPA 4RD4A 2JJ1A 1B8IA 3VO2A 3VNVA 2VKHA 3EYYA 3MZ8A 4NK6A 5KK1A 2R4GA 2VJ5A 2F4NA 1QBJA 2VJJA 3S1NJ 4G1VA 4KKSA 4LK0F 2BVMA 1A31A 4WCGA 3H9QA 3GMEA 1GVJA 3H5RA 3M7GA 5B3SH 4HF2A 5EEGA 4BBRJ 5FO0A 2PLYA 1ITYA 2DMPA 4AVZA 4DK0A 2DO7A 1ZGJA 1JKOC 3LJYA 2NVYJ 3W2VA 3S1RJ 1W87A 4J19A 3WBJA 3NWSA 5LRSA 2JT1A 1QGAA 1MH3A 4XRMA 5EMNA 2QY1A 2YUHA 1MBJA 3B6CA 2VLAA 2VN2A 4LC0A 1DABA 5IP6A 5FLXK 4PFOA 4ZTFA 1GJRA 3E6BA 3ONUA 4F52A 4N4NB 2OTJI 3HSEA 2Q6KA 4YFOA 1TWGJ 3HEFA 2FJ1A 3V76A 3OYJA 2W7ZA 3DTIA 3F8FA 1V3FA 4XLNF 2LOOA 3ZMSA 4DOZA 3CCLI 5IYDJ 2EK5A 2M7BA 2VT2A 1E3OC 1WZ2A 1YJWI 1TNTA 2E2IJ 1VQ6B 1WMRA 1X3ZB 2NOGA 1ETXA 4TSFA 4G6TB 3M8EA 1VQPI 1W35A 4OP7A 4WZKA 2KMUA 2JUGA 4OM9A 5F4MA 1V0EA 3W6KB 4OWRB 1FX0A 2VODA 5DUKA 2NRAC 5LRRA 4Q47A 1Z6RA 2EJRA 1CF7B 5E6TA 2FVGA 4M6VA 4I6ZA 2R7UA 1W7PB 2NTBA 3TO7A 2RKHA 4G7XA 3I54A 2DQRA 2V7UA 1RQPA 3OOUA 2Q6OA 1VQLB 1YW9A 1YRNB 1S0UA 1TBXA 2R3SA 4EGYA 4C3HJ 2PJPA 2VFMA 3FXJA 2QN6A 2XC1A 3F23A 3JRDA 3DXJF 1TYUA 1G59A 1EH7A 2ZL6A 1OGOX 3CF5F 3VDXA 5LMZA 4RGXA 5GV7A 2COMA 3U1KA 2QYOA 3GVAA 1JTYA 3K2ZA 4I7HA 4KNYA 2YWEA 1R1VA 1KU2A 1P2FA 5ICFA 2ZJPF 9ANTA 3QYEA 2HTJA 3CCMB 1R6RA 1SVLA 2E35A 4HNUA 3G4SI 3CC2I 3A2KA 5FJ8J 4FASD 2W25A 2A05A 2R5YA 1HC8A 3OV8A 2PJRA 2CRVA 2R9VA 2V7XA 1EZGA 3JTHA 1I39A 3B8HA 3AG4H 2W82A 4OPSA 2V1NA 2WADA 4U88A 5E1WA 4Y7NJ 1OCRH 3MKYB 1RUOA 3VNUA 5FA6A 3HIFA 2DFHA 1WOSA 2V1DA 3GF2A 1H89C 2OBSA 3SYJA 1MH4A 2DEUA 2QKLB 2K02A 2GLOA 1UG0A 2PN6A 4M2LA 3AGPA 2ICWG 2BW3A 2FD5A 1J5YA 4H0EA 2V79A 5J1UA 4RCYA 2OTLI 4CCJA 1DARA 1WSUA 1TW3A 2FMYA 4YIIA 4MEXF 1FNBA 3F9KA 2RQQA 1JTXA 1LVAA 3CD6B 4IPAA 3HM5A 4IHTA 1Z1DA 4HQEA 1AMOA 1ETKA 2XDVA 3PNVA 3ZMUA 3DBHB 3S1QJ 3CCUI 2A6EF 1GVDA 2KQRA 4IO9F 2NNYA 3HSFA 4WK8F 1LDDA 4XBFA 1Z7LA 4ASNA 4HNVA 3WHCA 4IOAF 2R7QA 3GO5A 5IOYA 2EIXA 2W24A 3HHHA 2E60A 2G0EA 1N0VC 3F6VA 3E5UA 1CQTA 5IP9J 4RCZA 3CDHA 3WTUC 1FDRA 1B23P 1S72I 2X9DA 4XOPA 2H6BA 2DDBA 1EXMA 3MN2A 4U0VA 5EYRA 1G7TA 1J09A 2LH9A 3OYDA 2XPWA 2V7QA 4UZUA 5HLTA 4YEIA 4IHSA 2MGQA 2CV0A 4PC6A 5GTIC 4PSXA 1V5EA 4Z4TA 4P3IA 4U7BA 1T39A 5CVVA 3HL2A 3V7SA 3ES9A 2XASA 3JQPA 1E79A 2VC1A 2IT0A 1VQOI 1YJWB 1S29A 1YRNA 5GPCA 4M6XA 3HUGA 3AKZA 2XGJA 3BOQA 1VQ5I 2UWMA 4GRIA 1JNYA 2HPIA 3FKIJ 1FRNA 3A35A 1HDDC 2BM4A 4BEHA 1U5TB 2X6XA 2VFNA 2L01A 4D0PA 4X07A 3DLAA 4DQKA 2HZDA 2ISZA 2DFIA 1KJZA 1FBUA 3R6JA 1XX5A 4OJ6A 3MMPA 3HB9A 3KETA 1MBEA 3BNWA 2EZLA 4XK4A 2QEXB 5D5XB 5IT9K 1LB2A 4E6KG 5DS0A 1IB4A 4NC6A 1HBXG 1LJ9A 1YJ9I 1H8EA 4F92B 1YITI 2CW7A 4RLFA 4BDYA 1UD3A 1R9TJ 2M7AA 1JI8A 3LQRA 3FM3A 3GCMA 2ISYA 1VQ6I 4S05A 4EGZA 2M5SA 4UVBA 5HODA 2O61A 4CQJA 3CP8A 4JQFA 3H5AA 1OCPA 3OIPA 4N3NA 5BNGA 5GPAA 4EJTA 3J7YJ 2PJRB 3WTTC 3DP7A 1IRFA 3VMFA 3BZCA 2HPMA 1M90D 1S8NA 1DDGA 1QO0D 2W1OA 4DQ2A 4FCYA 1FMWA 1DUXC 3BQYA 2DMNA 4Q5SF 2E1BA 1VQKI 4ACAA 2NAZA 4OAYA 2VKEA 2NS7A 4ZC3A 2F1LA 1K5CA 1XFOA 3GTMJ 3I64A 2C2WA 2DERA 2QQBA 3IKTA 3BY6A 3ZQGA 2BOLA 4BY1J 1KYZA 2G7UA 5TGTA 2BY2A 4MQ9F 4DYQA 2VNKA 3HOTA 1VJSA 4FN5A 4FE4A 3CCQB 1Y0UA 1JJ6C 4B47A 1OB0A 1QGPA 1BQEA 5H59A 2KHMA 1P7IA 2XB5A 4RPBA 1S9HA 3B73A 1TLLA 4OMZA 1LEAA 3BH7B 2R6HA 3WTXC 5F27A 5D5WB 1VQNI 1IC8A 5GV8A 2DTRA 4D1QA 3F8NA 4M3DA 3NARA 4MEYF 2BHYA 1K78B 3N97A 2VI6A 1RZ4A 3B02A 3DEWA 1J9IA 2R7SA 3F8CA 3DU6A 1V55H 3PSIA 1Y8QB 3X2QH 1WQ2A 4X1EA 2M0CA 1YTYA 4L5EA 2KZGA 1DPRA 1JE8A 5AIPA 3F22A 4ZYEA 1PUFB 2EIMH 3S1MJ 1LLWA 4X7DA 4H9GA 4YRVA 1X2MA 4UB6C 3GVLA 5H5JA 2H1LA 5ICEA 2KRCA 1BR1A 3K1PA 1T38A 3GX4X 2ECBA 1HCRA 2QQ8A 1S5LC 2GM4A 2L54A 3FXQA 1O7FA 3CUQC 4RS8A 3BH4A 2ZZFA 2BW3B 4EM0B 3OE7A 2F2EA 4E7LA 2OYNA 1ACIA 1K4SA 3IWZA 1EFCA 1N08A 1BI3A 3MCAA 2ZO4A 1I3AA 4U87A 2CYYA 4D7NA 1S72B 3JQRA 5M3MJ 1MMSA 4G12A 4RLZA 2G7HA 2IEKA 3CLOA 4JK1X 5FROA 3RZOJ 2WJVA 4V19K 3VWBA 3A01B 2O6GE 1T6ZA 3BCDA 2PECA 5FRNA 1ZK8A 2K27A 1MMAA 3BROA 2MH2A 1NHCA 2XROA 5IYNA 1V5FA 2E19A 2YPRA 1OCZH 1MNDA 1XN7A 3NAUA 4MHGA 5HZAA 4LG3A 4XLFA 3NRVA 2J7KA 4QLCU 1WKMA 2BY0A 2CSOA 2RQPA 1XSDA 4TMXA 4NK8A 4PGGA 1S6LA 3CB4A 3ZQIA 2HZTA 1HQCA 1EWYA 4Y9UA 1SANA 1W4MA 4E70A 1CQXA 1QX4A 4WWVA 4WXHA 2LY2A 4CO8A 2BVNA 3ZZUA 3M8FA 4I98B 5GAGJ 1XD7A 4N4OB 2Z1DA 2I1LA 2VBEA 2VBZA 1Z05A 1ZGWA 4OU0A 3SDGA 4BXUA 5KAFC 2GQQA 3H3ZA 1N8RD 2JN9A 3QOPA 2LC2A 1YI2I 3U6KA 2VONA 3QODA 1O8GA 3HBLA 4LD5A 1IN5A 1YO5C 2RC5A 3ASPA 1WHUA 1XMAA 1ETOA 3CQZJ 1HZEA 3GQ7A 2ZNYA 5LLQA 4DJAA 3OP1A 4JYKA 1JKQC 1O8LA 3Q0WA 1WCMJ 4M9ZA 3DTKA 3JRGA 4PSWA 2DYSH 2P8TA 2I8DA 2DU9A 3JQQA 4CCNA 1EV7A 4XICA 2K9LA 1VQLI 2OQGA 3AAFA 3CC4B 3CJTB 2GA2A 1SMYF 2MLKA 3ZQ7A 4IRIA 1K4ZA 5DNSA 1QA2A 2Z99A 1ZG1A 2WSSA 3PL8A 3GFMA 4LBVA 1G7CA 2JJ2A 1OKRA 2QDXA 2ZSHB 1XDSA 2L5QA 2WV1A 1BM9A 4OPOA 2D45A 1ZM2A 3AVYA 5DV5A 1IAWA 4XMYA 3OR1C 1EJ9A 3I1FA 4XLEA 3ASRA 3ZN1A 2VQLA 5L3GA 2B5OA 2KP6A 2MBFA 2O0YA 5JBQA 1OISA 4IF4A 3TL4X 2C4UA 4PC3A 3TMOA 2K7LA 3RQ4A 2YU3A 3GQ8A 5K5QA 3EETA 4MTEA 3RKYA 1COWA 3B6AA 5E3MA 5F4OA 3MCZA 2I10A 1PP8F 4Z6YA 1XE1A 3IAM2 4L5IA 1JKRC 3E1YE 2Y0SA 1JA1A 1NJID 1OFMA 2ZL7A 2CFXA 1ZRCA 2HVQA 4ITVA 1X19A 1QJVA 3ZZ0A 2DA4A 2GIZA 3ZQCA 4HLXA 3CF2A 3DPTA 1E3XA 3AL0B 4DW6A 2CGPA 4OMYA 1LFPA 2RNJA 4KMFA 2ZNZA 1AKHB 2OBTA 4F55A 1WU8A 3CW2A 2VKDA 5EGOA 1IXSB 1L0OC 1WFXA 4KT5C 4URRA 2GK6A 2EZIA 4UUVA 5IT9Z 4X8IA 4I02A 3S14J 2HOAA 1EFRA 1QUFA 4MNUA 3W2HA 3H9JA 4ZDOA 1XMXA 4L0YB 4CCLA 1W9XA 3SY2A 3RZDJ 4RLQA 3L2CA 2HYFA 3CCJI 3WYAA 3VSKA 3MKLA 3K4NA 2ZBVA 3OMYA 4CCMA 1A6IA 3A0HC 1X1DA 3BPXA 2ELHA 3L00A 1OYYA 1XB4A 4DBQA 4C2UA 2AQEA 5J3LA 1TVCA 4ENKA 1YE9A 4YZ0A 2C78A 2L0KA 4RB3C 1KCCA 2HMAA 3D5LA 3I4PA 2CV1A 2X8KA 1HDPA 3ZUGA 4NBSA 3KLOA 4M74A 1T0FC 4A6DA 5EF6A 4MTDA 4PZJA 3M3YJ 2BM1A 1ZKGA 2K40A 2K86A 2L02A 2VE8A 1XDUA 5CVIA 1NBMA 3JX8A 2CQ7A 2KLOA 3FJOA 1GVHA 1YITB 2BY3A 1OR7C 4Z06A 1JGSA 4OPWA 3CCVB 2W48A 2ME6A 4OOXA 1YQAA 1WI3A 1XG1A 4AU7A 2Y48A 4A3EJ 4GDFA 1O8EA 1BL0A 1TT5B 1QA3A 1ZM3A 4PDKA 2LK2A 3ABUA 4KUMA 4RAFA 2ZL5A 4KMUX 1F5TA 2EINH 1SM4A 4JX6A 1W0KA 1PJ5A 3F0CA 4XSZF 3QPTA 2DA3A 5FLXZ 4ABZA 1YI2B 1BJZA 2M3AA 1F20A 3VPRA 1XTAA 3P9CA 2QXZA 4I2OA 1TTTA 4D7MA 3KZYA 4RDJA 1QVTA 3LYCA 4LK1F 2O3FA 2B7CA 1YOVB 4RD6A 1FT9A 1OB5A 3CD6I 3HPGA 1U8BA 1IV8A 5TRDA 2WB1A 3SJMA 2NVTJ 1IUYA 5FKOA 1XS9A 2EV6A 5BPIA 3PIPF 1MMNA 5D5UB 2ZMEA 4X0GA 1TSPA 2JWTA 4BDZA 3IWFA 5JFRA 4YHBA 1NHAA 2OA4A 3WTZA 1E1RA 3PM1A 1OFDA 5FNZA 1EF4A 3ASSA 4E7IA 3EUHA 5FO1A 4A3KJ 2M0MA 4HX4A 1PP7U 3P27A 2E7XA 4TT3A 4O6JA 4NQWB 3QOEA 4XOTA 3H0DA 4P9FA 3TP0A 3AVTA 3NAWA 2R7TA 2OPTA 3CUQA 2QQ9A 4YC5A 4D9JA 4FTHA 1KK0A 2XNJA 4BXXJ 1EH6A 2IS1A 4R71A 4PC2A 2QM3A 2GZWA 4TV7A 1R5GA 1KQ0A 2BXYA 2P5VA 3IKVA 3LFKA 1DDNA 4P3YA 1GV2A 1BI1A 3WTYC 3JAMK 2YX7A 2ETHA 1UMQA 1YJNI 4E7HA 4IVNA 1V54H 1U9OA 1VQ9I 4CZCA 2R7VA 3H9NA 3IH3A 3LSJA 1ONVA 4WX9A 4BYYA 1P4MA 3EDPA 1OGIA 4WZLA 3A3GA 4TMVA 4IQ4A 3PSZA 3H36A 3A3BA 3CJQB 3CCEI 2ZFUA 4C30A 4CSWA 1Z21A 4ESFA 1R5ID 3ZC3A 2VNJA 4IOCF 4PGOA 3QSYA 2WAEA 3H3UA 5K1YA 4AIKA 1IN7A 5AN9A 3VSLA 2RC4A 5KW9A 2DODA 3LSTA 2W7NA 4WQMA 5JHFA 1YX2A 2OZ6A 1TP4A 2OC6A 2INUA 2QEXI 2LF7A 2EIJH 1NH3A 2ZSIB 1OGJA 4DK1A 1H9GA 2ELKA 4KIFA 3SXYA 3D5RC 2GA1A 4RJLA 4C2TA 1EH8A 1U9NA 3R0AA 4UUSB 2IP2A 2HDNB 2QQAA 1D0YA 4CGZA 3ESWB 4NUBA 4XONA 5F0CA 3RYPA 5JI6A 2BY1A 5L3FA 4YZXA 4G94A 1VBLA 3FXKA 5CVRA 1X2NA 2V26A 3JREA 2KL4A 2V1XA 3PIOF 2ZTGA 1WRJA 2F43A 1E43A 4OOSA 2HOTA 2Y9ZA 3W6JB 2L9VA 2V31A 3GSIA 1P4WA 2PMZA 3FBIB 2Z16A 1JUPA 3FISA 4ENJA 3JRFA 1ZR4A 1VLOA 2YX4A 1WGXA 4AD9A 3M1CA 3M8JA 3HOWJ 1MBHA 4IEJA 3VODA 2EFNA 3PSFA 2P6SA 4DYCA 1DP7P 4UB8C 3Q3AA 1QHGA 3DF8A 4RM3A 5E3OA 2Y30A 5F6FA 2P81A 3EUKL 5ICGA 3FIWA 1QZEA 5ILUA 1SC7A 5C44J 2ZC2A 3BT9A 5E17F 1MJBA 2NS0A 2X51A 5DCMB 3TGNA 5IPAA 6PAXA 3I0TA 4BE0A 1OYIA 3LSGA 4B43A 2HLDA 3W5UA 4YZAA 2JSCA 4X7FA 3CCVI 1KK2A 4WXCA 4DZPA 1NB0A 3QPHA 5KAIC 2P6TA 3SJPA 2JIZA 1BN5A 1FYLA 5CDFA 3FXOA 4ETSA 2Y69H 2X6YA 3NB2A 2GJKA 1W5SA 1EFTA 3QU3A 1OHHA 4U0YA 3KYCB 4A3JJ 2M4GA 4V02C 4G6IA 4HSRA 4RGSA 1FLIA 1LQ1A 5BOXA 4B4CA 3AVXA 2XPUA 5HDGA 3HTUA 4I0BA 3DTEA 1DBOA 3SZGA 2BM5A 1QVGB 2QYUA 3PETA 4IL6C 3WXMA 5IP7J 4WWCA 5L46A 1MW7A 2VPRA 1QGYA 1QPMA 2OAZA 3CMAB 3BCFA 1YIJB 2CUJA 5TISC 1RC9A 2WAFA 3Q0VA 1H80A 1K4TA 2B7BA 2DOGA 2FXAA 4C2LA 3GFJA 1SD4A 1F43A 2H6CA 2H1KA 3SLDA 2LF8A 2G9WA 1K6YA 1TC3C 1BC7C 2E71A 3AG2H 2OTLB 4OIQF 3HXLA 5FFXA 3TDUC 2TRTA 3HOUJ 2V7VA 4ACBA 1TUIA 1POGA 3CESA 3ZXSA 4TMZA 2DI3A 1VQ9B 3WTVC 4G6QA 4DQLA 2O04A 2DMQA 1XC5A 3E5XA 2F4MB 1Z6TA 1B9NA 2JDIA 2GOMA 2OU2A 5EGOB 2LD5A 2VBVA 3CCUB 2CV2A 2AQFA 5EG0A 4HV5A 1SFUA 3TH0A 4LG0B 2V9KA 3K9TA 3W2FA 2A5YB 1K8AD 1DU6A 1HA3A 1G6NA 2KJCA 3Q9SA 1TT0A 1R4MB 2L7FP 5LBQA 1BIAA 3IP4B 2WAQA 4MIMA 3CUQB 5BMZA 3VSVA 3KEWA 3H1CA 5CVJA 5BS6A 4RD3A 3C2HA 2E1MB 3NWTA 3VEPA 2XAGA 5DUIA 4QSHA 1GDTA 3MKZA 3CXCB 5CKTA 4DYRA 2C77A 5IYPA 3Q6QA 3PNYA 1OPCA 2Y31A 1QGZA 2Q2EA 5C1EA 3SQVA 5LGUA 4YCQA 1JJ8C 5JLXA 1UD5A 2IVMA 4RGRA 1AIPA 1RWRA 1UZCA 1STZA 2JPBA 1KZLA 3QFSA 2OJED 4CA0A 2D74A 4Y52J 4P6YA 3Q38A 2EILH 2WBMA 2KISA 4I76A 2XT4A 4GGGA 4R79A 1UHMA 4QPQA 4XLPF 3FZVA 2OCCH 1V0FA 3ZPNA 1MBFA 2DW4A 1F4KA 1OMIA 2KIQA 4LITA 3M4OJ 1VF7A 2CG4A 1O8MA 2DCEA 1LFUP 2O8KA 1XQBA 2VFOA 3F3XA 2K3FA 3G71I 3IRRA 3ZBUA 2ZMEC 5FLMJ 4KDPA 3AVWA 2P5KA 4P2NA 2D3LA 1C0WA 1ZAOA 2F48A 5FFZA 4A3FJ 4EATA 1BW6A 2CW0F 3LWFA 5J8FA 3OFNA 5ICCA 1XG2A 3J7AY 1YJNB 2M4KA 1ZYRF 4RB1A 4KA4A 4ZZDA 2OZUA 2HQRA 5DN6A 2MH9A 3S2HJ 1RPWA 2QX3A 5HVQC 3BWGA 1T0FA 2P3MA 3ML3A 2CU7A 4UZFA 3GIRA 1PE9A 4WF2A 2LYCA 3DKXA 2RC6A 2HYJA 1UAAA 1YJ9B 1RMGA 2GOXB 4Z4YA 3K2AA 2K4JA 1E3PA 1USSA 2JN6A 5IYBJ 4M9SA 2ESNA 2STTA 3CC2B 3P26A 4ASUA 1SKQA 1D3YA 2VNHA 2R7RA 4P1WA 1KQ9A 3O8GA 1BOBA 1V5GA 1FRQA 4A2UA 1I7PA 4YIFA 2F5FA 2MLGA 2OK7A 1B72B 4RAGA 2K9QA 1KQ5A 2O17A 2MW8A 1B2RA 3FK7A 1MABA 5FKKA 1G4DA 2ODLA 3WGIA 2DN0A 2VXZA 1PJ6A 3MEXA 2CH0A 4AYBA 1DQUA 3I4NJ 1YHQB 2L9SA 2L9RA 1K8FA 2CF4A 2A07F 3A02A 3HKZN 2DT6A 1QPIA 2DLLA 1JT0A 1I1GA 3WU1B 5IK2A 2NXNB 3OYGA 3T51B 1D1AA 2E1OA 1IXRC 3RCOA 3SEZA 1SFKA 2V4JC 2NYXA 2DA2A 3P5JA 3OOCA 1N06A 1PYVA 2VBMA 4EMSA 2Q6IA 3MKWB 3V7RA 4I0AA 4IHXA 1UFMA 2XUBA 3ZR8X 3E6CC 2WB1N 4LFUA 3HTSB 5GAHJ 3VMWA 1FSHA 1MMGA 3S3OA 2Q1ZB 3IV5A 3S3NA 2KRFA 1KD1D 4M3FA 4BY7J 1JHHA 1MSEC 4A3DJ 5C4XJ 3BG6A 4LB5A 5M5WJ 1Y0YA 2UV1A 4BQQA 3OJWA 1N78A 4FK8A 4R1HA 2WPDA 1Y0RA 2HDCA 3F8BA 1FIAA 4M1KA 1D2EA 3GW2A 3GFIA 4AUXA 1G3TA 2LREA 2VZLA 3CMEI 3VMVA 3CO7C 4YG2F 2LDUA 3Q5FA 1T6YA 4EJVA 1K61A 2K9NA 1QRCA 2GXGA 3W2AA 4BACA 1JUSA 3TO6A 5K5RA 3HRMA 1JB9A 2HXIA 4HA8A 1J2XA 4AC0A 5LEKA 5K7ZA 4ZDPA 1WP6A 2ZITA 4X7CA 5HLHA 4ZV4A 4ZCMA 4C3IJ 2DA1A 3ONQA 4PCQA 3I55B 4C43A 1UD6A 4AC9A 1GAWA 1UD8A 2EIKH 4JBAA 5JR3A 3CTAA 3UR3C 1L1IA 1KK3A 3E3VA 3H35A 4BHBA 4HE6A 4KIGA 2TCTA 1MGTA 4G7HF 1XGNA 1UCRA 3W6VA 4IJAA 1JTAA 5THXA 2WJYA 1TQIA 2KT0A 3MMYB 4EJWA 4HDVA 2VBXA 4P5OA 4KYWA 4EJOA 2Z2SB 1K28D 2EA2A 3QPSA 1I5ZA 1BBYA 2DFEA 4NB5A 1ZG5A 1WJDA 2LRDA 3PFIA 1E0EA 3BR5A 2EFWA 2QA4I 3V7AA 2BE5F 2E2JJ 4NBQA 4LJZF 5H20A 3ZBTA 3A1PA 4BHCA 2DETA 3R60A 1FC3A 3CC4I 4CHUA 1R1TA 3EUAA 3FDYA 1IGNA 3H92A 1IB0A 2R5YB 4M3GA 4L18B 2FEZA 3RKQA 2VQGA 2YWGA 2IRFG 1BA5A 1BLIA 1D1NA 3D1NI 2OQRA 5BSXA 3KP3A 1Q1VA 2B9SA 1GR1A 5IOZA 2QZ8A 4ON0A 4UV9A 2Z5UA 5FGMA 3BG3A 3OYEA 1EP1B 4QUZA 2QMUA 1EFUA 1R00A 4PGHA 1T6XA 1DPUA 4HE5A 2NS8A 1X4PA 1P4XA 3KE2A 5DD4A 1OGMX 2ESHA 4UUTA 2M34A 3REOA 4A3MJ 2OCEA 1WSVA 2X6OA 1MDMB 4NHJA 4E7JA 3F6OA 3RIRA 1WH5A 2BGCA 4P96A 3DFGA 4MXNA 2J5OA 2K4BA 2ZKZA 3W2WA 4ZYGA 3G73A 3S2DJ 1WPCA 3CJNA 3BR3A 1HLVA 2GREA 3EYIA 2HDWA 2NSPA 2PMHA 4RDLA 4EM2A 4E0FA 5FKLA 4U49A 2VJIA 3IUOA 4M72A 1VQ8B 3EUHC 5FKNA 1U2WA 3QYBA 3JTGA 1VFCA 1MNMC 5TR9A 3OYKA 1MSFC 2LMDA 2Y2ZA 5L3DA 4XRFA 3RPUA 1OQYA 1H88C 4P9SA 1MIJA 2DDAA 2HR3A 4IHVA 2KIFA 5B1BH 5HZBA 3FXMA 3KP6A 1XSXA 3K69A 3C7JA 4AIDA 5LHGA 3JRBA 2H27A 4HPQA 5GTHC 1QUEA 1OR7A 1WJBA 2VJ4A 4HX8A 3PFYA 4QWQA 2BSPA 1ZH5A 2GXBA 3GQBA 4Z05A 2RV8A 5A2QZ 4OAZA 4I84A 1P4AA 5EZGA 3OYAA 1IRGA 1LFBA 4NDLA 2JQ7A 3OSFA 3HGGA 2LY1A 2KDZA 4BQOA 3SFIA 2E1CA 3ZIAA 2LG4A 2XIGA 4HAMA 3COAC 4LB6B 2B0LA 2HXOA 5EEAA 3FHNA 3WBKA 4N0BA 2EWEA 3OEEA 2JK3A 4ANJA 1VHEA 1QQIA 1RIOH 2Z33A 1T6SA 2AHQA 4HNTA 3E6DA 5IYWA 2X6WA 4G9YA 2DMTA 4EEFG 2OBRA 5ILVA 5EZHA 4IRHA 1TWAJ 2KPMA 4YELA 4W8TA 2YR2A 2XEXA 3S16J 3SHFA 3SEQA 2HS5A 1R5BA 2ZXIA 3D5SC 1BMFA 3G05A 1ZELA 2HDDA 1R7JA 5L3EA 4G8XA 3E5QA 2Q0OA 3PUFA 3CCQI 1KTWA 3DDYA 1QU3A 5AIQA 2NOJB 1VHOA 5JLWA 4RD0A 2NTPA 4KKUA 2V6CA 2QF7A 2VPLA 3AK5A 1XCVA 3GEZA 4RDUA 2M9HA 3LSPA 3K7AJ 3KYDB 2FMLA 3LAJA 3T5XA 2O8XA 3ZPPA 4FISA 2COBA 4IRGA 2VE9A 2Y0MA 4KFCA 1U6GA 4XRSA 3K70C 2EBIA 1IJEA 1T08B 4B09A 5D4RA 4A3BJ 2VQCA 3KEYA 3RYRA 1BPLA 4L9JA 2XGDA 2XRLA 2IQ7A 1A5JA 1W7PD 3I55I 4Z2YA 3CMAI 1OCTC 4WZTA 1MKMA 3CJRB 3JRAA 4BAYA 2P7CB 1P6RA 1L3LA 1T98A 3C3WA 2CQQA 2ZFWA 4AF6A 2BV6A 2QWWA 4PJLA 3TOBA 1XCBA 4P12A 1QG0A 1D0ZA 1H0MA 4YAFA 2W6JA 4ZCIA 4HF0A 1I27A 2EWNA 2N8GA 2PG4A 3LQQA 4MR0A 3G1OA 3BY1A 2BYVE 5DTDA 2ZTNA 1IN8A 2MFZA 4BQAA 2V7WA 3TKYA 1U0JA 2D2WA 2IBDA 1Y1WJ 3BG7A 2GJRA 3QFCA 3OZWA 1K6OA 2O1DA 1JUMA 1SFXA 2ZBUA 3BR0A 1BN8A 3ASNH 3ZSCA 3QPLA 1W5TA 3C2GA 4Y15A 4ZH4F 4LLNA 3CCSB 4XKWA 4O5VA 1DP3A 1F9NA 2NT6A 1K7AA 4MYTA 3A0BC 2JA2A 3WGGA 3OS2A 4BEHB 2XNCA 2XAUA 4HQMA 3SUCA 1IJFA 3D26A 3L2WA 2IGOA 1I6HJ 3LSIA 4YZQA 4JP0A 1FOWA 1F36A 3H0GJ 3CZ6A 4UNOA 1B1BA 2FNAA 3GTGJ 3HUGB 1CLWA 2ZXWH 4OOIA 2ID6A 3F8MA 2RGVA 3FK6A 1YFHA 3MZYA 2QLZA 2PIAA 4KT6A 1ORKA 3J81K 1VQ5B 4RMNA 4A6EA 3BTJA 1YW8A 2IA0A 3TBIA 1P92A 3BZKA 5CVUA 3BG5A 2CUEA 4AYBN 5F1RA 5E18F 1OB2A 2O03A 2R5ZB 3GRHA 2B0RA 1VNDA 4OINF 1MRZA 1R36A 1BI2A 2VYQA 2IA2A 2Z3YA 2PX9A 1O8KA 1LE8A 5H6RA 1KU9A 4L0ZB 4OIRF 1FYMA 1TL8A 4IQJA 2GQFA 2PYGA 4IXAA 3GWZA 1RNLA 3RQIA 3OZUA 2V6EA 3TW7A 3WTSC 1TWCJ 2XC7A 4W97A 2DBBA 4XL9A 2DJNA 2XAHA 1R22A 1UB9A 5KSWB 3GVJA 1I3QJ 4P25A 1GO2A 4G1BA 1FPQA 2V5IA 4RB2C 3RKXA 3RKWA 4RM0A 5B66C 1E2XA 4TMTA 5EG0B 4O3MA 3PA1A 3ERMA 2BSAA 1E64A 5K7FA 2LBFB 3B82A 2HFHA 1KCDA 3OYCA 2VFPA 2VFQA 1EKEA 2X3UA 3AVVA 1KK1A 2XAFA 3H09A 1Z67A 3I4MJ 3I59B 2H94A 1EA3A 1O3TA 3T56B 4DNRB 1QHHD 3DKYA 4D5CA 3WNBA 3DPLC 3QYFA 4CH7A 4H4KC 2JA8J 1UD2A 2KIUA 5K5OA 5GAEJ 5BQTA 2HQAA 3KP5A 3HOSA 4XIDA 1X0CA 3RPQA 1Y0NA 1A8PA 5C4JJ 4F91B 1QA6A 4XQFA 1D8KA 1GHCA 5E1XA 3R6SA 4P9UA 5DM6F 1KMHA 2CS3A 1HKTA 1LPQA 3VYSB 5JVTA 3KEQA 1VF9A 5M3FJ 4AM3A 3SJZA 4FWTA 3SEJA 3BH6B 3TO9A 3ZMTA 1PJRA 3ECHA 2EFGA 4I99C 3WE3A 1UHWA 5J8CA 1HXDA 1A04A 2A5WA 4BJ6C 4RM2A 3HRUA 2D3NA 1BIBA 3TEDA 2DMUA 3KP2A 4GXOA 3T0YA 3CCJB 1YIJI 2K5CA 4S04A 3K6GA 1RKTA 2F5DA 1BR4A 1MBKA 2E34A 2FBIA 1IRXA 5L3BA 2QTZA 2HCJB 3SZTA 3WGHA 3LMMA 5D5VB 2BGIA 3T8TA 2L7ZA 2UVEA 5HLGA 2E7WA 2OF7A 4G7ZF 2HEOA 1ELOA 3BPVA 2L9NA 2Y9YA 2A61A 4PJ0C 5FL7A 2EFQA 4LBWA 5CQGA 1RI7A 3RPUD 4BQNA 1NG6A 3QRFF 5J1YA 3JW4A 2P4WA 1R23A 2QGUA 3DEEA 2FX0A 3FMRA 4QVAA 1BOAA 1X1PA 2FQ3A 2CK3A 1G2HA 2YU9J 1WOPA 5ED4A 2WZPP 1QFJA 1S4MA 1XMKA 3G6EB 3OIOA 2ADUA 1OOCA 3W3CA 1O8FA 2PI0A 3S32A 2QCOA 3TQNA 2P5LC 2ELJA 1QZZA 2H8WA 2QVOA 4BBSJ 2DK8A 2BHZA 3VOEA 1WPKA 1G3WA 4EQQA 2HOSA 3G1MA 1ETVA 2DIEA 1QCXA 2BX6A 3V8JA 4EJUA 4OOVA 4ZGQB 5IYRA 1I8DA 3AGQA 1MJAA 3C1DA 4BHPA 1NK3P 2Z8GA 4Y17A 2K3PA 2LFBA 2PQ8A 1TYXA 2D1HA 2XVCA 1YS7A 2BVLA 5E1ZB 1N77A 4WZEA 4LLGF 2FOWA 2JVGA 2LTPA 2JA5J 1N07A 3CC7I 4N3GA 1P9QC 3GZ6A 2EFOA 1SEUA 3E6MA 5DDGA 4I09A 2DT7B 4DGWB 2F4OB 3MWMA 3WU0A 3MZHA 1YG2A 4HW0A 5TJJA 2E1MC 3V8LA 1T56A 2DT5A 2GXAA 3U21A 4YIRX 2WR8A 2XT2A 3N4MA 4AIHA 2XRNA 3A1YA 3CDLA 3JRCA 2BXZA 1IV6A 1M1KD 5IT3A
chains in the Genus database with same CATH topology
3J7AY 2M4KA 3DPUA 1GQ8A 2BOLA 2R7XA 4DNTB 1CZFA 4NC7A 3ZRGA 3PUBA 1PXZA 3KYLA 5DN6A 5TGTA 4DIQA 2QX3A 4ZYAA 3HOTA 1VJSA 5HVQC 3T9GA 4BE1A 4IZZA 4B47A 1OB0A 5HOOA 2KHMA 4B44A 1PE9A 1DGRM 1S9HA 2LYCA 3DKXA 5HNFA 1UAAA 1RMGA 2GOXB 3GBGA 1UELB 4ASUA 4XN3A 2R7RA 1VZ0A 4P1WA 3PNTA 4D1QA 1BOBA 1V5GA 4YEJA 3FBNB 1PKVA 2KZVA 2R7SA 2O17A 3DU6A 1MABA 2VXDA 3PSIA 1Z3YA 1WJCA 2ODLA 1YX5A 4HG2A 2VXZA 2CH0A 4AYBA 1DQUA 2L9SA 1IDKA 3OS1A 3GQAA 2R7WA 1W0JA 1BR2A 4PJJA 3OFNA 3BC9A 2DT6A 2X85A 1X1CA 2W00A 4YRVA 5FRMA 3GVLA 5IK2A 3OYGA 2Q2EB 3KX2A 2KRCA 3T51B 1BR1A 3HKZA 3L2UA 1D1AA 3RCOA 3SEZA 1SFKA 2V4JC 4ZDLA 3OOCA 4BE2A 1PYVA 4CCOA 2BW3B 2ZZFA 3BH4A 4PJMA 3OE7A 4XNFA 4G7WA 4BU2A 3MKWB 4J00A 3VYTB 4E7LA 3UW0A 1FMVA 4U87A 2V4DA 3ZR8X 1O8HA 1D1CA 1YX3A 2RNGA 3VMWA 1MMGA 3S3OA 2Q1ZB 3S3NA 3S3MA 5KHDA 4OZYA 1LDKB 3H94A 1WJFA 3K4JA 1NG7A 5FROA 2WJVA 3BG6A 3VWBA 3BCDA 2UV1A 5FRNA 2PECA 3H5NA 2DJIA 1MMAA 4BQQA 2IS2A 1NHCA 3OYFA 3S93A 1V5FA 4II3A 1N78A 3FKJA 4II2A 1MNDA 4LG3A 2WPDA 3OYMA 2VIXA 2WY7Q 3OEHA 4XLFA 1LVKA 2KVOA 1N75A 4NK8A 2XOKA 3FPPA 1RU4A 2LREA 1Z3XA 4HSTA 2LY2A 3VYUB 4KITB 4NNJA 3VMVA 4N4OB 2Z1DA 4U4BA 4FETA 4TKOB 2VQHA 3W2AA 3OYLA 2VBEA 2E5ZA 4BACA 4CCKA 2KDOA 3CP2A 2LC2A 4FXUA 2DOAA 1WP6A 4ZDPA 3WWGA 1XG2A 3QODA 1O8GA 3OY9A 3ONQA 4BL0B 3LSHA 1ERDA 1UD6A 2O5RA 1UD8A 1HZEA 2GK7A 3UR3C 3GQ7A 5LD2C 3H35A 4DJAA 1O8LA 3ZQQA 5C1CA 1DGWY 3DTKA 3RTRA 4PSWA 1JTAA 1O88A 4BUPA 3HAGA 2RREA 2I8DA 2ZZQA 1I18A 2HNHA 2WJYA 3MMYB 4CCNA 4P5OA 2IS6A 2XNDA 2Z2SB 1K28D 1DBGA 1MNEA 1WJ5A 2K9LA 3L2RA 2JVHA 4XKBA 1WJDA 2LRDA 1E0EA 2CMPA 4B48A 2XF7A 3FY3A 3G2BA 2WSSA 1SAUA 3MD2A 3PL8A 3E0JB 2W4SA 3SYTA 2JJ2A 2ZSHB 5CPRB 3LL7A 2L5QA 2X1CA 2XF6A 3EUAA 3K4KA 2MABA 3FDYA 3ZGKA 1PLUA 3SDBA 4XMYA 3WQZA 3OR1C 4XLEA 3A4CA 2VQLA 4LIUA 2KP6A 3OW7A 4YXWA 3TL4X 2VB6A 4J01A 1EE6A 3TMOA 3RQ4A 2VQGA 3GQ8A 1VLYA 1BLIA 3AL0C 2MYSA 1COWA 2ZZEA 1T5EA 1UD4A 1K5CA 4IX7A 3IAM2 4JMQA 3NE5B 3OPOA 2Y0SA 3OYEA 1OFMA 1WJEA 3K10A 2HVQA 4ITVA 4PUSA 1X19A 4XLAA 2DXIA 5HKKA 1QJVA 3B4NA 1X4PA 3L2VA 3RSNA 1OGMX 3CF2A 3DPTA 1E3XA 3AL0B 3KRGA 1LFPA 4OJ5A 4F55A 4E7JA 4BGDA 2VKDA 4PMHA 1WFXA 2JSPA 4MXNA 4URRA 2CFOA 1KONA 2F4IA 3W2WA 1WPCA 2GK6A 1HA8A 1EFRA 4LIVA 2HDWA 2NSPA 4HIZA 4E0FA 3H9JA 4ZDOA 4U49A 2VJIA 3IUOA 4CCLA 1W9XA 4EW9A 3EUHC 4RLQA 2WY8Q 3QYBA 3VSKA 4KKTA 3K4MA 1IDJA 4OJPA 2MD0A 3K4NA 4CUGA 2IGNA 3OMYA 4CCMA 2NSTA 1JRGA 4C9YA 1X1DA 3OYKA 4BS9A 4DBQA 4C2UA 2F1MA 2AQEA 4YZ0A 1YE9A 1GLNA 3BCAA 1KCCA 3OIQA 4XR6A 3D5LA 2X1DA 2CV1A 2X8KA 3K4CA 4HPQA 1WJBA 2VJ4A 2X1EA 3PFYA 4XLCA 2BSPA 3GQBA 1T0FC 4Z05A 4OAZA 1NBMA 4I84A 2HU9A 2F6CA 3OYAA 2KLOA 1T95A 1OR7C 2NT9A 2LY1A 4HEA2 4Z06A 1IA5A 3I3LA 4BQOA 4IKFA 3ZIAA 2LG4A 4BXFA 4AU7A 4ZTJA 3B8YA 4OZZA 3FHNA 2HVRA 1O8EA 2F5VA 2EWEA 3OEEA 4ANJA 2INVA 4W8QA 3EPZA 1G8XA 3E1SA 1MMDA 1D0XA 4HNTA 3IAS2 4PK4A 2X6WA 2UVFA 1W0KA 2KPMA 4YELA 4Y4RA 2QE7A 4W8TA 1HVXA 4JOMA 2X3HA 3SEQA 1O8JA 3BCBA 3VSTA 2M3AA 4XM3A 3OYIA 2QXZA 2OV7A 2ZXIA 2ZXHA 2WA0A 3D5SC 3OYNA 2XZPA 4XKCA 5HNHA 1BMFA 3G05A 3LNNA 1ZELA 4P22A 1KTWA 2XZLA 3DDYA 1QU3A 1WTHD 5KCMA 3OAAA 3DU5A 2VASA 3HPGA 2NOJB 1NRKA 3EQOA 2NTPA 4KKUA 3PJRA 2VPLA 2WB1A 3AFHA 2NZMA 5LFAA 2OUMA 3V42A 2R7OA 1Y6IA 2UUZA 1MMNA 3ZCOA 2JJ1A 3ZPPA 4E7SA 2VKHA 4X0GA 4NK6A 3K70C 2R4GA 2VJ5A 4BDZA 1BPLA 3FKSA 1LKXA 2VQCA 2VJJA 3KEYA 1E1QA 1E1RA 3HG9A 4KKSA 2IQ7A 2BVMA 3H9QA 4Y33A 3H5RA 4E7IA 1E3ZA 2MC4A 2M0MA 3CJRB 4XORA 4AVZA 4TT3A 4DK0A 1OFLA 4NQWB 3QOEA 4XOTA 3VYRB 3W2VA 3H0DA 4W8SA 3NWSA 3K70D 2R7TA 4D9JA 3OL4A 3I9V2 4PJLA 2IS1A 2QY1A 3LMWA 1D0ZA 2IGMA 4F93B 2VLAA 1W36D 2W6JA 4PFOA 4BJ5C 4ZTFA 1AA7A 4GQNA 4KJZA 4F52A 4N4NB 4E7HA 4B3FX 4MR0A 4CZCA 2ZTNA 2MFZA 2R7VA 1U0JA 3OYJA 3DTIA 4OJLA 2LBFA 3BG7A 4HWVA 2LOOA 4DOZA 2GJRA 3A3GA 4IQ4A 2PYHA 2M7BA 2O1DA 3A3BA 2CW8A 2ZZGA 3CJQB 2ZFUA 2XSJC 4C30A 2X53S 1BN8A 1WMRA 4CSWA 1Z21A 4TSFA 4G6TB 3ZSCA 3C2GA 1AIRA 2KMUA 2JUGA 2CUZA 4HRIA 2WAEA 4XKWA 4OWRB 1DP3A 1FX0A 1V0EA 3VSLA 2NT6A 3OL3A 1O8DA 2W7NA 2JA2A 4BJTA 3OS2A 2R7UA 2NTBA 4BEHB 5JHFA 2XAUA 3SUCA 3N05A 4G7XA 3L2WA 2IGOA 4E4HA 3LSIA 4YZQA 3OOUA 3OYBA 3CZ6A 2OC6A 2INUA 2O0WA 5CQEA 3HUGB 2ZSIB 4DK1A 1G59A 3D5RC 1W36C 4NC8A 1OGOX 4KT6A 3VDXA 4C2TA 4RMNA 2IXSA 3L2QA 3TBIA 1D0YA 1OLTA 4NUBA 4XONA 4YZXA 1VBLA 3GRHA 2A6TA 2V26A 3QYEA 3T53B 3LSKA 1O8KA 1R6RA 1Y56A 2KL4A 2ZTGA 4HNUA 2F43A 1E43A 3A2KA 1SKYB 1X1AA 4FASD 4IQJA 2PYGA 2R9VA 2V31A 2PJRA 2PMZA 3FBIB 2Z16A 2V6EA 2W82A 2GJPA 2V1NA 2WADA 2XC7A 2P0WA 3MKYB 2IS4A 4MLOA 4XL9A 3M1CA 3M8JA 3GVJA 3VR6A 1WJAA 3PSFA 2NTQA 1O8IA 4E7ZA 1QHGA 4RM3A 2HVSA 2QKLB 2XZOA 2XF5A 3EUKL 2LBFB 1KCDA 1UG0A 4KISA 3OYCA 3BLYA 1X4OA 2BW3A 2X51A 4BE0A 2HLDA 4B3XA 3LSGA 4B43A 4YZAA 4CCJA 3JU4A 1EA3A 3T56B 4DNRB 1QHHD 3F9KA 1X1BA 2RQQA 3DKYA 3HC7A 2JIZA 5CDFA 3DPLC 3QYFA 4CH7A 4H4KC 2X6YA 1UD2A 2GJKA 1OHHA 2HQAA 4F3QA 3HOSA 2W6IA 2M4GA 1X0CA 3GQ9A 2XDVA 4F91B 4HSRA 4G6IA 3PNVA 4DBRA 3BC8A 4XQFA 2E5NA 3OYHA 3DTEA 1DBOA 3SZGA 1KMHA 2CS3A 3OR2C 2VBKA 3OWTA 3VYSB 2KQRA 1TZLA 1MW7A 1Z7LA 4XN0A 3H9GA 3BCFA 2CUJA 2QKMB 2R7QA 1PJRA 2WAFA 1H80A 2E60A 1D1BA 3B90A 4C2LA 1H8HA 2A5WA 4PJNA 4BJ6C 5AMVA 4RM2A 2D3NA 4E7KA 1K6YA 2K5CA 3K4BA 4XOPA 2L7KA 3K6GA 3CMMA 3HXLA 1J09A 2LH9A 1BR4A 3OYDA 2V7QA 4UZUA 5HLTA 1IRXA 4Z03A 3CESA 3ZXSA 3LMMA 3HPHA 2CV0A 2UVEA 2O04A 4PSXA 1V5EA 2L9NA 2VBMA 4U7BA 3GVKA 5FL7A 3LSMA 3HL2A 2JDIA 2GOMA 5CQGA 3RPUD 4OJOA 4BQNA 1NG6A 1E79A 2V7FA 2AQFA 2CV2A 4Z1MA 2V9KA 2XGJA 3AKZA 2K9MA 3DEEA 4PFPA 2UWMA 2LZJA 4GRIA 2CK3A 1BHEA 2HPIA 1TT0A 4L8JA 4XLHA 3A35A 2WZPP 3IP4B 2WAQA 4BEHA 2X6XA 3VSVA 3KEWA 4ZC3A 3DLAA 1OOCA 2HZDA 3W3CA 1O8FA 2O0VA 3S32A 4W8RA 3C2HA 2E1MB 2ELJA 2IGKA 3NWTA 3UNGC 2Z6BD 3MKZA 3DWLE 3K4LA 4OJ6A 5CKTA 2L2OA 3PNYA 3VSUA 2DIEA 1QCXA 1IB4A 4E6KG 5C1EA 1H8EA 4F92B 2CW7A 1I8DA 4RLFA 1UD5A 4ZJZA 4BDYA 2VL8A 1UD3A 2M7AA 1JI8A 1RWRA 4Y3OA 3DQVC 1KZLA 2K3PA 2Z8GA 3JURA 2M5SA 4CA0A 1HG8A 2BVLA 3CP8A 2WBMA 1N77A 4JQFA 3H5AA 2JVGA 5KNLA 4R79A 3OIPA 4QPQA 4XD7A 1P9QC 4QPOA 1V0FA 3ZPNA 3LFUA 2PJRB 2DT7B 3OS0A 4DGWB 4LITA 2HPMA 1VF7A 1O8MA 2DCEA 2E1MC 2W1OA 2KRHA 1FMWA 2FUG2 3EQNA 3U21A 2E1BA 2D3LA 4B3GA 4OAYA 3A1YA 3S8PA 4EATA 4XKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KCD A;  3EQO A;  2NTP A;  3FY3 A;  1GQ8 A;  1CZF A;  1PXZ A;  4YZA A;  2QX3 A;  2NZM A;  3T9G A;  3ZPP A;  1PLU A;  1PE9 A;  2X6Y A;  4XMY A;  4NK6 A;  4XLE A;  1RMG A;  2VJJ A;  1X0C A;  3GQ9 A;  2IQ7 A;  4XN3 A;  1EE6 A;  4XQF A;  3GQ8 A;  4YEJ A;  1DBO A;  4XOR A;  4AVZ A;  1OFL A;  2VBK A;  1K5C A;  2O17 A;  4XOT A;  4W8S A;  2ODL A;  1OFM A;  4XN0 A;  2QY1 A;  3LMW A;  4XLA A;  1IDK A;  1QJV A;  3GQA A;  3B4N A;  1H80 A;  1OGM X;  3B90 A;  4C2L A;  2X85 A;  5AMV A;  3KRG A;  4OJ5 A;  4MR0 A;  4PMH A;  4MXN A;  4XOP A;  4OJL A;  4URR A;  4HWV A;  2VBM A;  2NSP A;  2PYH A;  4XNF A;  2O1D A;  4Z03 A;  4U49 A;  2VJI A;  3UW0 A;  4EW9 A;  1BN8 A;  1WMR A;  2UVE A;  2O04 A;  1O8H A;  4OJP A;  1IDJ A;  3ZSC A;  2NST A;  3VMW A;  1JRG A;  1AIR A;  4XKW A;  4OJO A;  4OZY A;  2NT6 A;  1O8D A;  4YZ0 A;  1KCC A;  4XR6 A;  2NTB A;  2PEC A;  3SUC A;  1NHC A;  1BHE A;  2BSP A;  4XLC A;  4YZQ A;  4Z05 A;  4XLH A;  2INU A;  2O0W A;  2X6X A;  4XLF A;  3VSV A;  4I84 A;  1OOC A;  2O0V A;  4NK8 A;  1O8F A;  4W8R A;  1OGO X;  1RU4 A;  2NT9 A;  1IA5 A;  4Z06 A;  4OJ6 A;  3VMV A;  3B8Y A;  4U4B A;  2VBE A;  4OZZ A;  4XON A;  3VSU A;  1O8E A;  1QCX A;  1IB4 A;  4YZX A;  2EWE A;  2INV A;  1VBL A;  3GRH A;  5C1E A;  4W8Q A;  3WWG A;  1O8K A;  1O8G A;  1RWR A;  2Z8G A;  3JUR A;  2PYG A;  2X6W A;  2UVF A;  1HG8 A;  4YEL A;  4W8T A;  3GQ7 A;  2X3H A;  1O8J A;  4XL9 A;  1O8L A;  3VST A;  4XM3 A;  5C1C A;  1O88 A;  1JTA A;  1O8M A;  2QXZ A;  2NTQ A;  1O8I A;  3EQN A;  1DBG A;  1KTW A;  1XG2 A;  4XKV A; 
#chains in the Genus database with same CATH topology
 3J81 Z;  2DA6 A;  4M73 A;  1SD5 A;  3DPU A;  3CPW B;  4HDU A;  4KN7 X;  1GQ8 A;  1ETY A;  1IG7 A;  1HW1 A;  4NC7 A;  3DCF A;  3PUB A;  1IDY A;  3ULQ B;  3ZRG A;  5J4V A;  3JR9 A;  3KYL A;  1XPX A;  1ZRD A;  3T9G A;  4PC7 A;  1T2K A;  4B44 A;  1DGR M;  3RJP A;  2X4H A;  5HNF A;  3BZ6 A;  3L7W A;  2FNP A;  2ZB9 A;  4A5N A;  4LBZ A;  4GYI A;  4DZJ A;  5DS9 A;  2BPO A;  5J3O A;  1UEL B;  4JRA C;  5E3N A;  2DOE A;  5BPD A;  4XN3 A;  4LG0 A;  1VZ0 A;  2XB0 X;  3SLN A;  5E79 C;  3IL2 A;  5D4S A;  3IHU A;  3FBN B;  1PKV A;  3ASQ A;  1LUJ B;  2KZV A;  4ZZL A;  1H85 A;  3KP7 A;  4RAZ A;  3DBL B;  4HG2 A;  2V1U A;  1R5N A;  1WI9 A;  1ZLJ A;  1FY7 A;  3BJO A;  2P7V B;  3I53 A;  4Y9R A;  1FBS A;  5IYQ A;  4FHT A;  1BI0 A;  4Q4Z F;  2IA1 A;  3GQA A;  1RR7 A;  4R8H A;  4M9X A;  2YS9 A;  3BC9 A;  2C4T A;  1YS6 A;  3IRQ A;  1QVU A;  1X1C A;  1E3H A;  2W00 A;  2X85 A;  2NV4 A;  3A8K A;  1QA1 A;  2Q2E B;  1EA0 A;  3SFZ A;  3HKZ A;  1HSJ A;  2LLK A;  3CCY A;  3GXO A;  4B1R A;  2KKO A;  4IW3 B;  1IXC A;  4ZDL A;  1E17 A;  4BE2 A;  4CCO A;  5LHH A;  5DM7 F;  4P1V A;  4PJM A;  4BU2 A;  4J00 A;  1BW5 A;  3DBR B;  3M07 A;  3FPK A;  5J35 A;  2J8I A;  5M5Y J;  3BR1 A;  3HHG A;  4B3A A;  2V4D A;  1O8H A;  1D1C A;  1ZN2 A;  3ONY A;  2RNG A;  3S15 J;  3ZOB A;  4EVI A;  1K78 A;  1W2B B;  2F5E A;  1S7E A;  3S3M A;  1B59 A;  2JA7 J;  3QP5 A;  4BH9 A;  4RBO A;  3QQA A;  5J47 A;  3GFL A;  3CMY A;  1T8I A;  1LNW A;  2QGG A;  2O6W A;  4OZY A;  3K4J A;  3HYI A;  3BDD A;  3I56 B;  4ESJ A;  5EEH A;  2BEO A;  3OYF A;  2PLF A;  2CWE A;  3F21 A;  3FKJ A;  4II2 A;  2E2H J;  1LM1 A;  3OYM A;  2VIX A;  3OEH A;  2R7F A;  3AG1 H;  2VNI A;  2M1B A;  3LO8 A;  2HQ5 A;  3KZZ A;  3FPP A;  5IY5 H;  2XPV A;  1ENH A;  3LNQ A;  1UHS A;  4LGW A;  4KIT B;  1K83 J;  3LA7 A;  4MQV A;  2MSY A;  4NNJ A;  3WU2 C;  2OK8 A;  3HOV J;  2VQH A;  3I59 A;  3OYL A;  4Y13 A;  5J4Y A;  4FX4 A;  3W5V A;  1WOR A;  1OCO H;  2KDO A;  3ZP5 A;  3CP2 A;  1BJK A;  1G3Y A;  4A0Y A;  2DOA A;  3WWG A;  3VFZ A;  1S7A A;  1VQ7 I;  2V9V A;  5J40 A;  5ERI A;  4BL0 B;  3BG9 A;  4NQW A;  1H9T A;  2O5R A;  2WC2 A;  4G6D A;  1ERD A;  3DEU A;  5GAD J;  3G71 B;  1Q86 D;  2XTW A;  1FTT A;  2GK7 A;  5LD2 C;  3FXR A;  3R0J A;  1ZUN B;  3W2E A;  1RRJ A;  2QUF A;  3R4K A;  3R6K A;  1XGS A;  5C1C A;  3RTR A;  1O88 A;  3GTL J;  4BUP A;  3HAG A;  4D5F A;  3S8P A;  3U2Q A;  3OSG A;  3FHZ A;  2HNH A;  4PAB A;  1KYW A;  1B9M A;  1IN6 A;  2A69 F;  2IS6 A;  2XND A;  1DBG A;  1WJ5 A;  4KIC A;  4UVA A;  4IHY A;  1WWX A;  2W84 A;  3O2P E;  1GXQ A;  2CMP A;  3RDI A;  1PDN C;  2X48 A;  4UUS A;  1TTY A;  1RQR A;  3LQ6 A;  2XF7 A;  3FY3 A;  1N05 A;  4QHY A;  4RPD A;  2JTV A;  1W34 A;  2CC2 A;  1B4A A;  2W4S A;  3ABT A;  4W1U A;  2JRM A;  3SYT A;  5CPR B;  3LL7 A;  2X1C A;  3ZGK A;  1PLU A;  2DYR H;  3I71 A;  1YW7 A;  2W57 A;  2WZN A;  3RY8 A;  5HS9 A;  4P6V F;  3DV8 A;  2EZH A;  1IHM A;  2IJL A;  3MQ0 A;  4KIB A;  4LIU A;  5B5E C;  1PVE A;  4U9U A;  5A89 A;  1QFY A;  3OW7 A;  4YXW A;  1VQP B;  2VB6 A;  4J01 A;  1SAX A;  1SD6 A;  2STW A;  1YHQ I;  1ETW A;  1J0R A;  3SZP A;  4RGU A;  1VTN C;  2MYS A;  1BC8 C;  1T5E A;  3ZZT A;  1UD4 A;  3CC7 B;  5GP9 A;  3O6B B;  3J80 K;  3CPX A;  3C18 A;  1PUF A;  2Q8K A;  1FOX A;  1O57 A;  5FO5 A;  5JHU A;  1FNC A;  3NE5 B;  3OPO A;  4JMQ A;  1VQM B;  4GFB A;  2BN4 A;  3NEU A;  3FXL A;  1AHD P;  4C3J J;  2XTX A;  3CUO A;  4XLA A;  2DXI A;  1QH0 A;  2GBY A;  3B4N A;  3L2V A;  1I1S A;  3RSN A;  1A6Q A;  3BQZ A;  3MAJ A;  3KRG A;  4UXN A;  4OJ5 A;  4IHW A;  3TDZ C;  2CO5 A;  3CDI A;  4ZYD A;  2ZJR F;  2X0K A;  1FP1 D;  4BGD A;  1D8J A;  1ZTR A;  4PMH A;  4KH3 A;  1ZHF A;  2JSP A;  2F4I A;  1HF0 A;  1T33 A;  1HA8 A;  4LIV A;  2JA6 J;  2RN7 A;  3V8K A;  3J80 Z;  3GZ5 A;  4LLL A;  2WY8 Q;  5FIU A;  4OJP A;  3K4M A;  2MD0 A;  2XGC A;  4CUG A;  2IGN A;  3OZV A;  4P26 A;  4GYG A;  1JRG A;  3BQJ A;  4CDG A;  4BS9 A;  4QVJ A;  5KVR A;  3OJX A;  1OFE A;  5D6E A;  2F1M A;  1SMT A;  2V7T A;  4BNC A;  3OIQ A;  1Z91 A;  4WXD A;  1H8A C;  3FF5 A;  1QZY A;  1FOK A;  2YWF A;  2GIV A;  2RVC A;  4XLC A;  2MA3 A;  2DCU A;  3SZE A;  5DEQ A;  1LEB A;  3ISX A;  2CQX A;  3HOY J;  5B6I A;  2HU9 A;  2CRG A;  2F6C A;  1QFZ A;  4Q48 A;  1ULY A;  4HOB A;  1T95 A;  2NT9 A;  2JMW A;  1FX7 A;  3U1D A;  2LKS A;  4RD2 A;  4N9I A;  3B8Y A;  3E20 A;  3JCU C;  4OZZ A;  1Q82 D;  2HTS A;  1Y1V J;  1Z7U A;  3CCL B;  2IW5 A;  4ROX A;  4W8Q A;  4M3B A;  1W5C C;  1WSR A;  4X06 A;  3EPZ A;  1J7K A;  1I6X A;  3CCE B;  1MMD A;  5HXB A;  4Z4U A;  3BR6 A;  1VQ8 I;  5A88 A;  3IAS 2;  2JPC A;  4PK4 A;  2LY9 A;  1U2R A;  2YWH A;  1GUU A;  1KRH A;  4Z4W A;  2QE7 A;  2EA4 A;  3HRT A;  2D9R A;  2X3H A;  3BCB A;  1IRZ A;  3CCR B;  2M2E A;  2OV7 A;  4C2M J;  1REP C;  4FE7 A;  1TYW A;  1EP2 B;  2PMD A;  2XZP A;  4ZCL A;  4XKC A;  5HNH A;  4F7D A;  4P22 A;  4S0H B;  5J6X A;  4YAU A;  1TNS A;  1B8I B;  3ERE D;  1W7P A;  5KCM A;  3CCR I;  3JSO A;  2OD5 A;  3WG7 H;  4ESB A;  3ABM H;  3Q0U A;  5F1J A;  1OFC X;  2MG4 A;  2NNN A;  3PJR A;  4HLY A;  1KTV A;  3AFH A;  4RA2 A;  2D1V A;  3KZI C;  4A69 C;  4U7D A;  3K1N A;  3V42 A;  5LEJ A;  2J5P A;  2R7O A;  3ZCO A;  2UUZ A;  4E7S A;  2DPU A;  1TWF J;  3BJ6 A;  3FKS A;  3QWL A;  1LKX A;  3TW6 A;  1Z0X A;  2BZT A;  3FMS A;  3HG9 A;  1Z77 A;  1E1Q A;  1NDH A;  3DU1 X;  2EFP A;  4Y33 A;  2G0Y A;  4X6A J;  1E3Z A;  2MC4 A;  3JSP A;  5F64 A;  2PEX A;  4XOR A;  1OFL A;  4MFD A;  2I5U A;  3VYR B;  3I58 A;  3PQJ A;  3K70 D;  1KC8 D;  4W8S A;  2XHK A;  3OL4 A;  1IW7 F;  3I9V 2;  1FJL A;  1FEX A;  3LMW A;  2XKP A;  2IGM A;  1J75 A;  4F93 B;  1W36 D;  4Y7C A;  2M30 A;  5EDN A;  4BJ5 C;  3LOC A;  2DPD A;  1AA7 A;  4GQN A;  1WDT A;  1W1W E;  2R7Z J;  1KU3 A;  4KJZ A;  3E7L A;  1F1Z A;  1HF2 A;  1QQ1 A;  4B3F X;  2WV0 A;  1VI0 A;  3OW2 B;  3CRZ A;  1YYV A;  4OJL A;  2LBF A;  1ON2 A;  5FLV A;  2KIM A;  2BGJ A;  2QTL A;  4HWV A;  3WE2 A;  1GV5 A;  2EPF A;  5M5X J;  3GTJ J;  1WVR A;  1XSV A;  2L7M P;  2PYH A;  3L09 A;  2CW8 A;  2ZZG A;  4L9N A;  2ZCW A;  2XSJ C;  1A35 A;  2X53 S;  2ZXJ A;  1KA8 A;  1DG1 G;  1GT0 C;  3HJE A;  1AIR A;  2DA5 A;  1OCC H;  2CUZ A;  1I50 J;  4HRI A;  3ZMD A;  1B72 A;  1UG2 A;  4MGR A;  3UKG A;  1Y39 A;  4BKX A;  2DYI A;  3OL3 A;  4YAL A;  3U6B A;  1O8D A;  4BJT A;  4UY8 I;  4M4S A;  5CLS A;  3KP4 A;  5D8L B;  3N05 A;  2R5Z A;  2ZJQ F;  4E4H A;  4OPV A;  4AVP A;  1MJ9 A;  2VT3 A;  5IYC J;  3OYB A;  1VQM I;  3CCS I;  3IH2 A;  1Q1H A;  2O0W A;  5CQE A;  1FWZ A;  3QAH A;  1W36 C;  4NC8 A;  2GAU A;  2XKO A;  3QFT A;  2R93 J;  2VBW A;  3U9G A;  2EZK A;  2IXS A;  2VC0 A;  3L2Q A;  3OKX A;  4YFK F;  2F5C A;  1OLT A;  1BX1 A;  5FD6 A;  1O3R A;  2AXT C;  2DY1 A;  4K1X A;  1Q7Y D;  3ASO H;  2A6T A;  3T53 B;  3LSK A;  4B4D A;  1Y56 A;  3OOP A;  2HI3 A;  2LKX A;  2O9L A;  1SKY B;  1X1A A;  1KU7 A;  4L5J A;  1DU0 A;  3S17 J;  1TW2 A;  3O8H A;  3KPH A;  4CIC A;  2OBP A;  1D5V A;  2GJP A;  1VQ4 B;  5JLV C;  2P0W A;  5E3L A;  2PE3 A;  3BY2 A;  2IS4 A;  3P9K A;  4MLO A;  3EQL F;  3WNC A;  1GXP A;  1RET A;  2HYG D;  3WTW C;  3VR6 A;  4X05 A;  1B6A A;  4PAA A;  2H8R A;  1WJA A;  2L3D A;  3L1P A;  4HF1 A;  1O8I A;  1NK2 P;  4E7Z A;  2NTQ A;  4RD1 A;  4M0L A;  1V4R A;  2FOK A;  1VQ4 I;  2HVS A;  4YDT A;  1K79 A;  4PC1 A;  2XZO A;  2XF5 A;  2EQR A;  2PFB A;  1U78 A;  4KIS A;  2FBK A;  3BLY A;  1X3W B;  2NVX J;  1X4O A;  2IAI A;  1FBQ A;  1HST A;  4B3X A;  3PO3 J;  1YIO A;  1J59 A;  2VUM J;  1AKH A;  3JU4 A;  5AON A;  3VB2 A;  4QFM A;  5F04 A;  1X1B A;  3HC7 A;  1CNF A;  1FIP A;  3D0S A;  4F3Q A;  1ZRF A;  2Q6L A;  3MVP A;  4V2F A;  2W6I A;  3GQ9 A;  4Z4V A;  4DBR A;  3V7C A;  4TN1 A;  3BC8 A;  3AVU A;  3ZN0 A;  2E5N A;  3OYH A;  2AS5 F;  2EV5 A;  4ENM A;  1QVF B;  3LA3 A;  3OR2 C;  2VBK A;  3GLL A;  3OWT A;  3ZPL A;  1Z9C A;  1JT6 A;  4MO7 A;  4FT8 A;  1TZL A;  4XN0 A;  3H9G A;  4P55 A;  4CYC B;  1HOM A;  2QKM B;  5BSY A;  3BTI A;  3PSS A;  5J1R A;  1FP2 A;  1LDJ A;  1ZM4 A;  4K2E A;  3BR2 A;  1D1B A;  2EB7 A;  3B90 A;  1H8H A;  4PJN A;  5AMV A;  2KFD A;  4M3E A;  1D8T A;  3PUM A;  4E7K A;  2LP0 A;  1R4N B;  1JJ2 B;  4BPR A;  3BTC A;  1UJ8 A;  3K4B A;  3TP3 A;  2L7K A;  3CMM A;  4A3G J;  4GCV A;  3LAP A;  4UHT A;  5HDK A;  2UXX A;  5D6F A;  1ZQ3 P;  4Z03 A;  3HPH A;  4MYU A;  2ID3 A;  4M71 A;  2VOO A;  1R1U A;  1U5T A;  3N90 A;  3DKW A;  3FMQ A;  1JKP C;  1FYK A;  5A2Q K;  2C5H A;  3LSM A;  3GVK A;  3ZMZ A;  5FD5 A;  2EV0 A;  2QBY B;  4OJO A;  2W85 A;  2RAE A;  1JHF A;  2V7F A;  3QP6 A;  2TDX A;  3CO6 C;  2HWV A;  4Z1M A;  1IDZ A;  3KL9 A;  5H6Q A;  2K9M A;  4L9T A;  4PFP A;  1UST A;  1SFO J;  2LZJ A;  5ILS A;  1BHE A;  2M5W A;  2PBI A;  4L8J A;  4XLH A;  3WG9 A;  2VKV A;  3J7Z I;  5LGN A;  1MDM A;  1E63 A;  2O0V A;  4W8R A;  4QV2 A;  2IGK A;  3UNG C;  1A36 A;  2Z6B D;  3RIQ A;  1VQ7 B;  1YLO A;  2CUF A;  3DWL E;  3K4L A;  1APL C;  4OIP F;  5H2F C;  2O7O A;  4OIO F;  2L2O A;  5HLI A;  3VSU A;  3HRS A;  4FQG A;  2R0Q C;  4HX7 A;  1V5V A;  2XTY A;  1U5T C;  2FBH A;  2PMZ N;  2MC3 A;  2QSF X;  2R7D A;  2XSD C;  1HW5 A;  4ZJZ A;  2VL8 A;  2ZME B;  1Q9S A;  4FX0 A;  1ZRE A;  1MBG A;  3DQV C;  4Y3O A;  3JUR A;  2FA5 A;  1AU7 A;  3PUN A;  3ABK H;  1HG8 A;  1X3U A;  1TYV A;  2E36 A;  3HOX J;  5KNL A;  2DTZ A;  4N9H A;  4CZZ A;  4XD7 A;  4QPO A;  3LFU A;  4G7O F;  1HW2 A;  2DOF A;  1S3J A;  4GO1 A;  3OS0 A;  1MZB A;  3HOZ J;  2AXL A;  2KRH A;  3KIO A;  2FUG 2;  3BTL A;  2A68 F;  4U0W A;  3EQN A;  2LNB A;  2X0L A;  4B3G A;  4A5M A;  3W2G A;  5LHI A;  1F60 A;  5FKM A;  4XKV A;  1QNT A;  4YFN F;  1ZG3 A;  2OTJ B;  2HGC A;  5TY0 A;  3J81 k;  3W2I A;  1OJL A;  3SQN A;  2R7X A;  4DNT B;  1CZF A;  4RDK A;  1PXZ A;  4DIQ A;  4ZYA A;  1VQN B;  2QZA A;  3HSR A;  4BE1 A;  2A3S A;  4IZZ A;  1K9M D;  3FXU A;  5HOO A;  3GTP J;  1JA0 A;  2JJ7 A;  3FX3 A;  3GTQ J;  5K7H A;  2CW5 A;  4G5G A;  2IOU G;  1FOY A;  3GBG A;  2R92 J;  3BJA A;  3K1M A;  2BBY A;  1PUE E;  1FNM A;  5E8G A;  1IZ1 A;  2VBY A;  3PNT A;  2M8E A;  3N6Z A;  3HDD A;  2WAQ N;  3LQE A;  4YEJ A;  2HKO A;  1R71 A;  4RB0 A;  4EV0 A;  4CYC A;  3U2R A;  3PO2 J;  4X7E A;  4Z4S A;  2VXD A;  1Z3Y A;  1WJC A;  2HQN A;  1YX5 A;  4JX4 A;  4M6Y A;  2XV4 S;  2FE3 A;  1U3E M;  3BP8 A;  3G6E I;  1KQS B;  3OS1 A;  1IDK A;  1RES A;  2LR8 A;  2R7W A;  1BR2 A;  4PJJ A;  4L9V A;  2QSG X;  1W0J A;  2WYR A;  4UZE A;  3GLX A;  2M8G X;  3S2W A;  1KZH A;  3Q3S A;  1W0U A;  5FRM A;  5HS7 A;  3KX2 A;  3SKB A;  3L2U A;  2BV3 A;  4Z4Z A;  2C6Y A;  2XGE A;  3K0L A;  3LVB A;  3R61 A;  4MFE A;  4A3C J;  4G7W A;  4XNF A;  3VYT B;  1AOY A;  3A03 A;  3UW0 A;  5TV2 A;  2ME0 A;  2IPQ X;  1FMV A;  1O3S A;  1RUN A;  3JRI A;  1YX3 A;  2YUS A;  2WWY A;  2UZK A;  2FX3 A;  1IO2 A;  1FTZ A;  5JMC B;  4ZYH A;  4NCN A;  5KHD A;  5DD8 A;  1JGG A;  1LDK B;  1IJW C;  1DDI A;  1WJF A;  1ODD A;  2NVU B;  3H94 A;  1NG7 A;  1MD0 A;  3P9I A;  5C3E J;  5F4J A;  3P4G A;  3H5N A;  2DJI A;  1QRB A;  2IS2 A;  3S93 A;  4II3 A;  4A3L J;  1IN4 A;  2K9S A;  1WH7 A;  2BM7 A;  2DK5 A;  3KCC A;  3PA2 A;  2DQL A;  2WY7 Q;  1LE8 B;  5EJC A;  5FB2 A;  5DCF A;  1LVK A;  1CNE A;  2KVO A;  1N75 A;  1RR8 C;  2LKP A;  2XOK A;  4HYE A;  2ECC A;  1SFE A;  4EM1 A;  1ZAR A;  1RU4 A;  1Z3X A;  4HST A;  3VYU B;  3L9F A;  3A01 A;  5DCM A;  1ZM9 A;  1ZGA A;  2A6H F;  3Q6R A;  4U4B A;  4FET A;  3NQO A;  2XAQ A;  2CBX A;  4TKO B;  2E5Z A;  4V2G A;  3ZQF A;  1NB9 A;  2DA7 A;  3V4G A;  4CCK A;  4M53 A;  3KFW X;  4KN4 X;  4RAY A;  2VBT A;  1O4X A;  1CGP A;  1KGS A;  5HS8 A;  4FXU A;  5F08 A;  3AG3 H;  3GZN B;  3OY9 A;  2F3L A;  4YAW A;  1N25 A;  3LSH A;  2QSH X;  5JVG F;  4ENN A;  3GTK J;  3WND A;  1EP3 B;  3PVD A;  3GYH X;  1ON1 A;  4AIJ A;  3ZQQ A;  3A8J A;  4UAJ A;  1DGW Y;  4TMW A;  1Q81 D;  2V9P A;  2RRE A;  1TQM A;  3ZMV A;  2ZZQ A;  5DSZ A;  1I18 A;  1NTC A;  1R5O A;  2DAO A;  3IH4 A;  1MNE A;  1ZR2 A;  2JUC A;  4LOC A;  2JVH A;  3L2R A;  4XKB A;  3A8I A;  2FSW A;  1K73 D;  5LGT A;  2CJJ A;  2XGX A;  2HOE A;  4LMY A;  4B48 A;  3G2B A;  1R49 A;  1SAU A;  1R58 A;  3MD2 A;  4LBY A;  1FZP B;  1RKW A;  2M87 A;  1FNN A;  3E0J B;  2ZJ2 A;  1G3S A;  4DNC A;  1P7J A;  1R5H A;  2XF6 A;  3K4K A;  2MAB A;  2EH3 A;  3C2B A;  1D5Y A;  3GTO J;  3SDB A;  3FM5 A;  4A93 J;  2AO9 A;  3ML6 A;  2BF4 A;  3WQZ A;  1LLZ A;  1WXR A;  3A4C A;  1X58 A;  2B7E A;  4AF7 A;  1FND A;  1CF7 A;  5L3C A;  1EE6 A;  2VBU A;  3I5U A;  5F0H A;  4Z4R A;  1VLY A;  3ABL H;  1WOO A;  3AL0 C;  2C5B A;  2MD5 A;  3J7A O;  3ISP A;  1PJ7 A;  2Y0S N;  2LVS A;  2ZZE A;  2JZY A;  4IX7 A;  1QRY A;  3MFK A;  1FSE A;  4A0Z A;  2B63 J;  4UVC A;  3H3V K;  3VO1 A;  1HKS A;  2UXN A;  1G7R A;  4C0S A;  1WJE A;  3FWE A;  1HKQ A;  3MHP A;  3ELK A;  1XGM A;  2AHO A;  3K10 A;  4PUS A;  5HKK A;  3HGY A;  2Y75 A;  2BMW A;  4F7Z A;  4XSX F;  1KQ8 A;  3RI4 A;  2YSR A;  3LSR A;  5CJ9 A;  1UMK A;  1ZLK A;  3CME B;  1XGO A;  5F0F A;  2FU4 A;  4B8X A;  2CFO A;  1KON A;  4ZGN B;  1IF1 A;  1BJA A;  2ZBK A;  3F72 A;  3WY9 A;  3M1E A;  4HIZ A;  4HBL A;  3LA2 A;  1U8R A;  2CND A;  3G4S B;  3W5H A;  4EW9 A;  4KKT A;  3I56 I;  3GUD A;  1GAQ A;  1IDJ A;  3T1B A;  1IUF A;  2NST A;  2BM0 A;  4C9Y A;  1H42 A;  1S7O A;  3HZJ A;  2HKX A;  4AWX B;  3KEO A;  3IC7 A;  2VBS A;  2K85 A;  1SVM A;  5E20 A;  4CXF A;  2JRT A;  2NVQ J;  4Q7J B;  3QU6 A;  3TOA A;  1GLN A;  3BCA A;  2LSO A;  1E62 A;  4XR6 A;  3ZQH A;  2X1D A;  3K4C A;  2KJB A;  2X1E A;  3B78 A;  3CLQ A;  2M45 A;  3WOD F;  2H09 A;  4QIW N;  2L4A A;  4HZF A;  1W0T A;  2E1R A;  4YAO A;  2NPF A;  3ECO A;  4CYD A;  2QA4 B;  3E97 A;  4EH1 A;  2XAJ A;  2QBY A;  3CCM I;  1IA5 A;  4HEA 2;  4A3I J;  1N0U A;  3JRH A;  3I3L A;  4I01 A;  4JX5 A;  4IKF A;  2BM6 A;  4BXF A;  5D8K B;  4X0C A;  3O3K A;  4ZTJ A;  3PQK A;  1J9Z A;  3DLL F;  3WHB A;  2HVR A;  2F5V A;  2PMU A;  3QE2 A;  2INV A;  2J8K A;  1M1E B;  5A8A A;  2CQK A;  2FQ4 A;  3PEN A;  1G8X A;  3E1S A;  3G1L A;  5B1A H;  3AST A;  1D0X A;  2RDP A;  1AWC A;  2UVF A;  1Y8R B;  3G3Z A;  5DYM A;  1ETQ A;  1TWH J;  3JAM Z;  1SVO A;  2E1N A;  4Y4R A;  1HVX A;  3Q9V A;  1JXS A;  2L4M A;  1TQP A;  1TLH B;  4JOM A;  1O8J A;  1YLF A;  4UV8 A;  3T8R A;  3VST A;  4XM3 A;  2DFF A;  4XRS G;  3OYI A;  1VQO B;  3QFR A;  2ZXH A;  3ZQL A;  2WA0 A;  2FF4 A;  3OYN A;  4YFX F;  3M9A A;  5HDN A;  3LNN A;  1OYW A;  3Q39 A;  4J0Q A;  2Z9O A;  1SD7 A;  2XZL A;  1WTH D;  3OAA A;  3DU5 A;  2QEN A;  2VAS A;  1NRK A;  3ROU A;  1BX0 A;  3EQO A;  1G7S A;  2CQN A;  3P7N A;  4A12 A;  3KLN A;  5CYV A;  5E8I A;  2D5V A;  4HV6 A;  2WTE A;  2GPJ A;  1O3Q A;  2FRH A;  1O7L A;  2GWR A;  1VQK B;  4A0X A;  1XB2 A;  2NZM A;  5LFA A;  2OUM A;  4QTR A;  2ACJ A;  1Y6I A;  2VOP A;  4RD4 A;  2JJ1 A;  1B8I A;  3VO2 A;  3VNV A;  2VKH A;  3EYY A;  3MZ8 A;  4NK6 A;  5KK1 A;  2R4G A;  2VJ5 A;  2F4N A;  1QBJ A;  2VJJ A;  3S1N J;  4G1V A;  4KKS A;  4LK0 F;  2BVM A;  1A31 A;  4WCG A;  3H9Q A;  3GME A;  1GVJ A;  3H5R A;  3M7G A;  5B3S H;  4HF2 A;  5EEG A;  4BBR J;  5FO0 A;  2PLY A;  1ITY A;  2DMP A;  4AVZ A;  4DK0 A;  2DO7 A;  1ZGJ A;  1JKO C;  3LJY A;  2NVY J;  3W2V A;  3S1R J;  1W87 A;  4J19 A;  3WBJ A;  3NWS A;  5LRS A;  2JT1 A;  1QGA A;  1MH3 A;  4XRM A;  5EMN A;  2QY1 A;  2YUH A;  1MBJ A;  3B6C A;  2VLA A;  2VN2 A;  4LC0 A;  1DAB A;  5IP6 A;  5FLX K;  4PFO A;  4ZTF A;  1GJR A;  3E6B A;  3ONU A;  4F52 A;  4N4N B;  2OTJ I;  3HSE A;  2Q6K A;  4YFO A;  1TWG J;  3HEF A;  2FJ1 A;  3V76 A;  3OYJ A;  2W7Z A;  3DTI A;  3F8F A;  1V3F A;  4XLN F;  2LOO A;  3ZMS A;  4DOZ A;  3CCL I;  5IYD J;  2EK5 A;  2M7B A;  2VT2 A;  1E3O C;  1WZ2 A;  1YJW I;  1TNT A;  2E2I J;  1VQ6 B;  1WMR A;  1X3Z B;  2NOG A;  1ETX A;  4TSF A;  4G6T B;  3M8E A;  1VQP I;  1W35 A;  4OP7 A;  4WZK A;  2KMU A;  2JUG A;  4OM9 A;  5F4M A;  1V0E A;  3W6K B;  4OWR B;  1FX0 A;  2VOD A;  5DUK A;  2NRA C;  5LRR A;  4Q47 A;  1Z6R A;  2EJR A;  1CF7 B;  5E6T A;  2FVG A;  4M6V A;  4I6Z A;  2R7U A;  1W7P B;  2NTB A;  3TO7 A;  2RKH A;  4G7X A;  3I54 A;  2DQR A;  2V7U A;  1RQP A;  3OOU A;  2Q6O A;  1VQL B;  1YW9 A;  1YRN B;  1S0U A;  1TBX A;  2R3S A;  4EGY A;  4C3H J;  2PJP A;  2VFM A;  3FXJ A;  2QN6 A;  2XC1 A;  3F23 A;  3JRD A;  3DXJ F;  1TYU A;  1G59 A;  1EH7 A;  2ZL6 A;  1OGO X;  3CF5 F;  3VDX A;  5LMZ A;  4RGX A;  5GV7 A;  2COM A;  3U1K A;  2QYO A;  3GVA A;  1JTY A;  3K2Z A;  4I7H A;  4KNY A;  2YWE A;  1R1V A;  1KU2 A;  1P2F A;  5ICF A;  2ZJP F;  9ANT A;  3QYE A;  2HTJ A;  3CCM B;  1R6R A;  1SVL A;  2E35 A;  4HNU A;  3G4S I;  3CC2 I;  3A2K A;  5FJ8 J;  4FAS D;  2W25 A;  2A05 A;  2R5Y A;  1HC8 A;  3OV8 A;  2PJR A;  2CRV A;  2R9V A;  2V7X A;  1EZG A;  3JTH A;  1I39 A;  3B8H A;  3AG4 H;  2W82 A;  4OPS A;  2V1N A;  2WAD A;  4U88 A;  5E1W A;  4Y7N J;  1OCR H;  3MKY B;  1RUO A;  3VNU A;  5FA6 A;  3HIF A;  2DFH A;  1WOS A;  2V1D A;  3GF2 A;  1H89 C;  2OBS A;  3SYJ A;  1MH4 A;  2DEU A;  2QKL B;  2K02 A;  2GLO A;  1UG0 A;  2PN6 A;  4M2L A;  3AGP A;  2ICW G;  2BW3 A;  2FD5 A;  1J5Y A;  4H0E A;  2V79 A;  5J1U A;  4RCY A;  2OTL I;  4CCJ A;  1DAR A;  1WSU A;  1TW3 A;  2FMY A;  4YII A;  4MEX F;  1FNB A;  3F9K A;  2RQQ A;  1JTX A;  1LVA A;  3CD6 B;  4IPA A;  3HM5 A;  4IHT A;  1Z1D A;  4HQE A;  1AMO A;  1ETK A;  2XDV A;  3PNV A;  3ZMU A;  3DBH B;  3S1Q J;  3CCU I;  2A6E F;  1GVD A;  2KQR A;  4IO9 F;  2NNY A;  3HSF A;  4WK8 F;  1LDD A;  4XBF A;  1Z7L A;  4ASN A;  4HNV A;  3WHC A;  4IOA F;  2R7Q A;  3GO5 A;  5IOY A;  2EIX A;  2W24 A;  3HHH A;  2E60 A;  2G0E A;  1N0V C;  3F6V A;  3E5U A;  1CQT A;  5IP9 J;  4RCZ A;  3CDH A;  3WTU C;  1FDR A;  1B23 P;  1S72 I;  2X9D A;  4XOP A;  2H6B A;  2DDB A;  1EXM A;  3MN2 A;  4U0V A;  5EYR A;  1G7T A;  1J09 A;  2LH9 A;  3OYD A;  2XPW A;  2V7Q A;  4UZU A;  5HLT A;  4YEI A;  4IHS A;  2MGQ A;  2CV0 A;  4PC6 A;  5GTI C;  4PSX A;  1V5E A;  4Z4T A;  4P3I A;  4U7B A;  1T39 A;  5CVV A;  3HL2 A;  3V7S A;  3ES9 A;  2XAS A;  3JQP A;  1E79 A;  2VC1 A;  2IT0 A;  1VQO I;  1YJW B;  1S29 A;  1YRN A;  5GPC A;  4M6X A;  3HUG A;  3AKZ A;  2XGJ A;  3BOQ A;  1VQ5 I;  2UWM A;  4GRI A;  1JNY A;  2HPI A;  3FKI J;  1FRN A;  3A35 A;  1HDD C;  2BM4 A;  4BEH A;  1U5T B;  2X6X A;  2VFN A;  2L01 A;  4D0P A;  4X07 A;  3DLA A;  4DQK A;  2HZD A;  2ISZ A;  2DFI A;  1KJZ A;  1FBU A;  3R6J A;  1XX5 A;  4OJ6 A;  3MMP A;  3HB9 A;  3KET A;  1MBE A;  3BNW A;  2EZL A;  4XK4 A;  2QEX B;  5D5X B;  5IT9 K;  1LB2 A;  4E6K G;  5DS0 A;  1IB4 A;  4NC6 A;  1HBX G;  1LJ9 A;  1YJ9 I;  1H8E A;  4F92 B;  1YIT I;  2CW7 A;  4RLF A;  4BDY A;  1UD3 A;  1R9T J;  2M7A A;  1JI8 A;  3LQR A;  3FM3 A;  3GCM A;  2ISY A;  1VQ6 I;  4S05 A;  4EGZ A;  2M5S A;  4UVB A;  5HOD A;  2O61 A;  4CQJ A;  3CP8 A;  4JQF A;  3H5A A;  1OCP A;  3OIP A;  4N3N A;  5BNG A;  5GPA A;  4EJT A;  3J7Y J;  2PJR B;  3WTT C;  3DP7 A;  1IRF A;  3VMF A;  3BZC A;  2HPM A;  1M90 D;  1S8N A;  1DDG A;  1QO0 D;  2W1O A;  4DQ2 A;  4FCY A;  1FMW A;  1DUX C;  3BQY A;  2DMN A;  4Q5S F;  2E1B A;  1VQK I;  4ACA A;  2NAZ A;  4OAY A;  2VKE A;  2NS7 A;  4ZC3 A;  2F1L A;  1K5C A;  1XFO A;  3GTM J;  3I64 A;  2C2W A;  2DER A;  2QQB A;  3IKT A;  3BY6 A;  3ZQG A;  2BOL A;  4BY1 J;  1KYZ A;  2G7U A;  5TGT A;  2BY2 A;  4MQ9 F;  4DYQ A;  2VNK A;  3HOT A;  1VJS A;  4FN5 A;  4FE4 A;  3CCQ B;  1Y0U A;  1JJ6 C;  4B47 A;  1OB0 A;  1QGP A;  1BQE A;  5H59 A;  2KHM A;  1P7I A;  2XB5 A;  4RPB A;  1S9H A;  3B73 A;  1TLL A;  4OMZ A;  1LEA A;  3BH7 B;  2R6H A;  3WTX C;  5F27 A;  5D5W B;  1VQN I;  1IC8 A;  5GV8 A;  2DTR A;  4D1Q A;  3F8N A;  4M3D A;  3NAR A;  4MEY F;  2BHY A;  1K78 B;  3N97 A;  2VI6 A;  1RZ4 A;  3B02 A;  3DEW A;  1J9I A;  2R7S A;  3F8C A;  3DU6 A;  1V55 H;  3PSI A;  1Y8Q B;  3X2Q H;  1WQ2 A;  4X1E A;  2M0C A;  1YTY A;  4L5E A;  2KZG A;  1DPR A;  1JE8 A;  5AIP A;  3F22 A;  4ZYE A;  1PUF B;  2EIM H;  3S1M J;  1LLW A;  4X7D A;  4H9G A;  4YRV A;  1X2M A;  4UB6 C;  3GVL A;  5H5J A;  2H1L A;  5ICE A;  2KRC A;  1BR1 A;  3K1P A;  1T38 A;  3GX4 X;  2ECB A;  1HCR A;  2QQ8 A;  1S5L C;  2GM4 A;  2L54 A;  3FXQ A;  1O7F A;  3CUQ C;  4RS8 A;  3BH4 A;  2ZZF A;  2BW3 B;  4EM0 B;  3OE7 A;  2F2E A;  4E7L A;  2OYN A;  1ACI A;  1K4S A;  3IWZ A;  1EFC A;  1N08 A;  1BI3 A;  3MCA A;  2ZO4 A;  1I3A A;  4U87 A;  2CYY A;  4D7N A;  1S72 B;  3JQR A;  5M3M J;  1MMS A;  4G12 A;  4RLZ A;  2G7H A;  2IEK A;  3CLO A;  4JK1 X;  5FRO A;  3RZO J;  2WJV A;  4V19 K;  3VWB A;  3A01 B;  2O6G E;  1T6Z A;  3BCD A;  2PEC A;  5FRN A;  1ZK8 A;  2K27 A;  1MMA A;  3BRO A;  2MH2 A;  1NHC A;  2XRO A;  5IYN A;  1V5F A;  2E19 A;  2YPR A;  1OCZ H;  1MND A;  1XN7 A;  3NAU A;  4MHG A;  5HZA A;  4LG3 A;  4XLF A;  3NRV A;  2J7K A;  4QLC U;  1WKM A;  2BY0 A;  2CSO A;  2RQP A;  1XSD A;  4TMX A;  4NK8 A;  4PGG A;  1S6L A;  3CB4 A;  3ZQI A;  2HZT A;  1HQC A;  1EWY A;  4Y9U A;  1SAN A;  1W4M A;  4E70 A;  1CQX A;  1QX4 A;  4WWV A;  4WXH A;  2LY2 A;  4CO8 A;  2BVN A;  3ZZU A;  3M8F A;  4I98 B;  5GAG J;  1XD7 A;  4N4O B;  2Z1D A;  2I1L A;  2VBE A;  2VBZ A;  1Z05 A;  1ZGW A;  4OU0 A;  3SDG A;  4BXU A;  5KAF C;  2GQQ A;  3H3Z A;  1N8R D;  2JN9 A;  3QOP A;  2LC2 A;  1YI2 I;  3U6K A;  2VON A;  3QOD A;  1O8G A;  3HBL A;  4LD5 A;  1IN5 A;  1YO5 C;  2RC5 A;  3ASP A;  1WHU A;  1XMA A;  1ETO A;  3CQZ J;  1HZE A;  3GQ7 A;  2ZNY A;  5LLQ A;  4DJA A;  3OP1 A;  4JYK A;  1JKQ C;  1O8L A;  3Q0W A;  1WCM J;  4M9Z A;  3DTK A;  3JRG A;  4PSW A;  2DYS H;  2P8T A;  2I8D A;  2DU9 A;  3JQQ A;  4CCN A;  1EV7 A;  4XIC A;  2K9L A;  1VQL I;  2OQG A;  3AAF A;  3CC4 B;  3CJT B;  2GA2 A;  1SMY F;  2MLK A;  3ZQ7 A;  4IRI A;  1K4Z A;  5DNS A;  1QA2 A;  2Z99 A;  1ZG1 A;  2WSS A;  3PL8 A;  3GFM A;  4LBV A;  1G7C A;  2JJ2 A;  1OKR A;  2QDX A;  2ZSH B;  1XDS A;  2L5Q A;  2WV1 A;  1BM9 A;  4OPO A;  2D45 A;  1ZM2 A;  3AVY A;  5DV5 A;  1IAW A;  4XMY A;  3OR1 C;  1EJ9 A;  3I1F A;  4XLE A;  3ASR A;  3ZN1 A;  2VQL A;  5L3G A;  2B5O A;  2KP6 A;  2MBF A;  2O0Y A;  5JBQ A;  1OIS A;  4IF4 A;  3TL4 X;  2C4U A;  4PC3 A;  3TMO A;  2K7L A;  3RQ4 A;  2YU3 A;  3GQ8 A;  5K5Q A;  3EET A;  4MTE A;  3RKY A;  1COW A;  3B6A A;  5E3M A;  5F4O A;  3MCZ A;  2I10 A;  1PP8 F;  4Z6Y A;  1XE1 A;  3IAM 2;  4L5I A;  1JKR C;  3E1Y E;  2Y0S A;  1JA1 A;  1NJI D;  1OFM A;  2ZL7 A;  2CFX A;  1ZRC A;  2HVQ A;  4ITV A;  1X19 A;  1QJV A;  3ZZ0 A;  2DA4 A;  2GIZ A;  3ZQC A;  4HLX A;  3CF2 A;  3DPT A;  1E3X A;  3AL0 B;  4DW6 A;  2CGP A;  4OMY A;  1LFP A;  2RNJ A;  4KMF A;  2ZNZ A;  1AKH B;  2OBT A;  4F55 A;  1WU8 A;  3CW2 A;  2VKD A;  5EGO A;  1IXS B;  1L0O C;  1WFX A;  4KT5 C;  4URR A;  2GK6 A;  2EZI A;  4UUV A;  5IT9 Z;  4X8I A;  4I02 A;  3S14 J;  2HOA A;  1EFR A;  1QUF A;  4MNU A;  3W2H A;  3H9J A;  4ZDO A;  1XMX A;  4L0Y B;  4CCL A;  1W9X A;  3SY2 A;  3RZD J;  4RLQ A;  3L2C A;  2HYF A;  3CCJ I;  3WYA A;  3VSK A;  3MKL A;  3K4N A;  2ZBV A;  3OMY A;  4CCM A;  1A6I A;  3A0H C;  1X1D A;  3BPX A;  2ELH A;  3L00 A;  1OYY A;  1XB4 A;  4DBQ A;  4C2U A;  2AQE A;  5J3L A;  1TVC A;  4ENK A;  1YE9 A;  4YZ0 A;  2C78 A;  2L0K A;  4RB3 C;  1KCC A;  2HMA A;  3D5L A;  3I4P A;  2CV1 A;  2X8K A;  1HDP A;  3ZUG A;  4NBS A;  3KLO A;  4M74 A;  1T0F C;  4A6D A;  5EF6 A;  4MTD A;  4PZJ A;  3M3Y J;  2BM1 A;  1ZKG A;  2K40 A;  2K86 A;  2L02 A;  2VE8 A;  1XDU A;  5CVI A;  1NBM A;  3JX8 A;  2CQ7 A;  2KLO A;  3FJO A;  1GVH A;  1YIT B;  2BY3 A;  1OR7 C;  4Z06 A;  1JGS A;  4OPW A;  3CCV B;  2W48 A;  2ME6 A;  4OOX A;  1YQA A;  1WI3 A;  1XG1 A;  4AU7 A;  2Y48 A;  4A3E J;  4GDF A;  1O8E A;  1BL0 A;  1TT5 B;  1QA3 A;  1ZM3 A;  4PDK A;  2LK2 A;  3ABU A;  4KUM A;  4RAF A;  2ZL5 A;  4KMU X;  1F5T A;  2EIN H;  1SM4 A;  4JX6 A;  1W0K A;  1PJ5 A;  3F0C A;  4XSZ F;  3QPT A;  2DA3 A;  5FLX Z;  4ABZ A;  1YI2 B;  1BJZ A;  2M3A A;  1F20 A;  3VPR A;  1XTA A;  3P9C A;  2QXZ A;  4I2O A;  1TTT A;  4D7M A;  3KZY A;  4RDJ A;  1QVT A;  3LYC A;  4LK1 F;  2O3F A;  2B7C A;  1YOV B;  4RD6 A;  1FT9 A;  1OB5 A;  3CD6 I;  3HPG A;  1U8B A;  1IV8 A;  5TRD A;  2WB1 A;  3SJM A;  2NVT J;  1IUY A;  5FKO A;  1XS9 A;  2EV6 A;  5BPI A;  3PIP F;  1MMN A;  5D5U B;  2ZME A;  4X0G A;  1TSP A;  2JWT A;  4BDZ A;  3IWF A;  5JFR A;  4YHB A;  1NHA A;  2OA4 A;  3WTZ A;  1E1R A;  3PM1 A;  1OFD A;  5FNZ A;  1EF4 A;  3ASS A;  4E7I A;  3EUH A;  5FO1 A;  4A3K J;  2M0M A;  4HX4 A;  1PP7 U;  3P27 A;  2E7X A;  4TT3 A;  4O6J A;  4NQW B;  3QOE A;  4XOT A;  3H0D A;  4P9F A;  3TP0 A;  3AVT A;  3NAW A;  2R7T A;  2OPT A;  3CUQ A;  2QQ9 A;  4YC5 A;  4D9J A;  4FTH A;  1KK0 A;  2XNJ A;  4BXX J;  1EH6 A;  2IS1 A;  4R71 A;  4PC2 A;  2QM3 A;  2GZW A;  4TV7 A;  1R5G A;  1KQ0 A;  2BXY A;  2P5V A;  3IKV A;  3LFK A;  1DDN A;  4P3Y A;  1GV2 A;  1BI1 A;  3WTY C;  3JAM K;  2YX7 A;  2ETH A;  1UMQ A;  1YJN I;  4E7H A;  4IVN A;  1V54 H;  1U9O A;  1VQ9 I;  4CZC A;  2R7V A;  3H9N A;  3IH3 A;  3LSJ A;  1ONV A;  4WX9 A;  4BYY A;  1P4M A;  3EDP A;  1OGI A;  4WZL A;  3A3G A;  4TMV A;  4IQ4 A;  3PSZ A;  3H36 A;  3A3B A;  3CJQ B;  3CCE I;  2ZFU A;  4C30 A;  4CSW A;  1Z21 A;  4ESF A;  1R5I D;  3ZC3 A;  2VNJ A;  4IOC F;  4PGO A;  3QSY A;  2WAE A;  3H3U A;  5K1Y A;  4AIK A;  1IN7 A;  5AN9 A;  3VSL A;  2RC4 A;  5KW9 A;  2DOD A;  3LST A;  2W7N A;  4WQM A;  5JHF A;  1YX2 A;  2OZ6 A;  1TP4 A;  2OC6 A;  2INU A;  2QEX I;  2LF7 A;  2EIJ H;  1NH3 A;  2ZSI B;  1OGJ A;  4DK1 A;  1H9G A;  2ELK A;  4KIF A;  3SXY A;  3D5R C;  2GA1 A;  4RJL A;  4C2T A;  1EH8 A;  1U9N A;  3R0A A;  4UUS B;  2IP2 A;  2HDN B;  2QQA A;  1D0Y A;  4CGZ A;  3ESW B;  4NUB A;  4XON A;  5F0C A;  3RYP A;  5JI6 A;  2BY1 A;  5L3F A;  4YZX A;  4G94 A;  1VBL A;  3FXK A;  5CVR A;  1X2N A;  2V26 A;  3JRE A;  2KL4 A;  2V1X A;  3PIO F;  2ZTG A;  1WRJ A;  2F43 A;  1E43 A;  4OOS A;  2HOT A;  2Y9Z A;  3W6J B;  2L9V A;  2V31 A;  3GSI A;  1P4W A;  2PMZ A;  3FBI B;  2Z16 A;  1JUP A;  3FIS A;  4ENJ A;  3JRF A;  1ZR4 A;  1VLO A;  2YX4 A;  1WGX A;  4AD9 A;  3M1C A;  3M8J A;  3HOW J;  1MBH A;  4IEJ A;  3VOD A;  2EFN A;  3PSF A;  2P6S A;  4DYC A;  1DP7 P;  4UB8 C;  3Q3A A;  1QHG A;  3DF8 A;  4RM3 A;  5E3O A;  2Y30 A;  5F6F A;  2P81 A;  3EUK L;  5ICG A;  3FIW A;  1QZE A;  5ILU A;  1SC7 A;  5C44 J;  2ZC2 A;  3BT9 A;  5E17 F;  1MJB A;  2NS0 A;  2X51 A;  5DCM B;  3TGN A;  5IPA A;  6PAX A;  3I0T A;  4BE0 A;  1OYI A;  3LSG A;  4B43 A;  2HLD A;  3W5U A;  4YZA A;  2JSC A;  4X7F A;  3CCV I;  1KK2 A;  4WXC A;  4DZP A;  1NB0 A;  3QPH A;  5KAI C;  2P6T A;  3SJP A;  2JIZ A;  1BN5 A;  1FYL A;  5CDF A;  3FXO A;  4ETS A;  2Y69 H;  2X6Y A;  3NB2 A;  2GJK A;  1W5S A;  1EFT A;  3QU3 A;  1OHH A;  4U0Y A;  3KYC B;  4A3J J;  2M4G A;  4V02 C;  4G6I A;  4HSR A;  4RGS A;  1FLI A;  1LQ1 A;  5BOX A;  4B4C A;  3AVX A;  2XPU A;  5HDG A;  3HTU A;  4I0B A;  3DTE A;  1DBO A;  3SZG A;  2BM5 A;  1QVG B;  2QYU A;  3PET A;  4IL6 C;  3WXM A;  5IP7 J;  4WWC A;  5L46 A;  1MW7 A;  2VPR A;  1QGY A;  1QPM A;  2OAZ A;  3CMA B;  3BCF A;  1YIJ B;  2CUJ A;  5TIS C;  1RC9 A;  2WAF A;  3Q0V A;  1H80 A;  1K4T A;  2B7B A;  2DOG A;  2FXA A;  4C2L A;  3GFJ A;  1SD4 A;  1F43 A;  2H6C A;  2H1K A;  3SLD A;  2LF8 A;  2G9W A;  1K6Y A;  1TC3 C;  1BC7 C;  2E71 A;  3AG2 H;  2OTL B;  4OIQ F;  3HXL A;  5FFX A;  3TDU C;  2TRT A;  3HOU J;  2V7V A;  4ACB A;  1TUI A;  1POG A;  3CES A;  3ZXS A;  4TMZ A;  2DI3 A;  1VQ9 B;  3WTV C;  4G6Q A;  4DQL A;  2O04 A;  2DMQ A;  1XC5 A;  3E5X A;  2F4M B;  1Z6T A;  1B9N A;  2JDI A;  2GOM A;  2OU2 A;  5EGO B;  2LD5 A;  2VBV A;  3CCU B;  2CV2 A;  2AQF A;  5EG0 A;  4HV5 A;  1SFU A;  3TH0 A;  4LG0 B;  2V9K A;  3K9T A;  3W2F A;  2A5Y B;  1K8A D;  1DU6 A;  1HA3 A;  1G6N A;  2KJC A;  3Q9S A;  1TT0 A;  1R4M B;  2L7F P;  5LBQ A;  1BIA A;  3IP4 B;  2WAQ A;  4MIM A;  3CUQ B;  5BMZ A;  3VSV A;  3KEW A;  3H1C A;  5CVJ A;  5BS6 A;  4RD3 A;  3C2H A;  2E1M B;  3NWT A;  3VEP A;  2XAG A;  5DUI A;  4QSH A;  1GDT A;  3MKZ A;  3CXC B;  5CKT A;  4DYR A;  2C77 A;  5IYP A;  3Q6Q A;  3PNY A;  1OPC A;  2Y31 A;  1QGZ A;  2Q2E A;  5C1E A;  3SQV A;  5LGU A;  4YCQ A;  1JJ8 C;  5JLX A;  1UD5 A;  2IVM A;  4RGR A;  1AIP A;  1RWR A;  1UZC A;  1STZ A;  2JPB A;  1KZL A;  3QFS A;  2OJE D;  4CA0 A;  2D74 A;  4Y52 J;  4P6Y A;  3Q38 A;  2EIL H;  2WBM A;  2KIS A;  4I76 A;  2XT4 A;  4GGG A;  4R79 A;  1UHM A;  4QPQ A;  4XLP F;  3FZV A;  2OCC H;  1V0F A;  3ZPN A;  1MBF A;  2DW4 A;  1F4K A;  1OMI A;  2KIQ A;  4LIT A;  3M4O J;  1VF7 A;  2CG4 A;  1O8M A;  2DCE A;  1LFU P;  2O8K A;  1XQB A;  2VFO A;  3F3X A;  2K3F A;  3G71 I;  3IRR A;  3ZBU A;  2ZME C;  5FLM J;  4KDP A;  3AVW A;  2P5K A;  4P2N A;  2D3L A;  1C0W A;  1ZAO A;  2F48 A;  5FFZ A;  4A3F J;  4EAT A;  1BW6 A;  2CW0 F;  3LWF A;  5J8F A;  3OFN A;  5ICC A;  1XG2 A;  3J7A Y;  1YJN B;  2M4K A;  1ZYR F;  4RB1 A;  4KA4 A;  4ZZD A;  2OZU A;  2HQR A;  5DN6 A;  2MH9 A;  3S2H J;  1RPW A;  2QX3 A;  5HVQ C;  3BWG A;  1T0F A;  2P3M A;  3ML3 A;  2CU7 A;  4UZF A;  3GIR A;  1PE9 A;  4WF2 A;  2LYC A;  3DKX A;  2RC6 A;  2HYJ A;  1UAA A;  1YJ9 B;  1RMG A;  2GOX B;  4Z4Y A;  3K2A A;  2K4J A;  1E3P A;  1USS A;  2JN6 A;  5IYB J;  4M9S A;  2ESN A;  2STT A;  3CC2 B;  3P26 A;  4ASU A;  1SKQ A;  1D3Y A;  2VNH A;  2R7R A;  4P1W A;  1KQ9 A;  3O8G A;  1BOB A;  1V5G A;  1FRQ A;  4A2U A;  1I7P A;  4YIF A;  2F5F A;  2MLG A;  2OK7 A;  1B72 B;  4RAG A;  2K9Q A;  1KQ5 A;  2O17 A;  2MW8 A;  1B2R A;  3FK7 A;  1MAB A;  5FKK A;  1G4D A;  2ODL A;  3WGI A;  2DN0 A;  2VXZ A;  1PJ6 A;  3MEX A;  2CH0 A;  4AYB A;  1DQU A;  3I4N J;  1YHQ B;  2L9S A;  2L9R A;  1K8F A;  2CF4 A;  2A07 F;  3A02 A;  3HKZ N;  2DT6 A;  1QPI A;  2DLL A;  1JT0 A;  1I1G A;  3WU1 B;  5IK2 A;  2NXN B;  3OYG A;  3T51 B;  1D1A A;  2E1O A;  1IXR C;  3RCO A;  3SEZ A;  1SFK A;  2V4J C;  2NYX A;  2DA2 A;  3P5J A;  3OOC A;  1N06 A;  1PYV A;  2VBM A;  4EMS A;  2Q6I A;  3MKW B;  3V7R A;  4I0A A;  4IHX A;  1UFM A;  2XUB A;  3ZR8 X;  3E6C C;  2WB1 N;  4LFU A;  3HTS B;  5GAH J;  3VMW A;  1FSH A;  1MMG A;  3S3O A;  2Q1Z B;  3IV5 A;  3S3N A;  2KRF A;  1KD1 D;  4M3F A;  4BY7 J;  1JHH A;  1MSE C;  4A3D J;  5C4X J;  3BG6 A;  4LB5 A;  5M5W J;  1Y0Y A;  2UV1 A;  4BQQ A;  3OJW A;  1N78 A;  4FK8 A;  4R1H A;  2WPD A;  1Y0R A;  2HDC A;  3F8B A;  1FIA A;  4M1K A;  1D2E A;  3GW2 A;  3GFI A;  4AUX A;  1G3T A;  2LRE A;  2VZL A;  3CME I;  3VMV A;  3CO7 C;  4YG2 F;  2LDU A;  3Q5F A;  1T6Y A;  4EJV A;  1K61 A;  2K9N A;  1QRC A;  2GXG A;  3W2A A;  4BAC A;  1JUS A;  3TO6 A;  5K5R A;  3HRM A;  1JB9 A;  2HXI A;  4HA8 A;  1J2X A;  4AC0 A;  5LEK A;  5K7Z A;  4ZDP A;  1WP6 A;  2ZIT A;  4X7C A;  5HLH A;  4ZV4 A;  4ZCM A;  4C3I J;  2DA1 A;  3ONQ A;  4PCQ A;  3I55 B;  4C43 A;  1UD6 A;  4AC9 A;  1GAW A;  1UD8 A;  2EIK H;  4JBA A;  5JR3 A;  3CTA A;  3UR3 C;  1L1I A;  1KK3 A;  3E3V A;  3H35 A;  4BHB A;  4HE6 A;  4KIG A;  2TCT A;  1MGT A;  4G7H F;  1XGN A;  1UCR A;  3W6V A;  4IJA A;  1JTA A;  5THX A;  2WJY A;  1TQI A;  2KT0 A;  3MMY B;  4EJW A;  4HDV A;  2VBX A;  4P5O A;  4KYW A;  4EJO A;  2Z2S B;  1K28 D;  2EA2 A;  3QPS A;  1I5Z A;  1BBY A;  2DFE A;  4NB5 A;  1ZG5 A;  1WJD A;  2LRD A;  3PFI A;  1E0E A;  3BR5 A;  2EFW A;  2QA4 I;  3V7A A;  2BE5 F;  2E2J J;  4NBQ A;  4LJZ F;  5H20 A;  3ZBT A;  3A1P A;  4BHC A;  2DET A;  3R60 A;  1FC3 A;  3CC4 I;  4CHU A;  1R1T A;  3EUA A;  3FDY A;  1IGN A;  3H92 A;  1IB0 A;  2R5Y B;  4M3G A;  4L18 B;  2FEZ A;  3RKQ A;  2VQG A;  2YWG A;  2IRF G;  1BA5 A;  1BLI A;  1D1N A;  3D1N I;  2OQR A;  5BSX A;  3KP3 A;  1Q1V A;  2B9S A;  1GR1 A;  5IOZ A;  2QZ8 A;  4ON0 A;  4UV9 A;  2Z5U A;  5FGM A;  3BG3 A;  3OYE A;  1EP1 B;  4QUZ A;  2QMU A;  1EFU A;  1R00 A;  4PGH A;  1T6X A;  1DPU A;  4HE5 A;  2NS8 A;  1X4P A;  1P4X A;  3KE2 A;  5DD4 A;  1OGM X;  2ESH A;  4UUT A;  2M34 A;  3REO A;  4A3M J;  2OCE A;  1WSV A;  2X6O A;  1MDM B;  4NHJ A;  4E7J A;  3F6O A;  3RIR A;  1WH5 A;  2BGC A;  4P96 A;  3DFG A;  4MXN A;  2J5O A;  2K4B A;  2ZKZ A;  3W2W A;  4ZYG A;  3G73 A;  3S2D J;  1WPC A;  3CJN A;  3BR3 A;  1HLV A;  2GRE A;  3EYI A;  2HDW A;  2NSP A;  2PMH A;  4RDL A;  4EM2 A;  4E0F A;  5FKL A;  4U49 A;  2VJI A;  3IUO A;  4M72 A;  1VQ8 B;  3EUH C;  5FKN A;  1U2W A;  3QYB A;  3JTG A;  1VFC A;  1MNM C;  5TR9 A;  3OYK A;  1MSF C;  2LMD A;  2Y2Z A;  5L3D A;  4XRF A;  3RPU A;  1OQY A;  1H88 C;  4P9S A;  1MIJ A;  2DDA A;  2HR3 A;  4IHV A;  2KIF A;  5B1B H;  5HZB A;  3FXM A;  3KP6 A;  1XSX A;  3K69 A;  3C7J A;  4AID A;  5LHG A;  3JRB A;  2H27 A;  4HPQ A;  5GTH C;  1QUE A;  1OR7 A;  1WJB A;  2VJ4 A;  4HX8 A;  3PFY A;  4QWQ A;  2BSP A;  1ZH5 A;  2GXB A;  3GQB A;  4Z05 A;  2RV8 A;  5A2Q Z;  4OAZ A;  4I84 A;  1P4A A;  5EZG A;  3OYA A;  1IRG A;  1LFB A;  4NDL A;  2JQ7 A;  3OSF A;  3HGG A;  2LY1 A;  2KDZ A;  4BQO A;  3SFI A;  2E1C A;  3ZIA A;  2LG4 A;  2XIG A;  4HAM A;  3COA C;  4LB6 B;  2B0L A;  2HXO A;  5EEA A;  3FHN A;  3WBK A;  4N0B A;  2EWE A;  3OEE A;  2JK3 A;  4ANJ A;  1VHE A;  1QQI A;  1RIO H;  2Z33 A;  1T6S A;  2AHQ A;  4HNT A;  3E6D A;  5IYW A;  2X6W A;  4G9Y A;  2DMT A;  4EEF G;  2OBR A;  5ILV A;  5EZH A;  4IRH A;  1TWA J;  2KPM A;  4YEL A;  4W8T A;  2YR2 A;  2XEX A;  3S16 J;  3SHF A;  3SEQ A;  2HS5 A;  1R5B A;  2ZXI A;  3D5S C;  1BMF A;  3G05 A;  1ZEL A;  2HDD A;  1R7J A;  5L3E A;  4G8X A;  3E5Q A;  2Q0O A;  3PUF A;  3CCQ I;  1KTW A;  3DDY A;  1QU3 A;  5AIQ A;  2NOJ B;  1VHO A;  5JLW A;  4RD0 A;  2NTP A;  4KKU A;  2V6C A;  2QF7 A;  2VPL A;  3AK5 A;  1XCV A;  3GEZ A;  4RDU A;  2M9H A;  3LSP A;  3K7A J;  3KYD B;  2FML A;  3LAJ A;  3T5X A;  2O8X A;  3ZPP A;  4FIS A;  2COB A;  4IRG A;  2VE9 A;  2Y0M A;  4KFC A;  1U6G A;  4XRS A;  3K70 C;  2EBI A;  1IJE A;  1T08 B;  4B09 A;  5D4R A;  4A3B J;  2VQC A;  3KEY A;  3RYR A;  1BPL A;  4L9J A;  2XGD A;  2XRL A;  2IQ7 A;  1A5J A;  1W7P D;  3I55 I;  4Z2Y A;  3CMA I;  1OCT C;  4WZT A;  1MKM A;  3CJR B;  3JRA A;  4BAY A;  2P7C B;  1P6R A;  1L3L A;  1T98 A;  3C3W A;  2CQQ A;  2ZFW A;  4AF6 A;  2BV6 A;  2QWW A;  4PJL A;  3TOB A;  1XCB A;  4P12 A;  1QG0 A;  1D0Z A;  1H0M A;  4YAF A;  2W6J A;  4ZCI A;  4HF0 A;  1I27 A;  2EWN A;  2N8G A;  2PG4 A;  3LQQ A;  4MR0 A;  3G1O A;  3BY1 A;  2BYV E;  5DTD A;  2ZTN A;  1IN8 A;  2MFZ A;  4BQA A;  2V7W A;  3TKY A;  1U0J A;  2D2W A;  2IBD A;  1Y1W J;  3BG7 A;  2GJR A;  3QFC A;  3OZW A;  1K6O A;  2O1D A;  1JUM A;  1SFX A;  2ZBU A;  3BR0 A;  1BN8 A;  3ASN H;  3ZSC A;  3QPL A;  1W5T A;  3C2G A;  4Y15 A;  4ZH4 F;  4LLN A;  3CCS B;  4XKW A;  4O5V A;  1DP3 A;  1F9N A;  2NT6 A;  1K7A A;  4MYT A;  3A0B C;  2JA2 A;  3WGG A;  3OS2 A;  4BEH B;  2XNC A;  2XAU A;  4HQM A;  3SUC A;  1IJF A;  3D26 A;  3L2W A;  2IGO A;  1I6H J;  3LSI A;  4YZQ A;  4JP0 A;  1FOW A;  1F36 A;  3H0G J;  3CZ6 A;  4UNO A;  1B1B A;  2FNA A;  3GTG J;  3HUG B;  1CLW A;  2ZXW H;  4OOI A;  2ID6 A;  3F8M A;  2RGV A;  3FK6 A;  1YFH A;  3MZY A;  2QLZ A;  2PIA A;  4KT6 A;  1ORK A;  3J81 K;  1VQ5 B;  4RMN A;  4A6E A;  3BTJ A;  1YW8 A;  2IA0 A;  3TBI A;  1P92 A;  3BZK A;  5CVU A;  3BG5 A;  2CUE A;  4AYB N;  5F1R A;  5E18 F;  1OB2 A;  2O03 A;  2R5Z B;  3GRH A;  2B0R A;  1VND A;  4OIN F;  1MRZ A;  1R36 A;  1BI2 A;  2VYQ A;  2IA2 A;  2Z3Y A;  2PX9 A;  1O8K A;  1LE8 A;  5H6R A;  1KU9 A;  4L0Z B;  4OIR F;  1FYM A;  1TL8 A;  4IQJ A;  2GQF A;  2PYG A;  4IXA A;  3GWZ A;  1RNL A;  3RQI A;  3OZU A;  2V6E A;  3TW7 A;  3WTS C;  1TWC J;  2XC7 A;  4W97 A;  2DBB A;  4XL9 A;  2DJN A;  2XAH A;  1R22 A;  1UB9 A;  5KSW B;  3GVJ A;  1I3Q J;  4P25 A;  1GO2 A;  4G1B A;  1FPQ A;  2V5I A;  4RB2 C;  3RKX A;  3RKW A;  4RM0 A;  5B66 C;  1E2X A;  4TMT A;  5EG0 B;  4O3M A;  3PA1 A;  3ERM A;  2BSA A;  1E64 A;  5K7F A;  2LBF B;  3B82 A;  2HFH A;  1KCD A;  3OYC A;  2VFP A;  2VFQ A;  1EKE A;  2X3U A;  3AVV A;  1KK1 A;  2XAF A;  3H09 A;  1Z67 A;  3I4M J;  3I59 B;  2H94 A;  1EA3 A;  1O3T A;  3T56 B;  4DNR B;  1QHH D;  3DKY A;  4D5C A;  3WNB A;  3DPL C;  3QYF A;  4CH7 A;  4H4K C;  2JA8 J;  1UD2 A;  2KIU A;  5K5O A;  5GAE J;  5BQT A;  2HQA A;  3KP5 A;  3HOS A;  4XID A;  1X0C A;  3RPQ A;  1Y0N A;  1A8P A;  5C4J J;  4F91 B;  1QA6 A;  4XQF A;  1D8K A;  1GHC A;  5E1X A;  3R6S A;  4P9U A;  5DM6 F;  1KMH A;  2CS3 A;  1HKT A;  1LPQ A;  3VYS B;  5JVT A;  3KEQ A;  1VF9 A;  5M3F J;  4AM3 A;  3SJZ A;  4FWT A;  3SEJ A;  3BH6 B;  3TO9 A;  3ZMT A;  1PJR A;  3ECH A;  2EFG A;  4I99 C;  3WE3 A;  1UHW A;  5J8C A;  1HXD A;  1A04 A;  2A5W A;  4BJ6 C;  4RM2 A;  3HRU A;  2D3N A;  1BIB A;  3TED A;  2DMU A;  3KP2 A;  4GXO A;  3T0Y A;  3CCJ B;  1YIJ I;  2K5C A;  4S04 A;  3K6G A;  1RKT A;  2F5D A;  1BR4 A;  1MBK A;  2E34 A;  2FBI A;  1IRX A;  5L3B A;  2QTZ A;  2HCJ B;  3SZT A;  3WGH A;  3LMM A;  5D5V B;  2BGI A;  3T8T A;  2L7Z A;  2UVE A;  5HLG A;  2E7W A;  2OF7 A;  4G7Z F;  2HEO A;  1ELO A;  3BPV A;  2L9N A;  2Y9Y A;  2A61 A;  4PJ0 C;  5FL7 A;  2EFQ A;  4LBW A;  5CQG A;  1RI7 A;  3RPU D;  4BQN A;  1NG6 A;  3QRF F;  5J1Y A;  3JW4 A;  2P4W A;  1R23 A;  2QGU A;  3DEE A;  2FX0 A;  3FMR A;  4QVA A;  1BOA A;  1X1P A;  2FQ3 A;  2CK3 A;  1G2H A;  2YU9 J;  1WOP A;  5ED4 A;  2WZP P;  1QFJ A;  1S4M A;  1XMK A;  3G6E B;  3OIO A;  2ADU A;  1OOC A;  3W3C A;  1O8F A;  2PI0 A;  3S32 A;  2QCO A;  3TQN A;  2P5L C;  2ELJ A;  1QZZ A;  2H8W A;  2QVO A;  4BBS J;  2DK8 A;  2BHZ A;  3VOE A;  1WPK A;  1G3W A;  4EQQ A;  2HOS A;  3G1M A;  1ETV A;  2DIE A;  1QCX A;  2BX6 A;  3V8J A;  4EJU A;  4OOV A;  4ZGQ B;  5IYR A;  1I8D A;  3AGQ A;  1MJA A;  3C1D A;  4BHP A;  1NK3 P;  2Z8G A;  4Y17 A;  2K3P A;  2LFB A;  2PQ8 A;  1TYX A;  2D1H A;  2XVC A;  1YS7 A;  2BVL A;  5E1Z B;  1N77 A;  4WZE A;  4LLG F;  2FOW A;  2JVG A;  2LTP A;  2JA5 J;  1N07 A;  3CC7 I;  4N3G A;  1P9Q C;  3GZ6 A;  2EFO A;  1SEU A;  3E6M A;  5DDG A;  4I09 A;  2DT7 B;  4DGW B;  2F4O B;  3MWM A;  3WU0 A;  3MZH A;  1YG2 A;  4HW0 A;  5TJJ A;  2E1M C;  3V8L A;  1T56 A;  2DT5 A;  2GXA A;  3U21 A;  4YIR X;  2WR8 A;  2XT2 A;  3N4M A;  4AIH A;  2XRN A;  3A1Y A;  3CDL A;  3JRC A;  2BXZ A;  1IV6 A;  1M1K D;  5IT3 A; 
#chains in the Genus database with same CATH homology
 3J7A Y;  2M4K A;  3DPU A;  1GQ8 A;  2BOL A;  2R7X A;  4DNT B;  1CZF A;  4NC7 A;  3ZRG A;  3PUB A;  1PXZ A;  3KYL A;  5DN6 A;  5TGT A;  4DIQ A;  2QX3 A;  4ZYA A;  3HOT A;  1VJS A;  5HVQ C;  3T9G A;  4BE1 A;  4IZZ A;  4B47 A;  1OB0 A;  5HOO A;  2KHM A;  4B44 A;  1PE9 A;  1DGR M;  1S9H A;  2LYC A;  3DKX A;  5HNF A;  1UAA A;  1RMG A;  2GOX B;  3GBG A;  1UEL B;  4ASU A;  4XN3 A;  2R7R A;  1VZ0 A;  4P1W A;  3PNT A;  4D1Q A;  1BOB A;  1V5G A;  4YEJ A;  3FBN B;  1PKV A;  2KZV A;  2R7S A;  2O17 A;  3DU6 A;  1MAB A;  2VXD A;  3PSI A;  1Z3Y A;  1WJC A;  2ODL A;  1YX5 A;  4HG2 A;  2VXZ A;  2CH0 A;  4AYB A;  1DQU A;  2L9S A;  1IDK A;  3OS1 A;  3GQA A;  2R7W A;  1W0J A;  1BR2 A;  4PJJ A;  3OFN A;  3BC9 A;  2DT6 A;  2X85 A;  1X1C A;  2W00 A;  4YRV A;  5FRM A;  3GVL A;  5IK2 A;  3OYG A;  2Q2E B;  3KX2 A;  2KRC A;  3T51 B;  1BR1 A;  3HKZ A;  3L2U A;  1D1A A;  3RCO A;  3SEZ A;  1SFK A;  2V4J C;  4ZDL A;  3OOC A;  4BE2 A;  1PYV A;  4CCO A;  2BW3 B;  2ZZF A;  3BH4 A;  4PJM A;  3OE7 A;  4XNF A;  4G7W A;  4BU2 A;  3MKW B;  4J00 A;  3VYT B;  4E7L A;  3UW0 A;  1FMV A;  4U87 A;  2V4D A;  3ZR8 X;  1O8H A;  1D1C A;  1YX3 A;  2RNG A;  3VMW A;  1MMG A;  3S3O A;  2Q1Z B;  3S3N A;  3S3M A;  5KHD A;  4OZY A;  1LDK B;  3H94 A;  1WJF A;  3K4J A;  1NG7 A;  5FRO A;  2WJV A;  3BG6 A;  3VWB A;  3BCD A;  2UV1 A;  5FRN A;  2PEC A;  3H5N A;  2DJI A;  1MMA A;  4BQQ A;  2IS2 A;  1NHC A;  3OYF A;  3S93 A;  1V5F A;  4II3 A;  1N78 A;  3FKJ A;  4II2 A;  1MND A;  4LG3 A;  2WPD A;  3OYM A;  2VIX A;  2WY7 Q;  3OEH A;  4XLF A;  1LVK A;  2KVO A;  1N75 A;  4NK8 A;  2XOK A;  3FPP A;  1RU4 A;  2LRE A;  1Z3X A;  4HST A;  2LY2 A;  3VYU B;  4KIT B;  4NNJ A;  3VMV A;  4N4O B;  2Z1D A;  4U4B A;  4FET A;  4TKO B;  2VQH A;  3W2A A;  3OYL A;  2VBE A;  2E5Z A;  4BAC A;  4CCK A;  2KDO A;  3CP2 A;  2LC2 A;  4FXU A;  2DOA A;  1WP6 A;  4ZDP A;  3WWG A;  1XG2 A;  3QOD A;  1O8G A;  3OY9 A;  3ONQ A;  4BL0 B;  3LSH A;  1ERD A;  1UD6 A;  2O5R A;  1UD8 A;  1HZE A;  2GK7 A;  3UR3 C;  3GQ7 A;  5LD2 C;  3H35 A;  4DJA A;  1O8L A;  3ZQQ A;  5C1C A;  1DGW Y;  3DTK A;  3RTR A;  4PSW A;  1JTA A;  1O88 A;  4BUP A;  3HAG A;  2RRE A;  2I8D A;  2ZZQ A;  1I18 A;  2HNH A;  2WJY A;  3MMY B;  4CCN A;  4P5O A;  2IS6 A;  2XND A;  2Z2S B;  1K28 D;  1DBG A;  1MNE A;  1WJ5 A;  2K9L A;  3L2R A;  2JVH A;  4XKB A;  1WJD A;  2LRD A;  1E0E A;  2CMP A;  4B48 A;  2XF7 A;  3FY3 A;  3G2B A;  2WSS A;  1SAU A;  3MD2 A;  3PL8 A;  3E0J B;  2W4S A;  3SYT A;  2JJ2 A;  2ZSH B;  5CPR B;  3LL7 A;  2L5Q A;  2X1C A;  2XF6 A;  3EUA A;  3K4K A;  2MAB A;  3FDY A;  3ZGK A;  1PLU A;  3SDB A;  4XMY A;  3WQZ A;  3OR1 C;  4XLE A;  3A4C A;  2VQL A;  4LIU A;  2KP6 A;  3OW7 A;  4YXW A;  3TL4 X;  2VB6 A;  4J01 A;  1EE6 A;  3TMO A;  3RQ4 A;  2VQG A;  3GQ8 A;  1VLY A;  1BLI A;  3AL0 C;  2MYS A;  1COW A;  2ZZE A;  1T5E A;  1UD4 A;  1K5C A;  4IX7 A;  3IAM 2;  4JMQ A;  3NE5 B;  3OPO A;  2Y0S A;  3OYE A;  1OFM A;  1WJE A;  3K10 A;  2HVQ A;  4ITV A;  4PUS A;  1X19 A;  4XLA A;  2DXI A;  5HKK A;  1QJV A;  3B4N A;  1X4P A;  3L2V A;  3RSN A;  1OGM X;  3CF2 A;  3DPT A;  1E3X A;  3AL0 B;  3KRG A;  1LFP A;  4OJ5 A;  4F55 A;  4E7J A;  4BGD A;  2VKD A;  4PMH A;  1WFX A;  2JSP A;  4MXN A;  4URR A;  2CFO A;  1KON A;  2F4I A;  3W2W A;  1WPC A;  2GK6 A;  1HA8 A;  1EFR A;  4LIV A;  2HDW A;  2NSP A;  4HIZ A;  4E0F A;  3H9J A;  4ZDO A;  4U49 A;  2VJI A;  3IUO A;  4CCL A;  1W9X A;  4EW9 A;  3EUH C;  4RLQ A;  2WY8 Q;  3QYB A;  3VSK A;  4KKT A;  3K4M A;  1IDJ A;  4OJP A;  2MD0 A;  3K4N A;  4CUG A;  2IGN A;  3OMY A;  4CCM A;  2NST A;  1JRG A;  4C9Y A;  1X1D A;  3OYK A;  4BS9 A;  4DBQ A;  4C2U A;  2F1M A;  2AQE A;  4YZ0 A;  1YE9 A;  1GLN A;  3BCA A;  1KCC A;  3OIQ A;  4XR6 A;  3D5L A;  2X1D A;  2CV1 A;  2X8K A;  3K4C A;  4HPQ A;  1WJB A;  2VJ4 A;  2X1E A;  3PFY A;  4XLC A;  2BSP A;  3GQB A;  1T0F C;  4Z05 A;  4OAZ A;  1NBM A;  4I84 A;  2HU9 A;  2F6C A;  3OYA A;  2KLO A;  1T95 A;  1OR7 C;  2NT9 A;  2LY1 A;  4HEA 2;  4Z06 A;  1IA5 A;  3I3L A;  4BQO A;  4IKF A;  3ZIA A;  2LG4 A;  4BXF A;  4AU7 A;  4ZTJ A;  3B8Y A;  4OZZ A;  3FHN A;  2HVR A;  1O8E A;  2F5V A;  2EWE A;  3OEE A;  4ANJ A;  2INV A;  4W8Q A;  3EPZ A;  1G8X A;  3E1S A;  1MMD A;  1D0X A;  4HNT A;  3IAS 2;  4PK4 A;  2X6W A;  2UVF A;  1W0K A;  2KPM A;  4YEL A;  4Y4R A;  2QE7 A;  4W8T A;  1HVX A;  4JOM A;  2X3H A;  3SEQ A;  1O8J A;  3BCB A;  3VST A;  2M3A A;  4XM3 A;  3OYI A;  2QXZ A;  2OV7 A;  2ZXI A;  2ZXH A;  2WA0 A;  3D5S C;  3OYN A;  2XZP A;  4XKC A;  5HNH A;  1BMF A;  3G05 A;  3LNN A;  1ZEL A;  4P22 A;  1KTW A;  2XZL A;  3DDY A;  1QU3 A;  1WTH D;  5KCM A;  3OAA A;  3DU5 A;  2VAS A;  3HPG A;  2NOJ B;  1NRK A;  3EQO A;  2NTP A;  4KKU A;  3PJR A;  2VPL A;  2WB1 A;  3AFH A;  2NZM A;  5LFA A;  2OUM A;  3V42 A;  2R7O A;  1Y6I A;  2UUZ A;  1MMN A;  3ZCO A;  2JJ1 A;  3ZPP A;  4E7S A;  2VKH A;  4X0G A;  4NK6 A;  3K70 C;  2R4G A;  2VJ5 A;  4BDZ A;  1BPL A;  3FKS A;  1LKX A;  2VQC A;  2VJJ A;  3KEY A;  1E1Q A;  1E1R A;  3HG9 A;  4KKS A;  2IQ7 A;  2BVM A;  3H9Q A;  4Y33 A;  3H5R A;  4E7I A;  1E3Z A;  2MC4 A;  2M0M A;  3CJR B;  4XOR A;  4AVZ A;  4TT3 A;  4DK0 A;  1OFL A;  4NQW B;  3QOE A;  4XOT A;  3VYR B;  3W2V A;  3H0D A;  4W8S A;  3NWS A;  3K70 D;  2R7T A;  4D9J A;  3OL4 A;  3I9V 2;  4PJL A;  2IS1 A;  2QY1 A;  3LMW A;  1D0Z A;  2IGM A;  4F93 B;  2VLA A;  1W36 D;  2W6J A;  4PFO A;  4BJ5 C;  4ZTF A;  1AA7 A;  4GQN A;  4KJZ A;  4F52 A;  4N4N B;  4E7H A;  4B3F X;  4MR0 A;  4CZC A;  2ZTN A;  2MFZ A;  2R7V A;  1U0J A;  3OYJ A;  3DTI A;  4OJL A;  2LBF A;  3BG7 A;  4HWV A;  2LOO A;  4DOZ A;  2GJR A;  3A3G A;  4IQ4 A;  2PYH A;  2M7B A;  2O1D A;  3A3B A;  2CW8 A;  2ZZG A;  3CJQ B;  2ZFU A;  2XSJ C;  4C30 A;  2X53 S;  1BN8 A;  1WMR A;  4CSW A;  1Z21 A;  4TSF A;  4G6T B;  3ZSC A;  3C2G A;  1AIR A;  2KMU A;  2JUG A;  2CUZ A;  4HRI A;  2WAE A;  4XKW A;  4OWR B;  1DP3 A;  1FX0 A;  1V0E A;  3VSL A;  2NT6 A;  3OL3 A;  1O8D A;  2W7N A;  2JA2 A;  4BJT A;  3OS2 A;  2R7U A;  2NTB A;  4BEH B;  5JHF A;  2XAU A;  3SUC A;  3N05 A;  4G7X A;  3L2W A;  2IGO A;  4E4H A;  3LSI A;  4YZQ A;  3OOU A;  3OYB A;  3CZ6 A;  2OC6 A;  2INU A;  2O0W A;  5CQE A;  3HUG B;  2ZSI B;  4DK1 A;  1G59 A;  3D5R C;  1W36 C;  4NC8 A;  1OGO X;  4KT6 A;  3VDX A;  4C2T A;  4RMN A;  2IXS A;  3L2Q A;  3TBI A;  1D0Y A;  1OLT A;  4NUB A;  4XON A;  4YZX A;  1VBL A;  3GRH A;  2A6T A;  2V26 A;  3QYE A;  3T53 B;  3LSK A;  1O8K A;  1R6R A;  1Y56 A;  2KL4 A;  2ZTG A;  4HNU A;  2F43 A;  1E43 A;  3A2K A;  1SKY B;  1X1A A;  4FAS D;  4IQJ A;  2PYG A;  2R9V A;  2V31 A;  2PJR A;  2PMZ A;  3FBI B;  2Z16 A;  2V6E A;  2W82 A;  2GJP A;  2V1N A;  2WAD A;  2XC7 A;  2P0W A;  3MKY B;  2IS4 A;  4MLO A;  4XL9 A;  3M1C A;  3M8J A;  3GVJ A;  3VR6 A;  1WJA A;  3PSF A;  2NTQ A;  1O8I A;  4E7Z A;  1QHG A;  4RM3 A;  2HVS A;  2QKL B;  2XZO A;  2XF5 A;  3EUK L;  2LBF B;  1KCD A;  1UG0 A;  4KIS A;  3OYC A;  3BLY A;  1X4O A;  2BW3 A;  2X51 A;  4BE0 A;  2HLD A;  4B3X A;  3LSG A;  4B43 A;  4YZA A;  4CCJ A;  3JU4 A;  1EA3 A;  3T56 B;  4DNR B;  1QHH D;  3F9K A;  1X1B A;  2RQQ A;  3DKY A;  3HC7 A;  2JIZ A;  5CDF A;  3DPL C;  3QYF A;  4CH7 A;  4H4K C;  2X6Y A;  1UD2 A;  2GJK A;  1OHH A;  2HQA A;  4F3Q A;  3HOS A;  2W6I A;  2M4G A;  1X0C A;  3GQ9 A;  2XDV A;  4F91 B;  4HSR A;  4G6I A;  3PNV A;  4DBR A;  3BC8 A;  4XQF A;  2E5N A;  3OYH A;  3DTE A;  1DBO A;  3SZG A;  1KMH A;  2CS3 A;  3OR2 C;  2VBK A;  3OWT A;  3VYS B;  2KQR A;  1TZL A;  1MW7 A;  1Z7L A;  4XN0 A;  3H9G A;  3BCF A;  2CUJ A;  2QKM B;  2R7Q A;  1PJR A;  2WAF A;  1H80 A;  2E60 A;  1D1B A;  3B90 A;  4C2L A;  1H8H A;  2A5W A;  4PJN A;  4BJ6 C;  5AMV A;  4RM2 A;  2D3N A;  4E7K A;  1K6Y A;  2K5C A;  3K4B A;  4XOP A;  2L7K A;  3K6G A;  3CMM A;  3HXL A;  1J09 A;  2LH9 A;  1BR4 A;  3OYD A;  2V7Q A;  4UZU A;  5HLT A;  1IRX A;  4Z03 A;  3CES A;  3ZXS A;  3LMM A;  3HPH A;  2CV0 A;  2UVE A;  2O04 A;  4PSX A;  1V5E A;  2L9N A;  2VBM A;  4U7B A;  3GVK A;  5FL7 A;  3LSM A;  3HL2 A;  2JDI A;  2GOM A;  5CQG A;  3RPU D;  4OJO A;  4BQN A;  1NG6 A;  1E79 A;  2V7F A;  2AQF A;  2CV2 A;  4Z1M A;  2V9K A;  2XGJ A;  3AKZ A;  2K9M A;  3DEE A;  4PFP A;  2UWM A;  2LZJ A;  4GRI A;  2CK3 A;  1BHE A;  2HPI A;  1TT0 A;  4L8J A;  4XLH A;  3A35 A;  2WZP P;  3IP4 B;  2WAQ A;  4BEH A;  2X6X A;  3VSV A;  3KEW A;  4ZC3 A;  3DLA A;  1OOC A;  2HZD A;  3W3C A;  1O8F A;  2O0V A;  3S32 A;  4W8R A;  3C2H A;  2E1M B;  2ELJ A;  2IGK A;  3NWT A;  3UNG C;  2Z6B D;  3MKZ A;  3DWL E;  3K4L A;  4OJ6 A;  5CKT A;  2L2O A;  3PNY A;  3VSU A;  2DIE A;  1QCX A;  1IB4 A;  4E6K G;  5C1E A;  1H8E A;  4F92 B;  2CW7 A;  1I8D A;  4RLF A;  1UD5 A;  4ZJZ A;  4BDY A;  2VL8 A;  1UD3 A;  2M7A A;  1JI8 A;  1RWR A;  4Y3O A;  3DQV C;  1KZL A;  2K3P A;  2Z8G A;  3JUR A;  2M5S A;  4CA0 A;  1HG8 A;  2BVL A;  3CP8 A;  2WBM A;  1N77 A;  4JQF A;  3H5A A;  2JVG A;  5KNL A;  4R79 A;  3OIP A;  4QPQ A;  4XD7 A;  1P9Q C;  4QPO A;  1V0F A;  3ZPN A;  3LFU A;  2PJR B;  2DT7 B;  3OS0 A;  4DGW B;  4LIT A;  2HPM A;  1VF7 A;  1O8M A;  2DCE A;  2E1M C;  2W1O A;  2KRH A;  1FMW A;  2FUG 2;  3EQN A;  3U21 A;  2E1B A;  2D3L A;  4B3G A;  4OAY A;  3A1Y A;  3S8P A;  4EAT A;  4XKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...