4YELA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
596
structure length
596
Chain Sequence
b'FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
total genus 228
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yelA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yelA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yelA02
2UVFA 1O8MA 2NSPA 2NTQA 2PYHA 3VMWA 1O8LA 3LMWA 1PXZA 2QY1A 1PE9A 1NHCA 2Z8GA 3GQ9A 1JTAA 1O88A 4Z06A 3T9GA 1BN8A 2NTPA 4YELA 4PMHA 2X6WA 1X0CA 1RWRA 2O04A 4MR0A 2O0VA 1PLUA 4Z05A 2VBEA 4XLFA 2INUA 1RMGA 5AMVA 1KTWA 2X85A 4W8QA 1DBGA 3FY3A 4YZ0A 2VJIA 1GQ8A 1OGOX 1IA5A 1IDJA 1O8GA 1RU4A 2X6YA 2ODLA 4XLAA 2NT6A 1O8KA 4YZAA 4OJ6A 4YZQA 1EE6A 3KRGA 3ZPPA 4YEJA 2O0WA 3B90A 1K5CA 1AIRA 2BSPA 1OFLA 2PECA 4OJ5A 3JURA 5C1EA 2O17A 3WWGA 4XORA 3EQNA 4XLHA 1QJVA 2NT9A 3SUCA 1OOCA 1O8IA 1OGMX 2O1DA 2PYGA 1JRGA 4XOPA 1IB4A 2X3HA 2EWEA 4OZZA 2VBKA 3EQOA 2IQ7A 4XLEA 3GRHA 2QX3A 4U49A 4OJOA 4NK6A 1O8DA 3GQ8A 4XM3A 1KCDA 4XONA 2NSTA 1HG8A 3VSVA 4AVZA 3B4NA 4EW9A 1WMRA 4U4BA 3VSUA 4XLCA 4W8RA 4XMYA 4XR6A 4OJLA 4OZYA 3GQ7A 1XG2A 4XKVA 1H80A 4MXNA 3ZSCA 1KCCA 4I84A 1VBLA 2QXZA 1DBOA 3VMVA 4W8SA 1QCXA 1CZFA 4NK8A 1BHEA 3UW0A 4XN3A 3B8YA 4XNFA 4XL9A 4XQFA 1O8HA 5C1CA 2INVA 2VBMA 2NTBA 4W8TA 4YZXA 4C2LA 2UVEA 4XN0A 2VJJA 3VSTA 1IDKA 2X6XA 4HWVA 1O8JA 4XOTA 4URRA 3GQAA 1OFMA 4XKWA 1O8FA 4Z03A 1O8EA 2NZMA 4OJPA
chains in the Genus database with same CATH superfamily
5K7ZA 2MYSA 1ZREA 3I56B 4C30A 4BNCA 1P9QC 4RBOA 3I4PA 1QVFB 2ESNA 1VLOA 1O8LA 3LMWA 3H3ZA 4NC6A 1PUEE 3CCSB 2JVGA 5A2QZ 2EZLA 2F4OB 1S6LA 2Z3YA 3X2QH 1T6ZA 1VQNB 4RMNA 4N0BA 3QOEA 3MQ0A 4CCJA 4XRSG 1N77A 1GAQA 1DU0A 2JRMA 4UNOA 4H4KC 2LY1A 3ZR8X 2MA3A 4PMHA 1VFCA 1W0KA 2OUMA 1R5ID 4NDLA 1B23P 3S1RJ 3CC4I 1K73D 5EGOB 2EV6A 1FT9A 5C4JJ 2QN6A 5CVJA 2K9MA 2ACJA 2GZWA 2XF5A 2ZKZA 2K4BA 3CCQI 1X1AA 3F8MA 1JT6A 3DLLF 1OB2A 3W2VA 1CNFA 2QSGX 1TYUA 3IRRA 2KMUA 1EFRA 2V6EA 4AIKA 2KIQA 3T56B 1LKXA 1TLHB 3MKWB 2XT2A 2A6HF 3QFSA 2KISA 2DT7B 4PZJA 2XOKA 2AQEA 3DBLB 1Y56A 1U0JA 4HSTA 2A07F 4MLOA 4J0QA 1TZLA 2DMQA 3TOBA 5DS9A 2QLZA 4RDUA 5KHDA 4XLAA 1GVHA 2Z1DA 4RM0A 1EE6A 2IVMA 2ECCA 2K02A 2W7NA 3A8IA 2ZTGA 3PA1A 1WJBA 2VC0A 3B02A 2Q2EB 5DUIA 2QKLB 3GXOA 3CCMB 1OFLA 5DCMB 5LGNA 4OJ5A 1W5CC 3C2GA 4IQJA 3ZPNA 1S8NA 1YJNB 3SDBA 1S72I 2ZL5A 1O57A 3HAGA 5L46A 1O8IA 1FMVA 5HLGA 1OGMX 4N4OB 1POGA 2QA4I 1VQ8I 5EGOA 3ASNH 3BQYA 5TRDA 3ZQIA 3SJPA 3WG7H 4CHUA 1YG2A 3LFUA 2QX3A 1BI0A 2QUFA 4DBQA 1R5HA 3VNVA 1IB0A 3QPLA 3CCLI 1G2HA 4HLXA 5IYPA 3GTPJ 2NSTA 2LY9A 4HOBA 2DERA 5E3NA 1QRBA 4A3CJ 1Z7LA 3EPZA 1ORKA 2HU9A 3BG7A 4WF2A 3TDUC 5EEAA 2NVQJ 3OYKA 4LG3A 1OPCA 4Q4ZF 2B7BA 3JQRA 2ZBVA 2E36A 1ZM3A 1FOKA 1YW9A 1Z1DA 4XR6A 4A0YA 5EMNA 2V6CA 3CUOA 1TUIA 3ZZ0A 3DPLC 4LG0B 2L4MA 2VFOA 2E2IJ 1XC5A 2WZPP 2Y9YA 3HTUA 3ZSCA 2F3LA 3PUFA 4I99C 4HPQA 1MDMB 4PABA 1Y8QB 3K4KA 3AL0B 4ESJA 3KP3A 3CCUI 2PMHA 4F7DA 5HNHA 1H0MA 2W6IA 5IT9K 3V8LA 1B9NA 2P5VA 2HZDA 4LJZF 4F52A 3GEZA 3T8RA 4RB3C 3A3BA 1O8HA 4MTDA 3F6OA 1FOWA 3D5RC 5HLHA 3RTRA 3WU2C 3FPKA 1B4AA 1BQEA 2F4MB 1HXDA 2VT2A 4FISA 3VMFA 1G7TA 3CPWB 3PUMA 3SYTA 2RKHA 3KEYA 2OTJB 1B2RA 2P0WA 4EEFG 1E3OC 2Y0MA 3RY8A 2COBA 2F6CA 1H88C 4C2TA 3ZIAA 1VQ8B 2QMUA 1DGWY 3QP6A 2MLGA 2RV8A 2LG4A 3QYBA 2DT6A 2CV2A 1Z3XA 1TT0A 2YWGA 1W36C 2RAEA 3RI4A 4EQQA 4YAOA 5B5EC 1QO0D 2H27A 2RN7A 4DBRA 2Z8GA 2BVMA 4II2A 5CQGA 1OKRA 4A3DJ 4DYQA 4DZPA 2E7XA 5F4MA 4MGRA 4YELA 3VNUA 1X58A 2R7TA 3JRFA 3LVBA 2LKSA 4YEIA 2BGJA 3K4BA 1MDMA 5J3OA 3ZXSA 1RWRA 2VN2A 5CQEA 4C3IJ 4D5CA 1VQ5B 3OP1A 1X1PA 1G3SA 4P96A 2O0VA 1DPRA 4XLFA 2DFIA 3CCUB 2A69F 4HX8A 4J19A 2X85A 5DM7F 1QU3A 5J1YA 3GLLA 3IWFA 1X3ZB 1KD1D 2CO5A 3LSGA 1IN7A 4XSXF 9ANTA 2OZ6A 1RESA 1J5YA 3OYDA 1KK1A 2RVCA 2L9SA 2ZFWA 3Q5FA 2F1LA 2VPLA 2HQ5A 1TYWA 1MSFC 2FMLA 2ZXJA 4KNYA 2VI6A 3JRDA 2OAZA 1IXCA 1T2KA 2GLOA 3FZVA 1M1EB 5BS6A 3BZKA 1IO2A 2JA2A 1MMSA 3SYJA 5DUKA 1XSDA 3KP4A 3PL8A 1YIJI 1K61A 2LZJA 3E6CC 3VO1A 1VQ4I 1Q82D 3OYEA 2EIJH 2O1DA 5KW9A 1VQPB 3SEQA 2WB1N 3R6SA 4Y33A 1X4PA 4ENNA 4HRIA 3JRAA 3K10A 1EZGA 3ZN1A 4C43A 1F36A 3BT9A 1F1ZA 4RAGA 4YFXF 3MZHA 4HNTA 4TMVA 4X7CA 4A5NA 4BHBA 2CWEA 3H35A 1BMFA 2JIZA 1GV2A 3W2IA 2Y31A 4W8RA 4B3AA 5D5WB 3O8HA 2ZMEA 3MZ8A 3ERED 2E35A 2HKXA 3HZJA 1B8IB 1H8HA 1CNEA 4OIRF 3WTXC 1Y39A 1O3QA 1H80A 1T56A 1SFOJ 4ZDLA 3GVKA 4I76A 4NQWB 3DKYA 5E18F 2QXZA 2KJCA 3VMVA 2KDOA 1EA3A 4QIWN 3CO6C 1VF7A 4FQGA 1Q7YD 1WPCA 3TP3A 3RSNA 4GQNA 4CYDA 4A3JJ 2VT3A 1K28D 1FDRA 2HOEA 3FMSA 3HSFA 1WSRA 2DIEA 4YZXA 3QODA 2KRCA 4FT8A 2BHYA 5CYVA 1XQBA 2HDCA 1D8JA 1E62A 4E7JA 3FMRA 4U0YA 1MMGA 1MIJA 2CUJA 1HCRA 4M6YA 4MTEA 3AVVA 3R60A 5FJ8J 1F5TA 3QE2A 1U9NA 1YIOA 3G71I 4TMXA 2BM0A 5IY5H 1YX5A 1D1NA 5K7FA 4IO9F 2NS0A 4DNCA 1SD6A 2V1DA 1EH6A 2EK5A 4MFEA 1OHHA 3M4OJ 2X1EA 3AVYA 1UCRA 3HOSA 1LDKB 1CQXA 1WU8A 3LAPA 2FRHA 3EYIA 2XSDC 2OA4A 5HKKA 4QPQA 4HNUA 2K3FA 4NQWA 3PQJA 3L2VA 3ONQA 1RKTA 2DOGA 1NDHA 3WBKA 3BH4A 2V9PA 4RD1A 1JTYA 3VSLA 4UUTA 1UHMA 2WB1A 2JSPA 1TQIA 3BG9A 2JZYA 1QG0A 2M4GA 4RCZA 4PSWA 3LQQA 3OJWA 3W2GA 3FXQA 3AVUA 3CMMA 4N3NA 2F1MA 4Z05A 2EZKA 5GV8A 1PVEA 2ISZA 2Y30A 4IKFA 1W9XA 1YW8A 4EJOA 1HSJA 5CVVA 3OS0A 3TO7A 1K4ZA 3A8KA 1YHQB 4YZQA 3G6EB 2XB5A 4LC0A 5E6TA 2HCJB 1KC8D 1YRNB 1FP1D 3VDXA 3JQQA 1SMTA 1YS7A 2X9DA 3D1NI 1GUUA 3HC7A 3CJQB 4ESBA 1DDNA 4GRIA 3L2WA 1HVXA 3H9GA 3HHHA 3MWMA 4RB2C 1HW2A 4LLNA 5DSZA 3JR9A 5HS7A 3FBNB 4P12A 2LC2A 5E8IA 1KU3A 4RD3A 4Z6YA 4C0SA 2XPWA 2X3HA 3JW4A 1MJ9A 4B44A 2STTA 1PP8F 2WSSA 2X6OA 1S7AA 3H3UA 2HMAA 3PVDA 4UUVA 3CRZA 4OPVA 2WWYA 1QZYA 2O0YA 2RNJA 4WWVA 1QRCA 3H0DA 4F92B 1TP4A 4LITA 2BBYA 4KIBA 1KK2A 2OTLI 1KONA 2BW3A 2F5CA 2O9LA 1Z7UA 1KU9A 4CGZA 4RCYA 2A68F 2D2WA 4J00A 4OZYA 1XG2A 2CS3A 3O6BB 4KJZA 5E1WA 3G1LA 1MRZA 3MD2A 2BPOA 3HOVJ 1O7FA 5HODA 2HQAA 4ENJA 1V0FA 2E1RA 1YRNA 1HF2A 3CQZJ 2DT5A 1EH7A 2VKVA 1QA1A 4M0LA 5J47A 1LQ1A 2F4NA 4I02A 1WOOA 3CCEI 1A8PA 3DXJF 2R7XA 2H1LA 1QHHD 1VLYA 2LFBA 2L7KA 5LMZA 4A3FJ 2IS2A 2JA5J 3IH3A 4XKCA 1PKVA 2O5RA 1DDIA 4EGZA 2BYVE 1W0UA 1PDNC 3S93A 1SFXA 3FXMA 5K5QA 2EIXA 4P6VF 4M6VA 2X6XA 2HOAA 4BQNA 5K1YA 3HOTA 2A5YB 2DA5A 5LLQA 2YPRA 1HZEA 3QPTA 2NZMA 2FMYA 2JRTA 5GAHJ 2YU3A 1IXRC 1WOPA 4BYYA 3ASRA 2F48A 4PC2A 3ELKA 1PXZA 4PFPA 1J09A 2Y69H 2M45A 4HX4A 2L0KA 3HOYJ 5L3EA 4YFOA 1H89C 2VPRA 2VE8A 1QA6A 3K4JA 3HOUJ 4B3FX 5LGTA 1HDDC 4Z4ZA 1UAAA 5B1AH 4PK4A 3NQOA 2CV1A 2OZUA 3HTSB 2YUSA 2HI3A 2JTVA 2K27A 3BQJA 3H94A 1MH3A 1XX5A 3OOPA 2PJRB 1K83J 4FX0A 3G4SB 4ZV4A 3ASQA 3SJMA 3A01A 1OFCX 1RETA 2F5EA 3KZIC 2J5PA 2EBIA 3C18A 1U2WA 2LH9A 3K6GA 3GTKJ 3J80K 1YQAA 4D1QA 4OP7A 2EA4A 3JRBA 1ITYA 5HNFA 4IHVA 1LB2A 1U2RA 5AONA 2VQHA 1PLUA 4PJNA 3BCFA 4NBSA 2C78A 3LSJA 1YYVA 2DYRH 5HOOA 1JI8A 2HDWA 1RU4A 4BY1J 2XAHA 1HC8A 3R61A 2V7QA 1VJSA 2YX7A 1FZPB 4X06A 3EUKL 2LOOA 3OZUA 5J40A 2XAGA 1JHHA 5JLVC 1NHAA 3OWTA 2MH2A 4CYCB 3IH4A 4G8XA 2D3LA 4CDGA 4HNVA 1W5TA 1ZGWA 1JGSA 3S8PA 4YRVA 3H9NA 3GQBA 2K9LA 4MFDA 2DQRA 4PJ0C 4XORA 3JAMK 3VWBA 5EYRA 1FYLA 5A89A 3SZTA 2NT9A 3CDIA 2Q6IA 4A69C 3PO3J 3WNCA 4A3GJ 2VQGA 1T08B 4IQ4A 3Q0VA 4K1XA 3H1CA 4CCMA 3LQRA 4KN7X 3W2FA 2DODA 2BM6A 2CW0F 1UD6A 4CSWA 2RQQA 5FL7A 5F1RA 5F1JA 2HQRA 4JK1X 1XG1A 2M3AA 1C0WA 1UG0A 1SM4A 3ZZTA 1AHDP 2KHMA 2BEOA 2IP2A 2M87A 4X0GA 3I4MJ 2FVGA 1FIPA 2L9NA 2A3SA 1YLFA 4OINF 2D9RA 4KKUA 5IT9Z 1EP1B 3ABUA 2EFGA 3K69A 2EIKH 2VIXA 4D0PA 4UUSA 1FSHA 5F4OA 1H8AC 4KN4X 2ZJ2A 3OL3A 4B8XA 1GV5A 2FOKA 1O3TA 1XB4A 3GX4X 2XRLA 5FD5A 2K40A 1UFMA 1LEBA 4WXCA 4NK8A 2JPCA 1APLC 1I1SA 3B8YA 3AG4H 4RD4A 3S2DJ 3WGHA 2VBMA 2ZXIA 4UV8A 1TL8A 4CH7A 1U8RA 1FEXA 3OS1A 3P27A 2W4SA 4YFKF 1LFUP 2F4IA 5HS8A 5GADJ 1WHUA 2ZMEC 4XOTA 1JKQC 5E17F 3AG2H 3F23A 3J81Z 4Z4TA 1QVGB 2ISYA 4KMFA 2H6CA 1FP2A 2MW8A 2V7UA 3AVTA 1MW7A 4UVBA 4A3LJ 3I53A 5ERIA 4HDVA 1DPUA 4H0EA 2E34A 2BGCA 2FF4A 5C44J 4Z06A 1R4NB 2HKOA 5CVRA 3TEDA 4GFBA 2BY0A 2KDZA 3WBJA 5DCFA 3AGQA 4O5VA 4Z2YA 2OBSA 2IGKA 1R36A 2ME0A 2QF7A 1G7CA 3K9TA 2VBEA 5KCMA 1HF0A 1HKQA 2KIUA 5AMVA 2ZC2A 3RKWA 2R7VA 2AHOA 4G7HF 2FXAA 5CLSA 4LBZA 1QX4A 2H6BA 2VBWA 4K2EA 5GPCA 1BLIA 2E1OA 3BROA 1KMHA 3A2KA 2F2EA 3DBHB 2CRGA 3ZGKA 3RKQA 2LDUA 2QZ8A 5F64A 3OL4A 2LBFB 1VNDA 2IXSA 3KRGA 2XPVA 2CH0A 3V4GA 3FXKA 3SQNA 3SEJA 1DP3A 1EFUA 5ILVA 2L7FP 4ANJA 2H94A 2X0LA 1QUEA 4LOCA 3LA2A 3W6VA 1YI2I 3CCYA 2PLFA 5C1EA 2DDAA 3L1PA 1N0VC 2V7VA 1GDTA 2R5ZA 4M74A 4HG2A 3H0GJ 1WDTA 4N3GA 3N6ZA 5ICCA 4PJMA 2W00A 1MBJA 3MFKA 3ASPA 1TW3A 1T8IA 2OK7A 4B4CA 2IQ7A 1Z0XA 1S7EA 3MCZA 2Q6OA 2VBVA 4XBFA 3A35A 1TTYA 2M7BA 3OJXA 4YXWA 2VFMA 4RLQA 1ZTRA 4Q48A 1ZRDA 3LQ6A 2OQRA 3PUBA 1V5EA 2JSCA 1PJ5A 1P4WA 2DTRA 3V7SA 1QFJA 1I50J 3NWSA 1WSUA 2XAUA 1EF4A 1JKOC 4FK8A 4C9YA 3DPTA 2K5CA 3HRMA 1E3XA 1UD3A 1RIOH 2VL8A 4X1EA 4OJLA 4DNRB 3K2ZA 3W3CA 3JTHA 4I01A 3G2BA 2XGXA 1SD5A 2LBFA 1ZG3A 3HB9A 3Q6RA 2OD5A 3KPHA 3F22A 1JA1A 1G7SA 3H36A 5LHHA 4E7IA 2TCTA 2OBRA 3LSHA 1O4XA 4IOCF 1DP7P 2DYSH 1OYWA 3Q6QA 3DTEA 5JLXA 1T0FC 1XD7A 4WWCA 1LNWA 1Y1VJ 3OMYA 3CCSI 1G3YA 1YOVB 4RAZA 1YI2B 1TT5B 2E1MC 2F5DA 1VQNI 1DDGA 2XAFA 2HPIA 1SANA 2KJBA 5HS9A 1KQ0A 3S1QJ 4L0ZB 4G12A 2E1CA 1IRXA 1IV8A 3ZN0A 2B63J 4G1BA 3S16J 2XZOA 3BR6A 3DFGA 4LIVA 3K70C 2K9NA 2NSPA 3OYBA 3KYCB 3LYCA 3Q39A 1CQTA 4U87A 2QZAA 2VKEA 4KA4A 2PYHA 3EUHC 3PETA 1ETWA 1B1BA 3DU5A 1SEUA 2GWRA 4BY7J 4QV2A 3GQ9A 1RKWA 1O88A 4E70A 3HBLA 2VBTA 4OOVA 1B6AA 3A02A 3NAWA 3GZ6A 5IT3A 1ETKA 2HOSA 1QZZA 3IAM2 3FISA 2JVHA 5L3BA 4WZKA 1QA3A 3CCVB 3QFRA 2DA7A 5L3GA 1X2MA 1UD8A 1BC8C 2CW7A 4I0BA 1VHEA 3F8BA 1KTVA 2ZSIB 3K1NA 3SEZA 4XSZF 1IF1A 5GTHC 4ZYHA 1V54H 1NK2P 2DJNA 4L8JA 4B43A 3S1NJ 2V5IA 3QQAA 3CCMI 3MKZA 1VQMB 2V26A 1AU7A 3CUQB 2VJIA 1FYMA 4IVNA 3WHBA 4A2UA 1XTAA 2FD5A 4LLGF 5BPDA 3KEWA 2ODLA 3WG9A 2MABA 4OJ6A 5F27A 1JGGA 3BLYA 5FRMA 2QCOA 2DLLA 3AG3H 3W2WA 2DW4A 4AWXB 2HQNA 3CJNA 4JBAA 2R93J 5C4XJ 2J7KA 2OJED 2AO9A 4WXDA 5AIPA 2NNNA 3ZC3A 1AIRA 2XTYA 2M0MA 4C2MJ 2BXZA 2O17A 2VJ5A 2VE9A 1SKQA 1FBUA 3U1DA 3IH2A 1ERDA 3QFTA 4LB5A 4KH3A 1WQ2A 1KYWA 3PA2A 1U78A 4OZZA 2LTPA 3PUNA 2IPQX 3AAFA 5JMCB 4JRAC 3CC7B 3NWTA 4U49A 5H20A 1HW1A 3G73A 1ZM2A 1GO2A 1V3FA 4NCNA 2IGOA 5J1RA 1Z6RA 2W82A 4BEHB 3GZNB 4Y13A 4II3A 5F0FA 3OZWA 2IAIA 1DGRM 1OYIA 3QYFA 1BR1A 4IXAA 5IP9J 2R5YB 1U5TB 3MKYB 3RPUD 4IHYA 3OFNA 4PC3A 3BH7B 1BBYA 2V7WA 1M90D 2ZB9A 4U88A 4IHXA 2IJLA 2DI3A 3KL9A 5JHUA 1OMIA 2GJRA 4LBYA 2P7VB 3GVAA 4MXNA 3SXYA 3FBIB 2OTJI 3PFYA 4FWTA 3FK7A 2EFQA 3B6AA 4I09A 1Q9SA 3FXLA 3C2HA 2IOUG 1N25A 3Q0WA 1UMQA 1TWHJ 2KP6A 2LF8A 2QSFX 1ZH5A 4ZCLA 4HF1A 3ML3A 1BX0A 2CQ7A 2VQLA 3FDYA 2FU4A 1MBHA 2DJIA 5FLXK 3E0JB 2C4TA 1GVDA 1R1UA 3OZVA 4HX7A 3SZGA 1HSTA 3KLNA 3QPSA 3GTMJ 1XE1A 1A6QA 1VHOA 4BXUA 2QGUA 2BY2A 2JK3A 3LL7A 4ABZA 4DQ2A 4E7KA 4FN5A 4QSHA 4AU7A 1O8JA 3I9V2 2VBZA 3W6KB 2IA0A 2X48A 1OCCH 1FIAA 4R1HA 2Z9OA 1W7PD 1O8EA 1RR8C 4BEHA 4YIFA 2NTQA 1VQ5I 1QGAA 1ETYA 1Y0NA 4BJ5C 1SC7A 2EJRA 4GYGA 3G05A 1U5TA 5IOYA 3V76A 3A1YA 2Q2EA 4P1WA 3WNBA 3ZOBA 2PI0A 1PE9A 4RD2A 5DCMA 3EDPA 2BN4A 1QQ1A 2CQKA 2B0LA 5FRNA 2ME6A 5FKKA 1BN5A 1OYYA 4ZYDA 1HLVA 1E1QA 4ZTJA 3GTGJ 2KIMA 5FKLA 4C3HJ 2JDIA 3OYIA 1X19A 2R7RA 4MYTA 1BIAA 3IRQA 3M7GA 2IS6A 3L00A 2R0QC 2E60A 4HV5A 4TMWA 5IK2A 4ZGQB 3J80Z 5IYNA 1UJ8A 4FXUA 3E20A 3HOXJ 2FOWA 3V8JA 2FA5A 3DF8A 4E4HA 5ED4A 1XPXA 4D9JA 2Q6KA 4O3MA 4M3FA 1MD0A 3HG9A 5LRSA 2ADUA 4W8QA 2IGMA 2BE5F 2KPMA 3MMYB 1CGPA 1ZRCA 4P3IA 1X1BA 2ZFUA 3MMPA 1WFXA 3FXOA 3J81K 4P9SA 3BPXA 3CP2A 3HHGA 2KZVA 5F0CA 4AVPA 4U0WA 1TWFJ 1XMXA 4KMUX 1VQPI 1UD5A 1OCRH 3BR5A 4LG0A 2NT6A 3Q0UA 2FNAA 4KFCA 2KLOA 1MMNA 3VEPA 1EP3B 3E97A 4M3EA 3W5HA 3M07A 4MEYF 4BL0B 3LA3A 3ISXA 3ZZUA 1TTTA 1WPKA 1ZR2A 3JAMZ 4A93J 3K7AJ 2G0YA 4WQMA 1OB0A 4UB6C 1AKHB 4BAYA 3F9KA 2E7WA 3D5LA 1S0UA 1TLLA 2BM1A 3P9IA 4M9ZA 4L9VA 2H1KA 1IB4A 2JUGA 3CF5F 2CQQA 3O3KA 2EWEA 2V7TA 2KFDA 3EQOA 3TBIA 4BKXA 5GPAA 1OR7A 1PJRA 1DU6A 5EDNA 1FNDA 1LVAA 3E1SA 2O03A 2VBYA 1U6GA 3O8GA 4L9TA 2HVSA 2LREA 1T6XA 4NK6A 3GQ8A 3S17J 3A0BC 2HTJA 3S15J 1QPIA 1F4KA 3D0SA 3FXJA 1MNMC 3BY2A 3FXUA 3MCAA 2R7SA 2HXIA 1R49A 4KT5C 2CU7A 4AF7A 4GGGA 5EG0B 2QQBA 3I5UA 4IX7A 2DBBA 1R58A 4LK1F 1FRQA 4CUGA 4XRSA 2JJ7A 1ZYRF 2M5WA 3IKVA 2HNHA 4TV7A 5M5YJ 1GXQA 3FPPA 4W8SA 2GIZA 3U21A 1NG6A 1TNTA 1AKHA 5DN6A 2DY1A 3CD6B 1RQRA 5LGUA 2WC2A 3HJEA 1E2XA 1LVKA 1D3YA 2AXTC 2GBYA 2VFPA 5JFRA 3CPXA 2HZTA 1IG7A 5TV2A 1G6NA 2HYJA 1LFBA 1EWYA 3ML6A 5GP9A 4E7LA 1I39A 2WA0A 1SKYB 4Z03A 4M71A 1D8KA 2LF7A 4L9JA 4X6AJ 3OIOA 1IV6A 3QSYA 4L0YB 3CMYA 4OPWA 4RM3A 3OYJA 3M1EA 2DPUA 4R71A 4V2GA 2R7DA 3ABMH 2Y9ZA 4CQJA 1I5ZA 3V8KA 1A04A 1IGNA 4Y52J 1JTAA 4L5IA 2H8WA 4RDLA 2IEKA 5FKOA 2NTPA 4YC5A 3GF2A 4QHYA 2XAQA 4RM2A 1DABA 3BZCA 1EJ9A 2C6YA 5TY0A 3S3OA 4JX6A 2PMZN 1FNMA 1IRFA 1IRGA 3A1PA 3BCDA 2DQLA 3HM5A 2LYCA 4RJLA 1PYVA 4RGUA 1YHQI 1GR1A 2GQQA 3G6EI 1B72B 3Q9VA 4A3MJ 3MZYA 4ZZDA 2JUCA 2HOTA 4LFUA 2D45A 4ITVA 2EFPA 1LFPA 2ZXHA 4YZ0A 2UXNA 1D2EA 3DKXA 5FFXA 2XB0X 3GFLA 4EMSA 3OYCA 2ZZFA 1OGOX 3CCRB 2VNJA 2DU9A 3FJOA 1N07A 3OEHA 3Q9SA 4G94A 3B73A 5TJJA 4J01A 2OPTA 4BPRA 1I8DA 2DO7A 5HZAA 1B8IA 3CMAB 4A0ZA 3GWZA 4CZZA 2W57A 4YEJA 1EFTA 5F4JA 1YJWB 3V7CA 3HUGB 4UHTA 4OPOA 2IBDA 3OIQA 1UB9A 2KRHA 2XTXA 1L1IA 3LAJA 4CZCA 2QWWA 1K4SA 4BQOA 4WK8F 3DDYA 3GVLA 2NOJB 5M5WJ 3AVXA 2W48A 2DETA 4C2UA 3SFZA 2QBYB 2ZBKA 1QJVA 1WORA 4ZTFA 3REOA 5IYDJ 1OOCA 3E5XA 2W25A 3OR1C 1XCBA 1EKEA 3J7ZI 3I54A 2K7LA 5LEKA 1R5OA 1I1GA 4AYBN 5IPAA 2GAUA 2G0EA 3HPGA 5DTDA 1XGMA 4NB5A 2Y48A 4KYWA 2X1CA 3HSEA 3KX2A 1R5GA 4G7OF 3U1KA 2HR3A 2M5SA 1KCDA 4IJAA 1JKRC 3JX8A 2DFHA 2DK8A 2GXAA 3O2PE 1VQ6B 3DBRB 1BM9A 3HKZA 1PJ6A 3TW6A 1XGSA 1Y0YA 4BJ6C 2L02A 3VPRA 1JA0A 3I55B 3VSUA 2XGCA 5EZHA 4Y7NJ 1Q1VA 3GVJA 3WE3A 2ZJRF 2V31A 1CLWA 2QENA 4O6JA 2M30A 4Y4RA 1MBKA 1Z9CA 2OCEA 1N05A 3K70D 1ENHA 4PC7A 3ZQCA 5KAIC 1E3PA 2E5ZA 1I3QJ 5L3FA 2PMZA 3W6JB 1QCXA 2M4KA 2R9VA 3Q3SA 2QBYA 1XN7A 1QNTA 2W6JA 3S14J 2PIAA 3H09A 1IHMA 1FX0A 3COAC 1ETVA 3OKXA 1W0JA 3HL2A 4BXXJ 1F60A 3LMMA 1TVCA 2NOGA 5D4RA 1I6HJ 3K4MA 5EEGA 5LRRA 3TO9A 1A36A 2BX6A 4DZJA 2W24A 2VQCA 2CQXA 3KETA 1KQ9A 1WCMJ 2ZZEA 3E7LA 3KYDB 1XGOA 3G4SI 3FIWA 3PJRA 3I1FA 2KIFA 1OCZH 5IYRA 4A0XA 3H92A 2K86A 2EFNA 2DDBA 3OE7A 3OSGA 2NS7A 3OAAA 2XNDA 1QVUA 3BG3A 4A3EJ 2YU9J 2A6TA 1CF7B 1LEAA 4IOAF 1S7OA 1TW2A 4S04A 1NB0A 2C4UA 2L5QA 2YR2A 4OOIA 1X0CA 4MR0A 1HBXG 3ONUA 4E7ZA 1D1BA 1Z77A 3CF2A 4RB1A 2P3MA 3MAJA 2DOEA 1LDDA 2ECBA 4M2LA 4AYBA 2CRVA 1PP7U 3W5UA 2N8GA 1KTWA 2JJ2A 3PIPF 4N9IA 2VZLA 4DOZA 2GQFA 1BOBA 5THXA 1BJAA 4R8HA 2D1VA 4AM3A 3J7AY 2EH3A 3WQZA 1GQ8A 2VONA 2FNPA 1IXSB 4F7ZA 3F8CA 2IGNA 2L01A 4M6XA 4U0VA 3Q38A 1FBSA 2QTLA 1JUSA 4EM0B 1XS9A 3RYRA 4UB8C 4V2FA 3TKYA 2IT0A 5BSXA 3L7WA 4P22A 4X0CA 1P2FA 2O0WA 3SLNA 4PJJA 4HDUA 1SVOA 4PC1A 4IHWA 3IAS2 2EFOA 5BOXA 2PX9A 3WWGA 3GCMA 4CA0A 1GT0C 4PCQA 3EQLF 4HSRA 4LK0F 5FO1A 3ZCOA 1U9OA 1D5YA 2C5BA 5KNLA 1UD4A 1W5SA 5ICGA 2LLKA 1EP2B 1SD4A 1WJFA 2VBSA 1FRNA 3QU3A 5JI6A 4RGRA 3DU6A 1OGIA 4LLLA 2CFXA 1EXMA 1ZM4A 1OFDA 2RC6A 4X7DA 3AFHA 3OW7A 4ZCMA 1R1VA 4WZTA 1J0RA 5TGTA 1UZCA 1USTA 1YS6A 2W84A 3H9QA 1VQ9B 3I59B 1HG8A 1X3UA 3ABLH 5IYQA 3ZBUA 4XKBA 3ASTA 3AL0C 2WJVA 4ZYEA 1NB9A 3N90A 3A4CA 4BH9A 3BTLA 4DYCA 4DJAA 3RZOJ 4BACA 1T6SA 3CC2I 1K6YA 4OWRB 4NUBA 3IKTA 4DQKA 4FASD 4I98B 1SFUA 1QVTA 4A3BJ 5FLXZ 4AF6A 1RR7A 4E7HA 1OR7C 3L9FA 1G3WA 3KE2A 2PJRA 1E3HA 2DMUA 4S05A 1WJDA 3AVWA 2GJPA 3OW2B 1V5VA 1TQPA 3FM5A 5D5UB 3BG6A 4QPOA 4B3XA 4BE1A 1FNBA 5M3FJ 4C2LA 2CW8A 2LNBA 3A03A 4BHPA 2K9QA 4XN0A 3ZQGA 3F3XA 1TWCJ 4NHJA 5CDFA 2O6WA 4BGDA 1XFOA 3EYYA 1OFMA 4OM9A 4WXHA 1F43A 1S9HA 2ZXWH 2OV7A 1N0UA 2UVFA 2C5HA 1ZAOA 2RC4A 5D5VB 1R7JA 4P25A 1O3SA 3DEUA 2CW5A 3ZP5A 1UMKA 2QY1A 2EINH 4CYCA 1BW6A 2ELKA 3ECOA 2GPJA 3DKWA 2YSRA 4RA2A 2JA8J 4E6KG 1SAXA 2PN6A 3G3ZA 4ZH4F 1W36D 2VKDA 1J2XA 3TGNA 1JNYA 3CB4A 2D74A 3QPHA 1WTHD 2VYQA 3BR0A 3CC2B 1ZGJA 4L5EA 3T0YA 2BVLA 3HGGA 2CSOA 2DCEA 4BE0A 4JX5A 3OYNA 3HRTA 2V1XA 4GDFA 1GVJA 4KKTA 2NV4A 1BI1A 4HEA2 2DAOA 1BI2A 5H6RA 3WTYC 1XDUA 5HDGA 3FXRA 2ZBUA 4TMTA 3RIQA 1OB5A 3GTQJ 3FY3A 2XAJA 2X51A 2FBKA 2PBIA 3T8TA 2FQ4A 2QTZA 1ZHFA 2DMNA 4XLNF 1D0YA 3LSRA 3ZQLA 5IYWA 3ABKH 4UVCA 2QQ9A 1Z67A 1WZ2A 3BCAA 1IJEA 4RD6A 4Z4RA 4RS8A 1VQLI 1FY7A 2WV0A 3SFIA 2GIVA 2PLYA 2DEUA 4YZAA 1HA8A 2IA2A 2ID6A 3PENA 2P8TA 3CCJB 3PM1A 2AXLA 5A88A 1K8AD 4IRHA 2Q0OA 4N4NB 4I2OA 3AG1H 1Q81D 1ZN2A 2X8KA 3BC9A 2J8KA 1QFYA 2XTWA 4M3GA 4ZYAA 4R79A 1RUNA 4A6DA 5EJCA 2BV3A 4AD9A 1WRJA 4ENKA 2ZITA 3I71A 4B09A 3OYGA 1MABA 4IHSA 1IDYA 3JTGA 1KZLA 2ID3A 1R5BA 2LP0A 1FBQA 3SLDA 4AIDA 4AVZA 1J7KA 4EV0A 4M9XA 2XC7A 4IZZA 2ZZGA 1ETXA 1ETOA 3S3MA 3KEQA 3CDLA 2XZLA 2LVSA 1KA8A 3ZRGA 1COWA 1YX2A 2E2JJ 3CTAA 2CYYA 3PSIA 4YIRX 1W34A 4MYUA 3WGGA 3DEWA 2I8DA 2DYIA 1VQLB 4BHCA 1RPWA 1E1RA 3VB2A 3JREA 5BSYA 1JJ2B 2AHQA 4JMQA 3P7NA 3FKIJ 2EZHA 2QVOA 2HVQA 1QGPA 1LPQA 2FBIA 3U6KA 1T98A 4CO8A 2ELHA 2DOAA 4C3JJ 4OAYA 2V1UA 4X07A 1YW7A 4KDPA 1FTZA 1IDZA 1QA2A 2DPDA 2BZTA 2ZCWA 1V0EA 1VQOI 1P4AA 2DA6A 3LOCA 1H9GA 1S4MA 3OPOA 4Y9RA 3RKXA 4RDKA 3T1BA 5CPRB 4EJVA 2NS8A 1EV7A 4HV6A 5IP6A 3CCVI 1KQ8A 1VQ7B 1NG7A 2KL4A 2K4JA 3ZQ7A 5H6QA 4BDZA 4F91B 2B0RA 4G5GA 2VBUA 3DCFA 5JVGF 3FHZA 3VYSB 5EF6A 3CP8A 4QVAA 1QRYA 1S3JA 2JN6A 1XMAA 1F9NA 1NHCA 3KLOA 2CV0A 5LHGA 2RC5A 3DWLE 4W97A 3LNQA 1VQMI 2E71A 4ZDPA 1E64A 4DNTB 1A31A 1R1TA 1WKMA 3JRGA 1LM1A 4V19K 1KU2A 2B9SA 4Z4UA 3M8JA 1U3EM 2VJ4A 3P9KA 1NRKA 2V9VA 1T39A 4P55A 4ON0A 4TMZA 2BMWA 3LFKA 1IJWC 1SMYF 3GTJJ 1FSEA 1OGJA 1J75A 3BY1A 3RPQA 4U7DA 3GYHX 4KUMA 1YLOA 5KVRA 2JT1A 3FWEA 1WH5A 1Y8RB 1VQKB 1Y1WJ 4D7MA 4PJLA 1T38A 4X7FA 1D0XA 3NEUA 1MGTA 2XKOA 5F6FA 3TOAA 2X0KA 2ZL6A 5K7HA 1A5JA 1P6RA 2Y0SN 1A6IA 2LSOA 4EVIA 3N05A 1FC3A 2VNKA 3CW2A 1VQOB 4ENMA 2XGDA 2ZNYA 2D1HA 1XDSA 3ASOH 3CJRB 3OYHA 3CO7C 3CC7I 1ZUNB 4PGOA 5EEHA 5H5JA 3E1YE 1E3ZA 1KRHA 3F8NA 3B90A 2BF4A 4IL6C 2PECA 3ISPA 2GOXB 2MLKA 4DGWB 1QUFA 4ZCIA 1JT0A 1AWCA 5DD8A 1W35A 2C77A 2GOMA 3I0TA 2XKPA 1ZLJA 1NJID 2HEOA 5D8KB 4DK1A 4ZZLA 4IF4A 2X1DA 4PDKA 5TR9A 3VODA 3K1PA 3F0CA 2NVTJ 3AK5A 1O7LA 2FQ3A 3R0AA 5J4YA 4XM3A 1UHWA 2P5LC 1OJLA 2XDVA 2NNYA 3CJTB 3QP5A 2HTSA 2JWTA 2WR8A 4QFMA 2VFQA 2D3NA 3F6VA 3DTIA 3FM3A 4G6DA 4NBQA 3E6DA 3GFMA 5J4VA 4BBRJ 1SVLA 2CUZA 1KK3A 4U4BA 1QBJA 4Y7CA 2B7EA 4XMYA 1SD7A 3KP5A 1XCVA 4X05A 3KFWX 3C2BA 2JN9A 4OOXA 2DMPA 2RNGA 1JJ6C 1G7RA 1NTCA 4Z1MA 1XSXA 3IV5A 3F21A 4RDJA 2GA1A 2R7FA 3SJZA 3W2AA 3GTOJ 2VASA 2E1NA 1H85A 2KQRA 3VYRB 4QWQA 4AIJA 2M7AA 3NE5B 4Q7JB 2BHZA 2W7ZA 4M4SA 2JMWA 4BQQA 3VO2A 1IN4A 1R00A 2NVYJ 4AIHA 1BHEA 3UW0A 1W0TA 1WP6A 2VODA 1K9MD 2I1LA 1I3AA 1YE9A 3R4KA 2VXZA 3QRFF 2MD5A 1AOYA 1LLWA 1LJ9A 4XRFA 2HGCA 2PG4A 2FBHA 3CUQA 3GMEA 4QVJA 2WAEA 2G7UA 1SFEA 3WTWC 3DTKA 2YWHA 1O8FA 2EIMH 3K4LA 3A0HC 2Y0SA 1ONVA 3C7JA 3WODF 5JR3A 4IW3B 1L0OC 2X3UA 1I6XA 1OISA 5DS0A 3NB2A 1ULYA 1PJ7A 1FPQA 2MGQA 5HXBA 5JBQA 5HLTA 1NBMA 4WCGA 1WJ5A 2ZJPF 2BSAA 1IZ1A 1T33A 2LY2A 2KZGA 4E0FA 1BI3A 1HQCA 5IOZA 1UHSA 5HLIA 4OU0A 1BN8A 4HF0A 2V79A 5AN9A 5F04A 1I18A 2R7QA 4QLCU 5HDKA 3CMEI 5L3CA 3P4GA 5CVUA 2IS1A 2BM4A 2Y2ZA 5FIUA 2MC4A 3I3LA 2KRFA 4UZUA 3HEFA 2MD0A 3F72A 2VLAA 4AC9A 1RMGA 5DM6F 2BY3A 1N8RD 2JQ7A 5E79C 2VOOA 3BH6B 3HSRA 3R0JA 3BR1A 4JYKA 4PAAA 2GA2A 1HOMA 5H59A 1YO5C 3SY2A 2R5YA 3ES9A 1V5GA 4XK4A 1W7PB 1V55H 2P81A 3IP4B 1IDJA 3B78A 3CC4B 2PE3A 5FKMA 3GW2A 1R4MB 2BM5A 3RPUA 4ROXA 3D5SC 4YFNF 1ZELA 4FETA 3ZPPA 3CCQB 4Z4WA 3MN2A 4ZDOA 4XIDA 1JB9A 5B6IA 3TP0A 3KP2A 3V42A 4DYRA 1K79A 4G7ZF 2VXDA 2WYRA 2CC2A 4MIMA 3S2WA 2RDPA 5GAGJ 4PUSA 4XLHA 2M34A 3SUCA 3MVPA 1STZA 4JX4A 1J9IA 2MH9A 4CCKA 4OIPF 2YWEA 3RDIA 3A3GA 3RQIA 2W85A 2VKHA 2EZIA 3B8HA 1U8BA 3CMEB 1XSVA 4FCYA 5E1XA 5IYCJ 2PJPA 1I27A 2R3SA 3QFCA 3T5XA 4XONA 4I7HA 3WTVC 1S5LC 2R7WA 2HS5A 1TYVA 1WJEA 2F5FA 5FLMJ 4KIFA 2FE3A 2HYFA 1SVMA 4LBWA 4TT3A 4IRGA 1W4MA 2DK5A 2GM4A 4DK0A 3CD6I 1W7PA 2I5UA 1S72B 2CF4A 3PSZA 3ZQHA 5BPIA 2QA4B 1R23A 3LJYA 5B66C 2F5VA 4TN1A 3GIRA 2H09A 1K8FA 4KICA 2XF7A 1MMAA 1D8TA 2WAFA 3CCLB 1USSA 4YIIA 1BIBA 4I84A 1DBOA 2DA1A 1UG2A 2EV0A 2BXYA 5BNGA 1GLNA 3TDZC 4M1KA 3RKYA 3OOCA 2XRNA 3KIOA 3WXMA 2L4AA 2DOFA 3BP8A 2XROA 2XVCA 4XQFA 3TH0A 1QH0A 3ERMA 1R9TJ 2J5OA 1ZG5A 4Y3OA 3B6CA 4RD0A 1JUPA 3QWLA 4W8TA 2NXNB 2MC3A 3FMQA 1OQYA 1VI0A 1Y0UA 2G7HA 4HQMA 4F55A 4EJTA 1E63A 2GJKA 4Z4YA 3DPUA 4URRA 3IC7A 1E0EA 2XGJA 1ZKGA 4LIUA 1YTYA 2OQGA 3E3VA 2QSHX 1H9TA 2M8EA 4KISA 2QYOA 2C2WA 1B59A 5HZBA 1TC3C 4OJPA 4WZEA 1OLTA 4V02C 3M1CA 4CICA 3ESWB 2BVNA 5E20A 1FOXA 4HW0A 1JXSA 4RLZA 4EJUA 2FSWA 2ZMEB 3IL2A 1IJFA 3H5RA 4MQ9F 5H2FC 4P26A 1RNLA 3ABTA 5A8AA 2CJJA 1NK3P 1FYKA 2X6WA 2HWVA 1QQIA 3RJPA 3CCRI 4ASNA 3CCJI 2O04A 1MNEA 1X4OA 1HW5A 2M8GX 5FO5A 1P7JA 2OBPA 3TW7A 3CMAI 5ILSA 1ELOA 5IYBJ 3GTLJ 2P7CB 3TL4X 1YJWI 1X1DA 1N08A 4OOSA 4B47A 2ZO4A 4TKOB 4A3KJ 2PQ8A 4P9FA 3GZ5A 3HKZN 1A35A 2ELJA 4P5OA 2OCCH 2HDNB 4M3BA 2IA1A 2XV4S 4X7EA 4RAYA 5EG0A 3BJOA 1O3RA 1WWXA 1D1CA 1IC8A 3MEXA 2L54A 4L9NA 3WGIA 2AS5F 2Q6LA 1IUYA 1TQMA 4AC0A 4OAZA 4W1UA 1JKPC 1EFCA 4RLFA 4YCQA 2NVUB 1N75A 5GTIC 1YITI 5FD6A 1RZ4A 2WPDA 1MSEC 1ZG1A 2CG4A 4JQFA 1K5CA 1Y6IA 3VFZA 3UNGC 4EM2A 2NYXA 4ACBA 5E3OA 2QE7A 1K7AA 3JURA 1G8XA 1K6OA 1VQ6I 3T53B 2HFHA 4CCNA 2QYUA 3I55I 3C1DA 2NRAC 4BBSJ 4HE6A 3BOQA 4M3DA 2A05A 2XHKA 3TO6A 4JP0A 5J8FA 1YX3A 4XLEA 1BJKA 4HE5A 3GFJA 3M9AA 4HZFA 2XIGA 3ULQB 5C3EJ 1ON1A 1RC9A 2RGVA 3DLAA 5BMZA 1AIPA 4G7WA 1E17A 3V7RA 4P2NA 1IUFA 1D5VA 1D1AA 1WOSA 1LDJA 4E7SA 3HRUA 3VSVA 5DD4A 4DQLA 4KIGA 4YHBA 4Y17A 1YIJB 2M9HA 1Z21A 3OSFA 2X4HA 1VQ4B 1MMDA 4Y9UA 2E19A 4XLCA 4EM1A 1DUXC 3LSKA 2KKOA 2X53S 2Z99A 4X8IA 3GQ7A 2Q8KA 3LO8A 3BC8A 2EQRA 1IAWA 3W2HA 4YAWA 3E6MA 3I58A 1BW5A 3OYLA 4KT6A 2V4DA 4B48A 4S0HB 2DFEA 1YJNI 2H8RA 1ON2A 1VBLA 3WHCA 2Y75A 1ZM9A 2XF6A 3OIPA 3K2AA 2G9WA 2VFNA 1OCOH 1FNNA 1WSVA 4UXNA 1BA5A 3JSPA 3KP7A 2DXIA 5DYMA 2YWFA 4LGWA 1FJLA 1B72A 1XMKA 3H9JA 5LHIA 2J8IA 4XL9A 2Q1ZB 2B5OA 1BR2A 2DTZA 5ICFA 4IRIA 3WTTC 1LLZA 3RIRA 1K78B 5TISC 3FHNA 2XNJA 4F3QA 1P4MA 1W2BB 2HXOA 2VJJA 2ZSHB 2UVEA 3B82A 3VSTA 3BTJA 4IPAA 2M2EA 1FNCA 2EV5A 1GHCA 1VTNC 3CLOA 3E6BA 1E43A 3BJ6A 3ZMVA 4HWVA 4FX4A 2OC6A 2MG4A 4MO7A 1R22A 5FO0A 3CLQA 2R7ZJ 2UWMA 2L3DA 4UVAA 4FE7A 1IN6A 3BPVA 1WJCA 2E1MB 3GLXA 4PFOA 2P6TA 3KP6A 4ACAA 4HBLA 2BW3B 3HUGA 3L09A 1ZQ3P 1Z91A 4MHGA 3VSKA 2WY8Q 1OFEA 4HA8A 1Z6TA 2XC1A 2V7FA 4G9YA 5K5RA 3IHUA 1W87A 4ZJZA 1TSPA 1WI9A 2QQ8A 3WTZA 2W1OA 5A2QK 3S3NA 1J9ZA 2R92J 1P7IA 4G6IA 3FK6A 2CK3A 1WH7A 3EUAA 3H5NA 5DDGA 3CUQC 5D4SA 3HXLA 3G71B 2VBXA 3IWZA 1UD2A 2A61A 4YG2F 5FKNA 4DIQA 2E1BA 3BQZA 2INUA 2WADA 2TRTA 4Q47A 4BS9A 3KYLA 4CXFA 2VNHA 3PSFA 4HIZA 3BTIA 1K78A 1G59A 1XB2A 4TSFA 2A6EF 3DU1X 3TQNA 4ETSA 2B7CA 3JRIA 2VOPA 3NRVA 3PNYA 2NPFA 1KQSB 1Q86D 4YDTA 1IA5A 5KAFC 4WX9A 3W2EA 3JRHA 1T0FA 5JHFA 4IHTA 2ETHA 1ZRFA 1IN5A 3V7AA 1O8KA 3LSTA 3ZQFA 3E5UA 3SKBA 1T6YA 3CXCB 1LE8B 3U6BA 3HIFA 3VR6A 3P9CA 3OOUA 1JUMA 1VQ9I 4BE2A 3EETA 2GXBA 2KT0A 1BL0A 5B1BH 2COMA 4OIQF 1Z05A 2LR8A 3CZ6A 2PYGA 1UELB 5BQTA 1VF9A 3EUHA 3IUOA 4XD7A 3PSSA 4LD5A 1U5TC 3ZPLA 1F20A 3ZBTA 3BDDA 2DA4A 2CUEA 4BU2A 3Q3AA 5FB2A 3A01B 2WBMA 4GYIA 3DEEA 1S29A 4N9HA 2RQPA 4HYEA 2DA3A 1Y0RA 3B4NA 1L3LA 3KZYA 4M73A 1TWGJ 2UUZA 2XUBA 4NNJA 4EJWA 1DQUA 4EH1A 1YITB 3KZZA 2V9KA 1QZEA 3BTCA 4AUXA 5D8LB 1BR4A 4EGYA 2GK6A 5F08A 3BCBA 2R7OA 2MSYA 1ZR4A 1CF7A 5M3MJ 1X3WB 1OCTC 2K85A 2VNIA 1I7PA 1QFZA 1LE8A 1KCCA 4LB6B 3FF5A 2K9SA 5DEQA 5K5OA 3R6KA 4MNUA 5B3SH 1N78A 2MFZA 2PMUA 1BC7C 1BPLA 2BV6A 3OEEA 1AA7A 4G1VA 1G3TA 2ZZQA 2L9VA 1CZFA 2WTEA 2Z2SB 3P5JA 3QAHA 4PC6A 4LMYA 1LUJB 3ZUGA 2OTLB 2Z16A 1IW7F 1T95A 2EILH 1IN8A 5C1CA 1QGYA 3BWGA 4L5JA 3WYAA 3JRCA 2FX0A 1MNDA 5D6EA 2P4WA 1KU7A 1JTXA 4HLYA 1IDKA 5FGMA 5KK1A 1H42A 1HKTA 2R6HA 1IRZA 2M1BA 3HGYA 3J7YJ 1N06A 2KVOA 3U2QA 1HDPA 3CCEB 3MHPA 2XGEA 1SFKA 4XLPF 2LKXA 5HVQC 2V4JC 2ZL7A 1BJZA 3GSIA 3VMWA 3BZ6A 3QU6A 5LFAA 2O6GE 2IW5A 3BNWA 3WU0A 2E5NA 4EATA 3HYIA 3GO5A 5CVIA 2LK2A 5E3LA 3SZPA 4BJTA 3A8JA 1TWAJ 2VUMJ 3BR2A 1GAWA 3T9GA 4ZC3A 3LSIA 5IP7J 3BJAA 1RQPA 4A12A 1MBEA 4OMZA 1GJRA 4RPBA 4UUSB 1T5EA 5AIQA 3OS2A 2OK8A 3FKJA 1DARA 2V1NA 2XT4A 5EZGA 4G6QA 1FTTA 4ZGNB 1ZARA 1X1CA 3PNTA 4OMYA 4OPSA 4FHTA 4P3YA 3J7AO 4YALA 4NC7A 2XSJC 4GXOA 4PSXA 3ZMSA 1G4DA 3I59A 2HLDA 1WVRA 3LNNA 4ZYGA 3I64A 4HQEA 1WJAA 2UZKA 3LSMA 2FUG2 4A3IJ 2XEXA 4LBVA 3SQVA 1ZLKA 2QM3A 3SHFA 4I6ZA 3U9GA 4A6EA 3AGPA 2P5KA 3N4MA 1FWZA 1FMWA 5KSWB 2DMTA 3WE2A 1WI3A 4DW6A 4RGSA 2LKPA 2GREA 3OYFA 1ACIA 2P6SA 1MZBA 2EPFA 3E5QA 3NAUA 2Z6BD 2XPUA 3U2RA 2ZNZA 1W1WE 3RQ4A 2GK7A 4P6YA 4UZEA 1PUFB 3EQNA 4Y15A 2CUFA 2OBTA 2LD5A 4CCOA 1JE8A 4XOPA 1J59A 3N97A 1V4RA 4ESFA 2VBKA 3F8FA 1ZGAA 3MKLA 5E1ZB 3ZMUA 3WTSC 3GRHA 2YUHA 2WAQN 2QDXA 1O8DA 3H5AA 2ESHA 4UZFA 2ZTNA 2CNDA 1MKMA 1BX1A 2R7UA 3K1MA 1FLIA 3L2UA 4EW9A 3I4NJ 2TDXA 3G1OA 1QGZA 1M1KD 3GUDA 2O8XA 2DA2A 1OCPA 4F93B 1KGSA 1KQ5A 2WJYA 5HDNA 1KZHA 3KCCA 2EFWA 2F43A 5FFZA 3JQPA 2RREA 4Z4VA 4UY8I 3S1MJ 3K4CA 3UKGA 1ETQA 3BY6A 2O3FA 2VC1A 1BOAA 4FTHA 1H8EA 1WXRA 3GBGA 4RGXA 2ICWG 3DQVC 3OYMA 2FX3A 5FA6A 2Z5UA 1VQ7I 4IEJA 4BXFA 4XICA 2R5ZB 2NVXJ 3KEOA 3UR3C 1PUFA 4XN3A 2GXGA 2STWA 3VOEA 3L2CA 3VYUB 1E79A 2JJ1A 4YAUA 2INVA 1EA0A 3ZMTA 3GFIA 3RZDJ 1NH3A 2D5VA 4BDYA 4M72A 2O8KA 1YJ9I 5DNSA 3ASSA 2OU2A 1TBXA 3S32A 1R6RA 3LSPA 1P92A 3GQAA 2BY1A 5FROA 4G6TB 3J81k 2L7MP 2YS9A 3K0LA 1R71A 2V7XA 2JPBA 1VZ0A 5J35A 1GXPA 1O8MA 4UV9A 3QYEA 3L2RA 4Q5SF 1MJAA 2L7ZA 4M9SA 2XASA 3PNVA 2QQAA 2FJ1A 5LEJA 5JLWA 1RUOA 1VQKI 4RPDA 1KK0A 2EB7A 1REPC 3NARA 3WNDA 5CJ9A 4XRMA 3OYAA 3ECHA 1KJZA 2PFBA 4YAFA 3AKZA 2BGIA 2DCUA 1B9MA 2CMPA 2XNCA 2EA2A 2A5WA 5FNZA 2OYNA 2O7OA 2Z33A 3JSOA 2BOLA 3HOZJ 4MQVA 1Z3YA 2LMDA 2LRDA 2UXXA 3PFIA 5J3LA 3OY9A 2HPMA 6PAXA 3HPHA 3TMOA 3G1MA 4HAMA 2BM7A 2WAQA 4G7XA 2AQFA 2L9RA 1AMOA 1HA3A 1DBGA 4NC8A 4A5MA 2E2HJ 4B1RA 3ONYA 4CCLA 1O8GA 2OF7A 1R5NA 2I10A 4H9GA 4P1VA 1P4XA 4BUPA 3WTUC 2X6YA 3LA7A 1YJ9B 3ZQQA 3P26A 5FLVA 2EWNA 3FX3A 3VYTB 2WY7Q 1JJ8C 3PQKA 3SDGA 1Q1HA 2UV1A 5F0HA 4QTRA 2NAZA 2XZPA 5ILUA 5JVTA 1FX7A 4Z4SA 2BSPA 3C3WA 2CFOA 3FKSA 1JHFA 3M8EA 2L2OA 2HDDA 3PIOF 1SAUA 5LBQA 1DG1G 4M53A 3H3VK 4PGGA 4ASUA 5E3MA 1JRGA 2QKMB 2QEXI 3D26A 1D0ZA 3T51B 3RCOA 4OIOF 4U9UA 5J6XA 2K3PA 5DV5A 3I56I 4B4DA 3WY9A 5CKTA 2CQNA 1XGNA 4P9UA 3OV8A 2CBXA 1MBGA 1V5FA 2DFFA 4JOMA 1EH8A 4L18B 4OJOA 4RAFA 3PO2J 3CESA 3ZMZA 3RYPA 2DN0A 3CDHA 4U7BA 4BQAA 2WV1A 3HOWJ 2HYGD 1QHGA 2JA6J 2WZNA 2PEXA 2PMDA 3L2QA 1WMRA 5ICEA 4KKSA 5GAEJ 1RI7A 3HRSA 5J8CA 5LD2C 2IS4A 4D5FA 3BR3A 3M8FA 4B3GA 5D6FA 4KITB 3HDDA 1MJBA 3LQEA 4HF2A 4XKVA 2MBFA 5D5XB 2FEZA 4WZLA 3JCUC 2HVRA 1YFHA 1TYXA 1TNSA 3M3YJ 3S2HJ 1MH4A 1ZK8A 4FE4A 4GCVA 2JA7J 2O61A 1RRJA 1FOYA 3W5VA 1MBFA 3K4NA 2CGPA 3DP7A 5L3DA 3ZMDA 1X2NA 2IRFG 4XNFA 1ODDA 1WGXA 5GV7A 2ZJQF 5M5XJ 3WU1B 3OR2C 5J1UA 2NTBA 4I0AA 3SZEA 2VB6A 4PGHA 4UAJA 3R6JA 1HKSA 3LWFA 2QGGA 1KYZA 3QOPA 2R4GA 3BG5A 4GO1A 4D7NA 4RB0A 4MEXF 1QPMA 3ROUA 4XKWA 2YX4A 2QEXB 5E8GA 1K4TA 3JU4A 2M0CA 3DV8A 4QUZA
chains in the Genus database with same CATH topology
4KISA 2MYSA 4C30A 2ZZEA 1P9QC 1OLTA 3PJRA 3M1CA 1O8LA 3LMWA 1MW7A 2JVGA 3OE7A 3OAAA 3H5RA 2XNDA 4RMNA 3QOEA 2A6TA 4CCJA 1N77A 4Z06A 4H4KC 2LY1A 3ZR8X 2L5QA 4PMHA 2X6WA 1W0KA 2OUMA 1X0CA 2O04A 4MR0A 1MNEA 1X4OA 2IGKA 4E7ZA 1D1BA 2K9MA 3CF2A 2VBEA 5KCMA 2XF5A 3TL4X 4AYBA 1X1DA 5AMVA 1X1AA 4B47A 4TKOB 1KTWA 2JJ2A 3W2VA 4DOZA 2R7VA 2KMUA 1EFRA 2ELJA 1BOBA 4P5OA 2V6EA 1BLIA 1KMHA 3WQZA 1GQ8A 3J7AY 1LKXA 3MKWB 3A2KA 3T56B 2DT7B 2XOKA 2AQEA 2IGNA 1Y56A 1U0JA 4HSTA 3ZGKA 1D1CA 4MLOA 1TZLA 5KHDA 4XLAA 3OL4A 2Z1DA 4OAZA 1EE6A 2LBFB 2IXSA 4RLFA 3KRGA 2W7NA 2CH0A 1N75A 2WPDA 1DP3A 4P22A 2ZTGA 2O0WA 1WJBA 4ANJA 2Q2EB 4JQFA 1K5CA 1Y6IA 2QKLB 3UNGC 1OFLA 4PJJA 4OJ5A 3JURA 2QE7A 5C1EA 1G8XA 3C2GA 3IAS2 4IQJA 4HG2A 3T53B 3ZPNA 4CCNA 3WWGA 3SDBA 4CA0A 4PJMA 3HAGA 2W00A 4HSRA 1FMVA 1O8IA 3ZCOA 1OGMX 4N4OB 5KNLA 1UD4A 1WJFA 2IQ7A 1YX3A 4XLEA 3LFUA 3A35A 2QX3A 2M7BA 4DBQA 3DU6A 4YXWA 4RLQA 3PUBA 1V5EA 3AFHA 3DLAA 3OW7A 4G7WA 2NSTA 1D1AA 5TGTA 1HG8A 3H9QA 4E7SA 1Z7LA 3EPZA 3NWSA 2HU9A 2XAUA 3BG7A 3VSVA 4C9YA 3DPTA 3OYKA 2K5CA 4LG3A 4XKBA 1Z21A 1E3XA 3AL0C 1UD3A 1MMDA 2WJVA 4XLCA 3LSKA 2VL8A 4XR6A 4OJLA 2X53S 4DNRB 3GQ7A 3A4CA 3W3CA 3BC8A 3DPLC 4DJAA 3G2BA 4BACA 3OYLA 2LBFA 4KT6A 1K6YA 4B48A 2V4DA 2WZPP 4OWRB 4NUBA 3ZSCA 4FASD 1VBLA 4HPQA 2XF6A 3K4KA 3OIPA 4E7HA 4E7IA 1OR7C 3LSHA 2PJRA 3AL0B 5HNHA 2DXIA 1WJDA 2W6IA 3DTEA 2HZDA 3H9JA 1T0FC 4F52A 2GJPA 3A3BA 4XL9A 2Q1ZB 3OMYA 1O8HA 1BR2A 3D5RC 3RTRA 2E1MC 3BG6A 4QPOA 4B3XA 4BE1A 4C2LA 2HPIA 2CW8A 3FHNA 4F3QA 2UVEA 2VJJA 2ZSHB 4XN0A 3SYTA 3VSTA 3KEYA 5CDFA 2P0WA 4HWVA 1E43A 4BGDA 1IRXA 2F6CA 1OFMA 2OC6A 4C2TA 2XZOA 3ZIAA 4LIVA 1S9HA 3K70C 2OV7A 2UVFA 1DGWY 2UWMA 2NSPA 3OYBA 1WJCA 2E1MB 2LG4A 2DT6A 3QYBA 4U87A 4PFOA 2PYHA 2CV2A 3EUHC 1Z3XA 1TT0A 2BW3B 2QY1A 1W36C 3VSKA 2WY8Q 3DU5A 2V7FA 2Z8GA 4DBRA 3GQ9A 2BVMA 1O88A 4II2A 5CQGA 4E6KG 4ZJZA 4YELA 1W36D 2VKDA 2W1OA 3S3NA 2R7TA 4G6IA 3IAM2 1RWRA 3K4BA 3ZXSA 2JVHA 2CK3A 3EUAA 3H5NA 1WTHD 3HXLA 5CQEA 1UD2A 1UD8A 4DIQA 2BVLA 1PLUA 2CW7A 2DCEA 4BE0A 3OYNA 2E1BA 2O0VA 4Z05A 4KKTA 2ZSIB 4XLFA 3SEZA 2INUA 2WADA 4HEA2 4BS9A 3KYLA 3PSFA 4B43A 4L8JA 4HIZA 2X85A 3MKZA 1G59A 1QU3A 4TSFA 3FY3A 2V26A 3LSGA 2X51A 2VJIA 1D0YA 3PNYA 1IA5A 3OYDA 5JHFA 2L9SA 3BCAA 2VPLA 3KEWA 2ODLA 1O8KA 2MABA 4OJ6A 4YZAA 1HA8A 3BLYA 5FRMA 3W2WA 2JA2A 3VR6A 4N4NB 1AIRA 3OOUA 2M0MA 3BC9A 2X8KA 2O17A 4BE2A 2VJ5A 4ZYAA 4R79A 3PL8A 2LZJA 1ERDA 3OYEA 3CZ6A 2PYGA 1UELB 2O1DA 3IUOA 4XD7A 3SEQA 4OZZA 3OYGA 1MABA 4Y33A 4BU2A 4U49A 1X4PA 3NWTA 4HRIA 3K10A 2WBMA 1KZLA 3DEEA 2IGOA 4AVZA 2W82A 4BEHB 4HNTA 3B4NA 3H35A 4II3A 1BMFA 1DGRM 3QYFA 2UUZA 1BR1A 2JIZA 4NNJA 1DQUA 3MKYB 3RPUD 3OFNA 2V9KA 4W8RA 2XC7A 1BR4A 4IZZA 2ZZGA 3S3MA 2GK6A 2XZLA 3BCBA 2GJRA 2R7OA 1H8HA 1H80A 3ZRGA 1COWA 4MXNA 3FBIB 4ZDLA 3GVKA 3PFYA 4NQWB 3PSIA 3DKYA 1KCCA 2QXZA 3VMVA 2I8DA 1EA3A 2KDOA 3C2HA 1E1RA 1VF7A 1N78A 2MFZA 1BPLA 1WPCA 3OEEA 1AA7A 2KP6A 2ZZQA 4JMQA 1CZFA 2Z2SB 2VQLA 3FDYA 3RSNA 4GQNA 2DJIA 2HVQA 2Z16A 1T95A 3E0JB 1K28D 5C1CA 3SZGA 1MNDA 2DOAA 4OAYA 2DIEA 4YZXA 3QODA 2KRCA 3LL7A 4E7JA 1V0EA 4E7KA 1IDKA 4AU7A 1MMGA 2CUJA 1O8JA 3I9V2 3OPOA 1O8EA 2KVOA 5CPRB 1SFKA 4BEHA 2NTQA 1NG7A 5HVQC 1YX5A 2KL4A 2V4JC 4BJ5C 3G05A 4BDZA 4F91B 3VMWA 5LFAA 3A1YA 1OHHA 2X1EA 4P1WA 3VYSB 2E5NA 3CP8A 4EATA 3HOSA 1PE9A 1NHCA 1LDKB 4BJTA 2CV0A 5FRNA 3DWLE 3T9GA 4ZC3A 1E1QA 4ZDPA 3LSIA 4ZTJA 4DNTB 4QPQA 4HNUA 2JDIA 3OYIA 1X19A 3L2VA 3ONQA 5HKKA 2R7RA 1T5EA 3M8JA 2VJ4A 2IS6A 3BH4A 1NRKA 3OS2A 2E60A 3VSLA 3FKJA 2V1NA 5IK2A 2WB1A 2JSPA 4FXUA 1X1CA 3PNTA 4E4HA 4NC7A 2XSJC 4PSXA 4D9JA 2M4GA 4PJLA 2HLDA 3HG9A 3LNNA 4W8QA 4PSWA 2IGMA 1WJAA 2KPMA 3CMMA 3LSMA 3MMYB 1X1BA 2FUG2 2ZFUA 2F1MA 1D0XA 1WFXA 3CP2A 2KZVA 4IKFA 1UD5A 1W9XA 3N05A 1FMWA 2NT6A 3OS0A 2KLOA 1MMNA 4YZQA 4BL0B 3CJRB 3OYHA 3VDXA 3OYFA 1E3ZA 3B90A 3HC7A 3CJQB 4GRIA 3L2WA 2PECA 1HVXA 2GOXB 4DGWB 3H9GA 1OB0A 2Z6BD 3RQ4A 2GK7A 3F9KA 2GOMA 3D5LA 3FBNB 3EQNA 2LC2A 4DK1A 1IB4A 2JUGA 4CCOA 4XOPA 2X1DA 2X3HA 2EWEA 2VBKA 4B44A 3EQOA 3TBIA 1PJRA 2WSSA 3GRHA 3E1SA 2HVSA 2LREA 4NK6A 1O8DA 3GQ8A 3H5AA 4XM3A 2XDVA 2ZTNA 3H0DA 4F92B 2R7UA 4LITA 2D3NA 3L2UA 4EW9A 3DTIA 2R7SA 1KONA 2BW3A 4U4BA 2CUZA 4XMYA 4F93B 4IX7A 4J00A 2WJYA 4OZYA 4CUGA 1XG2A 2CS3A 2RNGA 4KJZA 2F43A 4Z1MA 4W8SA 3MD2A 2RREA 2HQAA 1V0FA 3W2AA 2VASA 2HNHA 3K4CA 2KQRA 3VYRB 1H8EA 3FPPA 2M7AA 3GBGA 3NE5B 3U21A 3DQVC 1NG6A 3OYMA 2R7XA 1VLYA 1QHHD 4BQQA 5DN6A 4BXFA 3UW0A 2L7KA 3UR3C 1BHEA 4XN3A 1WP6A 1LVKA 1YE9A 3VYUB 1E79A 2IS2A 2VXZA 2JJ1A 2INVA 4XKCA 1PKVA 2O5RA 4BDYA 3S93A 3S32A 2WAEA 1R6RA 2X6XA 4BQNA 3HOTA 4E7LA 3GQAA 3DTKA 5FROA 2WA0A 1SKYB 4G6TB 1O8FA 4Z03A 1HZEA 2NZMA 3K4LA 1VZ0A 1O8MA 2Y0SA 4RM3A 3OYJA 3QYEA 3L2RA 1PXZA 4PFPA 5HLTA 1J09A 1NBMA 1WJ5A 3PNVA 2LY2A 4E0FA 1JTAA 3K4JA 3OYAA 1BN8A 2NTPA 4B3FX 3AKZA 4RM2A 2CMPA 1UAAA 2R7QA 4PK4A 2CV1A 1I18A 2A5WA 3S3OA 2IS1A 2MC4A 3I3LA 3BCDA 2PJRB 3H94A 4UZUA 2BOLA 1Z3YA 2LYCA 1PYVA 2MD0A 2LRDA 2HPMA 3OY9A 2VLAA 3HPHA 3TMOA 1RMGA 2WAQA 4G7XA 3K6GA 2LH9A 2AQFA 4ITVA 2ZXHA 1LFPA 4D1QA 1DBGA 4YZ0A 5HNFA 4NC8A 1V5GA 3DKXA 2ZZFA 1OGOX 2VQHA 3OYCA 3IP4B 4PJNA 4CCLA 3BCFA 3OEHA 1IDJA 1O8GA 5HOOA 1JI8A 4J01A 2HDWA 1RU4A 4BUPA 1I8DA 2X6YA 3ZQQA 3D5SC 2V7QA 1ZELA 1VJSA 4FETA 3ZPPA 3VYTB 2WY7Q 3EUKL 2LOOA 4YEJA 2UV1A 3HUGB 2XZPA 4ZDOA 3OWTA 3OIQA 2BSPA 2KRHA 3V42A 2CFOA 4CZCA 2D3LA 4BQOA 3DDYA 3FKSA 2VXDA 2NOJB 3GVLA 2L2OA 3S8PA 4YRVA 3GQBA 2K9LA 1SAUA 4C2UA 4XORA 4PUSA 3VWBA 4XLHA 1QJVA 2NT9A 3SUCA 4ZTFA 4ASUA 1OOCA 4CCKA 1JRGA 2QKMB 3OR1C 2VQGA 1D0ZA 4IQ4A 3A3GA 3RCOA 3T51B 2K3PA 4CCMA 2VKHA 5CKTA 3HPGA 4OJOA 2X1CA 1V5FA 3KX2A 4JOMA 2M5SA 1KCDA 4XONA 3CESA 2R7WA 4CSWA 1UD6A 1WJEA 2RQQA 4U7BA 4TT3A 5FL7A 1QHGA 3HKZA 2M3AA 3L2QA 4DK0A 1WMRA 4KKSA 1UG0A 4BJ6C 5LD2C 2IS4A 3VSUA 2KHMA 3GVJA 4X0GA 4B3GA 2V31A 4KITB 2F5VA 2L9NA 4XKVA 4Y4RA 2XF7A 4KKUA 1MMAA 2WAFA 2HVRA 4I84A 2VIXA 1DBOA 3K70D 1GLNA 2E5ZA 3OL3A 3OOCA 1QCXA 2PMZA 3K4NA 2M4KA 2R9VA 4NK8A 3B8YA 4XNFA 4XQFA 2VBMA 2W6JA 2ZXIA 3OR2C 4Y3OA 2NTBA 4CH7A 2VB6A 4W8TA 1FX0A 3OS1A 4F55A 1W0JA 2W4SA 3HL2A 2GJKA 2F4IA 3LMMA 2R4GA 3DPUA 3K4MA 4XOTA 1E0EA 2XGJA 4URRA 4LIUA 4XKWA 3JU4A 2VQCA 4OJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVF A;  1O8M A;  2NSP A;  2NTQ A;  2PYH A;  3VMW A;  1O8L A;  3LMW A;  1PXZ A;  2QY1 A;  1PE9 A;  1NHC A;  2Z8G A;  3GQ9 A;  1JTA A;  1O88 A;  4Z06 A;  3T9G A;  1BN8 A;  2NTP A;  4YEL A;  4PMH A;  2X6W A;  1X0C A;  1RWR A;  2O04 A;  4MR0 A;  2O0V A;  1PLU A;  4Z05 A;  2VBE A;  4XLF A;  2INU A;  1RMG A;  5AMV A;  1KTW A;  2X85 A;  4W8Q A;  1DBG A;  3FY3 A;  4YZ0 A;  2VJI A;  1GQ8 A;  1OGO X;  1IA5 A;  1IDJ A;  1O8G A;  1RU4 A;  2X6Y A;  2ODL A;  4XLA A;  2NT6 A;  1O8K A;  4YZA A;  4OJ6 A;  4YZQ A;  1EE6 A;  3KRG A;  3ZPP A;  4YEJ A;  2O0W A;  3B90 A;  1K5C A;  1AIR A;  2BSP A;  1OFL A;  2PEC A;  4OJ5 A;  3JUR A;  5C1E A;  2O17 A;  3WWG A;  4XOR A;  3EQN A;  4XLH A;  1QJV A;  2NT9 A;  3SUC A;  1OOC A;  1O8I A;  1OGM X;  2O1D A;  2PYG A;  1JRG A;  4XOP A;  1IB4 A;  2X3H A;  2EWE A;  4OZZ A;  2VBK A;  3EQO A;  2IQ7 A;  4XLE A;  3GRH A;  2QX3 A;  4U49 A;  4OJO A;  4NK6 A;  1O8D A;  3GQ8 A;  4XM3 A;  1KCD A;  4XON A;  2NST A;  1HG8 A;  3VSV A;  4AVZ A;  3B4N A;  4EW9 A;  1WMR A;  4U4B A;  3VSU A;  4XLC A;  4W8R A;  4XMY A;  4XR6 A;  4OJL A;  4OZY A;  3GQ7 A;  1XG2 A;  4XKV A;  1H80 A;  4MXN A;  3ZSC A;  1KCC A;  4I84 A;  1VBL A;  2QXZ A;  1DBO A;  3VMV A;  4W8S A;  1QCX A;  1CZF A;  4NK8 A;  1BHE A;  3UW0 A;  4XN3 A;  3B8Y A;  4XNF A;  4XL9 A;  4XQF A;  1O8H A;  5C1C A;  2INV A;  2VBM A;  2NTB A;  4W8T A;  4YZX A;  4C2L A;  2UVE A;  4XN0 A;  2VJJ A;  3VST A;  1IDK A;  2X6X A;  4HWV A;  1O8J A;  4XOT A;  4URR A;  3GQA A;  1OFM A;  4XKW A;  1O8F A;  4Z03 A;  1O8E A;  2NZM A;  4OJP A; 
#chains in the Genus database with same CATH topology
 5K7Z A;  2MYS A;  1ZRE A;  3I56 B;  4C30 A;  4BNC A;  1P9Q C;  4RBO A;  3I4P A;  1QVF B;  2ESN A;  1VLO A;  1O8L A;  3LMW A;  3H3Z A;  4NC6 A;  1PUE E;  3CCS B;  2JVG A;  5A2Q Z;  2EZL A;  2F4O B;  1S6L A;  2Z3Y A;  3X2Q H;  1T6Z A;  1VQN B;  4RMN A;  4N0B A;  3QOE A;  3MQ0 A;  4CCJ A;  4XRS G;  1N77 A;  1GAQ A;  1DU0 A;  2JRM A;  4UNO A;  4H4K C;  2LY1 A;  3ZR8 X;  2MA3 A;  4PMH A;  1VFC A;  1W0K A;  2OUM A;  1R5I D;  4NDL A;  1B23 P;  3S1R J;  3CC4 I;  1K73 D;  5EGO B;  2EV6 A;  1FT9 A;  5C4J J;  2QN6 A;  5CVJ A;  2K9M A;  2ACJ A;  2GZW A;  2XF5 A;  2ZKZ A;  2K4B A;  3CCQ I;  1X1A A;  3F8M A;  1JT6 A;  3DLL F;  1OB2 A;  3W2V A;  1CNF A;  2QSG X;  1TYU A;  3IRR A;  2KMU A;  1EFR A;  2V6E A;  4AIK A;  2KIQ A;  3T56 B;  1LKX A;  1TLH B;  3MKW B;  2XT2 A;  2A6H F;  3QFS A;  2KIS A;  2DT7 B;  4PZJ A;  2XOK A;  2AQE A;  3DBL B;  1Y56 A;  1U0J A;  4HST A;  2A07 F;  4MLO A;  4J0Q A;  1TZL A;  2DMQ A;  3TOB A;  5DS9 A;  2QLZ A;  4RDU A;  5KHD A;  4XLA A;  1GVH A;  2Z1D A;  4RM0 A;  1EE6 A;  2IVM A;  2ECC A;  2K02 A;  2W7N A;  3A8I A;  2ZTG A;  3PA1 A;  1WJB A;  2VC0 A;  3B02 A;  2Q2E B;  5DUI A;  2QKL B;  3GXO A;  3CCM B;  1OFL A;  5DCM B;  5LGN A;  4OJ5 A;  1W5C C;  3C2G A;  4IQJ A;  3ZPN A;  1S8N A;  1YJN B;  3SDB A;  1S72 I;  2ZL5 A;  1O57 A;  3HAG A;  5L46 A;  1O8I A;  1FMV A;  5HLG A;  1OGM X;  4N4O B;  1POG A;  2QA4 I;  1VQ8 I;  5EGO A;  3ASN H;  3BQY A;  5TRD A;  3ZQI A;  3SJP A;  3WG7 H;  4CHU A;  1YG2 A;  3LFU A;  2QX3 A;  1BI0 A;  2QUF A;  4DBQ A;  1R5H A;  3VNV A;  1IB0 A;  3QPL A;  3CCL I;  1G2H A;  4HLX A;  5IYP A;  3GTP J;  2NST A;  2LY9 A;  4HOB A;  2DER A;  5E3N A;  1QRB A;  4A3C J;  1Z7L A;  3EPZ A;  1ORK A;  2HU9 A;  3BG7 A;  4WF2 A;  3TDU C;  5EEA A;  2NVQ J;  3OYK A;  4LG3 A;  1OPC A;  4Q4Z F;  2B7B A;  3JQR A;  2ZBV A;  2E36 A;  1ZM3 A;  1FOK A;  1YW9 A;  1Z1D A;  4XR6 A;  4A0Y A;  5EMN A;  2V6C A;  3CUO A;  1TUI A;  3ZZ0 A;  3DPL C;  4LG0 B;  2L4M A;  2VFO A;  2E2I J;  1XC5 A;  2WZP P;  2Y9Y A;  3HTU A;  3ZSC A;  2F3L A;  3PUF A;  4I99 C;  4HPQ A;  1MDM B;  4PAB A;  1Y8Q B;  3K4K A;  3AL0 B;  4ESJ A;  3KP3 A;  3CCU I;  2PMH A;  4F7D A;  5HNH A;  1H0M A;  2W6I A;  5IT9 K;  3V8L A;  1B9N A;  2P5V A;  2HZD A;  4LJZ F;  4F52 A;  3GEZ A;  3T8R A;  4RB3 C;  3A3B A;  1O8H A;  4MTD A;  3F6O A;  1FOW A;  3D5R C;  5HLH A;  3RTR A;  3WU2 C;  3FPK A;  1B4A A;  1BQE A;  2F4M B;  1HXD A;  2VT2 A;  4FIS A;  3VMF A;  1G7T A;  3CPW B;  3PUM A;  3SYT A;  2RKH A;  3KEY A;  2OTJ B;  1B2R A;  2P0W A;  4EEF G;  1E3O C;  2Y0M A;  3RY8 A;  2COB A;  2F6C A;  1H88 C;  4C2T A;  3ZIA A;  1VQ8 B;  2QMU A;  1DGW Y;  3QP6 A;  2MLG A;  2RV8 A;  2LG4 A;  3QYB A;  2DT6 A;  2CV2 A;  1Z3X A;  1TT0 A;  2YWG A;  1W36 C;  2RAE A;  3RI4 A;  4EQQ A;  4YAO A;  5B5E C;  1QO0 D;  2H27 A;  2RN7 A;  4DBR A;  2Z8G A;  2BVM A;  4II2 A;  5CQG A;  1OKR A;  4A3D J;  4DYQ A;  4DZP A;  2E7X A;  5F4M A;  4MGR A;  4YEL A;  3VNU A;  1X58 A;  2R7T A;  3JRF A;  3LVB A;  2LKS A;  4YEI A;  2BGJ A;  3K4B A;  1MDM A;  5J3O A;  3ZXS A;  1RWR A;  2VN2 A;  5CQE A;  4C3I J;  4D5C A;  1VQ5 B;  3OP1 A;  1X1P A;  1G3S A;  4P96 A;  2O0V A;  1DPR A;  4XLF A;  2DFI A;  3CCU B;  2A69 F;  4HX8 A;  4J19 A;  2X85 A;  5DM7 F;  1QU3 A;  5J1Y A;  3GLL A;  3IWF A;  1X3Z B;  1KD1 D;  2CO5 A;  3LSG A;  1IN7 A;  4XSX F;  9ANT A;  2OZ6 A;  1RES A;  1J5Y A;  3OYD A;  1KK1 A;  2RVC A;  2L9S A;  2ZFW A;  3Q5F A;  2F1L A;  2VPL A;  2HQ5 A;  1TYW A;  1MSF C;  2FML A;  2ZXJ A;  4KNY A;  2VI6 A;  3JRD A;  2OAZ A;  1IXC A;  1T2K A;  2GLO A;  3FZV A;  1M1E B;  5BS6 A;  3BZK A;  1IO2 A;  2JA2 A;  1MMS A;  3SYJ A;  5DUK A;  1XSD A;  3KP4 A;  3PL8 A;  1YIJ I;  1K61 A;  2LZJ A;  3E6C C;  3VO1 A;  1VQ4 I;  1Q82 D;  3OYE A;  2EIJ H;  2O1D A;  5KW9 A;  1VQP B;  3SEQ A;  2WB1 N;  3R6S A;  4Y33 A;  1X4P A;  4ENN A;  4HRI A;  3JRA A;  3K10 A;  1EZG A;  3ZN1 A;  4C43 A;  1F36 A;  3BT9 A;  1F1Z A;  4RAG A;  4YFX F;  3MZH A;  4HNT A;  4TMV A;  4X7C A;  4A5N A;  4BHB A;  2CWE A;  3H35 A;  1BMF A;  2JIZ A;  1GV2 A;  3W2I A;  2Y31 A;  4W8R A;  4B3A A;  5D5W B;  3O8H A;  2ZME A;  3MZ8 A;  3ERE D;  2E35 A;  2HKX A;  3HZJ A;  1B8I B;  1H8H A;  1CNE A;  4OIR F;  3WTX C;  1Y39 A;  1O3Q A;  1H80 A;  1T56 A;  1SFO J;  4ZDL A;  3GVK A;  4I76 A;  4NQW B;  3DKY A;  5E18 F;  2QXZ A;  2KJC A;  3VMV A;  2KDO A;  1EA3 A;  4QIW N;  3CO6 C;  1VF7 A;  4FQG A;  1Q7Y D;  1WPC A;  3TP3 A;  3RSN A;  4GQN A;  4CYD A;  4A3J J;  2VT3 A;  1K28 D;  1FDR A;  2HOE A;  3FMS A;  3HSF A;  1WSR A;  2DIE A;  4YZX A;  3QOD A;  2KRC A;  4FT8 A;  2BHY A;  5CYV A;  1XQB A;  2HDC A;  1D8J A;  1E62 A;  4E7J A;  3FMR A;  4U0Y A;  1MMG A;  1MIJ A;  2CUJ A;  1HCR A;  4M6Y A;  4MTE A;  3AVV A;  3R60 A;  5FJ8 J;  1F5T A;  3QE2 A;  1U9N A;  1YIO A;  3G71 I;  4TMX A;  2BM0 A;  5IY5 H;  1YX5 A;  1D1N A;  5K7F A;  4IO9 F;  2NS0 A;  4DNC A;  1SD6 A;  2V1D A;  1EH6 A;  2EK5 A;  4MFE A;  1OHH A;  3M4O J;  2X1E A;  3AVY A;  1UCR A;  3HOS A;  1LDK B;  1CQX A;  1WU8 A;  3LAP A;  2FRH A;  3EYI A;  2XSD C;  2OA4 A;  5HKK A;  4QPQ A;  4HNU A;  2K3F A;  4NQW A;  3PQJ A;  3L2V A;  3ONQ A;  1RKT A;  2DOG A;  1NDH A;  3WBK A;  3BH4 A;  2V9P A;  4RD1 A;  1JTY A;  3VSL A;  4UUT A;  1UHM A;  2WB1 A;  2JSP A;  1TQI A;  3BG9 A;  2JZY A;  1QG0 A;  2M4G A;  4RCZ A;  4PSW A;  3LQQ A;  3OJW A;  3W2G A;  3FXQ A;  3AVU A;  3CMM A;  4N3N A;  2F1M A;  4Z05 A;  2EZK A;  5GV8 A;  1PVE A;  2ISZ A;  2Y30 A;  4IKF A;  1W9X A;  1YW8 A;  4EJO A;  1HSJ A;  5CVV A;  3OS0 A;  3TO7 A;  1K4Z A;  3A8K A;  1YHQ B;  4YZQ A;  3G6E B;  2XB5 A;  4LC0 A;  5E6T A;  2HCJ B;  1KC8 D;  1YRN B;  1FP1 D;  3VDX A;  3JQQ A;  1SMT A;  1YS7 A;  2X9D A;  3D1N I;  1GUU A;  3HC7 A;  3CJQ B;  4ESB A;  1DDN A;  4GRI A;  3L2W A;  1HVX A;  3H9G A;  3HHH A;  3MWM A;  4RB2 C;  1HW2 A;  4LLN A;  5DSZ A;  3JR9 A;  5HS7 A;  3FBN B;  4P12 A;  2LC2 A;  5E8I A;  1KU3 A;  4RD3 A;  4Z6Y A;  4C0S A;  2XPW A;  2X3H A;  3JW4 A;  1MJ9 A;  4B44 A;  2STT A;  1PP8 F;  2WSS A;  2X6O A;  1S7A A;  3H3U A;  2HMA A;  3PVD A;  4UUV A;  3CRZ A;  4OPV A;  2WWY A;  1QZY A;  2O0Y A;  2RNJ A;  4WWV A;  1QRC A;  3H0D A;  4F92 B;  1TP4 A;  4LIT A;  2BBY A;  4KIB A;  1KK2 A;  2OTL I;  1KON A;  2BW3 A;  2F5C A;  2O9L A;  1Z7U A;  1KU9 A;  4CGZ A;  4RCY A;  2A68 F;  2D2W A;  4J00 A;  4OZY A;  1XG2 A;  2CS3 A;  3O6B B;  4KJZ A;  5E1W A;  3G1L A;  1MRZ A;  3MD2 A;  2BPO A;  3HOV J;  1O7F A;  5HOD A;  2HQA A;  4ENJ A;  1V0F A;  2E1R A;  1YRN A;  1HF2 A;  3CQZ J;  2DT5 A;  1EH7 A;  2VKV A;  1QA1 A;  4M0L A;  5J47 A;  1LQ1 A;  2F4N A;  4I02 A;  1WOO A;  3CCE I;  1A8P A;  3DXJ F;  2R7X A;  2H1L A;  1QHH D;  1VLY A;  2LFB A;  2L7K A;  5LMZ A;  4A3F J;  2IS2 A;  2JA5 J;  3IH3 A;  4XKC A;  1PKV A;  2O5R A;  1DDI A;  4EGZ A;  2BYV E;  1W0U A;  1PDN C;  3S93 A;  1SFX A;  3FXM A;  5K5Q A;  2EIX A;  4P6V F;  4M6V A;  2X6X A;  2HOA A;  4BQN A;  5K1Y A;  3HOT A;  2A5Y B;  2DA5 A;  5LLQ A;  2YPR A;  1HZE A;  3QPT A;  2NZM A;  2FMY A;  2JRT A;  5GAH J;  2YU3 A;  1IXR C;  1WOP A;  4BYY A;  3ASR A;  2F48 A;  4PC2 A;  3ELK A;  1PXZ A;  4PFP A;  1J09 A;  2Y69 H;  2M45 A;  4HX4 A;  2L0K A;  3HOY J;  5L3E A;  4YFO A;  1H89 C;  2VPR A;  2VE8 A;  1QA6 A;  3K4J A;  3HOU J;  4B3F X;  5LGT A;  1HDD C;  4Z4Z A;  1UAA A;  5B1A H;  4PK4 A;  3NQO A;  2CV1 A;  2OZU A;  3HTS B;  2YUS A;  2HI3 A;  2JTV A;  2K27 A;  3BQJ A;  3H94 A;  1MH3 A;  1XX5 A;  3OOP A;  2PJR B;  1K83 J;  4FX0 A;  3G4S B;  4ZV4 A;  3ASQ A;  3SJM A;  3A01 A;  1OFC X;  1RET A;  2F5E A;  3KZI C;  2J5P A;  2EBI A;  3C18 A;  1U2W A;  2LH9 A;  3K6G A;  3GTK J;  3J80 K;  1YQA A;  4D1Q A;  4OP7 A;  2EA4 A;  3JRB A;  1ITY A;  5HNF A;  4IHV A;  1LB2 A;  1U2R A;  5AON A;  2VQH A;  1PLU A;  4PJN A;  3BCF A;  4NBS A;  2C78 A;  3LSJ A;  1YYV A;  2DYR H;  5HOO A;  1JI8 A;  2HDW A;  1RU4 A;  4BY1 J;  2XAH A;  1HC8 A;  3R61 A;  2V7Q A;  1VJS A;  2YX7 A;  1FZP B;  4X06 A;  3EUK L;  2LOO A;  3OZU A;  5J40 A;  2XAG A;  1JHH A;  5JLV C;  1NHA A;  3OWT A;  2MH2 A;  4CYC B;  3IH4 A;  4G8X A;  2D3L A;  4CDG A;  4HNV A;  1W5T A;  1ZGW A;  1JGS A;  3S8P A;  4YRV A;  3H9N A;  3GQB A;  2K9L A;  4MFD A;  2DQR A;  4PJ0 C;  4XOR A;  3JAM K;  3VWB A;  5EYR A;  1FYL A;  5A89 A;  3SZT A;  2NT9 A;  3CDI A;  2Q6I A;  4A69 C;  3PO3 J;  3WNC A;  4A3G J;  2VQG A;  1T08 B;  4IQ4 A;  3Q0V A;  4K1X A;  3H1C A;  4CCM A;  3LQR A;  4KN7 X;  3W2F A;  2DOD A;  2BM6 A;  2CW0 F;  1UD6 A;  4CSW A;  2RQQ A;  5FL7 A;  5F1R A;  5F1J A;  2HQR A;  4JK1 X;  1XG1 A;  2M3A A;  1C0W A;  1UG0 A;  1SM4 A;  3ZZT A;  1AHD P;  2KHM A;  2BEO A;  2IP2 A;  2M87 A;  4X0G A;  3I4M J;  2FVG A;  1FIP A;  2L9N A;  2A3S A;  1YLF A;  4OIN F;  2D9R A;  4KKU A;  5IT9 Z;  1EP1 B;  3ABU A;  2EFG A;  3K69 A;  2EIK H;  2VIX A;  4D0P A;  4UUS A;  1FSH A;  5F4O A;  1H8A C;  4KN4 X;  2ZJ2 A;  3OL3 A;  4B8X A;  1GV5 A;  2FOK A;  1O3T A;  1XB4 A;  3GX4 X;  2XRL A;  5FD5 A;  2K40 A;  1UFM A;  1LEB A;  4WXC A;  4NK8 A;  2JPC A;  1APL C;  1I1S A;  3B8Y A;  3AG4 H;  4RD4 A;  3S2D J;  3WGH A;  2VBM A;  2ZXI A;  4UV8 A;  1TL8 A;  4CH7 A;  1U8R A;  1FEX A;  3OS1 A;  3P27 A;  2W4S A;  4YFK F;  1LFU P;  2F4I A;  5HS8 A;  5GAD J;  1WHU A;  2ZME C;  4XOT A;  1JKQ C;  5E17 F;  3AG2 H;  3F23 A;  3J81 Z;  4Z4T A;  1QVG B;  2ISY A;  4KMF A;  2H6C A;  1FP2 A;  2MW8 A;  2V7U A;  3AVT A;  1MW7 A;  4UVB A;  4A3L J;  3I53 A;  5ERI A;  4HDV A;  1DPU A;  4H0E A;  2E34 A;  2BGC A;  2FF4 A;  5C44 J;  4Z06 A;  1R4N B;  2HKO A;  5CVR A;  3TED A;  4GFB A;  2BY0 A;  2KDZ A;  3WBJ A;  5DCF A;  3AGQ A;  4O5V A;  4Z2Y A;  2OBS A;  2IGK A;  1R36 A;  2ME0 A;  2QF7 A;  1G7C A;  3K9T A;  2VBE A;  5KCM A;  1HF0 A;  1HKQ A;  2KIU A;  5AMV A;  2ZC2 A;  3RKW A;  2R7V A;  2AHO A;  4G7H F;  2FXA A;  5CLS A;  4LBZ A;  1QX4 A;  2H6B A;  2VBW A;  4K2E A;  5GPC A;  1BLI A;  2E1O A;  3BRO A;  1KMH A;  3A2K A;  2F2E A;  3DBH B;  2CRG A;  3ZGK A;  3RKQ A;  2LDU A;  2QZ8 A;  5F64 A;  3OL4 A;  2LBF B;  1VND A;  2IXS A;  3KRG A;  2XPV A;  2CH0 A;  3V4G A;  3FXK A;  3SQN A;  3SEJ A;  1DP3 A;  1EFU A;  5ILV A;  2L7F P;  4ANJ A;  2H94 A;  2X0L A;  1QUE A;  4LOC A;  3LA2 A;  3W6V A;  1YI2 I;  3CCY A;  2PLF A;  5C1E A;  2DDA A;  3L1P A;  1N0V C;  2V7V A;  1GDT A;  2R5Z A;  4M74 A;  4HG2 A;  3H0G J;  1WDT A;  4N3G A;  3N6Z A;  5ICC A;  4PJM A;  2W00 A;  1MBJ A;  3MFK A;  3ASP A;  1TW3 A;  1T8I A;  2OK7 A;  4B4C A;  2IQ7 A;  1Z0X A;  1S7E A;  3MCZ A;  2Q6O A;  2VBV A;  4XBF A;  3A35 A;  1TTY A;  2M7B A;  3OJX A;  4YXW A;  2VFM A;  4RLQ A;  1ZTR A;  4Q48 A;  1ZRD A;  3LQ6 A;  2OQR A;  3PUB A;  1V5E A;  2JSC A;  1PJ5 A;  1P4W A;  2DTR A;  3V7S A;  1QFJ A;  1I50 J;  3NWS A;  1WSU A;  2XAU A;  1EF4 A;  1JKO C;  4FK8 A;  4C9Y A;  3DPT A;  2K5C A;  3HRM A;  1E3X A;  1UD3 A;  1RIO H;  2VL8 A;  4X1E A;  4OJL A;  4DNR B;  3K2Z A;  3W3C A;  3JTH A;  4I01 A;  3G2B A;  2XGX A;  1SD5 A;  2LBF A;  1ZG3 A;  3HB9 A;  3Q6R A;  2OD5 A;  3KPH A;  3F22 A;  1JA1 A;  1G7S A;  3H36 A;  5LHH A;  4E7I A;  2TCT A;  2OBR A;  3LSH A;  1O4X A;  4IOC F;  1DP7 P;  2DYS H;  1OYW A;  3Q6Q A;  3DTE A;  5JLX A;  1T0F C;  1XD7 A;  4WWC A;  1LNW A;  1Y1V J;  3OMY A;  3CCS I;  1G3Y A;  1YOV B;  4RAZ A;  1YI2 B;  1TT5 B;  2E1M C;  2F5D A;  1VQN I;  1DDG A;  2XAF A;  2HPI A;  1SAN A;  2KJB A;  5HS9 A;  1KQ0 A;  3S1Q J;  4L0Z B;  4G12 A;  2E1C A;  1IRX A;  1IV8 A;  3ZN0 A;  2B63 J;  4G1B A;  3S16 J;  2XZO A;  3BR6 A;  3DFG A;  4LIV A;  3K70 C;  2K9N A;  2NSP A;  3OYB A;  3KYC B;  3LYC A;  3Q39 A;  1CQT A;  4U87 A;  2QZA A;  2VKE A;  4KA4 A;  2PYH A;  3EUH C;  3PET A;  1ETW A;  1B1B A;  3DU5 A;  1SEU A;  2GWR A;  4BY7 J;  4QV2 A;  3GQ9 A;  1RKW A;  1O88 A;  4E70 A;  3HBL A;  2VBT A;  4OOV A;  1B6A A;  3A02 A;  3NAW A;  3GZ6 A;  5IT3 A;  1ETK A;  2HOS A;  1QZZ A;  3IAM 2;  3FIS A;  2JVH A;  5L3B A;  4WZK A;  1QA3 A;  3CCV B;  3QFR A;  2DA7 A;  5L3G A;  1X2M A;  1UD8 A;  1BC8 C;  2CW7 A;  4I0B A;  1VHE A;  3F8B A;  1KTV A;  2ZSI B;  3K1N A;  3SEZ A;  4XSZ F;  1IF1 A;  5GTH C;  4ZYH A;  1V54 H;  1NK2 P;  2DJN A;  4L8J A;  4B43 A;  3S1N J;  2V5I A;  3QQA A;  3CCM I;  3MKZ A;  1VQM B;  2V26 A;  1AU7 A;  3CUQ B;  2VJI A;  1FYM A;  4IVN A;  3WHB A;  4A2U A;  1XTA A;  2FD5 A;  4LLG F;  5BPD A;  3KEW A;  2ODL A;  3WG9 A;  2MAB A;  4OJ6 A;  5F27 A;  1JGG A;  3BLY A;  5FRM A;  2QCO A;  2DLL A;  3AG3 H;  3W2W A;  2DW4 A;  4AWX B;  2HQN A;  3CJN A;  4JBA A;  2R93 J;  5C4X J;  2J7K A;  2OJE D;  2AO9 A;  4WXD A;  5AIP A;  2NNN A;  3ZC3 A;  1AIR A;  2XTY A;  2M0M A;  4C2M J;  2BXZ A;  2O17 A;  2VJ5 A;  2VE9 A;  1SKQ A;  1FBU A;  3U1D A;  3IH2 A;  1ERD A;  3QFT A;  4LB5 A;  4KH3 A;  1WQ2 A;  1KYW A;  3PA2 A;  1U78 A;  4OZZ A;  2LTP A;  3PUN A;  2IPQ X;  3AAF A;  5JMC B;  4JRA C;  3CC7 B;  3NWT A;  4U49 A;  5H20 A;  1HW1 A;  3G73 A;  1ZM2 A;  1GO2 A;  1V3F A;  4NCN A;  2IGO A;  5J1R A;  1Z6R A;  2W82 A;  4BEH B;  3GZN B;  4Y13 A;  4II3 A;  5F0F A;  3OZW A;  2IAI A;  1DGR M;  1OYI A;  3QYF A;  1BR1 A;  4IXA A;  5IP9 J;  2R5Y B;  1U5T B;  3MKY B;  3RPU D;  4IHY A;  3OFN A;  4PC3 A;  3BH7 B;  1BBY A;  2V7W A;  1M90 D;  2ZB9 A;  4U88 A;  4IHX A;  2IJL A;  2DI3 A;  3KL9 A;  5JHU A;  1OMI A;  2GJR A;  4LBY A;  2P7V B;  3GVA A;  4MXN A;  3SXY A;  3FBI B;  2OTJ I;  3PFY A;  4FWT A;  3FK7 A;  2EFQ A;  3B6A A;  4I09 A;  1Q9S A;  3FXL A;  3C2H A;  2IOU G;  1N25 A;  3Q0W A;  1UMQ A;  1TWH J;  2KP6 A;  2LF8 A;  2QSF X;  1ZH5 A;  4ZCL A;  4HF1 A;  3ML3 A;  1BX0 A;  2CQ7 A;  2VQL A;  3FDY A;  2FU4 A;  1MBH A;  2DJI A;  5FLX K;  3E0J B;  2C4T A;  1GVD A;  1R1U A;  3OZV A;  4HX7 A;  3SZG A;  1HST A;  3KLN A;  3QPS A;  3GTM J;  1XE1 A;  1A6Q A;  1VHO A;  4BXU A;  2QGU A;  2BY2 A;  2JK3 A;  3LL7 A;  4ABZ A;  4DQ2 A;  4E7K A;  4FN5 A;  4QSH A;  4AU7 A;  1O8J A;  3I9V 2;  2VBZ A;  3W6K B;  2IA0 A;  2X48 A;  1OCC H;  1FIA A;  4R1H A;  2Z9O A;  1W7P D;  1O8E A;  1RR8 C;  4BEH A;  4YIF A;  2NTQ A;  1VQ5 I;  1QGA A;  1ETY A;  1Y0N A;  4BJ5 C;  1SC7 A;  2EJR A;  4GYG A;  3G05 A;  1U5T A;  5IOY A;  3V76 A;  3A1Y A;  2Q2E A;  4P1W A;  3WNB A;  3ZOB A;  2PI0 A;  1PE9 A;  4RD2 A;  5DCM A;  3EDP A;  2BN4 A;  1QQ1 A;  2CQK A;  2B0L A;  5FRN A;  2ME6 A;  5FKK A;  1BN5 A;  1OYY A;  4ZYD A;  1HLV A;  1E1Q A;  4ZTJ A;  3GTG J;  2KIM A;  5FKL A;  4C3H J;  2JDI A;  3OYI A;  1X19 A;  2R7R A;  4MYT A;  1BIA A;  3IRQ A;  3M7G A;  2IS6 A;  3L00 A;  2R0Q C;  2E60 A;  4HV5 A;  4TMW A;  5IK2 A;  4ZGQ B;  3J80 Z;  5IYN A;  1UJ8 A;  4FXU A;  3E20 A;  3HOX J;  2FOW A;  3V8J A;  2FA5 A;  3DF8 A;  4E4H A;  5ED4 A;  1XPX A;  4D9J A;  2Q6K A;  4O3M A;  4M3F A;  1MD0 A;  3HG9 A;  5LRS A;  2ADU A;  4W8Q A;  2IGM A;  2BE5 F;  2KPM A;  3MMY B;  1CGP A;  1ZRC A;  4P3I A;  1X1B A;  2ZFU A;  3MMP A;  1WFX A;  3FXO A;  3J81 K;  4P9S A;  3BPX A;  3CP2 A;  3HHG A;  2KZV A;  5F0C A;  4AVP A;  4U0W A;  1TWF J;  1XMX A;  4KMU X;  1VQP I;  1UD5 A;  1OCR H;  3BR5 A;  4LG0 A;  2NT6 A;  3Q0U A;  2FNA A;  4KFC A;  2KLO A;  1MMN A;  3VEP A;  1EP3 B;  3E97 A;  4M3E A;  3W5H A;  3M07 A;  4MEY F;  4BL0 B;  3LA3 A;  3ISX A;  3ZZU A;  1TTT A;  1WPK A;  1ZR2 A;  3JAM Z;  4A93 J;  3K7A J;  2G0Y A;  4WQM A;  1OB0 A;  4UB6 C;  1AKH B;  4BAY A;  3F9K A;  2E7W A;  3D5L A;  1S0U A;  1TLL A;  2BM1 A;  3P9I A;  4M9Z A;  4L9V A;  2H1K A;  1IB4 A;  2JUG A;  3CF5 F;  2CQQ A;  3O3K A;  2EWE A;  2V7T A;  2KFD A;  3EQO A;  3TBI A;  4BKX A;  5GPA A;  1OR7 A;  1PJR A;  1DU6 A;  5EDN A;  1FND A;  1LVA A;  3E1S A;  2O03 A;  2VBY A;  1U6G A;  3O8G A;  4L9T A;  2HVS A;  2LRE A;  1T6X A;  4NK6 A;  3GQ8 A;  3S17 J;  3A0B C;  2HTJ A;  3S15 J;  1QPI A;  1F4K A;  3D0S A;  3FXJ A;  1MNM C;  3BY2 A;  3FXU A;  3MCA A;  2R7S A;  2HXI A;  1R49 A;  4KT5 C;  2CU7 A;  4AF7 A;  4GGG A;  5EG0 B;  2QQB A;  3I5U A;  4IX7 A;  2DBB A;  1R58 A;  4LK1 F;  1FRQ A;  4CUG A;  4XRS A;  2JJ7 A;  1ZYR F;  2M5W A;  3IKV A;  2HNH A;  4TV7 A;  5M5Y J;  1GXQ A;  3FPP A;  4W8S A;  2GIZ A;  3U21 A;  1NG6 A;  1TNT A;  1AKH A;  5DN6 A;  2DY1 A;  3CD6 B;  1RQR A;  5LGU A;  2WC2 A;  3HJE A;  1E2X A;  1LVK A;  1D3Y A;  2AXT C;  2GBY A;  2VFP A;  5JFR A;  3CPX A;  2HZT A;  1IG7 A;  5TV2 A;  1G6N A;  2HYJ A;  1LFB A;  1EWY A;  3ML6 A;  5GP9 A;  4E7L A;  1I39 A;  2WA0 A;  1SKY B;  4Z03 A;  4M71 A;  1D8K A;  2LF7 A;  4L9J A;  4X6A J;  3OIO A;  1IV6 A;  3QSY A;  4L0Y B;  3CMY A;  4OPW A;  4RM3 A;  3OYJ A;  3M1E A;  2DPU A;  4R71 A;  4V2G A;  2R7D A;  3ABM H;  2Y9Z A;  4CQJ A;  1I5Z A;  3V8K A;  1A04 A;  1IGN A;  4Y52 J;  1JTA A;  4L5I A;  2H8W A;  4RDL A;  2IEK A;  5FKO A;  2NTP A;  4YC5 A;  3GF2 A;  4QHY A;  2XAQ A;  4RM2 A;  1DAB A;  3BZC A;  1EJ9 A;  2C6Y A;  5TY0 A;  3S3O A;  4JX6 A;  2PMZ N;  1FNM A;  1IRF A;  1IRG A;  3A1P A;  3BCD A;  2DQL A;  3HM5 A;  2LYC A;  4RJL A;  1PYV A;  4RGU A;  1YHQ I;  1GR1 A;  2GQQ A;  3G6E I;  1B72 B;  3Q9V A;  4A3M J;  3MZY A;  4ZZD A;  2JUC A;  2HOT A;  4LFU A;  2D45 A;  4ITV A;  2EFP A;  1LFP A;  2ZXH A;  4YZ0 A;  2UXN A;  1D2E A;  3DKX A;  5FFX A;  2XB0 X;  3GFL A;  4EMS A;  3OYC A;  2ZZF A;  1OGO X;  3CCR B;  2VNJ A;  2DU9 A;  3FJO A;  1N07 A;  3OEH A;  3Q9S A;  4G94 A;  3B73 A;  5TJJ A;  4J01 A;  2OPT A;  4BPR A;  1I8D A;  2DO7 A;  5HZA A;  1B8I A;  3CMA B;  4A0Z A;  3GWZ A;  4CZZ A;  2W57 A;  4YEJ A;  1EFT A;  5F4J A;  1YJW B;  3V7C A;  3HUG B;  4UHT A;  4OPO A;  2IBD A;  3OIQ A;  1UB9 A;  2KRH A;  2XTX A;  1L1I A;  3LAJ A;  4CZC A;  2QWW A;  1K4S A;  4BQO A;  4WK8 F;  3DDY A;  3GVL A;  2NOJ B;  5M5W J;  3AVX A;  2W48 A;  2DET A;  4C2U A;  3SFZ A;  2QBY B;  2ZBK A;  1QJV A;  1WOR A;  4ZTF A;  3REO A;  5IYD J;  1OOC A;  3E5X A;  2W25 A;  3OR1 C;  1XCB A;  1EKE A;  3J7Z I;  3I54 A;  2K7L A;  5LEK A;  1R5O A;  1I1G A;  4AYB N;  5IPA A;  2GAU A;  2G0E A;  3HPG A;  5DTD A;  1XGM A;  4NB5 A;  2Y48 A;  4KYW A;  2X1C A;  3HSE A;  3KX2 A;  1R5G A;  4G7O F;  3U1K A;  2HR3 A;  2M5S A;  1KCD A;  4IJA A;  1JKR C;  3JX8 A;  2DFH A;  2DK8 A;  2GXA A;  3O2P E;  1VQ6 B;  3DBR B;  1BM9 A;  3HKZ A;  1PJ6 A;  3TW6 A;  1XGS A;  1Y0Y A;  4BJ6 C;  2L02 A;  3VPR A;  1JA0 A;  3I55 B;  3VSU A;  2XGC A;  5EZH A;  4Y7N J;  1Q1V A;  3GVJ A;  3WE3 A;  2ZJR F;  2V31 A;  1CLW A;  2QEN A;  4O6J A;  2M30 A;  4Y4R A;  1MBK A;  1Z9C A;  2OCE A;  1N05 A;  3K70 D;  1ENH A;  4PC7 A;  3ZQC A;  5KAI C;  1E3P A;  2E5Z A;  1I3Q J;  5L3F A;  2PMZ A;  3W6J B;  1QCX A;  2M4K A;  2R9V A;  3Q3S A;  2QBY A;  1XN7 A;  1QNT A;  2W6J A;  3S14 J;  2PIA A;  3H09 A;  1IHM A;  1FX0 A;  3COA C;  1ETV A;  3OKX A;  1W0J A;  3HL2 A;  4BXX J;  1F60 A;  3LMM A;  1TVC A;  2NOG A;  5D4R A;  1I6H J;  3K4M A;  5EEG A;  5LRR A;  3TO9 A;  1A36 A;  2BX6 A;  4DZJ A;  2W24 A;  2VQC A;  2CQX A;  3KET A;  1KQ9 A;  1WCM J;  2ZZE A;  3E7L A;  3KYD B;  1XGO A;  3G4S I;  3FIW A;  3PJR A;  3I1F A;  2KIF A;  1OCZ H;  5IYR A;  4A0X A;  3H92 A;  2K86 A;  2EFN A;  2DDB A;  3OE7 A;  3OSG A;  2NS7 A;  3OAA A;  2XND A;  1QVU A;  3BG3 A;  4A3E J;  2YU9 J;  2A6T A;  1CF7 B;  1LEA A;  4IOA F;  1S7O A;  1TW2 A;  4S04 A;  1NB0 A;  2C4U A;  2L5Q A;  2YR2 A;  4OOI A;  1X0C A;  4MR0 A;  1HBX G;  3ONU A;  4E7Z A;  1D1B A;  1Z77 A;  3CF2 A;  4RB1 A;  2P3M A;  3MAJ A;  2DOE A;  1LDD A;  2ECB A;  4M2L A;  4AYB A;  2CRV A;  1PP7 U;  3W5U A;  2N8G A;  1KTW A;  2JJ2 A;  3PIP F;  4N9I A;  2VZL A;  4DOZ A;  2GQF A;  1BOB A;  5THX A;  1BJA A;  4R8H A;  2D1V A;  4AM3 A;  3J7A Y;  2EH3 A;  3WQZ A;  1GQ8 A;  2VON A;  2FNP A;  1IXS B;  4F7Z A;  3F8C A;  2IGN A;  2L01 A;  4M6X A;  4U0V A;  3Q38 A;  1FBS A;  2QTL A;  1JUS A;  4EM0 B;  1XS9 A;  3RYR A;  4UB8 C;  4V2F A;  3TKY A;  2IT0 A;  5BSX A;  3L7W A;  4P22 A;  4X0C A;  1P2F A;  2O0W A;  3SLN A;  4PJJ A;  4HDU A;  1SVO A;  4PC1 A;  4IHW A;  3IAS 2;  2EFO A;  5BOX A;  2PX9 A;  3WWG A;  3GCM A;  4CA0 A;  1GT0 C;  4PCQ A;  3EQL F;  4HSR A;  4LK0 F;  5FO1 A;  3ZCO A;  1U9O A;  1D5Y A;  2C5B A;  5KNL A;  1UD4 A;  1W5S A;  5ICG A;  2LLK A;  1EP2 B;  1SD4 A;  1WJF A;  2VBS A;  1FRN A;  3QU3 A;  5JI6 A;  4RGR A;  3DU6 A;  1OGI A;  4LLL A;  2CFX A;  1EXM A;  1ZM4 A;  1OFD A;  2RC6 A;  4X7D A;  3AFH A;  3OW7 A;  4ZCM A;  1R1V A;  4WZT A;  1J0R A;  5TGT A;  1UZC A;  1UST A;  1YS6 A;  2W84 A;  3H9Q A;  1VQ9 B;  3I59 B;  1HG8 A;  1X3U A;  3ABL H;  5IYQ A;  3ZBU A;  4XKB A;  3AST A;  3AL0 C;  2WJV A;  4ZYE A;  1NB9 A;  3N90 A;  3A4C A;  4BH9 A;  3BTL A;  4DYC A;  4DJA A;  3RZO J;  4BAC A;  1T6S A;  3CC2 I;  1K6Y A;  4OWR B;  4NUB A;  3IKT A;  4DQK A;  4FAS D;  4I98 B;  1SFU A;  1QVT A;  4A3B J;  5FLX Z;  4AF6 A;  1RR7 A;  4E7H A;  1OR7 C;  3L9F A;  1G3W A;  3KE2 A;  2PJR A;  1E3H A;  2DMU A;  4S05 A;  1WJD A;  3AVW A;  2GJP A;  3OW2 B;  1V5V A;  1TQP A;  3FM5 A;  5D5U B;  3BG6 A;  4QPO A;  4B3X A;  4BE1 A;  1FNB A;  5M3F J;  4C2L A;  2CW8 A;  2LNB A;  3A03 A;  4BHP A;  2K9Q A;  4XN0 A;  3ZQG A;  3F3X A;  1TWC J;  4NHJ A;  5CDF A;  2O6W A;  4BGD A;  1XFO A;  3EYY A;  1OFM A;  4OM9 A;  4WXH A;  1F43 A;  1S9H A;  2ZXW H;  2OV7 A;  1N0U A;  2UVF A;  2C5H A;  1ZAO A;  2RC4 A;  5D5V B;  1R7J A;  4P25 A;  1O3S A;  3DEU A;  2CW5 A;  3ZP5 A;  1UMK A;  2QY1 A;  2EIN H;  4CYC A;  1BW6 A;  2ELK A;  3ECO A;  2GPJ A;  3DKW A;  2YSR A;  4RA2 A;  2JA8 J;  4E6K G;  1SAX A;  2PN6 A;  3G3Z A;  4ZH4 F;  1W36 D;  2VKD A;  1J2X A;  3TGN A;  1JNY A;  3CB4 A;  2D74 A;  3QPH A;  1WTH D;  2VYQ A;  3BR0 A;  3CC2 B;  1ZGJ A;  4L5E A;  3T0Y A;  2BVL A;  3HGG A;  2CSO A;  2DCE A;  4BE0 A;  4JX5 A;  3OYN A;  3HRT A;  2V1X A;  4GDF A;  1GVJ A;  4KKT A;  2NV4 A;  1BI1 A;  4HEA 2;  2DAO A;  1BI2 A;  5H6R A;  3WTY C;  1XDU A;  5HDG A;  3FXR A;  2ZBU A;  4TMT A;  3RIQ A;  1OB5 A;  3GTQ J;  3FY3 A;  2XAJ A;  2X51 A;  2FBK A;  2PBI A;  3T8T A;  2FQ4 A;  2QTZ A;  1ZHF A;  2DMN A;  4XLN F;  1D0Y A;  3LSR A;  3ZQL A;  5IYW A;  3ABK H;  4UVC A;  2QQ9 A;  1Z67 A;  1WZ2 A;  3BCA A;  1IJE A;  4RD6 A;  4Z4R A;  4RS8 A;  1VQL I;  1FY7 A;  2WV0 A;  3SFI A;  2GIV A;  2PLY A;  2DEU A;  4YZA A;  1HA8 A;  2IA2 A;  2ID6 A;  3PEN A;  2P8T A;  3CCJ B;  3PM1 A;  2AXL A;  5A88 A;  1K8A D;  4IRH A;  2Q0O A;  4N4N B;  4I2O A;  3AG1 H;  1Q81 D;  1ZN2 A;  2X8K A;  3BC9 A;  2J8K A;  1QFY A;  2XTW A;  4M3G A;  4ZYA A;  4R79 A;  1RUN A;  4A6D A;  5EJC A;  2BV3 A;  4AD9 A;  1WRJ A;  4ENK A;  2ZIT A;  3I71 A;  4B09 A;  3OYG A;  1MAB A;  4IHS A;  1IDY A;  3JTG A;  1KZL A;  2ID3 A;  1R5B A;  2LP0 A;  1FBQ A;  3SLD A;  4AID A;  4AVZ A;  1J7K A;  4EV0 A;  4M9X A;  2XC7 A;  4IZZ A;  2ZZG A;  1ETX A;  1ETO A;  3S3M A;  3KEQ A;  3CDL A;  2XZL A;  2LVS A;  1KA8 A;  3ZRG A;  1COW A;  1YX2 A;  2E2J J;  3CTA A;  2CYY A;  3PSI A;  4YIR X;  1W34 A;  4MYU A;  3WGG A;  3DEW A;  2I8D A;  2DYI A;  1VQL B;  4BHC A;  1RPW A;  1E1R A;  3VB2 A;  3JRE A;  5BSY A;  1JJ2 B;  2AHQ A;  4JMQ A;  3P7N A;  3FKI J;  2EZH A;  2QVO A;  2HVQ A;  1QGP A;  1LPQ A;  2FBI A;  3U6K A;  1T98 A;  4CO8 A;  2ELH A;  2DOA A;  4C3J J;  4OAY A;  2V1U A;  4X07 A;  1YW7 A;  4KDP A;  1FTZ A;  1IDZ A;  1QA2 A;  2DPD A;  2BZT A;  2ZCW A;  1V0E A;  1VQO I;  1P4A A;  2DA6 A;  3LOC A;  1H9G A;  1S4M A;  3OPO A;  4Y9R A;  3RKX A;  4RDK A;  3T1B A;  5CPR B;  4EJV A;  2NS8 A;  1EV7 A;  4HV6 A;  5IP6 A;  3CCV I;  1KQ8 A;  1VQ7 B;  1NG7 A;  2KL4 A;  2K4J A;  3ZQ7 A;  5H6Q A;  4BDZ A;  4F91 B;  2B0R A;  4G5G A;  2VBU A;  3DCF A;  5JVG F;  3FHZ A;  3VYS B;  5EF6 A;  3CP8 A;  4QVA A;  1QRY A;  1S3J A;  2JN6 A;  1XMA A;  1F9N A;  1NHC A;  3KLO A;  2CV0 A;  5LHG A;  2RC5 A;  3DWL E;  4W97 A;  3LNQ A;  1VQM I;  2E71 A;  4ZDP A;  1E64 A;  4DNT B;  1A31 A;  1R1T A;  1WKM A;  3JRG A;  1LM1 A;  4V19 K;  1KU2 A;  2B9S A;  4Z4U A;  3M8J A;  1U3E M;  2VJ4 A;  3P9K A;  1NRK A;  2V9V A;  1T39 A;  4P55 A;  4ON0 A;  4TMZ A;  2BMW A;  3LFK A;  1IJW C;  1SMY F;  3GTJ J;  1FSE A;  1OGJ A;  1J75 A;  3BY1 A;  3RPQ A;  4U7D A;  3GYH X;  4KUM A;  1YLO A;  5KVR A;  2JT1 A;  3FWE A;  1WH5 A;  1Y8R B;  1VQK B;  1Y1W J;  4D7M A;  4PJL A;  1T38 A;  4X7F A;  1D0X A;  3NEU A;  1MGT A;  2XKO A;  5F6F A;  3TOA A;  2X0K A;  2ZL6 A;  5K7H A;  1A5J A;  1P6R A;  2Y0S N;  1A6I A;  2LSO A;  4EVI A;  3N05 A;  1FC3 A;  2VNK A;  3CW2 A;  1VQO B;  4ENM A;  2XGD A;  2ZNY A;  2D1H A;  1XDS A;  3ASO H;  3CJR B;  3OYH A;  3CO7 C;  3CC7 I;  1ZUN B;  4PGO A;  5EEH A;  5H5J A;  3E1Y E;  1E3Z A;  1KRH A;  3F8N A;  3B90 A;  2BF4 A;  4IL6 C;  2PEC A;  3ISP A;  2GOX B;  2MLK A;  4DGW B;  1QUF A;  4ZCI A;  1JT0 A;  1AWC A;  5DD8 A;  1W35 A;  2C77 A;  2GOM A;  3I0T A;  2XKP A;  1ZLJ A;  1NJI D;  2HEO A;  5D8K B;  4DK1 A;  4ZZL A;  4IF4 A;  2X1D A;  4PDK A;  5TR9 A;  3VOD A;  3K1P A;  3F0C A;  2NVT J;  3AK5 A;  1O7L A;  2FQ3 A;  3R0A A;  5J4Y A;  4XM3 A;  1UHW A;  2P5L C;  1OJL A;  2XDV A;  2NNY A;  3CJT B;  3QP5 A;  2HTS A;  2JWT A;  2WR8 A;  4QFM A;  2VFQ A;  2D3N A;  3F6V A;  3DTI A;  3FM3 A;  4G6D A;  4NBQ A;  3E6D A;  3GFM A;  5J4V A;  4BBR J;  1SVL A;  2CUZ A;  1KK3 A;  4U4B A;  1QBJ A;  4Y7C A;  2B7E A;  4XMY A;  1SD7 A;  3KP5 A;  1XCV A;  4X05 A;  3KFW X;  3C2B A;  2JN9 A;  4OOX A;  2DMP A;  2RNG A;  1JJ6 C;  1G7R A;  1NTC A;  4Z1M A;  1XSX A;  3IV5 A;  3F21 A;  4RDJ A;  2GA1 A;  2R7F A;  3SJZ A;  3W2A A;  3GTO J;  2VAS A;  2E1N A;  1H85 A;  2KQR A;  3VYR B;  4QWQ A;  4AIJ A;  2M7A A;  3NE5 B;  4Q7J B;  2BHZ A;  2W7Z A;  4M4S A;  2JMW A;  4BQQ A;  3VO2 A;  1IN4 A;  1R00 A;  2NVY J;  4AIH A;  1BHE A;  3UW0 A;  1W0T A;  1WP6 A;  2VOD A;  1K9M D;  2I1L A;  1I3A A;  1YE9 A;  3R4K A;  2VXZ A;  3QRF F;  2MD5 A;  1AOY A;  1LLW A;  1LJ9 A;  4XRF A;  2HGC A;  2PG4 A;  2FBH A;  3CUQ A;  3GME A;  4QVJ A;  2WAE A;  2G7U A;  1SFE A;  3WTW C;  3DTK A;  2YWH A;  1O8F A;  2EIM H;  3K4L A;  3A0H C;  2Y0S A;  1ONV A;  3C7J A;  3WOD F;  5JR3 A;  4IW3 B;  1L0O C;  2X3U A;  1I6X A;  1OIS A;  5DS0 A;  3NB2 A;  1ULY A;  1PJ7 A;  1FPQ A;  2MGQ A;  5HXB A;  5JBQ A;  5HLT A;  1NBM A;  4WCG A;  1WJ5 A;  2ZJP F;  2BSA A;  1IZ1 A;  1T33 A;  2LY2 A;  2KZG A;  4E0F A;  1BI3 A;  1HQC A;  5IOZ A;  1UHS A;  5HLI A;  4OU0 A;  1BN8 A;  4HF0 A;  2V79 A;  5AN9 A;  5F04 A;  1I18 A;  2R7Q A;  4QLC U;  5HDK A;  3CME I;  5L3C A;  3P4G A;  5CVU A;  2IS1 A;  2BM4 A;  2Y2Z A;  5FIU A;  2MC4 A;  3I3L A;  2KRF A;  4UZU A;  3HEF A;  2MD0 A;  3F72 A;  2VLA A;  4AC9 A;  1RMG A;  5DM6 F;  2BY3 A;  1N8R D;  2JQ7 A;  5E79 C;  2VOO A;  3BH6 B;  3HSR A;  3R0J A;  3BR1 A;  4JYK A;  4PAA A;  2GA2 A;  1HOM A;  5H59 A;  1YO5 C;  3SY2 A;  2R5Y A;  3ES9 A;  1V5G A;  4XK4 A;  1W7P B;  1V55 H;  2P81 A;  3IP4 B;  1IDJ A;  3B78 A;  3CC4 B;  2PE3 A;  5FKM A;  3GW2 A;  1R4M B;  2BM5 A;  3RPU A;  4ROX A;  3D5S C;  4YFN F;  1ZEL A;  4FET A;  3ZPP A;  3CCQ B;  4Z4W A;  3MN2 A;  4ZDO A;  4XID A;  1JB9 A;  5B6I A;  3TP0 A;  3KP2 A;  3V42 A;  4DYR A;  1K79 A;  4G7Z F;  2VXD A;  2WYR A;  2CC2 A;  4MIM A;  3S2W A;  2RDP A;  5GAG J;  4PUS A;  4XLH A;  2M34 A;  3SUC A;  3MVP A;  1STZ A;  4JX4 A;  1J9I A;  2MH9 A;  4CCK A;  4OIP F;  2YWE A;  3RDI A;  3A3G A;  3RQI A;  2W85 A;  2VKH A;  2EZI A;  3B8H A;  1U8B A;  3CME B;  1XSV A;  4FCY A;  5E1X A;  5IYC J;  2PJP A;  1I27 A;  2R3S A;  3QFC A;  3T5X A;  4XON A;  4I7H A;  3WTV C;  1S5L C;  2R7W A;  2HS5 A;  1TYV A;  1WJE A;  2F5F A;  5FLM J;  4KIF A;  2FE3 A;  2HYF A;  1SVM A;  4LBW A;  4TT3 A;  4IRG A;  1W4M A;  2DK5 A;  2GM4 A;  4DK0 A;  3CD6 I;  1W7P A;  2I5U A;  1S72 B;  2CF4 A;  3PSZ A;  3ZQH A;  5BPI A;  2QA4 B;  1R23 A;  3LJY A;  5B66 C;  2F5V A;  4TN1 A;  3GIR A;  2H09 A;  1K8F A;  4KIC A;  2XF7 A;  1MMA A;  1D8T A;  2WAF A;  3CCL B;  1USS A;  4YII A;  1BIB A;  4I84 A;  1DBO A;  2DA1 A;  1UG2 A;  2EV0 A;  2BXY A;  5BNG A;  1GLN A;  3TDZ C;  4M1K A;  3RKY A;  3OOC A;  2XRN A;  3KIO A;  3WXM A;  2L4A A;  2DOF A;  3BP8 A;  2XRO A;  2XVC A;  4XQF A;  3TH0 A;  1QH0 A;  3ERM A;  1R9T J;  2J5O A;  1ZG5 A;  4Y3O A;  3B6C A;  4RD0 A;  1JUP A;  3QWL A;  4W8T A;  2NXN B;  2MC3 A;  3FMQ A;  1OQY A;  1VI0 A;  1Y0U A;  2G7H A;  4HQM A;  4F55 A;  4EJT A;  1E63 A;  2GJK A;  4Z4Y A;  3DPU A;  4URR A;  3IC7 A;  1E0E A;  2XGJ A;  1ZKG A;  4LIU A;  1YTY A;  2OQG A;  3E3V A;  2QSH X;  1H9T A;  2M8E A;  4KIS A;  2QYO A;  2C2W A;  1B59 A;  5HZB A;  1TC3 C;  4OJP A;  4WZE A;  1OLT A;  4V02 C;  3M1C A;  4CIC A;  3ESW B;  2BVN A;  5E20 A;  1FOX A;  4HW0 A;  1JXS A;  4RLZ A;  4EJU A;  2FSW A;  2ZME B;  3IL2 A;  1IJF A;  3H5R A;  4MQ9 F;  5H2F C;  4P26 A;  1RNL A;  3ABT A;  5A8A A;  2CJJ A;  1NK3 P;  1FYK A;  2X6W A;  2HWV A;  1QQI A;  3RJP A;  3CCR I;  4ASN A;  3CCJ I;  2O04 A;  1MNE A;  1X4O A;  1HW5 A;  2M8G X;  5FO5 A;  1P7J A;  2OBP A;  3TW7 A;  3CMA I;  5ILS A;  1ELO A;  5IYB J;  3GTL J;  2P7C B;  3TL4 X;  1YJW I;  1X1D A;  1N08 A;  4OOS A;  4B47 A;  2ZO4 A;  4TKO B;  4A3K J;  2PQ8 A;  4P9F A;  3GZ5 A;  3HKZ N;  1A35 A;  2ELJ A;  4P5O A;  2OCC H;  2HDN B;  4M3B A;  2IA1 A;  2XV4 S;  4X7E A;  4RAY A;  5EG0 A;  3BJO A;  1O3R A;  1WWX A;  1D1C A;  1IC8 A;  3MEX A;  2L54 A;  4L9N A;  3WGI A;  2AS5 F;  2Q6L A;  1IUY A;  1TQM A;  4AC0 A;  4OAZ A;  4W1U A;  1JKP C;  1EFC A;  4RLF A;  4YCQ A;  2NVU B;  1N75 A;  5GTI C;  1YIT I;  5FD6 A;  1RZ4 A;  2WPD A;  1MSE C;  1ZG1 A;  2CG4 A;  4JQF A;  1K5C A;  1Y6I A;  3VFZ A;  3UNG C;  4EM2 A;  2NYX A;  4ACB A;  5E3O A;  2QE7 A;  1K7A A;  3JUR A;  1G8X A;  1K6O A;  1VQ6 I;  3T53 B;  2HFH A;  4CCN A;  2QYU A;  3I55 I;  3C1D A;  2NRA C;  4BBS J;  4HE6 A;  3BOQ A;  4M3D A;  2A05 A;  2XHK A;  3TO6 A;  4JP0 A;  5J8F A;  1YX3 A;  4XLE A;  1BJK A;  4HE5 A;  3GFJ A;  3M9A A;  4HZF A;  2XIG A;  3ULQ B;  5C3E J;  1ON1 A;  1RC9 A;  2RGV A;  3DLA A;  5BMZ A;  1AIP A;  4G7W A;  1E17 A;  3V7R A;  4P2N A;  1IUF A;  1D5V A;  1D1A A;  1WOS A;  1LDJ A;  4E7S A;  3HRU A;  3VSV A;  5DD4 A;  4DQL A;  4KIG A;  4YHB A;  4Y17 A;  1YIJ B;  2M9H A;  1Z21 A;  3OSF A;  2X4H A;  1VQ4 B;  1MMD A;  4Y9U A;  2E19 A;  4XLC A;  4EM1 A;  1DUX C;  3LSK A;  2KKO A;  2X53 S;  2Z99 A;  4X8I A;  3GQ7 A;  2Q8K A;  3LO8 A;  3BC8 A;  2EQR A;  1IAW A;  3W2H A;  4YAW A;  3E6M A;  3I58 A;  1BW5 A;  3OYL A;  4KT6 A;  2V4D A;  4B48 A;  4S0H B;  2DFE A;  1YJN I;  2H8R A;  1ON2 A;  1VBL A;  3WHC A;  2Y75 A;  1ZM9 A;  2XF6 A;  3OIP A;  3K2A A;  2G9W A;  2VFN A;  1OCO H;  1FNN A;  1WSV A;  4UXN A;  1BA5 A;  3JSP A;  3KP7 A;  2DXI A;  5DYM A;  2YWF A;  4LGW A;  1FJL A;  1B72 A;  1XMK A;  3H9J A;  5LHI A;  2J8I A;  4XL9 A;  2Q1Z B;  2B5O A;  1BR2 A;  2DTZ A;  5ICF A;  4IRI A;  3WTT C;  1LLZ A;  3RIR A;  1K78 B;  5TIS C;  3FHN A;  2XNJ A;  4F3Q A;  1P4M A;  1W2B B;  2HXO A;  2VJJ A;  2ZSH B;  2UVE A;  3B82 A;  3VST A;  3BTJ A;  4IPA A;  2M2E A;  1FNC A;  2EV5 A;  1GHC A;  1VTN C;  3CLO A;  3E6B A;  1E43 A;  3BJ6 A;  3ZMV A;  4HWV A;  4FX4 A;  2OC6 A;  2MG4 A;  4MO7 A;  1R22 A;  5FO0 A;  3CLQ A;  2R7Z J;  2UWM A;  2L3D A;  4UVA A;  4FE7 A;  1IN6 A;  3BPV A;  1WJC A;  2E1M B;  3GLX A;  4PFO A;  2P6T A;  3KP6 A;  4ACA A;  4HBL A;  2BW3 B;  3HUG A;  3L09 A;  1ZQ3 P;  1Z91 A;  4MHG A;  3VSK A;  2WY8 Q;  1OFE A;  4HA8 A;  1Z6T A;  2XC1 A;  2V7F A;  4G9Y A;  5K5R A;  3IHU A;  1W87 A;  4ZJZ A;  1TSP A;  1WI9 A;  2QQ8 A;  3WTZ A;  2W1O A;  5A2Q K;  3S3N A;  1J9Z A;  2R92 J;  1P7I A;  4G6I A;  3FK6 A;  2CK3 A;  1WH7 A;  3EUA A;  3H5N A;  5DDG A;  3CUQ C;  5D4S A;  3HXL A;  3G71 B;  2VBX A;  3IWZ A;  1UD2 A;  2A61 A;  4YG2 F;  5FKN A;  4DIQ A;  2E1B A;  3BQZ A;  2INU A;  2WAD A;  2TRT A;  4Q47 A;  4BS9 A;  3KYL A;  4CXF A;  2VNH A;  3PSF A;  4HIZ A;  3BTI A;  1K78 A;  1G59 A;  1XB2 A;  4TSF A;  2A6E F;  3DU1 X;  3TQN A;  4ETS A;  2B7C A;  3JRI A;  2VOP A;  3NRV A;  3PNY A;  2NPF A;  1KQS B;  1Q86 D;  4YDT A;  1IA5 A;  5KAF C;  4WX9 A;  3W2E A;  3JRH A;  1T0F A;  5JHF A;  4IHT A;  2ETH A;  1ZRF A;  1IN5 A;  3V7A A;  1O8K A;  3LST A;  3ZQF A;  3E5U A;  3SKB A;  1T6Y A;  3CXC B;  1LE8 B;  3U6B A;  3HIF A;  3VR6 A;  3P9C A;  3OOU A;  1JUM A;  1VQ9 I;  4BE2 A;  3EET A;  2GXB A;  2KT0 A;  1BL0 A;  5B1B H;  2COM A;  4OIQ F;  1Z05 A;  2LR8 A;  3CZ6 A;  2PYG A;  1UEL B;  5BQT A;  1VF9 A;  3EUH A;  3IUO A;  4XD7 A;  3PSS A;  4LD5 A;  1U5T C;  3ZPL A;  1F20 A;  3ZBT A;  3BDD A;  2DA4 A;  2CUE A;  4BU2 A;  3Q3A A;  5FB2 A;  3A01 B;  2WBM A;  4GYI A;  3DEE A;  1S29 A;  4N9H A;  2RQP A;  4HYE A;  2DA3 A;  1Y0R A;  3B4N A;  1L3L A;  3KZY A;  4M73 A;  1TWG J;  2UUZ A;  2XUB A;  4NNJ A;  4EJW A;  1DQU A;  4EH1 A;  1YIT B;  3KZZ A;  2V9K A;  1QZE A;  3BTC A;  4AUX A;  5D8L B;  1BR4 A;  4EGY A;  2GK6 A;  5F08 A;  3BCB A;  2R7O A;  2MSY A;  1ZR4 A;  1CF7 A;  5M3M J;  1X3W B;  1OCT C;  2K85 A;  2VNI A;  1I7P A;  1QFZ A;  1LE8 A;  1KCC A;  4LB6 B;  3FF5 A;  2K9S A;  5DEQ A;  5K5O A;  3R6K A;  4MNU A;  5B3S H;  1N78 A;  2MFZ A;  2PMU A;  1BC7 C;  1BPL A;  2BV6 A;  3OEE A;  1AA7 A;  4G1V A;  1G3T A;  2ZZQ A;  2L9V A;  1CZF A;  2WTE A;  2Z2S B;  3P5J A;  3QAH A;  4PC6 A;  4LMY A;  1LUJ B;  3ZUG A;  2OTL B;  2Z16 A;  1IW7 F;  1T95 A;  2EIL H;  1IN8 A;  5C1C A;  1QGY A;  3BWG A;  4L5J A;  3WYA A;  3JRC A;  2FX0 A;  1MND A;  5D6E A;  2P4W A;  1KU7 A;  1JTX A;  4HLY A;  1IDK A;  5FGM A;  5KK1 A;  1H42 A;  1HKT A;  2R6H A;  1IRZ A;  2M1B A;  3HGY A;  3J7Y J;  1N06 A;  2KVO A;  3U2Q A;  1HDP A;  3CCE B;  3MHP A;  2XGE A;  1SFK A;  4XLP F;  2LKX A;  5HVQ C;  2V4J C;  2ZL7 A;  1BJZ A;  3GSI A;  3VMW A;  3BZ6 A;  3QU6 A;  5LFA A;  2O6G E;  2IW5 A;  3BNW A;  3WU0 A;  2E5N A;  4EAT A;  3HYI A;  3GO5 A;  5CVI A;  2LK2 A;  5E3L A;  3SZP A;  4BJT A;  3A8J A;  1TWA J;  2VUM J;  3BR2 A;  1GAW A;  3T9G A;  4ZC3 A;  3LSI A;  5IP7 J;  3BJA A;  1RQP A;  4A12 A;  1MBE A;  4OMZ A;  1GJR A;  4RPB A;  4UUS B;  1T5E A;  5AIQ A;  3OS2 A;  2OK8 A;  3FKJ A;  1DAR A;  2V1N A;  2XT4 A;  5EZG A;  4G6Q A;  1FTT A;  4ZGN B;  1ZAR A;  1X1C A;  3PNT A;  4OMY A;  4OPS A;  4FHT A;  4P3Y A;  3J7A O;  4YAL A;  4NC7 A;  2XSJ C;  4GXO A;  4PSX A;  3ZMS A;  1G4D A;  3I59 A;  2HLD A;  1WVR A;  3LNN A;  4ZYG A;  3I64 A;  4HQE A;  1WJA A;  2UZK A;  3LSM A;  2FUG 2;  4A3I J;  2XEX A;  4LBV A;  3SQV A;  1ZLK A;  2QM3 A;  3SHF A;  4I6Z A;  3U9G A;  4A6E A;  3AGP A;  2P5K A;  3N4M A;  1FWZ A;  1FMW A;  5KSW B;  2DMT A;  3WE2 A;  1WI3 A;  4DW6 A;  4RGS A;  2LKP A;  2GRE A;  3OYF A;  1ACI A;  2P6S A;  1MZB A;  2EPF A;  3E5Q A;  3NAU A;  2Z6B D;  2XPU A;  3U2R A;  2ZNZ A;  1W1W E;  3RQ4 A;  2GK7 A;  4P6Y A;  4UZE A;  1PUF B;  3EQN A;  4Y15 A;  2CUF A;  2OBT A;  2LD5 A;  4CCO A;  1JE8 A;  4XOP A;  1J59 A;  3N97 A;  1V4R A;  4ESF A;  2VBK A;  3F8F A;  1ZGA A;  3MKL A;  5E1Z B;  3ZMU A;  3WTS C;  3GRH A;  2YUH A;  2WAQ N;  2QDX A;  1O8D A;  3H5A A;  2ESH A;  4UZF A;  2ZTN A;  2CND A;  1MKM A;  1BX1 A;  2R7U A;  3K1M A;  1FLI A;  3L2U A;  4EW9 A;  3I4N J;  2TDX A;  3G1O A;  1QGZ A;  1M1K D;  3GUD A;  2O8X A;  2DA2 A;  1OCP A;  4F93 B;  1KGS A;  1KQ5 A;  2WJY A;  5HDN A;  1KZH A;  3KCC A;  2EFW A;  2F43 A;  5FFZ A;  3JQP A;  2RRE A;  4Z4V A;  4UY8 I;  3S1M J;  3K4C A;  3UKG A;  1ETQ A;  3BY6 A;  2O3F A;  2VC1 A;  1BOA A;  4FTH A;  1H8E A;  1WXR A;  3GBG A;  4RGX A;  2ICW G;  3DQV C;  3OYM A;  2FX3 A;  5FA6 A;  2Z5U A;  1VQ7 I;  4IEJ A;  4BXF A;  4XIC A;  2R5Z B;  2NVX J;  3KEO A;  3UR3 C;  1PUF A;  4XN3 A;  2GXG A;  2STW A;  3VOE A;  3L2C A;  3VYU B;  1E79 A;  2JJ1 A;  4YAU A;  2INV A;  1EA0 A;  3ZMT A;  3GFI A;  3RZD J;  1NH3 A;  2D5V A;  4BDY A;  4M72 A;  2O8K A;  1YJ9 I;  5DNS A;  3ASS A;  2OU2 A;  1TBX A;  3S32 A;  1R6R A;  3LSP A;  1P92 A;  3GQA A;  2BY1 A;  5FRO A;  4G6T B;  3J81 k;  2L7M P;  2YS9 A;  3K0L A;  1R71 A;  2V7X A;  2JPB A;  1VZ0 A;  5J35 A;  1GXP A;  1O8M A;  4UV9 A;  3QYE A;  3L2R A;  4Q5S F;  1MJA A;  2L7Z A;  4M9S A;  2XAS A;  3PNV A;  2QQA A;  2FJ1 A;  5LEJ A;  5JLW A;  1RUO A;  1VQK I;  4RPD A;  1KK0 A;  2EB7 A;  1REP C;  3NAR A;  3WND A;  5CJ9 A;  4XRM A;  3OYA A;  3ECH A;  1KJZ A;  2PFB A;  4YAF A;  3AKZ A;  2BGI A;  2DCU A;  1B9M A;  2CMP A;  2XNC A;  2EA2 A;  2A5W A;  5FNZ A;  2OYN A;  2O7O A;  2Z33 A;  3JSO A;  2BOL A;  3HOZ J;  4MQV A;  1Z3Y A;  2LMD A;  2LRD A;  2UXX A;  3PFI A;  5J3L A;  3OY9 A;  2HPM A;  6PAX A;  3HPH A;  3TMO A;  3G1M A;  4HAM A;  2BM7 A;  2WAQ A;  4G7X A;  2AQF A;  2L9R A;  1AMO A;  1HA3 A;  1DBG A;  4NC8 A;  4A5M A;  2E2H J;  4B1R A;  3ONY A;  4CCL A;  1O8G A;  2OF7 A;  1R5N A;  2I10 A;  4H9G A;  4P1V A;  1P4X A;  4BUP A;  3WTU C;  2X6Y A;  3LA7 A;  1YJ9 B;  3ZQQ A;  3P26 A;  5FLV A;  2EWN A;  3FX3 A;  3VYT B;  2WY7 Q;  1JJ8 C;  3PQK A;  3SDG A;  1Q1H A;  2UV1 A;  5F0H A;  4QTR A;  2NAZ A;  2XZP A;  5ILU A;  5JVT A;  1FX7 A;  4Z4S A;  2BSP A;  3C3W A;  2CFO A;  3FKS A;  1JHF A;  3M8E A;  2L2O A;  2HDD A;  3PIO F;  1SAU A;  5LBQ A;  1DG1 G;  4M53 A;  3H3V K;  4PGG A;  4ASU A;  5E3M A;  1JRG A;  2QKM B;  2QEX I;  3D26 A;  1D0Z A;  3T51 B;  3RCO A;  4OIO F;  4U9U A;  5J6X A;  2K3P A;  5DV5 A;  3I56 I;  4B4D A;  3WY9 A;  5CKT A;  2CQN A;  1XGN A;  4P9U A;  3OV8 A;  2CBX A;  1MBG A;  1V5F A;  2DFF A;  4JOM A;  1EH8 A;  4L18 B;  4OJO A;  4RAF A;  3PO2 J;  3CES A;  3ZMZ A;  3RYP A;  2DN0 A;  3CDH A;  4U7B A;  4BQA A;  2WV1 A;  3HOW J;  2HYG D;  1QHG A;  2JA6 J;  2WZN A;  2PEX A;  2PMD A;  3L2Q A;  1WMR A;  5ICE A;  4KKS A;  5GAE J;  1RI7 A;  3HRS A;  5J8C A;  5LD2 C;  2IS4 A;  4D5F A;  3BR3 A;  3M8F A;  4B3G A;  5D6F A;  4KIT B;  3HDD A;  1MJB A;  3LQE A;  4HF2 A;  4XKV A;  2MBF A;  5D5X B;  2FEZ A;  4WZL A;  3JCU C;  2HVR A;  1YFH A;  1TYX A;  1TNS A;  3M3Y J;  3S2H J;  1MH4 A;  1ZK8 A;  4FE4 A;  4GCV A;  2JA7 J;  2O61 A;  1RRJ A;  1FOY A;  3W5V A;  1MBF A;  3K4N A;  2CGP A;  3DP7 A;  5L3D A;  3ZMD A;  1X2N A;  2IRF G;  4XNF A;  1ODD A;  1WGX A;  5GV7 A;  2ZJQ F;  5M5X J;  3WU1 B;  3OR2 C;  5J1U A;  2NTB A;  4I0A A;  3SZE A;  2VB6 A;  4PGH A;  4UAJ A;  3R6J A;  1HKS A;  3LWF A;  2QGG A;  1KYZ A;  3QOP A;  2R4G A;  3BG5 A;  4GO1 A;  4D7N A;  4RB0 A;  4MEX F;  1QPM A;  3ROU A;  4XKW A;  2YX4 A;  2QEX B;  5E8G A;  1K4T A;  3JU4 A;  2M0C A;  3DV8 A;  4QUZ A; 
#chains in the Genus database with same CATH homology
 4KIS A;  2MYS A;  4C30 A;  2ZZE A;  1P9Q C;  1OLT A;  3PJR A;  3M1C A;  1O8L A;  3LMW A;  1MW7 A;  2JVG A;  3OE7 A;  3OAA A;  3H5R A;  2XND A;  4RMN A;  3QOE A;  2A6T A;  4CCJ A;  1N77 A;  4Z06 A;  4H4K C;  2LY1 A;  3ZR8 X;  2L5Q A;  4PMH A;  2X6W A;  1W0K A;  2OUM A;  1X0C A;  2O04 A;  4MR0 A;  1MNE A;  1X4O A;  2IGK A;  4E7Z A;  1D1B A;  2K9M A;  3CF2 A;  2VBE A;  5KCM A;  2XF5 A;  3TL4 X;  4AYB A;  1X1D A;  5AMV A;  1X1A A;  4B47 A;  4TKO B;  1KTW A;  2JJ2 A;  3W2V A;  4DOZ A;  2R7V A;  2KMU A;  1EFR A;  2ELJ A;  1BOB A;  4P5O A;  2V6E A;  1BLI A;  1KMH A;  3WQZ A;  1GQ8 A;  3J7A Y;  1LKX A;  3MKW B;  3A2K A;  3T56 B;  2DT7 B;  2XOK A;  2AQE A;  2IGN A;  1Y56 A;  1U0J A;  4HST A;  3ZGK A;  1D1C A;  4MLO A;  1TZL A;  5KHD A;  4XLA A;  3OL4 A;  2Z1D A;  4OAZ A;  1EE6 A;  2LBF B;  2IXS A;  4RLF A;  3KRG A;  2W7N A;  2CH0 A;  1N75 A;  2WPD A;  1DP3 A;  4P22 A;  2ZTG A;  2O0W A;  1WJB A;  4ANJ A;  2Q2E B;  4JQF A;  1K5C A;  1Y6I A;  2QKL B;  3UNG C;  1OFL A;  4PJJ A;  4OJ5 A;  3JUR A;  2QE7 A;  5C1E A;  1G8X A;  3C2G A;  3IAS 2;  4IQJ A;  4HG2 A;  3T53 B;  3ZPN A;  4CCN A;  3WWG A;  3SDB A;  4CA0 A;  4PJM A;  3HAG A;  2W00 A;  4HSR A;  1FMV A;  1O8I A;  3ZCO A;  1OGM X;  4N4O B;  5KNL A;  1UD4 A;  1WJF A;  2IQ7 A;  1YX3 A;  4XLE A;  3LFU A;  3A35 A;  2QX3 A;  2M7B A;  4DBQ A;  3DU6 A;  4YXW A;  4RLQ A;  3PUB A;  1V5E A;  3AFH A;  3DLA A;  3OW7 A;  4G7W A;  2NST A;  1D1A A;  5TGT A;  1HG8 A;  3H9Q A;  4E7S A;  1Z7L A;  3EPZ A;  3NWS A;  2HU9 A;  2XAU A;  3BG7 A;  3VSV A;  4C9Y A;  3DPT A;  3OYK A;  2K5C A;  4LG3 A;  4XKB A;  1Z21 A;  1E3X A;  3AL0 C;  1UD3 A;  1MMD A;  2WJV A;  4XLC A;  3LSK A;  2VL8 A;  4XR6 A;  4OJL A;  2X53 S;  4DNR B;  3GQ7 A;  3A4C A;  3W3C A;  3BC8 A;  3DPL C;  4DJA A;  3G2B A;  4BAC A;  3OYL A;  2LBF A;  4KT6 A;  1K6Y A;  4B48 A;  2V4D A;  2WZP P;  4OWR B;  4NUB A;  3ZSC A;  4FAS D;  1VBL A;  4HPQ A;  2XF6 A;  3K4K A;  3OIP A;  4E7H A;  4E7I A;  1OR7 C;  3LSH A;  2PJR A;  3AL0 B;  5HNH A;  2DXI A;  1WJD A;  2W6I A;  3DTE A;  2HZD A;  3H9J A;  1T0F C;  4F52 A;  2GJP A;  3A3B A;  4XL9 A;  2Q1Z B;  3OMY A;  1O8H A;  1BR2 A;  3D5R C;  3RTR A;  2E1M C;  3BG6 A;  4QPO A;  4B3X A;  4BE1 A;  4C2L A;  2HPI A;  2CW8 A;  3FHN A;  4F3Q A;  2UVE A;  2VJJ A;  2ZSH B;  4XN0 A;  3SYT A;  3VST A;  3KEY A;  5CDF A;  2P0W A;  4HWV A;  1E43 A;  4BGD A;  1IRX A;  2F6C A;  1OFM A;  2OC6 A;  4C2T A;  2XZO A;  3ZIA A;  4LIV A;  1S9H A;  3K70 C;  2OV7 A;  2UVF A;  1DGW Y;  2UWM A;  2NSP A;  3OYB A;  1WJC A;  2E1M B;  2LG4 A;  2DT6 A;  3QYB A;  4U87 A;  4PFO A;  2PYH A;  2CV2 A;  3EUH C;  1Z3X A;  1TT0 A;  2BW3 B;  2QY1 A;  1W36 C;  3VSK A;  2WY8 Q;  3DU5 A;  2V7F A;  2Z8G A;  4DBR A;  3GQ9 A;  2BVM A;  1O88 A;  4II2 A;  5CQG A;  4E6K G;  4ZJZ A;  4YEL A;  1W36 D;  2VKD A;  2W1O A;  3S3N A;  2R7T A;  4G6I A;  3IAM 2;  1RWR A;  3K4B A;  3ZXS A;  2JVH A;  2CK3 A;  3EUA A;  3H5N A;  1WTH D;  3HXL A;  5CQE A;  1UD2 A;  1UD8 A;  4DIQ A;  2BVL A;  1PLU A;  2CW7 A;  2DCE A;  4BE0 A;  3OYN A;  2E1B A;  2O0V A;  4Z05 A;  4KKT A;  2ZSI B;  4XLF A;  3SEZ A;  2INU A;  2WAD A;  4HEA 2;  4BS9 A;  3KYL A;  3PSF A;  4B43 A;  4L8J A;  4HIZ A;  2X85 A;  3MKZ A;  1G59 A;  1QU3 A;  4TSF A;  3FY3 A;  2V26 A;  3LSG A;  2X51 A;  2VJI A;  1D0Y A;  3PNY A;  1IA5 A;  3OYD A;  5JHF A;  2L9S A;  3BCA A;  2VPL A;  3KEW A;  2ODL A;  1O8K A;  2MAB A;  4OJ6 A;  4YZA A;  1HA8 A;  3BLY A;  5FRM A;  3W2W A;  2JA2 A;  3VR6 A;  4N4N B;  1AIR A;  3OOU A;  2M0M A;  3BC9 A;  2X8K A;  2O17 A;  4BE2 A;  2VJ5 A;  4ZYA A;  4R79 A;  3PL8 A;  2LZJ A;  1ERD A;  3OYE A;  3CZ6 A;  2PYG A;  1UEL B;  2O1D A;  3IUO A;  4XD7 A;  3SEQ A;  4OZZ A;  3OYG A;  1MAB A;  4Y33 A;  4BU2 A;  4U49 A;  1X4P A;  3NWT A;  4HRI A;  3K10 A;  2WBM A;  1KZL A;  3DEE A;  2IGO A;  4AVZ A;  2W82 A;  4BEH B;  4HNT A;  3B4N A;  3H35 A;  4II3 A;  1BMF A;  1DGR M;  3QYF A;  2UUZ A;  1BR1 A;  2JIZ A;  4NNJ A;  1DQU A;  3MKY B;  3RPU D;  3OFN A;  2V9K A;  4W8R A;  2XC7 A;  1BR4 A;  4IZZ A;  2ZZG A;  3S3M A;  2GK6 A;  2XZL A;  3BCB A;  2GJR A;  2R7O A;  1H8H A;  1H80 A;  3ZRG A;  1COW A;  4MXN A;  3FBI B;  4ZDL A;  3GVK A;  3PFY A;  4NQW B;  3PSI A;  3DKY A;  1KCC A;  2QXZ A;  3VMV A;  2I8D A;  1EA3 A;  2KDO A;  3C2H A;  1E1R A;  1VF7 A;  1N78 A;  2MFZ A;  1BPL A;  1WPC A;  3OEE A;  1AA7 A;  2KP6 A;  2ZZQ A;  4JMQ A;  1CZF A;  2Z2S B;  2VQL A;  3FDY A;  3RSN A;  4GQN A;  2DJI A;  2HVQ A;  2Z16 A;  1T95 A;  3E0J B;  1K28 D;  5C1C A;  3SZG A;  1MND A;  2DOA A;  4OAY A;  2DIE A;  4YZX A;  3QOD A;  2KRC A;  3LL7 A;  4E7J A;  1V0E A;  4E7K A;  1IDK A;  4AU7 A;  1MMG A;  2CUJ A;  1O8J A;  3I9V 2;  3OPO A;  1O8E A;  2KVO A;  5CPR B;  1SFK A;  4BEH A;  2NTQ A;  1NG7 A;  5HVQ C;  1YX5 A;  2KL4 A;  2V4J C;  4BJ5 C;  3G05 A;  4BDZ A;  4F91 B;  3VMW A;  5LFA A;  3A1Y A;  1OHH A;  2X1E A;  4P1W A;  3VYS B;  2E5N A;  3CP8 A;  4EAT A;  3HOS A;  1PE9 A;  1NHC A;  1LDK B;  4BJT A;  2CV0 A;  5FRN A;  3DWL E;  3T9G A;  4ZC3 A;  1E1Q A;  4ZDP A;  3LSI A;  4ZTJ A;  4DNT B;  4QPQ A;  4HNU A;  2JDI A;  3OYI A;  1X19 A;  3L2V A;  3ONQ A;  5HKK A;  2R7R A;  1T5E A;  3M8J A;  2VJ4 A;  2IS6 A;  3BH4 A;  1NRK A;  3OS2 A;  2E60 A;  3VSL A;  3FKJ A;  2V1N A;  5IK2 A;  2WB1 A;  2JSP A;  4FXU A;  1X1C A;  3PNT A;  4E4H A;  4NC7 A;  2XSJ C;  4PSX A;  4D9J A;  2M4G A;  4PJL A;  2HLD A;  3HG9 A;  3LNN A;  4W8Q A;  4PSW A;  2IGM A;  1WJA A;  2KPM A;  3CMM A;  3LSM A;  3MMY B;  1X1B A;  2FUG 2;  2ZFU A;  2F1M A;  1D0X A;  1WFX A;  3CP2 A;  2KZV A;  4IKF A;  1UD5 A;  1W9X A;  3N05 A;  1FMW A;  2NT6 A;  3OS0 A;  2KLO A;  1MMN A;  4YZQ A;  4BL0 B;  3CJR B;  3OYH A;  3VDX A;  3OYF A;  1E3Z A;  3B90 A;  3HC7 A;  3CJQ B;  4GRI A;  3L2W A;  2PEC A;  1HVX A;  2GOX B;  4DGW B;  3H9G A;  1OB0 A;  2Z6B D;  3RQ4 A;  2GK7 A;  3F9K A;  2GOM A;  3D5L A;  3FBN B;  3EQN A;  2LC2 A;  4DK1 A;  1IB4 A;  2JUG A;  4CCO A;  4XOP A;  2X1D A;  2X3H A;  2EWE A;  2VBK A;  4B44 A;  3EQO A;  3TBI A;  1PJR A;  2WSS A;  3GRH A;  3E1S A;  2HVS A;  2LRE A;  4NK6 A;  1O8D A;  3GQ8 A;  3H5A A;  4XM3 A;  2XDV A;  2ZTN A;  3H0D A;  4F92 B;  2R7U A;  4LIT A;  2D3N A;  3L2U A;  4EW9 A;  3DTI A;  2R7S A;  1KON A;  2BW3 A;  4U4B A;  2CUZ A;  4XMY A;  4F93 B;  4IX7 A;  4J00 A;  2WJY A;  4OZY A;  4CUG A;  1XG2 A;  2CS3 A;  2RNG A;  4KJZ A;  2F43 A;  4Z1M A;  4W8S A;  3MD2 A;  2RRE A;  2HQA A;  1V0F A;  3W2A A;  2VAS A;  2HNH A;  3K4C A;  2KQR A;  3VYR B;  1H8E A;  3FPP A;  2M7A A;  3GBG A;  3NE5 B;  3U21 A;  3DQV C;  1NG6 A;  3OYM A;  2R7X A;  1VLY A;  1QHH D;  4BQQ A;  5DN6 A;  4BXF A;  3UW0 A;  2L7K A;  3UR3 C;  1BHE A;  4XN3 A;  1WP6 A;  1LVK A;  1YE9 A;  3VYU B;  1E79 A;  2IS2 A;  2VXZ A;  2JJ1 A;  2INV A;  4XKC A;  1PKV A;  2O5R A;  4BDY A;  3S93 A;  3S32 A;  2WAE A;  1R6R A;  2X6X A;  4BQN A;  3HOT A;  4E7L A;  3GQA A;  3DTK A;  5FRO A;  2WA0 A;  1SKY B;  4G6T B;  1O8F A;  4Z03 A;  1HZE A;  2NZM A;  3K4L A;  1VZ0 A;  1O8M A;  2Y0S A;  4RM3 A;  3OYJ A;  3QYE A;  3L2R A;  1PXZ A;  4PFP A;  5HLT A;  1J09 A;  1NBM A;  1WJ5 A;  3PNV A;  2LY2 A;  4E0F A;  1JTA A;  3K4J A;  3OYA A;  1BN8 A;  2NTP A;  4B3F X;  3AKZ A;  4RM2 A;  2CMP A;  1UAA A;  2R7Q A;  4PK4 A;  2CV1 A;  1I18 A;  2A5W A;  3S3O A;  2IS1 A;  2MC4 A;  3I3L A;  3BCD A;  2PJR B;  3H94 A;  4UZU A;  2BOL A;  1Z3Y A;  2LYC A;  1PYV A;  2MD0 A;  2LRD A;  2HPM A;  3OY9 A;  2VLA A;  3HPH A;  3TMO A;  1RMG A;  2WAQ A;  4G7X A;  3K6G A;  2LH9 A;  2AQF A;  4ITV A;  2ZXH A;  1LFP A;  4D1Q A;  1DBG A;  4YZ0 A;  5HNF A;  4NC8 A;  1V5G A;  3DKX A;  2ZZF A;  1OGO X;  2VQH A;  3OYC A;  3IP4 B;  4PJN A;  4CCL A;  3BCF A;  3OEH A;  1IDJ A;  1O8G A;  5HOO A;  1JI8 A;  4J01 A;  2HDW A;  1RU4 A;  4BUP A;  1I8D A;  2X6Y A;  3ZQQ A;  3D5S C;  2V7Q A;  1ZEL A;  1VJS A;  4FET A;  3ZPP A;  3VYT B;  2WY7 Q;  3EUK L;  2LOO A;  4YEJ A;  2UV1 A;  3HUG B;  2XZP A;  4ZDO A;  3OWT A;  3OIQ A;  2BSP A;  2KRH A;  3V42 A;  2CFO A;  4CZC A;  2D3L A;  4BQO A;  3DDY A;  3FKS A;  2VXD A;  2NOJ B;  3GVL A;  2L2O A;  3S8P A;  4YRV A;  3GQB A;  2K9L A;  1SAU A;  4C2U A;  4XOR A;  4PUS A;  3VWB A;  4XLH A;  1QJV A;  2NT9 A;  3SUC A;  4ZTF A;  4ASU A;  1OOC A;  4CCK A;  1JRG A;  2QKM B;  3OR1 C;  2VQG A;  1D0Z A;  4IQ4 A;  3A3G A;  3RCO A;  3T51 B;  2K3P A;  4CCM A;  2VKH A;  5CKT A;  3HPG A;  4OJO A;  2X1C A;  1V5F A;  3KX2 A;  4JOM A;  2M5S A;  1KCD A;  4XON A;  3CES A;  2R7W A;  4CSW A;  1UD6 A;  1WJE A;  2RQQ A;  4U7B A;  4TT3 A;  5FL7 A;  1QHG A;  3HKZ A;  2M3A A;  3L2Q A;  4DK0 A;  1WMR A;  4KKS A;  1UG0 A;  4BJ6 C;  5LD2 C;  2IS4 A;  3VSU A;  2KHM A;  3GVJ A;  4X0G A;  4B3G A;  2V31 A;  4KIT B;  2F5V A;  2L9N A;  4XKV A;  4Y4R A;  2XF7 A;  4KKU A;  1MMA A;  2WAF A;  2HVR A;  4I84 A;  2VIX A;  1DBO A;  3K70 D;  1GLN A;  2E5Z A;  3OL3 A;  3OOC A;  1QCX A;  2PMZ A;  3K4N A;  2M4K A;  2R9V A;  4NK8 A;  3B8Y A;  4XNF A;  4XQF A;  2VBM A;  2W6J A;  2ZXI A;  3OR2 C;  4Y3O A;  2NTB A;  4CH7 A;  2VB6 A;  4W8T A;  1FX0 A;  3OS1 A;  4F55 A;  1W0J A;  2W4S A;  3HL2 A;  2GJK A;  2F4I A;  3LMM A;  2R4G A;  3DPU A;  3K4M A;  4XOT A;  1E0E A;  2XGJ A;  4URR A;  4LIU A;  4XKW A;  3JU4 A;  2VQC A;  4OJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...