4YELA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
molecule keywords Tail spike protein
total genus 228
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yelA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yelA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yelA02
4XLHA 4YZ0A 3GQ8A 1O8DA 2NTQA 3EQNA 4MR0A 3SUCA 1EE6A 2QX3A 4YEJA 4XKWA 5C1CA 2PYHA 4YZXA 3B90A 4XOTA 4XLFA 1BN8A 1O8MA 2X3HA 3VSUA 2O0WA 3UW0A 4XOPA 1IDJA 4XLCA 4XR6A 2NTBA 3VMVA 1PLUA 4W8QA 1IDKA 4XM3A 1IA5A 1O8HA 1O8JA 4XMYA 4XLAA 2UVEA 1KCDA 2VBMA 3GQ7A 1XG2A 3GQ9A 4XORA 3GRHA 2NTPA 2O1DA 2VBKA 2UVFA 2PYGA 1VBLA 4XN0A 1OGOX 1O8GA 1NHCA 2VJJA 2X85A 3GQAA 2X6XA 2IQ7A 2INUA 4AVZA 1OOCA 4OJLA 2QY1A 3ZSCA 2NSTA 2EWEA 1O8KA 3VSVA 1O8FA 3EQOA 4U49A 2VJIA 1JRGA 4OJPA 2PECA 3LMWA 2BSPA 4XN3A 1QCXA 4URRA 2O17A 3B4NA 3VMWA 4OJ5A 1KTWA 4I84A 4OZZA 4YELA 1GQ8A 4OJ6A 1OFMA 1PXZA 3JURA 4MXNA 5C1EA 1BHEA 1QJVA 4XLEA 2O0VA 2NSPA 3B8YA 1HG8A 1O8LA 2X6WA 4W8TA 1AIRA 4EW9A 1H80A 1X0CA 4NK8A 4Z06A 1O8IA 4NK6A 1WMRA 4W8RA 4XONA 4YZQA 1PE9A 4XKVA 2INVA 1DBOA 4YZAA 1K5CA 4U4BA 2X6YA 2NT9A 2ODLA 4C2LA 1RMGA 4HWVA 2VBEA 1OFLA 1DBGA 1RWRA 2O04A 2Z8GA 3ZPPA 3WWGA 4W8SA 4Z05A 2NZMA 1RU4A 3KRGA 2QXZA 3FY3A 5AMVA 1OGMX 2NT6A 3VSTA 4XL9A 4OZYA 4PMHA 4XQFA 4XNFA 1JTAA 3T9GA 1O8EA 4Z03A 1KCCA 1CZFA 1O88A 1IB4A 4OJOA
chains in the Genus database with same CATH superfamily
4II3A 2RV8A 3PVDA 1BX0A 1OR7C 2LF8A 1OYWA 2ISYA 1YW9A 4Y3OA 3K9TA 2KIMA 2WPDA 1WH7A 3LSJA 1PJRA 3HRTA 3KLNA 1QHGA 3NARA 2GBYA 3S32A 4YZXA 3FWEA 4OMZA 3Q0UA 2C4TA 3ZCOA 2CUZA 4FWTA 1O8MA 4RAZA 2X3HA 3PQKA 5E20A 2A6TA 1FWZA 2CRVA 2F1LA 1WFXA 1ONVA 3TP0A 4A3FJ 1YJNI 4UY8I 4H9GA 1JJ2B 4IVNA 2MW8A 2DLLA 4XM3A 3F21A 2IS6A 1R4MB 3DEWA 3ML6A 2RNGA 1OLTA 3JREA 3S3OA 1O3QA 5F4OA 2MH2A 2O03A 2PG4A 5DN6A 2VNIA 3AVWA 4IEJA 4GRIA 2L7MP 3W6JB 3QFSA 2QENA 5FLMJ 3MKLA 1J7KA 2WSSA 1ON2A 2MGQA 1VQ7I 1FTZA 3VYRB 3WE2A 2VUMJ 3CQZJ 2XPUA 3AG4H 5KSWB 2JT1A 1Y6IA 2H94A 3CD6B 2ZNZA 5KAFC 5IT9K 3BH4A 1LM1A 5EGOB 3JRGA 1HKTA 3KL9A 5FNZA 1ZARA 3BZCA 3ROUA 1YI2I 5DM7F 3I5UA 4Z1MA 2PMZA 5KK1A 4XRMA 1I7PA 4BHBA 4DQLA 2XT4A 3ASTA 1J9ZA 4XICA 2BSPA 4C3JJ 1XCVA 1YTYA 3ZMZA 2E2JJ 3BQZA 3HC7A 4TKOB 5TR9A 3MCAA 2BM7A 2ME0A 1W7PB 4ZDPA 2GPJA 3N6ZA 3AGQA 3GX4X 4EQQA 3LAJA 1U8BA 4KKTA 3BR3A 1TTTA 2AQEA 3H5NA 5JLVC 2E2HJ 3ZRGA 2VZLA 1BHEA 1N0VC 2GM4A 3BLYA 3F8MA 4ENNA 3HHHA 3A0BC 3V7AA 5IYRA 3DU1X 5LD2C 1WJFA 1BI3A 2CW8A 3RZDJ 1PJ7A 1WI9A 5IYWA 1EH7A 2TDXA 1N25A 3RPUA 2COBA 2KQRA 3BG6A 4M53A 1XMXA 2CO5A 5E6TA 4FISA 4RBOA 2WV1A 2L7ZA 4U9UA 3W2EA 1H80A 4NK8A 4YAFA 4WZTA 3G1LA 3ZZUA 2IA1A 1GAQA 4FXUA 1JI8A 3P9CA 1BN5A 1S3JA 1QPIA 1B8IA 1A6IA 4IKFA 4ZCMA 1IJFA 3NEUA 2W7NA 1H85A 4II2A 5EZGA 2O3FA 4LJZF 4U0VA 1VQ8I 5ICGA 1J75A 2HS5A 2ZXHA 4LIVA 2FX0A 2CG4A 3KP6A 1ZHFA 3ZPPA 1S7AA 2E1CA 2H6CA 4YIIA 1XCBA 1R36A 4ZYAA 3JRAA 1H8EA 2VBSA 2R7QA 2QMUA 4YCQA 3BG7A 1YJ9I 4BY7J 3ZZTA 3ABMH 2O5RA 1JA1A 2HQRA 1EFCA 4X6AJ 2P0WA 2WC2A 1XE1A 1GT0C 2OUMA 1AKHA 1O8EA 1IXRC 3K4BA 2DA1A 1JUMA 1RETA 3HPGA 2LLKA 4QPQA 1Y56A 1CNFA 2W57A 4P26A 4ZTFA 3W6VA 2PX9A 3AG3H 5L3GA 2OD5A 3S2DJ 2YWFA 2FRHA 4GDFA 4OOVA 1K73D 4MR0A 2E7XA 4YG2F 3VYTB 1ZKGA 1KQ5A 1T08B 2IXSA 1QVGB 4ZDLA 2B7CA 4NC7A 1R5GA 3PFIA 1ERDA 3AFHA 3BY6A 1W36C 1FYMA 3OYCA 5B1BH 2XAHA 1UD6A 5GP9A 1RIOH 1E62A 3CJNA 2NXNB 4ZGNB 4XR6A 4KA4A 5TJJA 2BGCA 1KQSB 1X4OA 1XG1A 5A2QK 2WAEA 3W2WA 4E7HA 2O8XA 2CFOA 2D1VA 3J81k 1D8TA 2VC0A 1J5YA 4HNUA 2P7VB 3FKSA 2DMTA 2NS0A 3H9QA 2FBIA 1U9NA 2ACJA 1UAAA 1ELOA 3REOA 1DPRA 1UD5A 2V7TA 3ASSA 2O1DA 3AG2H 3ZMDA 5HLTA 3GLLA 1MABA 2LTPA 3CTAA 3TOAA 4MFDA 1DP3A 2G9WA 4UVAA 2X85A 4EJOA 1FRNA 3G2BA 4A12A 3I54A 5HODA 1A35A 5M5XJ 4MNUA 2VL8A 1G2HA 1VQOI 2WTEA 4X7EA 4IRGA 4MTEA 3VMFA 3MZYA 2MYSA 1QVTA 2L4MA 4OOSA 2PI0A 1DPUA 2QSHX 1KA8A 2JSCA 4Q48A 2P3MA 1FT9A 1WSVA 1XX5A 3Q3AA 1PP8F 2YWEA 4XN3A 2DQLA 2IBDA 3OW7A 1D1BA 4BQQA 3KP5A 1L0OC 3BTCA 4Y33A 3WTWC 3GTOJ 1FNNA 4IQ4A 4PZJA 5IYCJ 2ECCA 4A3MJ 4WF2A 1T0FA 2FOKA 1OCTC 3GTLJ 4WXHA 3OZUA 4Z4UA 2LOOA 3C2HA 4H0EA 5FROA 3EPZA 2IPQX 2VBVA 1KMHA 3HHGA 2VNKA 3QPTA 2VBXA 1Q9SA 4OPVA 1N8RD 4OM9A 5HVQC 1EXMA 3BY2A 4RPBA 2J5OA 1ZGAA 1TNSA 2MABA 3CUOA 3G1MA 4UVCA 2KRFA 1EZGA 1P2FA 1W9XA 1YS6A 3V7CA 5M5WJ 1RKTA 2FQ3A 3LOCA 3V7RA 2Z9OA 3RQ4A 2DYRH 1JGGA 1YX2A 3ZBUA 1U6GA 3PM1A 1S9HA 1TVCA 2BHZA 1E17A 1I1SA 1GVDA 3CCQI 1UHWA 1DBGA 4CCKA 3VOEA 2W7ZA 1FOKA 4CDGA 1WJBA 1D1NA 1RRJA 1E3ZA 3LNQA 3O3KA 4A0YA 2QZ8A 1E43A 2QWWA 1S8NA 2XRLA 3RSNA 1QZYA 3V8JA 3R6JA 2L9RA 3B02A 2CQXA 2KFDA 1NB0A 1OGMX 1B8IB 2D3NA 3P9IA 2EZIA 4XQFA 3IL2A 1HLVA 3WGIA 1AMOA 5M5YJ 1STZA 4ITVA 1IN8A 1T6YA 4CCMA 3U6KA 1NK3P 2DOEA 2FQ4A 3OYEA 2A6EF 2Y2ZA 4OPSA 3MZ8A 2EH3A 3GQ8A 3I53A 1DDGA 2VOOA 2LMDA 2NTQA 4M3BA 3I56I 1OHHA 1UELB 2Y30A 3G05A 3BWGA 3HG9A 2W00A 5E3MA 3JW4A 2E1RA 1ETXA 3N05A 2C6YA 2P5LC 4FX4A 2XHKA 1TNTA 3OIOA 3ECHA 2OAZA 3LFKA 4YFXF 2LC2A 2LRDA 3BPXA 1VQNB 3K2AA 2FD5A 1V5VA 2OBRA 3I55B 2DA6A 3A4CA 3LSRA 1OFEA 1TWFJ 1Y8RB 3DKYA 1O3TA 3MN2A 3M1CA 1GO2A 1NDHA 5EEHA 2D5VA 5B3SH 4PDKA 1T6ZA 5CVUA 9ANTA 1JB9A 1RKWA 3BH7B 3S2HJ 2DYSH 3G1OA 4PABA 4QVJA 1LFBA 2BV3A 4G6TB 2X6XA 3OEEA 1UMQA 3OIQA 2ETHA 2XDVA 3CP8A 1LB2A 2DFHA 2FXAA 2AXLA 4LK1F 3S3MA 2COMA 2Z1DA 2EWEA 1G6NA 5CJ9A 4AVPA 1QRYA 4L9TA 2XNCA 2ZBKA 1IG7A 1KQ0A 2XKOA 2RAEA 2ZFUA 3RJPA 2DT5A 2EIKH 2A6HF 2WB1N 2ZNYA 4KT5C 4P22A 2JZYA 1YJWB 4CCJA 4URRA 3OS2A 1X1CA 1DG1G 2NPFA 1VLYA 1E3XA 4G7XA 3DQVC 2M45A 2R9VA 1I27A 2XF7A 3DBLB 3B8YA 1W5CC 3H5RA 2JPBA 1MMDA 4HAMA 3HSRA 4O5VA 3CO6C 1T0FC 3LVBA 5L3DA 4DNTB 1E3HA 1LLZA 1B59A 2IRFG 4ZZLA 4P6YA 3KP3A 2HYFA 2XB5A 3EUKL 1BBYA 4GGGA 4Z4WA 2E5ZA 3I4PA 4XKVA 3AKZA 1MIJA 5FKNA 1KZHA 3Q38A 3F8NA 3C18A 1H88C 1Z3XA 4CO8A 1YQAA 4Y13A 4C2TA 4KDPA 3CC7B 3MQ0A 2K5CA 2ZMEA 3ULQB 3IKTA 1EFUA 3N90A 4WZLA 1Y8QB 5EMNA 1VQOB 3HOTA 1RWRA 3BQYA 3CUQC 4IJAA 4HV5A 4KN4X 4LGWA 3T53B 1I3QJ 2DW4A 2QA4B 2OU2A 5FLVA 3L00A 1AHDP 3ZMSA 3Q0WA 5J4YA 2V31A 2K9NA 3HGGA 4M2LA 3PNYA 1FSEA 5DCMB 1GVHA 4K1XA 4M1KA 4A6DA 4TMWA 3ASOH 3GIRA 3S14J 1YIJB 3CMYA 1YG2A 4HG2A 4PJLA 1X2MA 3KP2A 3OWTA 3O6BB 4YFKF 1BM9A 3BDDA 3X2QH 1EP3B 3S2WA 4DBRA 5IP9J 5C4JJ 4GYIA 5EEGA 2XIGA 2JA5J 1YS7A 2PJRB 4YAWA 2JUCA 3GBGA 1U5TC 3CCEI 2HQNA 4BAYA 2LBFA 2M0CA 2STWA 1BX1A 2VNJA 4X07A 4LFUA 3QP6A 3T56B 3DPLC 3PJRA 4L9JA 4IOCF 3OOCA 2P4WA 2HU9A 3RKWA 4I2OA 3B90A 2X1EA 2ZFWA 2RC4A 1W34A 3HOVJ 3FHNA 3SY2A 1BC8C 1Y1WJ 2DA3A 2DA5A 4J19A 2ZMEC 3LSTA 4M3FA 1KU3A 1F43A 4BS9A 4RDUA 4B4CA 4F52A 4BJTA 4BKXA 2VBTA 1WJDA 2CW0F 4ASNA 1XQBA 4YHBA 1MBFA 1ZELA 2ZL5A 2PQ8A 4OOIA 4OIRF 1Z1DA 2UVFA 4DGWB 3EETA 1RQRA 4ZZDA 4EJWA 2IP2A 2YUSA 4HX8A 2JSPA 1O8GA 2PN6A 2J8KA 2DA7A 2PLYA 1YX3A 1ZRFA 2HYGD 5IK2A 3NAUA 1FIPA 5BNGA 2M87A 3H1CA 2VJIA 1S5LC 2KISA 3C2GA 5FA6A 4L8JA 1ZN2A 3J7ZI 3JSOA 4A0XA 2O17A 4DYQA 3L2CA 1S72I 1U8RA 4Q4ZF 1NRKA 1WOPA 4R8HA 3BOQA 4HNVA 5KHDA 3LSMA 4DK1A 1X19A 3T0YA 3LNNA 3JURA 3OOUA 2P5VA 2YWGA 1TYXA 1YW8A 2BM0A 3FXOA 2ID3A 3QU6A 1NH3A 4AIDA 3RDIA 2GXGA 2IGKA 3I58A 1YHQI 1N05A 3GFJA 2K7LA 2M5SA 4Z4SA 3K4NA 5CVVA 1BA5A 2VYQA 4EW9A 1V5GA 4L0ZB 4BQAA 4A3GJ 4HQEA 2AHQA 3BR2A 2ZL6A 3HUGB 1RESA 4ZDOA 1WRJA 1I8DA 5FGMA 2C77A 3SHFA 4X8IA 2DTRA 3A3GA 1HDDC 2BE5F 4ANJA 2F48A 4KUMA 3F72A 3A8IA 2VKHA 1FPQA 2ESNA 2DFEA 3MFKA 3GFLA 1OKRA 1SVLA 3OV8A 2B7BA 4RDJA 3BP8A 4YXWA 4TT3A 4RD0A 3OJWA 4HRIA 1GR1A 5FO1A 1ETYA 1Y0YA 2DEUA 4EJUA 2KPMA 3TEDA 2H09A 1W0KA 2QQ9A 5F08A 2YWHA 2YU9J 3PUMA 5FFZA 5K1YA 4RA2A 4ASUA 3SYJA 4AU7A 5A8AA 3A8JA 1B72B 5D5XB 4PJJA 2ZZGA 2R3SA 2RNJA 1P4XA 3K4CA 1SD4A 2EV5A 4YAOA 4M71A 2R5YB 3JQQA 2B63J 2UUZA 1LFPA 1TQIA 1D2EA 3DBRB 2WAQA 2VB6A 4BEHB 1D0YA 2VJ4A 2XAQA 3V7SA 3ZQHA 5FL7A 3C3WA 5E1XA 5B1AH 1D0ZA 3A2KA 2KRHA 1UHMA 2CW5A 1LVKA 4XLFA 2E1MB 4YC5A 1Y0NA 1ZGWA 5AIPA 1XD7A 1BPLA 2K4BA 3Q39A 1QVUA 3DTKA 5H2FC 2IVMA 3CLOA 1IDJA 1GXQA 2WR8A 2VFPA 3CDLA 1KQ9A 2NVQJ 2RREA 2DERA 1VNDA 2VLAA 1KZLA 2ZITA 1IUYA 5ICEA 1ZM3A 3QRFF 2NOGA 5B66C 2LYCA 4NDLA 4MO7A 3I3LA 3HGYA 4JQFA 4Z4RA 3NAWA 4XMYA 1VI0A 2E34A 2IGMA 3H3UA 3OZVA 2HDDA 2XKPA 2GA1A 2DJNA 2JTVA 2QYOA 4QTRA 1LJ9A 4BE2A 2OBSA 5E1ZB 4IX7A 3TOBA 4Z4TA 2XZLA 2WJVA 1I3AA 3Q6RA 3OFNA 1OGOX 5KNLA 3IUOA 4B3GA 3JTGA 1BLIA 1FC3A 3GUDA 5GPAA 3E20A 1MDMA 3CCSB 4D0PA 1OB5A 1D0XA 3D5LA 2HZDA 4RLQA 2GOXB 2LF7A 2V7QA 2KKOA 5IYBJ 3JU4A 5HKKA 4P12A 2DPDA 1A6QA 2DO7A 2CV2A 1TWHJ 2ME6A 2GJPA 2L3DA 1DABA 3PSZA 4QHYA 5A88A 2KIFA 1UCRA 3F8BA 2X51A 1EH6A 2H27A 1IW7F 1J09A 1X2NA 1XSVA 2BVLA 3H9NA 3PA2A 4E7SA 2F4NA 4G5GA 4LBWA 3HSFA 4BEHA 3CCSI 1HG8A 1XDSA 3NB2A 2Z5UA 4ESFA 1BJKA 4U7DA 2ELJA 3OIPA 1KU7A 1MW7A 3B78A 2M7BA 4A3DJ 1GUUA 5F4JA 2CS3A 3S17J 1BIAA 4TV7A 1XSDA 2VQGA 3VDXA 2BGIA 1TC3C 1FMVA 1S7EA 4Y52J 2P5KA 1QPMA 2GAUA 5DUKA 4MEXF 5ED4A 1HDPA 3S3NA 1IB0A 4C3HJ 4Y9RA 1B23P 2R7WA 4ZYDA 1SMTA 5LEKA 4JRAC 3T8RA 2V6CA 3ABLH 2ZZEA 4CZZA 2ID6A 3GTJJ 4LG0A 3H35A 3HRMA 1XGOA 1K9MD 2Z2SB 5TGTA 2F4IA 1YITI 1MH3A 4BE0A 4JX4A 5EYRA 4HEA2 3FY3A 4M72A 4RCZA 5BSYA 1YIOA 2G7UA 3IKVA 2WA0A 4QWQA 5DCFA 3GFIA 1MBEA 3E6BA 1JTAA 5EF6A 1CZFA 3JX8A 3DP7A 2IS4A 4H4KC 1MRZA 5E18F 2VQLA 2DYIA 3FISA 4ETSA 1IDZA 1U2WA 3E5XA 4XLHA 2XNDA 4IO9F 1TW2A 1D3YA 3WODF 3TMOA 5H59A 2DIEA 1MNDA 5DYMA 1JUPA 1VLOA 2P7CB 1WTHD 2BM5A 3HKZA 1OFDA 4X06A 1R22A 4G94A 2B0RA 4UUSB 2JRTA 3KEQA 5F6FA 2LBFB 1BI1A 2XF6A 1KQ8A 2A69F 3R0JA 4N9IA 1W87A 3TW7A 1Z0XA 3ZN1A 1QZEA 1ETWA 1WDTA 1SKYB 4YDTA 2YX7A 5CYVA 4A0ZA 2IEKA 3B6CA 1SKQA 1P4AA 2LG4A 4G7HF 4N0BA 3M8JA 3OY9A 1O8JA 2DJIA 3BCFA 2L2OA 4RD1A 1FZPB 3KETA 2VBMA 2DU9A 2LSOA 5F04A 3J80Z 1N78A 1X1PA 1J59A 2EFQA 1FSHA 5JLWA 1MSEC 4NCNA 1K6YA 4BBSJ 5H5JA 3OYKA 3PO2J 3WBKA 4FX0A 1VQ6B 3FIWA 4GYGA 1P7IA 1QFYA 2JWTA 1Y1VJ 4XLPF 3AVVA 2K9MA 3H92A 4OWRB 2R7SA 1GJRA 4I76A 2R7TA 3G4SI 2CUFA 1ODDA 1SD5A 2DMNA 2KZVA 4RB0A 5FRMA 1OMIA 4LBZA 4PC3A 2M0MA 2CQKA 4LLLA 3I0TA 3JRDA 1S7OA 2CMPA 2PJRA 2HDWA 3K4JA 2DOGA 4IF4A 1D8KA 1QGAA 4UUVA 4I0BA 5JI6A 3QU3A 4NBSA 1Q86D 4BXFA 2F3LA 1BI2A 2RVCA 3BC8A 3FX3A 5GADJ 2V5IA 4FE7A 4PC1A 5E1WA 4I84A 1EH8A 4YELA 3GF2A 5CQGA 3M3YJ 4WZKA 3IWZA 3ELKA 2IGOA 1HA3A 1R58A 4A3EJ 2BYVE 3PSIA 3CLQA 2GZWA 2W84A 4AC9A 2VT3A 1ENHA 2WWYA 2IS1A 2VQHA 1IV8A 3VODA 2BZTA 1UHSA 3ESWB 4OMYA 1WZ2A 4Z06A 2ZXJA 2TRTA 4HX7A 1HOMA 2DETA 2DN0A 3SZPA 2C78A 2QKLB 3PETA 3C1DA 1DU0A 3QAHA 3FKIJ 4M3DA 5CDFA 3ASPA 4JX6A 1SFOJ 1E63A 2XRNA 3CC4B 1P4WA 3OYHA 2NT9A 2F5CA 5FKLA 2UZKA 3LQEA 2OCCH 3MKZA 3QWLA 4HYEA 2VBEA 1VQ5I 4M74A 4G6DA 3VSKA 1IRGA 4LLGF 2AXTC 4JYKA 3LA3A 4RM2A 2GXAA 3P27A 4S05A 2EIMH 3J7AO 3BTLA 4EGZA 2X1DA 2XUBA 2NAZA 4MHGA 3LQRA 1CF7A 2V1UA 4O3MA 1EA3A 1DGWY 3ASQA 5L46A 1K8AD 1VQ7B 3D1NI 1UD8A 1YRNB 1UD2A 2DY1A 3PO3J 2QGGA 1HXDA 2WZNA 3JRBA 1YJ9B 3OYIA 3GSIA 3VSTA 4EM1A 3BG5A 3OOPA 1LLWA 4CGZA 3WTTC 4XNFA 2Q2EA 2V1NA 4Z03A 1K83J 4DIQA 3W2FA 1TWAJ 1B6AA 2D9RA 5FO0A 3IH2A 4J0QA 4A3LJ 1NG6A 2R93J 1J9IA 3HOSA 3K1NA 3ZMTA 2QQ8A 5JLXA 4BJ6C 2K02A 3K1PA 5J1RA 5GTHC 2XNJA 2R7ZJ 1LNWA 4M9XA 1V4RA 4FQGA 1GXPA 4WWVA 4YEJA 1Z7LA 4ROXA 3A0HC 1MNEA 2A05A 2X4HA 1BN8A 1A04A 2V9PA 3CC4I 1KK2A 2UV1A 4PAAA 2EA4A 4GCVA 4AYBA 3IRRA 5IPAA 1A31A 3SZEA 2IS2A 5IT3A 2BY3A 2XAJA 2BBYA 3TW6A 4X05A 1WJCA 2M30A 2P6SA 3MEXA 5BPIA 2P81A 4RDKA 3HYIA 3ZPNA 3CMAB 2C5HA 4YEIA 1QFJA 2IA2A 4U0YA 1MNMC 2XSJC 1R5ID 1JJ6C 5EG0A 5L3FA 1B9NA 1OCPA 2BGJA 1XG2A 1Z6TA 3F3XA 3SQNA 5DS0A 1IJEA 1FBQA 1KYWA 2CYYA 4HBLA 4P3IA 4E7LA 1QZZA 2EB7A 3ZUGA 5J47A 4HA8A 2O6GE 1FRQA 4B47A 2ZBUA 1DUXC 1OCRH 1D8JA 1JTXA 4KKSA 2KLOA 3JSPA 4AIKA 2E2IJ 1QUFA 3B8HA 3R4KA 2HQ5A 3OR1C 2W6JA 2XGJA 3PA1A 6PAXA 2VC1A 3R6SA 2DT6A 5GTIC 2ELHA 2M1BA 1OB2A 1W5SA 2Y0SA 3AVYA 3GEZA 1VFCA 1LPQA 1QCXA 1HKQA 2BM6A 5LBQA 2W82A 2QLZA 2XEXA 2JK3A 2OA4A 2F5VA 2HXOA 1KK0A 1JE8A 1SVOA 5M3FJ 4HDUA 1T98A 1WPCA 3O2PE 1RR7A 1W7PA 3EUHA 1FNBA 3BJ6A 4BH9A 2EINH 3MZHA 2V1DA 3M1EA 2CK3A 1W0UA 2LFBA 1VJSA 2F5FA 5LFAA 2A68F 3RY8A 1Z91A 3U1KA 2V7UA 4CUGA 4FE4A 1BI0A 1ZTRA 1B9MA 2R7FA 4XONA 1W0TA 1KC8D 1X1BA 2KP6A 2IGNA 3VB2A 2HKXA 3IRQA 4RM0A 4X7CA 1R49A 2X6YA 2Z33A 1WQ2A 5EZHA 4ESBA 1O4XA 4RLFA 3VEPA 1Z05A 3SQVA 1USSA 5F0CA 2OTJB 1G7TA 4M6XA 3CW2A 1S29A 2WY8Q 4YRVA 2DPUA 3AGPA 3G4SB 2O61A 4KH3A 2CU7A 5B5EC 3WTVC 5CKTA 1YHQB 3V8KA 4FCYA 4KIGA 4D5CA 2EFNA 1RU4A 4HW0A 5CVJA 1TBXA 1JNYA 1G7CA 3G73A 1QBJA 3A03A 1F4KA 2DXIA 3ZQFA 2RC6A 3A01B 3ONUA 2O6WA 1HF2A 3PENA 1FIAA 1K78B 3E97A 4ACBA 5JMCB 3ABTA 3CUQB 4G7OF 3RKYA 2ELKA 4N9HA 2A61A 2XPVA 4PC7A 4ZGQB 2AHOA 3LA2A 5FLXZ 2E1MC 2OTLB 3FJOA 2EZHA 1QA6A 3EQNA 4ACAA 5IP6A 4HLYA 1JGSA 1HKSA 1LFUP 2Q6KA 1NHAA 3TDZC 3DBHB 2X0KA 1O3RA 2PMZN 4D9JA 1RQPA 4XKWA 3V76A 5C1CA 2BHYA 2NVTJ 4PC6A 1G3TA 1TTYA 4OAYA 3ES9A 2O0WA 1NB9A 4CYCA 1QH0A 1HW1A 2P6TA 3QOPA 4CZCA 3H3ZA 2IT0A 4B48A 4Q47A 4PJMA 3BR1A 1VQLB 1DU6A 3CCYA 3HSEA 2E35A 3GTKJ 5A89A 2CSOA 4M9SA 2EIXA 2L4AA 3HXLA 2A07F 1QGZA 1HF0A 3GQ7A 4AF6A 1U5TA 3HTUA 3K4LA 4G6QA 1XGMA 4XORA 3V42A 4Z6YA 2OQRA 1WJ5A 1TWCJ 3HJEA 1VF7A 1ZH5A 3FKJA 3U1DA 2M5WA 2GJRA 2O7OA 1JKOC 4OIQF 2N8GA 3L2VA 3ISXA 4ZCIA 2ZXIA 3CCMI 4FN5A 1VQPB 3TKYA 2CGPA 2UXNA 4UZUA 4ZV4A 3ZSCA 5HS7A 4AWXB 4OU0A 1H0MA 3ONYA 4HE5A 1O8FA 2NSTA 3CCEB 2E5NA 2XGEA 3GO5A 2OV7A 1KU2A 1FYKA 4PC2A 5J8CA 5DD8A 1PP7U 4RJLA 2RQPA 2FU4A 5M3MJ 1LEBA 1OFCX 2OYNA 1ETOA 1LDKB 2M4GA 3T5XA 1KTVA 2HVSA 4C43A 1MSFC 4MYUA 4OJ6A 1ZK8A 1QG0A 3S15J 3LSIA 3S1RJ 3ZPLA 1Z6RA 2MLKA 1XMAA 3RZOJ 1BC7C 3LMMA 2O8KA 4LIUA 2EA2A 2DK5A 2XV4S 2IAIA 3EUHC 3IP4B 2BOLA 1AIRA 4HNTA 2VN2A 4IHWA 3GZNB 2XZOA 1TT0A 2KL4A 1X0CA 3ZR8X 4Y9UA 2CJJA 3DKXA 1PE9A 2HPMA 1EWYA 3RYPA 3Q5FA 4X0GA 3DTEA 1W36D 1USTA 3PUFA 2NVUB 1YFHA 3FM3A 1Y0UA 4G6IA 4TMXA 1PVEA 1ZYRF 2HR3A 2MA3A 2VE9A 1R5NA 2FX3A 2R7RA 3GLXA 2ZL7A 2VKDA 2V1XA 3UNGC 3RKQA 1R5BA 3ZP5A 4HZFA 1YX5A 2NZMA 4OIOF 3OYLA 1HSTA 1VHOA 2AO9A 5HS9A 1PJ6A 4N3NA 2X8KA 5ICCA 3FPPA 4PCQA 2PMDA 3GTPJ 2Q1ZB 2Z99A 3QYBA 2EFGA 2HEOA 2GWRA 2R0QC 3CCRB 2OC6A 1QQIA 1IC8A 3BNWA 4NC8A 4IW3B 4OIPF 2DT7B 2I10A 1F60A 3MHPA 2LY2A 3E5UA 1U3EM 4F93B 4OJOA 2K85A 5K5RA 2IOUG 3OAAA 1BR4A 1R1UA 3KPHA 1JJ8C 4PGOA 2M7AA 4WCGA 1SVMA 1HZEA 2UXXA 3EDPA 2BXZA 3HL2A 2E36A 1X58A 3VR6A 1KRHA 5C44J 4KT6A 4JP0A 1VQPI 3L1PA 4C2UA 2MFZA 3QYEA 1QGYA 2BX6A 3LSHA 3M9AA 4DQ2A 3IC7A 5JHFA 2JJ7A 2BVMA 3FPKA 3FK6A 1U0JA 4X1EA 3HOUJ 3E6MA 5B6IA 1QX4A 4W97A 3IAM2 2V6EA 3W2VA 3P26A 4UV9A 4XLAA 5BSXA 3K0LA 4XKCA 2XROA 3FMQA 2ZC2A 2Y48A 3RPUD 4GFBA 3S1MJ 4KJZA 1UJ8A 1TYVA 2PYGA 3EUAA 2LR8A 3DTIA 1ORKA 3R60A 4ZCLA 3W5VA 1WWXA 3HRSA 5BOXA 1IO2A 3TGNA 5FJ8J 1MBJA 2ZB9A 3NRVA 1A8PA 3SFIA 1KK1A 1IN4A 4HIZA 4TMVA 5J3OA 2INUA 4N4OB 3M4OJ 4OPWA 2K27A 4M9ZA 3MWMA 2F6CA 2L02A 3BZKA 2BY1A 2X48A 4S04A 2Q0OA 4FTHA 3CRZA 3AVTA 3VNUA 5IP7J 5J1YA 1QHHD 4CCNA 1Z67A 1PUEE 3KYCB 3H5AA 3CMMA 1YW7A 1VQ9B 4Y15A 2EPFA 2VKEA 4CQJA 1S72B 1WSRA 4ZC3A 4ZTJA 2GQQA 2QVOA 3FBIB 1UG0A 1WORA 4OZZA 1X1AA 2EILH 3DPTA 3NWTA 4B44A 1WGXA 4XKBA 1MDMB 2JJ1A 4MXNA 4HPQA 4MIMA 4XLEA 2HVRA 3Q9VA 2CFXA 2HMAA 2CWEA 4L9VA 3B6AA 5K5QA 4MFEA 5DCMA 1HBXG 3CC7I 5H20A 4C2MJ 2KRCA 1I18A 5AIQA 2DQRA 4EM0B 1IJWC 2EZKA 2QSFX 2XAFA 2GJKA 2O9LA 1QFZA 1WMRA 4BNCA 4YFNF 3KYDB 4U7BA 2X6OA 4PJ0C 3H94A 1SM4A 4DJAA 2JIZA 4L5IA 3C2BA 4M6VA 4QVAA 5EDNA 3I4MJ 2GQFA 3BY1A 3WBJA 2X9DA 2CF4A 4G12A 3J81Z 2J5PA 3F22A 2JA8J 4G1BA 4BGDA 1H9TA 2BF4A 1DGRM 3ZXSA 3B82A 4KYWA 1MJ9A 2HXIA 1EFTA 2OPTA 1L3LA 1HQCA 1W0JA 1K4TA 1V5FA 1GLNA 3ZQQA 1W2BB 3KZZA 2HWVA 3E3VA 4BE1A 1XB2A 1MMGA 1AOYA 2ICWG 1K78A 1WKMA 4CCLA 1JT6A 2ZZQA 3WQZA 1IB4A 2PMHA 4PUSA 4L5EA 2I8DA 3SKBA 2LD5A 2E7WA 3CJRB 3CUQA 1MGTA 1FNDA 1R23A 2H6BA 3CB4A 4OPOA 1QO0D 4BDYA 2ZJRF 3HAGA 2NS8A 4GQNA 3WTXC 3OSGA 4J00A 3SUCA 3ZMVA 1HCRA 1E64A 3WTZA 1CNEA 1G3YA 5ILVA 3SJMA 1FBSA 3L09A 3ZGKA 4IQJA 1FOYA 5HDKA 3VSUA 1FLIA 3UW0A 3Q6QA 1XMKA 1S0UA 4HE6A 4XLCA 2VPLA 1W4MA 1E2XA 3VO2A 4V19K 1X1DA 2HLDA 1MBGA 1XTAA 1PLUA 2Y9YA 3SEZA 1XC5A 5LGNA 1N08A 2JVGA 3ASNH 1MMNA 2STTA 2UVEA 3GQBA 3HPHA 4BXXJ 2W4SA 1BL0A 1MBKA 1T33A 3VSLA 1FOXA 3CESA 2R6HA 2NTPA 2GIZA 3V8LA 5JFRA 4LLNA 4DBQA 2V7XA 3PNVA 4RLZA 2VXZA 2BSAA 2BY2A 2W85A 3NQOA 3P7NA 1IXCA 2VBUA 3DCFA 3EYIA 1X3UA 3QPSA 4OINF 1QQ1A 4RCYA 1CQXA 1P7JA 4IRIA 4PSWA 3ABUA 2CUEA 4I7HA 3H3VK 3CMAI 2E60A 3I71A 1RPWA 3ASRA 2VONA 3BTIA 3KFWX 3RCOA 5K5OA 3WG9A 1XB4A 2FNAA 4HQMA 4ZH4F 1N75A 5D6EA 3FXUA 2WZPP 2OF7A 4NNJA 1FNCA 1MKMA 2K9LA 2QKMB 5C1EA 1P92A 4KIBA 1O3SA 1U9OA 1OCCH 2PBIA 4RB3C 1Z9CA 3H9JA 2EWNA 4N4NB 1VF9A 3VFZA 3N4MA 4LBYA 1V5EA 3WTUC 3LAPA 1C0WA 2VI6A 4DK0A 3ML3A 4AC0A 2DA2A 4UUSA 4C0SA 3Q3SA 2WBMA 4V2FA 4W8RA 4ZYGA 4BHPA 4WXCA 1KONA 2DCUA 5LGTA 2K4JA 1ZUNB 2ZTGA 3J80K 4V02C 2ODLA 1TLHB 3OSFA 1ZR2A 1XPXA 3GTQJ 4KICA 4CSWA 4Z4YA 1EF4A 3HZJA 3D26A 3LSGA 3VNVA 3RIRA 2I1LA 1R7JA 5F0HA 4HF2A 2Z6BD 3RPQA 1E1QA 2FBHA 4LD5A 2H8WA 1ZRDA 3LL7A 5D5UB 2QXZA 2VT2A 2EJRA 5LHIA 4XD7A 1IN5A 1IN6A 4CICA 1EP1B 4MQ9F 2E19A 3QOEA 4ENMA 3WNCA 3CCLI 2AQFA 3OPOA 2K40A 1KJZA 4JX5A 1G4DA 1OPCA 2HNHA 1U5TB 3MD2A 5ICFA 1M1KD 1P9QC 2HVQA 2RDPA 1VTNC 2HDCA 4HF1A 3GMEA 4DW6A 4ZYHA 4BHCA 1JA0A 3U21A 1QUEA 4PFPA 3MAJA 3SXYA 3FXJA 4RM3A 2V7FA 1LEAA 3VYUB 3PQJA 3BG9A 3LQQA 5HLIA 1ZG5A 1A5JA 5IOYA 1YRNA 4PGHA 5GAHJ 2QX3A 3ERED 3K2ZA 1D5YA 2J7KA 3CO7C 3WU2C 3T51B 4UHTA 2HYJA 4Y7CA 2Z3YA 2HCJB 1RNLA 2L9VA 2NOJB 3ISPA 3K1MA 1WOOA 3CPWB 3GYHX 3CXCB 5IYDJ 4MEYF 4HX4A 2OTJI 2ZJPF 3E1SA 4A3CJ 5FRNA 4UB6C 3VPRA 4HDVA 1IDKA 3TL4X 3BR5A 1QA1A 3WNDA 1EFRA 4EVIA 3KYLA 3ZIAA 4OAZA 5D4SA 1IF1A 1M1EB 4BY1J 1ZM9A 5ERIA 3MMPA 1K8FA 3TH0A 1LQ1A 4I99C 1HW5A 1L1IA 3ZZ0A 3GZ5A 4LB6B 3SDBA 2GK6A 2HI3A 2LP0A 3CJTB 1O57A 1NHCA 1VQ6I 2VJJA 5EGOA 2GXBA 4MQVA 4RMNA 3L2RA 1AIPA 2CBXA 1OOCA 4OJLA 2QE7A 3BROA 1TYUA 2FMYA 1W1WE 2QY1A 1T8IA 3VSVA 5AONA 1YIJI 3BH6B 3OS0A 3AL0B 1PKVA 2A5YB 4FASD 1DDNA 3CJQB 3WGGA 4PFOA 2DBBA 4C30A 2GK7A 1YJWI 2JRMA 1R71A 1K6OA 2BN4A 5HZBA 3BR6A 2VFOA 5E8GA 4D7MA 4QLCU 4GO1A 1V0FA 3SEQA 2XT2A 3H09A 3IWFA 4LMYA 3E0JB 3PFYA 3GVAA 5KW9A 3CD6I 1KTWA 1MBHA 3D5RC 2W6IA 4P2NA 2CC2A 3BT9A 1KU9A 3SLNA 1OFMA 3I59B 3KLOA 3I56B 5CVIA 2XGCA 1VQMB 3AG1H 2CW7A 4I0AA 2DDAA 4QUZA 2X0LA 3SLDA 2ESHA 2HPIA 2CV1A 2EFOA 1B2RA 2BMWA 4PK4A 2IA0A 3I9V2 3DFGA 4LG3A 1QA2A 1TLLA 4C3IJ 2M8GX 4M6YA 2ZJ2A 5IYQA 3VYSB 2A5WA 2XVCA 3DPUA 1BQEA 2FA5A 5CLSA 5J4VA 1ETVA 5HDNA 1WH5A 4R71A 2QZAA 3CZ6A 1FEXA 4G9YA 4XRSA 3BQJA 1EKEA 4Q7JB 1UMKA 2XPWA 4BYYA 3BR0A 1IRZA 1TW3A 2Z8GA 2F43A 2DA4A 3HDDA 3L2WA 1Z3YA 4UUTA 3ZOBA 5THXA 3W2HA 4B8XA 5HNHA 1G59A 2JA7J 5TY0A 1RI7A 4RGXA 4NB5A 1HW2A 2QA4I 1WJAA 2XGXA 5DV5A 4KMUX 1ZM2A 1WU8A 3OYBA 1V0EA 1SMYF 2MG4A 4AYBN 2HTJA 1PDNC 2BM1A 4NC6A 2VFQA 2V79A 5GPCA 2LKXA 2MD5A 4QSHA 1VQ8B 3E7LA 2CQNA 3HBLA 5E3NA 3TO7A 2NVYJ 5HLHA 1SFUA 1LDDA 5GAGJ 5C3EJ 3CDIA 1K4SA 1VQKI 2L9NA 4WWCA 1ZQ3P 3WGHA 1QA3A 4C9YA 3R61A 3OE7A 1MMAA 2WB1A 4E7IA 2L5QA 1UD4A 5K7FA 1Z77A 4DNCA 1V54H 4P5OA 4G1VA 3A01A 2Y9ZA 3OYMA 4XLNF 1ZM4A 3KE2A 3SJPA 1H9GA 1JHFA 2F1MA 1DP7P 2LZJA 3VO1A 4LK0F 1BJAA 4A3KJ 4LG0B 2RC5A 1IN7A 4L0YB 3L9FA 4G7WA 5HS8A 1AU7A 4CHUA 3J7YJ 2EFPA 1P6RA 4MLOA 2FSWA 2D45A 2WV0A 4IPAA 2KDOA 1TP4A 3KP7A 4P25A 2FUG2 2GLOA 4BPRA 4QPOA 1O8HA 2CQ7A 2LY9A 4EGYA 2QQAA 3GQ9A 1FY7A 1HA8A 1H42A 2FF4A 4HLXA 5J35A 2KZGA 1OB0A 2DI3A 3JQPA 4EEFG 5TRDA 1VQ5B 4IHXA 1VBLA 1T95A 2M9HA 4M4SA 1U2RA 5IT9Z 3MKYB 1BIBA 4BU2A 1G7RA 4YIRX 3SFZA 2PEXA 3KEOA 2DDBA 4LB5A 2ZSIB 1JTYA 2OTLI 3WHCA 5HLGA 1IDYA 3UR3C 1FNMA 3WHBA 1O8KA 2FEZA 1K61A 1ACIA 3J7AY 2X53S 1H89C 1JRGA 2Y0MA 1ZR4A 4OJPA 2X3UA 4A3IJ 2QBYA 1WXRA 1QRBA 3JR9A 3FM5A 2QQBA 4ZJZA 5LHHA 4PGGA 1QRCA 1G3SA 4X7FA 1CF7B 2V9KA 5JR3A 1ETQA 2G0EA 3GTMJ 3JAMZ 3L2QA 1YO5C 2RKHA 3PSSA 3P5JA 1DDIA 2ISZA 1TUIA 4QV2A 1SC7A 4D5FA 1J0RA 4BDZA 5E3LA 4EJTA 1T6SA 4E7KA 2EV6A 1I5ZA 2OK7A 2QYUA 4RAYA 1O7LA 5HOOA 3K6GA 4F92B 3HB9A 4Z2YA 5BMZA 2E1NA 1WSUA 3GXOA 1I6HJ 1E3PA 1O8IA 1OYIA 3WTSC 4XK4A 4DZPA 1VQ9I 2XOKA 3JAMK 2PMUA 1K5CA 2B0LA 2F2EA 4PJNA 5D6FA 1G8XA 3TO6A 3W6KB 2LKPA 2BXYA 1BJZA 1IZ1A 3RQIA 2RGVA 1F20A 1Q7YD 3A1YA 1FBUA 2HOAA 1K28D 4B1RA 2JPCA 4IXAA 2E1OA 4E7JA 2JJ2A 5D5VB 4W8SA 3TO9A 1TT5B 3HTSB 3ZQCA 2OQGA 3AK5A 3DLAA 5K7HA 4P9FA 1WJEA 2D2WA 2VE8A 5AMVA 1ZGJA 4K2EA 2G0YA 3F8FA 3JQRA 4I98B 4NQWB 2R5ZA 2VODA 1I6XA 5FB2A 1VHEA 2FVGA 1RUNA 2QTLA 3E6CC 3SZTA 1O88A 3LSKA 3ZQLA 5J1UA 5ILSA 4DYRA 2YPRA 3HIFA 2I5UA 3GWZA 1GDTA 1ZRCA 5E17F 2ZZFA 4BQNA 3JCUC 1F5TA 1BR1A 3KIOA 3SEJA 4BJ5C 1O8DA 4XSXF 3HRUA 1YI2B 1IRFA 3S16J 1Y0RA 3C7JA 4UAJA 1BW5A 1BR2A 2MH9A 1AA7A 3LFUA 1IGNA 1QGPA 4U87A 1RR8C 3LYCA 1R6RA 3OKXA 2MC3A 1YE9A 1FYLA 1EJ9A 4JK1X 4P96A 1MMSA 2R7DA 1SAUA 2PYHA 1XS9A 4I01A 3FBNB 4XIDA 1A36A 3QFRA 3ZQ7A 3OZWA 4RGUA 3DEUA 3TDUC 5L3CA 4RD3A 2YS9A 2TCTA 3ONQA 2QM3A 3AVXA 2R4GA 5EEAA 1R00A 1MJBA 4AM3A 1FX0A 1N06A 1OCOH 2YR2A 3LWFA 3U2RA 3QYFA 4HSTA 5HDGA 4I02A 2VNHA 4LBVA 4W8QA 4HSRA 3U2QA 2G7HA 2VJ5A 3HM5A 4DZJA 1KK3A 2Q2EB 3IH3A 3QP5A 1ZREA 1LVAA 1G7SA 3P9KA 1WHUA 1KCDA 1T6XA 2WAQN 3M8EA 4F3QA 2ZCWA 4W1UA 3CP2A 1W35A 5BS6A 1WPKA 2M2EA 2EV0A 3KZYA 4XN0A 4ENKA 1LE8B 1K79A 3OL3A 5EG0B 2KDZA 3CMEB 2HZTA 3I64A 5CPRB 4CYDA 3OL4A 2IQ7A 4KFCA 2ZTNA 3BPVA 1SFKA 3DDYA 1VQ4B 5FIUA 3BJOA 1OR7A 3Q0VA 4QIWN 5D8KB 4U49A 4JBAA 5CVRA 5A2QZ 2ZMEB 3QFTA 4RGSA 5DD4A 3TBIA 1WCMJ 4Y7NJ 3LMWA 2FNPA 3PIPF 4I09A 3SDGA 1RUOA 3AVUA 3B4NA 1X3ZB 4OJ5A 4UXNA 1ZAOA 1E3OC 2E71A 4AD9A 4WK8F 1RC9A 4LOCA 3U9GA 3GCMA 2FJ1A 1PUFB 2V7VA 3MMYB 2ZBVA 4M0LA 2WYRA 4RS8A 2JDIA 4F7ZA 1KD1D 1T5EA 1O8LA 2MD0A 1LKXA 3W3CA 3CCJI 2KIUA 3RYRA 4RD2A 4ZYEA 3QPHA 3DU6A 3QPLA 3BCAA 3BCDA 3A8KA 1XGSA 4HOBA 3I55I 2XZPA 3DU5A 1JHHA 2O0YA 3Q9SA 1I1GA 2MC4A 3W5UA 1QU3A 3CMEI 5J6XA 2VBZA 4P55A 1RMGA 4HWVA 1T2KA 3H36A 4CCOA 2ECBA 3K69A 1JT0A 4UZEA 1S6LA 2V7WA 1OFLA 3OYNA 1VQMI 3WWGA 4RB2C 2QEXI 1S4MA 2CQQA 3GW2A 2XTWA 2IW5A 4NQWA 2HGCA 2ZXWH 3OMYA 3K70D 2R5ZB 1ZLKA 5ILUA 2QSGX 2W24A 3E5QA 5GAEJ 3JRHA 4PMHA 1B1BA 3ZBTA 4UV8A 2DAOA 3S8PA 4AIJA 5E3OA 4F7DA 1D1CA 1I39A 2OZ6A 3G3ZA 1YJNB 2YX4A 2LREA 4Y4RA 5BPDA 3F6OA 3MKWB 2DMPA 4U0WA 1IUFA 2HOTA 4B3FX 2C2WA 1Z21A 2D1HA 3OYAA 5TV2A 1NBMA 4EV0A 3MVPA 2DCEA 1OQYA 3S1QJ 4DQKA 3RIQA 1ULYA 1FOWA 3TQNA 4EM2A 3K10A 3UKGA 1PUFA 5L3BA 4GXOA 5FKKA 3BC9A 1JXSA 1COWA 5LHGA 4TSFA 5F1RA 3L2UA 3LJYA 2HTSA 2MLGA 2NS7A 4XOPA 2K9QA 3SJZA 4J01A 1LUJB 4DNRB 1MJAA 2L9SA 3W5HA 2DODA 1CGPA 5IOZA 5D8LB 3P4GA 1R1TA 3FK7A 3AAFA 3DXJF 2X1CA 2Y69H 3GTGJ 3CCMB 2L01A 4NHJA 1WP6A 1PJ5A 3FMSA 1FJLA 1O7FA 3H0DA 2JN9A 4WX9A 3WTYC 4UNOA 4X7DA 5GV7A 3GRHA 2M8EA 2VBKA 1BOBA 2JN6A 1R5OA 3FF5A 2DMQA 3ZQIA 3IV5A 1WOSA 4RAGA 2XGDA 1OISA 4A5MA 4G7ZF 4FETA 5KAIC 3QODA 4CH7A 3OP1A 3GQAA 5F27A 1XN7A 1GV2A 5D4RA 1FMWA 2LKSA 4M73A 4WQMA 4AVZA 3CCQB 3OYDA 1ZLJA 2NNNA 1F36A 2XAUA 1RZ4A 4F91B 2D3LA 4MYTA 1E0EA 2CUJA 3OYFA 2QGUA 1IXSB 2M34A 1OJLA 1UFMA 2V4JC 2VBYA 4Q5SF 1LE8A 1UD3A 3OS1A 2ZSHB 3A1PA 4KIFA 1GQ8A 2BPOA 1YOVB 3H9GA 5K7ZA 3HOZJ 2HKOA 3S1NJ 4KMFA 2QEXB 1XFOA 1WVRA 4PSXA 3WNBA 3OYJA 3JTHA 1W7PD 3IH4A 3K70C 3HOXJ 2YUHA 5HXBA 4UB8C 1NG7A 5FLXK 3FXRA 4KKUA 2E1BA 2F4OB 1TWGJ 4UZFA 2LY1A 4XRSG 5IYPA 2OCEA 2BW3B 5DUIA 4TN1A 2HOEA 2R5YA 2BM4A 4NK6A 3QQAA 2BVNA 5DSZA 4YZQA 4D1QA 2BV6A 2INVA 5IYNA 4YIFA 1ZG1A 2YU3A 3PUBA 1JKRC 4RGRA 4TMTA 2NNYA 1IAWA 3GVLA 2JA6J 2XASA 1J2XA 4I6ZA 2Y75A 5GV8A 1P4MA 3CC2B 3CCLB 2XTXA 2WAFA 3FZVA 1ETKA 1TZLA 1VQNI 4UVBA 5JVTA 3HOYJ 1WI3A 3BJAA 3LQ6A 2PJPA 1SEUA 2GIVA 2PFBA 4L5JA 3KRGA 4ON0A 1EP2B 2OJED 1Z7UA 1Q1HA 3CCVI 4R1HA 1HC8A 1PYVA 2H8RA 4XL9A 1UB9A 4AIHA 4E7ZA 3V4GA 4KNYA 3T9GA 2ZKZA 2EIJH 1NK2P 1XGNA 3AL0C 3GVJA 4WZEA 3WE3A 3ZN0A 1IRXA 1G3WA 5DNSA 2B5OA 4B4DA 1MZBA 2XC7A 3O8GA 4Z4ZA 1FX7A 1F9NA 3WY9A 1X3WB 3BG3A 2R7XA 3QE2A 3ERMA 3K4MA 1N77A 4R79A 2QDXA 5FD5A 2LVSA 2VASA 5DDGA 5LRSA 2AS5F 1OGJA 2DTZA 2RN7A 5IY5H 3F8CA 2K86A 2XSDC 3I1FA 3GVKA 2VOPA 2ZO4A 2PLFA 2GREA 3N97A 4A3JJ 2Y31A 3CF5F 1R1VA 3F9KA 2Y0SN 1VQKB 4IZZA 1EV7A 1I50J 1R4NB 3E1YE 1SD6A 2R7VA 3O8HA 2R7UA 5L3EA 1B72A 3DWLE 4YALA 1GAWA 3PUNA 1ITYA 1GV5A 2KIQA 2P8TA 1X4PA 2Q8KA 4WXDA 5LLQA 2KJBA 3G71I 4RPDA 4EJVA 3FXKA 3PL8A 1U78A 4M3GA 3CPXA 4TMZA 3DEEA 4AF7A 3FHZA 2R92J 2Q6OA 2PIAA 2EK5A 4BXUA 4E6KG 3D0SA 5FD6A 2NV4A 2LK2A 4IOAF 2J8IA 5FKOA 1T38A 3W2GA 4A5NA 1H8AC 2NVXJ 2DOFA 2K3FA 4OP7A 4G8XA 1TSPA 1SFEA 3IHUA 2L7KA 2W1OA 3GFMA 3HKZN 1POGA 2HDNB 3LO8A 3PSFA 4RD4A 2JVHA 3BZ6A 4BQOA 2QTZA 1B4AA 2CNDA 4DYCA 3A3BA 3DF8A 5HNFA 1SAXA 1UG2A 1KYZA 2FOWA 2R7OA 2UWMA 1H8HA 5DEQA 3WXMA 1Q81D 1EA0A 4ESJA 2FBKA 5JVGF 1NTCA 2JUGA 5H6RA 5KVRA 1W5TA 3ZC3A 2QBYB 2V4DA 4YAUA 3VMWA 2D74A 2PE3A 3KX2A 2VFNA 3BTJA 4RB1A 1HVXA 4M3EA 1V55H 4X0CA 1Q1VA 1UZCA 3JRIA 1AWCA 5LGUA 2QF7A 4IHTA 3NE5B 2O0VA 2XB0X 2K3PA 2CH0A 4BUPA 3FDYA 5LEJA 5F1JA 1V3FA 2BW3A 1FP1D 2DFIA 4D7NA 5CQEA 5AN9A 3TP3A 3JRCA 1CLWA 4RAFA 3ZMUA 3KEWA 2KMUA 3KCCA 5HZAA 3G6EB 1YYVA 1IV6A 1R9TJ 3WU1B 3COAC 1Y39A 5J3LA 4F55A 4A6EA 4JOMA 5F0FA 4DOZA 1APLC 1NJID 4KITB 2Z16A 3F0CA 3ECOA 3B73A 4CXFA 1IHMA 4N3GA 4C2LA 1XSXA 5DTDA 4A93J 1OGIA 1TYWA 2EQRA 3KZIC 1HSJA 3FXMA 2WJYA 2O04A 3F6VA 3EQLF 1GHCA 1TQPA 3DKWA 2H1KA 2FMLA 4Z05A 3F23A 2QN6A 4IL6C 1BOAA 3JRFA 2DK8A 3PNTA 3L7WA 3T1BA 3OYGA 3G6EI 3W2AA 4L18B 1BMFA 1QNTA 2OBPA 4EMSA 4S0HB 4ABZA 1BW6A 3SYTA 4NUBA 2NT6A 4P1WA 3M7GA 3K4KA 1SANA 3CCUB 4OZYA 2V9VA 4B43A 4BACA 4V2GA 3FXLA 1TL8A 1TQMA 2NRAC 2DMUA 3KEYA 1QVFB 4IHVA 4B3AA 1MD0A 1REPC 2HOSA 4KN7X 3FMRA 4CYCB 3QFCA 4B09A 2XTYA 1GVJA 5E8IA 1FP2A 3ZQGA 4YZ0A 3M07A 2F5EA 2OZUA 5LRRA 2HFHA 2B9SA 2XF5A 4BL0B 1K7AA 2W25A 4KISA 4LITA 4XBFA 1OCZH 5KCMA 1EE6A 3OW2B 3LSPA 3A35A 2H1LA 3LA7A 4BBRJ 3KP4A 3CF2A 2DFFA 3I59A 4XOTA 1SFXA 2KJCA 2MSYA 3K7AJ 2BEOA 2YSRA 2JQ7A 3CC2I 3WU0A 2WADA 4B3XA 1DQUA 2K9SA 2VIXA 5BQTA 4RDLA 4RD6A 3U6BA 2NTBA 2F4MB 2HQAA 2NYXA 3RKXA 4P1VA 3VMVA 1M90D 1IA5A 1KGSA 1N0UA 3SZGA 2Q6IA 4FT8A 3OJXA 1ON1A 2M3AA 3OEHA 2KHMA 2OK8A 2DOAA 2L7FP 3I4NJ 4AUXA 3CCVB 5JBQA 5JHUA 3D5SC 2L54A 2QUFA 1R5HA 1YITB 4A69C 4E70A 5FO5A 3HOWJ 4HF0A 3BCBA 2KT0A 1JKQC 1AKHB 3VWBA 2XC1A 1SD7A 3H0GJ 4E4HA 2MBFA 3J81K 2ZJQF 3HEFA 3GZ6A 4YFOA 2C4UA 2CV0A 1F1ZA 2CRGA 5H6QA 2XAGA 3EQOA 3ABKH 4EATA 3OR2C 4U88A 5DM6F 2L0KA 2F5DA 2PECA 1FTTA 5LMZA 3S93A 3HUGA 1D5VA 1D1AA 2LNBA 4QFMA 4CA0A 4JMQA 1PXZA 4P9UA 2M4KA 1QJVA 2NSPA 2EZLA 1E1RA 4OOXA 2X6WA 3FXQA 1JKPC 4W8TA 4XSZF 4LC0A 4E0FA 2Q6LA 4O6JA 4Y17A 5TISC 4P9SA 3R0AA 3E6DA 2C5BA 2VFMA 4FHTA 4NBQA 1DARA 3T8TA 3PIOF 2VPRA 5DS9A 3DLLF 3CCUI 5FFXA 2VQCA 3DV8A 3G71B 1Q82D 1CQTA 5F4MA 3EYYA 5E79C 1DBOA 5D5WB 3CDHA 2JMWA 4MGRA 4ENJA 4YZAA 5J8FA 2KVOA 4U4BA 1VQLI 3IAS2 2EBIA 2B7EA 2LDUA 2VBWA 5F64A 4IRHA 4MTDA 1FDRA 5J40A 2IJLA 1YLFA 1K4ZA 4XRFA 3QSYA 1VQ4I 2LH9A 2V26A 4FK8A 4A2UA 2FE3A 2W48A 2RQQA 3A02A 4IHYA 3CCJB 2BY0A 3RTRA 3WG7H 2JA2A 4HV6A 1YLOA 4Z4VA 1N07A 4L9NA 4P3YA 3MCZA 4EH1A 3R6KA 2WY7Q 5FKMA 2A3SA 4A3BJ 4IHSA 1XDUA 1LDJA 1E79A 2ADUA 2OBTA 2GOMA 3W2IA 5EJCA 3NWSA 1OYYA 1JUSA 3M8FA 1MH4A 3CCRI 1KCCA 4P6VF 2EFWA 5C4XJ 1T39A 1T56A 2VXDA 3WYAA 2VKVA 2QCOA 3RI4A 1VZ0A 1ZG3A 2GA2A
chains in the Genus database with same CATH topology
4II3A 1BR1A 2WAQA 2VB6A 4BJ5C 3OAAA 1OR7C 4BEHB 1BR4A 1D0YA 2VJ4A 5FL7A 1O8DA 2M7AA 4Y3OA 2WPDA 1BR2A 1AA7A 3LFUA 1HZEA 1D0ZA 4U87A 1PJRA 3A2KA 1QHGA 1R6RA 3VR6A 3HL2A 1YE9A 3S32A 2KRHA 2PYHA 4YZXA 1SAUA 3ZCOA 2CUZA 1LVKA 3FBNB 2E1MB 4XLFA 4KT6A 1O8MA 2X3HA 1BPLA 4C2UA 2MFZA 3QYEA 3DTKA 2A6TA 3LSHA 3ONQA 2R4GA 1IDJA 1FX0A 2RREA 5JHFA 1WFXA 2BVMA 2VLAA 1KZLA 3QYFA 4HSTA 1U0JA 4OJOA 4W8QA 4HSRA 4XM3A 2LYCA 2VJ5A 3I3LA 4JQFA 3IAM2 2V6EA 2IS6A 2Q2EB 3W2VA 2RNGA 1OLTA 4XMYA 4XLAA 3S3OA 1KCDA 5DN6A 2IGMA 4F3QA 4XKCA 4GRIA 4BE2A 3CP2A 3RPUD 2XZLA 4KJZA 4IX7A 2PYGA 3EUAA 3DTIA 2WJVA 4XN0A 2WSSA 3OFNA 3OL3A 1OGOX 5KNLA 3IUOA 3VYRB 4B3GA 5CPRB 3OL4A 1BLIA 2ZTNA 2IQ7A 1Y6IA 4HIZA 1SFKA 2INUA 1D0XA 3D5LA 4N4OB 3BH4A 3DDYA 2HZDA 4RLQA 2GOXB 2V7QA 2F6CA 4U49A 3JU4A 4Z1MA 5HKKA 2PMZA 1QHHD 4CCNA 3LMWA 3TBIA 2CV2A 2BSPA 3H5AA 3CMMA 2GJPA 3HC7A 4TKOB 3B4NA 4OJ5A 4ZDPA 4ZC3A 4ZTJA 3FBIB 4OZZA 1UG0A 4KKTA 1X1AA 2X51A 2AQEA 3H5NA 1J09A 3DPTA 3NWTA 2BVLA 4B44A 4XKBA 3MMYB 4E7SA 2JJ1A 4HPQA 4MXNA 3ZRGA 1BHEA 4XLEA 2HVRA 2JDIA 3BLYA 4BEHA 1T5EA 1HG8A 5LD2C 2MD0A 1WJFA 1O8LA 2CW8A 1LKXA 3W3CA 2KQRA 2KRCA 3BG6A 1I18A 2ELJA 3OIPA 1H80A 3DU6A 2GJKA 3BCAA 3BCDA 4NK8A 1MW7A 2M7BA 1WMRA 4FXUA 2XZPA 2CS3A 3DU5A 1JI8A 4U7BA 3H94A 2VQGA 3VDXA 4DJAA 4IKFA 2MC4A 1FMVA 2JIZA 2W7NA 1QU3A 3S3NA 4II2A 2R7WA 1RMGA 4HWVA 4BGDA 4CCOA 2ZXHA 1DGRM 4LIVA 3ZXSA 1OFLA 3OYNA 2ZZEA 3ZPPA 3WWGA 1W0JA 3H35A 4ZYAA 1H8EA 2R7QA 2Z2SB 5TGTA 2F4IA 1V5FA 3BG7A 1GLNA 3OMYA 3ZQQA 3K70D 4BE0A 3FY3A 4HEA2 2O5RA 2P0WA 2WA0A 4PMHA 4BE1A 1MMGA 1JTAA 2OUMA 1O8EA 3S8PA 3K4BA 1CZFA 1D1CA 2IS4A 3HPGA 4H4KC 4CCLA 2ZZQA 4QPQA 2VQLA 3WQZA 4PUSA 2LREA 1IB4A 1Y56A 4Y4RA 2I8DA 3MKWB 3CJRB 4XLHA 4ZTFA 2XNDA 3TMOA 4B3FX 1Z21A 3OYAA 1MNDA 2DIEA 4BDYA 1NBMA 3HAGA 1WTHD 4GQNA 4MR0A 3HKZA 4J00A 3SUCA 3VYTB 2DCEA 2IXSA 4ZDLA 4NC7A 2LBFB 3K10A 1ERDA 3AFHA 2XF6A 3BC9A 1W36C 1COWA 4TSFA 3ZGKA 3L2UA 4IQJA 3OYCA 3VSUA 1UD6A 3UW0A 1SKYB 4XOPA 4XLCA 4XR6A 4J01A 2VPLA 4DNRB 2L9SA 1X4OA 1X1DA 2WAEA 3W2WA 4E7HA 2LG4A 2X1CA 4F93B 2CFOA 2HLDA 1PLUA 3SEZA 3M8JA 4HNUA 3OY9A 1WP6A 1O8JA 2JVGA 2DJIA 1MMNA 3BCFA 3H0DA 3FKSA 3GQBA 2UVEA 3HPHA 2L2OA 3H9QA 2VBMA 1UAAA 2W4SA 1UD5A 3VSLA 1N78A 3CESA 2NTPA 2O1DA 3GRHA 2VBKA 1BOBA 5HLTA 1MABA 1K6YA 3OYKA 1DP3A 4DBQA 4FETA 2X85A 3QODA 3G2BA 3PNVA 4CH7A 3GQAA 2K9MA 2VXZA 4OWRB 2R7SA 1FMWA 2R7TA 4AVZA 2VL8A 3OYDA 2KZVA 5FRMA 2MYSA 2M0MA 2XAUA 4PSWA 2D3LA 4F91B 2CMPA 2PJRA 2HDWA 3K4JA 1E0EA 2CUJA 3OYFA 2E60A 3RCOA 4BXFA 4XN3A 3BC8A 2V4JC 3OW7A 1N75A 1D1BA 4BQQA 1UD3A 2WZPP 3OS1A 2ZSHB 4I84A 4NNJA 4YELA 4Y33A 1GQ8A 2K9LA 4IQ4A 2QKMB 5CQGA 5C1EA 3H9GA 2IGOA 3PSIA 3C2HA 2LOOA 3H9JA 4N4NB 4PSXA 3OYJA 1V5EA 5FROA 3EPZA 3K70C 1KMHA 1NG7A 4DK0A 2IS1A 4KKUA 2E1BA 2VQHA 2LY1A 5HVQC 4Z06A 4NK6A 2BW3B 2WBMA 4W8RA 2QKLB 2MABA 4YZQA 4D1QA 2INVA 1KONA 1W9XA 5CDFA 3PUBA 3RQ4A 3OYHA 2ZTGA 3GVLA 2NT9A 2ODLA 1S9HA 4CSWA 3MKZA 2WAFA 2VBEA 3LSGA 1DBGA 1TZLA 4CCKA 3VSKA 2Z6BD 1WJBA 4RM2A 1E1QA 1E3ZA 1E43A 2X1DA 3LL7A 3RSNA 1EA3A 1DGWY 3KRGA 2QXZA 1UD8A 1UD2A 1OGMX 4XD7A 3VSTA 2D3NA 3OYIA 1PYVA 3QOEA 4XL9A 4E7ZA 2AQFA 4XQFA 4XNFA 3OPOA 3T9GA 2V1NA 4Z03A 4ITVA 3AL0C 3GVJA 2HNHA 4CCMA 4DIQA 3MD2A 1IRXA 1P9QC 2HVQA 1NG6A 3OYEA 3HOSA 2XC7A 3GQ8A 3U21A 4BJ6C 4PFPA 2NTQA 1OHHA 4RM3A 1UELB 2V7FA 2R7XA 3VYUB 3K4MA 1N77A 4R79A 3G05A 2VASA 2QX3A 3HG9A 4YEJA 1Z7LA 2W00A 3T51B 1MNEA 2NOJB 3GVKA 3N05A 1BN8A 2UV1A 4AYBA 2IS2A 2LC2A 3E1SA 2LRDA 3F9KA 1WJCA 5FRNA 4IZZA 1IDKA 3A4CA 3TL4X 2R7VA 3ZPNA 2R7UA 1EFRA 3DKYA 3KYLA 3ZIAA 3DWLE 4OAZA 2XSJC 3M1CA 1XG2A 1X4PA 3PL8A 3SDBA 2GK6A 3DEEA 4E7LA 1NHCA 2VJJA 4G6TB 4E6KG 2X6XA 3OEEA 4RMNA 3L2RA 3OIQA 4B47A 2XDVA 3CP8A 4KKSA 1OOCA 3S3MA 4OJLA 2QE7A 2KLOA 2QY1A 2Z1DA 2EWEA 3VSVA 2XGJA 2L7KA 2W1OA 3OR1C 2W6JA 3OS0A 3PSFA 3AL0B 2DT6A 2JVHA 4BQOA 1PKVA 4FASD 3A3BA 3CJQB 2Y0SA 4PFOA 2ZFUA 5HNFA 4C30A 2GK7A 2R7OA 2UWMA 1H8HA 1QCXA 4URRA 1V0FA 4P22A 3SEQA 2W82A 2JUGA 3VMWA 3OS2A 1X1CA 2V4DA 3E0JB 2F5VA 3PFYA 1KTWA 3D5RC 3KX2A 2W6IA 1VLYA 1E3XA 1HVXA 4G7XA 3DQVC 1OFMA 2R9VA 1WPCA 2XF7A 2O0VA 3NE5B 3B8YA 3H5RA 2K3PA 2CH0A 2CW7A 1MMDA 3FDYA 4BUPA 2CK3A 2BW3A 2HPIA 2CV1A 5CQEA 1T0FC 1VJSA 5LFAA 3KEWA 2KMUA 4DNTB 4PK4A 3I9V2 4LG3A 4CUGA 3EUKL 4XONA 2E5ZA 3AKZA 4XKVA 1X1BA 2KP6A 2IGNA 3VYSB 2A5WA 3DPUA 4F55A 4JOMA 4DOZA 3CZ6A 4KITB 1Z3XA 2X6YA 2Z16A 4C2TA 4C2LA 2K5CA 4RLFA 2WY8Q 4YRVA 3HOTA 1RWRA 2WJYA 2O04A 2Z8GA 2F43A 5CKTA 3L2WA 1Z3YA 3T53B 5HNHA 1G59A 4Z05A 1RU4A 3OYGA 3PNTA 1WJAA 1BMFA 3W2AA 3OYBA 1V0EA 2DXIA 3SYTA 4NUBA 2V31A 4P1WA 2NT6A 3K4KA 4OZYA 4B43A 3PNYA 4BACA 3KEYA 4HG2A 4PJLA 3OWTA 2L9NA 4C9YA 4DBRA 2PJRB 2E1MC 4YZ0A 3OE7A 1MMAA 2WB1A 4E7IA 2L5QA 3GBGA 1UD4A 2LBFA 2XF5A 3EQNA 4BL0B 4P5OA 4KISA 4LITA 3T56B 3DPLC 3PJRA 5KCMA 1EE6A 4D9JA 3OYMA 3A35A 3OOCA 4XKWA 5C1CA 2HU9A 2F1MA 3CF2A 3B90A 4XOTA 2X1EA 4OAYA 2LZJA 3FHNA 4G7WA 2O0WA 2WADA 4B3XA 1DQUA 4CZCA 4BS9A 2VIXA 4MLOA 2NTBA 4B48A 2HQAA 3VMVA 4PJMA 2KDOA 4F52A 2FUG2 1IA5A 4BJTA 4QPOA 1O8HA 3SZGA 1WJDA 3HXLA 2M3AA 3OEHA 2KHMA 3GQ7A 2DOAA 3GQ9A 4XORA 3K4LA 1ZELA 3V42A 1HA8A 1WJ5A 3D5SC 2UVFA 1OB0A 4DGWB 1VBLA 1VF7A 3FKJA 1T95A 2GJRA 2JSPA 1O8GA 3MKYB 4BU2A 3BCBA 3L2VA 2ZXIA 3VWBA 4E4HA 4UZUA 2ZSIB 3ZSCA 1YX3A 2CV0A 3UR3C 2NSTA 5IK2A 1O8KA 1O8FA 3EQOA 2E5NA 2VJIA 3OR2C 4EATA 3J7AY 2X53S 1JRGA 4OJPA 2OV7A 2PECA 3C2GA 4L8JA 3S93A 4ZJZA 2O17A 1NRKA 1D1AA 1LDKB 2M4GA 5KHDA 2HVSA 3LSMA 2V9KA 4DK1A 4OJ6A 4CA0A 1X19A 3LNNA 4JMQA 1PXZA 3JURA 3OOUA 3LSIA 3L2QA 2M4KA 1QJVA 2NSPA 2IGKA 3LMMA 1E1RA 4LIUA 2X6WA 4BDZA 4W8TA 2M5SA 3EUHC 3IP4B 3K4NA 4E0FA 2BOLA 1AIRA 4HNTA 4E7KA 4EW9A 1V5GA 2XZOA 1TT0A 2KL4A 1X0CA 5HOOA 3K6GA 3ZR8X 4F92B 1O8IA 3DKXA 2VQCA 3HUGB 4ZDOA 1I8DA 2HPMA 2XOKA 1PE9A 1DBOA 4YZAA 1K5CA 4PJNA 1G8XA 2KVOA 3A3GA 4X0GA 4U4BA 3IAS2 4ANJA 3DTEA 1W36D 2VKHA 3A1YA 4G6IA 1K28D 4YXWA 2LH9A 2V26A 2R7RA 4TT3A 2VKDA 3UNGC 4E7JA 2RQQA 4HRIA 2JJ2A 4W8SA 1YX5A 2NZMA 3OYLA 2KPMA 3RTRA 2JA2A 1W0KA 3DLAA 2X8KA 1WJEA 3FPPA 2WY7Q 5AMVA 1E79A 2Q1ZB 3QYBA 4ASUA 2GOMA 4AU7A 4NQWB 3NWSA 2OC6A 4PJJA 2ZZGA 1KCCA 4NC8A 1O88A 3LSKA 2DT7B 2VXDA 3K4CA 2LY2A 2ZZFA 1VZ0A 4BQNA 2UUZA 1LFPA 4CCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLH A;  4YZ0 A;  3GQ8 A;  1O8D A;  2NTQ A;  3EQN A;  4MR0 A;  3SUC A;  1EE6 A;  2QX3 A;  4YEJ A;  4XKW A;  5C1C A;  2PYH A;  4YZX A;  3B90 A;  4XOT A;  4XLF A;  1BN8 A;  1O8M A;  2X3H A;  3VSU A;  2O0W A;  3UW0 A;  4XOP A;  1IDJ A;  4XLC A;  4XR6 A;  2NTB A;  3VMV A;  1PLU A;  4W8Q A;  1IDK A;  4XM3 A;  1IA5 A;  1O8H A;  1O8J A;  4XMY A;  4XLA A;  2UVE A;  1KCD A;  2VBM A;  3GQ7 A;  1XG2 A;  3GQ9 A;  4XOR A;  3GRH A;  2NTP A;  2O1D A;  2VBK A;  2UVF A;  2PYG A;  1VBL A;  4XN0 A;  1OGO X;  1O8G A;  1NHC A;  2VJJ A;  2X85 A;  3GQA A;  2X6X A;  2IQ7 A;  2INU A;  4AVZ A;  1OOC A;  4OJL A;  2QY1 A;  3ZSC A;  2NST A;  2EWE A;  1O8K A;  3VSV A;  1O8F A;  3EQO A;  4U49 A;  2VJI A;  1JRG A;  4OJP A;  2PEC A;  3LMW A;  2BSP A;  4XN3 A;  1QCX A;  4URR A;  2O17 A;  3B4N A;  3VMW A;  4OJ5 A;  1KTW A;  4I84 A;  4OZZ A;  4YEL A;  1GQ8 A;  4OJ6 A;  1OFM A;  1PXZ A;  3JUR A;  4MXN A;  5C1E A;  1BHE A;  1QJV A;  4XLE A;  2O0V A;  2NSP A;  3B8Y A;  1HG8 A;  1O8L A;  2X6W A;  4W8T A;  1AIR A;  4EW9 A;  1H80 A;  1X0C A;  4NK8 A;  4Z06 A;  1O8I A;  4NK6 A;  1WMR A;  4W8R A;  4XON A;  4YZQ A;  1PE9 A;  4XKV A;  2INV A;  1DBO A;  4YZA A;  1K5C A;  4U4B A;  2X6Y A;  2NT9 A;  2ODL A;  4C2L A;  1RMG A;  4HWV A;  2VBE A;  1OFL A;  1DBG A;  1RWR A;  2O04 A;  2Z8G A;  3ZPP A;  3WWG A;  4W8S A;  4Z05 A;  2NZM A;  1RU4 A;  3KRG A;  2QXZ A;  3FY3 A;  5AMV A;  1OGM X;  2NT6 A;  3VST A;  4XL9 A;  4OZY A;  4PMH A;  4XQF A;  4XNF A;  1JTA A;  3T9G A;  1O8E A;  4Z03 A;  1KCC A;  1CZF A;  1O88 A;  1IB4 A;  4OJO A; 
#chains in the Genus database with same CATH topology
 4II3 A;  2RV8 A;  3PVD A;  1BX0 A;  1OR7 C;  2LF8 A;  1OYW A;  2ISY A;  1YW9 A;  4Y3O A;  3K9T A;  2KIM A;  2WPD A;  1WH7 A;  3LSJ A;  1PJR A;  3HRT A;  3KLN A;  1QHG A;  3NAR A;  2GBY A;  3S32 A;  4YZX A;  3FWE A;  4OMZ A;  3Q0U A;  2C4T A;  3ZCO A;  2CUZ A;  4FWT A;  1O8M A;  4RAZ A;  2X3H A;  3PQK A;  5E20 A;  2A6T A;  1FWZ A;  2CRV A;  2F1L A;  1WFX A;  1ONV A;  3TP0 A;  4A3F J;  1YJN I;  4UY8 I;  4H9G A;  1JJ2 B;  4IVN A;  2MW8 A;  2DLL A;  4XM3 A;  3F21 A;  2IS6 A;  1R4M B;  3DEW A;  3ML6 A;  2RNG A;  1OLT A;  3JRE A;  3S3O A;  1O3Q A;  5F4O A;  2MH2 A;  2O03 A;  2PG4 A;  5DN6 A;  2VNI A;  3AVW A;  4IEJ A;  4GRI A;  2L7M P;  3W6J B;  3QFS A;  2QEN A;  5FLM J;  3MKL A;  1J7K A;  2WSS A;  1ON2 A;  2MGQ A;  1VQ7 I;  1FTZ A;  3VYR B;  3WE2 A;  2VUM J;  3CQZ J;  2XPU A;  3AG4 H;  5KSW B;  2JT1 A;  1Y6I A;  2H94 A;  3CD6 B;  2ZNZ A;  5KAF C;  5IT9 K;  3BH4 A;  1LM1 A;  5EGO B;  3JRG A;  1HKT A;  3KL9 A;  5FNZ A;  1ZAR A;  3BZC A;  3ROU A;  1YI2 I;  5DM7 F;  3I5U A;  4Z1M A;  2PMZ A;  5KK1 A;  4XRM A;  1I7P A;  4BHB A;  4DQL A;  2XT4 A;  3AST A;  1J9Z A;  4XIC A;  2BSP A;  4C3J J;  1XCV A;  1YTY A;  3ZMZ A;  2E2J J;  3BQZ A;  3HC7 A;  4TKO B;  5TR9 A;  3MCA A;  2BM7 A;  2ME0 A;  1W7P B;  4ZDP A;  2GPJ A;  3N6Z A;  3AGQ A;  3GX4 X;  4EQQ A;  3LAJ A;  1U8B A;  4KKT A;  3BR3 A;  1TTT A;  2AQE A;  3H5N A;  5JLV C;  2E2H J;  3ZRG A;  2VZL A;  1BHE A;  1N0V C;  2GM4 A;  3BLY A;  3F8M A;  4ENN A;  3HHH A;  3A0B C;  3V7A A;  5IYR A;  3DU1 X;  5LD2 C;  1WJF A;  1BI3 A;  2CW8 A;  3RZD J;  1PJ7 A;  1WI9 A;  5IYW A;  1EH7 A;  2TDX A;  1N25 A;  3RPU A;  2COB A;  2KQR A;  3BG6 A;  4M53 A;  1XMX A;  2CO5 A;  5E6T A;  4FIS A;  4RBO A;  2WV1 A;  2L7Z A;  4U9U A;  3W2E A;  1H80 A;  4NK8 A;  4YAF A;  4WZT A;  3G1L A;  3ZZU A;  2IA1 A;  1GAQ A;  4FXU A;  1JI8 A;  3P9C A;  1BN5 A;  1S3J A;  1QPI A;  1B8I A;  1A6I A;  4IKF A;  4ZCM A;  1IJF A;  3NEU A;  2W7N A;  1H85 A;  4II2 A;  5EZG A;  2O3F A;  4LJZ F;  4U0V A;  1VQ8 I;  5ICG A;  1J75 A;  2HS5 A;  2ZXH A;  4LIV A;  2FX0 A;  2CG4 A;  3KP6 A;  1ZHF A;  3ZPP A;  1S7A A;  2E1C A;  2H6C A;  4YII A;  1XCB A;  1R36 A;  4ZYA A;  3JRA A;  1H8E A;  2VBS A;  2R7Q A;  2QMU A;  4YCQ A;  3BG7 A;  1YJ9 I;  4BY7 J;  3ZZT A;  3ABM H;  2O5R A;  1JA1 A;  2HQR A;  1EFC A;  4X6A J;  2P0W A;  2WC2 A;  1XE1 A;  1GT0 C;  2OUM A;  1AKH A;  1O8E A;  1IXR C;  3K4B A;  2DA1 A;  1JUM A;  1RET A;  3HPG A;  2LLK A;  4QPQ A;  1Y56 A;  1CNF A;  2W57 A;  4P26 A;  4ZTF A;  3W6V A;  2PX9 A;  3AG3 H;  5L3G A;  2OD5 A;  3S2D J;  2YWF A;  2FRH A;  4GDF A;  4OOV A;  1K73 D;  4MR0 A;  2E7X A;  4YG2 F;  3VYT B;  1ZKG A;  1KQ5 A;  1T08 B;  2IXS A;  1QVG B;  4ZDL A;  2B7C A;  4NC7 A;  1R5G A;  3PFI A;  1ERD A;  3AFH A;  3BY6 A;  1W36 C;  1FYM A;  3OYC A;  5B1B H;  2XAH A;  1UD6 A;  5GP9 A;  1RIO H;  1E62 A;  3CJN A;  2NXN B;  4ZGN B;  4XR6 A;  4KA4 A;  5TJJ A;  2BGC A;  1KQS B;  1X4O A;  1XG1 A;  5A2Q K;  2WAE A;  3W2W A;  4E7H A;  2O8X A;  2CFO A;  2D1V A;  3J81 k;  1D8T A;  2VC0 A;  1J5Y A;  4HNU A;  2P7V B;  3FKS A;  2DMT A;  2NS0 A;  3H9Q A;  2FBI A;  1U9N A;  2ACJ A;  1UAA A;  1ELO A;  3REO A;  1DPR A;  1UD5 A;  2V7T A;  3ASS A;  2O1D A;  3AG2 H;  3ZMD A;  5HLT A;  3GLL A;  1MAB A;  2LTP A;  3CTA A;  3TOA A;  4MFD A;  1DP3 A;  2G9W A;  4UVA A;  2X85 A;  4EJO A;  1FRN A;  3G2B A;  4A12 A;  3I54 A;  5HOD A;  1A35 A;  5M5X J;  4MNU A;  2VL8 A;  1G2H A;  1VQO I;  2WTE A;  4X7E A;  4IRG A;  4MTE A;  3VMF A;  3MZY A;  2MYS A;  1QVT A;  2L4M A;  4OOS A;  2PI0 A;  1DPU A;  2QSH X;  1KA8 A;  2JSC A;  4Q48 A;  2P3M A;  1FT9 A;  1WSV A;  1XX5 A;  3Q3A A;  1PP8 F;  2YWE A;  4XN3 A;  2DQL A;  2IBD A;  3OW7 A;  1D1B A;  4BQQ A;  3KP5 A;  1L0O C;  3BTC A;  4Y33 A;  3WTW C;  3GTO J;  1FNN A;  4IQ4 A;  4PZJ A;  5IYC J;  2ECC A;  4A3M J;  4WF2 A;  1T0F A;  2FOK A;  1OCT C;  3GTL J;  4WXH A;  3OZU A;  4Z4U A;  2LOO A;  3C2H A;  4H0E A;  5FRO A;  3EPZ A;  2IPQ X;  2VBV A;  1KMH A;  3HHG A;  2VNK A;  3QPT A;  2VBX A;  1Q9S A;  4OPV A;  1N8R D;  4OM9 A;  5HVQ C;  1EXM A;  3BY2 A;  4RPB A;  2J5O A;  1ZGA A;  1TNS A;  2MAB A;  3CUO A;  3G1M A;  4UVC A;  2KRF A;  1EZG A;  1P2F A;  1W9X A;  1YS6 A;  3V7C A;  5M5W J;  1RKT A;  2FQ3 A;  3LOC A;  3V7R A;  2Z9O A;  3RQ4 A;  2DYR H;  1JGG A;  1YX2 A;  3ZBU A;  1U6G A;  3PM1 A;  1S9H A;  1TVC A;  2BHZ A;  1E17 A;  1I1S A;  1GVD A;  3CCQ I;  1UHW A;  1DBG A;  4CCK A;  3VOE A;  2W7Z A;  1FOK A;  4CDG A;  1WJB A;  1D1N A;  1RRJ A;  1E3Z A;  3LNQ A;  3O3K A;  4A0Y A;  2QZ8 A;  1E43 A;  2QWW A;  1S8N A;  2XRL A;  3RSN A;  1QZY A;  3V8J A;  3R6J A;  2L9R A;  3B02 A;  2CQX A;  2KFD A;  1NB0 A;  1OGM X;  1B8I B;  2D3N A;  3P9I A;  2EZI A;  4XQF A;  3IL2 A;  1HLV A;  3WGI A;  1AMO A;  5M5Y J;  1STZ A;  4ITV A;  1IN8 A;  1T6Y A;  4CCM A;  3U6K A;  1NK3 P;  2DOE A;  2FQ4 A;  3OYE A;  2A6E F;  2Y2Z A;  4OPS A;  3MZ8 A;  2EH3 A;  3GQ8 A;  3I53 A;  1DDG A;  2VOO A;  2LMD A;  2NTQ A;  4M3B A;  3I56 I;  1OHH A;  1UEL B;  2Y30 A;  3G05 A;  3BWG A;  3HG9 A;  2W00 A;  5E3M A;  3JW4 A;  2E1R A;  1ETX A;  3N05 A;  2C6Y A;  2P5L C;  4FX4 A;  2XHK A;  1TNT A;  3OIO A;  3ECH A;  2OAZ A;  3LFK A;  4YFX F;  2LC2 A;  2LRD A;  3BPX A;  1VQN B;  3K2A A;  2FD5 A;  1V5V A;  2OBR A;  3I55 B;  2DA6 A;  3A4C A;  3LSR A;  1OFE A;  1TWF J;  1Y8R B;  3DKY A;  1O3T A;  3MN2 A;  3M1C A;  1GO2 A;  1NDH A;  5EEH A;  2D5V A;  5B3S H;  4PDK A;  1T6Z A;  5CVU A;  9ANT A;  1JB9 A;  1RKW A;  3BH7 B;  3S2H J;  2DYS H;  3G1O A;  4PAB A;  4QVJ A;  1LFB A;  2BV3 A;  4G6T B;  2X6X A;  3OEE A;  1UMQ A;  3OIQ A;  2ETH A;  2XDV A;  3CP8 A;  1LB2 A;  2DFH A;  2FXA A;  2AXL A;  4LK1 F;  3S3M A;  2COM A;  2Z1D A;  2EWE A;  1G6N A;  5CJ9 A;  4AVP A;  1QRY A;  4L9T A;  2XNC A;  2ZBK A;  1IG7 A;  1KQ0 A;  2XKO A;  2RAE A;  2ZFU A;  3RJP A;  2DT5 A;  2EIK H;  2A6H F;  2WB1 N;  2ZNY A;  4KT5 C;  4P22 A;  2JZY A;  1YJW B;  4CCJ A;  4URR A;  3OS2 A;  1X1C A;  1DG1 G;  2NPF A;  1VLY A;  1E3X A;  4G7X A;  3DQV C;  2M45 A;  2R9V A;  1I27 A;  2XF7 A;  3DBL B;  3B8Y A;  1W5C C;  3H5R A;  2JPB A;  1MMD A;  4HAM A;  3HSR A;  4O5V A;  3CO6 C;  1T0F C;  3LVB A;  5L3D A;  4DNT B;  1E3H A;  1LLZ A;  1B59 A;  2IRF G;  4ZZL A;  4P6Y A;  3KP3 A;  2HYF A;  2XB5 A;  3EUK L;  1BBY A;  4GGG A;  4Z4W A;  2E5Z A;  3I4P A;  4XKV A;  3AKZ A;  1MIJ A;  5FKN A;  1KZH A;  3Q38 A;  3F8N A;  3C18 A;  1H88 C;  1Z3X A;  4CO8 A;  1YQA A;  4Y13 A;  4C2T A;  4KDP A;  3CC7 B;  3MQ0 A;  2K5C A;  2ZME A;  3ULQ B;  3IKT A;  1EFU A;  3N90 A;  4WZL A;  1Y8Q B;  5EMN A;  1VQO B;  3HOT A;  1RWR A;  3BQY A;  3CUQ C;  4IJA A;  4HV5 A;  4KN4 X;  4LGW A;  3T53 B;  1I3Q J;  2DW4 A;  2QA4 B;  2OU2 A;  5FLV A;  3L00 A;  1AHD P;  3ZMS A;  3Q0W A;  5J4Y A;  2V31 A;  2K9N A;  3HGG A;  4M2L A;  3PNY A;  1FSE A;  5DCM B;  1GVH A;  4K1X A;  4M1K A;  4A6D A;  4TMW A;  3ASO H;  3GIR A;  3S14 J;  1YIJ B;  3CMY A;  1YG2 A;  4HG2 A;  4PJL A;  1X2M A;  3KP2 A;  3OWT A;  3O6B B;  4YFK F;  1BM9 A;  3BDD A;  3X2Q H;  1EP3 B;  3S2W A;  4DBR A;  5IP9 J;  5C4J J;  4GYI A;  5EEG A;  2XIG A;  2JA5 J;  1YS7 A;  2PJR B;  4YAW A;  2JUC A;  3GBG A;  1U5T C;  3CCE I;  2HQN A;  4BAY A;  2LBF A;  2M0C A;  2STW A;  1BX1 A;  2VNJ A;  4X07 A;  4LFU A;  3QP6 A;  3T56 B;  3DPL C;  3PJR A;  4L9J A;  4IOC F;  3OOC A;  2P4W A;  2HU9 A;  3RKW A;  4I2O A;  3B90 A;  2X1E A;  2ZFW A;  2RC4 A;  1W34 A;  3HOV J;  3FHN A;  3SY2 A;  1BC8 C;  1Y1W J;  2DA3 A;  2DA5 A;  4J19 A;  2ZME C;  3LST A;  4M3F A;  1KU3 A;  1F43 A;  4BS9 A;  4RDU A;  4B4C A;  4F52 A;  4BJT A;  4BKX A;  2VBT A;  1WJD A;  2CW0 F;  4ASN A;  1XQB A;  4YHB A;  1MBF A;  1ZEL A;  2ZL5 A;  2PQ8 A;  4OOI A;  4OIR F;  1Z1D A;  2UVF A;  4DGW B;  3EET A;  1RQR A;  4ZZD A;  4EJW A;  2IP2 A;  2YUS A;  4HX8 A;  2JSP A;  1O8G A;  2PN6 A;  2J8K A;  2DA7 A;  2PLY A;  1YX3 A;  1ZRF A;  2HYG D;  5IK2 A;  3NAU A;  1FIP A;  5BNG A;  2M87 A;  3H1C A;  2VJI A;  1S5L C;  2KIS A;  3C2G A;  5FA6 A;  4L8J A;  1ZN2 A;  3J7Z I;  3JSO A;  4A0X A;  2O17 A;  4DYQ A;  3L2C A;  1S72 I;  1U8R A;  4Q4Z F;  1NRK A;  1WOP A;  4R8H A;  3BOQ A;  4HNV A;  5KHD A;  3LSM A;  4DK1 A;  1X19 A;  3T0Y A;  3LNN A;  3JUR A;  3OOU A;  2P5V A;  2YWG A;  1TYX A;  1YW8 A;  2BM0 A;  3FXO A;  2ID3 A;  3QU6 A;  1NH3 A;  4AID A;  3RDI A;  2GXG A;  2IGK A;  3I58 A;  1YHQ I;  1N05 A;  3GFJ A;  2K7L A;  2M5S A;  4Z4S A;  3K4N A;  5CVV A;  1BA5 A;  2VYQ A;  4EW9 A;  1V5G A;  4L0Z B;  4BQA A;  4A3G J;  4HQE A;  2AHQ A;  3BR2 A;  2ZL6 A;  3HUG B;  1RES A;  4ZDO A;  1WRJ A;  1I8D A;  5FGM A;  2C77 A;  3SHF A;  4X8I A;  2DTR A;  3A3G A;  1HDD C;  2BE5 F;  4ANJ A;  2F48 A;  4KUM A;  3F72 A;  3A8I A;  2VKH A;  1FPQ A;  2ESN A;  2DFE A;  3MFK A;  3GFL A;  1OKR A;  1SVL A;  3OV8 A;  2B7B A;  4RDJ A;  3BP8 A;  4YXW A;  4TT3 A;  4RD0 A;  3OJW A;  4HRI A;  1GR1 A;  5FO1 A;  1ETY A;  1Y0Y A;  2DEU A;  4EJU A;  2KPM A;  3TED A;  2H09 A;  1W0K A;  2QQ9 A;  5F08 A;  2YWH A;  2YU9 J;  3PUM A;  5FFZ A;  5K1Y A;  4RA2 A;  4ASU A;  3SYJ A;  4AU7 A;  5A8A A;  3A8J A;  1B72 B;  5D5X B;  4PJJ A;  2ZZG A;  2R3S A;  2RNJ A;  1P4X A;  3K4C A;  1SD4 A;  2EV5 A;  4YAO A;  4M71 A;  2R5Y B;  3JQQ A;  2B63 J;  2UUZ A;  1LFP A;  1TQI A;  1D2E A;  3DBR B;  2WAQ A;  2VB6 A;  4BEH B;  1D0Y A;  2VJ4 A;  2XAQ A;  3V7S A;  3ZQH A;  5FL7 A;  3C3W A;  5E1X A;  5B1A H;  1D0Z A;  3A2K A;  2KRH A;  1UHM A;  2CW5 A;  1LVK A;  4XLF A;  2E1M B;  4YC5 A;  1Y0N A;  1ZGW A;  5AIP A;  1XD7 A;  1BPL A;  2K4B A;  3Q39 A;  1QVU A;  3DTK A;  5H2F C;  2IVM A;  3CLO A;  1IDJ A;  1GXQ A;  2WR8 A;  2VFP A;  3CDL A;  1KQ9 A;  2NVQ J;  2RRE A;  2DER A;  1VND A;  2VLA A;  1KZL A;  2ZIT A;  1IUY A;  5ICE A;  1ZM3 A;  3QRF F;  2NOG A;  5B66 C;  2LYC A;  4NDL A;  4MO7 A;  3I3L A;  3HGY A;  4JQF A;  4Z4R A;  3NAW A;  4XMY A;  1VI0 A;  2E34 A;  2IGM A;  3H3U A;  3OZV A;  2HDD A;  2XKP A;  2GA1 A;  2DJN A;  2JTV A;  2QYO A;  4QTR A;  1LJ9 A;  4BE2 A;  2OBS A;  5E1Z B;  4IX7 A;  3TOB A;  4Z4T A;  2XZL A;  2WJV A;  1I3A A;  3Q6R A;  3OFN A;  1OGO X;  5KNL A;  3IUO A;  4B3G A;  3JTG A;  1BLI A;  1FC3 A;  3GUD A;  5GPA A;  3E20 A;  1MDM A;  3CCS B;  4D0P A;  1OB5 A;  1D0X A;  3D5L A;  2HZD A;  4RLQ A;  2GOX B;  2LF7 A;  2V7Q A;  2KKO A;  5IYB J;  3JU4 A;  5HKK A;  4P12 A;  2DPD A;  1A6Q A;  2DO7 A;  2CV2 A;  1TWH J;  2ME6 A;  2GJP A;  2L3D A;  1DAB A;  3PSZ A;  4QHY A;  5A88 A;  2KIF A;  1UCR A;  3F8B A;  2X51 A;  1EH6 A;  2H27 A;  1IW7 F;  1J09 A;  1X2N A;  1XSV A;  2BVL A;  3H9N A;  3PA2 A;  4E7S A;  2F4N A;  4G5G A;  4LBW A;  3HSF A;  4BEH A;  3CCS I;  1HG8 A;  1XDS A;  3NB2 A;  2Z5U A;  4ESF A;  1BJK A;  4U7D A;  2ELJ A;  3OIP A;  1KU7 A;  1MW7 A;  3B78 A;  2M7B A;  4A3D J;  1GUU A;  5F4J A;  2CS3 A;  3S17 J;  1BIA A;  4TV7 A;  1XSD A;  2VQG A;  3VDX A;  2BGI A;  1TC3 C;  1FMV A;  1S7E A;  4Y52 J;  2P5K A;  1QPM A;  2GAU A;  5DUK A;  4MEX F;  5ED4 A;  1HDP A;  3S3N A;  1IB0 A;  4C3H J;  4Y9R A;  1B23 P;  2R7W A;  4ZYD A;  1SMT A;  5LEK A;  4JRA C;  3T8R A;  2V6C A;  3ABL H;  2ZZE A;  4CZZ A;  2ID6 A;  3GTJ J;  4LG0 A;  3H35 A;  3HRM A;  1XGO A;  1K9M D;  2Z2S B;  5TGT A;  2F4I A;  1YIT I;  1MH3 A;  4BE0 A;  4JX4 A;  5EYR A;  4HEA 2;  3FY3 A;  4M72 A;  4RCZ A;  5BSY A;  1YIO A;  2G7U A;  3IKV A;  2WA0 A;  4QWQ A;  5DCF A;  3GFI A;  1MBE A;  3E6B A;  1JTA A;  5EF6 A;  1CZF A;  3JX8 A;  3DP7 A;  2IS4 A;  4H4K C;  1MRZ A;  5E18 F;  2VQL A;  2DYI A;  3FIS A;  4ETS A;  1IDZ A;  1U2W A;  3E5X A;  4XLH A;  2XND A;  4IO9 F;  1TW2 A;  1D3Y A;  3WOD F;  3TMO A;  5H59 A;  2DIE A;  1MND A;  5DYM A;  1JUP A;  1VLO A;  2P7C B;  1WTH D;  2BM5 A;  3HKZ A;  1OFD A;  4X06 A;  1R22 A;  4G94 A;  2B0R A;  4UUS B;  2JRT A;  3KEQ A;  5F6F A;  2LBF B;  1BI1 A;  2XF6 A;  1KQ8 A;  2A69 F;  3R0J A;  4N9I A;  1W87 A;  3TW7 A;  1Z0X A;  3ZN1 A;  1QZE A;  1ETW A;  1WDT A;  1SKY B;  4YDT A;  2YX7 A;  5CYV A;  4A0Z A;  2IEK A;  3B6C A;  1SKQ A;  1P4A A;  2LG4 A;  4G7H F;  4N0B A;  3M8J A;  3OY9 A;  1O8J A;  2DJI A;  3BCF A;  2L2O A;  4RD1 A;  1FZP B;  3KET A;  2VBM A;  2DU9 A;  2LSO A;  5F04 A;  3J80 Z;  1N78 A;  1X1P A;  1J59 A;  2EFQ A;  1FSH A;  5JLW A;  1MSE C;  4NCN A;  1K6Y A;  4BBS J;  5H5J A;  3OYK A;  3PO2 J;  3WBK A;  4FX0 A;  1VQ6 B;  3FIW A;  4GYG A;  1P7I A;  1QFY A;  2JWT A;  1Y1V J;  4XLP F;  3AVV A;  2K9M A;  3H92 A;  4OWR B;  2R7S A;  1GJR A;  4I76 A;  2R7T A;  3G4S I;  2CUF A;  1ODD A;  1SD5 A;  2DMN A;  2KZV A;  4RB0 A;  5FRM A;  1OMI A;  4LBZ A;  4PC3 A;  2M0M A;  2CQK A;  4LLL A;  3I0T A;  3JRD A;  1S7O A;  2CMP A;  2PJR A;  2HDW A;  3K4J A;  2DOG A;  4IF4 A;  1D8K A;  1QGA A;  4UUV A;  4I0B A;  5JI6 A;  3QU3 A;  4NBS A;  1Q86 D;  4BXF A;  2F3L A;  1BI2 A;  2RVC A;  3BC8 A;  3FX3 A;  5GAD J;  2V5I A;  4FE7 A;  4PC1 A;  5E1W A;  4I84 A;  1EH8 A;  4YEL A;  3GF2 A;  5CQG A;  3M3Y J;  4WZK A;  3IWZ A;  3ELK A;  2IGO A;  1HA3 A;  1R58 A;  4A3E J;  2BYV E;  3PSI A;  3CLQ A;  2GZW A;  2W84 A;  4AC9 A;  2VT3 A;  1ENH A;  2WWY A;  2IS1 A;  2VQH A;  1IV8 A;  3VOD A;  2BZT A;  1UHS A;  3ESW B;  4OMY A;  1WZ2 A;  4Z06 A;  2ZXJ A;  2TRT A;  4HX7 A;  1HOM A;  2DET A;  2DN0 A;  3SZP A;  2C78 A;  2QKL B;  3PET A;  3C1D A;  1DU0 A;  3QAH A;  3FKI J;  4M3D A;  5CDF A;  3ASP A;  4JX6 A;  1SFO J;  1E63 A;  2XRN A;  3CC4 B;  1P4W A;  3OYH A;  2NT9 A;  2F5C A;  5FKL A;  2UZK A;  3LQE A;  2OCC H;  3MKZ A;  3QWL A;  4HYE A;  2VBE A;  1VQ5 I;  4M74 A;  4G6D A;  3VSK A;  1IRG A;  4LLG F;  2AXT C;  4JYK A;  3LA3 A;  4RM2 A;  2GXA A;  3P27 A;  4S05 A;  2EIM H;  3J7A O;  3BTL A;  4EGZ A;  2X1D A;  2XUB A;  2NAZ A;  4MHG A;  3LQR A;  1CF7 A;  2V1U A;  4O3M A;  1EA3 A;  1DGW Y;  3ASQ A;  5L46 A;  1K8A D;  1VQ7 B;  3D1N I;  1UD8 A;  1YRN B;  1UD2 A;  2DY1 A;  3PO3 J;  2QGG A;  1HXD A;  2WZN A;  3JRB A;  1YJ9 B;  3OYI A;  3GSI A;  3VST A;  4EM1 A;  3BG5 A;  3OOP A;  1LLW A;  4CGZ A;  3WTT C;  4XNF A;  2Q2E A;  2V1N A;  4Z03 A;  1K83 J;  4DIQ A;  3W2F A;  1TWA J;  1B6A A;  2D9R A;  5FO0 A;  3IH2 A;  4J0Q A;  4A3L J;  1NG6 A;  2R93 J;  1J9I A;  3HOS A;  3K1N A;  3ZMT A;  2QQ8 A;  5JLX A;  4BJ6 C;  2K02 A;  3K1P A;  5J1R A;  5GTH C;  2XNJ A;  2R7Z J;  1LNW A;  4M9X A;  1V4R A;  4FQG A;  1GXP A;  4WWV A;  4YEJ A;  1Z7L A;  4ROX A;  3A0H C;  1MNE A;  2A05 A;  2X4H A;  1BN8 A;  1A04 A;  2V9P A;  3CC4 I;  1KK2 A;  2UV1 A;  4PAA A;  2EA4 A;  4GCV A;  4AYB A;  3IRR A;  5IPA A;  1A31 A;  3SZE A;  2IS2 A;  5IT3 A;  2BY3 A;  2XAJ A;  2BBY A;  3TW6 A;  4X05 A;  1WJC A;  2M30 A;  2P6S A;  3MEX A;  5BPI A;  2P81 A;  4RDK A;  3HYI A;  3ZPN A;  3CMA B;  2C5H A;  4YEI A;  1QFJ A;  2IA2 A;  4U0Y A;  1MNM C;  2XSJ C;  1R5I D;  1JJ6 C;  5EG0 A;  5L3F A;  1B9N A;  1OCP A;  2BGJ A;  1XG2 A;  1Z6T A;  3F3X A;  3SQN A;  5DS0 A;  1IJE A;  1FBQ A;  1KYW A;  2CYY A;  4HBL A;  4P3I A;  4E7L A;  1QZZ A;  2EB7 A;  3ZUG A;  5J47 A;  4HA8 A;  2O6G E;  1FRQ A;  4B47 A;  2ZBU A;  1DUX C;  1OCR H;  1D8J A;  1JTX A;  4KKS A;  2KLO A;  3JSP A;  4AIK A;  2E2I J;  1QUF A;  3B8H A;  3R4K A;  2HQ5 A;  3OR1 C;  2W6J A;  2XGJ A;  3PA1 A;  6PAX A;  2VC1 A;  3R6S A;  2DT6 A;  5GTI C;  2ELH A;  2M1B A;  1OB2 A;  1W5S A;  2Y0S A;  3AVY A;  3GEZ A;  1VFC A;  1LPQ A;  1QCX A;  1HKQ A;  2BM6 A;  5LBQ A;  2W82 A;  2QLZ A;  2XEX A;  2JK3 A;  2OA4 A;  2F5V A;  2HXO A;  1KK0 A;  1JE8 A;  1SVO A;  5M3F J;  4HDU A;  1T98 A;  1WPC A;  3O2P E;  1RR7 A;  1W7P A;  3EUH A;  1FNB A;  3BJ6 A;  4BH9 A;  2EIN H;  3MZH A;  2V1D A;  3M1E A;  2CK3 A;  1W0U A;  2LFB A;  1VJS A;  2F5F A;  5LFA A;  2A68 F;  3RY8 A;  1Z91 A;  3U1K A;  2V7U A;  4CUG A;  4FE4 A;  1BI0 A;  1ZTR A;  1B9M A;  2R7F A;  4XON A;  1W0T A;  1KC8 D;  1X1B A;  2KP6 A;  2IGN A;  3VB2 A;  2HKX A;  3IRQ A;  4RM0 A;  4X7C A;  1R49 A;  2X6Y A;  2Z33 A;  1WQ2 A;  5EZH A;  4ESB A;  1O4X A;  4RLF A;  3VEP A;  1Z05 A;  3SQV A;  1USS A;  5F0C A;  2OTJ B;  1G7T A;  4M6X A;  3CW2 A;  1S29 A;  2WY8 Q;  4YRV A;  2DPU A;  3AGP A;  3G4S B;  2O61 A;  4KH3 A;  2CU7 A;  5B5E C;  3WTV C;  5CKT A;  1YHQ B;  3V8K A;  4FCY A;  4KIG A;  4D5C A;  2EFN A;  1RU4 A;  4HW0 A;  5CVJ A;  1TBX A;  1JNY A;  1G7C A;  3G73 A;  1QBJ A;  3A03 A;  1F4K A;  2DXI A;  3ZQF A;  2RC6 A;  3A01 B;  3ONU A;  2O6W A;  1HF2 A;  3PEN A;  1FIA A;  1K78 B;  3E97 A;  4ACB A;  5JMC B;  3ABT A;  3CUQ B;  4G7O F;  3RKY A;  2ELK A;  4N9H A;  2A61 A;  2XPV A;  4PC7 A;  4ZGQ B;  2AHO A;  3LA2 A;  5FLX Z;  2E1M C;  2OTL B;  3FJO A;  2EZH A;  1QA6 A;  3EQN A;  4ACA A;  5IP6 A;  4HLY A;  1JGS A;  1HKS A;  1LFU P;  2Q6K A;  1NHA A;  3TDZ C;  3DBH B;  2X0K A;  1O3R A;  2PMZ N;  4D9J A;  1RQP A;  4XKW A;  3V76 A;  5C1C A;  2BHY A;  2NVT J;  4PC6 A;  1G3T A;  1TTY A;  4OAY A;  3ES9 A;  2O0W A;  1NB9 A;  4CYC A;  1QH0 A;  1HW1 A;  2P6T A;  3QOP A;  4CZC A;  3H3Z A;  2IT0 A;  4B48 A;  4Q47 A;  4PJM A;  3BR1 A;  1VQL B;  1DU6 A;  3CCY A;  3HSE A;  2E35 A;  3GTK J;  5A89 A;  2CSO A;  4M9S A;  2EIX A;  2L4A A;  3HXL A;  2A07 F;  1QGZ A;  1HF0 A;  3GQ7 A;  4AF6 A;  1U5T A;  3HTU A;  3K4L A;  4G6Q A;  1XGM A;  4XOR A;  3V42 A;  4Z6Y A;  2OQR A;  1WJ5 A;  1TWC J;  3HJE A;  1VF7 A;  1ZH5 A;  3FKJ A;  3U1D A;  2M5W A;  2GJR A;  2O7O A;  1JKO C;  4OIQ F;  2N8G A;  3L2V A;  3ISX A;  4ZCI A;  2ZXI A;  3CCM I;  4FN5 A;  1VQP B;  3TKY A;  2CGP A;  2UXN A;  4UZU A;  4ZV4 A;  3ZSC A;  5HS7 A;  4AWX B;  4OU0 A;  1H0M A;  3ONY A;  4HE5 A;  1O8F A;  2NST A;  3CCE B;  2E5N A;  2XGE A;  3GO5 A;  2OV7 A;  1KU2 A;  1FYK A;  4PC2 A;  5J8C A;  5DD8 A;  1PP7 U;  4RJL A;  2RQP A;  2FU4 A;  5M3M J;  1LEB A;  1OFC X;  2OYN A;  1ETO A;  1LDK B;  2M4G A;  3T5X A;  1KTV A;  2HVS A;  4C43 A;  1MSF C;  4MYU A;  4OJ6 A;  1ZK8 A;  1QG0 A;  3S15 J;  3LSI A;  3S1R J;  3ZPL A;  1Z6R A;  2MLK A;  1XMA A;  3RZO J;  1BC7 C;  3LMM A;  2O8K A;  4LIU A;  2EA2 A;  2DK5 A;  2XV4 S;  2IAI A;  3EUH C;  3IP4 B;  2BOL A;  1AIR A;  4HNT A;  2VN2 A;  4IHW A;  3GZN B;  2XZO A;  1TT0 A;  2KL4 A;  1X0C A;  3ZR8 X;  4Y9U A;  2CJJ A;  3DKX A;  1PE9 A;  2HPM A;  1EWY A;  3RYP A;  3Q5F A;  4X0G A;  3DTE A;  1W36 D;  1UST A;  3PUF A;  2NVU B;  1YFH A;  3FM3 A;  1Y0U A;  4G6I A;  4TMX A;  1PVE A;  1ZYR F;  2HR3 A;  2MA3 A;  2VE9 A;  1R5N A;  2FX3 A;  2R7R A;  3GLX A;  2ZL7 A;  2VKD A;  2V1X A;  3UNG C;  3RKQ A;  1R5B A;  3ZP5 A;  4HZF A;  1YX5 A;  2NZM A;  4OIO F;  3OYL A;  1HST A;  1VHO A;  2AO9 A;  5HS9 A;  1PJ6 A;  4N3N A;  2X8K A;  5ICC A;  3FPP A;  4PCQ A;  2PMD A;  3GTP J;  2Q1Z B;  2Z99 A;  3QYB A;  2EFG A;  2HEO A;  2GWR A;  2R0Q C;  3CCR B;  2OC6 A;  1QQI A;  1IC8 A;  3BNW A;  4NC8 A;  4IW3 B;  4OIP F;  2DT7 B;  2I10 A;  1F60 A;  3MHP A;  2LY2 A;  3E5U A;  1U3E M;  4F93 B;  4OJO A;  2K85 A;  5K5R A;  2IOU G;  3OAA A;  1BR4 A;  1R1U A;  3KPH A;  1JJ8 C;  4PGO A;  2M7A A;  4WCG A;  1SVM A;  1HZE A;  2UXX A;  3EDP A;  2BXZ A;  3HL2 A;  2E36 A;  1X58 A;  3VR6 A;  1KRH A;  5C44 J;  4KT6 A;  4JP0 A;  1VQP I;  3L1P A;  4C2U A;  2MFZ A;  3QYE A;  1QGY A;  2BX6 A;  3LSH A;  3M9A A;  4DQ2 A;  3IC7 A;  5JHF A;  2JJ7 A;  2BVM A;  3FPK A;  3FK6 A;  1U0J A;  4X1E A;  3HOU J;  3E6M A;  5B6I A;  1QX4 A;  4W97 A;  3IAM 2;  2V6E A;  3W2V A;  3P26 A;  4UV9 A;  4XLA A;  5BSX A;  3K0L A;  4XKC A;  2XRO A;  3FMQ A;  2ZC2 A;  2Y48 A;  3RPU D;  4GFB A;  3S1M J;  4KJZ A;  1UJ8 A;  1TYV A;  2PYG A;  3EUA A;  2LR8 A;  3DTI A;  1ORK A;  3R60 A;  4ZCL A;  3W5V A;  1WWX A;  3HRS A;  5BOX A;  1IO2 A;  3TGN A;  5FJ8 J;  1MBJ A;  2ZB9 A;  3NRV A;  1A8P A;  3SFI A;  1KK1 A;  1IN4 A;  4HIZ A;  4TMV A;  5J3O A;  2INU A;  4N4O B;  3M4O J;  4OPW A;  2K27 A;  4M9Z A;  3MWM A;  2F6C A;  2L02 A;  3BZK A;  2BY1 A;  2X48 A;  4S04 A;  2Q0O A;  4FTH A;  3CRZ A;  3AVT A;  3VNU A;  5IP7 J;  5J1Y A;  1QHH D;  4CCN A;  1Z67 A;  1PUE E;  3KYC B;  3H5A A;  3CMM A;  1YW7 A;  1VQ9 B;  4Y15 A;  2EPF A;  2VKE A;  4CQJ A;  1S72 B;  1WSR A;  4ZC3 A;  4ZTJ A;  2GQQ A;  2QVO A;  3FBI B;  1UG0 A;  1WOR A;  4OZZ A;  1X1A A;  2EIL H;  3DPT A;  3NWT A;  4B44 A;  1WGX A;  4XKB A;  1MDM B;  2JJ1 A;  4MXN A;  4HPQ A;  4MIM A;  4XLE A;  2HVR A;  3Q9V A;  2CFX A;  2HMA A;  2CWE A;  4L9V A;  3B6A A;  5K5Q A;  4MFE A;  5DCM A;  1HBX G;  3CC7 I;  5H20 A;  4C2M J;  2KRC A;  1I18 A;  5AIQ A;  2DQR A;  4EM0 B;  1IJW C;  2EZK A;  2QSF X;  2XAF A;  2GJK A;  2O9L A;  1QFZ A;  1WMR A;  4BNC A;  4YFN F;  3KYD B;  4U7B A;  2X6O A;  4PJ0 C;  3H94 A;  1SM4 A;  4DJA A;  2JIZ A;  4L5I A;  3C2B A;  4M6V A;  4QVA A;  5EDN A;  3I4M J;  2GQF A;  3BY1 A;  3WBJ A;  2X9D A;  2CF4 A;  4G12 A;  3J81 Z;  2J5P A;  3F22 A;  2JA8 J;  4G1B A;  4BGD A;  1H9T A;  2BF4 A;  1DGR M;  3ZXS A;  3B82 A;  4KYW A;  1MJ9 A;  2HXI A;  1EFT A;  2OPT A;  1L3L A;  1HQC A;  1W0J A;  1K4T A;  1V5F A;  1GLN A;  3ZQQ A;  1W2B B;  3KZZ A;  2HWV A;  3E3V A;  4BE1 A;  1XB2 A;  1MMG A;  1AOY A;  2ICW G;  1K78 A;  1WKM A;  4CCL A;  1JT6 A;  2ZZQ A;  3WQZ A;  1IB4 A;  2PMH A;  4PUS A;  4L5E A;  2I8D A;  3SKB A;  2LD5 A;  2E7W A;  3CJR B;  3CUQ A;  1MGT A;  1FND A;  1R23 A;  2H6B A;  3CB4 A;  4OPO A;  1QO0 D;  4BDY A;  2ZJR F;  3HAG A;  2NS8 A;  4GQN A;  3WTX C;  3OSG A;  4J00 A;  3SUC A;  3ZMV A;  1HCR A;  1E64 A;  3WTZ A;  1CNE A;  1G3Y A;  5ILV A;  3SJM A;  1FBS A;  3L09 A;  3ZGK A;  4IQJ A;  1FOY A;  5HDK A;  3VSU A;  1FLI A;  3UW0 A;  3Q6Q A;  1XMK A;  1S0U A;  4HE6 A;  4XLC A;  2VPL A;  1W4M A;  1E2X A;  3VO2 A;  4V19 K;  1X1D A;  2HLD A;  1MBG A;  1XTA A;  1PLU A;  2Y9Y A;  3SEZ A;  1XC5 A;  5LGN A;  1N08 A;  2JVG A;  3ASN H;  1MMN A;  2STT A;  2UVE A;  3GQB A;  3HPH A;  4BXX J;  2W4S A;  1BL0 A;  1MBK A;  1T33 A;  3VSL A;  1FOX A;  3CES A;  2R6H A;  2NTP A;  2GIZ A;  3V8L A;  5JFR A;  4LLN A;  4DBQ A;  2V7X A;  3PNV A;  4RLZ A;  2VXZ A;  2BSA A;  2BY2 A;  2W85 A;  3NQO A;  3P7N A;  1IXC A;  2VBU A;  3DCF A;  3EYI A;  1X3U A;  3QPS A;  4OIN F;  1QQ1 A;  4RCY A;  1CQX A;  1P7J A;  4IRI A;  4PSW A;  3ABU A;  2CUE A;  4I7H A;  3H3V K;  3CMA I;  2E60 A;  3I71 A;  1RPW A;  3ASR A;  2VON A;  3BTI A;  3KFW X;  3RCO A;  5K5O A;  3WG9 A;  1XB4 A;  2FNA A;  4HQM A;  4ZH4 F;  1N75 A;  5D6E A;  3FXU A;  2WZP P;  2OF7 A;  4NNJ A;  1FNC A;  1MKM A;  2K9L A;  2QKM B;  5C1E A;  1P92 A;  4KIB A;  1O3S A;  1U9O A;  1OCC H;  2PBI A;  4RB3 C;  1Z9C A;  3H9J A;  2EWN A;  4N4N B;  1VF9 A;  3VFZ A;  3N4M A;  4LBY A;  1V5E A;  3WTU C;  3LAP A;  1C0W A;  2VI6 A;  4DK0 A;  3ML3 A;  4AC0 A;  2DA2 A;  4UUS A;  4C0S A;  3Q3S A;  2WBM A;  4V2F A;  4W8R A;  4ZYG A;  4BHP A;  4WXC A;  1KON A;  2DCU A;  5LGT A;  2K4J A;  1ZUN B;  2ZTG A;  3J80 K;  4V02 C;  2ODL A;  1TLH B;  3OSF A;  1ZR2 A;  1XPX A;  3GTQ J;  4KIC A;  4CSW A;  4Z4Y A;  1EF4 A;  3HZJ A;  3D26 A;  3LSG A;  3VNV A;  3RIR A;  2I1L A;  1R7J A;  5F0H A;  4HF2 A;  2Z6B D;  3RPQ A;  1E1Q A;  2FBH A;  4LD5 A;  2H8W A;  1ZRD A;  3LL7 A;  5D5U B;  2QXZ A;  2VT2 A;  2EJR A;  5LHI A;  4XD7 A;  1IN5 A;  1IN6 A;  4CIC A;  1EP1 B;  4MQ9 F;  2E19 A;  3QOE A;  4ENM A;  3WNC A;  3CCL I;  2AQF A;  3OPO A;  2K40 A;  1KJZ A;  4JX5 A;  1G4D A;  1OPC A;  2HNH A;  1U5T B;  3MD2 A;  5ICF A;  1M1K D;  1P9Q C;  2HVQ A;  2RDP A;  1VTN C;  2HDC A;  4HF1 A;  3GME A;  4DW6 A;  4ZYH A;  4BHC A;  1JA0 A;  3U21 A;  1QUE A;  4PFP A;  3MAJ A;  3SXY A;  3FXJ A;  4RM3 A;  2V7F A;  1LEA A;  3VYU B;  3PQJ A;  3BG9 A;  3LQQ A;  5HLI A;  1ZG5 A;  1A5J A;  5IOY A;  1YRN A;  4PGH A;  5GAH J;  2QX3 A;  3ERE D;  3K2Z A;  1D5Y A;  2J7K A;  3CO7 C;  3WU2 C;  3T51 B;  4UHT A;  2HYJ A;  4Y7C A;  2Z3Y A;  2HCJ B;  1RNL A;  2L9V A;  2NOJ B;  3ISP A;  3K1M A;  1WOO A;  3CPW B;  3GYH X;  3CXC B;  5IYD J;  4MEY F;  4HX4 A;  2OTJ I;  2ZJP F;  3E1S A;  4A3C J;  5FRN A;  4UB6 C;  3VPR A;  4HDV A;  1IDK A;  3TL4 X;  3BR5 A;  1QA1 A;  3WND A;  1EFR A;  4EVI A;  3KYL A;  3ZIA A;  4OAZ A;  5D4S A;  1IF1 A;  1M1E B;  4BY1 J;  1ZM9 A;  5ERI A;  3MMP A;  1K8F A;  3TH0 A;  1LQ1 A;  4I99 C;  1HW5 A;  1L1I A;  3ZZ0 A;  3GZ5 A;  4LB6 B;  3SDB A;  2GK6 A;  2HI3 A;  2LP0 A;  3CJT B;  1O57 A;  1NHC A;  1VQ6 I;  2VJJ A;  5EGO A;  2GXB A;  4MQV A;  4RMN A;  3L2R A;  1AIP A;  2CBX A;  1OOC A;  4OJL A;  2QE7 A;  3BRO A;  1TYU A;  2FMY A;  1W1W E;  2QY1 A;  1T8I A;  3VSV A;  5AON A;  1YIJ I;  3BH6 B;  3OS0 A;  3AL0 B;  1PKV A;  2A5Y B;  4FAS D;  1DDN A;  3CJQ B;  3WGG A;  4PFO A;  2DBB A;  4C30 A;  2GK7 A;  1YJW I;  2JRM A;  1R71 A;  1K6O A;  2BN4 A;  5HZB A;  3BR6 A;  2VFO A;  5E8G A;  4D7M A;  4QLC U;  4GO1 A;  1V0F A;  3SEQ A;  2XT2 A;  3H09 A;  3IWF A;  4LMY A;  3E0J B;  3PFY A;  3GVA A;  5KW9 A;  3CD6 I;  1KTW A;  1MBH A;  3D5R C;  2W6I A;  4P2N A;  2CC2 A;  3BT9 A;  1KU9 A;  3SLN A;  1OFM A;  3I59 B;  3KLO A;  3I56 B;  5CVI A;  2XGC A;  1VQM B;  3AG1 H;  2CW7 A;  4I0A A;  2DDA A;  4QUZ A;  2X0L A;  3SLD A;  2ESH A;  2HPI A;  2CV1 A;  2EFO A;  1B2R A;  2BMW A;  4PK4 A;  2IA0 A;  3I9V 2;  3DFG A;  4LG3 A;  1QA2 A;  1TLL A;  4C3I J;  2M8G X;  4M6Y A;  2ZJ2 A;  5IYQ A;  3VYS B;  2A5W A;  2XVC A;  3DPU A;  1BQE A;  2FA5 A;  5CLS A;  5J4V A;  1ETV A;  5HDN A;  1WH5 A;  4R71 A;  2QZA A;  3CZ6 A;  1FEX A;  4G9Y A;  4XRS A;  3BQJ A;  1EKE A;  4Q7J B;  1UMK A;  2XPW A;  4BYY A;  3BR0 A;  1IRZ A;  1TW3 A;  2Z8G A;  2F43 A;  2DA4 A;  3HDD A;  3L2W A;  1Z3Y A;  4UUT A;  3ZOB A;  5THX A;  3W2H A;  4B8X A;  5HNH A;  1G59 A;  2JA7 J;  5TY0 A;  1RI7 A;  4RGX A;  4NB5 A;  1HW2 A;  2QA4 I;  1WJA A;  2XGX A;  5DV5 A;  4KMU X;  1ZM2 A;  1WU8 A;  3OYB A;  1V0E A;  1SMY F;  2MG4 A;  4AYB N;  2HTJ A;  1PDN C;  2BM1 A;  4NC6 A;  2VFQ A;  2V79 A;  5GPC A;  2LKX A;  2MD5 A;  4QSH A;  1VQ8 B;  3E7L A;  2CQN A;  3HBL A;  5E3N A;  3TO7 A;  2NVY J;  5HLH A;  1SFU A;  1LDD A;  5GAG J;  5C3E J;  3CDI A;  1K4S A;  1VQK I;  2L9N A;  4WWC A;  1ZQ3 P;  3WGH A;  1QA3 A;  4C9Y A;  3R61 A;  3OE7 A;  1MMA A;  2WB1 A;  4E7I A;  2L5Q A;  1UD4 A;  5K7F A;  1Z77 A;  4DNC A;  1V54 H;  4P5O A;  4G1V A;  3A01 A;  2Y9Z A;  3OYM A;  4XLN F;  1ZM4 A;  3KE2 A;  3SJP A;  1H9G A;  1JHF A;  2F1M A;  1DP7 P;  2LZJ A;  3VO1 A;  4LK0 F;  1BJA A;  4A3K J;  4LG0 B;  2RC5 A;  1IN7 A;  4L0Y B;  3L9F A;  4G7W A;  5HS8 A;  1AU7 A;  4CHU A;  3J7Y J;  2EFP A;  1P6R A;  4MLO A;  2FSW A;  2D45 A;  2WV0 A;  4IPA A;  2KDO A;  1TP4 A;  3KP7 A;  4P25 A;  2FUG 2;  2GLO A;  4BPR A;  4QPO A;  1O8H A;  2CQ7 A;  2LY9 A;  4EGY A;  2QQA A;  3GQ9 A;  1FY7 A;  1HA8 A;  1H42 A;  2FF4 A;  4HLX A;  5J35 A;  2KZG A;  1OB0 A;  2DI3 A;  3JQP A;  4EEF G;  5TRD A;  1VQ5 B;  4IHX A;  1VBL A;  1T95 A;  2M9H A;  4M4S A;  1U2R A;  5IT9 Z;  3MKY B;  1BIB A;  4BU2 A;  1G7R A;  4YIR X;  3SFZ A;  2PEX A;  3KEO A;  2DDB A;  4LB5 A;  2ZSI B;  1JTY A;  2OTL I;  3WHC A;  5HLG A;  1IDY A;  3UR3 C;  1FNM A;  3WHB A;  1O8K A;  2FEZ A;  1K61 A;  1ACI A;  3J7A Y;  2X53 S;  1H89 C;  1JRG A;  2Y0M A;  1ZR4 A;  4OJP A;  2X3U A;  4A3I J;  2QBY A;  1WXR A;  1QRB A;  3JR9 A;  3FM5 A;  2QQB A;  4ZJZ A;  5LHH A;  4PGG A;  1QRC A;  1G3S A;  4X7F A;  1CF7 B;  2V9K A;  5JR3 A;  1ETQ A;  2G0E A;  3GTM J;  3JAM Z;  3L2Q A;  1YO5 C;  2RKH A;  3PSS A;  3P5J A;  1DDI A;  2ISZ A;  1TUI A;  4QV2 A;  1SC7 A;  4D5F A;  1J0R A;  4BDZ A;  5E3L A;  4EJT A;  1T6S A;  4E7K A;  2EV6 A;  1I5Z A;  2OK7 A;  2QYU A;  4RAY A;  1O7L A;  5HOO A;  3K6G A;  4F92 B;  3HB9 A;  4Z2Y A;  5BMZ A;  2E1N A;  1WSU A;  3GXO A;  1I6H J;  1E3P A;  1O8I A;  1OYI A;  3WTS C;  4XK4 A;  4DZP A;  1VQ9 I;  2XOK A;  3JAM K;  2PMU A;  1K5C A;  2B0L A;  2F2E A;  4PJN A;  5D6F A;  1G8X A;  3TO6 A;  3W6K B;  2LKP A;  2BXY A;  1BJZ A;  1IZ1 A;  3RQI A;  2RGV A;  1F20 A;  1Q7Y D;  3A1Y A;  1FBU A;  2HOA A;  1K28 D;  4B1R A;  2JPC A;  4IXA A;  2E1O A;  4E7J A;  2JJ2 A;  5D5V B;  4W8S A;  3TO9 A;  1TT5 B;  3HTS B;  3ZQC A;  2OQG A;  3AK5 A;  3DLA A;  5K7H A;  4P9F A;  1WJE A;  2D2W A;  2VE8 A;  5AMV A;  1ZGJ A;  4K2E A;  2G0Y A;  3F8F A;  3JQR A;  4I98 B;  4NQW B;  2R5Z A;  2VOD A;  1I6X A;  5FB2 A;  1VHE A;  2FVG A;  1RUN A;  2QTL A;  3E6C C;  3SZT A;  1O88 A;  3LSK A;  3ZQL A;  5J1U A;  5ILS A;  4DYR A;  2YPR A;  3HIF A;  2I5U A;  3GWZ A;  1GDT A;  1ZRC A;  5E17 F;  2ZZF A;  4BQN A;  3JCU C;  1F5T A;  1BR1 A;  3KIO A;  3SEJ A;  4BJ5 C;  1O8D A;  4XSX F;  3HRU A;  1YI2 B;  1IRF A;  3S16 J;  1Y0R A;  3C7J A;  4UAJ A;  1BW5 A;  1BR2 A;  2MH9 A;  1AA7 A;  3LFU A;  1IGN A;  1QGP A;  4U87 A;  1RR8 C;  3LYC A;  1R6R A;  3OKX A;  2MC3 A;  1YE9 A;  1FYL A;  1EJ9 A;  4JK1 X;  4P96 A;  1MMS A;  2R7D A;  1SAU A;  2PYH A;  1XS9 A;  4I01 A;  3FBN B;  4XID A;  1A36 A;  3QFR A;  3ZQ7 A;  3OZW A;  4RGU A;  3DEU A;  3TDU C;  5L3C A;  4RD3 A;  2YS9 A;  2TCT A;  3ONQ A;  2QM3 A;  3AVX A;  2R4G A;  5EEA A;  1R00 A;  1MJB A;  4AM3 A;  1FX0 A;  1N06 A;  1OCO H;  2YR2 A;  3LWF A;  3U2R A;  3QYF A;  4HST A;  5HDG A;  4I02 A;  2VNH A;  4LBV A;  4W8Q A;  4HSR A;  3U2Q A;  2G7H A;  2VJ5 A;  3HM5 A;  4DZJ A;  1KK3 A;  2Q2E B;  3IH3 A;  3QP5 A;  1ZRE A;  1LVA A;  1G7S A;  3P9K A;  1WHU A;  1KCD A;  1T6X A;  2WAQ N;  3M8E A;  4F3Q A;  2ZCW A;  4W1U A;  3CP2 A;  1W35 A;  5BS6 A;  1WPK A;  2M2E A;  2EV0 A;  3KZY A;  4XN0 A;  4ENK A;  1LE8 B;  1K79 A;  3OL3 A;  5EG0 B;  2KDZ A;  3CME B;  2HZT A;  3I64 A;  5CPR B;  4CYD A;  3OL4 A;  2IQ7 A;  4KFC A;  2ZTN A;  3BPV A;  1SFK A;  3DDY A;  1VQ4 B;  5FIU A;  3BJO A;  1OR7 A;  3Q0V A;  4QIW N;  5D8K B;  4U49 A;  4JBA A;  5CVR A;  5A2Q Z;  2ZME B;  3QFT A;  4RGS A;  5DD4 A;  3TBI A;  1WCM J;  4Y7N J;  3LMW A;  2FNP A;  3PIP F;  4I09 A;  3SDG A;  1RUO A;  3AVU A;  3B4N A;  1X3Z B;  4OJ5 A;  4UXN A;  1ZAO A;  1E3O C;  2E71 A;  4AD9 A;  4WK8 F;  1RC9 A;  4LOC A;  3U9G A;  3GCM A;  2FJ1 A;  1PUF B;  2V7V A;  3MMY B;  2ZBV A;  4M0L A;  2WYR A;  4RS8 A;  2JDI A;  4F7Z A;  1KD1 D;  1T5E A;  1O8L A;  2MD0 A;  1LKX A;  3W3C A;  3CCJ I;  2KIU A;  3RYR A;  4RD2 A;  4ZYE A;  3QPH A;  3DU6 A;  3QPL A;  3BCA A;  3BCD A;  3A8K A;  1XGS A;  4HOB A;  3I55 I;  2XZP A;  3DU5 A;  1JHH A;  2O0Y A;  3Q9S A;  1I1G A;  2MC4 A;  3W5U A;  1QU3 A;  3CME I;  5J6X A;  2VBZ A;  4P55 A;  1RMG A;  4HWV A;  1T2K A;  3H36 A;  4CCO A;  2ECB A;  3K69 A;  1JT0 A;  4UZE A;  1S6L A;  2V7W A;  1OFL A;  3OYN A;  1VQM I;  3WWG A;  4RB2 C;  2QEX I;  1S4M A;  2CQQ A;  3GW2 A;  2XTW A;  2IW5 A;  4NQW A;  2HGC A;  2ZXW H;  3OMY A;  3K70 D;  2R5Z B;  1ZLK A;  5ILU A;  2QSG X;  2W24 A;  3E5Q A;  5GAE J;  3JRH A;  4PMH A;  1B1B A;  3ZBT A;  4UV8 A;  2DAO A;  3S8P A;  4AIJ A;  5E3O A;  4F7D A;  1D1C A;  1I39 A;  2OZ6 A;  3G3Z A;  1YJN B;  2YX4 A;  2LRE A;  4Y4R A;  5BPD A;  3F6O A;  3MKW B;  2DMP A;  4U0W A;  1IUF A;  2HOT A;  4B3F X;  2C2W A;  1Z21 A;  2D1H A;  3OYA A;  5TV2 A;  1NBM A;  4EV0 A;  3MVP A;  2DCE A;  1OQY A;  3S1Q J;  4DQK A;  3RIQ A;  1ULY A;  1FOW A;  3TQN A;  4EM2 A;  3K10 A;  3UKG A;  1PUF A;  5L3B A;  4GXO A;  5FKK A;  3BC9 A;  1JXS A;  1COW A;  5LHG A;  4TSF A;  5F1R A;  3L2U A;  3LJY A;  2HTS A;  2MLG A;  2NS7 A;  4XOP A;  2K9Q A;  3SJZ A;  4J01 A;  1LUJ B;  4DNR B;  1MJA A;  2L9S A;  3W5H A;  2DOD A;  1CGP A;  5IOZ A;  5D8L B;  3P4G A;  1R1T A;  3FK7 A;  3AAF A;  3DXJ F;  2X1C A;  2Y69 H;  3GTG J;  3CCM B;  2L01 A;  4NHJ A;  1WP6 A;  1PJ5 A;  3FMS A;  1FJL A;  1O7F A;  3H0D A;  2JN9 A;  4WX9 A;  3WTY C;  4UNO A;  4X7D A;  5GV7 A;  3GRH A;  2M8E A;  2VBK A;  1BOB A;  2JN6 A;  1R5O A;  3FF5 A;  2DMQ A;  3ZQI A;  3IV5 A;  1WOS A;  4RAG A;  2XGD A;  1OIS A;  4A5M A;  4G7Z F;  4FET A;  5KAI C;  3QOD A;  4CH7 A;  3OP1 A;  3GQA A;  5F27 A;  1XN7 A;  1GV2 A;  5D4R A;  1FMW A;  2LKS A;  4M73 A;  4WQM A;  4AVZ A;  3CCQ B;  3OYD A;  1ZLJ A;  2NNN A;  1F36 A;  2XAU A;  1RZ4 A;  4F91 B;  2D3L A;  4MYT A;  1E0E A;  2CUJ A;  3OYF A;  2QGU A;  1IXS B;  2M34 A;  1OJL A;  1UFM A;  2V4J C;  2VBY A;  4Q5S F;  1LE8 A;  1UD3 A;  3OS1 A;  2ZSH B;  3A1P A;  4KIF A;  1GQ8 A;  2BPO A;  1YOV B;  3H9G A;  5K7Z A;  3HOZ J;  2HKO A;  3S1N J;  4KMF A;  2QEX B;  1XFO A;  1WVR A;  4PSX A;  3WNB A;  3OYJ A;  3JTH A;  1W7P D;  3IH4 A;  3K70 C;  3HOX J;  2YUH A;  5HXB A;  4UB8 C;  1NG7 A;  5FLX K;  3FXR A;  4KKU A;  2E1B A;  2F4O B;  1TWG J;  4UZF A;  2LY1 A;  4XRS G;  5IYP A;  2OCE A;  2BW3 B;  5DUI A;  4TN1 A;  2HOE A;  2R5Y A;  2BM4 A;  4NK6 A;  3QQA A;  2BVN A;  5DSZ A;  4YZQ A;  4D1Q A;  2BV6 A;  2INV A;  5IYN A;  4YIF A;  1ZG1 A;  2YU3 A;  3PUB A;  1JKR C;  4RGR A;  4TMT A;  2NNY A;  1IAW A;  3GVL A;  2JA6 J;  2XAS A;  1J2X A;  4I6Z A;  2Y75 A;  5GV8 A;  1P4M A;  3CC2 B;  3CCL B;  2XTX A;  2WAF A;  3FZV A;  1ETK A;  1TZL A;  1VQN I;  4UVB A;  5JVT A;  3HOY J;  1WI3 A;  3BJA A;  3LQ6 A;  2PJP A;  1SEU A;  2GIV A;  2PFB A;  4L5J A;  3KRG A;  4ON0 A;  1EP2 B;  2OJE D;  1Z7U A;  1Q1H A;  3CCV I;  4R1H A;  1HC8 A;  1PYV A;  2H8R A;  4XL9 A;  1UB9 A;  4AIH A;  4E7Z A;  3V4G A;  4KNY A;  3T9G A;  2ZKZ A;  2EIJ H;  1NK2 P;  1XGN A;  3AL0 C;  3GVJ A;  4WZE A;  3WE3 A;  3ZN0 A;  1IRX A;  1G3W A;  5DNS A;  2B5O A;  4B4D A;  1MZB A;  2XC7 A;  3O8G A;  4Z4Z A;  1FX7 A;  1F9N A;  3WY9 A;  1X3W B;  3BG3 A;  2R7X A;  3QE2 A;  3ERM A;  3K4M A;  1N77 A;  4R79 A;  2QDX A;  5FD5 A;  2LVS A;  2VAS A;  5DDG A;  5LRS A;  2AS5 F;  1OGJ A;  2DTZ A;  2RN7 A;  5IY5 H;  3F8C A;  2K86 A;  2XSD C;  3I1F A;  3GVK A;  2VOP A;  2ZO4 A;  2PLF A;  2GRE A;  3N97 A;  4A3J J;  2Y31 A;  3CF5 F;  1R1V A;  3F9K A;  2Y0S N;  1VQK B;  4IZZ A;  1EV7 A;  1I50 J;  1R4N B;  3E1Y E;  1SD6 A;  2R7V A;  3O8H A;  2R7U A;  5L3E A;  1B72 A;  3DWL E;  4YAL A;  1GAW A;  3PUN A;  1ITY A;  1GV5 A;  2KIQ A;  2P8T A;  1X4P A;  2Q8K A;  4WXD A;  5LLQ A;  2KJB A;  3G71 I;  4RPD A;  4EJV A;  3FXK A;  3PL8 A;  1U78 A;  4M3G A;  3CPX A;  4TMZ A;  3DEE A;  4AF7 A;  3FHZ A;  2R92 J;  2Q6O A;  2PIA A;  2EK5 A;  4BXU A;  4E6K G;  3D0S A;  5FD6 A;  2NV4 A;  2LK2 A;  4IOA F;  2J8I A;  5FKO A;  1T38 A;  3W2G A;  4A5N A;  1H8A C;  2NVX J;  2DOF A;  2K3F A;  4OP7 A;  4G8X A;  1TSP A;  1SFE A;  3IHU A;  2L7K A;  2W1O A;  3GFM A;  3HKZ N;  1POG A;  2HDN B;  3LO8 A;  3PSF A;  4RD4 A;  2JVH A;  3BZ6 A;  4BQO A;  2QTZ A;  1B4A A;  2CND A;  4DYC A;  3A3B A;  3DF8 A;  5HNF A;  1SAX A;  1UG2 A;  1KYZ A;  2FOW A;  2R7O A;  2UWM A;  1H8H A;  5DEQ A;  3WXM A;  1Q81 D;  1EA0 A;  4ESJ A;  2FBK A;  5JVG F;  1NTC A;  2JUG A;  5H6R A;  5KVR A;  1W5T A;  3ZC3 A;  2QBY B;  2V4D A;  4YAU A;  3VMW A;  2D74 A;  2PE3 A;  3KX2 A;  2VFN A;  3BTJ A;  4RB1 A;  1HVX A;  4M3E A;  1V55 H;  4X0C A;  1Q1V A;  1UZC A;  3JRI A;  1AWC A;  5LGU A;  2QF7 A;  4IHT A;  3NE5 B;  2O0V A;  2XB0 X;  2K3P A;  2CH0 A;  4BUP A;  3FDY A;  5LEJ A;  5F1J A;  1V3F A;  2BW3 A;  1FP1 D;  2DFI A;  4D7N A;  5CQE A;  5AN9 A;  3TP3 A;  3JRC A;  1CLW A;  4RAF A;  3ZMU A;  3KEW A;  2KMU A;  3KCC A;  5HZA A;  3G6E B;  1YYV A;  1IV6 A;  1R9T J;  3WU1 B;  3COA C;  1Y39 A;  5J3L A;  4F55 A;  4A6E A;  4JOM A;  5F0F A;  4DOZ A;  1APL C;  1NJI D;  4KIT B;  2Z16 A;  3F0C A;  3ECO A;  3B73 A;  4CXF A;  1IHM A;  4N3G A;  4C2L A;  1XSX A;  5DTD A;  4A93 J;  1OGI A;  1TYW A;  2EQR A;  3KZI C;  1HSJ A;  3FXM A;  2WJY A;  2O04 A;  3F6V A;  3EQL F;  1GHC A;  1TQP A;  3DKW A;  2H1K A;  2FML A;  4Z05 A;  3F23 A;  2QN6 A;  4IL6 C;  1BOA A;  3JRF A;  2DK8 A;  3PNT A;  3L7W A;  3T1B A;  3OYG A;  3G6E I;  3W2A A;  4L18 B;  1BMF A;  1QNT A;  2OBP A;  4EMS A;  4S0H B;  4ABZ A;  1BW6 A;  3SYT A;  4NUB A;  2NT6 A;  4P1W A;  3M7G A;  3K4K A;  1SAN A;  3CCU B;  4OZY A;  2V9V A;  4B43 A;  4BAC A;  4V2G A;  3FXL A;  1TL8 A;  1TQM A;  2NRA C;  2DMU A;  3KEY A;  1QVF B;  4IHV A;  4B3A A;  1MD0 A;  1REP C;  2HOS A;  4KN7 X;  3FMR A;  4CYC B;  3QFC A;  4B09 A;  2XTY A;  1GVJ A;  5E8I A;  1FP2 A;  3ZQG A;  4YZ0 A;  3M07 A;  2F5E A;  2OZU A;  5LRR A;  2HFH A;  2B9S A;  2XF5 A;  4BL0 B;  1K7A A;  2W25 A;  4KIS A;  4LIT A;  4XBF A;  1OCZ H;  5KCM A;  1EE6 A;  3OW2 B;  3LSP A;  3A35 A;  2H1L A;  3LA7 A;  4BBR J;  3KP4 A;  3CF2 A;  2DFF A;  3I59 A;  4XOT A;  1SFX A;  2KJC A;  2MSY A;  3K7A J;  2BEO A;  2YSR A;  2JQ7 A;  3CC2 I;  3WU0 A;  2WAD A;  4B3X A;  1DQU A;  2K9S A;  2VIX A;  5BQT A;  4RDL A;  4RD6 A;  3U6B A;  2NTB A;  2F4M B;  2HQA A;  2NYX A;  3RKX A;  4P1V A;  3VMV A;  1M90 D;  1IA5 A;  1KGS A;  1N0U A;  3SZG A;  2Q6I A;  4FT8 A;  3OJX A;  1ON1 A;  2M3A A;  3OEH A;  2KHM A;  2OK8 A;  2DOA A;  2L7F P;  3I4N J;  4AUX A;  3CCV B;  5JBQ A;  5JHU A;  3D5S C;  2L54 A;  2QUF A;  1R5H A;  1YIT B;  4A69 C;  4E70 A;  5FO5 A;  3HOW J;  4HF0 A;  3BCB A;  2KT0 A;  1JKQ C;  1AKH B;  3VWB A;  2XC1 A;  1SD7 A;  3H0G J;  4E4H A;  2MBF A;  3J81 K;  2ZJQ F;  3HEF A;  3GZ6 A;  4YFO A;  2C4U A;  2CV0 A;  1F1Z A;  2CRG A;  5H6Q A;  2XAG A;  3EQO A;  3ABK H;  4EAT A;  3OR2 C;  4U88 A;  5DM6 F;  2L0K A;  2F5D A;  2PEC A;  1FTT A;  5LMZ A;  3S93 A;  3HUG A;  1D5V A;  1D1A A;  2LNB A;  4QFM A;  4CA0 A;  4JMQ A;  1PXZ A;  4P9U A;  2M4K A;  1QJV A;  2NSP A;  2EZL A;  1E1R A;  4OOX A;  2X6W A;  3FXQ A;  1JKP C;  4W8T A;  4XSZ F;  4LC0 A;  4E0F A;  2Q6L A;  4O6J A;  4Y17 A;  5TIS C;  4P9S A;  3R0A A;  3E6D A;  2C5B A;  2VFM A;  4FHT A;  4NBQ A;  1DAR A;  3T8T A;  3PIO F;  2VPR A;  5DS9 A;  3DLL F;  3CCU I;  5FFX A;  2VQC A;  3DV8 A;  3G71 B;  1Q82 D;  1CQT A;  5F4M A;  3EYY A;  5E79 C;  1DBO A;  5D5W B;  3CDH A;  2JMW A;  4MGR A;  4ENJ A;  4YZA A;  5J8F A;  2KVO A;  4U4B A;  1VQL I;  3IAS 2;  2EBI A;  2B7E A;  2LDU A;  2VBW A;  5F64 A;  4IRH A;  4MTD A;  1FDR A;  5J40 A;  2IJL A;  1YLF A;  1K4Z A;  4XRF A;  3QSY A;  1VQ4 I;  2LH9 A;  2V26 A;  4FK8 A;  4A2U A;  2FE3 A;  2W48 A;  2RQQ A;  3A02 A;  4IHY A;  3CCJ B;  2BY0 A;  3RTR A;  3WG7 H;  2JA2 A;  4HV6 A;  1YLO A;  4Z4V A;  1N07 A;  4L9N A;  4P3Y A;  3MCZ A;  4EH1 A;  3R6K A;  2WY7 Q;  5FKM A;  2A3S A;  4A3B J;  4IHS A;  1XDU A;  1LDJ A;  1E79 A;  2ADU A;  2OBT A;  2GOM A;  3W2I A;  5EJC A;  3NWS A;  1OYY A;  1JUS A;  3M8F A;  1MH4 A;  3CCR I;  1KCC A;  4P6V F;  2EFW A;  5C4X J;  1T39 A;  1T56 A;  2VXD A;  3WYA A;  2VKV A;  2QCO A;  3RI4 A;  1VZ0 A;  1ZG3 A;  2GA2 A; 
#chains in the Genus database with same CATH homology
 4II3 A;  1BR1 A;  2WAQ A;  2VB6 A;  4BJ5 C;  3OAA A;  1OR7 C;  4BEH B;  1BR4 A;  1D0Y A;  2VJ4 A;  5FL7 A;  1O8D A;  2M7A A;  4Y3O A;  2WPD A;  1BR2 A;  1AA7 A;  3LFU A;  1HZE A;  1D0Z A;  4U87 A;  1PJR A;  3A2K A;  1QHG A;  1R6R A;  3VR6 A;  3HL2 A;  1YE9 A;  3S32 A;  2KRH A;  2PYH A;  4YZX A;  1SAU A;  3ZCO A;  2CUZ A;  1LVK A;  3FBN B;  2E1M B;  4XLF A;  4KT6 A;  1O8M A;  2X3H A;  1BPL A;  4C2U A;  2MFZ A;  3QYE A;  3DTK A;  2A6T A;  3LSH A;  3ONQ A;  2R4G A;  1IDJ A;  1FX0 A;  2RRE A;  5JHF A;  1WFX A;  2BVM A;  2VLA A;  1KZL A;  3QYF A;  4HST A;  1U0J A;  4OJO A;  4W8Q A;  4HSR A;  4XM3 A;  2LYC A;  2VJ5 A;  3I3L A;  4JQF A;  3IAM 2;  2V6E A;  2IS6 A;  2Q2E B;  3W2V A;  2RNG A;  1OLT A;  4XMY A;  4XLA A;  3S3O A;  1KCD A;  5DN6 A;  2IGM A;  4F3Q A;  4XKC A;  4GRI A;  4BE2 A;  3CP2 A;  3RPU D;  2XZL A;  4KJZ A;  4IX7 A;  2PYG A;  3EUA A;  3DTI A;  2WJV A;  4XN0 A;  2WSS A;  3OFN A;  3OL3 A;  1OGO X;  5KNL A;  3IUO A;  3VYR B;  4B3G A;  5CPR B;  3OL4 A;  1BLI A;  2ZTN A;  2IQ7 A;  1Y6I A;  4HIZ A;  1SFK A;  2INU A;  1D0X A;  3D5L A;  4N4O B;  3BH4 A;  3DDY A;  2HZD A;  4RLQ A;  2GOX B;  2V7Q A;  2F6C A;  4U49 A;  3JU4 A;  4Z1M A;  5HKK A;  2PMZ A;  1QHH D;  4CCN A;  3LMW A;  3TBI A;  2CV2 A;  2BSP A;  3H5A A;  3CMM A;  2GJP A;  3HC7 A;  4TKO B;  3B4N A;  4OJ5 A;  4ZDP A;  4ZC3 A;  4ZTJ A;  3FBI B;  4OZZ A;  1UG0 A;  4KKT A;  1X1A A;  2X51 A;  2AQE A;  3H5N A;  1J09 A;  3DPT A;  3NWT A;  2BVL A;  4B44 A;  4XKB A;  3MMY B;  4E7S A;  2JJ1 A;  4HPQ A;  4MXN A;  3ZRG A;  1BHE A;  4XLE A;  2HVR A;  2JDI A;  3BLY A;  4BEH A;  1T5E A;  1HG8 A;  5LD2 C;  2MD0 A;  1WJF A;  1O8L A;  2CW8 A;  1LKX A;  3W3C A;  2KQR A;  2KRC A;  3BG6 A;  1I18 A;  2ELJ A;  3OIP A;  1H80 A;  3DU6 A;  2GJK A;  3BCA A;  3BCD A;  4NK8 A;  1MW7 A;  2M7B A;  1WMR A;  4FXU A;  2XZP A;  2CS3 A;  3DU5 A;  1JI8 A;  4U7B A;  3H94 A;  2VQG A;  3VDX A;  4DJA A;  4IKF A;  2MC4 A;  1FMV A;  2JIZ A;  2W7N A;  1QU3 A;  3S3N A;  4II2 A;  2R7W A;  1RMG A;  4HWV A;  4BGD A;  4CCO A;  2ZXH A;  1DGR M;  4LIV A;  3ZXS A;  1OFL A;  3OYN A;  2ZZE A;  3ZPP A;  3WWG A;  1W0J A;  3H35 A;  4ZYA A;  1H8E A;  2R7Q A;  2Z2S B;  5TGT A;  2F4I A;  1V5F A;  3BG7 A;  1GLN A;  3OMY A;  3ZQQ A;  3K70 D;  4BE0 A;  3FY3 A;  4HEA 2;  2O5R A;  2P0W A;  2WA0 A;  4PMH A;  4BE1 A;  1MMG A;  1JTA A;  2OUM A;  1O8E A;  3S8P A;  3K4B A;  1CZF A;  1D1C A;  2IS4 A;  3HPG A;  4H4K C;  4CCL A;  2ZZQ A;  4QPQ A;  2VQL A;  3WQZ A;  4PUS A;  2LRE A;  1IB4 A;  1Y56 A;  4Y4R A;  2I8D A;  3MKW B;  3CJR B;  4XLH A;  4ZTF A;  2XND A;  3TMO A;  4B3F X;  1Z21 A;  3OYA A;  1MND A;  2DIE A;  4BDY A;  1NBM A;  3HAG A;  1WTH D;  4GQN A;  4MR0 A;  3HKZ A;  4J00 A;  3SUC A;  3VYT B;  2DCE A;  2IXS A;  4ZDL A;  4NC7 A;  2LBF B;  3K10 A;  1ERD A;  3AFH A;  2XF6 A;  3BC9 A;  1W36 C;  1COW A;  4TSF A;  3ZGK A;  3L2U A;  4IQJ A;  3OYC A;  3VSU A;  1UD6 A;  3UW0 A;  1SKY B;  4XOP A;  4XLC A;  4XR6 A;  4J01 A;  2VPL A;  4DNR B;  2L9S A;  1X4O A;  1X1D A;  2WAE A;  3W2W A;  4E7H A;  2LG4 A;  2X1C A;  4F93 B;  2CFO A;  2HLD A;  1PLU A;  3SEZ A;  3M8J A;  4HNU A;  3OY9 A;  1WP6 A;  1O8J A;  2JVG A;  2DJI A;  1MMN A;  3BCF A;  3H0D A;  3FKS A;  3GQB A;  2UVE A;  3HPH A;  2L2O A;  3H9Q A;  2VBM A;  1UAA A;  2W4S A;  1UD5 A;  3VSL A;  1N78 A;  3CES A;  2NTP A;  2O1D A;  3GRH A;  2VBK A;  1BOB A;  5HLT A;  1MAB A;  1K6Y A;  3OYK A;  1DP3 A;  4DBQ A;  4FET A;  2X85 A;  3QOD A;  3G2B A;  3PNV A;  4CH7 A;  3GQA A;  2K9M A;  2VXZ A;  4OWR B;  2R7S A;  1FMW A;  2R7T A;  4AVZ A;  2VL8 A;  3OYD A;  2KZV A;  5FRM A;  2MYS A;  2M0M A;  2XAU A;  4PSW A;  2D3L A;  4F91 B;  2CMP A;  2PJR A;  2HDW A;  3K4J A;  1E0E A;  2CUJ A;  3OYF A;  2E60 A;  3RCO A;  4BXF A;  4XN3 A;  3BC8 A;  2V4J C;  3OW7 A;  1N75 A;  1D1B A;  4BQQ A;  1UD3 A;  2WZP P;  3OS1 A;  2ZSH B;  4I84 A;  4NNJ A;  4YEL A;  4Y33 A;  1GQ8 A;  2K9L A;  4IQ4 A;  2QKM B;  5CQG A;  5C1E A;  3H9G A;  2IGO A;  3PSI A;  3C2H A;  2LOO A;  3H9J A;  4N4N B;  4PSX A;  3OYJ A;  1V5E A;  5FRO A;  3EPZ A;  3K70 C;  1KMH A;  1NG7 A;  4DK0 A;  2IS1 A;  4KKU A;  2E1B A;  2VQH A;  2LY1 A;  5HVQ C;  4Z06 A;  4NK6 A;  2BW3 B;  2WBM A;  4W8R A;  2QKL B;  2MAB A;  4YZQ A;  4D1Q A;  2INV A;  1KON A;  1W9X A;  5CDF A;  3PUB A;  3RQ4 A;  3OYH A;  2ZTG A;  3GVL A;  2NT9 A;  2ODL A;  1S9H A;  4CSW A;  3MKZ A;  2WAF A;  2VBE A;  3LSG A;  1DBG A;  1TZL A;  4CCK A;  3VSK A;  2Z6B D;  1WJB A;  4RM2 A;  1E1Q A;  1E3Z A;  1E43 A;  2X1D A;  3LL7 A;  3RSN A;  1EA3 A;  1DGW Y;  3KRG A;  2QXZ A;  1UD8 A;  1UD2 A;  1OGM X;  4XD7 A;  3VST A;  2D3N A;  3OYI A;  1PYV A;  3QOE A;  4XL9 A;  4E7Z A;  2AQF A;  4XQF A;  4XNF A;  3OPO A;  3T9G A;  2V1N A;  4Z03 A;  4ITV A;  3AL0 C;  3GVJ A;  2HNH A;  4CCM A;  4DIQ A;  3MD2 A;  1IRX A;  1P9Q C;  2HVQ A;  1NG6 A;  3OYE A;  3HOS A;  2XC7 A;  3GQ8 A;  3U21 A;  4BJ6 C;  4PFP A;  2NTQ A;  1OHH A;  4RM3 A;  1UEL B;  2V7F A;  2R7X A;  3VYU B;  3K4M A;  1N77 A;  4R79 A;  3G05 A;  2VAS A;  2QX3 A;  3HG9 A;  4YEJ A;  1Z7L A;  2W00 A;  3T51 B;  1MNE A;  2NOJ B;  3GVK A;  3N05 A;  1BN8 A;  2UV1 A;  4AYB A;  2IS2 A;  2LC2 A;  3E1S A;  2LRD A;  3F9K A;  1WJC A;  5FRN A;  4IZZ A;  1IDK A;  3A4C A;  3TL4 X;  2R7V A;  3ZPN A;  2R7U A;  1EFR A;  3DKY A;  3KYL A;  3ZIA A;  3DWL E;  4OAZ A;  2XSJ C;  3M1C A;  1XG2 A;  1X4P A;  3PL8 A;  3SDB A;  2GK6 A;  3DEE A;  4E7L A;  1NHC A;  2VJJ A;  4G6T B;  4E6K G;  2X6X A;  3OEE A;  4RMN A;  3L2R A;  3OIQ A;  4B47 A;  2XDV A;  3CP8 A;  4KKS A;  1OOC A;  3S3M A;  4OJL A;  2QE7 A;  2KLO A;  2QY1 A;  2Z1D A;  2EWE A;  3VSV A;  2XGJ A;  2L7K A;  2W1O A;  3OR1 C;  2W6J A;  3OS0 A;  3PSF A;  3AL0 B;  2DT6 A;  2JVH A;  4BQO A;  1PKV A;  4FAS D;  3A3B A;  3CJQ B;  2Y0S A;  4PFO A;  2ZFU A;  5HNF A;  4C30 A;  2GK7 A;  2R7O A;  2UWM A;  1H8H A;  1QCX A;  4URR A;  1V0F A;  4P22 A;  3SEQ A;  2W82 A;  2JUG A;  3VMW A;  3OS2 A;  1X1C A;  2V4D A;  3E0J B;  2F5V A;  3PFY A;  1KTW A;  3D5R C;  3KX2 A;  2W6I A;  1VLY A;  1E3X A;  1HVX A;  4G7X A;  3DQV C;  1OFM A;  2R9V A;  1WPC A;  2XF7 A;  2O0V A;  3NE5 B;  3B8Y A;  3H5R A;  2K3P A;  2CH0 A;  2CW7 A;  1MMD A;  3FDY A;  4BUP A;  2CK3 A;  2BW3 A;  2HPI A;  2CV1 A;  5CQE A;  1T0F C;  1VJS A;  5LFA A;  3KEW A;  2KMU A;  4DNT B;  4PK4 A;  3I9V 2;  4LG3 A;  4CUG A;  3EUK L;  4XON A;  2E5Z A;  3AKZ A;  4XKV A;  1X1B A;  2KP6 A;  2IGN A;  3VYS B;  2A5W A;  3DPU A;  4F55 A;  4JOM A;  4DOZ A;  3CZ6 A;  4KIT B;  1Z3X A;  2X6Y A;  2Z16 A;  4C2T A;  4C2L A;  2K5C A;  4RLF A;  2WY8 Q;  4YRV A;  3HOT A;  1RWR A;  2WJY A;  2O04 A;  2Z8G A;  2F43 A;  5CKT A;  3L2W A;  1Z3Y A;  3T53 B;  5HNH A;  1G59 A;  4Z05 A;  1RU4 A;  3OYG A;  3PNT A;  1WJA A;  1BMF A;  3W2A A;  3OYB A;  1V0E A;  2DXI A;  3SYT A;  4NUB A;  2V31 A;  4P1W A;  2NT6 A;  3K4K A;  4OZY A;  4B43 A;  3PNY A;  4BAC A;  3KEY A;  4HG2 A;  4PJL A;  3OWT A;  2L9N A;  4C9Y A;  4DBR A;  2PJR B;  2E1M C;  4YZ0 A;  3OE7 A;  1MMA A;  2WB1 A;  4E7I A;  2L5Q A;  3GBG A;  1UD4 A;  2LBF A;  2XF5 A;  3EQN A;  4BL0 B;  4P5O A;  4KIS A;  4LIT A;  3T56 B;  3DPL C;  3PJR A;  5KCM A;  1EE6 A;  4D9J A;  3OYM A;  3A35 A;  3OOC A;  4XKW A;  5C1C A;  2HU9 A;  2F1M A;  3CF2 A;  3B90 A;  4XOT A;  2X1E A;  4OAY A;  2LZJ A;  3FHN A;  4G7W A;  2O0W A;  2WAD A;  4B3X A;  1DQU A;  4CZC A;  4BS9 A;  2VIX A;  4MLO A;  2NTB A;  4B48 A;  2HQA A;  3VMV A;  4PJM A;  2KDO A;  4F52 A;  2FUG 2;  1IA5 A;  4BJT A;  4QPO A;  1O8H A;  3SZG A;  1WJD A;  3HXL A;  2M3A A;  3OEH A;  2KHM A;  3GQ7 A;  2DOA A;  3GQ9 A;  4XOR A;  3K4L A;  1ZEL A;  3V42 A;  1HA8 A;  1WJ5 A;  3D5S C;  2UVF A;  1OB0 A;  4DGW B;  1VBL A;  1VF7 A;  3FKJ A;  1T95 A;  2GJR A;  2JSP A;  1O8G A;  3MKY B;  4BU2 A;  3BCB A;  3L2V A;  2ZXI A;  3VWB A;  4E4H A;  4UZU A;  2ZSI B;  3ZSC A;  1YX3 A;  2CV0 A;  3UR3 C;  2NST A;  5IK2 A;  1O8K A;  1O8F A;  3EQO A;  2E5N A;  2VJI A;  3OR2 C;  4EAT A;  3J7A Y;  2X53 S;  1JRG A;  4OJP A;  2OV7 A;  2PEC A;  3C2G A;  4L8J A;  3S93 A;  4ZJZ A;  2O17 A;  1NRK A;  1D1A A;  1LDK B;  2M4G A;  5KHD A;  2HVS A;  3LSM A;  2V9K A;  4DK1 A;  4OJ6 A;  4CA0 A;  1X19 A;  3LNN A;  4JMQ A;  1PXZ A;  3JUR A;  3OOU A;  3LSI A;  3L2Q A;  2M4K A;  1QJV A;  2NSP A;  2IGK A;  3LMM A;  1E1R A;  4LIU A;  2X6W A;  4BDZ A;  4W8T A;  2M5S A;  3EUH C;  3IP4 B;  3K4N A;  4E0F A;  2BOL A;  1AIR A;  4HNT A;  4E7K A;  4EW9 A;  1V5G A;  2XZO A;  1TT0 A;  2KL4 A;  1X0C A;  5HOO A;  3K6G A;  3ZR8 X;  4F92 B;  1O8I A;  3DKX A;  2VQC A;  3HUG B;  4ZDO A;  1I8D A;  2HPM A;  2XOK A;  1PE9 A;  1DBO A;  4YZA A;  1K5C A;  4PJN A;  1G8X A;  2KVO A;  3A3G A;  4X0G A;  4U4B A;  3IAS 2;  4ANJ A;  3DTE A;  1W36 D;  2VKH A;  3A1Y A;  4G6I A;  1K28 D;  4YXW A;  2LH9 A;  2V26 A;  2R7R A;  4TT3 A;  2VKD A;  3UNG C;  4E7J A;  2RQQ A;  4HRI A;  2JJ2 A;  4W8S A;  1YX5 A;  2NZM A;  3OYL A;  2KPM A;  3RTR A;  2JA2 A;  1W0K A;  3DLA A;  2X8K A;  1WJE A;  3FPP A;  2WY7 Q;  5AMV A;  1E79 A;  2Q1Z B;  3QYB A;  4ASU A;  2GOM A;  4AU7 A;  4NQW B;  3NWS A;  2OC6 A;  4PJJ A;  2ZZG A;  1KCC A;  4NC8 A;  1O88 A;  3LSK A;  2DT7 B;  2VXD A;  3K4C A;  2LY2 A;  2ZZF A;  1VZ0 A;  4BQN A;  2UUZ A;  1LFP A;  4CCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...