4YELA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 228
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yelA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yelA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yelA02
4NK8A 1PLUA 1KCCA 2O04A 2O0WA 1O8DA 3UW0A 1OGOX 4OJPA 1O8FA 2NT9A 3T9GA 4W8RA 4XONA 1GQ8A 2PYHA 1OFMA 2X6WA 1O8HA 3GQ9A 1K5CA 3LMWA 4U4BA 1O8JA 1DBGA 1O8MA 4XNFA 4MXNA 4XOPA 4NK6A 1RMGA 4OJ6A 2VBKA 4U49A 1X0CA 3JURA 3EQNA 3ZSCA 4C2LA 5C1CA 4XMYA 2NZMA 4OZYA 1PXZA 1JRGA 1CZFA 4XLFA 3SUCA 1OOCA 4XN3A 4XLHA 1RU4A 4Z06A 3WWGA 4XKVA 4XOTA 1O8KA 3VMVA 3VSVA 2O17A 1XG2A 2QY1A 3VSUA 3VMWA 1QJVA 3VSTA 4OJLA 4YELA 2X6XA 4YZ0A 4OZZA 4XORA 2O1DA 4HWVA 2VBMA 2QX3A 2VJJA 1JTAA 4URRA 3GRHA 4OJOA 2NTBA 3FY3A 4I84A 1KCDA 2PECA 2PYGA 5AMVA 1OGMX 3B90A 2INUA 4EW9A 2INVA 3KRGA 1BHEA 3EQOA 1HG8A 4XM3A 2ODLA 4Z05A 1H80A 3ZPPA 4XN0A 1BN8A 1NHCA 1OFLA 2UVEA 4YEJA 1AIRA 2NTPA 2X85A 4XLEA 1O8EA 2NSTA 2X3HA 2VBEA 1EE6A 4MR0A 4YZAA 1QCXA 2NSPA 4XLCA 1PE9A 3B8YA 3GQ7A 2X6YA 4W8QA 2Z8GA 2QXZA 1IDKA 1IA5A 1RWRA 5C1EA 4XQFA 2UVFA 2O0VA 3GQ8A 1O88A 1KTWA 4PMHA 4OJ5A 3B4NA 1IB4A 4XKWA 4XLAA 4Z03A 2NT6A 4XR6A 1O8LA 2BSPA 1IDJA 4YZQA 3GQAA 2EWEA 4YZXA 1VBLA 2NTQA 2IQ7A 2VJIA 4XL9A 4AVZA 1DBOA 1O8IA 1O8GA 4W8SA 1WMRA 4W8TA
chains in the Genus database with same CATH superfamily
3SFZA 1TW3A 3SYJA 4I2OA 2BHZA 2P81A 3K4JA 4B43A 3UW0A 4PGGA 4EJOA 4P6VF 3K2AA 3OR2C 2QEXB 1I39A 3SJPA 3AK5A 2DT7B 5DNSA 1WSVA 2B7EA 2OCCH 4I02A 4F92B 3TL4X 1K5CA 1NG7A 3Q0VA 2HOSA 3KEWA 3HPGA 2LNBA 4CCJA 3KEYA 3GBGA 2IEKA 4CZCA 2E1CA 4ABZA 1QVGB 2A07F 1XGMA 5K5OA 4NK6A 1BW6A 1R5GA 1K4TA 2ZITA 2Z1DA 4XSZF 3ZQIA 5B66C 1B23P 4CA0A 1OYYA 4HAMA 2K40A 2IVMA 4XICA 4PABA 1M1KD 1P9QC 5ICFA 5D8KB 2VKHA 1S3JA 3KZIC 2CV1A 3S2DJ 4XLFA 2ELKA 3GZNB 4YAWA 3PETA 2O5RA 2WAQA 1RU4A 5K5RA 1S0UA 2L01A 2BPOA 2Q1ZB 4EGYA 3PSIA 2DA3A 4M6VA 1V0FA 4A3KJ 4RPBA 5DCFA 1F20A 3ZZ0A 3J7YJ 3HKZA 3L9FA 3MKYB 1RRJA 1SAXA 1YJWB 1I6XA 2P0WA 4B8XA 1R5HA 2EIMH 2HVRA 3CMEI 3N97A 4P5OA 4E6KG 5ICCA 3KE2A 3S3OA 3S3MA 4P26A 1WSUA 4QUZA 1FSHA 2O1DA 3JW4A 5J47A 1FOXA 1V54H 2JA2A 3K1NA 4MIMA 5HS9A 4M0LA 2VKVA 4E70A 2QZ8A 5F6FA 3JREA 3T56B 1NJID 2VFMA 3WTVC 4Q7JB 3KPHA 2KIQA 1IV6A 1YS7A 3IC7A 1QA6A 3Q38A 5HZBA 2VFPA 4EW9A 2E34A 2INVA 3OOPA 5LEKA 3DF8A 4LGWA 2NAZA 2VE9A 1LKXA 4IJAA 1GR1A 3GFJA 4TKOB 4IW3B 2QF7A 5E17F 3O8GA 1E3XA 1OFLA 5IYCJ 2R7VA 4OPVA 1AIRA 3VYTB 3ASTA 3BG5A 5EEGA 3CZ6A 4X06A 1EH8A 1FTZA 3LO8A 3WNDA 3LQRA 2EJRA 2QTZA 4YEIA 1ELOA 2NSTA 1XSXA 2M2EA 4AYBN 1QPIA 2W48A 3IH4A 2R7WA 2ZSHB 3KYLA 4P25A 2R7FA 3MN2A 1JJ8C 2B63J 4G6IA 5HNFA 5CJ9A 4GQNA 1WZ2A 2M5SA 5F4JA 4A3LJ 2EFPA 3HEFA 4G8XA 1ZHFA 2ZB9A 4E7HA 4OOVA 3CC7B 1DARA 3NRVA 3PJRA 4RGSA 3JAMK 3R6SA 5FNZA 5DUKA 5M5WJ 3M07A 4RGXA 4M6YA 1TLLA 4ROXA 2WB1A 4ASUA 3GQBA 5LEJA 5DD8A 4TMWA 4L5IA 1DABA 1OFCX 3A01A 2IS2A 1FRQA 2WBMA 2V1UA 4GYIA 3A0BC 1EH6A 1JGSA 3IAM2 4D5FA 2ELJA 4IPAA 1VQPI 1FY7A 4BKXA 1KQ0A 5FLMJ 2XC7A 4N9IA 2DCEA 2P4WA 4KA4A 2HEOA 4A3FJ 3F8BA 1Y1WJ 1QFYA 4YDTA 3K4BA 3FK6A 5CDFA 3FXJA 3E7LA 4BEHB 1J09A 2K5CA 1FP2A 4RLFA 4B47A 2OV7A 4AVZA 1FLIA 1JA1A 1YI2B 4ZYEA 3BH6B 1BI3A 4MHGA 4G7ZF 1DPUA 2M9HA 1U3EM 3P9KA 4ZYAA 2PMZA 2GREA 1OGOX 1FX7A 3ABTA 3NWSA 4P1WA 2ZBUA 2E7WA 4TT3A 4IOAF 1BOAA 4AIHA 1BLIA 3LMWA 1B9MA 2TDXA 2XF7A 3AG2H 1YW7A 3A1YA 4IF4A 3ZRGA 1CF7A 3W2HA 4MXNA 2XAQA 3TW7A 4EM0B 2F4NA 4RBOA 4IHYA 3UNGC 3FZVA 3I59B 1ZR2A 3ZPNA 3WHBA 4JQFA 2R7DA 2KQRA 2R4GA 3QP6A 4LK0F 1Q86D 2ZC2A 4X6AJ 1X1CA 4NC7A 5KCMA 2ESHA 4QSHA 2BXZA 2V31A 1IG7A 2O03A 3SUCA 4XLHA 3F8CA 1NG6A 1YG2A 2I5UA 1I50J 3WXMA 4RPDA 2A05A 1I8DA 3OYKA 2QY1A 3QU6A 1B4AA 2XGJA 1QJVA 3HXLA 2I1LA 3Q39A 4XBFA 4ZZLA 2DOAA 4NQWA 4NDLA 1O3TA 1QFZA 4QVAA 1YTYA 2GK7A 4W1UA 3I5UA 1ORKA 2MLKA 3BC9A 3LSIA 1JTAA 3CCQB 1UCRA 1TP4A 1Z3YA 1Z91A 2LREA 3OR1C 2K7LA 3FY3A 1WJFA 4BE2A 4CYDA 3TOAA 4DW6A 5AIPA 5TRDA 2G9WA 4YG2F 3BY2A 3I64A 5FD6A 4IX7A 4BE1A 4WWCA 5J1RA 1T95A 1DDIA 2BGCA 3PO2J 2VNIA 1E43A 1G6NA 3DTEA 3G1MA 3M7GA 1ZRFA 2H1KA 2WPDA 4F7DA 1MJ9A 3H36A 1USSA 2E1NA 4UNOA 1W87A 2XAHA 5K7FA 3L00A 4P12A 1SFKA 1UJ8A 5DS0A 4XLEA 1FMWA 1OISA 3K70C 1EFCA 1R4NB 2DMTA 3TOBA 3NE5B 1VQLI 4UY8I 3HOYJ 4X0CA 1C0WA 4LD5A 2FX3A 1QHHD 1MGTA 4W8QA 2IA0A 2QXZA 3WGIA 3GTOJ 5GTIC 2WJVA 3A3GA 2O8XA 2CFOA 1IA5A 2XGCA 1OPCA 1KA8A 3G4SB 1MBJA 5TISC 3MFKA 3RKQA 3RPUD 4FXUA 4RD0A 2QKMB 4UVCA 4AIKA 4OJ5A 3DU6A 3LFKA 3GSIA 1ZLKA 2VPLA 3NAUA 2HLDA 1KMHA 3WNBA 4XLAA 2AHOA 3GZ5A 2VBTA 4BJ5C 3E1SA 1O8LA 5BQTA 1W0TA 4UV8A 3WG9A 3OZWA 3BTCA 4G6QA 3U2RA 3LSHA 5HDNA 3GFMA 3F8MA 3H5RA 4BBSJ 3VODA 4L0ZB 3S1QJ 3BZ6A 3BTIA 1MBFA 5GAGJ 2EIXA 1DBOA 1O8IA 4HYEA 2L5QA 3G71B 1E3OC 1FOKA 4HIZA 2Z2SB 1W0JA 2WC2A 1GO2A 1RC9A 1K6OA 3E5XA 4YIIA 2XVCA 1T8IA 3EYIA 1O8FA 2VYQA 5EZGA 9ANTA 1DDNA 2QN6A 4BQAA 4LG0A 4HF2A 2HPMA 2OD5A 2VBYA 3S1MJ 2ECBA 1XDUA 2NPFA 3CTAA 2K86A 3K1MA 3S32A 3L7WA 2BW3A 4B3XA 4F93B 1MW7A 2L9RA 2WV0A 1GVDA 3CDIA 3M8EA 5IYPA 4TSFA 1HXDA 2V6CA 1RMGA 4OJ6A 1GV5A 5J6XA 3WU2C 4C2LA 3VSKA 4JYKA 1ZG1A 4LB5A 1XFOA 2X48A 4PJLA 2OTJI 4KIGA 3S14J 4EH1A 2VT3A 4PCQA 4WZLA 1WJAA 2M8EA 2QSFX 2RKHA 3GMEA 4I98B 4ZYDA 1HQCA 1GAWA 2DT6A 4CYCB 1FYKA 5J35A 1UMQA 1VQ5B 3WWGA 2OCEA 3C2HA 1U5TA 3V7AA 4FWTA 2ISYA 1YITI 2H6CA 2KFDA 3I71A 1FP1D 2CV2A 1F9NA 4HBLA 5DEQA 1GJRA 2Y69H 3ZQLA 1SVMA 1YLFA 2UV1A 3DTKA 2LBFB 2DY1A 4LBVA 3MKZA 1JJ6C 1GUUA 2NS0A 2VBUA 4Y9UA 3VSTA 2DA4A 2MD0A 3M4OJ 3PNYA 3Q3SA 3ZQCA 4A93J 4YELA 1IN7A 4UUSB 4QIWN 3ASNH 2VQCA 1ERDA 1PUFA 2E36A 4UB8C 1F1ZA 2AXTC 2VBMA 2L4AA 5J1YA 4A5NA 5FJ8J 1E62A 2Q6OA 2DQRA 3G6EB 3HOSA 3GRHA 3IP4B 1HW1A 1W5TA 4OIPF 1HKSA 1ONVA 3RKXA 5IP9J 3WNCA 3W2VA 2C4UA 1X2NA 1AMOA 4DYCA 2Y48A 1FNMA 4UZUA 3F3XA 3F21A 2GA1A 1QZZA 2J5OA 1VQKI 3J80Z 4HZFA 2L7MP 1I1SA 4XN0A 2DTRA 1BN8A 3JCUC 3CF5F 2AXLA 2F6CA 1WXRA 4UAJA 2X9DA 1B72B 4II3A 3I56I 4HE5A 1CNEA 2ZBKA 2L54A 1DUXC 2CQQA 1WQ2A 4C43A 3ZC3A 1I3QJ 1KD1D 2LKPA 4G1VA 2R7OA 2WSSA 4YAOA 2KRCA 2E1BA 2LF8A 2RC6A 4OOIA 2DFFA 1ON1A 3ZOBA 3QFSA 1FC3A 5DN6A 1T56A 4PGHA 4KT6A 2LKSA 1QUFA 4N3NA 4Z4SA 1QRCA 3BTLA 2H8WA 4HF0A 3ZR8X 1SD4A 4HSTA 2LDUA 1TQMA 5A2QK 4AVPA 3HOUJ 2Z5UA 2ECCA 3ZXSA 3LJYA 2DMQA 1LDDA 4RDUA 2QVOA 1S4MA 5A88A 3C7JA 3JRCA 2DLLA 4ZDOA 3K7AJ 2EPFA 1MMSA 1AOYA 5D4SA 2P6TA 3CLOA 3M1EA 3FXQA 1H0MA 1EWYA 4Y33A 5HDGA 1WJBA 2CW8A 4XL9A 1N07A 1MIJA 1ZLJA 2KMUA 3O2PE 4DK0A 4W8TA 1V5GA 3I53A 3HGYA 3GCMA 2GBYA 2XKOA 3OMYA 4AM3A 3L2QA 2VT2A 2PJRA 3LAJA 3HIFA 2KDOA 2LY1A 2OK7A 2XTYA 3CP2A 1ZH5A 3OSGA 1TNTA 2RAEA 1Q1VA 4W97A 1XS9A 3ASPA 2QWWA 3DPTA 5D6EA 2DW4A 3VYUB 4BGDA 1IJWC 4DYQA 4UZFA 2P7VB 3D1NI 2V1DA 1KTVA 3PSSA 1VHOA 3B6AA 3CJQB 2BM0A 2DMPA 4ACBA 3WE2A 3ZSCA 2CYYA 3SKBA 4X8IA 2FOWA 2A5WA 3WY9A 2A5YB 2V7WA 3PUBA 5GTHC 2ZZGA 5B3SH 3BQYA 3GLLA 4OIOF 4RD6A 2FQ3A 5L46A 4Z2YA 3JQPA 5CYVA 1GHCA 3C1DA 1QGAA 3J81k 1SFOJ 2F5CA 1XG2A 1Q9SA 4O5VA 3REOA 4Y7NJ 3OY9A 1WOSA 1TQPA 2Q2EB 4LG3A 3ZMZA 4E7SA 2WR8A 1FBUA 2QA4B 4OJLA 4BY7J 4M73A 3FIWA 2Y0SN 5F4MA 3E5UA 4MYTA 1PDNC 2W82A 3FHNA 1T39A 4BXFA 1QFJA 3QQAA 1GXPA 4URRA 3ABKH 4ZCMA 1YE9A 1S29A 1F5TA 1RQPA 1VLOA 3W6VA 2CC2A 1PJ5A 2BM6A 5L3FA 3FXLA 1WCMJ 2K9SA 1T6ZA 2ZFWA 3CUQB 1BPLA 4HQMA 4YIFA 4XM3A 1HSJA 1O7FA 1Y8QB 3IKTA 2OTLB 1LEAA 4CCKA 4M72A 2N8GA 3H9GA 4DZPA 4DK1A 2OU2A 1WORA 3B82A 5THXA 1ETWA 4IHTA 2HXIA 2PE3A 3BZKA 1SVOA 1K73D 3IRQA 2X3HA 4NC6A 4OAYA 1U0JA 1LNWA 4FT8A 2EFNA 1EE6A 4IXAA 3LSJA 4MGRA 1BOBA 2HS5A 3UR3C 1KZLA 1QCXA 2ZJQF 2WY7Q 1T98A 3RQ4A 2R5YB 1DP3A 4M71A 2X6YA 3OS1A 1PE9A 3B8YA 3G05A 3OOCA 3QP5A 1N77A 4U7BA 4FCYA 1R23A 4YHBA 1BJZA 5E79C 4MQVA 1KRHA 2DDAA 3TEDA 3OSFA 1AKHA 1VQMI 3MZHA 4I76A 2OBSA 1TWAJ 4IEJA 2FMYA 3M3YJ 5E1WA 2F5VA 2PFBA 2X0KA 1YX3A 3B73A 5CLSA 3W2GA 4QPQA 3CMMA 3AVWA 1IB4A 4C3HJ 3CDHA 4IRIA 3RDIA 5FKNA 3E6MA 1LDJA 2CWEA 3BY1A 4ZTJA 3DEWA 2BY3A 3RSNA 1ZQ3P 4I7HA 4KT5C 3PUMA 4TMTA 2ZMEA 4Z1MA 2VFNA 3GQAA 3OYNA 3IUOA 4BHCA 1G7SA 1N0UA 2HYJA 2HQAA 4NB5A 2NRAC 2OF7A 3EUKL 1TSPA 1FJLA 4LFUA 2ZXWH 1E0EA 1D8JA 5LFAA 1S8NA 2FNPA 2VKEA 4U0YA 2LKXA 1P4MA 4ZGNB 1XSVA 2KISA 2RQPA 3P7NA 3TDUC 2OYNA 2XIGA 3AGQA 3TBIA 3BPXA 1VF9A 3BP8A 4M1KA 5EGOA 2NT9A 2GQFA 1BR4A 1OFMA 2JT1A 1QGPA 1USTA 4M74A 5HKKA 5IYDJ 1IW7F 3HB9A 4C0SA 4EJVA 2ZCWA 2HKXA 3PL8A 2E2HJ 1XGSA 2DA6A 2M4KA 5H6RA 1FWZA 2D9RA 2NNYA 1EJ9A 3SZTA 1JUSA 4Y13A 3CUQC 2JA7J 3F8NA 3ZP5A 1Z3XA 4EVIA 3DTIA 1A8PA 4XKCA 2CW0F 3ROUA 2HZDA 2OQGA 4C3IJ 2X8KA 3CCSB 1D8KA 1JRGA 2M7BA 5FRNA 2FJ1A 3IKVA 5E1XA 1JA0A 4Y9RA 3K4NA 1I7PA 2WZNA 1I18A 3A01B 2IAIA 1XQBA 4DYRA 2QKLB 4KICA 3VMVA 4KN7X 3DXJF 3ONUA 3OZVA 2O17A 1IZ1A 2YX4A 3S3NA 2ADUA 1FX0A 2MC4A 2ESNA 3OYJA 3PIPF 1KU2A 1J2XA 1HSTA 2W25A 1HA8A 5GV8A 2WWYA 1LB2A 3V7SA 2RV8A 1K7AA 1DQUA 2ZKZA 2P5LC 4Z4YA 1W5CC 1YHQB 4RB1A 3F6VA 2VONA 4PC6A 2RDPA 4E7LA 1NH3A 3BT9A 4BAYA 2IS4A 2FXAA 2DN0A 3DCFA 4NCNA 2BVLA 2LC2A 3QWLA 1OCTC 1BX0A 3H0DA 4XRSA 3ES9A 1BI0A 2R0QC 2XV4S 3BOQA 2DK8A 3BZCA 1BHEA 3F6OA 5JVGF 1IJFA 1P4XA 2AQFA 5EF6A 1CF7B 1ITYA 4FQGA 2F4MB 2XAFA 1KK1A 1JHHA 5GPAA 2OBPA 1TTYA 2CV0A 4WZEA 2ZSIB 1MBGA 3A8IA 3EUAA 3ZIAA 2VFQA 2E2IJ 2BF4A 1B9NA 2ZXHA 1WJCA 4M6XA 2ZL6A 4QPOA 2E1MB 1VQNB 2QM3A 3OV8A 3HTUA 3LNQA 5DS9A 1UHWA 3E97A 4HDVA 2XROA 3KLNA 4RCZA 1QQIA 1V5EA 1QA1A 4N4OB 5E3NA 2J8IA 4ENKA 3IWZA 2K9LA 2HDWA 1JJ2B 3KP4A 2X3UA 3L2CA 1XGOA 3CESA 5FO5A 4E4HA 2HNHA 1OR7C 3H9QA 2M34A 2D74A 4NQWB 3J81Z 3G1OA 2XKPA 4XKWA 5JMCB 1VI0A 2LOOA 1O3SA 2GM4A 2IXSA 4HV5A 5E18F 2DI3A 4U0VA 3JR9A 2HQNA 3A1PA 2A6EF 4AU7A 4ITVA 2DPDA 1DGRM 2BMWA 2JUCA 4L5EA 4TV7A 2M45A 1K61A 5FKLA 3ZQHA 3MCAA 4BXXJ 3CC4I 4M9ZA 3TO9A 4EATA 3A8KA 3VWBA 2EFOA 2ZZQA 1A04A 2VQLA 1OCOH 3KP3A 5DYMA 4GDFA 1J0RA 2MFZA 4V2FA 1B59A 1R71A 3E20A 1Z77A 1H8EA 2V1XA 1RESA 4F55A 1Z6RA 1KU3A 1R7JA 3O6BB 5JI6A 1AU7A 4W8RA 3DDYA 4Y4RA 5LHHA 3U1DA 1YJNB 3HAGA 4U4BA 2O6WA 1JT6A 2LRDA 3E6CC 1I27A 1Z9CA 2FX0A 2W85A 1X4PA 1K78A 1STZA 4N9HA 1VTNC 1TL8A 1QO0D 1SD6A 4BH9A 5TV2A 3JX8A 4A2UA 3V7CA 4D7MA 2V7UA 3HC7A 1A35A 1CZFA 3BJ6A 3MCZA 3VO2A 5GP9A 1EP3B 4DNTB 1VNDA 4WCGA 2DJNA 3NEUA 4OU0A 2XPUA 5IYNA 1IV8A 2MBFA 4BL0B 1O8KA 1XB2A 2Z16A 4LB6B 1RETA 5CPRB 4UVAA 1H8AC 4Y7CA 2XT2A 3OPOA 1WGXA 1E1QA 3UKGA 1P7JA 3K0LA 3HKZN 5GAEJ 1HKQA 1EKEA 1NHAA 4RM0A 5EG0A 2E2JJ 5DCMA 2X6XA 2VJ4A 5GPCA 1MBKA 3O8HA 2W84A 4D0PA 2STWA 3CW2A 3SDBA 1XE1A 1MBHA 3E6DA 3NQOA 1RKTA 4JP0A 2XUBA 2JVGA 3ZMTA 1RR8C 3ML6A 1D3YA 3B90A 5HOOA 4Q47A 4M53A 2XZLA 3QYFA 3EETA 2QUFA 4S04A 1VQ8I 1IUFA 5DV5A 2XRLA 3OYBA 1TVCA 1SVLA 2BN4A 3KZYA 3U1KA 2G0YA 1UMKA 2D3LA 4IVNA 2CG4A 2R7RA 5ERIA 4HQEA 1VQ9I 3V42A 1IJEA 3GW2A 1EP1B 2MSYA 3BR3A 1YJ9I 4M2LA 5E6TA 3AG1H 3LWFA 2H27A 1MDMA 1V3FA 3I9V2 3KLOA 2B7BA 1T08B 3T5XA 2LY9A 1T38A 4ZDPA 2VODA 5FFXA 1N0VC 3WTSC 3JSOA 1RI7A 2KIMA 2X51A 2BV3A 5KVRA 1F43A 5IK2A 2R93J 1G3WA 5FRMA 2QQAA 1U5TB 4XRMA 2ZXJA 3GUDA 4P9SA 2Z8GA 1VQ7B 1X3ZB 2PMUA 1IN8A 3VB2A 3JQQA 4CICA 1SFUA 1H9GA 1KZHA 2FRHA 1PVEA 3MD2A 3CCLI 3LQ6A 3LQEA 4N3GA 4L9VA 2BX6A 2X6OA 4RDKA 3LSGA 2WB1N 1VQKB 2EFGA 3K6GA 3CD6I 1PUFB 1Z05A 1H9TA 1F60A 1ZYRF 1MJAA 4A0YA 1AA7A 4X05A 2BSPA 1BR1A 2CUEA 3ULQB 1D1AA 3H5AA 1H42A 3CB4A 1VBLA 1FYMA 3Q3AA 2FBIA 4MYUA 2XTXA 3B78A 3HOXJ 3RPQA 1FDRA 2R5ZB 3F0CA 1OCRH 3M8JA 1WI9A 3EYYA 2CF4A 2W6IA 4DJAA 3ZPLA 1VZ0A 5HLGA 2PMDA 2Q6KA 2KZGA 1JGGA 5K7ZA 2PMZN 1V0EA 4XK4A 5IT9K 2HQRA 3BC8A 4J00A 1K28D 3FKJA 4Y52J 4PUSA 1FT9A 3HSEA 4UV9A 3HDDA 2COBA 2BY0A 5K1YA 1YYVA 2ZXIA 3OYCA 3OEHA 1P4AA 1YRNA 1GDTA 2R7SA 2A6TA 2YS9A 1ACIA 1QA3A 4P3IA 1HA3A 3CQZJ 5FD5A 2XEXA 3FXOA 2XDVA 1FBSA 2VBWA 2XPWA 3F72A 2CU7A 3S93A 5TY0A 4HPQA 2H09A 4GCVA 2VKDA 2YU9J 5ED4A 2MABA 1HW5A 3HUGA 3P9CA 2XF5A 3VNUA 4HW0A 5HODA 2BYVE 1R1VA 2R7XA 1CNFA 3K70D 1U9OA 2FA5A 1A36A 2V7FA 2EB7A 3NAWA 2K27A 4I0BA 3GTPJ 3S17J 2E60A 3PVDA 2E1RA 2GIZA 4L18B 1KQ5A 1YIOA 1NK3P 1QVTA 2HKOA 3M9AA 1T33A 2BOLA 1ZTRA 3OYFA 5ILSA 2KJBA 2MA3A 4IO9F 2VJJA 5BSYA 2BZTA 1J5YA 2PJRB 4AIDA 1POGA 1ZAOA 3OFNA 1ZN2A 2O0YA 4FETA 3SJZA 2MD5A 4Q5SF 3HOZJ 2PYGA 5AMVA 3RJPA 2QSHX 2IA1A 2R7UA 2VNKA 3QU3A 3MMPA 1R6RA 1D5YA 3OYDA 4RGRA 3W6KB 2C4TA 2QGGA 2UXXA 4QWQA 4FX4A 1K4ZA 1SFXA 3WE3A 2J8KA 1SFEA 1SD7A 1E3ZA 1OYWA 2E71A 4YEJA 2VBXA 5KAFC 3BNWA 4X1EA 3BR6A 1R5NA 5JFRA 1MKMA 2DFIA 3JRIA 2GIVA 4ESFA 3PUFA 3CCEI 1TUIA 2RNGA 4GFBA 1VQ6B 2F2EA 2J7KA 2LG4A 3RTRA 5K5QA 2CH0A 3BH7B 2VQGA 3CMYA 2PQ8A 3AFHA 3BROA 2NVTJ 5D5WB 2HU9A 1XDSA 3BG7A 5EYRA 3CPXA 2PEXA 3BCDA 2CW7A 2XTWA 3BTJA 1LUJB 4AC0A 1CQTA 1XG1A 1VQOB 4P96A 3ASOH 2GOXB 1IHMA 1WWXA 2A69F 3FX3A 3JRAA 4ESJA 1LVKA 3IH2A 4EQQA 1F4KA 3GTKJ 3DQVC 2L02A 1W7PA 4YFXF 3OP1A 2Y9YA 1WH7A 1I3AA 1QGYA 4TMXA 1FZPB 1XTAA 2V9VA 3WYAA 1IDJA 4I09A 4RAFA 4JBAA 1YX5A 1YLOA 4NBQA 4IHWA 2FQ4A 3JRBA 1L0OC 3BLYA 3MZ8A 4UZEA 1V4RA 2EZIA 2VJIA 2Q6LA 3QFCA 4CXFA 1D1NA 1EFTA 1WMRA 1DU0A 4YALA 2DOGA 4I99C 2EINH 1G7RA 2O04A 3DBLB 1FOWA 1S7EA 1KONA 3QSYA 3QPTA 4R71A 5F4OA 4G9YA 3SXYA 1FYLA 3U21A 3DU1X 2W4SA 1U2WA 3FWEA 4KYWA 3SHFA 5L3DA 3RYPA 4KIBA 3FJOA 2C6YA 3CCMB 1N8RD 1GAQA 1X4OA 1OFEA 5JHUA 3OYHA 2HXOA 2MW8A 4RB0A 2L7FP 4WWVA 2R9VA 1JHFA 4U0WA 3CO7C 2XF6A 1NK2P 1JXSA 4DBRA 1X0CA 5C1CA 2CQNA 2QE7A 2EV6A 2EA2A 1YOVB 3ZMDA 4B1RA 3CC2I 2PJPA 2JIZA 1L3LA 3OW7A 3KP7A 1KK3A 1K4SA 3C2GA 3I55B 2QBYB 1FIAA 3KCCA 2BY2A 3JTHA 4LLNA 2JSCA 1UZCA 4D5CA 1TYXA 1VQ4I 1LFPA 2DOFA 4QV2A 4Z4UA 3HZJA 2DFEA 2VJ5A 3IWFA 3JQRA 3ZZTA 1OQYA 1Y0UA 1D0XA 2QGUA 1YS6A 3VSUA 1X2MA 3VMWA 2ZMEB 1R5BA 2OK8A 2DT5A 3VOEA 1S72I 3DU5A 3QAHA 2C5BA 3W6JB 3OL3A 1Y56A 4DQKA 4XD7A 2DFHA 2BGJA 4M3DA 4HWVA 2QX3A 1X19A 1QNTA 2IRFG 5JBQA 4OJOA 4B44A 5L3CA 2QEXI 1JKQC 2NXNB 4BS9A 1YIJB 3DV8A 1VFCA 2CS3A 2ZJPF 3EPZA 4A6EA 5C3EJ 2CFXA 2VQHA 3FXMA 3OIPA 3R0AA 3PSFA 1YW8A 1RUOA 3N05A 3V76A 1NHCA 4HX4A 3IV5A 1B8IB 5LRRA 4RS8A 5EJCA 3V8JA 1BC7C 3HHHA 3QRFF 3MEXA 2XASA 2W57A 3WG7H 1TBXA 1BL0A 3H0GJ 3W2IA 2VBEA 2IGKA 3WBJA 2OAZA 2QYUA 5CVUA 3BJAA 1TWCJ 2OPTA 4CHUA 1RIOH 3CMAB 2PLFA 3P9IA 2EIKH 1UD2A 5E20A 3DEUA 2WAEA 1TWFJ 4G6DA 3SZPA 2XB5A 3ZN0A 2BM7A 1E2XA 1LFBA 3BWGA 2DBBA 1YJWI 2VXZA 2XGDA 2XZOA 1D1BA 3L2WA 1FNDA 1O88A 1FOYA 1TWGJ 3ZMVA 2DK5A 1B6AA 3SQNA 3CP8A 5ICGA 3L09A 3HRMA 2NVXJ 4HLYA 5A8AA 2Y2ZA 2MGQA 4PFOA 3I4NJ 2WV1A 2XC1A 4PMHA 3GVKA 1BM9A 4RD3A 2B0RA 4Q4ZF 2B0LA 3BY6A 2PI0A 4EV0A 3GTMJ 4X7DA 1IN4A 3H1CA 3H3UA 4OWRB 4U7DA 1WPCA 3X2QH 2E35A 2JRMA 2JDIA 1ETVA 2XOKA 1MMNA 1S7OA 1HDPA 2OA4A 3OL4A 1TQIA 3QODA 2M7AA 4NC8A 1Y0YA 2BGIA 2UZKA 4OPSA 4G12A 1AIPA 2IS6A 4WXHA 3G73A 1WDTA 3CCUB 3RIQA 3K4MA 3W2FA 4A12A 4P3YA 2HYFA 1Q7YD 1MMDA 4UHTA 2ZJRF 3TH0A 3HRSA 2ME0A 1XSDA 5ILVA 2DYRH 1Y6IA 1OCZH 2IGNA 1XMXA 4C3JJ 1W35A 1TT0A 2IJLA 1IO2A 4MEYF 1Y8RB 1OB2A 2LR8A 1G3YA 1UG0A 3S8PA 4CO8A 5ILUA 3ERED 3MMYB 4A3MJ 3GVLA 1IDYA 2B9SA 5D5UB 2XGXA 4ASNA 3V8KA 1OYIA 2FMLA 2DJIA 2P5KA 3W5VA 2GA2A 5J40A 2BSAA 2ZL7A 5TR9A 4XMYA 3PQKA 5JHFA 4Q48A 1MH3A 2ZZEA 2OBRA 1QUEA 1JTYA 3CJRB 3C18A 5E1ZB 1IXSB 4P6YA 1OB0A 3CCRB 2QZAA 5BPDA 1R36A 1EFRA 4J19A 1V55H 3ABLH 2ZNZA 1YQAA 4ZV4A 2EIJH 5IOZA 4KUMA 5IYQA 4YFOA 1D5VA 1IRFA 5C4XJ 4ZDLA 3CCJB 1QQ1A 2M1BA 2X4HA 1O3QA 3P4GA 3SY2A 2V1NA 1ZKGA 2HVQA 4YRVA 3F8FA 5FLXZ 4BDYA 1YI2I 2XAJA 1PYVA 4OZZA 2DA2A 1YO5C 4HV6A 4F91B 2VE8A 2MLGA 3I59A 2XZPA 3VDXA 5LGNA 1N08A 3BCBA 3VEPA 5K7HA 1HKTA 2WTEA 2K9MA 1UD3A 1APLC 5KK1A 3HSFA 2IOUG 1MMAA 3LOCA 2INUA 4RMNA 3KRGA 3I4PA 4BNCA 2YUHA 4PJJA 4G94A 4PGOA 1T2KA 1UB9A 4CSWA 3BG3A 4CUGA 5HDKA 3D5LA 2LZJA 1P4WA 4XIDA 4BJTA 4MTEA 1TYUA 2H94A 3ASRA 1BJAA 4RAYA 4HNTA 2YU3A 4KKTA 3OEEA 4XLCA 2XB0X 1R1TA 2KDZA 2FE3A 3PA2A 2AQEA 4QHYA 5C1EA 4Z4TA 2ISZA 4D1QA 3ZQQA 1GT0C 3GLXA 5DTDA 5CKTA 2Q0OA 3GZ6A 1XMKA 2IS1A 4B3FX 5DM6F 2JJ1A 5EMNA 2G7UA 1RZ4A 1R4MB 2LYCA 3OYIA 5AIQA 2BBYA 3OOUA 5EG0B 5DCMB 2A6HF 2KRFA 2W24A 1N06A 1Z67A 1U78A 4YAUA 4RLQA 3CCQI 5HVQC 1XCBA 4QTRA 5F1JA 4JX4A 3CXCB 1WH5A 4LITA 2F4IA 4N4NB 2O3FA 5J8FA 3OYEA 2IQ7A 3CMEB 2R3SA 4ZJZA 4G7OF 4RDLA 2V26A 4ENMA 4RB2C 1H88C 4PJMA 2JQ7A 1OCCH 4YFKF 2LSOA 1DU6A 4J01A 5LHGA 5D5VB 2BE5F 3CO6C 1JTXA 1ON2A 5H2FC 1XB4A 1SKQA 3MKLA 2VZLA 1O8HA 1D0ZA 5LMZA 3GTJJ 1MDMB 4OINF 2Y0SA 1Y39A 4PC1A 3I3LA 5DDGA 2BM1A 3Q0UA 3GTQJ 2PN6A 4CGZA 2DETA 4CH7A 4BY1J 4DNRB 1O7LA 3EUHC 1LJ9A 3JURA 2TCTA 4ON0A 2HFHA 2KL4A 2IBDA 4HDUA 3SQVA 1KU7A 4TMZA 4I0AA 5CVRA 3K4KA 2GXAA 5HLIA 3G4SI 1JE8A 2NVQJ 2CGPA 1IN6A 4OZYA 2DODA 2JVHA 3JRFA 3CCVI 4NNJA 2Z33A 2L0KA 4IRHA 1JNYA 3WBKA 2DIEA 1XCVA 2QMUA 4Z06A 5M3FJ 1Z1DA 2DEUA 2P7CB 1E3HA 2K4JA 4OPOA 3E6BA 4M9XA 3JSPA 4E7KA 2LH9A 3L2RA 1SM4A 1P92A 3QOPA 2F5FA 1JT0A 2QDXA 5B1BH 1ZG5A 2H6BA 2UUZA 4M3EA 4ZCIA 2D1VA 3FXRA 1ZM2A 1ETOA 1ZRCA 4YZ0A 4ENJA 3G71I 3RI4A 2FU4A 5HLHA 2M0MA 2VXDA 4AIJA 1JKOC 3U6KA 5FB2A 3HRTA 1VQPB 5B5EC 1XX5A 1DG1G 2VASA 1U2RA 5FKKA 1KCDA 2RQQA 2GQQA 3PFYA 1G4DA 4F3QA 3P27A 5H6QA 4ENNA 3DKWA 2XSJC 4CYCA 3WTZA 2O9LA 5DSZA 4L9JA 3EQOA 4KN4X 3M8FA 4LJZF 2Z6BD 3TP0A 4BQQA 3ZBUA 3R60A 3JAMZ 3VNVA 2L9NA 4F52A 1V5VA 4P1VA 1K9MD 1GV2A 1S5LC 4EGZA 4WZTA 2ZTNA 3LVBA 2X85A 1DGWY 4XSXF 1IXRC 2JPCA 1Z7LA 3WU0A 2W7NA 1RQRA 4EM2A 1KQ9A 2DDBA 2Z3YA 4FISA 2P5VA 1ZR4A 4A3EJ 2ZJ2A 3HG9A 1VQ5I 2MC3A 4OOXA 2P6SA 3SLDA 3I0TA 1ZRDA 1JKRC 2CW5A 2H1LA 2VBSA 1NRKA 1JUMA 3J80K 4ZTFA 3HUGB 3AGPA 4ETSA 1IRZA 3GFLA 5C44J 1FRNA 4YCQA 1GXQA 2ZO4A 1RWRA 3DPUA 3S15J 4XQFA 4GRIA 2F1MA 2UVFA 5H5JA 4HX8A 1J7KA 2WYRA 3T51B 1GVHA 5FL7A 4A3IJ 3BDDA 1UHSA 2DU9A 4FASD 2DXIA 2JJ2A 1Q81D 1SAUA 1U6GA 4K2EA 1U8BA 2AHQA 5F04A 1B72A 5LRSA 3SJMA 3QYEA 4HOBA 1COWA 4PJNA 1K83J 1P6RA 3V8LA 4YZXA 2Y0MA 4A5MA 1REPC 1HOMA 4AC9A 2OZUA 2XRNA 1O8GA 2M5WA 3HYIA 3AL0B 4P2NA 1IUYA 1T5EA 3S2HJ 4UB6C 2VNHA 4RD1A 1O3RA 3U6BA 3ISXA 1U9NA 2OQRA 3BJOA 1X3WB 4A3GJ 2XNDA 2YWHA 2WY8Q 3ZQGA 1FTTA 4DNCA 2B5OA 4FE7A 4XRFA 1QG0A 3MAJA 1G8XA 1FIPA 1XGNA 5IYBJ 2VOPA 1SEUA 2HCJB 3QOEA 1MH4A 1W7PD 2KIUA 4U49A 3K4CA 3QFRA 5FLVA 2RC4A 2K3FA 1JI8A 2HMAA 3KEOA 3H5NA 2PG4A 2CSOA 2YPRA 3F9KA 2YSRA 5BOXA 2H8RA 3Q0WA 2W00A 1VQLB 5BS6A 1G7CA 2PLYA 3LA7A 3MQ0A 1R49A 2C2WA 3HM5A 3OYAA 4LC0A 1JKPC 2IGMA 2KP6A 5FLXK 2ELHA 4R79A 3R61A 3OS2A 2L7KA 3L2UA 3S2WA 2V9PA 5CQGA 4ACAA 1WPKA 2KT0A 3FXUA 1HZEA 4CQJA 1EV7A 3Q9VA 4RB3C 2V9KA 3D5SC 3LSTA 2R6HA 3LSRA 1X1PA 2JJ7A 5J3LA 2V5IA 4P9FA 2JA5J 1ZM4A 3R6JA 2DA1A 2QCOA 4BYYA 2BXYA 4WZKA 4JK1X 3MHPA 2XAUA 3A02A 2LF7A 3CUOA 3TO7A 2B7CA 1E64A 3CC2B 3QYBA 1FSEA 2CRVA 3JTGA 1HDDC 1TWHJ 3Q9SA 3ZQ7A 3J7AO 2WAQN 5FGMA 3ZPPA 2E1MC 4MO7A 2F43A 2PBIA 5HLTA 1DP7P 4JMQA 3AVTA 2DMUA 3J7ZI 1IC8A 3BCFA 3H9NA 2MYSA 3BR1A 1BIBA 2BVMA 4LLLA 2E19A 5J4YA 1N78A 3R0JA 5B1AH 2COMA 1W36C 1Z21A 2M87A 1IAWA 3M1CA 3BH4A 1S72B 2NS8A 1KQ8A 2OZ6A 1NBMA 4P22A 2DO7A 2M8GX 1W4MA 2RC5A 2YUSA 5HNHA 4MEXF 1A5JA 1TLHB 3WU1B 2V79A 4CCOA 5J1UA 4S0HB 2OBTA 1TTTA 2OTJB 3MKWB 2OUMA 2WAFA 4OM9A 4LG0B 1KK2A 2ZTGA 3HRUA 4LIUA 4G7HF 2QA4I 1T6SA 2EA4A 3CUQA 2NV4A 2BW3B 3DPLC 2VB6A 3FMRA 4YXWA 1YITB 4XLNF 4X7FA 4E7JA 3A35A 2IT0A 3I1FA 3CJTB 3WGHA 2GJRA 5IOYA 4OMZA 3WODF 2M3AA 2X1DA 2A68F 4QVJA 2VI6A 4N0BA 3KETA 3W5UA 4UVBA 3RY8A 4BU2A 4J0QA 2JWTA 3ABMH 1DDGA 4AF7A 1QRBA 1KYWA 2ZNYA 3FKIJ 4Z6YA 1LPQA 3COAC 2R5YA 3OJXA 2NS7A 3AVVA 2OTLI 2X0LA 5E8IA 4IHXA 1ENHA 1LLWA 3DFGA 1WU8A 3A4CA 3E0JB 3H35A 2PIAA 3NB2A 4HNVA 2LMDA 2DPUA 2XPVA 1HVXA 3C2BA 2Y9ZA 4P55A 2KHMA 4BJ6C 1FNBA 4QLCU 3IHUA 2JN6A 1O8MA 3DBHB 5HS8A 4XNFA 3ESWB 3LSPA 1Z0XA 3K10A 3GO5A 3FKSA 2R7QA 3F22A 2HPIA 2NVUB 3L2VA 1U8RA 3I54A 2AO9A 2IGOA 2XAGA 2X53S 4DGWB 2D5VA 3I56B 3FMQA 2LY2A 3ECOA 4FK8A 2VLAA 1OMIA 4WX9A 3L1PA 2GK6A 2NZMA 1WTHD 3SEQA 1VLYA 3B8HA 4KKUA 1IF1A 5J3OA 1PXZA 2VFOA 1KQSB 1OOCA 1EXMA 3WTUC 3DKYA 1ZM9A 2HI3A 3A2KA 3AVYA 2HQ5A 4OAZA 4XOTA 2FVGA 3CF2A 2XHKA 5J4VA 4L9NA 2UWMA 1SKYB 3ISPA 4M3GA 3W2AA 4AUXA 3IRRA 1ZREA 1IB0A 5JLXA 2XT4A 2EFWA 2PX9A 2K9QA 3R4KA 5TJJA 1LDKB 3HOTA 1OJLA 2Y30A 2I10A 2ZFUA 3SZEA 2EILH 5E3OA 3LFUA 2GZWA 4M4SA 1KK0A 5FKMA 2JRTA 4RJLA 3VR6A 1YX2A 3PFIA 5M5YJ 1K79A 2R7ZJ 1OR7A 3HGGA 1X58A 2WADA 3LSMA 4X0GA 4C2TA 2GXBA 1WSRA 3WGGA 1EF4A 2PECA 1P7IA 3ZBTA 2CRGA 3OE7A 3OYLA 1HF2A 4U88A 2EZHA 3GYHX 1KYZA 5KNLA 4RD4A 4IL6C 1Z7UA 2BY1A 4O6JA 5CVVA 2BVNA 1TT5B 2Z9OA 3LAPA 3T0YA 2LTPA 4LMYA 2D2WA 4AYBA 2NTPA 2FF4A 2MH9A 1U5TC 4RA2A 1O8EA 1UELB 1Y0NA 5A2QZ 5D5XB 3OS0A 1W1WE 5HS7A 3BR5A 3CCSI 1RUNA 1BX1A 3K1PA 3PENA 1RPWA 3PA1A 3GQ7A 1R5ID 5FO1A 5TGTA 1S9HA 2BHYA 1TYVA 5M3MJ 2L4MA 1IDKA 1I1GA 4RCYA 1MZBA 2HDDA 3OKXA 3B6CA 1QU3A 3S16J 1BJKA 2A3SA 3LA3A 2CO5A 3GQ8A 1SD5A 1TW2A 3RCOA 2O7OA 3GWZA 3WQZA 1R5OA 2F48A 2F5EA 1YHQI 2NT6A 2KZVA 1KU9A 1YFHA 2MH2A 3GVAA 2OJED 2RNJA 4CCMA 3KP5A 3HL2A 3OIQA 2NTQA 1X1BA 4B3AA 2EZLA 3B02A 4JX5A 2XNCA 1LE8A 5FROA 3V4GA 1FNNA 1JUPA 1IDZA 1MSFC 3J81K 3JU4A 3K2ZA 4OJPA 1R58A 3FF5A 2JPBA 3W2WA 4LLGF 1OB5A 1R9TJ 4XONA 3T9GA 5M5XJ 2DAOA 3RKWA 1RKWA 1VQNI 4BDZA 2DMNA 3KFWX 1SMTA 2O8KA 3AVUA 4NBSA 3ONQA 2CUFA 2Q8KA 1XPXA 3WTYC 1HF0A 2W6JA 5L3EA 1DBGA 3KX2A 2K02A 4RGUA 1HC8A 5GADJ 1MD0A 1KJZA 1WOPA 1NB0A 3RIRA 1BMFA 1W0KA 1QRYA 1RR7A 3KIOA 4BHPA 1H8HA 1ZGJA 3ZCOA 2DYSH 1CQXA 3NWTA 2JUGA 1TC3C 2V6EA 3Q6QA 3DEEA 1J75A 4D7NA 3FM5A 3SFIA 1BBYA 2E1OA 2FNAA 1ZGWA 4RD2A 1XC5A 2EV0A 3ONYA 2CQXA 4BBRJ 4KFCA 4U87A 5IYWA 4LOCA 1VQMB 3TDZC 3DLLF 2JN9A 3A3BA 4L5JA 4DIQA 3IL2A 2HWVA 3WTXC 3PNVA 4ZYGA 3F23A 2Y75A 1VF7A 3SEJA 4XORA 1PP8F 2QENA 2F4OB 5IP6A 1A31A 2AS5F 2M30A 1VHEA 4LBZA 1LM1A 1KGSA 1O4XA 3GIRA 5AN9A 4Z4ZA 5LHIA 2L2OA 1MNMC 3ZN1A 3C3WA 4KITB 1AKHB 1W0UA 2GJKA 1MNDA 3QPLA 4DQLA 1YJNI 1HLVA 1HG8A 3CCVB 1DPRA 5ICEA 1XMAA 2EFQA 2RVCA 3FM3A 3MWMA 4A0XA 1MNEA 1SANA 4HX7A 4BHBA 1M90D 4HA8A 2D1HA 4FX0A 1NDHA 4TMVA 4II2A 4IKFA 3DWLE 3PQJA 4FHTA 2DYIA 1ZELA 3TMOA 4NUBA 2CK3A 2HR3A 1G3TA 3FDYA 5DM7F 5BNGA 2EWNA 3ZQFA 1ZM3A 1QHGA 4EJUA 4UXNA 2X1EA 2YWEA 4P9UA 4A3CJ 1K8FA 3H94A 5C4JJ 3A03A 2D45A 2VL8A 1B2RA 5EGOB 3FPPA 4A3DJ 1W34A 2UXNA 4RM2A 1MMGA 5DUIA 2HDNB 3W5HA 3MVPA 1R00A 2HOTA 5CVIA 2C78A 3A0HC 3EDPA 4WF2A 4A0ZA 4EMSA 2IA2A 4KMUX 3B4NA 4Y3OA 1OHHA 1E17A 1PP7U 3D5RC 4MNUA 5H20A 3FPKA 1M1EB 4PK4A 2BM5A 1S6LA 1ETYA 4RLZA 1FEXA 1PJ7A 1R22A 3E5QA 2F1LA 1Q1HA 1BN5A 1QVUA 1BIAA 3WTWC 4AD9A 2DERA 1E63A 2O6GE 3N90A 2GXGA 1K8AD 4L8JA 3OIOA 4NK8A 1PLUA 5EEHA 4OPWA 2HZTA 4L0YB 3GFIA 2F5DA 2V7TA 4KMFA 2O0WA 1AWCA 1O8DA 5FKOA 1E3PA 1MJBA 4A3BJ 2PYHA 2QLZA 1XD7A 1K6YA 1D0YA 3A8JA 2CMPA 5DD4A 3QPSA 3ZMUA 3N4MA 1LFUP 4X7EA 3CPWB 2EQRA 1N05A 4RDJA 3HTSB 2ZL5A 3BR2A 4F7ZA 3FBNB 3KZZA 4WK8F 4O3MA 3H09A 1VQ7I 2KLOA 4R1HA 3DBRB 2BM4A 1FPQA 3TGNA 1OFDA 1N75A 4C2MJ 1QBJA 3VYRB 1EA0A 2ZZFA 2M4GA 4KNYA 2JA8J 4G6TB 5JLWA 2ZMEC 3AKZA 2R5ZA 3DLAA 1QH0A 3DKXA 3G3ZA 4Z4RA 5FO0A 3QFTA 3KP2A 1N25A 2GAUA 3BR0A 5FIUA 1X1DA 1UD4A 1UG2A 2KRHA 3RQIA 3RYRA 3CLQA 4DZJA 4U9UA 2O61A 1CGPA 1D1CA 4PSWA 1OGIA 4FN5A 3OYGA 4PSXA 4ZYHA 4H0EA 1Q82D 4OOSA 4HLXA 1SC7A 3TKYA 2C77A 4CZZA 3MZYA 1QGZA 2GOMA 2CQKA 4C2UA 2ETHA 4WXDA 4E7IA 4KIFA 3CC7I 2YR2A 3KL9A 4LBYA 2DQLA 2CJJA 4BEHA 3E3VA 1MBEA 2FUG2 2QQ8A 3ERMA 4JOMA 1X1AA 1GLNA 2E5NA 5F0FA 4BACA 4K1XA 3CC4B 5CQEA 2FD5A 2GWRA 2NOJB 3HPHA 4UUVA 2CUJA 3ECHA 2ODLA 2E5ZA 2EK5A 5D6FA 2NYXA 3BQJA 4Z4VA 3PM1A 1UD6A 4PC2A 2KVOA 1A6IA 5LLQA 3HOWJ 2ID3A 4E0FA 2IW5A 2QQBA 2VNJA 2DA7A 1I6HJ 2ID6A 1ZARA 1QVFB 3PSZA 4GGGA 1NTCA 4Y17A 4B4CA 4FE4A 1TNSA 5IPAA 2P8TA 1BR2A 1D2EA 2M0CA 4MFEA 2NSPA 1QA2A 4CCLA 3SLNA 3W3CA 1BI1A 3EQLF 4WXCA 1IRXA 3PIOF 4CCNA 4I6ZA 3KYCB 3KYDB 3VSLA 3P26A 3ML3A 3H9JA 5LBQA 4IOCF 2JSPA 4Z4WA 3OW2B 1B1BA 2QSGX 1J9ZA 4RM3A 2JMWA 3GF2A 2GJPA 2NNNA 1ETKA 5LD2C 4ZC3A 1KTWA 3AVXA 2EV5A 5KW9A 2GLOA 2IPQX 4MTDA 4NHJA 3RZOJ 2GPJA 3ASSA 3SDGA 1K78B 3RZDJ 1IN5A 2V7VA 4YIRX 3LMMA 2HYGD 2VPRA 4E7ZA 4BPRA 2EWEA 2DOEA 3N6ZA 3HSRA 1IGNA 1WI3A 5JLVC 4PFPA 2RREA 4RAGA 4HRIA 4V19K 3ABUA 5A89A 5GAHJ 3Q6RA 1W9XA 2FBHA 4BUPA 1ZUNB 2HTSA 3K9TA 2EBIA 4EJWA 4R8HA 4LK1F 3GVJA 5HXBA 2JA6J 4A6DA 5JR3A 3PNTA 1OGJA 2YWGA 4G5GA 1UD5A 2BV6A 5F0CA 4D9JA 2WZPP 4KKSA 4KJZA 1GQ8A 4G1BA 4ANJA 1T0FC 1KC8D 3GQ9A 2E7XA 1VQ6I 2NOGA 3SYTA 4HSRA 6PAXA 2L9VA 1LVAA 1O8JA 4JX6A 5EDNA 1VQ8B 4IRGA 4BQNA 1FNCA 3D26A 1BC8C 4FTHA 4OMYA 3AG4H 3K4LA 3Q5FA 5BPIA 1G7TA 1PKVA 3FK7A 2P3MA 1VQ9B 2VBKA 1T6XA 2W1OA 3OAAA 2KIFA 1YJ9B 1G2HA 5BSXA 4HNUA 2X1CA 4QFMA 4IZZA 3CRZA 1VQOI 4WQMA 1WJEA 4G7WA 2DA5A 1LLZA 1WKMA 2TRTA 1WJDA 4XKVA 3ZGKA 4KDPA 1TYWA 4V02C 3RKYA 1UHMA 4YAFA 2RGVA 4EM1A 4L9TA 3OWTA 4HF1A 3FISA 3CCLB 2K85A 1PJ6A 2HGCA 3VPRA 4B4DA 1BQEA 5J8CA 1UFMA 3FXKA 3I58A 5FA6A 1WVRA 2R7TA 2PMHA 3FMSA 4M9SA 4DQ2A 5L3GA 3H3VK 2V7QA 2CBXA 1WRJA 2EZKA 1MSEC 3CD6B 2XSDC 1UD8A 2LLKA 1PJRA 5F08A 1WFXA 4ZGQB 4V2GA 2NTBA 4I84A 1AHDP 1E1RA 2J5PA 2YX7A 5KSWB 2A61A 2KJCA 3RPUA 3TW6A 3GXOA 1OGMX 2V4DA 3CDLA 2QBYA 1QZYA 3CCMI 2LK2A 4HG2A 1J9IA 3GTGJ 4Z05A 3PO3J 1H80A 3H3ZA 2JK3A 1Y0RA 1O57A 1PUEE 3WTTC 3LNNA 2QYOA 3QE2A 2K9NA 1GVJA 3I4MJ 5F64A 3I55I 4B09A 4XLPF 4A3JJ 4MR0A 5LGUA 3T8RA 3AG3H 3TP3A 1JB9A 3ZUGA 2HDCA 3QPHA 1QZEA 4OIRF 1QX4A 2V7XA 1ETQA 1H89C 4ESBA 4YC5A 2WJYA 1YW9A 3ZMSA 2D3NA 3TO6A 4B3GA 1P2FA 2O0VA 3BQZA 1ZK8A 3HBLA 4IHSA 4LIVA 3E1YE 1EZGA 3KEQA 4BXUA 3G1LA 2ZBVA 3JRHA 4PDKA 3S1RJ 5IP7J 1YRNB 4Z03A 4H4KC 2FOKA 4Y15A 4XR6A 2LBFA 4BE0A 1LEBA 3V7RA 1B8IA 4PAAA 3VMFA 5IT9Z 5IT3A 4M3FA 4YZQA 2F3LA 2ACJA 1EP2B 2Q6IA 1YIJI 4BQOA 1BW5A 4UUSA 5BMZA 3LQQA 1SMYF 4XRSG 4W8SA 3OJWA 4LBWA 5EEAA 4X7CA 4ZZDA 1T6YA 3HJEA 1OCPA 1KCCA 2VOOA 4GO1A 3SZGA 5JVTA 1Y1VJ 3KP6A 5D8LB 4ZH4F 3SEZA 2CQ7A 5KAIC 1WP6A 2JZYA 3R6KA 3BCAA 2K3PA 2XGEA 4A69C 1L1IA 3T53B 2X6WA 3W2EA 3CCYA 4M3BA 1VJSA 1J59A 1A6QA 2FSWA 3GEZA 3IH3A 2G0EA 2VBZA 3OYMA 1W2BB 3IAS2 2EH3A 3G2BA 4XOPA 2ME6A 3CMAI 3G6EI 3FBIB 3T8TA 1ZGAA 5D4RA 2XNJA 4KH3A 3AAFA 3EQNA 2RN7A 2CUZA 1Z6TA 1MABA 3CCEB 1E79A 4EJTA 1FMVA 1LQ1A 4PJ0C 1S7AA 2VC0A 4XN3A 3BG9A 4UUTA 4PC3A 2WA0A 3U2QA 4PZJA 3ELKA 5FFZA 1EFUA 3DP7A 3D0SA 2Y31A 3VSVA 2HOEA 1WJ5A 2DCUA 1W5SA 3O3KA 1W36D 3U9GA 3VYSB 4KISA 2VBVA 1IRGA 3JRGA 1F36A 1ZG3A 5AONA 1EA3A 3HHGA 1X3UA 2OC6A 3CCUI 4OIQF 1CLWA 1LE8B 4AF6A 1G59A 4PC7A 3CJNA 1T0FA 4MQ9F 1WOOA 3LA2A 3ASQA 1HCRA 4MFDA 4RAZA 5KHDA 2QTLA 3S1NJ 2R92J 4DBQA 4YFNF 5CVJA 5E3LA 2BEOA 4B48A 3TQNA 1QPMA 4S05A 3GX4X 2W7ZA 1BA5A 2VN2A 1UAAA 1MRZA 3NARA 5F27A 2QQ9A 3LSKA 1FBQA 4ZCLA 1W7PB 4IQJA 2L7ZA 2STTA 3K69A 2UVEA 3LL7A 2I8DA 4GXOA 1IXCA 4X07A 2ICWG 1V5FA 2K4BA 5B6IA 2FEZA 2YWFA 3GTLJ 3H92A 2HTJA 1ETXA 3VFZA 2Z99A 4HE6A 4YZAA 2VC1A 2HOAA 2IP2A 1OLTA 2NVYJ 3CCRI 2LFBA 5F1RA 5EZHA 2CNDA 4H9GA 1XN7A 3P5JA 4AWXB 2LVSA 2FBKA 4IQ4A 1WHUA 3T1BA 1HBXG 4JRAC 1RNLA 4I01A 5LGTA 4DOZA 3CCJI 4C30A 2LD5A 2C5HA 5IYRA 3EUHA 1BI2A 4IHVA 2VIXA 5H59A 1NB9A 4C9YA 4CDGA 1ODDA 2G7HA 1EH7A 2HVSA 3BPVA 3FHZA 4OP7A 1OKRA 2V4JC 5E3MA 3JRDA 1VQ4B 2KKOA 1R1UA 1HW2A 3PUNA 4GYGA 3WHCA 2MG4A 4HEA2 4EEFG 5F0HA 1ULYA 2LP0A 3AL0C 2Q2EA 3BG6A 1TZLA 5E8GA 5GV7A 3VO1A 1I5ZA 3OZUA 4G7XA 5L3BA 5IY5H 4MLOA 1H85A 5HZAA 3LYCA 3HOVJ 2DTZA 2JTVA 2KPMA 1D8TA 3J7AY 2L9SA 4TN1A 4XKBA 3ZZUA 2VUMJ 2L3DA 1G3SA
chains in the Genus database with same CATH topology
1E0EA 3K4MA 5LFAA 3K4JA 1MMDA 4B43A 3JU4A 3UW0A 4OJPA 3OR2C 3TBIA 3W2WA 2NT9A 3T9GA 1Y6IA 4XONA 2IGNA 1BR4A 1OFMA 1TT0A 2DT7B 4F92B 1K5CA 5HKKA 3TL4X 1NG7A 4BDZA 1UG0A 3PL8A 3HPGA 3S8PA 4CCJA 3KEYA 3GBGA 3MMYB 3ONQA 4CZCA 3GVLA 1DBGA 2W6JA 2M4KA 3KX2A 4NK6A 2Z1DA 1BMFA 1W0KA 2DJIA 4CA0A 1Z3XA 1P9QC 1H8HA 3DTIA 4XMYA 4XKCA 3ZCOA 2VKHA 3NWTA 2HZDA 5JHFA 2JUGA 2CV1A 2X8KA 2ZZEA 1JRGA 2V6EA 2M7BA 4XLFA 3DEEA 3CJRB 5FRNA 2O5RA 2WAQA 3K4NA 1OB0A 1I18A 1RU4A 2QKLB 1EFRA 2Q1ZB 3VMVA 3PSIA 1V0FA 2O17A 4U87A 3S3NA 3HKZA 1FX0A 2MC4A 4ZDLA 3OYJA 3MKYB 2P0WA 1HA8A 3A3BA 4DIQA 2V1NA 2HVQA 3PNVA 4YRVA 2HVRA 4BDYA 1VF7A 1DQUA 4P5OA 4E6KG 4OZZA 1PYVA 4XORA 3S3OA 3S3MA 2O1DA 2JA2A 4E7LA 4F91B 2XZPA 2L2OA 3VDXA 2IS4A 4KITB 3BCBA 1UD3A 2K9MA 2BVLA 2GJKA 3T56B 2LC2A 3H0DA 1MNDA 1MMAA 2INUA 4EW9A 4RMNA 2INVA 3KRGA 1BHEA 1HG8A 4PJJA 1LKXA 4TKOB 2AQFA 1E3XA 1OFLA 1MNEA 2R7VA 4CSWA 4CUGA 2CV0A 1AIRA 2ZSIB 3VYTB 3EUAA 3ZIAA 3CZ6A 3D5LA 2LZJA 4BJTA 2ZXHA 1WJCA 4II2A 4IKFA 3DWLE 4QPOA 2NSTA 1ZELA 2E1MB 3TMOA 4NUBA 4HNTA 2CK3A 2R7WA 3FDYA 2ZSHB 3KYLA 4KKTA 4GQNA 3OEEA 4G6IA 1QHGA 4XLCA 5HNFA 2X1EA 2M5SA 3H94A 2AQEA 2VL8A 1V5EA 4D1QA 4E7HA 4N4OB 3ZQQA 3FPPA 2K9LA 2HDWA 3PJRA 5CKTA 4RM2A 1MMGA 2IS1A 4ASUA 2WB1A 3CESA 3GQBA 4B3FX 2JJ1A 4E4HA 2HNHA 1OR7C 3H9QA 2LYCA 2IS2A 4NQWB 2WBMA 3OYIA 3OOUA 3B4NA 4XKWA 4Y3OA 2LOOA 3IAM2 1OHHA 2ELJA 2IXSA 2XC7A 3D5RC 4RLQA 2DCEA 5HVQC 4PK4A 4AU7A 4ITVA 1DGRM 3K4BA 4LITA 5CDFA 2F4IA 4N4NB 4BEHB 2IQ7A 1J09A 2K5CA 3OYEA 4RLFA 4B47A 2OV7A 4AVZA 4ZJZA 4L8JA 4EATA 2V26A 3VWBA 4NK8A 1PLUA 4PJMA 2ZZQA 2VQLA 2MFZA 4J01A 4ZYAA 2O0WA 1O8DA 2PMZA 1H8EA 1OGOX 3NWSA 4F55A 4P1WA 4W8RA 4TT3A 2PYHA 3DDYA 1K6YA 1D0YA 4Y4RA 1BLIA 2CMPA 1O8HA 1D0ZA 3KEWA 3LMWA 2Y0SA 3HAGA 4U4BA 3I3LA 2XF7A 2LRDA 3A1YA 3ZRGA 4CH7A 3FBNB 4MXNA 4DNRB 3UNGC 3EUHC 1X4PA 2KLOA 3JURA 2KL4A 3ZPNA 4JQFA 2KQRA 2R4GA 3K4KA 1N75A 3HC7A 1X1CA 4NC7A 5KCMA 3VYRB 1CZFA 4OZYA 2V31A 2JVHA 2ZZFA 2M4GA 4DNTB 3SUCA 4XLHA 4G6TB 4NNJA 4Z06A 3AKZA 1NG6A 3DLAA 2DIEA 3DKXA 4BL0B 1O8KA 1X1DA 1UD4A 2Z16A 2KRHA 1I8DA 3OYKA 5CPRB 2QY1A 4E7KA 2LH9A 3L2RA 3OPOA 2XGJA 3HXLA 1QJVA 1E1QA 1D1CA 2UUZA 4PSWA 2DOAA 3OYGA 4PSXA 2X6XA 2VJ4A 4YZ0A 2GK7A 2M0MA 2VXDA 3BC9A 3SDBA 2GOMA 4C2UA 3LSIA 1JTAA 4E7IA 1Z3YA 2VASA 3OR1C 2LREA 2JVGA 1WJFA 3FY3A 4BE2A 1KCDA 4BEHA 2FUG2 2RQQA 4JOMA 1X1AA 1GLNA 2E5NA 3PFYA 4F3QA 5HOOA 4IX7A 4BACA 3B90A 5CQEA 4BE1A 2NOJB 1T95A 2XSJC 3HPHA 3QYFA 2XZLA 3EQOA 2CUJA 2ODLA 1E43A 3DTEA 2WPDA 2E5ZA 3OYBA 2Z6BD 4BQQA 2D3LA 1UD6A 2R7RA 2KVOA 2L9NA 4F52A 3V42A 1SFKA 4E0FA 2ZTNA 2X85A 4XLEA 1DGWY 1FMWA 1Z7LA 2W7NA 3K70C 3I9V2 3NE5B 1BR2A 4ZDPA 3HG9A 2X51A 2NSPA 1QHHD 4CCLA 5IK2A 5FRMA 3W3CA 1IRXA 4W8QA 4CCNA 1NRKA 2Z8GA 4ZTFA 3HUGB 3VSLA 2QXZA 3H9JA 2WJVA 2JSPA 3A3GA 2CFOA 1IA5A 4RM3A 1RWRA 3DPUA 4XQFA 4GRIA 2F1MA 3MD2A 2GJPA 4FXUA 3RPUD 3T51B 2UVFA 5LD2C 5FL7A 4ZC3A 2QKMB 1KTWA 3LSGA 4OJ5A 3DU6A 2HLDA 2VPLA 4FASD 2JJ2A 2DXIA 1KMHA 3K6GA 4XLAA 1SAUA 4BJ5C 3E1SA 1O8LA 2BSPA 1AA7A 1BR1A 3LMMA 4E7ZA 3QYEA 1D1AA 3LSHA 3H5AA 1COWA 3H5RA 4PJNA 2EWEA 4YZXA 1VBLA 4PFPA 2RREA 4HRIA 1O8GA 1DBOA 1O8IA 2L5QA 3AL0B 4HIZA 3M8JA 1T5EA 1W9XA 2Z2SB 4BUPA 1W0JA 2W6IA 4DJAA 3GVJA 3PNTA 1VZ0A 1UD5A 1O8FA 4D9JA 2WZPP 4KKSA 4KJZA 2XNDA 1GQ8A 1V0EA 4ANJA 1T0FC 2HPMA 2WY8Q 3GQ9A 3BC8A 4J00A 1K28D 3FKJA 4PUSA 4HSRA 3SYTA 3S32A 1O8JA 2BW3A 1G8XA 4B3XA 1MW7A 4F93B 4BQNA 2ZXIA 3OYCA 3OEHA 4TSFA 3K4LA 3QOEA 1RMGA 1PKVA 3K4CA 2R7SA 2VBKA 4OJ6A 4U49A 4C2LA 1JI8A 2W1OA 3VSKA 2A6TA 3OAAA 3H5NA 4PJLA 4HNUA 3F9KA 2X1CA 2XDVA 4IZZA 1WJAA 1WJEA 2W00A 4G7WA 2DT6A 3S93A 4HPQA 3WWGA 1WJDA 2VKDA 3C2HA 4XKVA 3ZGKA 2MABA 2XF5A 2CV2A 3OYAA 2R7XA 2IGMA 2KP6A 2UV1A 3K70D 3DTKA 2LBFB 4R79A 3MKZA 3OWTA 3OS2A 2L7KA 3L2UA 2V7FA 3VSTA 5CQGA 2MD0A 2E60A 1HZEA 3PNYA 2V9KA 3D5SC 4YELA 2R7TA 2VQCA 1ERDA 2V7QA 2BOLA 3OYFA 1UD8A 2VBMA 1PJRA 2VJJA 1WFXA 3HOSA 3GRHA 2XAUA 2PJRB 3IP4B 3OFNA 2NTBA 4FETA 1E1RA 4I84A 2PYGA 3W2VA 5AMVA 1OGMX 2V4DA 3QYBA 4UZUA 2R7UA 1R6RA 3OYDA 4HG2A 4Z05A 1H80A 3ZPPA 2E1MC 4XN0A 1E3ZA 2F43A 1BN8A 5HLTA 4JMQA 2F6CA 4YEJA 3BCFA 3LNNA 4II3A 2MYSA 2BVMA 1N78A 2RNGA 1W36C 1Z21A 2LG4A 3M1CA 3BH4A 4MR0A 3RTRA 2CH0A 1NBMA 2R7OA 2WSSA 2VQGA 4P22A 2KRCA 2E1BA 3AFHA 2HU9A 3BG7A 5HNHA 4CCOA 5DN6A 3BCDA 2CW7A 3MKWB 2OUMA 2WAFA 4KT6A 2D3NA 2WJYA 4B3GA 2O0VA 2ZTGA 3ZR8X 4LIUA 4HSTA 2GOXB 4LIVA 2BW3B 3DPLC 2VB6A 3ZXSA 1LVKA 4YXWA 3DQVC 4E7JA 4Z03A 3A35A 4H4KC 4XR6A 2LBFA 4BE0A 2GJRA 1IDJA 4ZDOA 1YX5A 2M3AA 2X1DA 4YZQA 3BLYA 4BQOA 4Y33A 2VJIA 1WJBA 2CW8A 4XL9A 2KMUA 4W8SA 4DK0A 4BU2A 1WMRA 4W8TA 1V5GA 1KCCA 3OMYA 3SZGA 3L2QA 2O04A 2PJRA 1KONA 2KDOA 2LY1A 3A4CA 3E0JB 3H35A 3SEZA 1WP6A 3BCAA 3CP2A 2K3PA 3U21A 2W4SA 3T53B 2X6WA 1HVXA 1VJSA 2KHMA 4BJ6C 3DPTA 1X4OA 4BGDA 3VYUB 3OYMA 3OYHA 1O8MA 3FKSA 4XNFA 3IAS2 3G2BA 3K10A 4XOPA 2R7QA 2R9VA 3FBIB 2HPIA 2XF6A 3L2VA 2IGOA 3CJQB 2X53S 4DBRA 1X0CA 3EQNA 4DGWB 3ZSCA 2QE7A 5C1CA 2LY2A 2CUZA 2JIZA 2VLAA 1MABA 3OW7A 2A5WA 2GK6A 2NZMA 1E79A 1WTHD 3SEQA 1VLYA 3C2GA 1FMVA 3PUBA 4KKUA 1PXZA 2ZZGA 1OOCA 4XN3A 3DKYA 2WA0A 3A2KA 4OAZA 4XOTA 3CF2A 1LFPA 1SKYB 2UWMA 3VSVA 2VJ5A 1WJ5A 3W2AA 1XG2A 1D0XA 3VSUA 1W36D 3OY9A 3VYSB 4KISA 2Q2EB 1LDKB 4LG3A 3HOTA 3VMWA 2ZFUA 4E7SA 4OJLA 3DU5A 1EA3A 3LFUA 3OL3A 1Y56A 2OC6A 3VR6A 4XD7A 2W82A 3FHNA 4BXFA 1G59A 4HWVA 2QX3A 4URRA 1X19A 2WADA 3LSMA 4X0GA 4C2TA 4OJOA 4B44A 5KHDA 2PECA 1YE9A 4BS9A 4DBQA 3OE7A 3OYLA 4B48A 2CS3A 3EPZA 5KNLA 2VQHA 1UAAA 1BPLA 4XM3A 3OIPA 3LSKA 4IQJA 3PSFA 4CCKA 1NHCA 3N05A 2UVEA 3H9GA 3LL7A 2I8DA 4DK1A 1V5FA 4AYBA 2NTPA 1O8EA 1UELB 3OS0A 2X3HA 2VBEA 4OAYA 1U0JA 2IGKA 1EE6A 3UR3C 1BOBA 1KZLA 4YZAA 1QCXA 1OLTA 2WY7Q 3RQ4A 1DP3A 1PE9A 3B8YA 2X6YA 3OS1A 3GQ7A 1UD2A 3G05A 2WAEA 5TGTA 1S9HA 3OOCA 1N77A 4U7BA 4IQ4A 1IDKA 4DOZA 1QU3A 2XZOA 4C30A 2VXZA 3GQ8A 5C1EA 1D1BA 3L2WA 2F5VA 1O88A 1YX3A 3RCOA 2VIXA 3CP8A 4C9YA 4PMHA 4PFOA 3WQZA 4QPQA 3CMMA 2HVSA 3GVKA 1IB4A 2V4JC 2NT6A 2KZVA 4HEA2 4OWRB 4ZTJA 3AL0C 3RSNA 4Z1MA 1WPCA 3BG6A 2JDIA 1TZLA 2XOKA 3GQAA 1MMNA 3OYNA 3IUOA 3OL4A 2HQAA 4CCMA 4G7XA 4MLOA 3OIQA 3QODA 1X1BA 3HL2A 2NTQA 2KPMA 2M7AA 4NC8A 3EUKL 3J7AY 2L9SA 4XKBA 2IS6A 5FROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NK8 A;  1PLU A;  1KCC A;  2O04 A;  2O0W A;  1O8D A;  3UW0 A;  1OGO X;  4OJP A;  1O8F A;  2NT9 A;  3T9G A;  4W8R A;  4XON A;  1GQ8 A;  2PYH A;  1OFM A;  2X6W A;  1O8H A;  3GQ9 A;  1K5C A;  3LMW A;  4U4B A;  1O8J A;  1DBG A;  1O8M A;  4XNF A;  4MXN A;  4XOP A;  4NK6 A;  1RMG A;  4OJ6 A;  2VBK A;  4U49 A;  1X0C A;  3JUR A;  3EQN A;  3ZSC A;  4C2L A;  5C1C A;  4XMY A;  2NZM A;  4OZY A;  1PXZ A;  1JRG A;  1CZF A;  4XLF A;  3SUC A;  1OOC A;  4XN3 A;  4XLH A;  1RU4 A;  4Z06 A;  3WWG A;  4XKV A;  4XOT A;  1O8K A;  3VMV A;  3VSV A;  2O17 A;  1XG2 A;  2QY1 A;  3VSU A;  3VMW A;  1QJV A;  3VST A;  4OJL A;  4YEL A;  2X6X A;  4YZ0 A;  4OZZ A;  4XOR A;  2O1D A;  4HWV A;  2VBM A;  2QX3 A;  2VJJ A;  1JTA A;  4URR A;  3GRH A;  4OJO A;  2NTB A;  3FY3 A;  4I84 A;  1KCD A;  2PEC A;  2PYG A;  5AMV A;  1OGM X;  3B90 A;  2INU A;  4EW9 A;  2INV A;  3KRG A;  1BHE A;  3EQO A;  1HG8 A;  4XM3 A;  2ODL A;  4Z05 A;  1H80 A;  3ZPP A;  4XN0 A;  1BN8 A;  1NHC A;  1OFL A;  2UVE A;  4YEJ A;  1AIR A;  2NTP A;  2X85 A;  4XLE A;  1O8E A;  2NST A;  2X3H A;  2VBE A;  1EE6 A;  4MR0 A;  4YZA A;  1QCX A;  2NSP A;  4XLC A;  1PE9 A;  3B8Y A;  3GQ7 A;  2X6Y A;  4W8Q A;  2Z8G A;  2QXZ A;  1IDK A;  1IA5 A;  1RWR A;  5C1E A;  4XQF A;  2UVF A;  2O0V A;  3GQ8 A;  1O88 A;  1KTW A;  4PMH A;  4OJ5 A;  3B4N A;  1IB4 A;  4XKW A;  4XLA A;  4Z03 A;  2NT6 A;  4XR6 A;  1O8L A;  2BSP A;  1IDJ A;  4YZQ A;  3GQA A;  2EWE A;  4YZX A;  1VBL A;  2NTQ A;  2IQ7 A;  2VJI A;  4XL9 A;  4AVZ A;  1DBO A;  1O8I A;  1O8G A;  4W8S A;  1WMR A;  4W8T A; 
#chains in the Genus database with same CATH topology
 3SFZ A;  1TW3 A;  3SYJ A;  4I2O A;  2BHZ A;  2P81 A;  3K4J A;  4B43 A;  3UW0 A;  4PGG A;  4EJO A;  4P6V F;  3K2A A;  3OR2 C;  2QEX B;  1I39 A;  3SJP A;  3AK5 A;  2DT7 B;  5DNS A;  1WSV A;  2B7E A;  2OCC H;  4I02 A;  4F92 B;  3TL4 X;  1K5C A;  1NG7 A;  3Q0V A;  2HOS A;  3KEW A;  3HPG A;  2LNB A;  4CCJ A;  3KEY A;  3GBG A;  2IEK A;  4CZC A;  2E1C A;  4ABZ A;  1QVG B;  2A07 F;  1XGM A;  5K5O A;  4NK6 A;  1BW6 A;  1R5G A;  1K4T A;  2ZIT A;  2Z1D A;  4XSZ F;  3ZQI A;  5B66 C;  1B23 P;  4CA0 A;  1OYY A;  4HAM A;  2K40 A;  2IVM A;  4XIC A;  4PAB A;  1M1K D;  1P9Q C;  5ICF A;  5D8K B;  2VKH A;  1S3J A;  3KZI C;  2CV1 A;  3S2D J;  4XLF A;  2ELK A;  3GZN B;  4YAW A;  3PET A;  2O5R A;  2WAQ A;  1RU4 A;  5K5R A;  1S0U A;  2L01 A;  2BPO A;  2Q1Z B;  4EGY A;  3PSI A;  2DA3 A;  4M6V A;  1V0F A;  4A3K J;  4RPB A;  5DCF A;  1F20 A;  3ZZ0 A;  3J7Y J;  3HKZ A;  3L9F A;  3MKY B;  1RRJ A;  1SAX A;  1YJW B;  1I6X A;  2P0W A;  4B8X A;  1R5H A;  2EIM H;  2HVR A;  3CME I;  3N97 A;  4P5O A;  4E6K G;  5ICC A;  3KE2 A;  3S3O A;  3S3M A;  4P26 A;  1WSU A;  4QUZ A;  1FSH A;  2O1D A;  3JW4 A;  5J47 A;  1FOX A;  1V54 H;  2JA2 A;  3K1N A;  4MIM A;  5HS9 A;  4M0L A;  2VKV A;  4E70 A;  2QZ8 A;  5F6F A;  3JRE A;  3T56 B;  1NJI D;  2VFM A;  3WTV C;  4Q7J B;  3KPH A;  2KIQ A;  1IV6 A;  1YS7 A;  3IC7 A;  1QA6 A;  3Q38 A;  5HZB A;  2VFP A;  4EW9 A;  2E34 A;  2INV A;  3OOP A;  5LEK A;  3DF8 A;  4LGW A;  2NAZ A;  2VE9 A;  1LKX A;  4IJA A;  1GR1 A;  3GFJ A;  4TKO B;  4IW3 B;  2QF7 A;  5E17 F;  3O8G A;  1E3X A;  1OFL A;  5IYC J;  2R7V A;  4OPV A;  1AIR A;  3VYT B;  3AST A;  3BG5 A;  5EEG A;  3CZ6 A;  4X06 A;  1EH8 A;  1FTZ A;  3LO8 A;  3WND A;  3LQR A;  2EJR A;  2QTZ A;  4YEI A;  1ELO A;  2NST A;  1XSX A;  2M2E A;  4AYB N;  1QPI A;  2W48 A;  3IH4 A;  2R7W A;  2ZSH B;  3KYL A;  4P25 A;  2R7F A;  3MN2 A;  1JJ8 C;  2B63 J;  4G6I A;  5HNF A;  5CJ9 A;  4GQN A;  1WZ2 A;  2M5S A;  5F4J A;  4A3L J;  2EFP A;  3HEF A;  4G8X A;  1ZHF A;  2ZB9 A;  4E7H A;  4OOV A;  3CC7 B;  1DAR A;  3NRV A;  3PJR A;  4RGS A;  3JAM K;  3R6S A;  5FNZ A;  5DUK A;  5M5W J;  3M07 A;  4RGX A;  4M6Y A;  1TLL A;  4ROX A;  2WB1 A;  4ASU A;  3GQB A;  5LEJ A;  5DD8 A;  4TMW A;  4L5I A;  1DAB A;  1OFC X;  3A01 A;  2IS2 A;  1FRQ A;  2WBM A;  2V1U A;  4GYI A;  3A0B C;  1EH6 A;  1JGS A;  3IAM 2;  4D5F A;  2ELJ A;  4IPA A;  1VQP I;  1FY7 A;  4BKX A;  1KQ0 A;  5FLM J;  2XC7 A;  4N9I A;  2DCE A;  2P4W A;  4KA4 A;  2HEO A;  4A3F J;  3F8B A;  1Y1W J;  1QFY A;  4YDT A;  3K4B A;  3FK6 A;  5CDF A;  3FXJ A;  3E7L A;  4BEH B;  1J09 A;  2K5C A;  1FP2 A;  4RLF A;  4B47 A;  2OV7 A;  4AVZ A;  1FLI A;  1JA1 A;  1YI2 B;  4ZYE A;  3BH6 B;  1BI3 A;  4MHG A;  4G7Z F;  1DPU A;  2M9H A;  1U3E M;  3P9K A;  4ZYA A;  2PMZ A;  2GRE A;  1OGO X;  1FX7 A;  3ABT A;  3NWS A;  4P1W A;  2ZBU A;  2E7W A;  4TT3 A;  4IOA F;  1BOA A;  4AIH A;  1BLI A;  3LMW A;  1B9M A;  2TDX A;  2XF7 A;  3AG2 H;  1YW7 A;  3A1Y A;  4IF4 A;  3ZRG A;  1CF7 A;  3W2H A;  4MXN A;  2XAQ A;  3TW7 A;  4EM0 B;  2F4N A;  4RBO A;  4IHY A;  3UNG C;  3FZV A;  3I59 B;  1ZR2 A;  3ZPN A;  3WHB A;  4JQF A;  2R7D A;  2KQR A;  2R4G A;  3QP6 A;  4LK0 F;  1Q86 D;  2ZC2 A;  4X6A J;  1X1C A;  4NC7 A;  5KCM A;  2ESH A;  4QSH A;  2BXZ A;  2V31 A;  1IG7 A;  2O03 A;  3SUC A;  4XLH A;  3F8C A;  1NG6 A;  1YG2 A;  2I5U A;  1I50 J;  3WXM A;  4RPD A;  2A05 A;  1I8D A;  3OYK A;  2QY1 A;  3QU6 A;  1B4A A;  2XGJ A;  1QJV A;  3HXL A;  2I1L A;  3Q39 A;  4XBF A;  4ZZL A;  2DOA A;  4NQW A;  4NDL A;  1O3T A;  1QFZ A;  4QVA A;  1YTY A;  2GK7 A;  4W1U A;  3I5U A;  1ORK A;  2MLK A;  3BC9 A;  3LSI A;  1JTA A;  3CCQ B;  1UCR A;  1TP4 A;  1Z3Y A;  1Z91 A;  2LRE A;  3OR1 C;  2K7L A;  3FY3 A;  1WJF A;  4BE2 A;  4CYD A;  3TOA A;  4DW6 A;  5AIP A;  5TRD A;  2G9W A;  4YG2 F;  3BY2 A;  3I64 A;  5FD6 A;  4IX7 A;  4BE1 A;  4WWC A;  5J1R A;  1T95 A;  1DDI A;  2BGC A;  3PO2 J;  2VNI A;  1E43 A;  1G6N A;  3DTE A;  3G1M A;  3M7G A;  1ZRF A;  2H1K A;  2WPD A;  4F7D A;  1MJ9 A;  3H36 A;  1USS A;  2E1N A;  4UNO A;  1W87 A;  2XAH A;  5K7F A;  3L00 A;  4P12 A;  1SFK A;  1UJ8 A;  5DS0 A;  4XLE A;  1FMW A;  1OIS A;  3K70 C;  1EFC A;  1R4N B;  2DMT A;  3TOB A;  3NE5 B;  1VQL I;  4UY8 I;  3HOY J;  4X0C A;  1C0W A;  4LD5 A;  2FX3 A;  1QHH D;  1MGT A;  4W8Q A;  2IA0 A;  2QXZ A;  3WGI A;  3GTO J;  5GTI C;  2WJV A;  3A3G A;  2O8X A;  2CFO A;  1IA5 A;  2XGC A;  1OPC A;  1KA8 A;  3G4S B;  1MBJ A;  5TIS C;  3MFK A;  3RKQ A;  3RPU D;  4FXU A;  4RD0 A;  2QKM B;  4UVC A;  4AIK A;  4OJ5 A;  3DU6 A;  3LFK A;  3GSI A;  1ZLK A;  2VPL A;  3NAU A;  2HLD A;  1KMH A;  3WNB A;  4XLA A;  2AHO A;  3GZ5 A;  2VBT A;  4BJ5 C;  3E1S A;  1O8L A;  5BQT A;  1W0T A;  4UV8 A;  3WG9 A;  3OZW A;  3BTC A;  4G6Q A;  3U2R A;  3LSH A;  5HDN A;  3GFM A;  3F8M A;  3H5R A;  4BBS J;  3VOD A;  4L0Z B;  3S1Q J;  3BZ6 A;  3BTI A;  1MBF A;  5GAG J;  2EIX A;  1DBO A;  1O8I A;  4HYE A;  2L5Q A;  3G71 B;  1E3O C;  1FOK A;  4HIZ A;  2Z2S B;  1W0J A;  2WC2 A;  1GO2 A;  1RC9 A;  1K6O A;  3E5X A;  4YII A;  2XVC A;  1T8I A;  3EYI A;  1O8F A;  2VYQ A;  5EZG A;  9ANT A;  1DDN A;  2QN6 A;  4BQA A;  4LG0 A;  4HF2 A;  2HPM A;  2OD5 A;  2VBY A;  3S1M J;  2ECB A;  1XDU A;  2NPF A;  3CTA A;  2K86 A;  3K1M A;  3S32 A;  3L7W A;  2BW3 A;  4B3X A;  4F93 B;  1MW7 A;  2L9R A;  2WV0 A;  1GVD A;  3CDI A;  3M8E A;  5IYP A;  4TSF A;  1HXD A;  2V6C A;  1RMG A;  4OJ6 A;  1GV5 A;  5J6X A;  3WU2 C;  4C2L A;  3VSK A;  4JYK A;  1ZG1 A;  4LB5 A;  1XFO A;  2X48 A;  4PJL A;  2OTJ I;  4KIG A;  3S14 J;  4EH1 A;  2VT3 A;  4PCQ A;  4WZL A;  1WJA A;  2M8E A;  2QSF X;  2RKH A;  3GME A;  4I98 B;  4ZYD A;  1HQC A;  1GAW A;  2DT6 A;  4CYC B;  1FYK A;  5J35 A;  1UMQ A;  1VQ5 B;  3WWG A;  2OCE A;  3C2H A;  1U5T A;  3V7A A;  4FWT A;  2ISY A;  1YIT I;  2H6C A;  2KFD A;  3I71 A;  1FP1 D;  2CV2 A;  1F9N A;  4HBL A;  5DEQ A;  1GJR A;  2Y69 H;  3ZQL A;  1SVM A;  1YLF A;  2UV1 A;  3DTK A;  2LBF B;  2DY1 A;  4LBV A;  3MKZ A;  1JJ6 C;  1GUU A;  2NS0 A;  2VBU A;  4Y9U A;  3VST A;  2DA4 A;  2MD0 A;  3M4O J;  3PNY A;  3Q3S A;  3ZQC A;  4A93 J;  4YEL A;  1IN7 A;  4UUS B;  4QIW N;  3ASN H;  2VQC A;  1ERD A;  1PUF A;  2E36 A;  4UB8 C;  1F1Z A;  2AXT C;  2VBM A;  2L4A A;  5J1Y A;  4A5N A;  5FJ8 J;  1E62 A;  2Q6O A;  2DQR A;  3G6E B;  3HOS A;  3GRH A;  3IP4 B;  1HW1 A;  1W5T A;  4OIP F;  1HKS A;  1ONV A;  3RKX A;  5IP9 J;  3WNC A;  3W2V A;  2C4U A;  1X2N A;  1AMO A;  4DYC A;  2Y48 A;  1FNM A;  4UZU A;  3F3X A;  3F21 A;  2GA1 A;  1QZZ A;  2J5O A;  1VQK I;  3J80 Z;  4HZF A;  2L7M P;  1I1S A;  4XN0 A;  2DTR A;  1BN8 A;  3JCU C;  3CF5 F;  2AXL A;  2F6C A;  1WXR A;  4UAJ A;  2X9D A;  1B72 B;  4II3 A;  3I56 I;  4HE5 A;  1CNE A;  2ZBK A;  2L54 A;  1DUX C;  2CQQ A;  1WQ2 A;  4C43 A;  3ZC3 A;  1I3Q J;  1KD1 D;  2LKP A;  4G1V A;  2R7O A;  2WSS A;  4YAO A;  2KRC A;  2E1B A;  2LF8 A;  2RC6 A;  4OOI A;  2DFF A;  1ON1 A;  3ZOB A;  3QFS A;  1FC3 A;  5DN6 A;  1T56 A;  4PGH A;  4KT6 A;  2LKS A;  1QUF A;  4N3N A;  4Z4S A;  1QRC A;  3BTL A;  2H8W A;  4HF0 A;  3ZR8 X;  1SD4 A;  4HST A;  2LDU A;  1TQM A;  5A2Q K;  4AVP A;  3HOU J;  2Z5U A;  2ECC A;  3ZXS A;  3LJY A;  2DMQ A;  1LDD A;  4RDU A;  2QVO A;  1S4M A;  5A88 A;  3C7J A;  3JRC A;  2DLL A;  4ZDO A;  3K7A J;  2EPF A;  1MMS A;  1AOY A;  5D4S A;  2P6T A;  3CLO A;  3M1E A;  3FXQ A;  1H0M A;  1EWY A;  4Y33 A;  5HDG A;  1WJB A;  2CW8 A;  4XL9 A;  1N07 A;  1MIJ A;  1ZLJ A;  2KMU A;  3O2P E;  4DK0 A;  4W8T A;  1V5G A;  3I53 A;  3HGY A;  3GCM A;  2GBY A;  2XKO A;  3OMY A;  4AM3 A;  3L2Q A;  2VT2 A;  2PJR A;  3LAJ A;  3HIF A;  2KDO A;  2LY1 A;  2OK7 A;  2XTY A;  3CP2 A;  1ZH5 A;  3OSG A;  1TNT A;  2RAE A;  1Q1V A;  4W97 A;  1XS9 A;  3ASP A;  2QWW A;  3DPT A;  5D6E A;  2DW4 A;  3VYU B;  4BGD A;  1IJW C;  4DYQ A;  4UZF A;  2P7V B;  3D1N I;  2V1D A;  1KTV A;  3PSS A;  1VHO A;  3B6A A;  3CJQ B;  2BM0 A;  2DMP A;  4ACB A;  3WE2 A;  3ZSC A;  2CYY A;  3SKB A;  4X8I A;  2FOW A;  2A5W A;  3WY9 A;  2A5Y B;  2V7W A;  3PUB A;  5GTH C;  2ZZG A;  5B3S H;  3BQY A;  3GLL A;  4OIO F;  4RD6 A;  2FQ3 A;  5L46 A;  4Z2Y A;  3JQP A;  5CYV A;  1GHC A;  3C1D A;  1QGA A;  3J81 k;  1SFO J;  2F5C A;  1XG2 A;  1Q9S A;  4O5V A;  3REO A;  4Y7N J;  3OY9 A;  1WOS A;  1TQP A;  2Q2E B;  4LG3 A;  3ZMZ A;  4E7S A;  2WR8 A;  1FBU A;  2QA4 B;  4OJL A;  4BY7 J;  4M73 A;  3FIW A;  2Y0S N;  5F4M A;  3E5U A;  4MYT A;  1PDN C;  2W82 A;  3FHN A;  1T39 A;  4BXF A;  1QFJ A;  3QQA A;  1GXP A;  4URR A;  3ABK H;  4ZCM A;  1YE9 A;  1S29 A;  1F5T A;  1RQP A;  1VLO A;  3W6V A;  2CC2 A;  1PJ5 A;  2BM6 A;  5L3F A;  3FXL A;  1WCM J;  2K9S A;  1T6Z A;  2ZFW A;  3CUQ B;  1BPL A;  4HQM A;  4YIF A;  4XM3 A;  1HSJ A;  1O7F A;  1Y8Q B;  3IKT A;  2OTL B;  1LEA A;  4CCK A;  4M72 A;  2N8G A;  3H9G A;  4DZP A;  4DK1 A;  2OU2 A;  1WOR A;  3B82 A;  5THX A;  1ETW A;  4IHT A;  2HXI A;  2PE3 A;  3BZK A;  1SVO A;  1K73 D;  3IRQ A;  2X3H A;  4NC6 A;  4OAY A;  1U0J A;  1LNW A;  4FT8 A;  2EFN A;  1EE6 A;  4IXA A;  3LSJ A;  4MGR A;  1BOB A;  2HS5 A;  3UR3 C;  1KZL A;  1QCX A;  2ZJQ F;  2WY7 Q;  1T98 A;  3RQ4 A;  2R5Y B;  1DP3 A;  4M71 A;  2X6Y A;  3OS1 A;  1PE9 A;  3B8Y A;  3G05 A;  3OOC A;  3QP5 A;  1N77 A;  4U7B A;  4FCY A;  1R23 A;  4YHB A;  1BJZ A;  5E79 C;  4MQV A;  1KRH A;  2DDA A;  3TED A;  3OSF A;  1AKH A;  1VQM I;  3MZH A;  4I76 A;  2OBS A;  1TWA J;  4IEJ A;  2FMY A;  3M3Y J;  5E1W A;  2F5V A;  2PFB A;  2X0K A;  1YX3 A;  3B73 A;  5CLS A;  3W2G A;  4QPQ A;  3CMM A;  3AVW A;  1IB4 A;  4C3H J;  3CDH A;  4IRI A;  3RDI A;  5FKN A;  3E6M A;  1LDJ A;  2CWE A;  3BY1 A;  4ZTJ A;  3DEW A;  2BY3 A;  3RSN A;  1ZQ3 P;  4I7H A;  4KT5 C;  3PUM A;  4TMT A;  2ZME A;  4Z1M A;  2VFN A;  3GQA A;  3OYN A;  3IUO A;  4BHC A;  1G7S A;  1N0U A;  2HYJ A;  2HQA A;  4NB5 A;  2NRA C;  2OF7 A;  3EUK L;  1TSP A;  1FJL A;  4LFU A;  2ZXW H;  1E0E A;  1D8J A;  5LFA A;  1S8N A;  2FNP A;  2VKE A;  4U0Y A;  2LKX A;  1P4M A;  4ZGN B;  1XSV A;  2KIS A;  2RQP A;  3P7N A;  3TDU C;  2OYN A;  2XIG A;  3AGQ A;  3TBI A;  3BPX A;  1VF9 A;  3BP8 A;  4M1K A;  5EGO A;  2NT9 A;  2GQF A;  1BR4 A;  1OFM A;  2JT1 A;  1QGP A;  1UST A;  4M74 A;  5HKK A;  5IYD J;  1IW7 F;  3HB9 A;  4C0S A;  4EJV A;  2ZCW A;  2HKX A;  3PL8 A;  2E2H J;  1XGS A;  2DA6 A;  2M4K A;  5H6R A;  1FWZ A;  2D9R A;  2NNY A;  1EJ9 A;  3SZT A;  1JUS A;  4Y13 A;  3CUQ C;  2JA7 J;  3F8N A;  3ZP5 A;  1Z3X A;  4EVI A;  3DTI A;  1A8P A;  4XKC A;  2CW0 F;  3ROU A;  2HZD A;  2OQG A;  4C3I J;  2X8K A;  3CCS B;  1D8K A;  1JRG A;  2M7B A;  5FRN A;  2FJ1 A;  3IKV A;  5E1X A;  1JA0 A;  4Y9R A;  3K4N A;  1I7P A;  2WZN A;  1I18 A;  3A01 B;  2IAI A;  1XQB A;  4DYR A;  2QKL B;  4KIC A;  3VMV A;  4KN7 X;  3DXJ F;  3ONU A;  3OZV A;  2O17 A;  1IZ1 A;  2YX4 A;  3S3N A;  2ADU A;  1FX0 A;  2MC4 A;  2ESN A;  3OYJ A;  3PIP F;  1KU2 A;  1J2X A;  1HST A;  2W25 A;  1HA8 A;  5GV8 A;  2WWY A;  1LB2 A;  3V7S A;  2RV8 A;  1K7A A;  1DQU A;  2ZKZ A;  2P5L C;  4Z4Y A;  1W5C C;  1YHQ B;  4RB1 A;  3F6V A;  2VON A;  4PC6 A;  2RDP A;  4E7L A;  1NH3 A;  3BT9 A;  4BAY A;  2IS4 A;  2FXA A;  2DN0 A;  3DCF A;  4NCN A;  2BVL A;  2LC2 A;  3QWL A;  1OCT C;  1BX0 A;  3H0D A;  4XRS A;  3ES9 A;  1BI0 A;  2R0Q C;  2XV4 S;  3BOQ A;  2DK8 A;  3BZC A;  1BHE A;  3F6O A;  5JVG F;  1IJF A;  1P4X A;  2AQF A;  5EF6 A;  1CF7 B;  1ITY A;  4FQG A;  2F4M B;  2XAF A;  1KK1 A;  1JHH A;  5GPA A;  2OBP A;  1TTY A;  2CV0 A;  4WZE A;  2ZSI B;  1MBG A;  3A8I A;  3EUA A;  3ZIA A;  2VFQ A;  2E2I J;  2BF4 A;  1B9N A;  2ZXH A;  1WJC A;  4M6X A;  2ZL6 A;  4QPO A;  2E1M B;  1VQN B;  2QM3 A;  3OV8 A;  3HTU A;  3LNQ A;  5DS9 A;  1UHW A;  3E97 A;  4HDV A;  2XRO A;  3KLN A;  4RCZ A;  1QQI A;  1V5E A;  1QA1 A;  4N4O B;  5E3N A;  2J8I A;  4ENK A;  3IWZ A;  2K9L A;  2HDW A;  1JJ2 B;  3KP4 A;  2X3U A;  3L2C A;  1XGO A;  3CES A;  5FO5 A;  4E4H A;  2HNH A;  1OR7 C;  3H9Q A;  2M34 A;  2D74 A;  4NQW B;  3J81 Z;  3G1O A;  2XKP A;  4XKW A;  5JMC B;  1VI0 A;  2LOO A;  1O3S A;  2GM4 A;  2IXS A;  4HV5 A;  5E18 F;  2DI3 A;  4U0V A;  3JR9 A;  2HQN A;  3A1P A;  2A6E F;  4AU7 A;  4ITV A;  2DPD A;  1DGR M;  2BMW A;  2JUC A;  4L5E A;  4TV7 A;  2M45 A;  1K61 A;  5FKL A;  3ZQH A;  3MCA A;  4BXX J;  3CC4 I;  4M9Z A;  3TO9 A;  4EAT A;  3A8K A;  3VWB A;  2EFO A;  2ZZQ A;  1A04 A;  2VQL A;  1OCO H;  3KP3 A;  5DYM A;  4GDF A;  1J0R A;  2MFZ A;  4V2F A;  1B59 A;  1R71 A;  3E20 A;  1Z77 A;  1H8E A;  2V1X A;  1RES A;  4F55 A;  1Z6R A;  1KU3 A;  1R7J A;  3O6B B;  5JI6 A;  1AU7 A;  4W8R A;  3DDY A;  4Y4R A;  5LHH A;  3U1D A;  1YJN B;  3HAG A;  4U4B A;  2O6W A;  1JT6 A;  2LRD A;  3E6C C;  1I27 A;  1Z9C A;  2FX0 A;  2W85 A;  1X4P A;  1K78 A;  1STZ A;  4N9H A;  1VTN C;  1TL8 A;  1QO0 D;  1SD6 A;  4BH9 A;  5TV2 A;  3JX8 A;  4A2U A;  3V7C A;  4D7M A;  2V7U A;  3HC7 A;  1A35 A;  1CZF A;  3BJ6 A;  3MCZ A;  3VO2 A;  5GP9 A;  1EP3 B;  4DNT B;  1VND A;  4WCG A;  2DJN A;  3NEU A;  4OU0 A;  2XPU A;  5IYN A;  1IV8 A;  2MBF A;  4BL0 B;  1O8K A;  1XB2 A;  2Z16 A;  4LB6 B;  1RET A;  5CPR B;  4UVA A;  1H8A C;  4Y7C A;  2XT2 A;  3OPO A;  1WGX A;  1E1Q A;  3UKG A;  1P7J A;  3K0L A;  3HKZ N;  5GAE J;  1HKQ A;  1EKE A;  1NHA A;  4RM0 A;  5EG0 A;  2E2J J;  5DCM A;  2X6X A;  2VJ4 A;  5GPC A;  1MBK A;  3O8H A;  2W84 A;  4D0P A;  2STW A;  3CW2 A;  3SDB A;  1XE1 A;  1MBH A;  3E6D A;  3NQO A;  1RKT A;  4JP0 A;  2XUB A;  2JVG A;  3ZMT A;  1RR8 C;  3ML6 A;  1D3Y A;  3B90 A;  5HOO A;  4Q47 A;  4M53 A;  2XZL A;  3QYF A;  3EET A;  2QUF A;  4S04 A;  1VQ8 I;  1IUF A;  5DV5 A;  2XRL A;  3OYB A;  1TVC A;  1SVL A;  2BN4 A;  3KZY A;  3U1K A;  2G0Y A;  1UMK A;  2D3L A;  4IVN A;  2CG4 A;  2R7R A;  5ERI A;  4HQE A;  1VQ9 I;  3V42 A;  1IJE A;  3GW2 A;  1EP1 B;  2MSY A;  3BR3 A;  1YJ9 I;  4M2L A;  5E6T A;  3AG1 H;  3LWF A;  2H27 A;  1MDM A;  1V3F A;  3I9V 2;  3KLO A;  2B7B A;  1T08 B;  3T5X A;  2LY9 A;  1T38 A;  4ZDP A;  2VOD A;  5FFX A;  1N0V C;  3WTS C;  3JSO A;  1RI7 A;  2KIM A;  2X51 A;  2BV3 A;  5KVR A;  1F43 A;  5IK2 A;  2R93 J;  1G3W A;  5FRM A;  2QQA A;  1U5T B;  4XRM A;  2ZXJ A;  3GUD A;  4P9S A;  2Z8G A;  1VQ7 B;  1X3Z B;  2PMU A;  1IN8 A;  3VB2 A;  3JQQ A;  4CIC A;  1SFU A;  1H9G A;  1KZH A;  2FRH A;  1PVE A;  3MD2 A;  3CCL I;  3LQ6 A;  3LQE A;  4N3G A;  4L9V A;  2BX6 A;  2X6O A;  4RDK A;  3LSG A;  2WB1 N;  1VQK B;  2EFG A;  3K6G A;  3CD6 I;  1PUF B;  1Z05 A;  1H9T A;  1F60 A;  1ZYR F;  1MJA A;  4A0Y A;  1AA7 A;  4X05 A;  2BSP A;  1BR1 A;  2CUE A;  3ULQ B;  1D1A A;  3H5A A;  1H42 A;  3CB4 A;  1VBL A;  1FYM A;  3Q3A A;  2FBI A;  4MYU A;  2XTX A;  3B78 A;  3HOX J;  3RPQ A;  1FDR A;  2R5Z B;  3F0C A;  1OCR H;  3M8J A;  1WI9 A;  3EYY A;  2CF4 A;  2W6I A;  4DJA A;  3ZPL A;  1VZ0 A;  5HLG A;  2PMD A;  2Q6K A;  2KZG A;  1JGG A;  5K7Z A;  2PMZ N;  1V0E A;  4XK4 A;  5IT9 K;  2HQR A;  3BC8 A;  4J00 A;  1K28 D;  3FKJ A;  4Y52 J;  4PUS A;  1FT9 A;  3HSE A;  4UV9 A;  3HDD A;  2COB A;  2BY0 A;  5K1Y A;  1YYV A;  2ZXI A;  3OYC A;  3OEH A;  1P4A A;  1YRN A;  1GDT A;  2R7S A;  2A6T A;  2YS9 A;  1ACI A;  1QA3 A;  4P3I A;  1HA3 A;  3CQZ J;  5FD5 A;  2XEX A;  3FXO A;  2XDV A;  1FBS A;  2VBW A;  2XPW A;  3F72 A;  2CU7 A;  3S93 A;  5TY0 A;  4HPQ A;  2H09 A;  4GCV A;  2VKD A;  2YU9 J;  5ED4 A;  2MAB A;  1HW5 A;  3HUG A;  3P9C A;  2XF5 A;  3VNU A;  4HW0 A;  5HOD A;  2BYV E;  1R1V A;  2R7X A;  1CNF A;  3K70 D;  1U9O A;  2FA5 A;  1A36 A;  2V7F A;  2EB7 A;  3NAW A;  2K27 A;  4I0B A;  3GTP J;  3S17 J;  2E60 A;  3PVD A;  2E1R A;  2GIZ A;  4L18 B;  1KQ5 A;  1YIO A;  1NK3 P;  1QVT A;  2HKO A;  3M9A A;  1T33 A;  2BOL A;  1ZTR A;  3OYF A;  5ILS A;  2KJB A;  2MA3 A;  4IO9 F;  2VJJ A;  5BSY A;  2BZT A;  1J5Y A;  2PJR B;  4AID A;  1POG A;  1ZAO A;  3OFN A;  1ZN2 A;  2O0Y A;  4FET A;  3SJZ A;  2MD5 A;  4Q5S F;  3HOZ J;  2PYG A;  5AMV A;  3RJP A;  2QSH X;  2IA1 A;  2R7U A;  2VNK A;  3QU3 A;  3MMP A;  1R6R A;  1D5Y A;  3OYD A;  4RGR A;  3W6K B;  2C4T A;  2QGG A;  2UXX A;  4QWQ A;  4FX4 A;  1K4Z A;  1SFX A;  3WE3 A;  2J8K A;  1SFE A;  1SD7 A;  1E3Z A;  1OYW A;  2E71 A;  4YEJ A;  2VBX A;  5KAF C;  3BNW A;  4X1E A;  3BR6 A;  1R5N A;  5JFR A;  1MKM A;  2DFI A;  3JRI A;  2GIV A;  4ESF A;  3PUF A;  3CCE I;  1TUI A;  2RNG A;  4GFB A;  1VQ6 B;  2F2E A;  2J7K A;  2LG4 A;  3RTR A;  5K5Q A;  2CH0 A;  3BH7 B;  2VQG A;  3CMY A;  2PQ8 A;  3AFH A;  3BRO A;  2NVT J;  5D5W B;  2HU9 A;  1XDS A;  3BG7 A;  5EYR A;  3CPX A;  2PEX A;  3BCD A;  2CW7 A;  2XTW A;  3BTJ A;  1LUJ B;  4AC0 A;  1CQT A;  1XG1 A;  1VQO B;  4P96 A;  3ASO H;  2GOX B;  1IHM A;  1WWX A;  2A69 F;  3FX3 A;  3JRA A;  4ESJ A;  1LVK A;  3IH2 A;  4EQQ A;  1F4K A;  3GTK J;  3DQV C;  2L02 A;  1W7P A;  4YFX F;  3OP1 A;  2Y9Y A;  1WH7 A;  1I3A A;  1QGY A;  4TMX A;  1FZP B;  1XTA A;  2V9V A;  3WYA A;  1IDJ A;  4I09 A;  4RAF A;  4JBA A;  1YX5 A;  1YLO A;  4NBQ A;  4IHW A;  2FQ4 A;  3JRB A;  1L0O C;  3BLY A;  3MZ8 A;  4UZE A;  1V4R A;  2EZI A;  2VJI A;  2Q6L A;  3QFC A;  4CXF A;  1D1N A;  1EFT A;  1WMR A;  1DU0 A;  4YAL A;  2DOG A;  4I99 C;  2EIN H;  1G7R A;  2O04 A;  3DBL B;  1FOW A;  1S7E A;  1KON A;  3QSY A;  3QPT A;  4R71 A;  5F4O A;  4G9Y A;  3SXY A;  1FYL A;  3U21 A;  3DU1 X;  2W4S A;  1U2W A;  3FWE A;  4KYW A;  3SHF A;  5L3D A;  3RYP A;  4KIB A;  3FJO A;  2C6Y A;  3CCM B;  1N8R D;  1GAQ A;  1X4O A;  1OFE A;  5JHU A;  3OYH A;  2HXO A;  2MW8 A;  4RB0 A;  2L7F P;  4WWV A;  2R9V A;  1JHF A;  4U0W A;  3CO7 C;  2XF6 A;  1NK2 P;  1JXS A;  4DBR A;  1X0C A;  5C1C A;  2CQN A;  2QE7 A;  2EV6 A;  2EA2 A;  1YOV B;  3ZMD A;  4B1R A;  3CC2 I;  2PJP A;  2JIZ A;  1L3L A;  3OW7 A;  3KP7 A;  1KK3 A;  1K4S A;  3C2G A;  3I55 B;  2QBY B;  1FIA A;  3KCC A;  2BY2 A;  3JTH A;  4LLN A;  2JSC A;  1UZC A;  4D5C A;  1TYX A;  1VQ4 I;  1LFP A;  2DOF A;  4QV2 A;  4Z4U A;  3HZJ A;  2DFE A;  2VJ5 A;  3IWF A;  3JQR A;  3ZZT A;  1OQY A;  1Y0U A;  1D0X A;  2QGU A;  1YS6 A;  3VSU A;  1X2M A;  3VMW A;  2ZME B;  1R5B A;  2OK8 A;  2DT5 A;  3VOE A;  1S72 I;  3DU5 A;  3QAH A;  2C5B A;  3W6J B;  3OL3 A;  1Y56 A;  4DQK A;  4XD7 A;  2DFH A;  2BGJ A;  4M3D A;  4HWV A;  2QX3 A;  1X19 A;  1QNT A;  2IRF G;  5JBQ A;  4OJO A;  4B44 A;  5L3C A;  2QEX I;  1JKQ C;  2NXN B;  4BS9 A;  1YIJ B;  3DV8 A;  1VFC A;  2CS3 A;  2ZJP F;  3EPZ A;  4A6E A;  5C3E J;  2CFX A;  2VQH A;  3FXM A;  3OIP A;  3R0A A;  3PSF A;  1YW8 A;  1RUO A;  3N05 A;  3V76 A;  1NHC A;  4HX4 A;  3IV5 A;  1B8I B;  5LRR A;  4RS8 A;  5EJC A;  3V8J A;  1BC7 C;  3HHH A;  3QRF F;  3MEX A;  2XAS A;  2W57 A;  3WG7 H;  1TBX A;  1BL0 A;  3H0G J;  3W2I A;  2VBE A;  2IGK A;  3WBJ A;  2OAZ A;  2QYU A;  5CVU A;  3BJA A;  1TWC J;  2OPT A;  4CHU A;  1RIO H;  3CMA B;  2PLF A;  3P9I A;  2EIK H;  1UD2 A;  5E20 A;  3DEU A;  2WAE A;  1TWF J;  4G6D A;  3SZP A;  2XB5 A;  3ZN0 A;  2BM7 A;  1E2X A;  1LFB A;  3BWG A;  2DBB A;  1YJW I;  2VXZ A;  2XGD A;  2XZO A;  1D1B A;  3L2W A;  1FND A;  1O88 A;  1FOY A;  1TWG J;  3ZMV A;  2DK5 A;  1B6A A;  3SQN A;  3CP8 A;  5ICG A;  3L09 A;  3HRM A;  2NVX J;  4HLY A;  5A8A A;  2Y2Z A;  2MGQ A;  4PFO A;  3I4N J;  2WV1 A;  2XC1 A;  4PMH A;  3GVK A;  1BM9 A;  4RD3 A;  2B0R A;  4Q4Z F;  2B0L A;  3BY6 A;  2PI0 A;  4EV0 A;  3GTM J;  4X7D A;  1IN4 A;  3H1C A;  3H3U A;  4OWR B;  4U7D A;  1WPC A;  3X2Q H;  2E35 A;  2JRM A;  2JDI A;  1ETV A;  2XOK A;  1MMN A;  1S7O A;  1HDP A;  2OA4 A;  3OL4 A;  1TQI A;  3QOD A;  2M7A A;  4NC8 A;  1Y0Y A;  2BGI A;  2UZK A;  4OPS A;  4G12 A;  1AIP A;  2IS6 A;  4WXH A;  3G73 A;  1WDT A;  3CCU B;  3RIQ A;  3K4M A;  3W2F A;  4A12 A;  4P3Y A;  2HYF A;  1Q7Y D;  1MMD A;  4UHT A;  2ZJR F;  3TH0 A;  3HRS A;  2ME0 A;  1XSD A;  5ILV A;  2DYR H;  1Y6I A;  1OCZ H;  2IGN A;  1XMX A;  4C3J J;  1W35 A;  1TT0 A;  2IJL A;  1IO2 A;  4MEY F;  1Y8R B;  1OB2 A;  2LR8 A;  1G3Y A;  1UG0 A;  3S8P A;  4CO8 A;  5ILU A;  3ERE D;  3MMY B;  4A3M J;  3GVL A;  1IDY A;  2B9S A;  5D5U B;  2XGX A;  4ASN A;  3V8K A;  1OYI A;  2FML A;  2DJI A;  2P5K A;  3W5V A;  2GA2 A;  5J40 A;  2BSA A;  2ZL7 A;  5TR9 A;  4XMY A;  3PQK A;  5JHF A;  4Q48 A;  1MH3 A;  2ZZE A;  2OBR A;  1QUE A;  1JTY A;  3CJR B;  3C18 A;  5E1Z B;  1IXS B;  4P6Y A;  1OB0 A;  3CCR B;  2QZA A;  5BPD A;  1R36 A;  1EFR A;  4J19 A;  1V55 H;  3ABL H;  2ZNZ A;  1YQA A;  4ZV4 A;  2EIJ H;  5IOZ A;  4KUM A;  5IYQ A;  4YFO A;  1D5V A;  1IRF A;  5C4X J;  4ZDL A;  3CCJ B;  1QQ1 A;  2M1B A;  2X4H A;  1O3Q A;  3P4G A;  3SY2 A;  2V1N A;  1ZKG A;  2HVQ A;  4YRV A;  3F8F A;  5FLX Z;  4BDY A;  1YI2 I;  2XAJ A;  1PYV A;  4OZZ A;  2DA2 A;  1YO5 C;  4HV6 A;  4F91 B;  2VE8 A;  2MLG A;  3I59 A;  2XZP A;  3VDX A;  5LGN A;  1N08 A;  3BCB A;  3VEP A;  5K7H A;  1HKT A;  2WTE A;  2K9M A;  1UD3 A;  1APL C;  5KK1 A;  3HSF A;  2IOU G;  1MMA A;  3LOC A;  2INU A;  4RMN A;  3KRG A;  3I4P A;  4BNC A;  2YUH A;  4PJJ A;  4G94 A;  4PGO A;  1T2K A;  1UB9 A;  4CSW A;  3BG3 A;  4CUG A;  5HDK A;  3D5L A;  2LZJ A;  1P4W A;  4XID A;  4BJT A;  4MTE A;  1TYU A;  2H94 A;  3ASR A;  1BJA A;  4RAY A;  4HNT A;  2YU3 A;  4KKT A;  3OEE A;  4XLC A;  2XB0 X;  1R1T A;  2KDZ A;  2FE3 A;  3PA2 A;  2AQE A;  4QHY A;  5C1E A;  4Z4T A;  2ISZ A;  4D1Q A;  3ZQQ A;  1GT0 C;  3GLX A;  5DTD A;  5CKT A;  2Q0O A;  3GZ6 A;  1XMK A;  2IS1 A;  4B3F X;  5DM6 F;  2JJ1 A;  5EMN A;  2G7U A;  1RZ4 A;  1R4M B;  2LYC A;  3OYI A;  5AIQ A;  2BBY A;  3OOU A;  5EG0 B;  5DCM B;  2A6H F;  2KRF A;  2W24 A;  1N06 A;  1Z67 A;  1U78 A;  4YAU A;  4RLQ A;  3CCQ I;  5HVQ C;  1XCB A;  4QTR A;  5F1J A;  4JX4 A;  3CXC B;  1WH5 A;  4LIT A;  2F4I A;  4N4N B;  2O3F A;  5J8F A;  3OYE A;  2IQ7 A;  3CME B;  2R3S A;  4ZJZ A;  4G7O F;  4RDL A;  2V26 A;  4ENM A;  4RB2 C;  1H88 C;  4PJM A;  2JQ7 A;  1OCC H;  4YFK F;  2LSO A;  1DU6 A;  4J01 A;  5LHG A;  5D5V B;  2BE5 F;  3CO6 C;  1JTX A;  1ON2 A;  5H2F C;  1XB4 A;  1SKQ A;  3MKL A;  2VZL A;  1O8H A;  1D0Z A;  5LMZ A;  3GTJ J;  1MDM B;  4OIN F;  2Y0S A;  1Y39 A;  4PC1 A;  3I3L A;  5DDG A;  2BM1 A;  3Q0U A;  3GTQ J;  2PN6 A;  4CGZ A;  2DET A;  4CH7 A;  4BY1 J;  4DNR B;  1O7L A;  3EUH C;  1LJ9 A;  3JUR A;  2TCT A;  4ON0 A;  2HFH A;  2KL4 A;  2IBD A;  4HDU A;  3SQV A;  1KU7 A;  4TMZ A;  4I0A A;  5CVR A;  3K4K A;  2GXA A;  5HLI A;  3G4S I;  1JE8 A;  2NVQ J;  2CGP A;  1IN6 A;  4OZY A;  2DOD A;  2JVH A;  3JRF A;  3CCV I;  4NNJ A;  2Z33 A;  2L0K A;  4IRH A;  1JNY A;  3WBK A;  2DIE A;  1XCV A;  2QMU A;  4Z06 A;  5M3F J;  1Z1D A;  2DEU A;  2P7C B;  1E3H A;  2K4J A;  4OPO A;  3E6B A;  4M9X A;  3JSP A;  4E7K A;  2LH9 A;  3L2R A;  1SM4 A;  1P92 A;  3QOP A;  2F5F A;  1JT0 A;  2QDX A;  5B1B H;  1ZG5 A;  2H6B A;  2UUZ A;  4M3E A;  4ZCI A;  2D1V A;  3FXR A;  1ZM2 A;  1ETO A;  1ZRC A;  4YZ0 A;  4ENJ A;  3G71 I;  3RI4 A;  2FU4 A;  5HLH A;  2M0M A;  2VXD A;  4AIJ A;  1JKO C;  3U6K A;  5FB2 A;  3HRT A;  1VQP B;  5B5E C;  1XX5 A;  1DG1 G;  2VAS A;  1U2R A;  5FKK A;  1KCD A;  2RQQ A;  2GQQ A;  3PFY A;  1G4D A;  4F3Q A;  3P27 A;  5H6Q A;  4ENN A;  3DKW A;  2XSJ C;  4CYC A;  3WTZ A;  2O9L A;  5DSZ A;  4L9J A;  3EQO A;  4KN4 X;  3M8F A;  4LJZ F;  2Z6B D;  3TP0 A;  4BQQ A;  3ZBU A;  3R60 A;  3JAM Z;  3VNV A;  2L9N A;  4F52 A;  1V5V A;  4P1V A;  1K9M D;  1GV2 A;  1S5L C;  4EGZ A;  4WZT A;  2ZTN A;  3LVB A;  2X85 A;  1DGW Y;  4XSX F;  1IXR C;  2JPC A;  1Z7L A;  3WU0 A;  2W7N A;  1RQR A;  4EM2 A;  1KQ9 A;  2DDB A;  2Z3Y A;  4FIS A;  2P5V A;  1ZR4 A;  4A3E J;  2ZJ2 A;  3HG9 A;  1VQ5 I;  2MC3 A;  4OOX A;  2P6S A;  3SLD A;  3I0T A;  1ZRD A;  1JKR C;  2CW5 A;  2H1L A;  2VBS A;  1NRK A;  1JUM A;  3J80 K;  4ZTF A;  3HUG B;  3AGP A;  4ETS A;  1IRZ A;  3GFL A;  5C44 J;  1FRN A;  4YCQ A;  1GXQ A;  2ZO4 A;  1RWR A;  3DPU A;  3S15 J;  4XQF A;  4GRI A;  2F1M A;  2UVF A;  5H5J A;  4HX8 A;  1J7K A;  2WYR A;  3T51 B;  1GVH A;  5FL7 A;  4A3I J;  3BDD A;  1UHS A;  2DU9 A;  4FAS D;  2DXI A;  2JJ2 A;  1Q81 D;  1SAU A;  1U6G A;  4K2E A;  1U8B A;  2AHQ A;  5F04 A;  1B72 A;  5LRS A;  3SJM A;  3QYE A;  4HOB A;  1COW A;  4PJN A;  1K83 J;  1P6R A;  3V8L A;  4YZX A;  2Y0M A;  4A5M A;  1REP C;  1HOM A;  4AC9 A;  2OZU A;  2XRN A;  1O8G A;  2M5W A;  3HYI A;  3AL0 B;  4P2N A;  1IUY A;  1T5E A;  3S2H J;  4UB6 C;  2VNH A;  4RD1 A;  1O3R A;  3U6B A;  3ISX A;  1U9N A;  2OQR A;  3BJO A;  1X3W B;  4A3G J;  2XND A;  2YWH A;  2WY8 Q;  3ZQG A;  1FTT A;  4DNC A;  2B5O A;  4FE7 A;  4XRF A;  1QG0 A;  3MAJ A;  1G8X A;  1FIP A;  1XGN A;  5IYB J;  2VOP A;  1SEU A;  2HCJ B;  3QOE A;  1MH4 A;  1W7P D;  2KIU A;  4U49 A;  3K4C A;  3QFR A;  5FLV A;  2RC4 A;  2K3F A;  1JI8 A;  2HMA A;  3KEO A;  3H5N A;  2PG4 A;  2CSO A;  2YPR A;  3F9K A;  2YSR A;  5BOX A;  2H8R A;  3Q0W A;  2W00 A;  1VQL B;  5BS6 A;  1G7C A;  2PLY A;  3LA7 A;  3MQ0 A;  1R49 A;  2C2W A;  3HM5 A;  3OYA A;  4LC0 A;  1JKP C;  2IGM A;  2KP6 A;  5FLX K;  2ELH A;  4R79 A;  3R61 A;  3OS2 A;  2L7K A;  3L2U A;  3S2W A;  2V9P A;  5CQG A;  4ACA A;  1WPK A;  2KT0 A;  3FXU A;  1HZE A;  4CQJ A;  1EV7 A;  3Q9V A;  4RB3 C;  2V9K A;  3D5S C;  3LST A;  2R6H A;  3LSR A;  1X1P A;  2JJ7 A;  5J3L A;  2V5I A;  4P9F A;  2JA5 J;  1ZM4 A;  3R6J A;  2DA1 A;  2QCO A;  4BYY A;  2BXY A;  4WZK A;  4JK1 X;  3MHP A;  2XAU A;  3A02 A;  2LF7 A;  3CUO A;  3TO7 A;  2B7C A;  1E64 A;  3CC2 B;  3QYB A;  1FSE A;  2CRV A;  3JTG A;  1HDD C;  1TWH J;  3Q9S A;  3ZQ7 A;  3J7A O;  2WAQ N;  5FGM A;  3ZPP A;  2E1M C;  4MO7 A;  2F43 A;  2PBI A;  5HLT A;  1DP7 P;  4JMQ A;  3AVT A;  2DMU A;  3J7Z I;  1IC8 A;  3BCF A;  3H9N A;  2MYS A;  3BR1 A;  1BIB A;  2BVM A;  4LLL A;  2E19 A;  5J4Y A;  1N78 A;  3R0J A;  5B1A H;  2COM A;  1W36 C;  1Z21 A;  2M87 A;  1IAW A;  3M1C A;  3BH4 A;  1S72 B;  2NS8 A;  1KQ8 A;  2OZ6 A;  1NBM A;  4P22 A;  2DO7 A;  2M8G X;  1W4M A;  2RC5 A;  2YUS A;  5HNH A;  4MEX F;  1A5J A;  1TLH B;  3WU1 B;  2V79 A;  4CCO A;  5J1U A;  4S0H B;  2OBT A;  1TTT A;  2OTJ B;  3MKW B;  2OUM A;  2WAF A;  4OM9 A;  4LG0 B;  1KK2 A;  2ZTG A;  3HRU A;  4LIU A;  4G7H F;  2QA4 I;  1T6S A;  2EA4 A;  3CUQ A;  2NV4 A;  2BW3 B;  3DPL C;  2VB6 A;  3FMR A;  4YXW A;  1YIT B;  4XLN F;  4X7F A;  4E7J A;  3A35 A;  2IT0 A;  3I1F A;  3CJT B;  3WGH A;  2GJR A;  5IOY A;  4OMZ A;  3WOD F;  2M3A A;  2X1D A;  2A68 F;  4QVJ A;  2VI6 A;  4N0B A;  3KET A;  3W5U A;  4UVB A;  3RY8 A;  4BU2 A;  4J0Q A;  2JWT A;  3ABM H;  1DDG A;  4AF7 A;  1QRB A;  1KYW A;  2ZNY A;  3FKI J;  4Z6Y A;  1LPQ A;  3COA C;  2R5Y A;  3OJX A;  2NS7 A;  3AVV A;  2OTL I;  2X0L A;  5E8I A;  4IHX A;  1ENH A;  1LLW A;  3DFG A;  1WU8 A;  3A4C A;  3E0J B;  3H35 A;  2PIA A;  3NB2 A;  4HNV A;  2LMD A;  2DPU A;  2XPV A;  1HVX A;  3C2B A;  2Y9Z A;  4P55 A;  2KHM A;  4BJ6 C;  1FNB A;  4QLC U;  3IHU A;  2JN6 A;  1O8M A;  3DBH B;  5HS8 A;  4XNF A;  3ESW B;  3LSP A;  1Z0X A;  3K10 A;  3GO5 A;  3FKS A;  2R7Q A;  3F22 A;  2HPI A;  2NVU B;  3L2V A;  1U8R A;  3I54 A;  2AO9 A;  2IGO A;  2XAG A;  2X53 S;  4DGW B;  2D5V A;  3I56 B;  3FMQ A;  2LY2 A;  3ECO A;  4FK8 A;  2VLA A;  1OMI A;  4WX9 A;  3L1P A;  2GK6 A;  2NZM A;  1WTH D;  3SEQ A;  1VLY A;  3B8H A;  4KKU A;  1IF1 A;  5J3O A;  1PXZ A;  2VFO A;  1KQS B;  1OOC A;  1EXM A;  3WTU C;  3DKY A;  1ZM9 A;  2HI3 A;  3A2K A;  3AVY A;  2HQ5 A;  4OAZ A;  4XOT A;  2FVG A;  3CF2 A;  2XHK A;  5J4V A;  4L9N A;  2UWM A;  1SKY B;  3ISP A;  4M3G A;  3W2A A;  4AUX A;  3IRR A;  1ZRE A;  1IB0 A;  5JLX A;  2XT4 A;  2EFW A;  2PX9 A;  2K9Q A;  3R4K A;  5TJJ A;  1LDK B;  3HOT A;  1OJL A;  2Y30 A;  2I10 A;  2ZFU A;  3SZE A;  2EIL H;  5E3O A;  3LFU A;  2GZW A;  4M4S A;  1KK0 A;  5FKM A;  2JRT A;  4RJL A;  3VR6 A;  1YX2 A;  3PFI A;  5M5Y J;  1K79 A;  2R7Z J;  1OR7 A;  3HGG A;  1X58 A;  2WAD A;  3LSM A;  4X0G A;  4C2T A;  2GXB A;  1WSR A;  3WGG A;  1EF4 A;  2PEC A;  1P7I A;  3ZBT A;  2CRG A;  3OE7 A;  3OYL A;  1HF2 A;  4U88 A;  2EZH A;  3GYH X;  1KYZ A;  5KNL A;  4RD4 A;  4IL6 C;  1Z7U A;  2BY1 A;  4O6J A;  5CVV A;  2BVN A;  1TT5 B;  2Z9O A;  3LAP A;  3T0Y A;  2LTP A;  4LMY A;  2D2W A;  4AYB A;  2NTP A;  2FF4 A;  2MH9 A;  1U5T C;  4RA2 A;  1O8E A;  1UEL B;  1Y0N A;  5A2Q Z;  5D5X B;  3OS0 A;  1W1W E;  5HS7 A;  3BR5 A;  3CCS I;  1RUN A;  1BX1 A;  3K1P A;  3PEN A;  1RPW A;  3PA1 A;  3GQ7 A;  1R5I D;  5FO1 A;  5TGT A;  1S9H A;  2BHY A;  1TYV A;  5M3M J;  2L4M A;  1IDK A;  1I1G A;  4RCY A;  1MZB A;  2HDD A;  3OKX A;  3B6C A;  1QU3 A;  3S16 J;  1BJK A;  2A3S A;  3LA3 A;  2CO5 A;  3GQ8 A;  1SD5 A;  1TW2 A;  3RCO A;  2O7O A;  3GWZ A;  3WQZ A;  1R5O A;  2F48 A;  2F5E A;  1YHQ I;  2NT6 A;  2KZV A;  1KU9 A;  1YFH A;  2MH2 A;  3GVA A;  2OJE D;  2RNJ A;  4CCM A;  3KP5 A;  3HL2 A;  3OIQ A;  2NTQ A;  1X1B A;  4B3A A;  2EZL A;  3B02 A;  4JX5 A;  2XNC A;  1LE8 A;  5FRO A;  3V4G A;  1FNN A;  1JUP A;  1IDZ A;  1MSF C;  3J81 K;  3JU4 A;  3K2Z A;  4OJP A;  1R58 A;  3FF5 A;  2JPB A;  3W2W A;  4LLG F;  1OB5 A;  1R9T J;  4XON A;  3T9G A;  5M5X J;  2DAO A;  3RKW A;  1RKW A;  1VQN I;  4BDZ A;  2DMN A;  3KFW X;  1SMT A;  2O8K A;  3AVU A;  4NBS A;  3ONQ A;  2CUF A;  2Q8K A;  1XPX A;  3WTY C;  1HF0 A;  2W6J A;  5L3E A;  1DBG A;  3KX2 A;  2K02 A;  4RGU A;  1HC8 A;  5GAD J;  1MD0 A;  1KJZ A;  1WOP A;  1NB0 A;  3RIR A;  1BMF A;  1W0K A;  1QRY A;  1RR7 A;  3KIO A;  4BHP A;  1H8H A;  1ZGJ A;  3ZCO A;  2DYS H;  1CQX A;  3NWT A;  2JUG A;  1TC3 C;  2V6E A;  3Q6Q A;  3DEE A;  1J75 A;  4D7N A;  3FM5 A;  3SFI A;  1BBY A;  2E1O A;  2FNA A;  1ZGW A;  4RD2 A;  1XC5 A;  2EV0 A;  3ONY A;  2CQX A;  4BBR J;  4KFC A;  4U87 A;  5IYW A;  4LOC A;  1VQM B;  3TDZ C;  3DLL F;  2JN9 A;  3A3B A;  4L5J A;  4DIQ A;  3IL2 A;  2HWV A;  3WTX C;  3PNV A;  4ZYG A;  3F23 A;  2Y75 A;  1VF7 A;  3SEJ A;  4XOR A;  1PP8 F;  2QEN A;  2F4O B;  5IP6 A;  1A31 A;  2AS5 F;  2M30 A;  1VHE A;  4LBZ A;  1LM1 A;  1KGS A;  1O4X A;  3GIR A;  5AN9 A;  4Z4Z A;  5LHI A;  2L2O A;  1MNM C;  3ZN1 A;  3C3W A;  4KIT B;  1AKH B;  1W0U A;  2GJK A;  1MND A;  3QPL A;  4DQL A;  1YJN I;  1HLV A;  1HG8 A;  3CCV B;  1DPR A;  5ICE A;  1XMA A;  2EFQ A;  2RVC A;  3FM3 A;  3MWM A;  4A0X A;  1MNE A;  1SAN A;  4HX7 A;  4BHB A;  1M90 D;  4HA8 A;  2D1H A;  4FX0 A;  1NDH A;  4TMV A;  4II2 A;  4IKF A;  3DWL E;  3PQJ A;  4FHT A;  2DYI A;  1ZEL A;  3TMO A;  4NUB A;  2CK3 A;  2HR3 A;  1G3T A;  3FDY A;  5DM7 F;  5BNG A;  2EWN A;  3ZQF A;  1ZM3 A;  1QHG A;  4EJU A;  4UXN A;  2X1E A;  2YWE A;  4P9U A;  4A3C J;  1K8F A;  3H94 A;  5C4J J;  3A03 A;  2D45 A;  2VL8 A;  1B2R A;  5EGO B;  3FPP A;  4A3D J;  1W34 A;  2UXN A;  4RM2 A;  1MMG A;  5DUI A;  2HDN B;  3W5H A;  3MVP A;  1R00 A;  2HOT A;  5CVI A;  2C78 A;  3A0H C;  3EDP A;  4WF2 A;  4A0Z A;  4EMS A;  2IA2 A;  4KMU X;  3B4N A;  4Y3O A;  1OHH A;  1E17 A;  1PP7 U;  3D5R C;  4MNU A;  5H20 A;  3FPK A;  1M1E B;  4PK4 A;  2BM5 A;  1S6L A;  1ETY A;  4RLZ A;  1FEX A;  1PJ7 A;  1R22 A;  3E5Q A;  2F1L A;  1Q1H A;  1BN5 A;  1QVU A;  1BIA A;  3WTW C;  4AD9 A;  2DER A;  1E63 A;  2O6G E;  3N90 A;  2GXG A;  1K8A D;  4L8J A;  3OIO A;  4NK8 A;  1PLU A;  5EEH A;  4OPW A;  2HZT A;  4L0Y B;  3GFI A;  2F5D A;  2V7T A;  4KMF A;  2O0W A;  1AWC A;  1O8D A;  5FKO A;  1E3P A;  1MJB A;  4A3B J;  2PYH A;  2QLZ A;  1XD7 A;  1K6Y A;  1D0Y A;  3A8J A;  2CMP A;  5DD4 A;  3QPS A;  3ZMU A;  3N4M A;  1LFU P;  4X7E A;  3CPW B;  2EQR A;  1N05 A;  4RDJ A;  3HTS B;  2ZL5 A;  3BR2 A;  4F7Z A;  3FBN B;  3KZZ A;  4WK8 F;  4O3M A;  3H09 A;  1VQ7 I;  2KLO A;  4R1H A;  3DBR B;  2BM4 A;  1FPQ A;  3TGN A;  1OFD A;  1N75 A;  4C2M J;  1QBJ A;  3VYR B;  1EA0 A;  2ZZF A;  2M4G A;  4KNY A;  2JA8 J;  4G6T B;  5JLW A;  2ZME C;  3AKZ A;  2R5Z A;  3DLA A;  1QH0 A;  3DKX A;  3G3Z A;  4Z4R A;  5FO0 A;  3QFT A;  3KP2 A;  1N25 A;  2GAU A;  3BR0 A;  5FIU A;  1X1D A;  1UD4 A;  1UG2 A;  2KRH A;  3RQI A;  3RYR A;  3CLQ A;  4DZJ A;  4U9U A;  2O61 A;  1CGP A;  1D1C A;  4PSW A;  1OGI A;  4FN5 A;  3OYG A;  4PSX A;  4ZYH A;  4H0E A;  1Q82 D;  4OOS A;  4HLX A;  1SC7 A;  3TKY A;  2C77 A;  4CZZ A;  3MZY A;  1QGZ A;  2GOM A;  2CQK A;  4C2U A;  2ETH A;  4WXD A;  4E7I A;  4KIF A;  3CC7 I;  2YR2 A;  3KL9 A;  4LBY A;  2DQL A;  2CJJ A;  4BEH A;  3E3V A;  1MBE A;  2FUG 2;  2QQ8 A;  3ERM A;  4JOM A;  1X1A A;  1GLN A;  2E5N A;  5F0F A;  4BAC A;  4K1X A;  3CC4 B;  5CQE A;  2FD5 A;  2GWR A;  2NOJ B;  3HPH A;  4UUV A;  2CUJ A;  3ECH A;  2ODL A;  2E5Z A;  2EK5 A;  5D6F A;  2NYX A;  3BQJ A;  4Z4V A;  3PM1 A;  1UD6 A;  4PC2 A;  2KVO A;  1A6I A;  5LLQ A;  3HOW J;  2ID3 A;  4E0F A;  2IW5 A;  2QQB A;  2VNJ A;  2DA7 A;  1I6H J;  2ID6 A;  1ZAR A;  1QVF B;  3PSZ A;  4GGG A;  1NTC A;  4Y17 A;  4B4C A;  4FE4 A;  1TNS A;  5IPA A;  2P8T A;  1BR2 A;  1D2E A;  2M0C A;  4MFE A;  2NSP A;  1QA2 A;  4CCL A;  3SLN A;  3W3C A;  1BI1 A;  3EQL F;  4WXC A;  1IRX A;  3PIO F;  4CCN A;  4I6Z A;  3KYC B;  3KYD B;  3VSL A;  3P26 A;  3ML3 A;  3H9J A;  5LBQ A;  4IOC F;  2JSP A;  4Z4W A;  3OW2 B;  1B1B A;  2QSG X;  1J9Z A;  4RM3 A;  2JMW A;  3GF2 A;  2GJP A;  2NNN A;  1ETK A;  5LD2 C;  4ZC3 A;  1KTW A;  3AVX A;  2EV5 A;  5KW9 A;  2GLO A;  2IPQ X;  4MTD A;  4NHJ A;  3RZO J;  2GPJ A;  3ASS A;  3SDG A;  1K78 B;  3RZD J;  1IN5 A;  2V7V A;  4YIR X;  3LMM A;  2HYG D;  2VPR A;  4E7Z A;  4BPR A;  2EWE A;  2DOE A;  3N6Z A;  3HSR A;  1IGN A;  1WI3 A;  5JLV C;  4PFP A;  2RRE A;  4RAG A;  4HRI A;  4V19 K;  3ABU A;  5A89 A;  5GAH J;  3Q6R A;  1W9X A;  2FBH A;  4BUP A;  1ZUN B;  2HTS A;  3K9T A;  2EBI A;  4EJW A;  4R8H A;  4LK1 F;  3GVJ A;  5HXB A;  2JA6 J;  4A6D A;  5JR3 A;  3PNT A;  1OGJ A;  2YWG A;  4G5G A;  1UD5 A;  2BV6 A;  5F0C A;  4D9J A;  2WZP P;  4KKS A;  4KJZ A;  1GQ8 A;  4G1B A;  4ANJ A;  1T0F C;  1KC8 D;  3GQ9 A;  2E7X A;  1VQ6 I;  2NOG A;  3SYT A;  4HSR A;  6PAX A;  2L9V A;  1LVA A;  1O8J A;  4JX6 A;  5EDN A;  1VQ8 B;  4IRG A;  4BQN A;  1FNC A;  3D26 A;  1BC8 C;  4FTH A;  4OMY A;  3AG4 H;  3K4L A;  3Q5F A;  5BPI A;  1G7T A;  1PKV A;  3FK7 A;  2P3M A;  1VQ9 B;  2VBK A;  1T6X A;  2W1O A;  3OAA A;  2KIF A;  1YJ9 B;  1G2H A;  5BSX A;  4HNU A;  2X1C A;  4QFM A;  4IZZ A;  3CRZ A;  1VQO I;  4WQM A;  1WJE A;  4G7W A;  2DA5 A;  1LLZ A;  1WKM A;  2TRT A;  1WJD A;  4XKV A;  3ZGK A;  4KDP A;  1TYW A;  4V02 C;  3RKY A;  1UHM A;  4YAF A;  2RGV A;  4EM1 A;  4L9T A;  3OWT A;  4HF1 A;  3FIS A;  3CCL B;  2K85 A;  1PJ6 A;  2HGC A;  3VPR A;  4B4D A;  1BQE A;  5J8C A;  1UFM A;  3FXK A;  3I58 A;  5FA6 A;  1WVR A;  2R7T A;  2PMH A;  3FMS A;  4M9S A;  4DQ2 A;  5L3G A;  3H3V K;  2V7Q A;  2CBX A;  1WRJ A;  2EZK A;  1MSE C;  3CD6 B;  2XSD C;  1UD8 A;  2LLK A;  1PJR A;  5F08 A;  1WFX A;  4ZGQ B;  4V2G A;  2NTB A;  4I84 A;  1AHD P;  1E1R A;  2J5P A;  2YX7 A;  5KSW B;  2A61 A;  2KJC A;  3RPU A;  3TW6 A;  3GXO A;  1OGM X;  2V4D A;  3CDL A;  2QBY A;  1QZY A;  3CCM I;  2LK2 A;  4HG2 A;  1J9I A;  3GTG J;  4Z05 A;  3PO3 J;  1H80 A;  3H3Z A;  2JK3 A;  1Y0R A;  1O57 A;  1PUE E;  3WTT C;  3LNN A;  2QYO A;  3QE2 A;  2K9N A;  1GVJ A;  3I4M J;  5F64 A;  3I55 I;  4B09 A;  4XLP F;  4A3J J;  4MR0 A;  5LGU A;  3T8R A;  3AG3 H;  3TP3 A;  1JB9 A;  3ZUG A;  2HDC A;  3QPH A;  1QZE A;  4OIR F;  1QX4 A;  2V7X A;  1ETQ A;  1H89 C;  4ESB A;  4YC5 A;  2WJY A;  1YW9 A;  3ZMS A;  2D3N A;  3TO6 A;  4B3G A;  1P2F A;  2O0V A;  3BQZ A;  1ZK8 A;  3HBL A;  4IHS A;  4LIV A;  3E1Y E;  1EZG A;  3KEQ A;  4BXU A;  3G1L A;  2ZBV A;  3JRH A;  4PDK A;  3S1R J;  5IP7 J;  1YRN B;  4Z03 A;  4H4K C;  2FOK A;  4Y15 A;  4XR6 A;  2LBF A;  4BE0 A;  1LEB A;  3V7R A;  1B8I A;  4PAA A;  3VMF A;  5IT9 Z;  5IT3 A;  4M3F A;  4YZQ A;  2F3L A;  2ACJ A;  1EP2 B;  2Q6I A;  1YIJ I;  4BQO A;  1BW5 A;  4UUS A;  5BMZ A;  3LQQ A;  1SMY F;  4XRS G;  4W8S A;  3OJW A;  4LBW A;  5EEA A;  4X7C A;  4ZZD A;  1T6Y A;  3HJE A;  1OCP A;  1KCC A;  2VOO A;  4GO1 A;  3SZG A;  5JVT A;  1Y1V J;  3KP6 A;  5D8L B;  4ZH4 F;  3SEZ A;  2CQ7 A;  5KAI C;  1WP6 A;  2JZY A;  3R6K A;  3BCA A;  2K3P A;  2XGE A;  4A69 C;  1L1I A;  3T53 B;  2X6W A;  3W2E A;  3CCY A;  4M3B A;  1VJS A;  1J59 A;  1A6Q A;  2FSW A;  3GEZ A;  3IH3 A;  2G0E A;  2VBZ A;  3OYM A;  1W2B B;  3IAS 2;  2EH3 A;  3G2B A;  4XOP A;  2ME6 A;  3CMA I;  3G6E I;  3FBI B;  3T8T A;  1ZGA A;  5D4R A;  2XNJ A;  4KH3 A;  3AAF A;  3EQN A;  2RN7 A;  2CUZ A;  1Z6T A;  1MAB A;  3CCE B;  1E79 A;  4EJT A;  1FMV A;  1LQ1 A;  4PJ0 C;  1S7A A;  2VC0 A;  4XN3 A;  3BG9 A;  4UUT A;  4PC3 A;  2WA0 A;  3U2Q A;  4PZJ A;  3ELK A;  5FFZ A;  1EFU A;  3DP7 A;  3D0S A;  2Y31 A;  3VSV A;  2HOE A;  1WJ5 A;  2DCU A;  1W5S A;  3O3K A;  1W36 D;  3U9G A;  3VYS B;  4KIS A;  2VBV A;  1IRG A;  3JRG A;  1F36 A;  1ZG3 A;  5AON A;  1EA3 A;  3HHG A;  1X3U A;  2OC6 A;  3CCU I;  4OIQ F;  1CLW A;  1LE8 B;  4AF6 A;  1G59 A;  4PC7 A;  3CJN A;  1T0F A;  4MQ9 F;  1WOO A;  3LA2 A;  3ASQ A;  1HCR A;  4MFD A;  4RAZ A;  5KHD A;  2QTL A;  3S1N J;  2R92 J;  4DBQ A;  4YFN F;  5CVJ A;  5E3L A;  2BEO A;  4B48 A;  3TQN A;  1QPM A;  4S05 A;  3GX4 X;  2W7Z A;  1BA5 A;  2VN2 A;  1UAA A;  1MRZ A;  3NAR A;  5F27 A;  2QQ9 A;  3LSK A;  1FBQ A;  4ZCL A;  1W7P B;  4IQJ A;  2L7Z A;  2STT A;  3K69 A;  2UVE A;  3LL7 A;  2I8D A;  4GXO A;  1IXC A;  4X07 A;  2ICW G;  1V5F A;  2K4B A;  5B6I A;  2FEZ A;  2YWF A;  3GTL J;  3H92 A;  2HTJ A;  1ETX A;  3VFZ A;  2Z99 A;  4HE6 A;  4YZA A;  2VC1 A;  2HOA A;  2IP2 A;  1OLT A;  2NVY J;  3CCR I;  2LFB A;  5F1R A;  5EZH A;  2CND A;  4H9G A;  1XN7 A;  3P5J A;  4AWX B;  2LVS A;  2FBK A;  4IQ4 A;  1WHU A;  3T1B A;  1HBX G;  4JRA C;  1RNL A;  4I01 A;  5LGT A;  4DOZ A;  3CCJ I;  4C30 A;  2LD5 A;  2C5H A;  5IYR A;  3EUH A;  1BI2 A;  4IHV A;  2VIX A;  5H59 A;  1NB9 A;  4C9Y A;  4CDG A;  1ODD A;  2G7H A;  1EH7 A;  2HVS A;  3BPV A;  3FHZ A;  4OP7 A;  1OKR A;  2V4J C;  5E3M A;  3JRD A;  1VQ4 B;  2KKO A;  1R1U A;  1HW2 A;  3PUN A;  4GYG A;  3WHC A;  2MG4 A;  4HEA 2;  4EEF G;  5F0H A;  1ULY A;  2LP0 A;  3AL0 C;  2Q2E A;  3BG6 A;  1TZL A;  5E8G A;  5GV7 A;  3VO1 A;  1I5Z A;  3OZU A;  4G7X A;  5L3B A;  5IY5 H;  4MLO A;  1H85 A;  5HZA A;  3LYC A;  3HOV J;  2DTZ A;  2JTV A;  2KPM A;  1D8T A;  3J7A Y;  2L9S A;  4TN1 A;  4XKB A;  3ZZU A;  2VUM J;  2L3D A;  1G3S A; 
#chains in the Genus database with same CATH homology
 1E0E A;  3K4M A;  5LFA A;  3K4J A;  1MMD A;  4B43 A;  3JU4 A;  3UW0 A;  4OJP A;  3OR2 C;  3TBI A;  3W2W A;  2NT9 A;  3T9G A;  1Y6I A;  4XON A;  2IGN A;  1BR4 A;  1OFM A;  1TT0 A;  2DT7 B;  4F92 B;  1K5C A;  5HKK A;  3TL4 X;  1NG7 A;  4BDZ A;  1UG0 A;  3PL8 A;  3HPG A;  3S8P A;  4CCJ A;  3KEY A;  3GBG A;  3MMY B;  3ONQ A;  4CZC A;  3GVL A;  1DBG A;  2W6J A;  2M4K A;  3KX2 A;  4NK6 A;  2Z1D A;  1BMF A;  1W0K A;  2DJI A;  4CA0 A;  1Z3X A;  1P9Q C;  1H8H A;  3DTI A;  4XMY A;  4XKC A;  3ZCO A;  2VKH A;  3NWT A;  2HZD A;  5JHF A;  2JUG A;  2CV1 A;  2X8K A;  2ZZE A;  1JRG A;  2V6E A;  2M7B A;  4XLF A;  3DEE A;  3CJR B;  5FRN A;  2O5R A;  2WAQ A;  3K4N A;  1OB0 A;  1I18 A;  1RU4 A;  2QKL B;  1EFR A;  2Q1Z B;  3VMV A;  3PSI A;  1V0F A;  2O17 A;  4U87 A;  3S3N A;  3HKZ A;  1FX0 A;  2MC4 A;  4ZDL A;  3OYJ A;  3MKY B;  2P0W A;  1HA8 A;  3A3B A;  4DIQ A;  2V1N A;  2HVQ A;  3PNV A;  4YRV A;  2HVR A;  4BDY A;  1VF7 A;  1DQU A;  4P5O A;  4E6K G;  4OZZ A;  1PYV A;  4XOR A;  3S3O A;  3S3M A;  2O1D A;  2JA2 A;  4E7L A;  4F91 B;  2XZP A;  2L2O A;  3VDX A;  2IS4 A;  4KIT B;  3BCB A;  1UD3 A;  2K9M A;  2BVL A;  2GJK A;  3T56 B;  2LC2 A;  3H0D A;  1MND A;  1MMA A;  2INU A;  4EW9 A;  4RMN A;  2INV A;  3KRG A;  1BHE A;  1HG8 A;  4PJJ A;  1LKX A;  4TKO B;  2AQF A;  1E3X A;  1OFL A;  1MNE A;  2R7V A;  4CSW A;  4CUG A;  2CV0 A;  1AIR A;  2ZSI B;  3VYT B;  3EUA A;  3ZIA A;  3CZ6 A;  3D5L A;  2LZJ A;  4BJT A;  2ZXH A;  1WJC A;  4II2 A;  4IKF A;  3DWL E;  4QPO A;  2NST A;  1ZEL A;  2E1M B;  3TMO A;  4NUB A;  4HNT A;  2CK3 A;  2R7W A;  3FDY A;  2ZSH B;  3KYL A;  4KKT A;  4GQN A;  3OEE A;  4G6I A;  1QHG A;  4XLC A;  5HNF A;  2X1E A;  2M5S A;  3H94 A;  2AQE A;  2VL8 A;  1V5E A;  4D1Q A;  4E7H A;  4N4O B;  3ZQQ A;  3FPP A;  2K9L A;  2HDW A;  3PJR A;  5CKT A;  4RM2 A;  1MMG A;  2IS1 A;  4ASU A;  2WB1 A;  3CES A;  3GQB A;  4B3F X;  2JJ1 A;  4E4H A;  2HNH A;  1OR7 C;  3H9Q A;  2LYC A;  2IS2 A;  4NQW B;  2WBM A;  3OYI A;  3OOU A;  3B4N A;  4XKW A;  4Y3O A;  2LOO A;  3IAM 2;  1OHH A;  2ELJ A;  2IXS A;  2XC7 A;  3D5R C;  4RLQ A;  2DCE A;  5HVQ C;  4PK4 A;  4AU7 A;  4ITV A;  1DGR M;  3K4B A;  4LIT A;  5CDF A;  2F4I A;  4N4N B;  4BEH B;  2IQ7 A;  1J09 A;  2K5C A;  3OYE A;  4RLF A;  4B47 A;  2OV7 A;  4AVZ A;  4ZJZ A;  4L8J A;  4EAT A;  2V26 A;  3VWB A;  4NK8 A;  1PLU A;  4PJM A;  2ZZQ A;  2VQL A;  2MFZ A;  4J01 A;  4ZYA A;  2O0W A;  1O8D A;  2PMZ A;  1H8E A;  1OGO X;  3NWS A;  4F55 A;  4P1W A;  4W8R A;  4TT3 A;  2PYH A;  3DDY A;  1K6Y A;  1D0Y A;  4Y4R A;  1BLI A;  2CMP A;  1O8H A;  1D0Z A;  3KEW A;  3LMW A;  2Y0S A;  3HAG A;  4U4B A;  3I3L A;  2XF7 A;  2LRD A;  3A1Y A;  3ZRG A;  4CH7 A;  3FBN B;  4MXN A;  4DNR B;  3UNG C;  3EUH C;  1X4P A;  2KLO A;  3JUR A;  2KL4 A;  3ZPN A;  4JQF A;  2KQR A;  2R4G A;  3K4K A;  1N75 A;  3HC7 A;  1X1C A;  4NC7 A;  5KCM A;  3VYR B;  1CZF A;  4OZY A;  2V31 A;  2JVH A;  2ZZF A;  2M4G A;  4DNT B;  3SUC A;  4XLH A;  4G6T B;  4NNJ A;  4Z06 A;  3AKZ A;  1NG6 A;  3DLA A;  2DIE A;  3DKX A;  4BL0 B;  1O8K A;  1X1D A;  1UD4 A;  2Z16 A;  2KRH A;  1I8D A;  3OYK A;  5CPR B;  2QY1 A;  4E7K A;  2LH9 A;  3L2R A;  3OPO A;  2XGJ A;  3HXL A;  1QJV A;  1E1Q A;  1D1C A;  2UUZ A;  4PSW A;  2DOA A;  3OYG A;  4PSX A;  2X6X A;  2VJ4 A;  4YZ0 A;  2GK7 A;  2M0M A;  2VXD A;  3BC9 A;  3SDB A;  2GOM A;  4C2U A;  3LSI A;  1JTA A;  4E7I A;  1Z3Y A;  2VAS A;  3OR1 C;  2LRE A;  2JVG A;  1WJF A;  3FY3 A;  4BE2 A;  1KCD A;  4BEH A;  2FUG 2;  2RQQ A;  4JOM A;  1X1A A;  1GLN A;  2E5N A;  3PFY A;  4F3Q A;  5HOO A;  4IX7 A;  4BAC A;  3B90 A;  5CQE A;  4BE1 A;  2NOJ B;  1T95 A;  2XSJ C;  3HPH A;  3QYF A;  2XZL A;  3EQO A;  2CUJ A;  2ODL A;  1E43 A;  3DTE A;  2WPD A;  2E5Z A;  3OYB A;  2Z6B D;  4BQQ A;  2D3L A;  1UD6 A;  2R7R A;  2KVO A;  2L9N A;  4F52 A;  3V42 A;  1SFK A;  4E0F A;  2ZTN A;  2X85 A;  4XLE A;  1DGW Y;  1FMW A;  1Z7L A;  2W7N A;  3K70 C;  3I9V 2;  3NE5 B;  1BR2 A;  4ZDP A;  3HG9 A;  2X51 A;  2NSP A;  1QHH D;  4CCL A;  5IK2 A;  5FRM A;  3W3C A;  1IRX A;  4W8Q A;  4CCN A;  1NRK A;  2Z8G A;  4ZTF A;  3HUG B;  3VSL A;  2QXZ A;  3H9J A;  2WJV A;  2JSP A;  3A3G A;  2CFO A;  1IA5 A;  4RM3 A;  1RWR A;  3DPU A;  4XQF A;  4GRI A;  2F1M A;  3MD2 A;  2GJP A;  4FXU A;  3RPU D;  3T51 B;  2UVF A;  5LD2 C;  5FL7 A;  4ZC3 A;  2QKM B;  1KTW A;  3LSG A;  4OJ5 A;  3DU6 A;  2HLD A;  2VPL A;  4FAS D;  2JJ2 A;  2DXI A;  1KMH A;  3K6G A;  4XLA A;  1SAU A;  4BJ5 C;  3E1S A;  1O8L A;  2BSP A;  1AA7 A;  1BR1 A;  3LMM A;  4E7Z A;  3QYE A;  1D1A A;  3LSH A;  3H5A A;  1COW A;  3H5R A;  4PJN A;  2EWE A;  4YZX A;  1VBL A;  4PFP A;  2RRE A;  4HRI A;  1O8G A;  1DBO A;  1O8I A;  2L5Q A;  3AL0 B;  4HIZ A;  3M8J A;  1T5E A;  1W9X A;  2Z2S B;  4BUP A;  1W0J A;  2W6I A;  4DJA A;  3GVJ A;  3PNT A;  1VZ0 A;  1UD5 A;  1O8F A;  4D9J A;  2WZP P;  4KKS A;  4KJZ A;  2XND A;  1GQ8 A;  1V0E A;  4ANJ A;  1T0F C;  2HPM A;  2WY8 Q;  3GQ9 A;  3BC8 A;  4J00 A;  1K28 D;  3FKJ A;  4PUS A;  4HSR A;  3SYT A;  3S32 A;  1O8J A;  2BW3 A;  1G8X A;  4B3X A;  1MW7 A;  4F93 B;  4BQN A;  2ZXI A;  3OYC A;  3OEH A;  4TSF A;  3K4L A;  3QOE A;  1RMG A;  1PKV A;  3K4C A;  2R7S A;  2VBK A;  4OJ6 A;  4U49 A;  4C2L A;  1JI8 A;  2W1O A;  3VSK A;  2A6T A;  3OAA A;  3H5N A;  4PJL A;  4HNU A;  3F9K A;  2X1C A;  2XDV A;  4IZZ A;  1WJA A;  1WJE A;  2W00 A;  4G7W A;  2DT6 A;  3S93 A;  4HPQ A;  3WWG A;  1WJD A;  2VKD A;  3C2H A;  4XKV A;  3ZGK A;  2MAB A;  2XF5 A;  2CV2 A;  3OYA A;  2R7X A;  2IGM A;  2KP6 A;  2UV1 A;  3K70 D;  3DTK A;  2LBF B;  4R79 A;  3MKZ A;  3OWT A;  3OS2 A;  2L7K A;  3L2U A;  2V7F A;  3VST A;  5CQG A;  2MD0 A;  2E60 A;  1HZE A;  3PNY A;  2V9K A;  3D5S C;  4YEL A;  2R7T A;  2VQC A;  1ERD A;  2V7Q A;  2BOL A;  3OYF A;  1UD8 A;  2VBM A;  1PJR A;  2VJJ A;  1WFX A;  3HOS A;  3GRH A;  2XAU A;  2PJR B;  3IP4 B;  3OFN A;  2NTB A;  4FET A;  1E1R A;  4I84 A;  2PYG A;  3W2V A;  5AMV A;  1OGM X;  2V4D A;  3QYB A;  4UZU A;  2R7U A;  1R6R A;  3OYD A;  4HG2 A;  4Z05 A;  1H80 A;  3ZPP A;  2E1M C;  4XN0 A;  1E3Z A;  2F43 A;  1BN8 A;  5HLT A;  4JMQ A;  2F6C A;  4YEJ A;  3BCF A;  3LNN A;  4II3 A;  2MYS A;  2BVM A;  1N78 A;  2RNG A;  1W36 C;  1Z21 A;  2LG4 A;  3M1C A;  3BH4 A;  4MR0 A;  3RTR A;  2CH0 A;  1NBM A;  2R7O A;  2WSS A;  2VQG A;  4P22 A;  2KRC A;  2E1B A;  3AFH A;  2HU9 A;  3BG7 A;  5HNH A;  4CCO A;  5DN6 A;  3BCD A;  2CW7 A;  3MKW B;  2OUM A;  2WAF A;  4KT6 A;  2D3N A;  2WJY A;  4B3G A;  2O0V A;  2ZTG A;  3ZR8 X;  4LIU A;  4HST A;  2GOX B;  4LIV A;  2BW3 B;  3DPL C;  2VB6 A;  3ZXS A;  1LVK A;  4YXW A;  3DQV C;  4E7J A;  4Z03 A;  3A35 A;  4H4K C;  4XR6 A;  2LBF A;  4BE0 A;  2GJR A;  1IDJ A;  4ZDO A;  1YX5 A;  2M3A A;  2X1D A;  4YZQ A;  3BLY A;  4BQO A;  4Y33 A;  2VJI A;  1WJB A;  2CW8 A;  4XL9 A;  2KMU A;  4W8S A;  4DK0 A;  4BU2 A;  1WMR A;  4W8T A;  1V5G A;  1KCC A;  3OMY A;  3SZG A;  3L2Q A;  2O04 A;  2PJR A;  1KON A;  2KDO A;  2LY1 A;  3A4C A;  3E0J B;  3H35 A;  3SEZ A;  1WP6 A;  3BCA A;  3CP2 A;  2K3P A;  3U21 A;  2W4S A;  3T53 B;  2X6W A;  1HVX A;  1VJS A;  2KHM A;  4BJ6 C;  3DPT A;  1X4O A;  4BGD A;  3VYU B;  3OYM A;  3OYH A;  1O8M A;  3FKS A;  4XNF A;  3IAS 2;  3G2B A;  3K10 A;  4XOP A;  2R7Q A;  2R9V A;  3FBI B;  2HPI A;  2XF6 A;  3L2V A;  2IGO A;  3CJQ B;  2X53 S;  4DBR A;  1X0C A;  3EQN A;  4DGW B;  3ZSC A;  2QE7 A;  5C1C A;  2LY2 A;  2CUZ A;  2JIZ A;  2VLA A;  1MAB A;  3OW7 A;  2A5W A;  2GK6 A;  2NZM A;  1E79 A;  1WTH D;  3SEQ A;  1VLY A;  3C2G A;  1FMV A;  3PUB A;  4KKU A;  1PXZ A;  2ZZG A;  1OOC A;  4XN3 A;  3DKY A;  2WA0 A;  3A2K A;  4OAZ A;  4XOT A;  3CF2 A;  1LFP A;  1SKY B;  2UWM A;  3VSV A;  2VJ5 A;  1WJ5 A;  3W2A A;  1XG2 A;  1D0X A;  3VSU A;  1W36 D;  3OY9 A;  3VYS B;  4KIS A;  2Q2E B;  1LDK B;  4LG3 A;  3HOT A;  3VMW A;  2ZFU A;  4E7S A;  4OJL A;  3DU5 A;  1EA3 A;  3LFU A;  3OL3 A;  1Y56 A;  2OC6 A;  3VR6 A;  4XD7 A;  2W82 A;  3FHN A;  4BXF A;  1G59 A;  4HWV A;  2QX3 A;  4URR A;  1X19 A;  2WAD A;  3LSM A;  4X0G A;  4C2T A;  4OJO A;  4B44 A;  5KHD A;  2PEC A;  1YE9 A;  4BS9 A;  4DBQ A;  3OE7 A;  3OYL A;  4B48 A;  2CS3 A;  3EPZ A;  5KNL A;  2VQH A;  1UAA A;  1BPL A;  4XM3 A;  3OIP A;  3LSK A;  4IQJ A;  3PSF A;  4CCK A;  1NHC A;  3N05 A;  2UVE A;  3H9G A;  3LL7 A;  2I8D A;  4DK1 A;  1V5F A;  4AYB A;  2NTP A;  1O8E A;  1UEL B;  3OS0 A;  2X3H A;  2VBE A;  4OAY A;  1U0J A;  2IGK A;  1EE6 A;  3UR3 C;  1BOB A;  1KZL A;  4YZA A;  1QCX A;  1OLT A;  2WY7 Q;  3RQ4 A;  1DP3 A;  1PE9 A;  3B8Y A;  2X6Y A;  3OS1 A;  3GQ7 A;  1UD2 A;  3G05 A;  2WAE A;  5TGT A;  1S9H A;  3OOC A;  1N77 A;  4U7B A;  4IQ4 A;  1IDK A;  4DOZ A;  1QU3 A;  2XZO A;  4C30 A;  2VXZ A;  3GQ8 A;  5C1E A;  1D1B A;  3L2W A;  2F5V A;  1O88 A;  1YX3 A;  3RCO A;  2VIX A;  3CP8 A;  4C9Y A;  4PMH A;  4PFO A;  3WQZ A;  4QPQ A;  3CMM A;  2HVS A;  3GVK A;  1IB4 A;  2V4J C;  2NT6 A;  2KZV A;  4HEA 2;  4OWR B;  4ZTJ A;  3AL0 C;  3RSN A;  4Z1M A;  1WPC A;  3BG6 A;  2JDI A;  1TZL A;  2XOK A;  3GQA A;  1MMN A;  3OYN A;  3IUO A;  3OL4 A;  2HQA A;  4CCM A;  4G7X A;  4MLO A;  3OIQ A;  3QOD A;  1X1B A;  3HL2 A;  2NTQ A;  2KPM A;  2M7A A;  4NC8 A;  3EUK L;  3J7A Y;  2L9S A;  4XKB A;  2IS6 A;  5FRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...