4YELA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
total genus 228
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yelA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yelA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yelA02
1XG2A 4I84A 1QJVA 4XLFA 1X0CA 2QX3A 2INUA 1OOCA 2ODLA 1RWRA 2PYHA 5C1CA 4XKWA 1DBGA 4XOTA 3VSTA 1O8DA 2NTBA 1IDKA 4W8SA 1O8JA 1KTWA 1OFLA 4URRA 5C1EA 4U4BA 1O8LA 2Z8GA 1O8IA 3WWGA 4AVZA 1WMRA 2NTQA 4XORA 2NSTA 2NZMA 4C2LA 4OZZA 3GQ9A 1RU4A 2VBKA 4Z03A 2O1DA 1O8EA 1O8MA 4YZQA 4YEJA 4XLEA 2NT6A 4MR0A 4XLHA 4W8RA 3GQ8A 4OZYA 4XQFA 3VSVA 1K5CA 2VBEA 2O0WA 3VMWA 1O88A 1NHCA 3T9GA 2INVA 1HG8A 1RMGA 3B8YA 1VBLA 4YZ0A 3LMWA 4OJOA 1CZFA 1OFMA 3VSUA 4XLAA 2UVEA 3UW0A 1PXZA 2NT9A 1EE6A 2X6YA 2VBMA 4PMHA 1O8HA 4XN0A 5AMVA 1H80A 2O17A 2UVFA 1O8FA 1AIRA 4YZAA 1JRGA 1KCCA 1QCXA 2VJIA 4XR6A 4MXNA 4NK8A 3GRHA 4W8TA 1OGOX 1PLUA 1GQ8A 2EWEA 4Z06A 2X6WA 4Z05A 3ZPPA 4XL9A 4XM3A 3GQAA 4OJLA 4NK6A 2O04A 3ZSCA 4XONA 2NTPA 1O8KA 4YZXA 2QY1A 2O0VA 4YELA 1JTAA 4XN3A 2X3HA 2BSPA 3KRGA 1BHEA 3VMVA 4XMYA 3JURA 4OJ6A 3EQOA 1IA5A 2VJJA 3FY3A 4XKVA 3B90A 3SUCA 2PECA 1KCDA 2IQ7A 3B4NA 4XOPA 1IB4A 1IDJA 4OJ5A 4W8QA 1DBOA 2X85A 4XLCA 1OGMX 2QXZA 1BN8A 2NSPA 1PE9A 3EQNA 4HWVA 4OJPA 2X6XA 4EW9A 4U49A 4XNFA 1O8GA 2PYGA 3GQ7A
chains in the Genus database with same CATH superfamily
4PC1A 1BX1A 2VZLA 4U0YA 3BT9A 1BX0A 4JK1X 1P4AA 4C43A 2CYYA 3I71A 4KIFA 1M1EB 5L3EA 4C3JJ 1ETVA 3LWFA 4RGSA 3ZPLA 1N78A 4B4DA 2OQGA 3TOBA 2XGXA 4BAYA 3LQEA 3GFMA 1KQ0A 2EZIA 3BTCA 3M8JA 2Q0OA 3R4KA 3KP2A 4WWCA 2L9VA 2ME0A 2LDUA 3HRMA 3TQNA 2WC2A 2W1OA 4HDUA 1VQKI 3WBJA 1LFUP 3RYPA 4BPRA 3HTUA 3BR0A 1SANA 3GVAA 2JDIA 1QQIA 3OY9A 1D5VA 1CNFA 3BDDA 1FYKA 1IJFA 2PQ8A 2GIVA 1U8RA 3BJOA 2VKDA 4EJVA 3B6AA 3KFWX 4OZYA 2L7FP 1WOOA 1HW2A 1AOYA 1YX2A 4IHSA 3F8CA 3CJTB 4QTRA 1XGSA 2ADUA 3DV8A 2ZITA 1JUSA 2F6CA 2F5DA 3VSKA 3HXLA 4UY8I 2WJYA 1RZ4A 1YI2B 4KT5C 3Q6RA 4YHBA 4Z4YA 3VR6A 2V1XA 3COAC 3RQIA 4ZYDA 2C78A 1IXRC 1SMTA 3RDIA 3U2QA 5FKLA 5EYRA 2NAZA 3BTIA 2HOEA 4DK1A 5J35A 1IHMA 1OCPA 3F23A 4BHBA 1PXZA 2NT9A 2BE5F 5F0CA 3H5RA 1ZK8A 3DFGA 4ON0A 1YO5C 1I6HJ 1W5TA 4J01A 3HIFA 1PKVA 3R61A 5L3BA 1YJ9I 3PUBA 4MEXF 3F3XA 1WJCA 1OFCX 2V7XA 3ML3A 2V7TA 1YIJI 1O8FA 4A3DJ 4ZYEA 2AXTC 3CJNA 1K6YA 1OGOX 4E6KG 4CCKA 1FPQA 1Q9SA 2IS1A 3T8RA 3E1SA 3F0CA 3Q9VA 1FSEA 3CMMA 4RB3C 5GV8A 4QSHA 5JHFA 1H85A 2QCOA 3ZSCA 5E20A 1XX5A 1I8DA 3OKXA 3A3GA 2BSAA 3JW4A 2KL4A 2QENA 3CUQB 4AVPA 1R00A 2DTRA 2WY8Q 1GXQA 2QBYA 5GAGJ 1JTXA 2YX7A 3OL4A 4BH9A 1I6XA 3JTGA 5K5OA 2MH2A 3BH4A 3VMVA 1OB2A 3I4MJ 3NAUA 2R7FA 3TH0A 1PUFB 4RPBA 3HOXJ 3QP6A 1S3JA 3TGNA 4L5JA 1MKMA 4DQ2A 2GQQA 2JK3A 4V02C 1TT5B 4KNYA 4MTDA 2DXIA 3IC7A 2P3MA 2NT6A 1DBOA 1EA3A 2ICWG 5EJCA 4MTEA 4AC0A 1KMHA 3JRGA 2YPRA 3WXMA 1LDDA 2PI0A 5GAEJ 1R49A 2NSPA 2OF7A 3BY1A 2D2WA 3EQNA 2QKMB 5DS0A 4I0AA 1XQBA 4UNOA 3FXMA 1OYWA 1D5YA 1DQUA 3ASNH 2X9DA 3G6EI 1YTYA 4HYEA 2ESHA 2Y9ZA 3WTUC 1VF9A 1EP1B 3I5UA 2LD5A 4L18B 3V7RA 2EFWA 3HUGA 3KYDB 3JQRA 3R6SA 1BW5A 3QWLA 2K9MA 2CO5A 3AG4H 3I59A 3QRFF 2QEXI 1XGOA 3H9QA 1FOKA 4KKTA 3GYHX 3HKZN 2XGJA 5GP9A 4AD9A 5IYRA 2XHKA 2XSDC 4P26A 4URRA 1T56A 5J8CA 3S15J 4WWVA 3R0JA 1OMIA 4DW6A 2R5ZA 3ONUA 1QHGA 3B82A 3H35A 4IXAA 1HKTA 3L2WA 1I39A 1UD3A 4X7CA 2NSTA 3SEQA 3FX3A 3NAWA 1K83J 1E63A 3OYHA 3BP8A 3G73A 2ELHA 3A4CA 1UHSA 3K4JA 2BW3B 3KP3A 1A6QA 2QZAA 4W8RA 2RC4A 3ZN0A 4CCLA 1MDMB 4RS8A 1KTVA 2O0WA 2CQKA 1RKWA 1X1PA 3H0GJ 4YFNF 3QFSA 4BDZA 1PUFA 3T9GA 1YRNA 3KZZA 1CF7A 3F8FA 4ZDPA 4RM3A 3FBIB 2ZKZA 2VE9A 4P1VA 3FM5A 3BY6A 2Y30A 4PJJA 3GLXA 5K5QA 3GTGJ 2ECCA 3I4PA 2ZZFA 4LJZF 3QP5A 4LLNA 2Y48A 3EDPA 3CC4B 3DBRB 1CQXA 1MMGA 5DEQA 2M87A 1VQ7I 4CYCA 2KZVA 4OIQF 1YW7A 2NPFA 2KMUA 3OMYA 4G7ZF 3PM1A 1V0EA 1SVLA 4KN7X 2NS7A 2Y31A 1AA7A 5DD8A 4Z2YA 4MGRA 1B9NA 3NE5B 1IXSB 4CCMA 4GRIA 4X07A 1N07A 1LLWA 5KCMA 3W2FA 3CC2I 4N4NB 3OS1A 1UD5A 3CCJB 2JRTA 4LLGF 1Z1DA 5KAFC 2MSYA 5H6RA 1SFEA 2HKXA 4LC0A 4I6ZA 1W7PD 4M3DA 4A0ZA 2NVTJ 3J81k 1ZKGA 1ZG1A 1IGNA 4M3FA 4EJTA 2DI3A 4WZTA 3ASSA 3S2HJ 2STWA 3FXRA 3KP4A 3GBGA 3KEYA 1VQLI 1IN8A 1Y0UA 3PSZA 3M9AA 1A5JA 1NG7A 3U6KA 2BY1A 3I58A 1N75A 3IRRA 4RD0A 3LAPA 4L8JA 2XB0X 4ZCIA 4UHTA 1MDMA 9ANTA 1RPWA 3Q0VA 1I50J 3G4SB 3ISPA 4MQVA 2E1CA 5LGNA 1QRBA 3ZR8X 3DPLC 4GFBA 1IB4A 2M3AA 2ID3A 1HW1A 3PIOF 3AVWA 1NHAA 2PJRB 1SFKA 5DD4A 1EH6A 4DNRB 1OR7A 3RCOA 1T08B 3LAJA 1OGMX 2OC6A 3TKYA 5FD6A 4IVNA 1FNMA 1UZCA 1UMQA 4ACAA 1O3QA 2VQGA 3LSGA 5JLWA 5H59A 1OCZH 1YYVA 4FE4A 5BOXA 4GYGA 2FEZA 4UB8C 1REPC 3S1QJ 3P27A 1DPRA 1OFDA 2PYGA 4FXUA 3K6GA 1IRZA 1W4MA 4X0GA 2IA0A 3LA3A 2PJPA 5EZGA 2BV6A 2KLOA 4ESFA 2Q6KA 2CJJA 4IRHA 2E71A 2F2EA 4LLLA 5FJ8J 3DU1X 3HYIA 4RDKA 1S7EA 5FO1A 2XF5A 2HVRA 1AMOA 2FNPA 2CF4A 1A31A 1YE9A 1ZYRF 2UUZA 3FDYA 3IWZA 4XORA 3S8PA 4X1EA 1LPQA 3HM5A 2DPUA 5FLVA 1MRZA 3WNCA 4NC8A 3RQ4A 5F0FA 2RV8A 2FU4A 1V5GA 3PSFA 1X3UA 5D5WB 3F72A 3W2AA 3LVBA 5AONA 3JAMZ 3FXKA 2CSOA 2ZL6A 1FT9A 1WVRA 1UG0A 1ERDA 2WAFA 2J5PA 3MN2A 4YIIA 4B09A 1JA0A 4BQNA 3WGGA 2FUG2 3H5AA 4C3IJ 2K4BA 1D3YA 1I3AA 2HVQA 4W97A 2PJRA 3CD6B 2BMWA 5DCMB 4HV6A 2W6IA 1TQMA 1VQ5B 3VSUA 2HTSA 2FBHA 1Z91A 3Q3AA 1TTYA 1NB0A 2O0YA 3BCAA 2OBTA 4MQ9F 2VE8A 2BHZA 3DLAA 3ZCOA 2VBMA 3DTIA 2GM4A 4PMHA 1T2KA 1KYWA 2HXIA 3C2HA 4C30A 2XVCA 5ERIA 4BJ5C 3RZOJ 3WGHA 4BHCA 2XAGA 1EFUA 3W5HA 1AIRA 2UVFA 4YZAA 2VJIA 4P6VF 4MXNA 2E1NA 4QVJA 4NK8A 3I56B 1QZYA 2WJVA 3R0AA 2QQ8A 4II2A 3VO2A 3A02A 1MH3A 1EF4A 2LREA 1TYVA 3RI4A 1F9NA 4NK6A 3JSPA 1D8TA 3IKVA 1Z9CA 2VOPA 1FTZA 4R79A 4UZUA 1BI0A 2L9SA 5TJJA 3CB4A 3BTJA 5F4MA 3PFIA 4B44A 4G7XA 3GZ5A 2FA5A 1QGYA 2XOKA 1QUEA 3HOWJ 4DGWB 4UVAA 2F5FA 3QU3A 3H09A 1I7PA 5B66C 4DBRA 2R7SA 1GJRA 4V2FA 2DT5A 4XMYA 2P4WA 4IL6C 5IYWA 4B3XA 2UZKA 1H9TA 2XKPA 3B90A 1MNMC 4W1UA 3RPUA 4IHVA 4KKSA 2VJ5A 4RLZA 2VNIA 2VPRA 2ZJRF 4C2UA 5JBQA 3K70D 4IW3B 4O3MA 4DQLA 3F8MA 1R7JA 3EETA 4G6DA 2VN2A 2V7WA 1JT6A 4M73A 4RB2C 2XB5A 3FPKA 2YX4A 2RGVA 1EFTA 3OIPA 3BG3A 3K1PA 4CCNA 2VT3A 4O6JA 3ABTA 5BQTA 1RKTA 3H92A 2CUZA 4PSWA 2I5UA 2GREA 1MJ9A 1IF1A 3KEQA 2ZFWA 3PA1A 1V3FA 1G7CA 1KONA 3CCSB 2XIGA 1D1AA 4KT6A 2ZJQF 2JJ2A 3QPLA 1WSVA 2JQ7A 2GA2A 2CBXA 3ZQHA 1VHEA 2IBDA 4EMSA 3Q3SA 2X48A 1EH8A 3BCDA 2HXOA 2ZFUA 2M7BA 1WPKA 3K9TA 4WZKA 4RB0A 1Y39A 3GF2A 4P55A 5K7FA 1JJ2B 4NDLA 2LMDA 2LF8A 3VSTA 2YR2A 4H4KC 1ZGJA 5LD2C 2NS0A 5ILVA 3K70C 3RZDJ 1IDYA 5KHDA 2VC0A 3CUQC 2NTQA 1BR2A 4PUSA 1R5OA 3CPWB 2R6HA 1U6GA 1APLC 2DETA 2RN7A 5LGUA 2LOOA 4YIRX 1RRJA 2HQAA 3M7GA 1JGGA 2WTEA 3PSIA 4FX0A 2JMWA 2ME6A 1NDHA 3BZ6A 4BY7J 4PZJA 4X06A 5FRNA 4AIHA 3E6MA 4Q47A 1YI2I 4LG0B 1BLIA 2FNAA 3LMMA 2JSCA 3TW6A 4C9YA 4E7HA 3GUDA 1WJAA 5HOOA 1T0FC 1OCOH 3DPTA 3U9GA 2ISZA 2HQ5A 1FEXA 1JKPC 3PSSA 3SDBA 2XV4S 3V7SA 1N0VC 1IXCA 1S6LA 3FXJA 4U7DA 5LMZA 3HOZJ 4OJOA 3SFZA 2GXBA 2L3DA 2X1EA 1QRYA 4X7FA 1F20A 2X53S 2L4MA 2GA1A 4HNVA 2W6JA 4AUXA 1FYMA 2EFPA 1Y0NA 1ZG5A 2ZB9A 3SFIA 2V9PA 5JLXA 4ZJZA 3S14J 1MMSA 3LSHA 4UUVA 3KE2A 1ETXA 4AWXB 2KRFA 4A5NA 5JFRA 1V5VA 3TL4X 3LNNA 4WXDA 1FOWA 3RJPA 3AVYA 3Q0WA 4OOVA 1TSPA 4W8TA 2OV7A 4RJLA 2V4DA 4RD6A 1T95A 2DDAA 1SC7A 1GVHA 4K1XA 1UMKA 1LE8B 3VO1A 1SD4A 1X4PA 3E6CC 4MO7A 1H88C 2J7KA 2NVQJ 1HW5A 2NTPA 3ZQIA 1B59A 4S05A 4RD1A 2R9VA 2IA1A 2CQ7A 2QM3A 1VQ9B 4EEFG 3A01B 1MNEA 2VYQA 1W36D 5HZAA 1HF2A 2E36A 3CQZJ 2LKPA 4LOCA 2DA3A 2O6GE 3ZRGA 2M4KA 1R4MB 4HOBA 1FDRA 2X0KA 1UD8A 1BHEA 3AVVA 3VNUA 1ULYA 1YQAA 2PN6A 3ROUA 1LB2A 4MEYF 3KLOA 4AIDA 4U87A 3L00A 1WOSA 1ZGAA 5F27A 1SFUA 2PIAA 4A3CJ 1OR7C 3CTAA 1ON1A 1T6ZA 1Z3YA 3K2AA 3HOUJ 1R5ID 2Q6LA 3BNWA 3ZN1A 2C5HA 4ZH4F 3PUMA 2C5BA 2IW5A 4RCZA 1WH5A 1WKMA 2D1HA 2HZDA 3P26A 3BH6B 1UHMA 4IJAA 4B3AA 2NVXJ 1FNNA 1R4NB 3FMRA 2MA3A 1WJDA 1DDNA 3CC2B 1R23A 4ZCMA 3CZ6A 4CH7A 3PNTA 2VBYA 1QH0A 1TP4A 2DA6A 2LYCA 1ORKA 3ERMA 2IXSA 4ESJA 1W36C 4RBOA 3TMOA 4XLFA 1QJVA 4M6VA 2HMAA 4M6YA 2DMNA 1A36A 4HE6A 5EZHA 4NBSA 1K61A 4W8SA 1EP2B 2RAEA 3WTYC 1X58A 4U4BA 2ZXWH 3W6JB 1MBKA 3WTVC 2DFEA 4JQFA 1ON2A 1MBFA 4EM1A 4Y15A 4BQQA 3IL2A 1QA3A 4OPVA 2D3NA 1E1RA 3K4NA 1KYZA 2ZMEB 5ILUA 1B9MA 2RKHA 2JUCA 1POGA 2ESNA 3H5NA 1YLOA 3KP7A 4LFUA 2GXAA 4XQFA 1SAXA 1B8IB 1MSEC 2R7VA 1P7JA 1TWCJ 1D1NA 2VT2A 1JE8A 2Z99A 3CC4I 2GWRA 4KIGA 4RGUA 4E7IA 4GGGA 1W0TA 1XSXA 5J1YA 4Y9UA 1DG1G 1WQ2A 2JN6A 3DXJF 5GTHC 3MZYA 4FASD 1QGAA 2VNHA 2IA2A 3T53B 1FP1D 3ZBTA 3I64A 2PE3A 3SLNA 5CVRA 1EJ9A 4OPOA 2DT7B 2NOJB 1K6OA 2DOFA 2LY1A 3WU0A 3JRIA 4Q48A 4LD5A 2GAUA 5D4RA 4R71A 2DK5A 3UW0A 3RPUD 2VODA 3KPHA 3GMEA 3ZMSA 4LBVA 3ESWB 2E1OA 4KN4X 3E3VA 5HLTA 1GLNA 1Y8QB 2W7NA 3CCJI 2LKXA 3PVDA 5AMVA 3ZMUA 1Y6IA 3H36A 3VSLA 4FTHA 2EQRA 4IQ4A 2KDZA 1MBJA 1X2MA 2BVLA 3OW2B 3GFJA 4OU0A 2FOKA 3WTZA 3G1MA 2QSGX 5IOZA 4XL9A 1LFPA 4P2NA 1XS9A 1WCMJ 1IN4A 2E1BA 1KRHA 1U5TB 1X19A 2Z9OA 3S93A 2DA5A 2A5WA 2V5IA 5FB2A 3G4SI 2DO7A 1GXPA 3IH3A 2WYRA 3H0DA 4Y7NJ 2ISYA 4RA2A 5HNHA 2G0YA 4ZYHA 2KKOA 1LUJB 2MABA 4MFDA 2F1LA 1R1VA 4HA8A 2XASA 2KJBA 1YITB 2ECBA 2G9WA 1J0RA 4NBQA 5CVIA 3UKGA 1F5TA 4Z1MA 1B8IA 4IRGA 4A3BJ 5EDNA 3ISXA 4BXXJ 4C3HJ 4HX4A 5DM6F 4LBZA 3SY2A 4CZCA 5FLXK 2I1LA 2W84A 1DU0A 4PABA 1P4XA 2R4GA 5D5UB 1D8KA 1BC7C 1E62A 2CC2A 1X1DA 1GV5A 3O8HA 5C44J 3WTSC 3MQ0A 5K7ZA 3J7AY 2QSHX 3OYGA 3MCZA 1RUOA 1RESA 1Z05A 4YAWA 2X6XA 3U6BA 4L5IA 3ASOH 3K0LA 4P9FA 5CVJA 3A3BA 4A93J 1KK2A 3G2BA 2HTJA 1JGSA 4F91B 1S7OA 2W24A 4Z4VA 2R3SA 5KVRA 2G7HA 1XDUA 3REOA 2JA8J 3HSRA 3HGYA 1FNCA 3JQQA 1FRNA 1XG2A 2QX3A 4I84A 2ODLA 3S3MA 2GQFA 2HLDA 3GTKJ 2DMTA 2DAOA 3BR2A 2DDBA 3P9KA 3QYEA 4HX8A 1E3OC 1YX5A 4XOTA 4B48A 2EBIA 3M8FA 2Q6OA 2P5KA 2UV1A 2GLOA 4KYWA 2ZXHA 5FFZA 1Z7UA 3OEEA 2DJNA 2M4GA 3WWGA 3HHHA 3OV8A 1BN5A 4H9GA 1PP7U 2FJ1A 1U5TA 2VQLA 1W87A 4ROXA 1FC3A 3RKYA 1W35A 2MW8A 3NQOA 4OAYA 2D5VA 3WTTC 4OOSA 4A69C 5LFAA 5DS9A 1EZGA 1FBQA 2IGKA 2V9VA 3J80Z 4NC6A 2M9HA 3IAS2 2AHQA 5CVUA 5E18F 2HOTA 1QO0D 2AQFA 4LMYA 4D5CA 1QQ1A 2EZHA 2L2OA 3SZGA 1VQ6B 2FOWA 5IPAA 2G7UA 5C3EJ 1E3PA 3CD6I 2PMHA 1FRQA 2LSOA 1H42A 3G05A 1VQ5I 3CP2A 2HEOA 2YWGA 3OW7A 4YRVA 3CCMB 2CNDA 2F43A 1HKQA 3FPPA 1EA0A 1YJWB 5JLVC 4CO8A 2E2JJ 1YLFA 3F9KA 1MJBA 3WNDA 3WY9A 1M90D 3S16J 1TYUA 5EF6A 1B4AA 3PIPF 5KAIC 1AHDP 1E79A 3HKZA 1FY7A 2IGMA 2MC4A 4DNCA 1VLYA 2WR8A 2HGCA 1J09A 2OJED 3D1NI 1XTAA 2QBYB 3I56I 1H89C 2OUMA 1MABA 1TLLA 2GK7A 4YFKF 5LHGA 3CC7B 2XC7A 2C4UA 5H20A 4TN1A 1SMYF 4HW0A 2V7VA 1ETOA 1G3TA 3T5XA 2OBSA 2QGUA 4EV0A 4AF6A 3WGIA 5FIUA 3HSEA 4YG2F 2MH9A 3DDYA 5FLMJ 1VQPI 4HF1A 5B3SH 2R92J 1PLUA 3GRHA 3DWLE 5KSWB 1BJZA 3CCUB 4Z05A 4E7ZA 3WG7H 5GTIC 1Y1VJ 3KIOA 4OJLA 3T51B 3VPRA 3TEDA 4FX4A 3EYYA 2HQRA 1G3WA 3PENA 2XF6A 3WTWC 4E7JA 4RGXA 4BL0B 1QA6A 3DTKA 1QVFB 1EFRA 2JVGA 2WPDA 1DU6A 2E1RA 4M53A 4EJOA 4NC7A 3DKWA 4C2TA 2HPMA 4YC5A 4G6TB 4HSTA 1LLZA 1QVGB 5F6FA 2VNKA 3OR2C 2BEOA 1BM9A 2JWTA 3HUGB 3K4MA 5C4JJ 3EQOA 2PLYA 2RVCA 3FY3A 3SUCA 2EFQA 1QFYA 2F4MB 3CUOA 2ZZEA 3V8KA 2LVSA 3E5QA 3ZOBA 3I59B 4ZYGA 1COWA 1UELB 4NUBA 4XOPA 2CUFA 3NEUA 1WFXA 4J00A 1LVAA 5DTDA 4R1HA 1XFOA 4TMZA 4KIBA 3CCSI 1ETKA 3PUFA 2R5ZB 2A6HF 3IV5A 1ETYA 1FYLA 5E8IA 5DDGA 4HEA2 4OPWA 1LEAA 1X1BA 3S32A 3BROA 3V42A 4M3EA 3PNYA 4FE7A 3S1RJ 4Z4ZA 4XBFA 4ENJA 1ZM4A 3QE2A 3M07A 3ZQLA 3TP0A 3H3UA 3BR5A 4PC6A 4D7MA 4G12A 1RWRA 2I8DA 4EJWA 4PAAA 1OJLA 2H94A 1YRNB 3GVJA 3QODA 4TKOB 1CF7B 3KCCA 3B02A 4HG2A 1Q86D 1STZA 2R93J 1ETWA 3WQZA 1ZRCA 4I02A 2DBBA 1W0UA 1BR4A 5E1WA 2XROA 4KUMA 4GDFA 4QPQA 1HA3A 4ENKA 1VQ4B 1WMRA 2XGDA 2GJKA 1E3HA 5K5RA 2LY9A 4CYCB 1SVOA 3HEFA 3G71B 5D6FA 4OP7A 1VQOB 4OZZA 6PAXA 1XSVA 1AIPA 3RY8A 3KETA 3HL2A 3CCQB 1YS7A 2YSRA 1R5NA 3PQJA 4EM2A 1ZELA 4RM0A 4YALA 1PP8F 3V8LA 2MLGA 1UD2A 2ZTNA 3RKXA 4PJNA 1ZUNB 1O88A 1TVCA 2XPWA 2R7TA 1QPIA 3GVLA 3VWBA 4TMWA 4HBLA 3WG9A 4LBYA 1FMWA 2CK3A 1LKXA 2VKHA 3AG1H 1G7SA 2G0EA 1RUNA 1OYYA 1M1KD 1HG8A 2VLAA 4OIPF 5M3MJ 2Q8KA 3MKLA 3OYKA 2P5LC 4QLCU 3D5RC 1ZN2A 2Y0SA 2B0RA 2EIMH 2HWVA 3KEOA 5JMCB 3JRDA 3IUOA 4BXUA 1JHHA 4PJ0C 3HB9A 3A1PA 2NVUB 4FHTA 1K28D 1R6RA 1O8HA 5B1AH 1XE1A 3AGPA 1HA8A 1U8BA 1O4XA 2UWMA 3ABUA 2D45A 3VYSB 3RKWA 2CS3A 2Z33A 2L01A 2WB1A 3CCYA 2DA7A 3BR3A 1VQ9I 2NRAC 4QVAA 1SFOJ 2JA2A 5A8AA 3OYJA 2CQXA 4XSXF 1FSHA 3R6JA 4G7WA 4UB6C 1VI0A 2ZBVA 5IT9Z 3OSFA 4L9NA 4N3GA 2ZMEC 3MMPA 3BJ6A 1KA8A 3BC8A 4GCVA 2JIZA 2NXNB 1BW6A 2DOAA 3SEZA 3G1OA 3JURA 2VJJA 2IVMA 3L7WA 1OQYA 2KIMA 2ZC2A 5E1ZB 1HF0A 1UG2A 4HLYA 3EUHA 3SJMA 4BU2A 3V7AA 2L9RA 4LIVA 3HBLA 4LG3A 1O3SA 1XB2A 3ELKA 4RDUA 1IDJA 2P7CB 4OJ5A 1WRJA 3C7JA 5HVQC 3OJXA 1EV7A 1WU8A 5E1XA 2K9SA 2VB6A 1YS6A 1KK0A 4RB1A 5A2QZ 2XAUA 4ABZA 4ZTFA 2XEXA 4P5OA 4U49A 4PGGA 2EA2A 3I55B 2ZSHB 5CQGA 5F1RA 5DCFA 2MC3A 2VL8A 2M0CA 2AXLA 2XPUA 4KJZA 2HOSA 2JA5J 1O7FA 2O9LA 1HLVA 1OGIA 4Q7JB 1K7AA 1QNTA 3TDZC 3N05A 2CV1A 2QSFX 2QGGA 3L2UA 4RGRA 2CGPA 2EV5A 2IJLA 2W00A 4QFMA 3AVXA 1IRFA 2FBIA 3N90A 5L3FA 4NCNA 5C1CA 2V9KA 3QSYA 4RDLA 3GFIA 1OB5A 5FROA 5D5VB 1OFLA 1U5TC 2CFOA 2V1UA 3IH2A 2H27A 2DQRA 2HU9A 2JTVA 2EA4A 3DP7A 4P12A 4HF0A 1LFBA 3CPXA 2KDOA 3V4GA 4NNJA 3N4MA 4OWRB 1KZHA 1T6YA 2RQQA 2O1DA 3CCEB 3J80K 1O8MA 5LHIA 1D2EA 2L5QA 1WZ2A 1WDTA 2XAJA 2YU3A 1J5YA 1DDGA 5HDKA 2NS8A 2W57A 3S3OA 2QDXA 1T6SA 4HSRA 5KNLA 3OS2A 2LK2A 4N0BA 4RM2A 2JUGA 5E3NA 1VHOA 1R5HA 1UAAA 4JX6A 1XCVA 3WE2A 4YDTA 2NYXA 1ZLKA 2Y0SN 2ZBKA 2PMUA 3OWTA 3E6DA 2XNDA 3QPSA 4DK0A 2OTJI 3PO3J 4A12A 1CZFA 3VYTB 1ZR2A 4WF2A 1SVMA 4IX7A 2O7OA 2HDNB 2LFBA 1VNDA 1Y56A 2X6YA 2Y0MA 2WB1N 4A3MJ 2HDWA 2EV0A 1IJEA 1JA1A 4IZZA 3FJOA 1H8AC 4X0CA 1JB9A 1VJSA 1RQPA 2GOMA 3LSTA 1RC9A 5HLIA 2BF4A 1Y8RB 4L9JA 1B1BA 3ULQB 5D5XB 4UZEA 1WWXA 3E7LA 2BOLA 1TC3C 2VNJA 4LB6B 2O04A 2VFOA 3HRSA 3SQVA 1E43A 3MVPA 2B7EA 4D5FA 5E17F 1YITI 2KIQA 3MWMA 2XT4A 1BA5A 4BHPA 3VMFA 5IYNA 4KH3A 4Z4SA 1K8FA 4DQKA 4Y3OA 1R1UA 1WJFA 4A0YA 5DUIA 4KMFA 3CW2A 3OFNA 3FXUA 4P6YA 2A07F 4TSFA 3ML6A 4J0QA 4U7BA 1GR1A 2Z1DA 4I99C 4M6XA 3HOTA 3OOPA 2EJRA 3R6KA 4IOCF 1A8PA 3FHZA 3OPOA 2VKVA 1H8EA 4ZGQB 4D7NA 2P6TA 1Q1VA 4W8QA 2KT0A 1UFMA 4EVIA 1UHWA 3E5XA 4DIQA 4KFCA 2DEUA 4RLQA 3K7AJ 4MFEA 2QF7A 5GPCA 1OCRH 1WJEA 4CXFA 2VKEA 1KJZA 3Q39A 4OOXA 3SKBA 1G59A 4MIMA 3W6VA 1VQPB 3ABLH 5IP9J 3J7AO 1P4MA 1S7AA 1KU7A 2XTXA 4GQNA 1W9XA 5L46A 2GXGA 3JRFA 4XNFA 1KU9A 1BL0A 5FO0A 3LSIA 1W1WE 4Y9RA 3CO6C 4P25A 1QX4A 4AIKA 1W34A 4DYQA 1B23P 4B47A 4XRFA 2C6YA 4X6AJ 4XKWA 2E5ZA 1N0UA 2D9RA 1DBGA 2BY0A 3QYFA 3I0TA 3LSRA 1ZM2A 4IEJA 1S5LC 1Z6RA 5E3OA 3ASTA 4OPSA 2E60A 2FX3A 3A1YA 4G9YA 1S0UA 1XGNA 2ELJA 3VYRB 2JT1A 3AKZA 3HPHA 4HDVA 1O8LA 2VFQA 1QUFA 4AIJA 2HDDA 1WSRA 5E3LA 5EG0A 1QZZA 3F8BA 4IKFA 4OM9A 2VBXA 3B6CA 3E0JB 3RKQA 2V6EA 1VQ6I 1Z21A 4JMQA 1FZPB 1QGPA 3LFUA 2F5CA 5J40A 2L02A 2DPDA 2M1BA 1QFZA 4X8IA 3NWTA 1TNTA 3CMAB 1O8EA 2K7LA 4YZQA 4YEJA 5KW9A 1JJ6C 1K4TA 3CCMI 1O3TA 2NVYJ 2ZNZA 2RC6A 3GVKA 2VUMJ 4I2OA 1YJWI 1OHHA 2QN6A 4JOMA 5THXA 4BEHB 2XT2A 2E2HJ 3BTLA 5BMZA 4WZEA 2BV3A 1MMAA 1P6RA 1S8NA 1WXRA 1ELOA 3HPGA 2DFIA 2N8GA 2CU7A 2QKLB 3L09A 4QPOA 4IHTA 1OB0A 5IYQA 1BI3A 3R60A 5L3GA 1ZRFA 3CC7I 2GJPA 2WADA 3L9FA 4S0HB 4U88A 1TWAJ 1K9MD 4WCGA 1I5ZA 3E6BA 2UVEA 1TW3A 4IOAF 3K69A 2JJ1A 2DN0A 3FK7A 3A8IA 1G7TA 3TO6A 3HC7A 3MCAA 3NWSA 3PNVA 4AYBA 1OYIA 4M3BA 3FK6A 1TUIA 3CCUI 1AKHB 1IV6A 2IS2A 4BE2A 4ENMA 4U9UA 3CMYA 4YAUA 1PJRA 3A0HC 1IO2A 1N25A 2X1CA 3KP6A 5J4VA 1CNEA 2B63J 2H8WA 3JRBA 3IWFA 1EP3B 2VXDA 5C4XJ 2XRLA 5JR3A 4XICA 1FOYA 2X6WA 3QOEA 3SJZA 4ENNA 4Y13A 3TBIA 2R7ZJ 5A89A 3BQYA 1LEBA 3U2RA 4B1RA 3SYJA 1FP2A 4M9XA 2ZZGA 5IT9K 2EV6A 2F48A 1IRGA 1TNSA 4Z6YA 2CW7A 2CG4A 4E7KA 3BLYA 1K79A 3W5VA 4BE1A 4Z4UA 3FBNB 3H9JA 4DNTB 2BM6A 5LHHA 2PEXA 5DYMA 1S4MA 2NNNA 3GEZA 1XG1A 1AWCA 3JCUC 2DFFA 3EUHC 2EZLA 3GZ6A 1CLWA 1KCCA 4CSWA 4CGZA 2F4IA 5CPRB 2Z5UA 4A6EA 3DU5A 4BEHA 3TDUC 2K9NA 3TO7A 3U1DA 2A05A 3MHPA 3OYEA 1HDDC 3AL0C 4UVBA 2LBFA 3CO7C 1ZREA 1HOMA 3WHBA 5BNGA 3G3ZA 2DCEA 1G4DA 1IUFA 1D1CA 4HWVA 2VBTA 1E2XA 1OPCA 2DQLA 2IGOA 5B5EC 2HYJA 1BC8C 2YU9J 3K2ZA 5CVVA 2DCUA 5E8GA 5FKKA 1LVKA 2WZNA 3OP1A 3AVUA 2FQ3A 1AKHA 2QUFA 2INUA 1OCCH 1VQMB 2ZTGA 3IH4A 3C2GA 3L2VA 1U2RA 3BR1A 1VQ4I 4A3IJ 3G71I 5FKMA 1ENHA 1NH3A 1VQOI 3HOYJ 2R7XA 2FVGA 1U3EM 3CF5F 1WI9A 4OMYA 2C2WA 2E19A 3CCQI 1D0YA 1ZM9A 3A8JA 2GZWA 3W2WA 2Z8GA 1R22A 1WI3A 4BNCA 4MYUA 3A35A 2BVMA 2VOOA 3BC9A 2ZBUA 4I76A 2M30A 2OPTA 4BBSJ 3I53A 1RU4A 4I7HA 4CICA 1QA2A 3Q9SA 1W0KA 1F1ZA 2VFPA 2VONA 3LL7A 4RCYA 3Q6QA 1G6NA 4F55A 1Z77A 1USTA 3M3YJ 1BPLA 1RIOH 4P22A 4BXFA 5BS6A 3ZZUA 4Z4RA 1NHCA 3JRAA 1C0WA 5J3OA 4AF7A 2A6EF 3VNVA 3SZEA 2W25A 5LEJA 1EWYA 4JRAC 4YAOA 1K78B 3GTPJ 1TWFJ 1QPMA 4KMUX 1TQPA 3W2GA 4AYBN 1D0ZA 2QQBA 3LO8A 2QYOA 1UD6A 1W0JA 1Y0RA 4TV7A 1DGRM 3N6ZA 1TWGJ 2AS5F 3MZHA 5HS7A 4L0YB 1SD7A 3O8GA 1K4ZA 2BM4A 2PX9A 3I54A 1EE6A 4I98B 2B7CA 4PC2A 4LGWA 4NHJA 4HAMA 1V55H 4HNTA 3JAMK 4P96A 1ZQ3P 1IDZA 1H8HA 3SEJA 3M4OJ 2XUBA 1YIOA 2ID6A 4BQAA 5CYVA 2FF4A 2HYGD 3V7CA 2DJIA 2MGQA 4CYDA 5L3DA 2XKOA 3F8NA 2V26A 5D4SA 2CFXA 2L7KA 1GQ8A 1P92A 3L2RA 1D1BA 5LLQA 1Q81D 1ZAOA 4XM3A 4ASNA 1E3XA 2P6SA 5IYBJ 2DIEA 5TGTA 1PJ6A 2P81A 4H0EA 1FMVA 3E5UA 3F22A 1DABA 3OIOA 1HXDA 2K27A 4YZXA 2VI6A 3I9V2 4PK4A 2OAZA 2RNGA 2MG4A 4PCQA 3OJWA 3QFRA 1DP7P 1Z6TA 1YHQB 1F36A 2FRHA 2BSPA 2OTJB 1TYWA 2VFMA 3OIQA 3CCRB 3KRGA 1IA5A 1I1GA 1MIJA 2XC1A 4QWQA 4XLNF 1DDIA 4X7EA 2DY1A 1R9TJ 1G8XA 3GTLJ 2JVHA 1JKQC 3ZQ7A 5FNZA 1OLTA 3AAFA 2B7BA 3ZBUA 2PLFA 1G3YA 4G94A 3I55I 1K78A 4CCOA 1T39A 1PE9A 3ZQFA 1XMAA 5DM7F 2O3FA 4OJPA 5HS9A 2K9QA 1LJ9A 1ONVA 3BCBA 3EUKL 4IPAA 4XSZF 4EH1A 1MBEA 2K86A 2CUJA 2BXYA 2UXXA 3BWGA 1R36A 1Z7LA 4YELA 2Q2EB 3I1FA 5LEKA 2V7FA 2PMDA 5HXBA 4PFOA 4YIFA 3DQVC 2QVOA 1MH4A 4Q5SF 1R5BA 1FJLA 4V2GA 3ZUGA 4FISA 1QZEA 2XAQA 4BBRJ 2OBPA 2NTBA 2PFBA 4G7HF 1IDKA 4KITB 1KTWA 3BQJA 4LB5A 3CCEI 2Y69H 2IRFG 3K1MA 1A04A 1QVUA 3K4CA 3QYBA 3OYAA 2C77A 2CW5A 4TMXA 1O8IA 2F4OB 2J8IA 1OGJA 5H6QA 1YW8A 2XAHA 1PVEA 4M72A 2EH3A 4MLOA 2WA0A 3WTXC 3PL8A 1TWHJ 3GQ9A 2KP6A 1HDPA 2QMUA 3GWZA 2OA4A 3QPTA 1ZARA 4HX7A 4M9ZA 1YJNB 1TLHB 3SDGA 1OKRA 1JTYA 3U1KA 4CDGA 1GAQA 4OOIA 5HDGA 4WQMA 2FSWA 3HZJA 1VZ0A 2ACJA 3LA7A 2H1KA 1W5CC 2H6BA 4P3YA 5TISC 4P9SA 2AHOA 4HZFA 1DUXC 3Q38A 2OD5A 4E7SA 2F5VA 2CQQA 5EEGA 4PFPA 1ZLJA 2HNHA 2XF7A 1RQRA 1OFMA 3D5LA 2H1LA 2LLKA 4UVCA 2PBIA 1GDTA 2LC2A 5E79C 1R58A 1JHFA 2QYUA 2HQNA 1J7KA 1JUPA 2YWFA 3ZQQA 4JX4A 4V19K 5D6EA 2Q2EA 2EZKA 3RSNA 2X4HA 4Y4RA 1EXMA 1XCBA 2DT6A 3GW2A 2FBKA 3ZMZA 1JJ8C 1D8JA 2HVSA 1RI7A 4CA0A 4XKBA 1HZEA 4F3QA 2Q6IA 1KQSB 1KQ5A 5F64A 3DU6A 1FNDA 2OZUA 5IOYA 4XRMA 1GV2A 1U9OA 1FOXA 1FX0A 2VBVA 4LBWA 2DMQA 2BGCA 3V76A 3AVTA 4L0ZB 1XDSA 5BPDA 5J3LA 4J19A 2KIFA 2H8RA 3VB2A 2VIXA 1ETQA 3LFKA 2FE3A 1KU3A 3T0YA 5TRDA 5TV2A 4Z4WA 2DK8A 2BM5A 1T98A 1GUUA 3FXQA 4L9TA 1U78A 5E6TA 1W7PA 2O0VA 3ABMH 3JTHA 5LRRA 3ZMTA 3MFKA 1IAWA 2BX6A 4PGHA 3B8HA 3OOCA 4CUGA 2PECA 4HNUA 3CDIA 5F04A 2KRHA 4Q4ZF 2BHYA 5IP6A 2HDCA 4M0LA 2L7ZA 5FO5A 1MD0A 2BN4A 3F6OA 3ONQA 1BMFA 4PJMA 4FQGA 1ZHFA 2JRMA 5JHUA 2X85A 4NQWA 2STTA 2WAEA 3KP5A 1KK3A 1GT0C 4RPDA 3H9GA 2QXZA 2IPQX 3SYTA 3GSIA 2ELKA 4OIOF 3FKSA 1BOBA 3A2KA 3ZXSA 2VQCA 4L9VA 1FBSA 4YFXF 2DOEA 2R7RA 1TL8A 1SFXA 2JPBA 1BJAA 4KICA 1MNDA 3TP3A 2TRTA 4PDKA 1JKOC 3DTEA 3KEWA 3C1DA 2E2IJ 1O8GA 1TZLA 2VJ4A 3S2DJ 2CUEA 1UCRA 2DU9A 3HOVJ 1BIAA 4N9IA 5FKNA 2FX0A 3ZMDA 4A6DA 3QPHA 3W2EA 2PYHA 2L54A 1Q1HA 4BDYA 5F0HA 4QUZA 4WXCA 5A88A 1KD1D 1H9GA 2IOUG 2D3LA 1X2NA 2VPLA 3AK5A 3CMAI 5C1EA 3OS0A 2JA6J 1LM1A 1IV8A 2D74A 5J1UA 1FNBA 3K4KA 2EPFA 3CCVB 4AVZA 3I4NJ 3ECHA 4RD2A 4U0VA 4F52A 3AGQA 1YFHA 2EFGA 2JJ7A 4AM3A 2XNJA 2IGNA 1NK2P 3OYMA 1T38A 4ZDOA 5EGOB 1E0EA 4ZTJA 2GPJA 2M5SA 5HZBA 4UV8A 4MR0A 4XLHA 4EATA 3TW7A 4JX5A 4YFOA 3T8TA 4E4HA 2RNJA 2LTPA 3GTOJ 2J8KA 2HS5A 2ZCWA 4XRSG 1PJ7A 2BY3A 4BKXA 2E1MB 1X3ZB 3ABKH 3QFTA 3CJRB 1MBHA 2K40A 3DBHB 2E7XA 2FXAA 2JA7J 4GO1A 3B8YA 3MEXA 3ZGKA 4LK1F 5HODA 2EWNA 4EGZA 3TO9A 2OYNA 3OZUA 2Q1ZB 4KKUA 5F4OA 1WHUA 5FRMA 3VOEA 1UB9A 4XLAA 1JT0A 4P1WA 1GVJA 3LOCA 3HOSA 2GOXB 2HI3A 2TDXA 2E7WA 3PQKA 4KDPA 2HOAA 2COBA 4P3IA 1JNYA 3GXOA 3W6KB 3OZVA 1D0XA 2MBFA 2X1DA 2R7WA 2HPIA 4ANJA 3A03A 3PA2A 2LR8A 3RPQA 2C4TA 3ES9A 3CCLB 2P0WA 1TYXA 2CV2A 3GX4X 4N3NA 2O17A 1QCXA 2EINH 3OYFA 3ASPA 3S1NJ 2KJCA 3L1PA 2K4JA 1S72B 3E1YE 1T5EA 1VFCA 2VBWA 5ICFA 2KHMA 5M5YJ 4G6IA 1VQ8B 1J9ZA 2W7ZA 3AL0B 3LA2A 4XONA 3G1LA 1O8KA 1V0FA 5EEHA 2CH0A 2QLZA 1YOVB 1E17A 3W3CA 1BI1A 2TCTA 4D0PA 5IP7J 2VC1A 2O03A 1MSFC 1CGPA 5EGOA 2YWEA 2WBMA 1FLIA 2B0LA 4LIUA 4XKVA 1TBXA 3S3NA 4M9SA 3F6VA 2VQHA 3QOPA 1X3WB 3T1BA 4F7DA 2KISA 5HNFA 2DA4A 5JI6A 3B4NA 3RTRA 3AFHA 5IYCJ 4B3GA 4HPQA 1BJKA 2BBYA 2LF7A 5M3FJ 3GTJJ 5TR9A 4GXOA 3H9NA 1VQNB 1BN8A 2OTLB 4A3KJ 3VSVA 3S17J 3J7ZI 2XSJC 2ZXJA 2Z6BD 3GCMA 5DV5A 3RIQA 2DERA 1VQMI 1OCTC 2IS4A 3CUQA 3QU6A 3ZZ0A 1E64A 2MD5A 2BY2A 2IS6A 2VXZA 3DKXA 4M74A 3H3VK 2P7VB 4GYIA 1JKRC 1EH7A 2V4JC 4XKCA 1SEUA 5ICCA 1N77A 2R7DA 2QWWA 2RQPA 1XD7A 4RMNA 2DA1A 2EIKH 1ZRDA 4RAGA 4YEIA 3PFYA 2DMUA 3FXOA 3CXCB 1T0FA 3GLLA 2VFNA 2MFZA 5CQEA 3O2PE 2K85A 3FKIJ 3KZYA 1G3SA 1VLOA 3J7YJ 4BQOA 3O6BB 4LITA 1XC5A 4TMTA 1I18A 2V31A 2QQAA 4MYTA 3J81Z 1N08A 4Z03A 2AO9A 2F1MA 2K9LA 3FIWA 4XLEA 1QGZA 4S04A 3KLNA 1FIPA 4FT8A 2OBRA 4MNUA 3BG9A 5DSZA 4UUSB 2O8KA 3W2IA 1WH7A 4FWTA 1USSA 2P8TA 3PETA 2DOGA 4UAJA 1KC8D 4YCQA 2YUHA 3CDLA 1QBJA 3KYLA 1J59A 2ZL5A 3EPZA 3KZIC 3OYCA 2INVA 1T33A 4LK0F 5DUKA 2LRDA 1SKQA 4Y33A 4RD3A 3ZPNA 4A3FJ 4U0WA 3LSKA 3DBLB 3LMWA 1IN7A 1JUMA 4QV2A 1HVXA 1IC8A 1WP6A 2HKOA 1NK3P 4X05A 4A0XA 1G7RA 3IAM2 1ZG3A 5KK1A 3ASRA 1BI2A 1X1CA 4A5MA 3MKZA 2V6CA 1WJBA 2BW3A 2LP0A 4RAZA 4XN0A 3AG3H 3MKYB 1WTHD 1I27A 2OU2A 4UXNA 5LGTA 1BQEA 5JVGF 2QQ9A 2LG4A 2M34A 4ZCLA 3OOUA 1NTCA 2BYVE 3BQZA 1JRGA 2WWYA 2Y2ZA 3LSJA 1LQ1A 1V54H 2K3FA 1ITYA 3ZPPA 2CMPA 5FL7A 2ZJPF 3JU4A 3A0BC 2CRVA 3GQAA 1P7IA 1YHQI 1N05A 2ZXIA 1NJID 2DYRH 3E20A 3GTMJ 1SM4A 3CESA 2A61A 3CCRI 1QA1A 4OAZA 3PO2J 2MLKA 5CJ9A 2V1NA 4E0FA 1QHHD 3WE3A 4A3LJ 1DARA 1IUYA 3DEWA 5IT3A 4ZV4A 1IJWC 3U21A 2BVNA 2LY2A 3DKYA 1DP3A 1BR1A 4BJ6C 4M71A 4BGDA 1T6XA 1ZR4A 4UUSA 1R71A 3LQRA 2XTWA 2M2EA 3RYRA 4CCJA 1J75A 5CDFA 3CMEB 4EM0B 5F08A 4IF4A 2BM7A 2FMYA 5M5WJ 4JYKA 3PUNA 1E3ZA 2XDVA 2Y75A 2Z2SB 3EUAA 1BOAA 4K2EA 4ACBA 5GV7A 1QG0A 5TY0A 1ACIA 2CW0F 1BIBA 5ILSA 5EG0B 3BZCA 3HAGA 3CJQB 3FM3A 5IYPA 2L4AA 1WJ5A 3V8JA 2PMZA 2QA4B 1B72B 2DFHA 4FN5A 4KISA 2DODA 1IN6A 5CKTA 1J2XA 1TW2A 3JRHA 3ASQA 2V1DA 3DPUA 1XB4A 2KVOA 1MBGA 2BXZA 4N9HA 3OEHA 2M5WA 1GHCA 4O5VA 1LNWA 3O3KA 5D8KB 1RR7A 4B4CA 4DZJA 4MHGA 4B43A 4IHWA 3LQ6A 1KU2A 3M1CA 4G8XA 3SHFA 4A3JJ 4Z4TA 1O7LA 4DBQA 3K4BA 5E3MA 1YJNI 1EKEA 4IHXA 4ZC3A 1FTTA 5IYDJ 3FXLA 4XLPF 4ZDLA 2XTYA 1SKYB 3L2CA 3H94A 2O61A 4KA4A 1T8IA 1R5GA 2QE7A 3HRUA 2QTLA 3P9CA 4G1BA 5AN9A 2QZ8A 4QIWN 5M5XJ 3Q0UA 2VBKA 1W2BB 5FGMA 2IP2A 4A3EJ 4QHYA 4AC9A 4HRIA 2WV1A 2ZJ2A 1VQKB 3FF5A 1K5CA 1B2RA 4WXHA 2VBUA 1F60A 2GIZA 2L0KA 3B78A 3IHUA 3BZKA 3T56B 1XPXA 1LDJA 3FISA 1HCRA 5BSYA 1MZBA 2BZTA 2LNBA 2GJRA 4JBAA 1Z67A 1B6AA 1MGTA 4I09A 3HGGA 1RMGA 1J9IA 3SLDA 3ZMVA 2OCEA 1HBXG 4I01A 4HQMA 4D1QA 1I3QJ 2F4NA 1WOPA 1P4WA 2IAIA 4II3A 2EFOA 3MZ8A 1CQTA 3GFLA 2NNYA 2F3LA 1TQIA 3H1CA 3W2VA 3OYBA 1B72A 3ERED 3NARA 1FIAA 2MD0A 2NOGA 5F1JA 1AU7A 2PG4A 3VFZA 1H0MA 2OQRA 5IY5H 4I0BA 3W5UA 2EK5A 4G7OF 2XAFA 2WAQA 2RDPA 2XGCA 3LNQA 4CZZA 2L7MP 5FD5A 1YJ9B 5ICEA 3BPXA 5FLXZ 3A8KA 1O3RA 2LBFB 1YIJB 2WSSA 2V7QA 2V79A 3HSFA 4DZPA 3B73A 2CW8A 1U0JA 4EJUA 3CF2A 5DCMA 5H2FC 5J47A 1JI8A 3JQPA 1Z3XA 3ZZTA 3HJEA 4ZZLA 2X8KA 4D9JA 4E70A 1FBUA 3LSMA 4EQQA 2QY1A 3ECOA 4A3GJ 4FETA 2BPOA 3OYDA 4BUPA 4ZZDA 2E5NA 2X51A 1HQCA 1PYVA 1X1AA 1RNLA 2E1MC 4M1KA 4PJLA 1X4OA 2YUSA 3UR3C 5HDNA 2R7QA 2ZO4A 1PJ5A 1K73D 2IQ7A 2Y9YA 2L9NA 3LJYA 2A5YB 4HLXA 2PMZN 3DCFA 4BJTA 1GAWA 2BM1A 1WSUA 3BJAA 1I1SA 3ZP5A 2DA2A 4IQJA 2CWEA 2H6CA 5JVTA 1XMKA 4Y17A 4TMVA 4EW9A 5K7HA 2XNCA 3HHGA 1KGSA 1Q82D 1W5SA 2GBYA 1VTNC 3FMSA 4ETSA 2ZSIB 4G1VA 3OL3A 3JSOA 2H09A 3EYIA 1WORA 5ICGA 1X0CA 2KQRA 3VEPA 1OOCA 2ZNYA 3GO5A 2FMLA 4HF2A 1ZM3A 3CCVI 2RC5A 4Y7CA 3G6EB 2AQEA 2OK7A 2VBZA 5HS8A 4M3GA 4HE5A 3P4GA 3FZVA 4G6QA 3SZTA 1F4KA 2NV4A 4B3FX 5BSXA 2JZYA 3BG7A 1XN7A 4BYYA 2OK8A 3LQQA 1NBMA 5A2QK 3J81K 2QEXB 3K4LA 2LKSA 1QU3A 1EFCA 1QRCA 1NG6A 3OYIA 5LRSA 1F43A 5J1RA 4B8XA 2W4SA 2V7UA 1KZLA 5B6IA 3M1EA 3OAAA 4HIZA 2O6WA 3BH7B 2XZLA 3GQ8A 2RREA 3QAHA 1L3LA 1UJ8A 5FFXA 4RAYA 5BPIA 2WZPP 1Z0XA 3DLLF 2YWHA 2KZGA 3IRQA 2R7UA 1MMNA 1MMDA 4N4OB 5LBQA 4TT3A 2ZZQA 3BG6A 2BGIA 1VBLA 3BY2A 1DPUA 2IT0A 3TOAA 5DNSA 3S2WA 1N8RD 2A3SA 2WV0A 5F4JA 3CDHA 2R0QC 4HQEA 4NB5A 3CCLI 3FKJA 3FWEA 2DLLA 4PC7A 3GTQJ 1KQ9A 2HCJB 1V5FA 4PC3A 2WAQN 1S72I 3BOQA 3OYLA 4LG0A 1H80A 1VQ8I 2E34A 3BCFA 2VASA 1FWZA 2HR3A 1VQ7B 1A35A 4BS9A 2DW4A 2KPMA 1Q7YD 3HRTA 3GZNB 2COMA 1FX7A 2EWEA 3MKWB 4Z06A 2LH9A 1VF7A 2ZL7A 2EIJH 2KFDA 4E7LA 2B9SA 1NRKA 5J4YA 1U9NA 4EGYA 3D26A 2W85A 2Z3YA 4M4SA 3DF8A 3SQNA 2CRGA 4CQJA 3OYNA 1JXSA 1IZ1A 1YG2A 1XGMA 1G2HA 4JP0A 4DYRA 5FA6A 2OCCH 4AU7A 2XZOA 2M0MA 5HKKA 3BR6A 3P5JA 2WY7Q 2FQ4A 2A68F 2HYFA 1TT0A 2CQNA 1U2WA 2X3UA 3MAJA 3MD2A 5GAHJ 1SD6A 3HTSB 5IK2A 4OJ6A 3BG5A 2JPCA 2W48A 1VQNI 1HKSA 3E97A 1IN5A 2OTLI 1R1TA 2JSPA 4F7ZA 4XIDA 1VQLB 1PUEE 4L5EA 3W2HA 3OSGA 3AG2H 4PSXA 3VODA 4OMZA 4XLCA 4WZLA 3ZIAA 1O57A 1LE8A 4IRIA 3P9IA 4YAFA 1DGWY 1LDKB 1V4RA 3D5SC 2J5OA 2CV0A 4UZFA 3KL9A 3A01A 2A6TA 3KYCB 1HSJA 1QVTA 3SJPA 3M8EA 1IB0A 3IP4B 3WODF 2EB7A 3WU1B 4Y52J 3JREA 4RD4A 2K02A 2R5YB 3OE7A 2DYSH 1Y1WJ 2B5OA 4BACA 1O8DA 2E35A 1O8JA 1NB9A 4ZGNB 1SAUA 1UD4A 5EMNA 1Y0YA 5K1YA 2QTZA 1S9HA 3LSPA 4G5GA 4R8HA 2UXNA 4IO9F 3RIRA 3HG9A 2NZMA 2KIUA 4C0SA 5EEAA 3CRZA 1GVDA 4C2LA 2R7OA 2EFNA 5J6XA 5ED4A 4OIRF 3KX2A 3D0SA 1WGXA 3FMQA 1ZH5A 2XPVA 2DMPA 2YS9A 4RLFA 3WU2C 5FKOA 4OINF 5D8LB 4XRSA 4IHYA 2VBEA 1SD5A 3SXYA 4FCYA 3VMWA 2FD5A 1MW7A 3MMYB 5AIQA 5B1BH 4DJAA 5GADJ 3C18A 1A6IA 1V5EA 4BE0A 2HZTA 1IW7F 4ESBA 1XSDA 1P2FA 2F5EA 3NB2A 3WYAA 4YZ0A 3WNBA 1ODDA 1RETA 4XD7A 3ZQGA 3CLOA 4F93B 4F92B 3C2BA 5DN6A 4CHUA 2DTZA 2DYIA 3LYCA 3SZPA 3PJRA 4RDJA 3K1NA 2LZJA 1K8AD 1ZTRA 2M45A 1W7PB 2JN9A 2ZMEA 5GPAA 1N06A 3VDXA 4C2MJ 4UV9A 4WX9A 3GIRA 4HV5A 2D1VA 1S29A 2A69F 1KK1A 2HFHA 2O8XA 2Z16A 2X0LA 2KRCA 2X6OA 4ITVA 4XR6A 4A2UA 1XMXA 2R5YA 1TTTA 1PDNC 3GQBA 2M7AA 3CLQA 3X2QH 3ZQCA 1ZGWA 2XZPA 3WBKA 4UUTA 1E1QA 4NQWB 4DOZA 1OISA 3CP8A 1HSTA 1IRXA 3UNGC 3JRCA 2XRNA 1WPCA 4ASUA 1HC8A 2EIXA 2XGEA 3S1MJ 3H3ZA 3OR1C 2K5CA 2BGJA 3JX8A 3DEEA 3HDDA 3CMEI 4XK4A 3Q5FA 1RR8C 2O5RA 5AIPA 3F21A 4XN3A 5HLGA 1JTAA 1KQ8A 2MYSA 2X3HA 3OZWA 3QQAA 2P5VA 1OFEA 4BY1J 1L1IA 4RAFA 1KCDA 4DYCA 4ZYAA 3QFCA 2W82A 3EQLF 3P7NA 5CLSA 2OZ6A 1YX3A 4WK8F 2QA4I 3N97A 4X7DA 5J8FA 3WHCA 1IG7A 4FK8A 3BPVA 2GK6A 4PGOA 2BM0A 3ZC3A 4P9UA 3NRVA 3I3LA 2ETHA 2EILH 3IKTA 3VYUB 1QFJA 4M2LA 2M8GX 3FHNA 1GO2A 1BBYA 1MJAA 2VBSA 3ONYA 1K4SA 5HLHA 2K3PA 4YXWA 3L2QA 3K10A 2I10A 5H5JA 2M8EA 3DEUA 1P9QC 3C3WA 1YW9A 3JR9A 1L0OC 5L3CA 2IEKA 3GQ7A
chains in the Genus database with same CATH topology
2IS6A 2VXZA 3DKXA 3TMOA 4XLFA 1QJVA 2V4JC 4XKCA 1N77A 4RMNA 4B47A 4XKWA 2E5ZA 1N78A 1DBGA 3PFYA 3QYFA 4W8SA 2E60A 2MFZA 5CQEA 3A1YA 4U4BA 2ELJA 3M8JA 3VYRB 3AKZA 3HPHA 4BQOA 1O8LA 4JQFA 4LITA 4IKFA 1I18A 2W1OA 3E0JB 2V6EA 2V31A 1Z21A 4BQQA 4JMQA 3LFUA 2JDIA 2D3NA 3OY9A 1E1RA 3K4NA 4Z03A 3NWTA 1O8EA 2F1MA 4YZQA 2K9LA 4YEJA 4XLEA 3H5NA 2VKDA 4OZYA 4XQFA 3GVKA 2R7VA 1OHHA 4JOMA 3KYLA 4BEHB 3EPZA 2F6CA 3VSKA 3HXLA 3OYCA 4E7IA 2WJYA 2INVA 1MMAA 2LRDA 3HPGA 4QPOA 4Y33A 2QKLB 1OB0A 3VR6A 3ZPNA 3LSKA 3T53B 3LMWA 4FASD 2GJPA 2WADA 1HVXA 2DT7B 4DK1A 2NOJB 1WP6A 2LY1A 2UVEA 3UW0A 2JJ1A 1PXZA 2NT9A 3RPUD 3IAM2 3HC7A 3NWSA 3H5RA 1X1CA 3PNVA 4AYBA 4J01A 1PKVA 5HLTA 1WJBA 2BW3A 1GLNA 3PUBA 4XN0A 3MKYB 1WJCA 2W7NA 4BE2A 2IS2A 1WTHD 5AMVA 1PJRA 1Y6IA 2LG4A 2X1CA 3OOUA 1O8FA 1JRGA 3VSLA 4IQ4A 1K6YA 2VXDA 1OGOX 4E6KG 2BVLA 4CCKA 2X6WA 3QOEA 2IS1A 3TBIA 3E1SA 3ZPPA 2CMPA 3CMMA 4XL9A 5FL7A 1LFPA 3JU4A 3GQAA 5JHFA 2E1BA 2ZZGA 2ZXIA 1X19A 3ZSCA 2CW7A 3S93A 3CESA 4OAZA 4E7KA 3BLYA 2A5WA 1I8DA 4BE1A 3A3GA 2KL4A 3FBNB 3H9JA 4DNTB 2V1NA 4E0FA 1QHHD 2WY8Q 3H0DA 3U21A 2LY2A 3OL4A 5HNHA 3DKYA 3EUHC 1BR1A 4BJ6C 4BGDA 1DP3A 2MABA 3BH4A 3VMVA 1KCCA 4Z1MA 4CSWA 2F4IA 4CCJA 5CPRB 5CDFA 4BEHA 3DU5A 4CZCA 1E3ZA 2DXIA 2XDVA 2Z2SB 3EUAA 3OYEA 1DBOA 3AL0C 1EA3A 2R4GA 1X1DA 2LBFA 1KMHA 3HAGA 2NSPA 3J7AY 3CJQB 2DCEA 3OYGA 1D1CA 1WJ5A 3EQNA 2PMZA 2QKMB 4HWVA 2X6XA 4KISA 2IGOA 1DQUA 3A3BA 3G2BA 5CKTA 4F91B 3DPUA 2KVOA 3OEHA 1LVKA 1XG2A 4I84A 2QX3A 2INUA 2ODLA 3S3MA 2ZTGA 2HLDA 3C2GA 4B43A 3L2VA 3QYEA 2K9MA 3M1CA 1YX5A 4XOTA 3H9QA 4B48A 4KKTA 2R7XA 4DBQA 2XGJA 3K4BA 2UV1A 4URRA 2ZXHA 1D0YA 3OEEA 4ZC3A 3W2WA 2M4GA 2Z8GA 3WWGA 4ZDLA 3A35A 1SKYB 1QHGA 2BVMA 2QE7A 3BC9A 3H35A 3H94A 2VQLA 3L2WA 1UD3A 2NSTA 3SEQA 4OAYA 1RU4A 2VBKA 3OYHA 3A4CA 5LFAA 1W0KA 3K4JA 3LL7A 2IGKA 2BW3B 4F55A 3IAS2 2NT6A 4HRIA 4W8RA 3VSVA 2AQFA 1K5CA 4CCLA 3SZGA 2L2OA 1BPLA 4P22A 2O0WA 4BXFA 3T56B 3G05A 1NHCA 4BDZA 2GJRA 3T9GA 3CP2A 3OW7A 4ZDPA 4RM3A 4YRVA 3FBIB 1RMGA 2F43A 3FPPA 4PJJA 1D0ZA 3F9KA 4D1QA 2ZZFA 4II3A 1UD6A 1W0JA 1DGRM 1MMGA 1E79A 3W2VA 3HKZA 2IGMA 2MC4A 2KZVA 3OYBA 1VLYA 4TT3A 1J09A 2GK7A 1EE6A 1MABA 2MD0A 2OUMA 2KMUA 3OMYA 2XC7A 1V0EA 4HNTA 3GQ7A 1H8HA 1AA7A 3NE5B 4CCMA 3DDYA 2WAQA 2DJIA 4GRIA 3GRHA 1PLUA 5KCMA 1GQ8A 2V26A 3DWLE 2L7KA 4N4NB 3OS1A 1UD5A 4Z05A 3L2RA 1D1BA 4E7ZA 4XM3A 2LBFB 1E3XA 2DIEA 4OJLA 2WSSA 3T51B 5TGTA 2V7QA 2CW8A 1U0JA 1FMVA 2XF6A 3CF2A 1JI8A 4E7JA 1Z3XA 4BL0B 3DTKA 1EFRA 4YZXA 2JVGA 2WPDA 2X8KA 4D9JA 2QY1A 3LSMA 3GBGA 3I9V2 4NC7A 4PK4A 3KEYA 4C2TA 2RNGA 4FETA 3OYDA 4G6TB 4HSTA 4BUPA 2HPMA 1NG7A 2E5NA 2BSPA 3KRGA 1N75A 3OIQA 3OR2C 1IA5A 2X51A 3K4MA 3HUGB 1PYVA 1X1AA 2E1MC 4L8JA 3EQOA 3FY3A 4PJLA 3SUCA 1X4OA 3UR3C 2R7QA 2ZZEA 2IQ7A 1COWA 1UELB 1G8XA 2L9NA 4NUBA 4XOPA 2JVHA 3DPLC 3ZR8X 1IB4A 1OLTA 2M3AA 4BJTA 1WFXA 4J00A 2PJRB 1SFKA 4DNRB 3RCOA 4CCOA 1OGMX 2OC6A 1PE9A 4OJPA 4IQJA 3BCBA 2VQGA 3EUKL 3LSGA 4HEA2 1X1BA 3S32A 4EW9A 3V42A 3PNYA 2CUJA 1Z7LA 4YELA 2Q2EB 2ZSIB 2V7FA 2PYGA 3OL3A 4PFOA 4FXUA 3DQVC 3K6GA 1X0CA 2KQRA 1OOCA 4X0GA 1RWRA 2I8DA 2KLOA 2AQEA 3GVJA 3QODA 4TKOB 2NTBA 1IDKA 4HG2A 4KITB 1KTWA 3WQZA 4B3FX 3K4CA 2XF5A 3BG7A 1BR4A 3QYBA 3OYAA 2HVRA 1O8IA 4QPQA 1WMRA 1NBMA 1YE9A 4XORA 2UUZA 3FDYA 3K4LA 3S8PA 4MLOA 2GJKA 1QU3A 2WA0A 3GQ9A 3PL8A 4OZZA 2KP6A 4NC8A 1NG6A 3RQ4A 3OYIA 1V5GA 3PSFA 3HL2A 2W4SA 3W2AA 1KZLA 3OAAA 4HIZA 2XZLA 3GQ8A 2RREA 1ZELA 2ZTNA 1UD2A 1VZ0A 2WZPP 4PJNA 1O88A 2R7TA 1UG0A 1ERDA 2WAFA 3GVLA 3VWBA 2R7UA 1MMNA 1MMDA 4N4OB 4BQNA 1FMWA 2FUG2 3H5AA 1LKXA 2VKHA 3BG6A 2CK3A 2ZZQA 4E7SA 2F5VA 1HG8A 1VBLA 4PFPA 2VLAA 2HVQA 2PJRA 2HNHA 2XF7A 2W6IA 1OFMA 3VSUA 3D5LA 3OYKA 3D5RC 3FKJA 2LC2A 2Y0SA 3BCAA 1V5FA 3IUOA 3DLAA 3ZCOA 3ZQQA 2VBMA 3DTIA 4PMHA 1O8HA 3C2HA 3OYLA 4C30A 1R6RA 1K28D 1H80A 3BCFA 3RSNA 2VASA 4Y4RA 4BJ5C 1HA8A 1AIRA 2UVFA 4YZAA 2DT6A 4BS9A 2UWMA 2VJIA 2KPMA 1HZEA 2HVSA 4MXNA 4CA0A 4XKBA 3VYSB 4F3QA 2WJVA 4NK8A 2CS3A 2WB1A 3MKWB 2EWEA 3DU6A 2LH9A 4II2A 1VF7A 4Z06A 2LREA 4E7LA 1FX0A 1NRKA 2JA2A 4NK6A 3OYJA 4G7WA 3OYNA 2VIXA 4R79A 4UZUA 2L9SA 4B44A 4G7XA 4AU7A 2XOKA 2XZOA 2M0MA 5HKKA 4DGWB 2O0VA 2WY7Q 3BC8A 2JIZA 2DOAA 1TT0A 4DBRA 2R7SA 3SEZA 5IK2A 3MD2A 4XMYA 3JURA 4OJ6A 2VJJA 4B3XA 3OOCA 3B90A 4CUGA 2PECA 4HNUA 4KKSA 2KRHA 4BU2A 2JSPA 2VJ5A 4LIVA 4LG3A 3ONQA 4C2UA 1BMFA 4PJMA 3K70D 1IDJA 4OJ5A 4PSXA 5HVQC 2X85A 4XLCA 2WAEA 3H9GA 3ZIAA 2QXZA 3SYTA 2VB6A 3FKSA 1BOBA 1DGWY 1LDKB 3A2KA 3D5SC 3ZXSA 2VQCA 3OIPA 4CCNA 2R7RA 2XAUA 4ZTFA 2CV0A 4P5OA 2CUZA 4PSWA 1MNDA 4U49A 2A6TA 2ZSHB 5CQGA 3DTEA 3KEWA 1KONA 2VL8A 1D1AA 1TZLA 4KJZA 2VJ4A 3IP4B 4KT6A 2JJ2A 1O8GA 3N05A 2PYHA 2CV1A 3BCDA 3L2UA 2ZFUA 2M7BA 2W00A 4BDYA 3OE7A 5C1CA 4BACA 2V9KA 3VSTA 1W36C 1O8DA 2D3LA 2VPLA 1O8JA 4H4KC 5FROA 1OFLA 1SAUA 5LD2C 1UD4A 5C1EA 2CFOA 1S9HA 3OS0A 3K70C 2HU9A 5KHDA 3K4KA 4AVZA 2KDOA 3HG9A 2NTQA 1BR2A 4PUSA 4NNJA 2NZMA 4F52A 4OWRB 4C2LA 2R7OA 2IGNA 2LOOA 2RQQA 3OYMA 2HQAA 4ZDOA 1E0EA 2O1DA 3PSIA 3KX2A 1O8MA 4ZTJA 2M5SA 2L5QA 4MR0A 4XLHA 4RLFA 5FRNA 4EATA 1BLIA 2VBEA 4E4HA 3LMMA 3S3OA 3VMWA 4C9YA 1MW7A 3MMYB 4E7HA 1WJAA 2E1MB 1T0FC 4HSRA 3DPTA 4DJAA 4RM2A 2JUGA 5HOOA 5KNLA 3OS2A 3SDBA 3CJRB 1V5EA 4BE0A 1UAAA 3B8YA 3ZGKA 4YZ0A 3OWTA 4OJOA 2XNDA 4DK0A 4XD7A 2Q1ZB 4KKUA 4F93B 2X1EA 5FRMA 4F92B 5DN6A 1CZFA 4XLAA 3VYTB 2X53S 4P1WA 3PJRA 2W6JA 2LZJA 3HOSA 2GOXB 4IX7A 3VDXA 1D0XA 2X6YA 1Y56A 4ZJZA 2X1DA 3LSHA 2R7WA 2HDWA 2HPIA 4ANJA 4IZZA 2O17A 2P0WA 2CV2A 2Z16A 1QCXA 2KRCA 4XR6A 4ITVA 3TL4X 3OYFA 1VJSA 3LNNA 4W8TA 3GQBA 2M7AA 2GOMA 2OV7A 2XZPA 2V4DA 1E1QA 1T5EA 4NQWB 1T95A 2KHMA 3CP8A 2BOLA 4DOZA 4G6IA 1IRXA 3UNGC 2O04A 1X4PA 1E43A 3AL0B 1WPCA 4ASUA 4XONA 2NTPA 1O8KA 1V0FA 2CH0A 2R9VA 3OR1C 3W3CA 2K5CA 1MNEA 1W36D 3LSIA 3DEEA 4Y3OA 1WJFA 3ZRGA 2M4KA 2O5RA 3OFNA 4XN3A 1JTAA 4TSFA 2MYSA 2WBMA 2X3HA 1UD8A 1BHEA 4U7BA 4LIUA 2Z1DA 4XKVA 3S3NA 1KCDA 2VQHA 4U87A 2W82A 4ZYAA 3HOTA 5HNFA 1YX3A 3B4NA 1OR7C 3RTRA 3AFHA 3OPOA 1Z3YA 1H8EA 4B3GA 2GK6A 4W8QA 4HPQA 3I3LA 4DIQA 2HZDA 4RLQA 1BN8A 3VYUB 1WJEA 3FHNA 2Z6BD 2XSJC 1G59A 4YXWA 2K3PA 1WJDA 3L2QA 3K10A 2IS4A 1P9QC 3CZ6A 1W9XA 4GQNA 4CH7A 3PNTA 4XNFA 2LYCA 3MKZA 2IXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XG2 A;  4I84 A;  1QJV A;  4XLF A;  1X0C A;  2QX3 A;  2INU A;  1OOC A;  2ODL A;  1RWR A;  2PYH A;  5C1C A;  4XKW A;  1DBG A;  4XOT A;  3VST A;  1O8D A;  2NTB A;  1IDK A;  4W8S A;  1O8J A;  1KTW A;  1OFL A;  4URR A;  5C1E A;  4U4B A;  1O8L A;  2Z8G A;  1O8I A;  3WWG A;  4AVZ A;  1WMR A;  2NTQ A;  4XOR A;  2NST A;  2NZM A;  4C2L A;  4OZZ A;  3GQ9 A;  1RU4 A;  2VBK A;  4Z03 A;  2O1D A;  1O8E A;  1O8M A;  4YZQ A;  4YEJ A;  4XLE A;  2NT6 A;  4MR0 A;  4XLH A;  4W8R A;  3GQ8 A;  4OZY A;  4XQF A;  3VSV A;  1K5C A;  2VBE A;  2O0W A;  3VMW A;  1O88 A;  1NHC A;  3T9G A;  2INV A;  1HG8 A;  1RMG A;  3B8Y A;  1VBL A;  4YZ0 A;  3LMW A;  4OJO A;  1CZF A;  1OFM A;  3VSU A;  4XLA A;  2UVE A;  3UW0 A;  1PXZ A;  2NT9 A;  1EE6 A;  2X6Y A;  2VBM A;  4PMH A;  1O8H A;  4XN0 A;  5AMV A;  1H80 A;  2O17 A;  2UVF A;  1O8F A;  1AIR A;  4YZA A;  1JRG A;  1KCC A;  1QCX A;  2VJI A;  4XR6 A;  4MXN A;  4NK8 A;  3GRH A;  4W8T A;  1OGO X;  1PLU A;  1GQ8 A;  2EWE A;  4Z06 A;  2X6W A;  4Z05 A;  3ZPP A;  4XL9 A;  4XM3 A;  3GQA A;  4OJL A;  4NK6 A;  2O04 A;  3ZSC A;  4XON A;  2NTP A;  1O8K A;  4YZX A;  2QY1 A;  2O0V A;  4YEL A;  1JTA A;  4XN3 A;  2X3H A;  2BSP A;  3KRG A;  1BHE A;  3VMV A;  4XMY A;  3JUR A;  4OJ6 A;  3EQO A;  1IA5 A;  2VJJ A;  3FY3 A;  4XKV A;  3B90 A;  3SUC A;  2PEC A;  1KCD A;  2IQ7 A;  3B4N A;  4XOP A;  1IB4 A;  1IDJ A;  4OJ5 A;  4W8Q A;  1DBO A;  2X85 A;  4XLC A;  1OGM X;  2QXZ A;  1BN8 A;  2NSP A;  1PE9 A;  3EQN A;  4HWV A;  4OJP A;  2X6X A;  4EW9 A;  4U49 A;  4XNF A;  1O8G A;  2PYG A;  3GQ7 A; 
#chains in the Genus database with same CATH topology
 4PC1 A;  1BX1 A;  2VZL A;  4U0Y A;  3BT9 A;  1BX0 A;  4JK1 X;  1P4A A;  4C43 A;  2CYY A;  3I71 A;  4KIF A;  1M1E B;  5L3E A;  4C3J J;  1ETV A;  3LWF A;  4RGS A;  3ZPL A;  1N78 A;  4B4D A;  2OQG A;  3TOB A;  2XGX A;  4BAY A;  3LQE A;  3GFM A;  1KQ0 A;  2EZI A;  3BTC A;  3M8J A;  2Q0O A;  3R4K A;  3KP2 A;  4WWC A;  2L9V A;  2ME0 A;  2LDU A;  3HRM A;  3TQN A;  2WC2 A;  2W1O A;  4HDU A;  1VQK I;  3WBJ A;  1LFU P;  3RYP A;  4BPR A;  3HTU A;  3BR0 A;  1SAN A;  3GVA A;  2JDI A;  1QQI A;  3OY9 A;  1D5V A;  1CNF A;  3BDD A;  1FYK A;  1IJF A;  2PQ8 A;  2GIV A;  1U8R A;  3BJO A;  2VKD A;  4EJV A;  3B6A A;  3KFW X;  4OZY A;  2L7F P;  1WOO A;  1HW2 A;  1AOY A;  1YX2 A;  4IHS A;  3F8C A;  3CJT B;  4QTR A;  1XGS A;  2ADU A;  3DV8 A;  2ZIT A;  1JUS A;  2F6C A;  2F5D A;  3VSK A;  3HXL A;  4UY8 I;  2WJY A;  1RZ4 A;  1YI2 B;  4KT5 C;  3Q6R A;  4YHB A;  4Z4Y A;  3VR6 A;  2V1X A;  3COA C;  3RQI A;  4ZYD A;  2C78 A;  1IXR C;  1SMT A;  3RDI A;  3U2Q A;  5FKL A;  5EYR A;  2NAZ A;  3BTI A;  2HOE A;  4DK1 A;  5J35 A;  1IHM A;  1OCP A;  3F23 A;  4BHB A;  1PXZ A;  2NT9 A;  2BE5 F;  5F0C A;  3H5R A;  1ZK8 A;  3DFG A;  4ON0 A;  1YO5 C;  1I6H J;  1W5T A;  4J01 A;  3HIF A;  1PKV A;  3R61 A;  5L3B A;  1YJ9 I;  3PUB A;  4MEX F;  3F3X A;  1WJC A;  1OFC X;  2V7X A;  3ML3 A;  2V7T A;  1YIJ I;  1O8F A;  4A3D J;  4ZYE A;  2AXT C;  3CJN A;  1K6Y A;  1OGO X;  4E6K G;  4CCK A;  1FPQ A;  1Q9S A;  2IS1 A;  3T8R A;  3E1S A;  3F0C A;  3Q9V A;  1FSE A;  3CMM A;  4RB3 C;  5GV8 A;  4QSH A;  5JHF A;  1H85 A;  2QCO A;  3ZSC A;  5E20 A;  1XX5 A;  1I8D A;  3OKX A;  3A3G A;  2BSA A;  3JW4 A;  2KL4 A;  2QEN A;  3CUQ B;  4AVP A;  1R00 A;  2DTR A;  2WY8 Q;  1GXQ A;  2QBY A;  5GAG J;  1JTX A;  2YX7 A;  3OL4 A;  4BH9 A;  1I6X A;  3JTG A;  5K5O A;  2MH2 A;  3BH4 A;  3VMV A;  1OB2 A;  3I4M J;  3NAU A;  2R7F A;  3TH0 A;  1PUF B;  4RPB A;  3HOX J;  3QP6 A;  1S3J A;  3TGN A;  4L5J A;  1MKM A;  4DQ2 A;  2GQQ A;  2JK3 A;  4V02 C;  1TT5 B;  4KNY A;  4MTD A;  2DXI A;  3IC7 A;  2P3M A;  2NT6 A;  1DBO A;  1EA3 A;  2ICW G;  5EJC A;  4MTE A;  4AC0 A;  1KMH A;  3JRG A;  2YPR A;  3WXM A;  1LDD A;  2PI0 A;  5GAE J;  1R49 A;  2NSP A;  2OF7 A;  3BY1 A;  2D2W A;  3EQN A;  2QKM B;  5DS0 A;  4I0A A;  1XQB A;  4UNO A;  3FXM A;  1OYW A;  1D5Y A;  1DQU A;  3ASN H;  2X9D A;  3G6E I;  1YTY A;  4HYE A;  2ESH A;  2Y9Z A;  3WTU C;  1VF9 A;  1EP1 B;  3I5U A;  2LD5 A;  4L18 B;  3V7R A;  2EFW A;  3HUG A;  3KYD B;  3JQR A;  3R6S A;  1BW5 A;  3QWL A;  2K9M A;  2CO5 A;  3AG4 H;  3I59 A;  3QRF F;  2QEX I;  1XGO A;  3H9Q A;  1FOK A;  4KKT A;  3GYH X;  3HKZ N;  2XGJ A;  5GP9 A;  4AD9 A;  5IYR A;  2XHK A;  2XSD C;  4P26 A;  4URR A;  1T56 A;  5J8C A;  3S15 J;  4WWV A;  3R0J A;  1OMI A;  4DW6 A;  2R5Z A;  3ONU A;  1QHG A;  3B82 A;  3H35 A;  4IXA A;  1HKT A;  3L2W A;  1I39 A;  1UD3 A;  4X7C A;  2NST A;  3SEQ A;  3FX3 A;  3NAW A;  1K83 J;  1E63 A;  3OYH A;  3BP8 A;  3G73 A;  2ELH A;  3A4C A;  1UHS A;  3K4J A;  2BW3 B;  3KP3 A;  1A6Q A;  2QZA A;  4W8R A;  2RC4 A;  3ZN0 A;  4CCL A;  1MDM B;  4RS8 A;  1KTV A;  2O0W A;  2CQK A;  1RKW A;  1X1P A;  3H0G J;  4YFN F;  3QFS A;  4BDZ A;  1PUF A;  3T9G A;  1YRN A;  3KZZ A;  1CF7 A;  3F8F A;  4ZDP A;  4RM3 A;  3FBI B;  2ZKZ A;  2VE9 A;  4P1V A;  3FM5 A;  3BY6 A;  2Y30 A;  4PJJ A;  3GLX A;  5K5Q A;  3GTG J;  2ECC A;  3I4P A;  2ZZF A;  4LJZ F;  3QP5 A;  4LLN A;  2Y48 A;  3EDP A;  3CC4 B;  3DBR B;  1CQX A;  1MMG A;  5DEQ A;  2M87 A;  1VQ7 I;  4CYC A;  2KZV A;  4OIQ F;  1YW7 A;  2NPF A;  2KMU A;  3OMY A;  4G7Z F;  3PM1 A;  1V0E A;  1SVL A;  4KN7 X;  2NS7 A;  2Y31 A;  1AA7 A;  5DD8 A;  4Z2Y A;  4MGR A;  1B9N A;  3NE5 B;  1IXS B;  4CCM A;  4GRI A;  4X07 A;  1N07 A;  1LLW A;  5KCM A;  3W2F A;  3CC2 I;  4N4N B;  3OS1 A;  1UD5 A;  3CCJ B;  2JRT A;  4LLG F;  1Z1D A;  5KAF C;  2MSY A;  5H6R A;  1SFE A;  2HKX A;  4LC0 A;  4I6Z A;  1W7P D;  4M3D A;  4A0Z A;  2NVT J;  3J81 k;  1ZKG A;  1ZG1 A;  1IGN A;  4M3F A;  4EJT A;  2DI3 A;  4WZT A;  3ASS A;  3S2H J;  2STW A;  3FXR A;  3KP4 A;  3GBG A;  3KEY A;  1VQL I;  1IN8 A;  1Y0U A;  3PSZ A;  3M9A A;  1A5J A;  1NG7 A;  3U6K A;  2BY1 A;  3I58 A;  1N75 A;  3IRR A;  4RD0 A;  3LAP A;  4L8J A;  2XB0 X;  4ZCI A;  4UHT A;  1MDM A;  9ANT A;  1RPW A;  3Q0V A;  1I50 J;  3G4S B;  3ISP A;  4MQV A;  2E1C A;  5LGN A;  1QRB A;  3ZR8 X;  3DPL C;  4GFB A;  1IB4 A;  2M3A A;  2ID3 A;  1HW1 A;  3PIO F;  3AVW A;  1NHA A;  2PJR B;  1SFK A;  5DD4 A;  1EH6 A;  4DNR B;  1OR7 A;  3RCO A;  1T08 B;  3LAJ A;  1OGM X;  2OC6 A;  3TKY A;  5FD6 A;  4IVN A;  1FNM A;  1UZC A;  1UMQ A;  4ACA A;  1O3Q A;  2VQG A;  3LSG A;  5JLW A;  5H59 A;  1OCZ H;  1YYV A;  4FE4 A;  5BOX A;  4GYG A;  2FEZ A;  4UB8 C;  1REP C;  3S1Q J;  3P27 A;  1DPR A;  1OFD A;  2PYG A;  4FXU A;  3K6G A;  1IRZ A;  1W4M A;  4X0G A;  2IA0 A;  3LA3 A;  2PJP A;  5EZG A;  2BV6 A;  2KLO A;  4ESF A;  2Q6K A;  2CJJ A;  4IRH A;  2E71 A;  2F2E A;  4LLL A;  5FJ8 J;  3DU1 X;  3HYI A;  4RDK A;  1S7E A;  5FO1 A;  2XF5 A;  2HVR A;  1AMO A;  2FNP A;  2CF4 A;  1A31 A;  1YE9 A;  1ZYR F;  2UUZ A;  3FDY A;  3IWZ A;  4XOR A;  3S8P A;  4X1E A;  1LPQ A;  3HM5 A;  2DPU A;  5FLV A;  1MRZ A;  3WNC A;  4NC8 A;  3RQ4 A;  5F0F A;  2RV8 A;  2FU4 A;  1V5G A;  3PSF A;  1X3U A;  5D5W B;  3F72 A;  3W2A A;  3LVB A;  5AON A;  3JAM Z;  3FXK A;  2CSO A;  2ZL6 A;  1FT9 A;  1WVR A;  1UG0 A;  1ERD A;  2WAF A;  2J5P A;  3MN2 A;  4YII A;  4B09 A;  1JA0 A;  4BQN A;  3WGG A;  2FUG 2;  3H5A A;  4C3I J;  2K4B A;  1D3Y A;  1I3A A;  2HVQ A;  4W97 A;  2PJR A;  3CD6 B;  2BMW A;  5DCM B;  4HV6 A;  2W6I A;  1TQM A;  1VQ5 B;  3VSU A;  2HTS A;  2FBH A;  1Z91 A;  3Q3A A;  1TTY A;  1NB0 A;  2O0Y A;  3BCA A;  2OBT A;  4MQ9 F;  2VE8 A;  2BHZ A;  3DLA A;  3ZCO A;  2VBM A;  3DTI A;  2GM4 A;  4PMH A;  1T2K A;  1KYW A;  2HXI A;  3C2H A;  4C30 A;  2XVC A;  5ERI A;  4BJ5 C;  3RZO J;  3WGH A;  4BHC A;  2XAG A;  1EFU A;  3W5H A;  1AIR A;  2UVF A;  4YZA A;  2VJI A;  4P6V F;  4MXN A;  2E1N A;  4QVJ A;  4NK8 A;  3I56 B;  1QZY A;  2WJV A;  3R0A A;  2QQ8 A;  4II2 A;  3VO2 A;  3A02 A;  1MH3 A;  1EF4 A;  2LRE A;  1TYV A;  3RI4 A;  1F9N A;  4NK6 A;  3JSP A;  1D8T A;  3IKV A;  1Z9C A;  2VOP A;  1FTZ A;  4R79 A;  4UZU A;  1BI0 A;  2L9S A;  5TJJ A;  3CB4 A;  3BTJ A;  5F4M A;  3PFI A;  4B44 A;  4G7X A;  3GZ5 A;  2FA5 A;  1QGY A;  2XOK A;  1QUE A;  3HOW J;  4DGW B;  4UVA A;  2F5F A;  3QU3 A;  3H09 A;  1I7P A;  5B66 C;  4DBR A;  2R7S A;  1GJR A;  4V2F A;  2DT5 A;  4XMY A;  2P4W A;  4IL6 C;  5IYW A;  4B3X A;  2UZK A;  1H9T A;  2XKP A;  3B90 A;  1MNM C;  4W1U A;  3RPU A;  4IHV A;  4KKS A;  2VJ5 A;  4RLZ A;  2VNI A;  2VPR A;  2ZJR F;  4C2U A;  5JBQ A;  3K70 D;  4IW3 B;  4O3M A;  4DQL A;  3F8M A;  1R7J A;  3EET A;  4G6D A;  2VN2 A;  2V7W A;  1JT6 A;  4M73 A;  4RB2 C;  2XB5 A;  3FPK A;  2YX4 A;  2RGV A;  1EFT A;  3OIP A;  3BG3 A;  3K1P A;  4CCN A;  2VT3 A;  4O6J A;  3ABT A;  5BQT A;  1RKT A;  3H92 A;  2CUZ A;  4PSW A;  2I5U A;  2GRE A;  1MJ9 A;  1IF1 A;  3KEQ A;  2ZFW A;  3PA1 A;  1V3F A;  1G7C A;  1KON A;  3CCS B;  2XIG A;  1D1A A;  4KT6 A;  2ZJQ F;  2JJ2 A;  3QPL A;  1WSV A;  2JQ7 A;  2GA2 A;  2CBX A;  3ZQH A;  1VHE A;  2IBD A;  4EMS A;  3Q3S A;  2X48 A;  1EH8 A;  3BCD A;  2HXO A;  2ZFU A;  2M7B A;  1WPK A;  3K9T A;  4WZK A;  4RB0 A;  1Y39 A;  3GF2 A;  4P55 A;  5K7F A;  1JJ2 B;  4NDL A;  2LMD A;  2LF8 A;  3VST A;  2YR2 A;  4H4K C;  1ZGJ A;  5LD2 C;  2NS0 A;  5ILV A;  3K70 C;  3RZD J;  1IDY A;  5KHD A;  2VC0 A;  3CUQ C;  2NTQ A;  1BR2 A;  4PUS A;  1R5O A;  3CPW B;  2R6H A;  1U6G A;  1APL C;  2DET A;  2RN7 A;  5LGU A;  2LOO A;  4YIR X;  1RRJ A;  2HQA A;  3M7G A;  1JGG A;  2WTE A;  3PSI A;  4FX0 A;  2JMW A;  2ME6 A;  1NDH A;  3BZ6 A;  4BY7 J;  4PZJ A;  4X06 A;  5FRN A;  4AIH A;  3E6M A;  4Q47 A;  1YI2 I;  4LG0 B;  1BLI A;  2FNA A;  3LMM A;  2JSC A;  3TW6 A;  4C9Y A;  4E7H A;  3GUD A;  1WJA A;  5HOO A;  1T0F C;  1OCO H;  3DPT A;  3U9G A;  2ISZ A;  2HQ5 A;  1FEX A;  1JKP C;  3PSS A;  3SDB A;  2XV4 S;  3V7S A;  1N0V C;  1IXC A;  1S6L A;  3FXJ A;  4U7D A;  5LMZ A;  3HOZ J;  4OJO A;  3SFZ A;  2GXB A;  2L3D A;  2X1E A;  1QRY A;  4X7F A;  1F20 A;  2X53 S;  2L4M A;  2GA1 A;  4HNV A;  2W6J A;  4AUX A;  1FYM A;  2EFP A;  1Y0N A;  1ZG5 A;  2ZB9 A;  3SFI A;  2V9P A;  5JLX A;  4ZJZ A;  3S14 J;  1MMS A;  3LSH A;  4UUV A;  3KE2 A;  1ETX A;  4AWX B;  2KRF A;  4A5N A;  5JFR A;  1V5V A;  3TL4 X;  3LNN A;  4WXD A;  1FOW A;  3RJP A;  3AVY A;  3Q0W A;  4OOV A;  1TSP A;  4W8T A;  2OV7 A;  4RJL A;  2V4D A;  4RD6 A;  1T95 A;  2DDA A;  1SC7 A;  1GVH A;  4K1X A;  1UMK A;  1LE8 B;  3VO1 A;  1SD4 A;  1X4P A;  3E6C C;  4MO7 A;  1H88 C;  2J7K A;  2NVQ J;  1HW5 A;  2NTP A;  3ZQI A;  1B59 A;  4S05 A;  4RD1 A;  2R9V A;  2IA1 A;  2CQ7 A;  2QM3 A;  1VQ9 B;  4EEF G;  3A01 B;  1MNE A;  2VYQ A;  1W36 D;  5HZA A;  1HF2 A;  2E36 A;  3CQZ J;  2LKP A;  4LOC A;  2DA3 A;  2O6G E;  3ZRG A;  2M4K A;  1R4M B;  4HOB A;  1FDR A;  2X0K A;  1UD8 A;  1BHE A;  3AVV A;  3VNU A;  1ULY A;  1YQA A;  2PN6 A;  3ROU A;  1LB2 A;  4MEY F;  3KLO A;  4AID A;  4U87 A;  3L00 A;  1WOS A;  1ZGA A;  5F27 A;  1SFU A;  2PIA A;  4A3C J;  1OR7 C;  3CTA A;  1ON1 A;  1T6Z A;  1Z3Y A;  3K2A A;  3HOU J;  1R5I D;  2Q6L A;  3BNW A;  3ZN1 A;  2C5H A;  4ZH4 F;  3PUM A;  2C5B A;  2IW5 A;  4RCZ A;  1WH5 A;  1WKM A;  2D1H A;  2HZD A;  3P26 A;  3BH6 B;  1UHM A;  4IJA A;  4B3A A;  2NVX J;  1FNN A;  1R4N B;  3FMR A;  2MA3 A;  1WJD A;  1DDN A;  3CC2 B;  1R23 A;  4ZCM A;  3CZ6 A;  4CH7 A;  3PNT A;  2VBY A;  1QH0 A;  1TP4 A;  2DA6 A;  2LYC A;  1ORK A;  3ERM A;  2IXS A;  4ESJ A;  1W36 C;  4RBO A;  3TMO A;  4XLF A;  1QJV A;  4M6V A;  2HMA A;  4M6Y A;  2DMN A;  1A36 A;  4HE6 A;  5EZH A;  4NBS A;  1K61 A;  4W8S A;  1EP2 B;  2RAE A;  3WTY C;  1X58 A;  4U4B A;  2ZXW H;  3W6J B;  1MBK A;  3WTV C;  2DFE A;  4JQF A;  1ON2 A;  1MBF A;  4EM1 A;  4Y15 A;  4BQQ A;  3IL2 A;  1QA3 A;  4OPV A;  2D3N A;  1E1R A;  3K4N A;  1KYZ A;  2ZME B;  5ILU A;  1B9M A;  2RKH A;  2JUC A;  1POG A;  2ESN A;  3H5N A;  1YLO A;  3KP7 A;  4LFU A;  2GXA A;  4XQF A;  1SAX A;  1B8I B;  1MSE C;  2R7V A;  1P7J A;  1TWC J;  1D1N A;  2VT2 A;  1JE8 A;  2Z99 A;  3CC4 I;  2GWR A;  4KIG A;  4RGU A;  4E7I A;  4GGG A;  1W0T A;  1XSX A;  5J1Y A;  4Y9U A;  1DG1 G;  1WQ2 A;  2JN6 A;  3DXJ F;  5GTH C;  3MZY A;  4FAS D;  1QGA A;  2VNH A;  2IA2 A;  3T53 B;  1FP1 D;  3ZBT A;  3I64 A;  2PE3 A;  3SLN A;  5CVR A;  1EJ9 A;  4OPO A;  2DT7 B;  2NOJ B;  1K6O A;  2DOF A;  2LY1 A;  3WU0 A;  3JRI A;  4Q48 A;  4LD5 A;  2GAU A;  5D4R A;  4R71 A;  2DK5 A;  3UW0 A;  3RPU D;  2VOD A;  3KPH A;  3GME A;  3ZMS A;  4LBV A;  3ESW B;  2E1O A;  4KN4 X;  3E3V A;  5HLT A;  1GLN A;  1Y8Q B;  2W7N A;  3CCJ I;  2LKX A;  3PVD A;  5AMV A;  3ZMU A;  1Y6I A;  3H36 A;  3VSL A;  4FTH A;  2EQR A;  4IQ4 A;  2KDZ A;  1MBJ A;  1X2M A;  2BVL A;  3OW2 B;  3GFJ A;  4OU0 A;  2FOK A;  3WTZ A;  3G1M A;  2QSG X;  5IOZ A;  4XL9 A;  1LFP A;  4P2N A;  1XS9 A;  1WCM J;  1IN4 A;  2E1B A;  1KRH A;  1U5T B;  1X19 A;  2Z9O A;  3S93 A;  2DA5 A;  2A5W A;  2V5I A;  5FB2 A;  3G4S I;  2DO7 A;  1GXP A;  3IH3 A;  2WYR A;  3H0D A;  4Y7N J;  2ISY A;  4RA2 A;  5HNH A;  2G0Y A;  4ZYH A;  2KKO A;  1LUJ B;  2MAB A;  4MFD A;  2F1L A;  1R1V A;  4HA8 A;  2XAS A;  2KJB A;  1YIT B;  2ECB A;  2G9W A;  1J0R A;  4NBQ A;  5CVI A;  3UKG A;  1F5T A;  4Z1M A;  1B8I A;  4IRG A;  4A3B J;  5EDN A;  3ISX A;  4BXX J;  4C3H J;  4HX4 A;  5DM6 F;  4LBZ A;  3SY2 A;  4CZC A;  5FLX K;  2I1L A;  2W84 A;  1DU0 A;  4PAB A;  1P4X A;  2R4G A;  5D5U B;  1D8K A;  1BC7 C;  1E62 A;  2CC2 A;  1X1D A;  1GV5 A;  3O8H A;  5C44 J;  3WTS C;  3MQ0 A;  5K7Z A;  3J7A Y;  2QSH X;  3OYG A;  3MCZ A;  1RUO A;  1RES A;  1Z05 A;  4YAW A;  2X6X A;  3U6B A;  4L5I A;  3ASO H;  3K0L A;  4P9F A;  5CVJ A;  3A3B A;  4A93 J;  1KK2 A;  3G2B A;  2HTJ A;  1JGS A;  4F91 B;  1S7O A;  2W24 A;  4Z4V A;  2R3S A;  5KVR A;  2G7H A;  1XDU A;  3REO A;  2JA8 J;  3HSR A;  3HGY A;  1FNC A;  3JQQ A;  1FRN A;  1XG2 A;  2QX3 A;  4I84 A;  2ODL A;  3S3M A;  2GQF A;  2HLD A;  3GTK J;  2DMT A;  2DAO A;  3BR2 A;  2DDB A;  3P9K A;  3QYE A;  4HX8 A;  1E3O C;  1YX5 A;  4XOT A;  4B48 A;  2EBI A;  3M8F A;  2Q6O A;  2P5K A;  2UV1 A;  2GLO A;  4KYW A;  2ZXH A;  5FFZ A;  1Z7U A;  3OEE A;  2DJN A;  2M4G A;  3WWG A;  3HHH A;  3OV8 A;  1BN5 A;  4H9G A;  1PP7 U;  2FJ1 A;  1U5T A;  2VQL A;  1W87 A;  4ROX A;  1FC3 A;  3RKY A;  1W35 A;  2MW8 A;  3NQO A;  4OAY A;  2D5V A;  3WTT C;  4OOS A;  4A69 C;  5LFA A;  5DS9 A;  1EZG A;  1FBQ A;  2IGK A;  2V9V A;  3J80 Z;  4NC6 A;  2M9H A;  3IAS 2;  2AHQ A;  5CVU A;  5E18 F;  2HOT A;  1QO0 D;  2AQF A;  4LMY A;  4D5C A;  1QQ1 A;  2EZH A;  2L2O A;  3SZG A;  1VQ6 B;  2FOW A;  5IPA A;  2G7U A;  5C3E J;  1E3P A;  3CD6 I;  2PMH A;  1FRQ A;  2LSO A;  1H42 A;  3G05 A;  1VQ5 I;  3CP2 A;  2HEO A;  2YWG A;  3OW7 A;  4YRV A;  3CCM B;  2CND A;  2F43 A;  1HKQ A;  3FPP A;  1EA0 A;  1YJW B;  5JLV C;  4CO8 A;  2E2J J;  1YLF A;  3F9K A;  1MJB A;  3WND A;  3WY9 A;  1M90 D;  3S16 J;  1TYU A;  5EF6 A;  1B4A A;  3PIP F;  5KAI C;  1AHD P;  1E79 A;  3HKZ A;  1FY7 A;  2IGM A;  2MC4 A;  4DNC A;  1VLY A;  2WR8 A;  2HGC A;  1J09 A;  2OJE D;  3D1N I;  1XTA A;  2QBY B;  3I56 I;  1H89 C;  2OUM A;  1MAB A;  1TLL A;  2GK7 A;  4YFK F;  5LHG A;  3CC7 B;  2XC7 A;  2C4U A;  5H20 A;  4TN1 A;  1SMY F;  4HW0 A;  2V7V A;  1ETO A;  1G3T A;  3T5X A;  2OBS A;  2QGU A;  4EV0 A;  4AF6 A;  3WGI A;  5FIU A;  3HSE A;  4YG2 F;  2MH9 A;  3DDY A;  5FLM J;  1VQP I;  4HF1 A;  5B3S H;  2R92 J;  1PLU A;  3GRH A;  3DWL E;  5KSW B;  1BJZ A;  3CCU B;  4Z05 A;  4E7Z A;  3WG7 H;  5GTI C;  1Y1V J;  3KIO A;  4OJL A;  3T51 B;  3VPR A;  3TED A;  4FX4 A;  3EYY A;  2HQR A;  1G3W A;  3PEN A;  2XF6 A;  3WTW C;  4E7J A;  4RGX A;  4BL0 B;  1QA6 A;  3DTK A;  1QVF B;  1EFR A;  2JVG A;  2WPD A;  1DU6 A;  2E1R A;  4M53 A;  4EJO A;  4NC7 A;  3DKW A;  4C2T A;  2HPM A;  4YC5 A;  4G6T B;  4HST A;  1LLZ A;  1QVG B;  5F6F A;  2VNK A;  3OR2 C;  2BEO A;  1BM9 A;  2JWT A;  3HUG B;  3K4M A;  5C4J J;  3EQO A;  2PLY A;  2RVC A;  3FY3 A;  3SUC A;  2EFQ A;  1QFY A;  2F4M B;  3CUO A;  2ZZE A;  3V8K A;  2LVS A;  3E5Q A;  3ZOB A;  3I59 B;  4ZYG A;  1COW A;  1UEL B;  4NUB A;  4XOP A;  2CUF A;  3NEU A;  1WFX A;  4J00 A;  1LVA A;  5DTD A;  4R1H A;  1XFO A;  4TMZ A;  4KIB A;  3CCS I;  1ETK A;  3PUF A;  2R5Z B;  2A6H F;  3IV5 A;  1ETY A;  1FYL A;  5E8I A;  5DDG A;  4HEA 2;  4OPW A;  1LEA A;  1X1B A;  3S32 A;  3BRO A;  3V42 A;  4M3E A;  3PNY A;  4FE7 A;  3S1R J;  4Z4Z A;  4XBF A;  4ENJ A;  1ZM4 A;  3QE2 A;  3M07 A;  3ZQL A;  3TP0 A;  3H3U A;  3BR5 A;  4PC6 A;  4D7M A;  4G12 A;  1RWR A;  2I8D A;  4EJW A;  4PAA A;  1OJL A;  2H94 A;  1YRN B;  3GVJ A;  3QOD A;  4TKO B;  1CF7 B;  3KCC A;  3B02 A;  4HG2 A;  1Q86 D;  1STZ A;  2R93 J;  1ETW A;  3WQZ A;  1ZRC A;  4I02 A;  2DBB A;  1W0U A;  1BR4 A;  5E1W A;  2XRO A;  4KUM A;  4GDF A;  4QPQ A;  1HA3 A;  4ENK A;  1VQ4 B;  1WMR A;  2XGD A;  2GJK A;  1E3H A;  5K5R A;  2LY9 A;  4CYC B;  1SVO A;  3HEF A;  3G71 B;  5D6F A;  4OP7 A;  1VQO B;  4OZZ A;  6PAX A;  1XSV A;  1AIP A;  3RY8 A;  3KET A;  3HL2 A;  3CCQ B;  1YS7 A;  2YSR A;  1R5N A;  3PQJ A;  4EM2 A;  1ZEL A;  4RM0 A;  4YAL A;  1PP8 F;  3V8L A;  2MLG A;  1UD2 A;  2ZTN A;  3RKX A;  4PJN A;  1ZUN B;  1O88 A;  1TVC A;  2XPW A;  2R7T A;  1QPI A;  3GVL A;  3VWB A;  4TMW A;  4HBL A;  3WG9 A;  4LBY A;  1FMW A;  2CK3 A;  1LKX A;  2VKH A;  3AG1 H;  1G7S A;  2G0E A;  1RUN A;  1OYY A;  1M1K D;  1HG8 A;  2VLA A;  4OIP F;  5M3M J;  2Q8K A;  3MKL A;  3OYK A;  2P5L C;  4QLC U;  3D5R C;  1ZN2 A;  2Y0S A;  2B0R A;  2EIM H;  2HWV A;  3KEO A;  5JMC B;  3JRD A;  3IUO A;  4BXU A;  1JHH A;  4PJ0 C;  3HB9 A;  3A1P A;  2NVU B;  4FHT A;  1K28 D;  1R6R A;  1O8H A;  5B1A H;  1XE1 A;  3AGP A;  1HA8 A;  1U8B A;  1O4X A;  2UWM A;  3ABU A;  2D45 A;  3VYS B;  3RKW A;  2CS3 A;  2Z33 A;  2L01 A;  2WB1 A;  3CCY A;  2DA7 A;  3BR3 A;  1VQ9 I;  2NRA C;  4QVA A;  1SFO J;  2JA2 A;  5A8A A;  3OYJ A;  2CQX A;  4XSX F;  1FSH A;  3R6J A;  4G7W A;  4UB6 C;  1VI0 A;  2ZBV A;  5IT9 Z;  3OSF A;  4L9N A;  4N3G A;  2ZME C;  3MMP A;  3BJ6 A;  1KA8 A;  3BC8 A;  4GCV A;  2JIZ A;  2NXN B;  1BW6 A;  2DOA A;  3SEZ A;  3G1O A;  3JUR A;  2VJJ A;  2IVM A;  3L7W A;  1OQY A;  2KIM A;  2ZC2 A;  5E1Z B;  1HF0 A;  1UG2 A;  4HLY A;  3EUH A;  3SJM A;  4BU2 A;  3V7A A;  2L9R A;  4LIV A;  3HBL A;  4LG3 A;  1O3S A;  1XB2 A;  3ELK A;  4RDU A;  1IDJ A;  2P7C B;  4OJ5 A;  1WRJ A;  3C7J A;  5HVQ C;  3OJX A;  1EV7 A;  1WU8 A;  5E1X A;  2K9S A;  2VB6 A;  1YS6 A;  1KK0 A;  4RB1 A;  5A2Q Z;  2XAU A;  4ABZ A;  4ZTF A;  2XEX A;  4P5O A;  4U49 A;  4PGG A;  2EA2 A;  3I55 B;  2ZSH B;  5CQG A;  5F1R A;  5DCF A;  2MC3 A;  2VL8 A;  2M0C A;  2AXL A;  2XPU A;  4KJZ A;  2HOS A;  2JA5 J;  1O7F A;  2O9L A;  1HLV A;  1OGI A;  4Q7J B;  1K7A A;  1QNT A;  3TDZ C;  3N05 A;  2CV1 A;  2QSF X;  2QGG A;  3L2U A;  4RGR A;  2CGP A;  2EV5 A;  2IJL A;  2W00 A;  4QFM A;  3AVX A;  1IRF A;  2FBI A;  3N90 A;  5L3F A;  4NCN A;  5C1C A;  2V9K A;  3QSY A;  4RDL A;  3GFI A;  1OB5 A;  5FRO A;  5D5V B;  1OFL A;  1U5T C;  2CFO A;  2V1U A;  3IH2 A;  2H27 A;  2DQR A;  2HU9 A;  2JTV A;  2EA4 A;  3DP7 A;  4P12 A;  4HF0 A;  1LFB A;  3CPX A;  2KDO A;  3V4G A;  4NNJ A;  3N4M A;  4OWR B;  1KZH A;  1T6Y A;  2RQQ A;  2O1D A;  3CCE B;  3J80 K;  1O8M A;  5LHI A;  1D2E A;  2L5Q A;  1WZ2 A;  1WDT A;  2XAJ A;  2YU3 A;  1J5Y A;  1DDG A;  5HDK A;  2NS8 A;  2W57 A;  3S3O A;  2QDX A;  1T6S A;  4HSR A;  5KNL A;  3OS2 A;  2LK2 A;  4N0B A;  4RM2 A;  2JUG A;  5E3N A;  1VHO A;  1R5H A;  1UAA A;  4JX6 A;  1XCV A;  3WE2 A;  4YDT A;  2NYX A;  1ZLK A;  2Y0S N;  2ZBK A;  2PMU A;  3OWT A;  3E6D A;  2XND A;  3QPS A;  4DK0 A;  2OTJ I;  3PO3 J;  4A12 A;  1CZF A;  3VYT B;  1ZR2 A;  4WF2 A;  1SVM A;  4IX7 A;  2O7O A;  2HDN B;  2LFB A;  1VND A;  1Y56 A;  2X6Y A;  2Y0M A;  2WB1 N;  4A3M J;  2HDW A;  2EV0 A;  1IJE A;  1JA1 A;  4IZZ A;  3FJO A;  1H8A C;  4X0C A;  1JB9 A;  1VJS A;  1RQP A;  2GOM A;  3LST A;  1RC9 A;  5HLI A;  2BF4 A;  1Y8R B;  4L9J A;  1B1B A;  3ULQ B;  5D5X B;  4UZE A;  1WWX A;  3E7L A;  2BOL A;  1TC3 C;  2VNJ A;  4LB6 B;  2O04 A;  2VFO A;  3HRS A;  3SQV A;  1E43 A;  3MVP A;  2B7E A;  4D5F A;  5E17 F;  1YIT I;  2KIQ A;  3MWM A;  2XT4 A;  1BA5 A;  4BHP A;  3VMF A;  5IYN A;  4KH3 A;  4Z4S A;  1K8F A;  4DQK A;  4Y3O A;  1R1U A;  1WJF A;  4A0Y A;  5DUI A;  4KMF A;  3CW2 A;  3OFN A;  3FXU A;  4P6Y A;  2A07 F;  4TSF A;  3ML6 A;  4J0Q A;  4U7B A;  1GR1 A;  2Z1D A;  4I99 C;  4M6X A;  3HOT A;  3OOP A;  2EJR A;  3R6K A;  4IOC F;  1A8P A;  3FHZ A;  3OPO A;  2VKV A;  1H8E A;  4ZGQ B;  4D7N A;  2P6T A;  1Q1V A;  4W8Q A;  2KT0 A;  1UFM A;  4EVI A;  1UHW A;  3E5X A;  4DIQ A;  4KFC A;  2DEU A;  4RLQ A;  3K7A J;  4MFE A;  2QF7 A;  5GPC A;  1OCR H;  1WJE A;  4CXF A;  2VKE A;  1KJZ A;  3Q39 A;  4OOX A;  3SKB A;  1G59 A;  4MIM A;  3W6V A;  1VQP B;  3ABL H;  5IP9 J;  3J7A O;  1P4M A;  1S7A A;  1KU7 A;  2XTX A;  4GQN A;  1W9X A;  5L46 A;  2GXG A;  3JRF A;  4XNF A;  1KU9 A;  1BL0 A;  5FO0 A;  3LSI A;  1W1W E;  4Y9R A;  3CO6 C;  4P25 A;  1QX4 A;  4AIK A;  1W34 A;  4DYQ A;  1B23 P;  4B47 A;  4XRF A;  2C6Y A;  4X6A J;  4XKW A;  2E5Z A;  1N0U A;  2D9R A;  1DBG A;  2BY0 A;  3QYF A;  3I0T A;  3LSR A;  1ZM2 A;  4IEJ A;  1S5L C;  1Z6R A;  5E3O A;  3AST A;  4OPS A;  2E60 A;  2FX3 A;  3A1Y A;  4G9Y A;  1S0U A;  1XGN A;  2ELJ A;  3VYR B;  2JT1 A;  3AKZ A;  3HPH A;  4HDV A;  1O8L A;  2VFQ A;  1QUF A;  4AIJ A;  2HDD A;  1WSR A;  5E3L A;  5EG0 A;  1QZZ A;  3F8B A;  4IKF A;  4OM9 A;  2VBX A;  3B6C A;  3E0J B;  3RKQ A;  2V6E A;  1VQ6 I;  1Z21 A;  4JMQ A;  1FZP B;  1QGP A;  3LFU A;  2F5C A;  5J40 A;  2L02 A;  2DPD A;  2M1B A;  1QFZ A;  4X8I A;  3NWT A;  1TNT A;  3CMA B;  1O8E A;  2K7L A;  4YZQ A;  4YEJ A;  5KW9 A;  1JJ6 C;  1K4T A;  3CCM I;  1O3T A;  2NVY J;  2ZNZ A;  2RC6 A;  3GVK A;  2VUM J;  4I2O A;  1YJW I;  1OHH A;  2QN6 A;  4JOM A;  5THX A;  4BEH B;  2XT2 A;  2E2H J;  3BTL A;  5BMZ A;  4WZE A;  2BV3 A;  1MMA A;  1P6R A;  1S8N A;  1WXR A;  1ELO A;  3HPG A;  2DFI A;  2N8G A;  2CU7 A;  2QKL B;  3L09 A;  4QPO A;  4IHT A;  1OB0 A;  5IYQ A;  1BI3 A;  3R60 A;  5L3G A;  1ZRF A;  3CC7 I;  2GJP A;  2WAD A;  3L9F A;  4S0H B;  4U88 A;  1TWA J;  1K9M D;  4WCG A;  1I5Z A;  3E6B A;  2UVE A;  1TW3 A;  4IOA F;  3K69 A;  2JJ1 A;  2DN0 A;  3FK7 A;  3A8I A;  1G7T A;  3TO6 A;  3HC7 A;  3MCA A;  3NWS A;  3PNV A;  4AYB A;  1OYI A;  4M3B A;  3FK6 A;  1TUI A;  3CCU I;  1AKH B;  1IV6 A;  2IS2 A;  4BE2 A;  4ENM A;  4U9U A;  3CMY A;  4YAU A;  1PJR A;  3A0H C;  1IO2 A;  1N25 A;  2X1C A;  3KP6 A;  5J4V A;  1CNE A;  2B63 J;  2H8W A;  3JRB A;  3IWF A;  1EP3 B;  2VXD A;  5C4X J;  2XRL A;  5JR3 A;  4XIC A;  1FOY A;  2X6W A;  3QOE A;  3SJZ A;  4ENN A;  4Y13 A;  3TBI A;  2R7Z J;  5A89 A;  3BQY A;  1LEB A;  3U2R A;  4B1R A;  3SYJ A;  1FP2 A;  4M9X A;  2ZZG A;  5IT9 K;  2EV6 A;  2F48 A;  1IRG A;  1TNS A;  4Z6Y A;  2CW7 A;  2CG4 A;  4E7K A;  3BLY A;  1K79 A;  3W5V A;  4BE1 A;  4Z4U A;  3FBN B;  3H9J A;  4DNT B;  2BM6 A;  5LHH A;  2PEX A;  5DYM A;  1S4M A;  2NNN A;  3GEZ A;  1XG1 A;  1AWC A;  3JCU C;  2DFF A;  3EUH C;  2EZL A;  3GZ6 A;  1CLW A;  1KCC A;  4CSW A;  4CGZ A;  2F4I A;  5CPR B;  2Z5U A;  4A6E A;  3DU5 A;  4BEH A;  3TDU C;  2K9N A;  3TO7 A;  3U1D A;  2A05 A;  3MHP A;  3OYE A;  1HDD C;  3AL0 C;  4UVB A;  2LBF A;  3CO7 C;  1ZRE A;  1HOM A;  3WHB A;  5BNG A;  3G3Z A;  2DCE A;  1G4D A;  1IUF A;  1D1C A;  4HWV A;  2VBT A;  1E2X A;  1OPC A;  2DQL A;  2IGO A;  5B5E C;  2HYJ A;  1BC8 C;  2YU9 J;  3K2Z A;  5CVV A;  2DCU A;  5E8G A;  5FKK A;  1LVK A;  2WZN A;  3OP1 A;  3AVU A;  2FQ3 A;  1AKH A;  2QUF A;  2INU A;  1OCC H;  1VQM B;  2ZTG A;  3IH4 A;  3C2G A;  3L2V A;  1U2R A;  3BR1 A;  1VQ4 I;  4A3I J;  3G71 I;  5FKM A;  1ENH A;  1NH3 A;  1VQO I;  3HOY J;  2R7X A;  2FVG A;  1U3E M;  3CF5 F;  1WI9 A;  4OMY A;  2C2W A;  2E19 A;  3CCQ I;  1D0Y A;  1ZM9 A;  3A8J A;  2GZW A;  3W2W A;  2Z8G A;  1R22 A;  1WI3 A;  4BNC A;  4MYU A;  3A35 A;  2BVM A;  2VOO A;  3BC9 A;  2ZBU A;  4I76 A;  2M30 A;  2OPT A;  4BBS J;  3I53 A;  1RU4 A;  4I7H A;  4CIC A;  1QA2 A;  3Q9S A;  1W0K A;  1F1Z A;  2VFP A;  2VON A;  3LL7 A;  4RCY A;  3Q6Q A;  1G6N A;  4F55 A;  1Z77 A;  1UST A;  3M3Y J;  1BPL A;  1RIO H;  4P22 A;  4BXF A;  5BS6 A;  3ZZU A;  4Z4R A;  1NHC A;  3JRA A;  1C0W A;  5J3O A;  4AF7 A;  2A6E F;  3VNV A;  3SZE A;  2W25 A;  5LEJ A;  1EWY A;  4JRA C;  4YAO A;  1K78 B;  3GTP J;  1TWF J;  1QPM A;  4KMU X;  1TQP A;  3W2G A;  4AYB N;  1D0Z A;  2QQB A;  3LO8 A;  2QYO A;  1UD6 A;  1W0J A;  1Y0R A;  4TV7 A;  1DGR M;  3N6Z A;  1TWG J;  2AS5 F;  3MZH A;  5HS7 A;  4L0Y B;  1SD7 A;  3O8G A;  1K4Z A;  2BM4 A;  2PX9 A;  3I54 A;  1EE6 A;  4I98 B;  2B7C A;  4PC2 A;  4LGW A;  4NHJ A;  4HAM A;  1V55 H;  4HNT A;  3JAM K;  4P96 A;  1ZQ3 P;  1IDZ A;  1H8H A;  3SEJ A;  3M4O J;  2XUB A;  1YIO A;  2ID6 A;  4BQA A;  5CYV A;  2FF4 A;  2HYG D;  3V7C A;  2DJI A;  2MGQ A;  4CYD A;  5L3D A;  2XKO A;  3F8N A;  2V26 A;  5D4S A;  2CFX A;  2L7K A;  1GQ8 A;  1P92 A;  3L2R A;  1D1B A;  5LLQ A;  1Q81 D;  1ZAO A;  4XM3 A;  4ASN A;  1E3X A;  2P6S A;  5IYB J;  2DIE A;  5TGT A;  1PJ6 A;  2P81 A;  4H0E A;  1FMV A;  3E5U A;  3F22 A;  1DAB A;  3OIO A;  1HXD A;  2K27 A;  4YZX A;  2VI6 A;  3I9V 2;  4PK4 A;  2OAZ A;  2RNG A;  2MG4 A;  4PCQ A;  3OJW A;  3QFR A;  1DP7 P;  1Z6T A;  1YHQ B;  1F36 A;  2FRH A;  2BSP A;  2OTJ B;  1TYW A;  2VFM A;  3OIQ A;  3CCR B;  3KRG A;  1IA5 A;  1I1G A;  1MIJ A;  2XC1 A;  4QWQ A;  4XLN F;  1DDI A;  4X7E A;  2DY1 A;  1R9T J;  1G8X A;  3GTL J;  2JVH A;  1JKQ C;  3ZQ7 A;  5FNZ A;  1OLT A;  3AAF A;  2B7B A;  3ZBU A;  2PLF A;  1G3Y A;  4G94 A;  3I55 I;  1K78 A;  4CCO A;  1T39 A;  1PE9 A;  3ZQF A;  1XMA A;  5DM7 F;  2O3F A;  4OJP A;  5HS9 A;  2K9Q A;  1LJ9 A;  1ONV A;  3BCB A;  3EUK L;  4IPA A;  4XSZ F;  4EH1 A;  1MBE A;  2K86 A;  2CUJ A;  2BXY A;  2UXX A;  3BWG A;  1R36 A;  1Z7L A;  4YEL A;  2Q2E B;  3I1F A;  5LEK A;  2V7F A;  2PMD A;  5HXB A;  4PFO A;  4YIF A;  3DQV C;  2QVO A;  1MH4 A;  4Q5S F;  1R5B A;  1FJL A;  4V2G A;  3ZUG A;  4FIS A;  1QZE A;  2XAQ A;  4BBR J;  2OBP A;  2NTB A;  2PFB A;  4G7H F;  1IDK A;  4KIT B;  1KTW A;  3BQJ A;  4LB5 A;  3CCE I;  2Y69 H;  2IRF G;  3K1M A;  1A04 A;  1QVU A;  3K4C A;  3QYB A;  3OYA A;  2C77 A;  2CW5 A;  4TMX A;  1O8I A;  2F4O B;  2J8I A;  1OGJ A;  5H6Q A;  1YW8 A;  2XAH A;  1PVE A;  4M72 A;  2EH3 A;  4MLO A;  2WA0 A;  3WTX C;  3PL8 A;  1TWH J;  3GQ9 A;  2KP6 A;  1HDP A;  2QMU A;  3GWZ A;  2OA4 A;  3QPT A;  1ZAR A;  4HX7 A;  4M9Z A;  1YJN B;  1TLH B;  3SDG A;  1OKR A;  1JTY A;  3U1K A;  4CDG A;  1GAQ A;  4OOI A;  5HDG A;  4WQM A;  2FSW A;  3HZJ A;  1VZ0 A;  2ACJ A;  3LA7 A;  2H1K A;  1W5C C;  2H6B A;  4P3Y A;  5TIS C;  4P9S A;  2AHO A;  4HZF A;  1DUX C;  3Q38 A;  2OD5 A;  4E7S A;  2F5V A;  2CQQ A;  5EEG A;  4PFP A;  1ZLJ A;  2HNH A;  2XF7 A;  1RQR A;  1OFM A;  3D5L A;  2H1L A;  2LLK A;  4UVC A;  2PBI A;  1GDT A;  2LC2 A;  5E79 C;  1R58 A;  1JHF A;  2QYU A;  2HQN A;  1J7K A;  1JUP A;  2YWF A;  3ZQQ A;  4JX4 A;  4V19 K;  5D6E A;  2Q2E A;  2EZK A;  3RSN A;  2X4H A;  4Y4R A;  1EXM A;  1XCB A;  2DT6 A;  3GW2 A;  2FBK A;  3ZMZ A;  1JJ8 C;  1D8J A;  2HVS A;  1RI7 A;  4CA0 A;  4XKB A;  1HZE A;  4F3Q A;  2Q6I A;  1KQS B;  1KQ5 A;  5F64 A;  3DU6 A;  1FND A;  2OZU A;  5IOY A;  4XRM A;  1GV2 A;  1U9O A;  1FOX A;  1FX0 A;  2VBV A;  4LBW A;  2DMQ A;  2BGC A;  3V76 A;  3AVT A;  4L0Z B;  1XDS A;  5BPD A;  5J3L A;  4J19 A;  2KIF A;  2H8R A;  3VB2 A;  2VIX A;  1ETQ A;  3LFK A;  2FE3 A;  1KU3 A;  3T0Y A;  5TRD A;  5TV2 A;  4Z4W A;  2DK8 A;  2BM5 A;  1T98 A;  1GUU A;  3FXQ A;  4L9T A;  1U78 A;  5E6T A;  1W7P A;  2O0V A;  3ABM H;  3JTH A;  5LRR A;  3ZMT A;  3MFK A;  1IAW A;  2BX6 A;  4PGH A;  3B8H A;  3OOC A;  4CUG A;  2PEC A;  4HNU A;  3CDI A;  5F04 A;  2KRH A;  4Q4Z F;  2BHY A;  5IP6 A;  2HDC A;  4M0L A;  2L7Z A;  5FO5 A;  1MD0 A;  2BN4 A;  3F6O A;  3ONQ A;  1BMF A;  4PJM A;  4FQG A;  1ZHF A;  2JRM A;  5JHU A;  2X85 A;  4NQW A;  2STT A;  2WAE A;  3KP5 A;  1KK3 A;  1GT0 C;  4RPD A;  3H9G A;  2QXZ A;  2IPQ X;  3SYT A;  3GSI A;  2ELK A;  4OIO F;  3FKS A;  1BOB A;  3A2K A;  3ZXS A;  2VQC A;  4L9V A;  1FBS A;  4YFX F;  2DOE A;  2R7R A;  1TL8 A;  1SFX A;  2JPB A;  1BJA A;  4KIC A;  1MND A;  3TP3 A;  2TRT A;  4PDK A;  1JKO C;  3DTE A;  3KEW A;  3C1D A;  2E2I J;  1O8G A;  1TZL A;  2VJ4 A;  3S2D J;  2CUE A;  1UCR A;  2DU9 A;  3HOV J;  1BIA A;  4N9I A;  5FKN A;  2FX0 A;  3ZMD A;  4A6D A;  3QPH A;  3W2E A;  2PYH A;  2L54 A;  1Q1H A;  4BDY A;  5F0H A;  4QUZ A;  4WXC A;  5A88 A;  1KD1 D;  1H9G A;  2IOU G;  2D3L A;  1X2N A;  2VPL A;  3AK5 A;  3CMA I;  5C1E A;  3OS0 A;  2JA6 J;  1LM1 A;  1IV8 A;  2D74 A;  5J1U A;  1FNB A;  3K4K A;  2EPF A;  3CCV B;  4AVZ A;  3I4N J;  3ECH A;  4RD2 A;  4U0V A;  4F52 A;  3AGQ A;  1YFH A;  2EFG A;  2JJ7 A;  4AM3 A;  2XNJ A;  2IGN A;  1NK2 P;  3OYM A;  1T38 A;  4ZDO A;  5EGO B;  1E0E A;  4ZTJ A;  2GPJ A;  2M5S A;  5HZB A;  4UV8 A;  4MR0 A;  4XLH A;  4EAT A;  3TW7 A;  4JX5 A;  4YFO A;  3T8T A;  4E4H A;  2RNJ A;  2LTP A;  3GTO J;  2J8K A;  2HS5 A;  2ZCW A;  4XRS G;  1PJ7 A;  2BY3 A;  4BKX A;  2E1M B;  1X3Z B;  3ABK H;  3QFT A;  3CJR B;  1MBH A;  2K40 A;  3DBH B;  2E7X A;  2FXA A;  2JA7 J;  4GO1 A;  3B8Y A;  3MEX A;  3ZGK A;  4LK1 F;  5HOD A;  2EWN A;  4EGZ A;  3TO9 A;  2OYN A;  3OZU A;  2Q1Z B;  4KKU A;  5F4O A;  1WHU A;  5FRM A;  3VOE A;  1UB9 A;  4XLA A;  1JT0 A;  4P1W A;  1GVJ A;  3LOC A;  3HOS A;  2GOX B;  2HI3 A;  2TDX A;  2E7W A;  3PQK A;  4KDP A;  2HOA A;  2COB A;  4P3I A;  1JNY A;  3GXO A;  3W6K B;  3OZV A;  1D0X A;  2MBF A;  2X1D A;  2R7W A;  2HPI A;  4ANJ A;  3A03 A;  3PA2 A;  2LR8 A;  3RPQ A;  2C4T A;  3ES9 A;  3CCL B;  2P0W A;  1TYX A;  2CV2 A;  3GX4 X;  4N3N A;  2O17 A;  1QCX A;  2EIN H;  3OYF A;  3ASP A;  3S1N J;  2KJC A;  3L1P A;  2K4J A;  1S72 B;  3E1Y E;  1T5E A;  1VFC A;  2VBW A;  5ICF A;  2KHM A;  5M5Y J;  4G6I A;  1VQ8 B;  1J9Z A;  2W7Z A;  3AL0 B;  3LA2 A;  4XON A;  3G1L A;  1O8K A;  1V0F A;  5EEH A;  2CH0 A;  2QLZ A;  1YOV B;  1E17 A;  3W3C A;  1BI1 A;  2TCT A;  4D0P A;  5IP7 J;  2VC1 A;  2O03 A;  1MSF C;  1CGP A;  5EGO A;  2YWE A;  2WBM A;  1FLI A;  2B0L A;  4LIU A;  4XKV A;  1TBX A;  3S3N A;  4M9S A;  3F6V A;  2VQH A;  3QOP A;  1X3W B;  3T1B A;  4F7D A;  2KIS A;  5HNF A;  2DA4 A;  5JI6 A;  3B4N A;  3RTR A;  3AFH A;  5IYC J;  4B3G A;  4HPQ A;  1BJK A;  2BBY A;  2LF7 A;  5M3F J;  3GTJ J;  5TR9 A;  4GXO A;  3H9N A;  1VQN B;  1BN8 A;  2OTL B;  4A3K J;  3VSV A;  3S17 J;  3J7Z I;  2XSJ C;  2ZXJ A;  2Z6B D;  3GCM A;  5DV5 A;  3RIQ A;  2DER A;  1VQM I;  1OCT C;  2IS4 A;  3CUQ A;  3QU6 A;  3ZZ0 A;  1E64 A;  2MD5 A;  2BY2 A;  2IS6 A;  2VXZ A;  3DKX A;  4M74 A;  3H3V K;  2P7V B;  4GYI A;  1JKR C;  1EH7 A;  2V4J C;  4XKC A;  1SEU A;  5ICC A;  1N77 A;  2R7D A;  2QWW A;  2RQP A;  1XD7 A;  4RMN A;  2DA1 A;  2EIK H;  1ZRD A;  4RAG A;  4YEI A;  3PFY A;  2DMU A;  3FXO A;  3CXC B;  1T0F A;  3GLL A;  2VFN A;  2MFZ A;  5CQE A;  3O2P E;  2K85 A;  3FKI J;  3KZY A;  1G3S A;  1VLO A;  3J7Y J;  4BQO A;  3O6B B;  4LIT A;  1XC5 A;  4TMT A;  1I18 A;  2V31 A;  2QQA A;  4MYT A;  3J81 Z;  1N08 A;  4Z03 A;  2AO9 A;  2F1M A;  2K9L A;  3FIW A;  4XLE A;  1QGZ A;  4S04 A;  3KLN A;  1FIP A;  4FT8 A;  2OBR A;  4MNU A;  3BG9 A;  5DSZ A;  4UUS B;  2O8K A;  3W2I A;  1WH7 A;  4FWT A;  1USS A;  2P8T A;  3PET A;  2DOG A;  4UAJ A;  1KC8 D;  4YCQ A;  2YUH A;  3CDL A;  1QBJ A;  3KYL A;  1J59 A;  2ZL5 A;  3EPZ A;  3KZI C;  3OYC A;  2INV A;  1T33 A;  4LK0 F;  5DUK A;  2LRD A;  1SKQ A;  4Y33 A;  4RD3 A;  3ZPN A;  4A3F J;  4U0W A;  3LSK A;  3DBL B;  3LMW A;  1IN7 A;  1JUM A;  4QV2 A;  1HVX A;  1IC8 A;  1WP6 A;  2HKO A;  1NK3 P;  4X05 A;  4A0X A;  1G7R A;  3IAM 2;  1ZG3 A;  5KK1 A;  3ASR A;  1BI2 A;  1X1C A;  4A5M A;  3MKZ A;  2V6C A;  1WJB A;  2BW3 A;  2LP0 A;  4RAZ A;  4XN0 A;  3AG3 H;  3MKY B;  1WTH D;  1I27 A;  2OU2 A;  4UXN A;  5LGT A;  1BQE A;  5JVG F;  2QQ9 A;  2LG4 A;  2M34 A;  4ZCL A;  3OOU A;  1NTC A;  2BYV E;  3BQZ A;  1JRG A;  2WWY A;  2Y2Z A;  3LSJ A;  1LQ1 A;  1V54 H;  2K3F A;  1ITY A;  3ZPP A;  2CMP A;  5FL7 A;  2ZJP F;  3JU4 A;  3A0B C;  2CRV A;  3GQA A;  1P7I A;  1YHQ I;  1N05 A;  2ZXI A;  1NJI D;  2DYR H;  3E20 A;  3GTM J;  1SM4 A;  3CES A;  2A61 A;  3CCR I;  1QA1 A;  4OAZ A;  3PO2 J;  2MLK A;  5CJ9 A;  2V1N A;  4E0F A;  1QHH D;  3WE3 A;  4A3L J;  1DAR A;  1IUY A;  3DEW A;  5IT3 A;  4ZV4 A;  1IJW C;  3U21 A;  2BVN A;  2LY2 A;  3DKY A;  1DP3 A;  1BR1 A;  4BJ6 C;  4M71 A;  4BGD A;  1T6X A;  1ZR4 A;  4UUS A;  1R71 A;  3LQR A;  2XTW A;  2M2E A;  3RYR A;  4CCJ A;  1J75 A;  5CDF A;  3CME B;  4EM0 B;  5F08 A;  4IF4 A;  2BM7 A;  2FMY A;  5M5W J;  4JYK A;  3PUN A;  1E3Z A;  2XDV A;  2Y75 A;  2Z2S B;  3EUA A;  1BOA A;  4K2E A;  4ACB A;  5GV7 A;  1QG0 A;  5TY0 A;  1ACI A;  2CW0 F;  1BIB A;  5ILS A;  5EG0 B;  3BZC A;  3HAG A;  3CJQ B;  3FM3 A;  5IYP A;  2L4A A;  1WJ5 A;  3V8J A;  2PMZ A;  2QA4 B;  1B72 B;  2DFH A;  4FN5 A;  4KIS A;  2DOD A;  1IN6 A;  5CKT A;  1J2X A;  1TW2 A;  3JRH A;  3ASQ A;  2V1D A;  3DPU A;  1XB4 A;  2KVO A;  1MBG A;  2BXZ A;  4N9H A;  3OEH A;  2M5W A;  1GHC A;  4O5V A;  1LNW A;  3O3K A;  5D8K B;  1RR7 A;  4B4C A;  4DZJ A;  4MHG A;  4B43 A;  4IHW A;  3LQ6 A;  1KU2 A;  3M1C A;  4G8X A;  3SHF A;  4A3J J;  4Z4T A;  1O7L A;  4DBQ A;  3K4B A;  5E3M A;  1YJN I;  1EKE A;  4IHX A;  4ZC3 A;  1FTT A;  5IYD J;  3FXL A;  4XLP F;  4ZDL A;  2XTY A;  1SKY B;  3L2C A;  3H94 A;  2O61 A;  4KA4 A;  1T8I A;  1R5G A;  2QE7 A;  3HRU A;  2QTL A;  3P9C A;  4G1B A;  5AN9 A;  2QZ8 A;  4QIW N;  5M5X J;  3Q0U A;  2VBK A;  1W2B B;  5FGM A;  2IP2 A;  4A3E J;  4QHY A;  4AC9 A;  4HRI A;  2WV1 A;  2ZJ2 A;  1VQK B;  3FF5 A;  1K5C A;  1B2R A;  4WXH A;  2VBU A;  1F60 A;  2GIZ A;  2L0K A;  3B78 A;  3IHU A;  3BZK A;  3T56 B;  1XPX A;  1LDJ A;  3FIS A;  1HCR A;  5BSY A;  1MZB A;  2BZT A;  2LNB A;  2GJR A;  4JBA A;  1Z67 A;  1B6A A;  1MGT A;  4I09 A;  3HGG A;  1RMG A;  1J9I A;  3SLD A;  3ZMV A;  2OCE A;  1HBX G;  4I01 A;  4HQM A;  4D1Q A;  1I3Q J;  2F4N A;  1WOP A;  1P4W A;  2IAI A;  4II3 A;  2EFO A;  3MZ8 A;  1CQT A;  3GFL A;  2NNY A;  2F3L A;  1TQI A;  3H1C A;  3W2V A;  3OYB A;  1B72 A;  3ERE D;  3NAR A;  1FIA A;  2MD0 A;  2NOG A;  5F1J A;  1AU7 A;  2PG4 A;  3VFZ A;  1H0M A;  2OQR A;  5IY5 H;  4I0B A;  3W5U A;  2EK5 A;  4G7O F;  2XAF A;  2WAQ A;  2RDP A;  2XGC A;  3LNQ A;  4CZZ A;  2L7M P;  5FD5 A;  1YJ9 B;  5ICE A;  3BPX A;  5FLX Z;  3A8K A;  1O3R A;  2LBF B;  1YIJ B;  2WSS A;  2V7Q A;  2V79 A;  3HSF A;  4DZP A;  3B73 A;  2CW8 A;  1U0J A;  4EJU A;  3CF2 A;  5DCM A;  5H2F C;  5J47 A;  1JI8 A;  3JQP A;  1Z3X A;  3ZZT A;  3HJE A;  4ZZL A;  2X8K A;  4D9J A;  4E70 A;  1FBU A;  3LSM A;  4EQQ A;  2QY1 A;  3ECO A;  4A3G J;  4FET A;  2BPO A;  3OYD A;  4BUP A;  4ZZD A;  2E5N A;  2X51 A;  1HQC A;  1PYV A;  1X1A A;  1RNL A;  2E1M C;  4M1K A;  4PJL A;  1X4O A;  2YUS A;  3UR3 C;  5HDN A;  2R7Q A;  2ZO4 A;  1PJ5 A;  1K73 D;  2IQ7 A;  2Y9Y A;  2L9N A;  3LJY A;  2A5Y B;  4HLX A;  2PMZ N;  3DCF A;  4BJT A;  1GAW A;  2BM1 A;  1WSU A;  3BJA A;  1I1S A;  3ZP5 A;  2DA2 A;  4IQJ A;  2CWE A;  2H6C A;  5JVT A;  1XMK A;  4Y17 A;  4TMV A;  4EW9 A;  5K7H A;  2XNC A;  3HHG A;  1KGS A;  1Q82 D;  1W5S A;  2GBY A;  1VTN C;  3FMS A;  4ETS A;  2ZSI B;  4G1V A;  3OL3 A;  3JSO A;  2H09 A;  3EYI A;  1WOR A;  5ICG A;  1X0C A;  2KQR A;  3VEP A;  1OOC A;  2ZNY A;  3GO5 A;  2FML A;  4HF2 A;  1ZM3 A;  3CCV I;  2RC5 A;  4Y7C A;  3G6E B;  2AQE A;  2OK7 A;  2VBZ A;  5HS8 A;  4M3G A;  4HE5 A;  3P4G A;  3FZV A;  4G6Q A;  3SZT A;  1F4K A;  2NV4 A;  4B3F X;  5BSX A;  2JZY A;  3BG7 A;  1XN7 A;  4BYY A;  2OK8 A;  3LQQ A;  1NBM A;  5A2Q K;  3J81 K;  2QEX B;  3K4L A;  2LKS A;  1QU3 A;  1EFC A;  1QRC A;  1NG6 A;  3OYI A;  5LRS A;  1F43 A;  5J1R A;  4B8X A;  2W4S A;  2V7U A;  1KZL A;  5B6I A;  3M1E A;  3OAA A;  4HIZ A;  2O6W A;  3BH7 B;  2XZL A;  3GQ8 A;  2RRE A;  3QAH A;  1L3L A;  1UJ8 A;  5FFX A;  4RAY A;  5BPI A;  2WZP P;  1Z0X A;  3DLL F;  2YWH A;  2KZG A;  3IRQ A;  2R7U A;  1MMN A;  1MMD A;  4N4O B;  5LBQ A;  4TT3 A;  2ZZQ A;  3BG6 A;  2BGI A;  1VBL A;  3BY2 A;  1DPU A;  2IT0 A;  3TOA A;  5DNS A;  3S2W A;  1N8R D;  2A3S A;  2WV0 A;  5F4J A;  3CDH A;  2R0Q C;  4HQE A;  4NB5 A;  3CCL I;  3FKJ A;  3FWE A;  2DLL A;  4PC7 A;  3GTQ J;  1KQ9 A;  2HCJ B;  1V5F A;  4PC3 A;  2WAQ N;  1S72 I;  3BOQ A;  3OYL A;  4LG0 A;  1H80 A;  1VQ8 I;  2E34 A;  3BCF A;  2VAS A;  1FWZ A;  2HR3 A;  1VQ7 B;  1A35 A;  4BS9 A;  2DW4 A;  2KPM A;  1Q7Y D;  3HRT A;  3GZN B;  2COM A;  1FX7 A;  2EWE A;  3MKW B;  4Z06 A;  2LH9 A;  1VF7 A;  2ZL7 A;  2EIJ H;  2KFD A;  4E7L A;  2B9S A;  1NRK A;  5J4Y A;  1U9N A;  4EGY A;  3D26 A;  2W85 A;  2Z3Y A;  4M4S A;  3DF8 A;  3SQN A;  2CRG A;  4CQJ A;  3OYN A;  1JXS A;  1IZ1 A;  1YG2 A;  1XGM A;  1G2H A;  4JP0 A;  4DYR A;  5FA6 A;  2OCC H;  4AU7 A;  2XZO A;  2M0M A;  5HKK A;  3BR6 A;  3P5J A;  2WY7 Q;  2FQ4 A;  2A68 F;  2HYF A;  1TT0 A;  2CQN A;  1U2W A;  2X3U A;  3MAJ A;  3MD2 A;  5GAH J;  1SD6 A;  3HTS B;  5IK2 A;  4OJ6 A;  3BG5 A;  2JPC A;  2W48 A;  1VQN I;  1HKS A;  3E97 A;  1IN5 A;  2OTL I;  1R1T A;  2JSP A;  4F7Z A;  4XID A;  1VQL B;  1PUE E;  4L5E A;  3W2H A;  3OSG A;  3AG2 H;  4PSX A;  3VOD A;  4OMZ A;  4XLC A;  4WZL A;  3ZIA A;  1O57 A;  1LE8 A;  4IRI A;  3P9I A;  4YAF A;  1DGW Y;  1LDK B;  1V4R A;  3D5S C;  2J5O A;  2CV0 A;  4UZF A;  3KL9 A;  3A01 A;  2A6T A;  3KYC B;  1HSJ A;  1QVT A;  3SJP A;  3M8E A;  1IB0 A;  3IP4 B;  3WOD F;  2EB7 A;  3WU1 B;  4Y52 J;  3JRE A;  4RD4 A;  2K02 A;  2R5Y B;  3OE7 A;  2DYS H;  1Y1W J;  2B5O A;  4BAC A;  1O8D A;  2E35 A;  1O8J A;  1NB9 A;  4ZGN B;  1SAU A;  1UD4 A;  5EMN A;  1Y0Y A;  5K1Y A;  2QTZ A;  1S9H A;  3LSP A;  4G5G A;  4R8H A;  2UXN A;  4IO9 F;  3RIR A;  3HG9 A;  2NZM A;  2KIU A;  4C0S A;  5EEA A;  3CRZ A;  1GVD A;  4C2L A;  2R7O A;  2EFN A;  5J6X A;  5ED4 A;  4OIR F;  3KX2 A;  3D0S A;  1WGX A;  3FMQ A;  1ZH5 A;  2XPV A;  2DMP A;  2YS9 A;  4RLF A;  3WU2 C;  5FKO A;  4OIN F;  5D8L B;  4XRS A;  4IHY A;  2VBE A;  1SD5 A;  3SXY A;  4FCY A;  3VMW A;  2FD5 A;  1MW7 A;  3MMY B;  5AIQ A;  5B1B H;  4DJA A;  5GAD J;  3C18 A;  1A6I A;  1V5E A;  4BE0 A;  2HZT A;  1IW7 F;  4ESB A;  1XSD A;  1P2F A;  2F5E A;  3NB2 A;  3WYA A;  4YZ0 A;  3WNB A;  1ODD A;  1RET A;  4XD7 A;  3ZQG A;  3CLO A;  4F93 B;  4F92 B;  3C2B A;  5DN6 A;  4CHU A;  2DTZ A;  2DYI A;  3LYC A;  3SZP A;  3PJR A;  4RDJ A;  3K1N A;  2LZJ A;  1K8A D;  1ZTR A;  2M45 A;  1W7P B;  2JN9 A;  2ZME A;  5GPA A;  1N06 A;  3VDX A;  4C2M J;  4UV9 A;  4WX9 A;  3GIR A;  4HV5 A;  2D1V A;  1S29 A;  2A69 F;  1KK1 A;  2HFH A;  2O8X A;  2Z16 A;  2X0L A;  2KRC A;  2X6O A;  4ITV A;  4XR6 A;  4A2U A;  1XMX A;  2R5Y A;  1TTT A;  1PDN C;  3GQB A;  2M7A A;  3CLQ A;  3X2Q H;  3ZQC A;  1ZGW A;  2XZP A;  3WBK A;  4UUT A;  1E1Q A;  4NQW B;  4DOZ A;  1OIS A;  3CP8 A;  1HST A;  1IRX A;  3UNG C;  3JRC A;  2XRN A;  1WPC A;  4ASU A;  1HC8 A;  2EIX A;  2XGE A;  3S1M J;  3H3Z A;  3OR1 C;  2K5C A;  2BGJ A;  3JX8 A;  3DEE A;  3HDD A;  3CME I;  4XK4 A;  3Q5F A;  1RR8 C;  2O5R A;  5AIP A;  3F21 A;  4XN3 A;  5HLG A;  1JTA A;  1KQ8 A;  2MYS A;  2X3H A;  3OZW A;  3QQA A;  2P5V A;  1OFE A;  4BY1 J;  1L1I A;  4RAF A;  1KCD A;  4DYC A;  4ZYA A;  3QFC A;  2W82 A;  3EQL F;  3P7N A;  5CLS A;  2OZ6 A;  1YX3 A;  4WK8 F;  2QA4 I;  3N97 A;  4X7D A;  5J8F A;  3WHC A;  1IG7 A;  4FK8 A;  3BPV A;  2GK6 A;  4PGO A;  2BM0 A;  3ZC3 A;  4P9U A;  3NRV A;  3I3L A;  2ETH A;  2EIL H;  3IKT A;  3VYU B;  1QFJ A;  4M2L A;  2M8G X;  3FHN A;  1GO2 A;  1BBY A;  1MJA A;  2VBS A;  3ONY A;  1K4S A;  5HLH A;  2K3P A;  4YXW A;  3L2Q A;  3K10 A;  2I10 A;  5H5J A;  2M8E A;  3DEU A;  1P9Q C;  3C3W A;  1YW9 A;  3JR9 A;  1L0O C;  5L3C A;  2IEK A;  3GQ7 A; 
#chains in the Genus database with same CATH homology
 2IS6 A;  2VXZ A;  3DKX A;  3TMO A;  4XLF A;  1QJV A;  2V4J C;  4XKC A;  1N77 A;  4RMN A;  4B47 A;  4XKW A;  2E5Z A;  1N78 A;  1DBG A;  3PFY A;  3QYF A;  4W8S A;  2E60 A;  2MFZ A;  5CQE A;  3A1Y A;  4U4B A;  2ELJ A;  3M8J A;  3VYR B;  3AKZ A;  3HPH A;  4BQO A;  1O8L A;  4JQF A;  4LIT A;  4IKF A;  1I18 A;  2W1O A;  3E0J B;  2V6E A;  2V31 A;  1Z21 A;  4BQQ A;  4JMQ A;  3LFU A;  2JDI A;  2D3N A;  3OY9 A;  1E1R A;  3K4N A;  4Z03 A;  3NWT A;  1O8E A;  2F1M A;  4YZQ A;  2K9L A;  4YEJ A;  4XLE A;  3H5N A;  2VKD A;  4OZY A;  4XQF A;  3GVK A;  2R7V A;  1OHH A;  4JOM A;  3KYL A;  4BEH B;  3EPZ A;  2F6C A;  3VSK A;  3HXL A;  3OYC A;  4E7I A;  2WJY A;  2INV A;  1MMA A;  2LRD A;  3HPG A;  4QPO A;  4Y33 A;  2QKL B;  1OB0 A;  3VR6 A;  3ZPN A;  3LSK A;  3T53 B;  3LMW A;  4FAS D;  2GJP A;  2WAD A;  1HVX A;  2DT7 B;  4DK1 A;  2NOJ B;  1WP6 A;  2LY1 A;  2UVE A;  3UW0 A;  2JJ1 A;  1PXZ A;  2NT9 A;  3RPU D;  3IAM 2;  3HC7 A;  3NWS A;  3H5R A;  1X1C A;  3PNV A;  4AYB A;  4J01 A;  1PKV A;  5HLT A;  1WJB A;  2BW3 A;  1GLN A;  3PUB A;  4XN0 A;  3MKY B;  1WJC A;  2W7N A;  4BE2 A;  2IS2 A;  1WTH D;  5AMV A;  1PJR A;  1Y6I A;  2LG4 A;  2X1C A;  3OOU A;  1O8F A;  1JRG A;  3VSL A;  4IQ4 A;  1K6Y A;  2VXD A;  1OGO X;  4E6K G;  2BVL A;  4CCK A;  2X6W A;  3QOE A;  2IS1 A;  3TBI A;  3E1S A;  3ZPP A;  2CMP A;  3CMM A;  4XL9 A;  5FL7 A;  1LFP A;  3JU4 A;  3GQA A;  5JHF A;  2E1B A;  2ZZG A;  2ZXI A;  1X19 A;  3ZSC A;  2CW7 A;  3S93 A;  3CES A;  4OAZ A;  4E7K A;  3BLY A;  2A5W A;  1I8D A;  4BE1 A;  3A3G A;  2KL4 A;  3FBN B;  3H9J A;  4DNT B;  2V1N A;  4E0F A;  1QHH D;  2WY8 Q;  3H0D A;  3U21 A;  2LY2 A;  3OL4 A;  5HNH A;  3DKY A;  3EUH C;  1BR1 A;  4BJ6 C;  4BGD A;  1DP3 A;  2MAB A;  3BH4 A;  3VMV A;  1KCC A;  4Z1M A;  4CSW A;  2F4I A;  4CCJ A;  5CPR B;  5CDF A;  4BEH A;  3DU5 A;  4CZC A;  1E3Z A;  2DXI A;  2XDV A;  2Z2S B;  3EUA A;  3OYE A;  1DBO A;  3AL0 C;  1EA3 A;  2R4G A;  1X1D A;  2LBF A;  1KMH A;  3HAG A;  2NSP A;  3J7A Y;  3CJQ B;  2DCE A;  3OYG A;  1D1C A;  1WJ5 A;  3EQN A;  2PMZ A;  2QKM B;  4HWV A;  2X6X A;  4KIS A;  2IGO A;  1DQU A;  3A3B A;  3G2B A;  5CKT A;  4F91 B;  3DPU A;  2KVO A;  3OEH A;  1LVK A;  1XG2 A;  4I84 A;  2QX3 A;  2INU A;  2ODL A;  3S3M A;  2ZTG A;  2HLD A;  3C2G A;  4B43 A;  3L2V A;  3QYE A;  2K9M A;  3M1C A;  1YX5 A;  4XOT A;  3H9Q A;  4B48 A;  4KKT A;  2R7X A;  4DBQ A;  2XGJ A;  3K4B A;  2UV1 A;  4URR A;  2ZXH A;  1D0Y A;  3OEE A;  4ZC3 A;  3W2W A;  2M4G A;  2Z8G A;  3WWG A;  4ZDL A;  3A35 A;  1SKY B;  1QHG A;  2BVM A;  2QE7 A;  3BC9 A;  3H35 A;  3H94 A;  2VQL A;  3L2W A;  1UD3 A;  2NST A;  3SEQ A;  4OAY A;  1RU4 A;  2VBK A;  3OYH A;  3A4C A;  5LFA A;  1W0K A;  3K4J A;  3LL7 A;  2IGK A;  2BW3 B;  4F55 A;  3IAS 2;  2NT6 A;  4HRI A;  4W8R A;  3VSV A;  2AQF A;  1K5C A;  4CCL A;  3SZG A;  2L2O A;  1BPL A;  4P22 A;  2O0W A;  4BXF A;  3T56 B;  3G05 A;  1NHC A;  4BDZ A;  2GJR A;  3T9G A;  3CP2 A;  3OW7 A;  4ZDP A;  4RM3 A;  4YRV A;  3FBI B;  1RMG A;  2F43 A;  3FPP A;  4PJJ A;  1D0Z A;  3F9K A;  4D1Q A;  2ZZF A;  4II3 A;  1UD6 A;  1W0J A;  1DGR M;  1MMG A;  1E79 A;  3W2V A;  3HKZ A;  2IGM A;  2MC4 A;  2KZV A;  3OYB A;  1VLY A;  4TT3 A;  1J09 A;  2GK7 A;  1EE6 A;  1MAB A;  2MD0 A;  2OUM A;  2KMU A;  3OMY A;  2XC7 A;  1V0E A;  4HNT A;  3GQ7 A;  1H8H A;  1AA7 A;  3NE5 B;  4CCM A;  3DDY A;  2WAQ A;  2DJI A;  4GRI A;  3GRH A;  1PLU A;  5KCM A;  1GQ8 A;  2V26 A;  3DWL E;  2L7K A;  4N4N B;  3OS1 A;  1UD5 A;  4Z05 A;  3L2R A;  1D1B A;  4E7Z A;  4XM3 A;  2LBF B;  1E3X A;  2DIE A;  4OJL A;  2WSS A;  3T51 B;  5TGT A;  2V7Q A;  2CW8 A;  1U0J A;  1FMV A;  2XF6 A;  3CF2 A;  1JI8 A;  4E7J A;  1Z3X A;  4BL0 B;  3DTK A;  1EFR A;  4YZX A;  2JVG A;  2WPD A;  2X8K A;  4D9J A;  2QY1 A;  3LSM A;  3GBG A;  3I9V 2;  4NC7 A;  4PK4 A;  3KEY A;  4C2T A;  2RNG A;  4FET A;  3OYD A;  4G6T B;  4HST A;  4BUP A;  2HPM A;  1NG7 A;  2E5N A;  2BSP A;  3KRG A;  1N75 A;  3OIQ A;  3OR2 C;  1IA5 A;  2X51 A;  3K4M A;  3HUG B;  1PYV A;  1X1A A;  2E1M C;  4L8J A;  3EQO A;  3FY3 A;  4PJL A;  3SUC A;  1X4O A;  3UR3 C;  2R7Q A;  2ZZE A;  2IQ7 A;  1COW A;  1UEL B;  1G8X A;  2L9N A;  4NUB A;  4XOP A;  2JVH A;  3DPL C;  3ZR8 X;  1IB4 A;  1OLT A;  2M3A A;  4BJT A;  1WFX A;  4J00 A;  2PJR B;  1SFK A;  4DNR B;  3RCO A;  4CCO A;  1OGM X;  2OC6 A;  1PE9 A;  4OJP A;  4IQJ A;  3BCB A;  2VQG A;  3EUK L;  3LSG A;  4HEA 2;  1X1B A;  3S32 A;  4EW9 A;  3V42 A;  3PNY A;  2CUJ A;  1Z7L A;  4YEL A;  2Q2E B;  2ZSI B;  2V7F A;  2PYG A;  3OL3 A;  4PFO A;  4FXU A;  3DQV C;  3K6G A;  1X0C A;  2KQR A;  1OOC A;  4X0G A;  1RWR A;  2I8D A;  2KLO A;  2AQE A;  3GVJ A;  3QOD A;  4TKO B;  2NTB A;  1IDK A;  4HG2 A;  4KIT B;  1KTW A;  3WQZ A;  4B3F X;  3K4C A;  2XF5 A;  3BG7 A;  1BR4 A;  3QYB A;  3OYA A;  2HVR A;  1O8I A;  4QPQ A;  1WMR A;  1NBM A;  1YE9 A;  4XOR A;  2UUZ A;  3FDY A;  3K4L A;  3S8P A;  4MLO A;  2GJK A;  1QU3 A;  2WA0 A;  3GQ9 A;  3PL8 A;  4OZZ A;  2KP6 A;  4NC8 A;  1NG6 A;  3RQ4 A;  3OYI A;  1V5G A;  3PSF A;  3HL2 A;  2W4S A;  3W2A A;  1KZL A;  3OAA A;  4HIZ A;  2XZL A;  3GQ8 A;  2RRE A;  1ZEL A;  2ZTN A;  1UD2 A;  1VZ0 A;  2WZP P;  4PJN A;  1O88 A;  2R7T A;  1UG0 A;  1ERD A;  2WAF A;  3GVL A;  3VWB A;  2R7U A;  1MMN A;  1MMD A;  4N4O B;  4BQN A;  1FMW A;  2FUG 2;  3H5A A;  1LKX A;  2VKH A;  3BG6 A;  2CK3 A;  2ZZQ A;  4E7S A;  2F5V A;  1HG8 A;  1VBL A;  4PFP A;  2VLA A;  2HVQ A;  2PJR A;  2HNH A;  2XF7 A;  2W6I A;  1OFM A;  3VSU A;  3D5L A;  3OYK A;  3D5R C;  3FKJ A;  2LC2 A;  2Y0S A;  3BCA A;  1V5F A;  3IUO A;  3DLA A;  3ZCO A;  3ZQQ A;  2VBM A;  3DTI A;  4PMH A;  1O8H A;  3C2H A;  3OYL A;  4C30 A;  1R6R A;  1K28 D;  1H80 A;  3BCF A;  3RSN A;  2VAS A;  4Y4R A;  4BJ5 C;  1HA8 A;  1AIR A;  2UVF A;  4YZA A;  2DT6 A;  4BS9 A;  2UWM A;  2VJI A;  2KPM A;  1HZE A;  2HVS A;  4MXN A;  4CA0 A;  4XKB A;  3VYS B;  4F3Q A;  2WJV A;  4NK8 A;  2CS3 A;  2WB1 A;  3MKW B;  2EWE A;  3DU6 A;  2LH9 A;  4II2 A;  1VF7 A;  4Z06 A;  2LRE A;  4E7L A;  1FX0 A;  1NRK A;  2JA2 A;  4NK6 A;  3OYJ A;  4G7W A;  3OYN A;  2VIX A;  4R79 A;  4UZU A;  2L9S A;  4B44 A;  4G7X A;  4AU7 A;  2XOK A;  2XZO A;  2M0M A;  5HKK A;  4DGW B;  2O0V A;  2WY7 Q;  3BC8 A;  2JIZ A;  2DOA A;  1TT0 A;  4DBR A;  2R7S A;  3SEZ A;  5IK2 A;  3MD2 A;  4XMY A;  3JUR A;  4OJ6 A;  2VJJ A;  4B3X A;  3OOC A;  3B90 A;  4CUG A;  2PEC A;  4HNU A;  4KKS A;  2KRH A;  4BU2 A;  2JSP A;  2VJ5 A;  4LIV A;  4LG3 A;  3ONQ A;  4C2U A;  1BMF A;  4PJM A;  3K70 D;  1IDJ A;  4OJ5 A;  4PSX A;  5HVQ C;  2X85 A;  4XLC A;  2WAE A;  3H9G A;  3ZIA A;  2QXZ A;  3SYT A;  2VB6 A;  3FKS A;  1BOB A;  1DGW Y;  1LDK B;  3A2K A;  3D5S C;  3ZXS A;  2VQC A;  3OIP A;  4CCN A;  2R7R A;  2XAU A;  4ZTF A;  2CV0 A;  4P5O A;  2CUZ A;  4PSW A;  1MND A;  4U49 A;  2A6T A;  2ZSH B;  5CQG A;  3DTE A;  3KEW A;  1KON A;  2VL8 A;  1D1A A;  1TZL A;  4KJZ A;  2VJ4 A;  3IP4 B;  4KT6 A;  2JJ2 A;  1O8G A;  3N05 A;  2PYH A;  2CV1 A;  3BCD A;  3L2U A;  2ZFU A;  2M7B A;  2W00 A;  4BDY A;  3OE7 A;  5C1C A;  4BAC A;  2V9K A;  3VST A;  1W36 C;  1O8D A;  2D3L A;  2VPL A;  1O8J A;  4H4K C;  5FRO A;  1OFL A;  1SAU A;  5LD2 C;  1UD4 A;  5C1E A;  2CFO A;  1S9H A;  3OS0 A;  3K70 C;  2HU9 A;  5KHD A;  3K4K A;  4AVZ A;  2KDO A;  3HG9 A;  2NTQ A;  1BR2 A;  4PUS A;  4NNJ A;  2NZM A;  4F52 A;  4OWR B;  4C2L A;  2R7O A;  2IGN A;  2LOO A;  2RQQ A;  3OYM A;  2HQA A;  4ZDO A;  1E0E A;  2O1D A;  3PSI A;  3KX2 A;  1O8M A;  4ZTJ A;  2M5S A;  2L5Q A;  4MR0 A;  4XLH A;  4RLF A;  5FRN A;  4EAT A;  1BLI A;  2VBE A;  4E4H A;  3LMM A;  3S3O A;  3VMW A;  4C9Y A;  1MW7 A;  3MMY B;  4E7H A;  1WJA A;  2E1M B;  1T0F C;  4HSR A;  3DPT A;  4DJA A;  4RM2 A;  2JUG A;  5HOO A;  5KNL A;  3OS2 A;  3SDB A;  3CJR B;  1V5E A;  4BE0 A;  1UAA A;  3B8Y A;  3ZGK A;  4YZ0 A;  3OWT A;  4OJO A;  2XND A;  4DK0 A;  4XD7 A;  2Q1Z B;  4KKU A;  4F93 B;  2X1E A;  5FRM A;  4F92 B;  5DN6 A;  1CZF A;  4XLA A;  3VYT B;  2X53 S;  4P1W A;  3PJR A;  2W6J A;  2LZJ A;  3HOS A;  2GOX B;  4IX7 A;  3VDX A;  1D0X A;  2X6Y A;  1Y56 A;  4ZJZ A;  2X1D A;  3LSH A;  2R7W A;  2HDW A;  2HPI A;  4ANJ A;  4IZZ A;  2O17 A;  2P0W A;  2CV2 A;  2Z16 A;  1QCX A;  2KRC A;  4XR6 A;  4ITV A;  3TL4 X;  3OYF A;  1VJS A;  3LNN A;  4W8T A;  3GQB A;  2M7A A;  2GOM A;  2OV7 A;  2XZP A;  2V4D A;  1E1Q A;  1T5E A;  4NQW B;  1T95 A;  2KHM A;  3CP8 A;  2BOL A;  4DOZ A;  4G6I A;  1IRX A;  3UNG C;  2O04 A;  1X4P A;  1E43 A;  3AL0 B;  1WPC A;  4ASU A;  4XON A;  2NTP A;  1O8K A;  1V0F A;  2CH0 A;  2R9V A;  3OR1 C;  3W3C A;  2K5C A;  1MNE A;  1W36 D;  3LSI A;  3DEE A;  4Y3O A;  1WJF A;  3ZRG A;  2M4K A;  2O5R A;  3OFN A;  4XN3 A;  1JTA A;  4TSF A;  2MYS A;  2WBM A;  2X3H A;  1UD8 A;  1BHE A;  4U7B A;  4LIU A;  2Z1D A;  4XKV A;  3S3N A;  1KCD A;  2VQH A;  4U87 A;  2W82 A;  4ZYA A;  3HOT A;  5HNF A;  1YX3 A;  3B4N A;  1OR7 C;  3RTR A;  3AFH A;  3OPO A;  1Z3Y A;  1H8E A;  4B3G A;  2GK6 A;  4W8Q A;  4HPQ A;  3I3L A;  4DIQ A;  2HZD A;  4RLQ A;  1BN8 A;  3VYU B;  1WJE A;  3FHN A;  2Z6B D;  2XSJ C;  1G59 A;  4YXW A;  2K3P A;  1WJD A;  3L2Q A;  3K10 A;  2IS4 A;  1P9Q C;  3CZ6 A;  1W9X A;  4GQN A;  4CH7 A;  3PNT A;  4XNF A;  2LYC A;  3MKZ A;  2IXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...