4YELA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
total genus 228
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yelA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yelA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yelA02
2NTBA 1PXZA 3VMWA 3T9GA 3ZPPA 2NSPA 3FY3A 1BN8A 2PYHA 4AVZA 4W8SA 1NHCA 1BHEA 4YZQA 4YZXA 1QJVA 5C1CA 1JRGA 1OGMX 4XLHA 1X0CA 2NTQA 1OFMA 1O8DA 1IDJA 4XM3A 2NT9A 2INVA 1VBLA 4XN3A 2X85A 4XN0A 1EE6A 1H80A 3B4NA 3KRGA 4XOPA 3B90A 4MR0A 4XORA 3B8YA 1OGOX 1PLUA 1O8JA 4OJOA 3ZSCA 3GRHA 4URRA 2QY1A 2NSTA 1O8IA 2EWEA 1IB4A 2NZMA 4XQFA 3GQ7A 2VBEA 1KCCA 3EQNA 1HG8A 2BSPA 2VJJA 2QXZA 4XLFA 2O0WA 3EQOA 1QCXA 1RMGA 4XOTA 1RWRA 3VSVA 1RU4A 4YZAA 4XLEA 4YZ0A 1XG2A 2X6XA 4NK8A 1DBGA 2O17A 4I84A 4OZYA 5C1EA 4MXNA 1CZFA 4NK6A 1O88A 2ODLA 1O8KA 2INUA 5AMVA 4XR6A 4HWVA 4PMHA 4XLAA 4OJ6A 3WWGA 1O8LA 1AIRA 4XNFA 4YELA 3LMWA 4XKVA 2X6WA 3GQ8A 2O04A 2QX3A 4Z03A 4W8QA 1O8HA 1OFLA 2PECA 4U4BA 2NT6A 2X3HA 2X6YA 4XL9A 4OJ5A 4Z05A 4W8TA 4XONA 2VBKA 1WMRA 3JURA 3VSTA 1KTWA 2Z8GA 3VSUA 4OJPA 4XLCA 4XMYA 4XKWA 3GQ9A 1O8MA 2IQ7A 2VBMA 1IA5A 1KCDA 1DBOA 1O8EA 2NTPA 1O8GA 4OJLA 3UW0A 3VMVA 4C2LA 1OOCA 4Z06A 2O0VA 2O1DA 3SUCA 1PE9A 1IDKA 4OZZA 1K5CA 4U49A 1O8FA 2UVFA 4W8RA 2VJIA 4EW9A 3GQAA 2PYGA 1JTAA 4YEJA 1GQ8A 2UVEA
chains in the Genus database with same CATH superfamily
3ZMTA 1FP2A 5DDGA 2BGCA 1NB0A 3CMAI 1ZM2A 1HA3A 3CMAB 1BN8A 4A3BJ 2DLLA 2DT6A 3E0JB 1MBEA 1R9TJ 5FKMA 2IJLA 2XT4A 2XF6A 2VI6A 3OYKA 3AL0C 1X0CA 4HF2A 2KQRA 4M6VA 3EUHC 5L3DA 1ZREA 4MEYF 2F3LA 3BT9A 4F7ZA 1IB0A 4RB1A 4XN3A 3WU1B 2C5BA 1U78A 1PJ5A 2P3MA 3SLNA 2F2EA 2QWWA 1Y0RA 2BOLA 2J7KA 5HS9A 2JUCA 4FE7A 3ZN1A 4MHGA 1X2NA 4BPRA 2UZKA 1ETVA 3FXRA 4NQWA 4FASD 3OYHA 3GCMA 2XAFA 2F4MB 2HGCA 4J00A 2X3UA 1VQ9I 2W1OA 1O8JA 1VQ9B 3IAM2 2VL8A 2VE8A 3ZXSA 4HEA2 1W4MA 3L2UA 1JKOC 1HF0A 2GM4A 1R4NB 1B2RA 3CB4A 4X05A 1OB5A 1Z91A 1QVTA 3KE2A 1YYVA 3NWTA 3C7JA 2VQLA 4JK1X 1K61A 2VQGA 5DCMB 1AOYA 4B3FX 2CS3A 1K8AD 3HBLA 2R3SA 3HSRA 2GK7A 1GXQA 2F5EA 3HRUA 3TGNA 2M5WA 5TJJA 1V5GA 3WE2A 3DLAA 1R71A 3OS1A 2X1CA 3KLNA 4CCMA 1YRNB 4BY1J 2HKXA 1D0ZA 2BBYA 2ZJQF 2O6GE 2ZBVA 1X4OA 2VXDA 2XF7A 1JGSA 3NE5B 3PA2A 3WQZA 4C2TA 4BU2A 2FA5A 2WZNA 3BCBA 3HUGA 4BKXA 4IL6C 4TSFA 3I54A 2STWA 5B66C 3ZPLA 1A6QA 3LVBA 4HWVA 1W1WE 1T95A 4RGXA 3S2DJ 2FQ3A 3ABUA 1OGJA 5E20A 4Z2YA 4UAJA 5D4RA 1LQ1A 4RD2A 1OYYA 3WBJA 1BN5A 3BOQA 2K3FA 2H94A 2RKHA 4AYBA 3QPTA 4AIJA 2K85A 3QOEA 1XGOA 3MQ0A 1WJ5A 2JWTA 2LF7A 2X1DA 3BTIA 1HA8A 2ELJA 4C3IJ 2X3HA 2K9SA 2VT2A 2EJRA 5C3EJ 4IZZA 4R79A 2ZFWA 3CCYA 3ZR8X 2XRLA 5FRNA 3S14J 1AHDP 3CPXA 5F0HA 5F0CA 1ENHA 2IS6A 3F0CA 3BR0A 1VLOA 5EZGA 3CD6I 2K9LA 3CCJB 1QX4A 1DU6A 5GADJ 3IKTA 1W9XA 1VLYA 3B73A 3G2BA 2IQ7A 1QNTA 3CCEI 2KL4A 3QOPA 2RNJA 3OSFA 1IJFA 5F4OA 4G7HF 2MC3A 3B82A 5AN9A 2Z6BD 1VNDA 4DGWB 3OYIA 4RD6A 4TMTA 4HX4A 3C2GA 1H0MA 4S05A 1E62A 3A8JA 4LC0A 2O0VA 4YDTA 1S72I 1FTTA 3SYJA 3O2PE 1P4AA 3SFZA 2FVGA 1S72B 4HE6A 2DMNA 3T1BA 2E36A 1WP6A 2L0KA 1H9GA 4EVIA 3S1RJ 4IHXA 5EGOB 3CCMI 3QFTA 3VNVA 3GQAA 3CCMB 4NK8A 2Q2EA 2DA1A 3LFKA 4MO7A 2FE3A 1IN6A 3WYAA 5K7FA 2GJKA 3NWSA 3TO9A 3W6VA 1UHWA 3FXUA 3MEXA 2KJCA 1CNFA 3CP8A 4OPOA 2RGVA 3BJAA 4E4HA 1KK2A 2COMA 5GV7A 5LMZA 2L7MP 2VT3A 3WNCA 4XM3A 4ZDPA 3LA2A 4NC8A 1MRZA 3O3KA 2KJBA 3BG7A 1XG1A 3LSGA 1U3EM 4HNVA 4M3DA 1Z05A 1TL8A 3BZCA 2PMHA 3G1MA 4KISA 2KIMA 1D5VA 1H80A 4FQGA 3GTOJ 5FJ8J 1DQUA 4NC6A 3GLXA 5KSWB 3PETA 1OPCA 3JRHA 3B8YA 4P1VA 1N25A 3FK7A 5LEKA 4G7WA 2GA1A 2XAHA 3EYYA 3QP5A 2LKSA 5EG0A 1W2BB 4URRA 3PJRA 2NSTA 1R6RA 3ASOH 4R71A 3M3YJ 4CH7A 1FYMA 3GO5A 2W85A 1G3TA 5HODA 3AVWA 4IHVA 3VFZA 1QFYA 3T53B 3A2KA 2XNCA 3D0SA 4E7LA 4LLLA 4AC0A 1XMXA 5K7HA 3W5HA 2QXZA 3FBIB 2VUMJ 1NRKA 1QUEA 3LSTA 1IV6A 1WU8A 3SEQA 4ZH4F 2B5OA 4J0QA 4LFUA 1NDHA 2A5YB 2QZAA 3BH6B 1Y1VJ 1JT6A 3G1LA 2C78A 1SFXA 4ZYDA 1R36A 1DBGA 3ZMUA 3LQ6A 4UY8I 2QA4I 4OZYA 3V8KA 2YS9A 2WB1N 5C4JJ 1JE8A 1WI9A 2RNGA 1R00A 4JYKA 4ZTJA 1R22A 2L9NA 1O8KA 4BHPA 1KA8A 1B8IB 4PGOA 3F22A 4KH3A 4RA2A 2O3FA 3VYRB 1MH4A 5D6EA 1ZRCA 3BH4A 3FZVA 2LSOA 4P3YA 3C2BA 5M3FJ 2VBXA 4C3JJ 3LMWA 4UV8A 5M5WJ 2K3PA 1BX0A 1UHMA 2AQFA 3TQNA 1MH3A 4DJAA 3JREA 3VODA 2BMWA 3SZGA 4BQQA 2ZTGA 4PABA 2DA5A 4XICA 1CF7B 3W5VA 4CHUA 1R5OA 2L3DA 3QYBA 1HCRA 3BG6A 1EF4A 1DPUA 1QVGB 1POGA 1YJNB 2XGXA 3FKJA 5IYCJ 1H8EA 4KN7X 3DV8A 1Z9CA 3RJPA 4DNCA 4X6AJ 2E1MB 2PI0A 2H6BA 2XIGA 3A1YA 2EQRA 2V5IA 1RPWA 3FXKA 1N77A 2BVNA 3K69A 1QZEA 3GXOA 5F6FA 4LLNA 3E6DA 5TGTA 2DMQA 2DERA 4UVCA 1O8EA 4OPSA 2LKXA 1YW7A 2CRVA 3EPZA 1QU3A 3KYLA 3H94A 3I56I 2HQAA 3I56B 2DFFA 1Q9SA 1XTAA 1ZR2A 2JVHA 2FEZA 3KP6A 4QTRA 2KDOA 4IO9F 1TNTA 3HKZN 3W2AA 1OFEA 1R1UA 1GQ8A 2ELKA 4Y17A 1E3OC 4PSWA 1S9HA 1NB9A 2Y0MA 3H92A 4H4KC 2VQHA 3VSLA 1IAWA 4CCOA 3A1PA 3BC8A 2ZXJA 4M2LA 3ERMA 3H36A 1MMNA 1TSPA 5J8CA 1DU0A 2D5VA 2NRAC 4G9YA 1AU7A 3WBKA 4II3A 5C1CA 2Z5UA 1WJAA 1HLVA 4B1RA 4WWCA 5IOZA 2BM6A 3VEPA 2X85A 2AXLA 4IRHA 1MIJA 5HKKA 5GPAA 2HZTA 2VE9A 2G0YA 3JRCA 1ZLJA 3I4PA 2RN7A 3GZNB 2HS5A 3RZDJ 3PNYA 3BCAA 3AGPA 2X0LA 2VBSA 4OJOA 4E7JA 2CFOA 3L2VA 4NBSA 2LK2A 3OOCA 1PJ6A 2R92J 3L00A 5J6XA 2ZTNA 3W2FA 3KP7A 3WODF 3E97A 4HNUA 3NRVA 5A88A 4WK8F 1NG6A 1OISA 2P81A 3L2WA 2HOSA 2DT5A 3FM3A 4BEHB 1K9MD 1RNLA 1X1CA 3W3CA 4XBFA 1KQ8A 1QRCA 3BCDA 3MKWB 5JVTA 2R7WA 4KNYA 1F1ZA 2OBTA 1Y56A 2YX7A 3CW2A 4JP0A 4F93B 3J7AO 2BN4A 2P6SA 2ZXWH 2GQQA 4RCZA 2FNAA 1WWXA 2M0MA 1IHMA 2A6EF 3REOA 1IDZA 3HGGA 1J9IA 2ZXHA 4N3GA 3VSKA 1YI2I 1YI2B 2Z3YA 2DFHA 2X6OA 1FOWA 1MBGA 3I55I 1I39A 2WY7Q 1BC7C 2ZC2A 1HW5A 2J5OA 1MDMB 1EA3A 1XGSA 3F72A 3GTMJ 3U2RA 1MNDA 2A5WA 3H3ZA 4A2UA 4FTHA 3GFIA 1RRJA 3B78A 1KMHA 1GVDA 3HPGA 5IOYA 2R5ZB 1K78B 3BCFA 3BY2A 1MZBA 3BZKA 2XKOA 3SEJA 3RSNA 1D0YA 2PJRA 2JT1A 3WTWC 4ACAA 3FWEA 1HBXG 1OFLA 3GBGA 2Y30A 4PGGA 3K7AJ 2R4GA 3GFMA 3F6VA 1I1SA 5CVUA 3U1KA 1ACIA 1UD2A 1MJ9A 2BW3A 1WJDA 3Q39A 5ICEA 2JMWA 2L2OA 5HOOA 5HDKA 3CDLA 3C18A 3BTLA 2A3SA 3V7CA 3KP3A 2VC1A 3JU4A 2ZZGA 3KYCB 3FHNA 3OYFA 1HSTA 1ZGWA 1A31A 3K70D 3HTUA 4YCQA 3KLOA 1PJ7A 2EFQA 3RZOJ 1UD5A 3J81K 2HPIA 2HKOA 5GTHC 4Z06A 1J75A 3CLQA 4MTDA 2OU2A 5CQEA 3OMYA 1GDTA 5HXBA 5JLWA 3W2GA 3A02A 2ISZA 4Y33A 1XD7A 2KDZA 4P6YA 4LMYA 5A89A 1JT0A 1FRNA 4KA4A 5FFZA 5HZAA 3JX8A 4EW9A 2YSRA 3QU6A 2E1CA 4ZJZA 4HF1A 2UVEA 4HZFA 4U0VA 3V7SA 4U87A 2OJED 6PAXA 4UUVA 3I59A 1UG0A 1KK1A 1OHHA 2MA3A 2LKPA 3LAPA 2V6EA 1FIPA 4HF0A 4OP7A 3ZIAA 3FY3A 2L9SA 1USTA 5D5VB 5BOXA 1MNMC 1G59A 4PSXA 1E43A 2VBTA 4RB3C 5K7ZA 1D8JA 4K1XA 1HW1A 1BQEA 2WBMA 3LQEA 3PENA 1RKTA 2Z99A 3CUQA 4BE0A 3MAJA 3TH0A 1SAUA 2QSFX 5LHIA 3K70C 1WQ2A 1ZM3A 3F6OA 2V9PA 3DPLC 2OK7A 3LNQA 1QFJA 5TRDA 5KNLA 4ASNA 2R7UA 1WJCA 3K4LA 3R6JA 1OCZH 4IX7A 3KP5A 3BG3A 4KKTA 2W48A 2R5YA 2F1MA 1LE8A 2XPUA 3ZRGA 1WXRA 3DBHB 2JTVA 5DV5A 2R7VA 1VF7A 1ZGAA 2Y48A 3OIPA 2DFIA 4D0PA 4LG0B 4ZGQB 3MMYB 1PYVA 3MZ8A 4B47A 3T8RA 3ISPA 2F4NA 3Q0UA 2M2EA 1DPRA 2QQAA 3LSKA 1J9ZA 3S32A 5BMZA 1K4TA 3T56B 5F08A 4CCLA 4EM1A 1ITYA 2F4OB 4D7NA 4L5EA 3CUOA 5JBQA 3O6BB 1B72A 1XC5A 4M53A 2D3LA 4U88A 4RM0A 3FK6A 1VQKI 4V2FA 4A93J 1CZFA 1DDIA 1EP2B 3K9TA 1V55H 1A04A 2LOOA 1GT0C 1ZRFA 3ZBUA 3WTTC 3OYMA 3WU0A 4QVAA 4DQLA 3PIOF 3KETA 1FNBA 4WZKA 3CDIA 5CKTA 4EMSA 1U2WA 1XCBA 4RS8A 3GZ6A 2L4MA 5ILSA 1W34A 4BJ5C 2ZMEB 3IH4A 3U2QA 3AG4H 1YG2A 2DCUA 1K7AA 4WCGA 2CQQA 3DPTA 3A3BA 3HOZJ 2O04A 1JKRC 5C44J 1BR4A 1TYUA 3WXMA 1SD5A 2LYCA 2VBZA 2KT0A 4ESBA 3H1CA 3LSRA 1XE1A 2B7CA 3ASSA 1PUFB 2BM1A 3KCCA 4RLFA 4W8TA 3FKIJ 1W7PB 4MLOA 4YEIA 2VNKA 4RMNA 3BH7B 1TWFJ 3F8NA 4R8HA 4X1EA 5LHGA 3Q9SA 1K79A 1TQIA 2Y2ZA 3HOXJ 5IT3A 3MZYA 4I01A 5A2QK 1O8MA 5HLIA 2DOGA 3S2WA 5E1XA 3CC7I 4LK1F 5EEGA 2NS0A 4RM3A 3U6KA 3CC7B 2HXIA 1FOYA 4J19A 4BQNA 5BS6A 5F0FA 1MMAA 1SKYB 2ZZQA 3I64A 4BUPA 5IYRA 5EEAA 4RDLA 2W7ZA 4OZZA 3RKYA 5E17F 1XGMA 1ETYA 1XN7A 5E3LA 2NVYJ 3LA3A 4II2A 3AL0B 3RYRA 2MFZA 2Q6LA 1FNDA 1I8DA 3Q6RA 1ZAOA 4UVBA 3PO3J 2NTBA 1MMSA 2GZWA 1D2EA 3VMWA 1QRYA 5ICGA 1VQPI 4BQOA 1QUFA 1IJWC 2X0KA 1VQPB 2TCTA 3VYUB 3MZHA 3TDZC 1N08A 4MFEA 1I5ZA 3I53A 1I6HJ 1NHCA 2BY0A 1BHEA 3KEYA 4B3AA 1ZTRA 2BY1A 4ZYHA 2EFNA 5F64A 3M07A 5F1RA 3BPXA 2XRNA 4BBRJ 2XKPA 3AGQA 2K4BA 1WPCA 1V4RA 4ZV4A 3I58A 1VFCA 2HNHA 3VDXA 1R49A 2HOTA 4OIQF 5IYQA 4NQWB 3IH3A 5IYNA 3KRGA 4Q4ZF 4FCYA 3K4CA 5DD4A 4L9JA 1EH7A 3B8HA 3RKWA 1WH5A 5CJ9A 4ANJA 4LB5A 1ZKGA 2JSCA 2PLFA 1IUFA 4CZCA 3GRHA 1B23P 1W5TA 2CQXA 1QGYA 2QF7A 3O8GA 4B8XA 2KVOA 2DU9A 1G4DA 1SMTA 4EATA 3G73A 1X2MA 1GV5A 3S1NJ 1Y6IA 2EB7A 5HLHA 2AS5F 2RDPA 3K4BA 1BA5A 2Y69H 4IEJA 4I99C 2W57A 3QPLA 1XMAA 2V1UA 5FLXK 1RU4A 3JTGA 1CGPA 4XLEA 4YZ0A 2XGDA 4ZGNB 1EP3B 2EIKH 3RQIA 1RR8C 2F43A 4FISA 2XEXA 2OBSA 4PC1A 4L9NA 2DDAA 2ZZEA 3L2QA 5D5UB 1X19A 5C1EA 3HUGB 1G7SA 4RLZA 2HR3A 2O03A 4C9YA 2E1NA 1RETA 2H8RA 2BSAA 4XKCA 4NC7A 1H42A 4XR6A 3WHCA 3WGIA 2HCJB 5IT9Z 2EINH 2DA2A 4Y15A 2LMDA 1IN7A 1ZG3A 1J09A 2L9RA 3D5SC 4B44A 4LIVA 1DP3A 1QA6A 3H3UA 3TOAA 2IOUG 3DTIA 4U0YA 3A0BC 4PUSA 3BR5A 3ZP5A 1U8BA 4L9TA 4A3LJ 3GX4X 1O7LA 2E2HJ 2Z2SB 1X58A 1QVUA 2IW5A 1TWHJ 3PO2J 4F7DA 2VPLA 1T8IA 2JA5J 4TMZA 2FSWA 2MD0A 2QE7A 1OKRA 2OZ6A 4XL9A 1V0FA 3WNDA 1MBJA 1VQ7I 4PZJA 2GIVA 2XAJA 1BW5A 1VQ7B 4NNJA 1F9NA 1RI7A 2W24A 2F48A 4CCNA 2NV4A 2XZLA 3JRAA 2CW8A 2CO5A 1D1CA 2DA7A 4HNTA 3AVUA 4QPQA 3BG5A 5E1ZB 3ZQGA 3IRRA 4CO8A 5JR3A 3GWZA 4PGHA 2ICWG 1ZLKA 5B3SH 1M1EB 2OA4A 4E7KA 2AQEA 1RIOH 1ZARA 4CZZA 2C4UA 4G12A 2DMUA 2GAUA 2ZJ2A 2XZOA 2Q2EB 4ACBA 5D8KB 1BOAA 3JAMK 2VKHA 4RAFA 4ZZDA 1MNEA 1SVOA 1LFPA 3HJEA 1G3SA 3JCUC 5AIQA 2XB0X 3DEUA 5FKNA 2M7BA 2XPVA 1F36A 1PXZA 3QAHA 1RQRA 1RKWA 1JJ8C 3IC7A 5ILUA 3CCQI 1XB4A 3CCQB 2EPFA 2BM4A 3JRBA 2OD5A 2QKMB 2CK3A 4YZQA 2FQ4A 1QJVA 5CLSA 1VQ8I 1MMGA 2XC7A 3V76A 2NTQA 4PCQA 1X3ZB 5FKKA 2HU9A 1P92A 2M8GX 2DPUA 2DOFA 3FMRA 4ENMA 4IKFA 1R5BA 4M4SA 5BSYA 3P26A 3DTKA 1VQ4I 4CYCA 1VQ4B 3M1EA 2WR8A 5FRMA 3OW2B 3E5XA 4A12A 1HC8A 3KEOA 1HVXA 2TRTA 2KKOA 3OSGA 3SXYA 3HXLA 1IXSB 5EG0B 2BHYA 3R61A 5DYMA 2ID6A 4PJNA 4BHCA 5DSZA 4UHTA 1UD6A 3SKBA 2O5RA 3EUHA 2QY1A 4XLNF 4PC2A 1HQCA 2L54A 2Y0SN 3ABMH 4YIIA 2V26A 1KK0A 3ZQ7A 1TYWA 4RBOA 1R7JA 2XF5A 4HSRA 3S3MA 2XGJA 5E3OA 1V54H 3OYCA 1BJKA 3LSHA 3GLLA 3ROUA 3ZZUA 2LBFA 2XOKA 1RMGA 3TP0A 3OJWA 1NG7A 3RPUD 4UV9A 1OCCH 2YX4A 2H8WA 2VKEA 1SFEA 1ZG1A 1EXMA 5M5YJ 3SZPA 1LNWA 4UUSA 4JX6A 3KP4A 3PUBA 2PFBA 5HDNA 1YOVB 3RKXA 4XD7A 1FPQA 1TW3A 1KGSA 4G8XA 2PQ8A 5EJCA 5L3FA 4AIKA 4K2EA 4ZCLA 2V7FA 4NDLA 2XVCA 3HAGA 4YAFA 4OJ6A 4AC9A 1KZLA 4CSWA 2WAQA 3BTJA 2AXTC 2PIAA 1SFUA 1M1KD 1D1BA 3FHZA 1MJBA 1JGGA 5JHUA 3HB9A 1OCPA 2XUBA 5KAFC 4Z4YA 1FNNA 4MNUA 1OCTC 3PUMA 3FXJA 5TISC 3N6ZA 1YITI 3DKXA 1EH8A 3OR2C 3S8PA 3PSIA 5LD2C 1A5JA 1YITB 2C5HA 4L18B 2V4DA 1FBUA 3NB2A 2A68F 4RB2C 2DODA 2VPRA 1BJAA 1E17A 1YX5A 1HKQA 3R0AA 5CVJA 1PUEE 4RD3A 1K4SA 1MSFC 3GZ5A 3ECHA 2EZLA 2P4WA 1ELOA 4P12A 1OYIA 2JPCA 3OYLA 4YFKF 2IA2A 2LLKA 3Q38A 2G9WA 2AHQA 4F55A 5IYWA 1UELB 3DF8A 3K2AA 3CPWB 2HQNA 2YWFA 4P26A 5JLVC 1LDJA 4N3NA 1XSXA 4HX7A 4MQVA 2BVMA 4O6JA 5FL7A 1WFXA 1TTYA 5E18F 4OOIA 1K5CA 3HYIA 4HLYA 4U49A 3ML3A 4B48A 5HZBA 1TQMA 4IF4A 3EUAA 3IL2A 5FKOA 2GPJA 2IT0A 1P9QC 3ML6A 2KRHA 2LR8A 2Z16A 4WX9A 3N4MA 5DUIA 2FXAA 4FT8A 3CCJI 2I10A 2M3AA 3KZIC 3RKQA 3AAFA 5D5WB 4YZXA 2NS8A 3OJXA 2L7KA 1DARA 2RV8A 3BG9A 3U1DA 4PC6A 3BP8A 1LUJB 3P9KA 2KFDA 4HAMA 4XKBA 3ZQLA 1QFZA 2WTEA 2B9SA 2C4TA 3OW7A 2FF4A 2GOMA 5FA6A 5K5QA 1HF2A 2INVA 2PN6A 2HQRA 1UFMA 2FOWA 5J4YA 2MYSA 4YIFA 3D5LA 4EJWA 1R5ID 1V0EA 3ZZ0A 2Y75A 1E63A 1NTCA 4MR0A 2LFBA 3KEQA 3DFGA 3CTAA 3CESA 1JA0A 4Q5SF 3K6GA 3W2WA 4HIZA 4LBZA 4M3BA 2RVCA 4BHBA 3JRFA 3J7YJ 1T6SA 2P5LC 4E0FA 1LJ9A 4N4NB 2CU7A 4ZCMA 3UR3C 2DTZA 4J01A 1Z3YA 2VFOA 1LVKA 1MSEC 2O9LA 2QZ8A 2RQQA 5DN6A 2DOEA 1R58A 2O61A 1D1AA 1NJID 2ACJA 3LYCA 4YZAA 2DJIA 4LBYA 2M87A 4Z6YA 3OPOA 1WI3A 2W6IA 3OIOA 1U5TA 1HKSA 3FF5A 1W87A 4P9SA 5E79C 3L09A 1BW6A 1KU9A 3LSPA 4OIOF 1H9TA 2D45A 3BJOA 2DYRH 2HDNB 4QIWN 3A01A 4PMHA 1WJBA 1D1NA 1WGXA 4RPDA 4YG2F 1Q81D 1U5TC 2YR2A 3IUOA 1FMVA 2CUZA 2E35A 4Z4WA 4BXXJ 2PJRB 4KT6A 1ETXA 2BY3A 3ELKA 2R7XA 1H8HA 1E3PA 2WA0A 2X51A 1KZHA 3CMMA 1KU3A 1P7IA 4Z03A 4Y13A 2IS4A 3HOTA 1E1RA 3GEZA 5H5JA 4HOBA 1Y8QB 5GTIC 3GTGJ 2F4IA 2BW3B 2JSPA 4IJAA 5C4XJ 1GAQA 3EQLF 3G3ZA 1W36D 3PUFA 4KMUX 4B3XA 2QCOA 2VBKA 2FBHA 2MG4A 3ONYA 1I27A 2P5VA 3DKWA 3SQNA 4DNRB 4MQ9F 5CVRA 4XRSA 1WKMA 3OR1C 3CO6C 1Z67A 4M73A 3GVLA 1KCDA 3DEWA 9ANTA 3C3WA 5DEQA 2ID3A 1OFDA 3RI4A 4BS9A 5FROA 2WAEA 1TVCA 4X7EA 5J1RA 4LB6B 2PMDA 3LQQA 1PP7U 3GQBA 1CLWA 3R60A 2VJIA 4U0WA 1VHEA 5B5EC 5BPIA 2VB6A 3BR1A 3GW2A 4CQJA 3I59B 1OQYA 2EILH 4M9ZA 1YJNI 4BBSJ 4HDVA 1HDDC 2P5KA 1EH6A 2KISA 3ZPPA 1BI2A 1B59A 4HPQA 3R0JA 3TW6A 1KTVA 2PYHA 1QPIA 5FB2A 4E7ZA 3HTSB 1H88C 1XSVA 3TW7A 1R23A 1W36C 4XLHA 1Z77A 3CUQB 4N9HA 4CCKA 2DN0A 1T6YA 1QGPA 5FO1A 5A8AA 2QSGX 1SD6A 4UZFA 1ZG5A 4I2OA 1JJ6C 4Z4TA 2DK5A 3BC9A 4WWVA 1DP7P 2HMAA 4A0XA 1FYKA 4RAYA 4A3JJ 2KP6A 3MMPA 1LKXA 3L1PA 3B90A 1DDGA 1IW7F 3F8CA 3JW4A 3GTLJ 2HVSA 3CQZJ 1YRNA 1VF9A 4HLXA 3V42A 5FO0A 5DM6F 1S6LA 3WNBA 4KFCA 2STTA 2DEUA 2W25A 2D9RA 1WPKA 5DM7F 3VYTB 2R7ZJ 2CG4A 4O3MA 2P7CB 2V9VA 1ETKA 1QGZA 1TBXA 2JA2A 4PC3A 1IB4A 4D1QA 4ZCIA 2ESHA 4L5IA 3G71I 2V79A 1VQ6I 2ZJRF 2X9DA 3G71B 1VQ6B 1QQ1A 2NZMA 2VBEA 3DU1X 5LGNA 1IDYA 4UNOA 1SMYF 5LLQA 4DK0A 1YLOA 4A0YA 3QWLA 4HW0A 3OEEA 5J47A 2O0WA 1QCXA 4F3QA 1RWRA 3QPHA 3VB2A 4AIDA 4RD1A 4WXCA 3C1DA 2WSSA 4LBVA 4E7HA 1N8RD 5FFXA 1WCMJ 1P2FA 2E5ZA 2MW8A 2E1OA 3TO7A 1AKHA 1OMIA 1Z7UA 3GTQJ 2OZUA 4QUZA 4ESFA 5L3EA 3JRGA 1BJZA 2EBIA 4HV6A 2DAOA 1MJAA 3RIRA 2JA7J 1YQAA 4WXDA 2F5FA 3UKGA 4S04A 4LOCA 1HW2A 2C6YA 4YAOA 2JA6J 4NUBA 1YE9A 1BR1A 1O3TA 1BM9A 2A6TA 1YO5C 2DT7B 4ENNA 2PMUA 4WXHA 1ZHFA 1N06A 3GQ8A 2RAEA 4PC7A 1SKQA 1HOMA 2EIJH 3BQJA 2EV5A 1O8HA 3ULQB 5EDNA 2MH9A 2FRHA 1WOPA 5EGOA 4KMFA 2O6WA 3N90A 2V6CA 2JJ7A 3VSUA 2K4JA 3LQRA 4OJPA 5IYDJ 3EUKL 2VBUA 2VBYA 1LFBA 2LNBA 5CQGA 5DCFA 2R7RA 1TC3C 4RD4A 3ZQFA 2CW0F 1Y1WJ 1LM1A 4A0ZA 3ZCOA 1XPXA 2Y9YA 2L4AA 1N05A 3VMVA 2TDXA 4ETSA 1OB0A 1R5GA 3OS0A 1D5YA 3VNUA 4UB8C 4EJVA 1KK3A 3GSIA 5CVVA 5B1AH 1K83J 1PE9A 4GQNA 3K4JA 4RJLA 5HDGA 1GXPA 2QQ8A 2VLAA 2R7TA 4F52A 1JTAA 3IWFA 4U4BA 1LEAA 2DDBA 2CMPA 4UZEA 5M3MJ 1OR7C 2HVQA 4FWTA 3J81k 2WB1A 4HYEA 1L1IA 4AVZA 3HRTA 1IF1A 5J35A 2LDUA 3QYFA 2GA2A 1UD3A 4BYYA 2GIZA 2D1HA 5KCMA 1OFMA 3CCUI 3J80Z 2J8KA 3CCUB 2H1LA 4L5JA 3LOCA 3IV5A 1FC3A 3QE2A 2KIUA 1XCVA 4C2UA 1G8XA 4RB0A 4Q7JB 2OCCH 1JKPC 2QQBA 4UUTA 2KZGA 2OC6A 3G6EI 1XB2A 3G6EB 5L3GA 2V1XA 2P7VB 3IRQA 2LD5A 2OQRA 3A3GA 1OCOH 3JQQA 2I1LA 2DFEA 3ABKH 3T0YA 2D1VA 3U21A 2YWEA 4OIRF 3ZSCA 2M30A 1AWCA 1UD4A 2FMLA 1QHHD 1B8IA 4BNCA 2X4HA 3PVDA 4M3FA 3FMSA 1H85A 3A8KA 4BE1A 2H6CA 4XQFA 2ME0A 1MBFA 5ED4A 4LGWA 2KPMA 3WG7H 1VQOI 1VQOB 3HHHA 2MLGA 4B4DA 1OB2A 2YUHA 1Y8RB 3PSSA 4IHTA 3I4MJ 2NXNB 3RY8A 1IO2A 2ESNA 2NNYA 2VZLA 3L2CA 4GRIA 5GV8A 3F23A 2L5QA 3CCRB 3G05A 4YIRX 1ZYRF 3SYTA 4CUGA 2QM3A 2X53S 2D3NA 1QQIA 3JTHA 1JTYA 3OOUA 1B1BA 4TT3A 5CYVA 2QBYA 5IY5H 1S7AA 2JQ7A 5AMVA 4Y9UA 3DTEA 2HDDA 4PAAA 4XLAA 1T56A 1I18A 1Q1VA 1T6ZA 3M8EA 2OTLB 3U6BA 3KPHA 4PFPA 5JHFA 3DPUA 1B6AA 5H2FC 2Q8KA 2BX6A 2DK8A 3OIQA 4GYIA 4RM2A 3ZZTA 3GYHX 2PECA 4UVAA 3BR2A 2X6YA 3FPKA 1NK3P 4IVNA 4A3EJ 1A8PA 2YUSA 2ZNYA 3E1YE 4PDKA 4YALA 2PMZN 2EZIA 2K5CA 2PG4A 1U0JA 2NPFA 2L01A 2ZL5A 1A36A 1SFKA 3ES9A 4ZYAA 2L9VA 1R5HA 1FSEA 2R7SA 1SD7A 3AG3H 1X1AA 3V7AA 1MW7A 4XLPF 4A3CJ 2ZO4A 4ZYGA 2DI3A 3QYEA 4OU0A 3W2HA 3PM1A 2LP0A 3SUCA 3RIQA 2MH2A 1I3AA 2VONA 2BV3A 2HZDA 3TL4X 3HRMA 4OOSA 3I3LA 1IRXA 2R7DA 1BIBA 1U9OA 4KUMA 3AG1H 4I0BA 1LPQA 3BROA 1EJ9A 3DU5A 1OGIA 1YTYA 4C0SA 4I0AA 3NQOA 2QTLA 3WGHA 4DQKA 2VKVA 1B9MA 3HSEA 3K2ZA 2DPDA 4CDGA 5J1YA 2ZB9A 3OY9A 5JI6A 1OGMX 2Q6IA 3TBIA 1IRFA 1W5CC 2XROA 1IDJA 3KIOA 4EM2A 3F8FA 1GLNA 4BEHA 3TEDA 4U9UA 3FXQA 1SAXA 4JX5A 5KAIC 3N05A 1X3UA 3ABLH 1G3WA 4ESJA 4L8JA 2JVGA 4XN0A 4XK4A 3W2VA 1IC8A 3W5UA 5J3OA 4I98B 2EFOA 4AIHA 3FM5A 3GTJJ 3E1SA 2DO7A 2KHMA 3OZVA 4XORA 1X1BA 2OPTA 2QVOA 1MMDA 4FHTA 5D6FA 1PLUA 1XSDA 2QUFA 1BBYA 4Q48A 4OMYA 1GVJA 2HEOA 4RAZA 2JK3A 3LAJA 1RR7A 4OWRB 3E6MA 2V1NA 4W97A 5JVGF 4KDPA 5AIPA 2QGGA 3JQRA 2HI3A 2KIQA 3FBNB 4Y4RA 3FIWA 4D7MA 2VASA 5KW9A 4LBWA 2WPDA 3E6BA 2CW5A 1VZ0A 2LBFB 4DQ2A 1CNEA 1YS7A 1FEXA 4F91B 2R5ZA 1K78A 1QBJA 4CGZA 1ONVA 3BY6A 4Z1MA 1Y39A 1YW9A 4UZUA 4PK4A 4UUSB 1W0TA 2QYUA 3SQVA 1XG2A 3DBLB 4G6QA 3QP6A 5HLTA 2O17A 1UG2A 3ASQA 2EV0A 3GVAA 4Z4VA 4XRMA 4N9IA 5J3LA 2ZCWA 2O7OA 2RREA 1K6YA 2GJRA 1O88A 4F92B 1ZK8A 3G1OA 4G7OF 1D3YA 2MGQA 1T0FC 1ON1A 3E7LA 4BJTA 3E20A 2VFNA 5FLVA 3JRIA 5FO5A 4P96A 3D26A 2DIEA 3LNNA 1WJFA 2BV6A 3PSFA 1UCRA 5DUKA 1V5FA 5IYBJ 2EWNA 3OYGA 3HL2A 5ILVA 4ZDOA 3H3VK 4X8IA 3VPRA 1ZQ3P 2DY1A 3BLYA 3ZGKA 3CMYA 3AVTA 4BGDA 1WSUA 2BY2A 2QX3A 2VBWA 4ENJA 1WH7A 2V7QA 2KMUA 4G6TB 2RC4A 4OJ5A 5CDFA 1E2XA 5E1WA 2L7ZA 1W0KA 4DZPA 1GJRA 3NARA 3V8JA 1GV2A 1Z6RA 3ZN0A 3KX2A 2CJJA 1WRJA 4P5OA 1OJLA 2LC2A 4L0ZB 1Q7YD 2VIXA 4KKSA 2BZTA 1R4MB 5J4VA 1BPLA 1O8GA 4KIFA 5H6RA 3VR6A 2MC4A 2YU9J 2M9HA 4N4OB 3PFIA 3K0LA 2NS7A 1WDTA 3EYIA 1IDKA 1EV7A 5IPAA 2OV7A 2JRTA 4GGGA 4ZC3A 1GUUA 5H6QA 3D1NI 3NEUA 3SDGA 4BDYA 4BXUA 4Z4RA 3CMEB 1JNYA 2K40A 2BPOA 2NSPA 2V9KA 1H89C 4AYBN 4U7DA 3BPVA 4KIBA 2OTJB 4X7DA 3CO7C 3E5UA 2QQ9A 4LG0A 3TP3A 1PKVA 4HE5A 4IOCF 2IGNA 2XGCA 5GAEJ 1DUXC 3SZEA 3GFLA 3OOPA 1VBLA 1WTHD 3R6KA 2F5VA 1BIAA 4BE2A 3ONUA 2B63J 3CF5F 3T8TA 3PUNA 4M9XA 1A35A 2JUGA 1IRZA 1E64A 2EA4A 3P4GA 2W82A 1GR1A 3WHBA 2DW4A 3CXCB 1BL0A 2CFXA 3A4CA 4Z4UA 4RLQA 3H9NA 4EQQA 1PDNC 1ORKA 4RD0A 2VBVA 4ZYEA 2HDCA 2WV0A 2DA3A 3E5QA 1F4KA 2NAZA 1FOXA 1KC8D 2BXYA 4CA0A 1MABA 2JN6A 2O8XA 1TT0A 4C43A 4KITB 2ZMEA 3WTXC 2BSPA 1Y0YA 1N78A 1VQLB 1UB9A 1KQ0A 3OL3A 4Y7NJ 1PP8F 1BC8C 3W2EA 4L0YB 3LSIA 3VOEA 1D8KA 1IN8A 2Y31A 2ZSHB 2EZKA 5GP9A 2IP2A 2JA8J 1U5TB 2X6XA 1FSHA 1E3ZA 2F1LA 1QPMA 2V7VA 2ZMEC 4EJUA 1EKEA 1PVEA 1K4ZA 3OEHA 2IAIA 1PUFA 2G0EA 1U9NA 4XRFA 1RUOA 1E0EA 2ZL6A 4QV2A 2V31A 2UV1A 3TO6A 1MKMA 3A01B 2ZZFA 2IPQX 4YAUA 5HS7A 3QRFF 4O5VA 4N0BA 3VMFA 5IP9J 3ZQCA 4Q47A 1ETOA 1OLTA 1S8NA 3OYNA 4RDJA 1X1PA 5ICCA 2B7BA 1LVAA 1L3LA 2PE3A 2F5DA 1EFUA 1G7RA 3TKYA 3TDUC 4FX4A 1ZGJA 2X6WA 2VODA 2IGKA 1KU7A 1Y0UA 2AHOA 4M71A 1IRGA 3Q0WA 5KVRA 1E3HA 5HS8A 4TKOB 1M90D 4YFXF 1SVMA 4LIUA 2F5CA 4YAWA 1VQMI 4BL0B 1Z21A 2OQGA 3DP7A 1VQMB 3OYJA 3QQAA 1ZH5A 2QDXA 4WZEA 3JURA 2GREA 5K5OA 1O4XA 1TLLA 4IHSA 2XPWA 1T6XA 4LITA 3FKSA 4MYUA 4A3GJ 4HDUA 5IP7J 3NAWA 3HG9A 3ONQA 2ZSIB 1D8TA 3LO8A 3ZC3A 3IAS2 4G1BA 1W0UA 2V1DA 3KZZA 3CJTB 4CXFA 5TR9A 3F9KA 1DBOA 3CC2I 2W00A 2O8KA 2HFHA 1FX7A 3OZWA 3CC2B 1TQPA 3TMOA 1BI0A 4S0HB 1W0JA 2E5NA 4V2GA 2ME6A 3QFRA 2UXXA 3CCSI 4MFDA 1E3XA 4G1VA 3CCSB 3VO1A 3HEFA 3RYPA 1GHCA 4AUXA 3MN2A 4B43A 1O8FA 2UVFA 4A69C 5IT9K 3RPUA 3HOWJ 5F4MA 3ASPA 4CICA 1UJ8A 4A3KJ 4A6DA 4YEJA 2XTWA 3CJRB 1QA1A 4U7BA 1J5YA 1Q1HA 2XSDC 4FK8A 1VHOA 3T9GA 1S7OA 4JQFA 3ECOA 2M4GA 1ODDA 3BJ6A 4P2NA 1I7PA 2BM0A 2DA6A 2VN2A 1I3QJ 2LVSA 2X1EA 3S15J 4YHBA 3CLOA 1MBKA 4G6DA 5DNSA 3LJYA 4LLGF 2E34A 2ELHA 3Q9VA 2QSHX 2J8IA 1MGTA 2EFGA 1RESA 3KFWX 2XT2A 2MD5A 1O3QA 2YU3A 2HWVA 3GMEA 2M34A 3Q0VA 3RQ4A 1G3YA 3A0HC 3QPSA 3QSYA 4KN4X 5J1UA 1FNMA 2GLOA 2GWRA 2QLZA 4IXAA 1RZ4A 1SM4A 2WYRA 1YIJI 3VO2A 4TV7A 1YIJB 3FXOA 2W7NA 4ITVA 2BM5A 3S93A 3ZOBA 2M0CA 1O7FA 2MSYA 2E7WA 3OYDA 2PX9A 2UUZA 3HM5A 2NOJB 5LRRA 4XIDA 3G4SI 1V5VA 4G7ZF 1WSRA 3G4SB 3MHPA 3ZMSA 3F8BA 1GVHA 1JUSA 3ASRA 3KL9A 3PNTA 3JR9A 4YFOA 1G7CA 3JSOA 1KCCA 3WU2C 5EEHA 4QVJA 1JJ2B 3EQNA 1P4WA 4KT5C 1QZYA 1U6GA 2FNPA 2BXZA 1LDKB 4OAYA 4XLFA 4LK0F 2R93J 2FOKA 2LH9A 2CF4A 1AKHB 4M0LA 4I84A 4M6XA 1OCRH 4AF7A 4BY7J 1P6RA 2CGPA 1ETQA 1WJEA 3CD6B 2UXNA 3HGYA 3KEWA 4OPVA 3BDDA 4ON0A 1ZM9A 3KYDB 5HLGA 5B6IA 2GJPA 3CCEB 3LWFA 4OPWA 1S29A 3WWGA 5D5XB 3GVKA 1O8LA 2DQLA 3L2RA 5ICFA 2XNDA 3EETA 3GIRA 3IWZA 3PL8A 1V3FA 4Y9RA 4XKVA 4WZTA 2BVLA 2VNIA 4FXUA 3K10A 2GXAA 2VFPA 2B7EA 4CYDA 2IXSA 4Y3OA 2MABA 3VYSB 1BX1A 1TWAJ 4ZDLA 1XFOA 2YPRA 1FDRA 1G2HA 5JMCB 1FBQA 3S3OA 2IVMA 3I71A 1F43A 1WORA 1HZEA 1NH3A 1TZLA 3GUDA 3BQYA 1CQTA 2XNJA 2H09A 5FD6A 3H9JA 1KTWA 2CYYA 3VSTA 2NNNA 3MKYB 1P7JA 4Z4SA 4XMYA 4IRGA 3P9CA 5L46A 1IZ1A 4I7HA 4XSZF 3M8FA 1FOKA 3GTPJ 3S17J 1WOSA 1QRBA 3OP1A 4HBLA 4PJMA 4I02A 3AKZA 3COAC 4C2MJ 1OYWA 3LFUA 2VOPA 2WZPP 2NTPA 2NVUB 2Y0SA 3OYBA 2VNJA 5TY0A 3H35A 2ZKZA 2HOAA 4QLCU 1SD4A 3FDYA 1VQNI 1VQNB 2O1DA 1JB9A 3MCAA 5FNZA 1I1GA 1JKQC 1ZUNB 4JMQA 3ASNH 2XTYA 1ON2A 3DKYA 2CV1A 4W8RA 3R4KA 4C30A 1EZGA 3RTRA 2LZJA 1DGWY 1IV8A 1X4PA 2XAQA 3TOBA 2H1KA 3GQ7A 3NAUA 3OYAA 1G7TA 2V7UA 2K9QA 3OS2A 2GXBA 2EH3A 3C2HA 1YW8A 4NHJA 1KU2A 3FX3A 3MKLA 1F20A 4Y7CA 3D5RC 4QPOA 2CBXA 3BR3A 3RPQA 2WC2A 2ZL7A 3L7WA 1ZM4A 1KYZA 1JUPA 2W84A 3HOVJ 3Q5FA 2Z9OA 2JRMA 3LL7A 1TW2A 2HTJA 4A5MA 4IW3B 4GYGA 2A6HF 5J8FA 3V8LA 1XQBA 2PBIA 2RC5A 4M1KA 1W35A 2CC2A 3S16J 4XOPA 3ZUGA 1YS6A 4FE4A 3KZYA 1REPC 2QMUA 2QA4B 5LGUA 4X0GA 1K73D 2D2WA 3V4GA 5L3BA 1OGOX 2EA2A 4GO1A 1UAAA 3M4OJ 2GBYA 2K27A 1BR2A 2JIZA 2OK8A 2WJVA 1QA2A 4XRSG 1V5EA 4C3HJ 3A8IA 4M6YA 1ZR4A 2FBIA 4P22A 4XSXF 3QFSA 3MKZA 1UMKA 1Q86D 3WTZA 3DXJF 2BM7A 1MBHA 3BY1A 2A05A 1QA3A 4MGRA 3CCLI 5DCMA 3CCLB 2WWYA 4W1UA 4XOTA 1IUYA 3HOUJ 2BF4A 3J7AY 4E7SA 2YWGA 5BQTA 3HRSA 2GQFA 4IHYA 1SANA 2JZYA 4DIQA 1J7KA 3MCZA 3K4NA 4ABZA 3H0DA 1T5EA 2H27A 3OWTA 4A3FJ 3J81Z 1Q82D 1R1TA 2QBYB 4KIGA 2E2IJ 3LSMA 3ZMDA 5B1BH 3DWLE 2M1BA 2R5YB 1XS9A 1IXRC 1LE8B 2OYNA 2R9VA 4TMWA 4QSHA 2JJ2A 2PEXA 4QHYA 1UMQA 3ZMZA 2WY8Q 4A3MJ 5K1YA 1YHQI 1YHQB 2DYSH 2OAZA 3H0GJ 3PNVA 4EGZA 4X07A 1YFHA 4M9SA 3I1FA 4A5NA 1FP1D 1HXDA 5EF6A 2QEXI 2QEXB 1TYVA 4XNFA 2CWEA 1BLIA 3MFKA 3S1MJ 3AVXA 2E2JJ 2JN9A 1S4MA 3SLDA 5F1JA 1QG0A 5THXA 2ECCA 2M5SA 4W8QA 1B72B 2CUJA 2VQCA 1Z0XA 1I50J 4P1WA 1SC7A 3PA1A 3FISA 4GXOA 4HSTA 2NYXA 2Z33A 5BSXA 2O0YA 1Y0NA 1QH0A 1ERDA 3M1CA 2Z8GA 4EJOA 3GVJA 1LDDA 2NVXJ 3H9GA 4R1HA 1HKTA 2V7TA 1J59A 2BEOA 5ERIA 2XGEA 1IA5A 3AK5A 2BGJA 3PFYA 2WV1A 3BNWA 1S3JA 4NBQA 1KQ9A 5DD8A 2XDVA 4A6EA 4P9UA 1OOCA 4BH9A 2A07F 3UW0A 3WG9A 5K5RA 1EFRA 2DMTA 3K4KA 3OYEA 5FGMA 2GK6A 1K8FA 4OIPF 1S0UA 1U2RA 3AG2H 1SFOJ 3T5XA 3CRZA 2VC0A 1YX3A 1YJWI 1EFTA 1YJWB 2VFQA 2FUG2 2VBMA 2Y9ZA 3ESWB 1Z7LA 3PIPF 3ASTA 1TTTA 1LFUP 2Z1DA 4BXFA 3IHUA 3P9IA 4HV5A 3ZQQA 1RQPA 2DMPA 1JHFA 3I5UA 4V19K 1CQXA 4RDUA 4W8SA 2EV6A 2ZFUA 3ZPNA 3CZ6A 2M8EA 3Q6QA 3H09A 1JRGA 2HPMA 1IJEA 1Z6TA 5DTDA 1ETWA 1WVRA 2NT9A 4PJJA 3I0TA 3MD2A 4MTEA 4NCNA 2BHZA 4FX0A 1FJLA 1OR7A 2CSOA 4JOMA 3A35A 1XGNA 2KRFA 1FIAA 4M74A 4DK1A 4AD9A 1XX5A 2E1BA 2AO9A 2PJPA 2GOXB 4MIMA 2ZBUA 4BAYA 4HRIA 4LD5A 4LG3A 4BJ6C 3SY2A 2V4JC 4PJ0C 4E7IA 2DYIA 2IS1A 3I55B 1KQ5A 1O8IA 1NHAA 2IRFG 1P4MA 4JBAA 5E8IA 3W6KB 4EEFG 1RUNA 4IRIA 2M45A 4BACA 3EDPA 3B6AA 5J40A 4V02C 1QO0D 4EGYA 3SDBA 4KYWA 3ISXA 1HG8A 4TMVA 2VFMA 1DG1G 4I76A 2V7WA 4GDFA 3DEEA 1FT9A 4DYQA 4CCJA 2IGMA 4AM3A 5A2QZ 2VYQA 2QGUA 5GPCA 5KHDA 1XMKA 1F5TA 3HOYJ 3E6CC 4L9VA 4DZJA 4QFMA 2CQ7A 5H59A 2LY9A 4M72A 2CQNA 1JTXA 3I9V2 3DU6A 2NVQJ 2UWMA 2DTRA 1XDUA 2R0QC 1T38A 2I8DA 1S5LC 3OL4A 3OV8A 5LBQA 1Z3XA 2CNDA 2W6JA 2DCEA 4Z4ZA 2IEKA 2ODLA 2LG4A 2QYOA 2INUA 4X7FA 4X0CA 3P5JA 5M5XJ 2OCEA 4B3GA 1FWZA 1JUMA 1XDSA 4UXNA 2B0RA 4HX8A 2P8TA 2IS2A 3SZTA 1QHGA 1J2XA 2I5UA 3BR6A 4A3IJ 4YXWA 3WTSC 1AIRA 2E1RA 3HC7A 2NOGA 2XV4S 1NK2P 1W5SA 2CUEA 2OF7A 2ZJPF 5F27A 2VXZA 1IN4A 4B09A 3DQVC 1B4AA 4WF2A 4G5GA 4AU7A 2E19A 2QKLB 2EFWA 2MBFA 2CV2A 1JXSA 4DYCA 4X06A 5FIUA 4HA8A 3M7GA 2E71A 1CF7A 4Z05A 3ABTA 2R7FA 1AA7A 3CCRI 1FBSA 1APLC 3HHGA 3QODA 4XONA 5LRSA 4OOXA 1X1DA 2HQ5A 1R5NA 3HOSA 4I6ZA 2XASA 3WTUC 1GAWA 3HKZA 3AVYA 4XKWA 5L3CA 2XB5A 1TP4A 4YRVA 3J7ZI 1QVFB 3FXMA 5E8GA 3DCFA 5E3NA 2IA1A 2DXIA 4GFBA 4RCYA 1S7EA 2KZVA 3N97A 2OTLI 2LTPA 4OJLA 4C2LA 1TYXA 3A03A 3W2IA 4QWQA 3RCOA 3SHFA 4Y52J 4AVPA 2R7QA 1O3RA 2LY1A 2HLDA 2E1MC 1TWGJ 4RGUA 4IQ4A 3S1QJ 4EJTA 4TMXA 2ETHA 2FBKA 1YIOA 4X7CA 4UB6C 4DOZA 3IP4B 4D5FA 3CUQC 2DJNA 2IGOA 1KRHA 3K4MA 2HYJA 3WTYC 2EIXA 5FLXZ 5FLMJ 2C2WA 5E3MA 5EMNA 4WZLA 2VJ5A 1LLZA 3ZQHA 1O8DA 1FMWA 2FU4A 4YFNF 1JI8A 1FTZA 2HOEA 1IGNA 4HQEA 2WAFA 4G6IA 1OFCX 1WZ2A 2DBBA 5DS9A 1COWA 2M4KA 3S3NA 1O57A 4DYRA 1ZN2A 1FY7A 3P27A 5E6TA 1LLWA 4EH1A 2XC1A 3SJPA 1VQKB 3LSJA 1UHSA 3SJMA 3K1MA 1AIPA 1VJSA 1DABA 4KJZA 3CC4I 4M3EA 2JJ1A 3CC4B 1ZELA 4ASUA 2DQRA 3LMMA 3SEZA 2K86A 2RC6A 1D0XA 3HZJA 3O8HA 3UNGC 1DDNA 4I09A 2PLYA 1YJ9I 3JQPA 1YJ9B 5EZHA 1N0UA 3OAAA 2XAGA 2VJJA 5BNGA 4CYCB 5JFRA 2K7LA 3F3XA 4PJLA 3FPPA 4IHWA 1STZA 2VNHA 4EM0B 2E7XA 2GXGA 1BOBA 3CDHA 2V7XA 2XSJC 5IK2A 4A3DJ 4MXNA 3CCVI 2EIMH 3CCVB 1QZZA 3R6SA 3I4NJ 4NK6A 3J80K 2ZBKA 1QGAA 2ZITA 4JX4A 5LHHA 2FX3A 2A69F 2ECBA 2IA0A 1LEBA 1FRQA 3K1NA 3P7NA 2P0WA 1O3SA 2VJ4A 4OINF 2FMYA 3JAMZ 4G7XA 2ZNZA 2M7AA 1SEUA 2G7UA 3FMQA 1MDMA 3E3VA 2X48A 4G94A 4YELA 4FETA 3WY9A 5IYPA 3X2QH 1PJRA 4P6VF 1USSA 2B0LA 3QFCA 3SJZA 1B9NA 2A61A 3B02A 5KK1A 1K28D 4D5CA 2NT6A 4LJZF 3M8JA 2CH0A 4RAGA 1T0FA 2YWHA 2K02A 3GTKJ 1BMFA 3QU3A 2VOOA 1TT5B 2WJYA 4TN1A 3OE7A 3Q3SA 3BQZA 3S2HJ 3U9GA 4DBQA 1TWCJ 2J5PA 2FX0A 3IKVA 4IQJA 4KKUA 4GCVA 2W4SA 2KRCA 1FZPB 1C0WA 2R6HA 3GQ9A 2CQKA 4IPAA 3HDDA 1K6OA 2DA4A 5LFAA 4M3GA 5HNHA 5HNFA 3WTVC 2DETA 4P55A 1GO2A 2CW7A 4JRAC 2ADUA 2BYVE 1A6IA 3GFJA 1BI3A 2K9NA 5D8LB 1KONA 3H5RA 2X8KA 2NVTJ 1BI1A 3WE3A 3DLLF 2XTXA 1I6XA 1TLHB 3HPHA 4DNTB 2ISYA 1FNCA 4EV0A 2KLOA 3M9AA 2P6TA 1EA0A 4E70A 2EFPA 1NBMA 2LF8A 3CJQB 4YC5A 2RQPA 5D4SA 4IOAF 4RGSA 2WAQN 1DGRM 3SFIA 3ERED 5GAHJ 2LREA 3RDIA 1WOOA 3DDYA 1LB2A 3VWBA 1VI0A 3HSFA 4DW6A 2C77A 5LGTA 3GF2A 3ZBTA 5F4JA 1MD0A 1T33A 2Q1ZB 1KYWA 1YX2A 2KIFA 4OMZA 4D9JA 2QTZA 1E1QA 4ROXA 2XHKA 2L7FP 1FYLA 1EE6A 3H5AA 1IXCA 1KJZA 3FJOA 2HDWA 3B4NA 1TUIA 3PSZA 1EP1B 1G6NA 3W6JB 3F8MA 1IN5A 1E79A 3K1PA 1AMOA 3H5NA 1KQSB 2EK5A 5CPRB 4H9GA 2IBDA 2OBPA 3CMEI 1WSVA 4RDKA 4OOVA 5GAGJ 1UZCA 1SVLA 4H0EA 1VTNC 2EWEA 2PMZA 5BPDA 1T39A 3BTCA 5CVIA 5AONA 2JPBA 1H8AC 2EZHA 2OTJI 1N0VC 4NB5A 5HVQC 4RPBA 2K9MA 2L02A 3AVVA 2QENA 4HQMA 2CUFA 3CJNA 1T08B 4P25A 3FXLA 2N8GA 3LA7A 2Q6KA 2COBA 4AF6A 1N75A 3EQOA 3VSVA 2OBRA 1WHUA 4ZTFA 1UD8A 1ULYA 1FLIA 1X3WB 1YLFA 3ZMVA 2FJ1A 2CV0A 4WQMA 2XAUA 2F6CA 1KD1D 3CP2A 1HSJA 2E60A 5JLXA 5DS0A 5IP6A 4HG2A 3F21A 1W7PD 4BDZA 2VKDA 4FN5A 2QN6A 4KICA 1T98A 3HIFA 4ENKA 1JA1A 1L0OC 3OFNA 2HYGD 1N07A 5H20A 2D74A 4OM9A 1JHHA 5FD5A 3JSPA 2FD5A 5FKLA 2LRDA 4MEXF 2Q0OA 1VQLI 2DOAA 4RGRA 3DBRB 1F60A 5TV2A 3T51B 1Z1DA 3B6CA 4DBRA 2MLKA 3BZ6A 3L9FA 1IG7A 1HDPA 3V7RA 4PFOA 1U8RA 3IH2A 2CRGA 2OUMA 3WGGA 1ZRDA 2BE5F 1TNSA 3PQJA 2Q6OA 2BGIA 1WMRA 3ZQIA 5F04A 3MVPA 3JRDA 4MYTA 2LY2A 3KP2A 4E6KG 3Q3AA 3H9QA 1W7PA 4XLCA 4AWXB 1T2KA 2HYFA 2XZPA 3CF2A 2HXOA 3OKXA 1VQ8B 1RC9A 2R7OA 1R1VA 2ZXIA 5EYRA 2HVRA 5LEJA 4BQAA 1P4XA 3OZUA 4P9FA 3AFHA 4OAZA 2G7HA 2HTSA 1EFCA 1FX0A 3MWMA 1EWYA 2JDIA 4P3IA 4B4CA 2WADA 3BWGA 3PQKA 2PYGA 1J0RA 1VQ5I 4ZZLA 1VQ5B
chains in the Genus database with same CATH topology
2CMPA 2NTBA 3OYAA 1OR7C 2HVQA 3VMWA 3OS2A 3C2HA 4BQOA 5C1EA 2WB1A 1BN8A 3VYUB 4AVZA 3D5RC 4QPOA 2DT6A 3E0JB 3QYFA 1NHCA 1BHEA 1UD3A 2XF6A 3OYKA 3KEYA 3AL0C 1X0CA 5KCMA 1OFMA 2KQRA 3EUHC 3LL7A 4XN3A 1WPCA 4C2UA 1G8XA 2HNHA 3VDXA 2BOLA 4NQWB 2OC6A 3KRGA 4XOPA 4FASD 3K4CA 3OYHA 4X0GA 3A3GA 1OGOX 4J00A 1UAAA 4ANJA 2W1OA 1O8JA 3U21A 1BR2A 3ZSCA 3IAM2 4CZCA 2JIZA 3GRHA 2VL8A 1UD4A 3ZXSA 2WJVA 1QHHD 1V5EA 4HEA2 3L2UA 2KVOA 4P22A 4EATA 4BE1A 1Y6IA 4XQFA 3NWTA 3MKZA 2VQLA 2VQGA 3K4BA 2KPMA 4B3FX 2CS3A 2GK7A 4XOTA 3J7AY 4E7SA 1RU4A 4XLEA 4YZ0A 1V5GA 4GRIA 3DLAA 4DIQA 2F43A 3K4NA 3H0DA 2L5QA 3OS1A 2X1CA 1T5EA 3G05A 3OWTA 4CCMA 3SYTA 4CUGA 1X19A 1D0ZA 3L2QA 3HUGB 2X53S 2ZZEA 1X4OA 2VXDA 2XF7A 3LSMA 2D3NA 3NE5B 3DWLE 4TT3A 3OOUA 4C9YA 4BU2A 4C2TA 2R9VA 3WQZA 3BCBA 4XKCA 4TSFA 4NC7A 2JJ2A 5AMVA 4XR6A 3DTEA 4HWVA 2WY8Q 1T95A 4XLAA 3PNVA 1J09A 3D5SC 1DP3A 4B44A 4LIVA 1I18A 3DTIA 4AYBA 4XNFA 1BLIA 4PUSA 3QOEA 4PFPA 5JHFA 3DPUA 1WJ5A 2Z2SB 2X1DA 2M5SA 4W8QA 3OIQA 2CUJA 2VQCA 4RM2A 2VPLA 2PECA 1HA8A 2ELJA 4P1WA 2MD0A 2X6YA 2X3HA 2QE7A 4HSTA 4XL9A 1V0FA 4IZZA 4R79A 5FRNA 3ZR8X 4NNJA 2IS6A 1ERDA 3M1CA 2K5CA 2Z8GA 4CCNA 1U0JA 2K9LA 3GVJA 2XZLA 3H9GA 1SFKA 2CW8A 4ZYAA 1W9XA 1VLYA 3G2BA 2R7SA 1D1CA 4HNTA 2IQ7A 1X1AA 2KL4A 4QPQA 1MW7A 1IA5A 3PFYA 2Z6BD 4DGWB 3OYIA 3UW0A 2XDVA 1OOCA 3QYEA 1EFRA 3C2GA 2O0VA 3K4KA 3OYEA 2GK6A 4E7KA 2AQEA 3SUCA 2HZDA 1WP6A 1YX3A 3TL4X 2XZOA 3I3LA 1IRXA 2Q2EB 2VKHA 2FUG2 2VBMA 4NK8A 3GQAA 1MNEA 1LFPA 3DU5A 1PXZA 1Z7LA 2M7BA 2GJKA 3NWSA 2Z1DA 4BXFA 3ZQQA 3CP8A 4W8SA 2ZFUA 2CK3A 2QKMB 4E4HA 4YZQA 3ZPNA 3CZ6A 1QJVA 3OY9A 1JRGA 1OGMX 1MMGA 2XC7A 2NTQA 2HPMA 3TBIA 1IDJA 4XM3A 4ZDPA 2HU9A 2NT9A 1GLNA 4PJJA 4BEHA 4IKFA 4NC8A 3MD2A 3BG7A 3DTKA 3N05A 4L8JA 3LSGA 2JVGA 4XN0A 3W2VA 5FRMA 3A35A 4JOMA 4KISA 1H80A 3E1SA 1HVXA 2KHMA 4DK1A 1DQUA 4XORA 3HXLA 1X1BA 2E1BA 3B8YA 4PJNA 1MMDA 1UD6A 4G7WA 1PLUA 2GOXB 4HRIA 2O5RA 4LG3A 4BJ6C 4URRA 2V4JC 3PJRA 2NSTA 4E7IA 2QY1A 2IS1A 1R6RA 1O8IA 4OWRB 2V1NA 4CH7A 2V26A 4BACA 3FBNB 4Y4RA 2VASA 2WPDA 3SDBA 3T53B 1HG8A 1VZ0A 2XF5A 4HSRA 2LBFB 4E7LA 3S3MA 3A2KA 2XGJA 2QXZA 4F91B 3FBIB 3DEEA 3LSHA 3OYCA 4CCJA 2IGMA 2LBFA 1NRKA 2XOKA 4Z1MA 1RMGA 3SEQA 1NG7A 5KHDA 3RPUD 4UZUA 4PK4A 1XG2A 5HLTA 1DBGA 2O17A 3I9V2 3DU6A 2UWMA 4OZYA 3PUBA 2I8DA 3OL4A 4XD7A 2RREA 1Z3XA 2RNGA 4ZTJA 1K6YA 2DCEA 2GJRA 2W6JA 2L9NA 2LG4A 4F92B 1O88A 1O8KA 2INUA 2ODLA 1T0FC 2V7FA 4B3GA 3VYRB 4BJTA 3HAGA 4OJ6A 3BH4A 1KZLA 4CSWA 2WAQA 2DIEA 3LNNA 1WJFA 2IS2A 1QHGA 3PSFA 4YXWA 3HL2A 3OYGA 1V5FA 1AIRA 4ZDOA 3HC7A 1D1BA 3LMWA 2K3PA 2AQFA 4DJAA 3BLYA 3SZGA 3ZGKA 4BQQA 2VXZA 4BGDA 2ZTGA 2QX3A 3DQVC 4AU7A 2QKLB 2V7QA 2CV2A 3QYBA 2KMUA 4G6TB 3BG6A 3DKXA 3OR2C 3S8PA 3PSIA 5LD2C 4Z05A 4OJ5A 5CDFA 1AA7A 2V4DA 3QODA 4XONA 1W0KA 3FKJA 1X1DA 1H8EA 3HOSA 1YX5A 2E1MB 3A1YA 3HKZA 3KX2A 4XKWA 4P5OA 2LC2A 4YRVA 3OYLA 1N77A 5TGTA 2VIXA 2DXIA 2KZVA 4KKSA 1BPLA 4F55A 1O8EA 1UELB 1O8GA 4OJLA 4C2LA 3VR6A 2MC4A 3EPZA 1QU3A 3RCOA 2BVMA 2R7QA 4N4OB 2LY1A 3KYLA 2HLDA 2E1MC 2HQAA 1WFXA 3H94A 4IQ4A 5FL7A 1IDKA 1K5CA 4U49A 2OV7A 4B48A 2JVHA 4ZC3A 4DOZA 2KDOA 3W2AA 3IP4B 2IGOA 3EUAA 1GQ8A 4BDYA 3K4MA 4PSWA 1S9HA 1P9QC 4H4KC 2KRHA 2VQHA 2Z16A 3VSLA 4CCOA 3BC8A 2NSPA 2V9KA 2M3AA 1MMNA 4YZXA 2L7KA 2VJ5A 4II3A 5C1CA 1O8DA 4XKBA 1PKVA 3OW7A 2IGNA 1FMWA 1WJAA 2GOMA 1JI8A 2INVA 1VBLA 1WTHD 2X85A 2F5VA 2WAFA 4G6IA 4BE2A 2MYSA 1COWA 3D5LA 5HKKA 2M4KA 3S3NA 2JUGA 1V0EA 4MR0A 2W82A 3PNYA 3BCAA 1VJSA 3CESA 4KJZA 4OJOA 3K6GA 3A4CA 3W2WA 2JJ1A 4HIZA 4E7JA 2CFOA 1ZELA 4RLQA 3L2VA 4ASUA 3OOCA 3LMMA 3SEZA 2ZTNA 4E0FA 1D0XA 4N4NB 4HNUA 3UNGC 3UR3C 4J01A 1Z3YA 1NG6A 4CA0A 3L2WA 1MABA 1TT0A 4BEHB 1LVKA 3OAAA 4KITB 2BSPA 1X1CA 3W3CA 1N78A 2VJJA 3BCDA 2RQQA 3OL3A 3MKWB 5DN6A 4PJLA 2R7WA 1Y56A 3LSIA 3FPPA 1D1AA 4F93B 2ZSHB 4YZAA 2DJIA 3OPOA 1BOBA 2X6XA 1E3ZA 2W6IA 2M0MA 2XSJC 5IK2A 3OEHA 4MXNA 1E0EA 4NK6A 2V31A 2UV1A 2ZXHA 3VSKA 2ZZFA 2WY7Q 2P0WA 4PMHA 1WJBA 2VJ4A 1EA3A 4G7XA 2M7AA 1OLTA 3IUOA 1FMVA 2CUZA 1MNDA 2A5WA 3OYNA 4YELA 1KMHA 3HPGA 3BCFA 4FETA 4KT6A 2PJRB 2X6WA 2IGKA 1PJRA 2R7XA 2WA0A 2X51A 3RSNA 1D0YA 3CMMA 2PJRA 1H8HA 4Z03A 2IS4A 1OFLA 3GBGA 3HOTA 1E1RA 1K28D 4TKOB 3M8JA 2CH0A 2NT6A 4LIUA 2R4GA 2F4IA 2BW3B 2JSPA 4BL0B 1Z21A 1BMFA 1W36D 3OYJA 1UD2A 2WJYA 4B3XA 2VBKA 2BW3A 3OE7A 3JURA 1WJDA 4DBQA 2L2OA 5HOOA 4LITA 4IQJA 3FKSA 4KKUA 2W4SA 2KRCA 3JU4A 2ZZGA 3HG9A 3FHNA 3ONQA 3GQ9A 3OYFA 2ZSIB 4DNRB 3OR1C 3IAS2 3K70D 5LFAA 3GVLA 1KCDA 5HNHA 1DBOA 3F9KA 5HNFA 2W00A 2CW7A 1UD5A 3TMOA 1W0JA 2E5NA 2HPIA 2WAEA 5FROA 4BS9A 4Z06A 1E3XA 1KONA 3H5RA 5CQEA 3OMYA 2X8KA 3GQBA 4Y33A 4B43A 1O8FA 2UVFA 2VJIA 3HPHA 4DNTB 4EW9A 2VB6A 2KLOA 4YEJA 4ZJZA 3CJRB 2UVEA 4U7BA 1NBMA 3CJQB 4U87A 1OHHA 3T9GA 1UG0A 4JQFA 3ZPPA 2V6EA 1DGRM 2M4GA 4HPQA 3ZIAA 3FY3A 2L9SA 2PYHA 2LREA 3DDYA 3VWBA 4E7ZA 1G59A 4PSXA 2X1EA 1E43A 1W36C 4XLHA 4CCKA 2WBMA 2Q1ZB 4D9JA 4BE0A 1E1QA 1SAUA 3BC9A 1EE6A 3RQ4A 3H5AA 2HDWA 3B4NA 3K70C 2KP6A 1LKXA 3B90A 3DPLC 1E79A 5KNLA 2W7NA 4ITVA 2HVSA 2R7UA 1WJCA 3K4LA 3S93A 4IX7A 3H5NA 3V42A 4KKTA 5CPRB 2F1MA 3OYDA 3VYTB 2UUZA 2NOJB 3ZRGA 2R7VA 2JA2A 1VF7A 2PMZA 2EWEA 3OIPA 1IB4A 4D1QA 2NZMA 3MMYB 3PNTA 1PYVA 5HVQC 2K9MA 2VBEA 1KCCA 4B47A 3EQNA 4DK0A 3LSKA 3S32A 4XLFA 1LDKB 4OAYA 3OEEA 1N75A 3T56B 2O0WA 4CCLA 4F3QA 1QCXA 1RWRA 3EQOA 3VSVA 2LH9A 2WSSA 4E7HA 4ZTFA 1UD8A 2E5ZA 2CV0A 2D3LA 2XAUA 2F6CA 4I84A 3CP2A 1CZFA 2E60A 2LOOA 1WJEA 4HG2A 4BDZA 2VKDA 3OYMA 5CKTA 3KEWA 3OFNA 2GJPA 3WWGA 4BJ5C 3GVKA 4NUBA 1YE9A 3L2RA 1O8LA 1BR1A 2XNDA 2LRDA 3PL8A 2A6TA 3A3BA 3DPTA 2DOAA 2DT7B 4XKVA 3T51B 4DBRA 2BVLA 4FXUA 3GQ8A 3K10A 2O04A 2IXSA 4Y3OA 2MABA 3VYSB 1BR4A 1O8HA 4ZDLA 4PFOA 2LYCA 2OUMA 3S3OA 4RLFA 4W8TA 1HZEA 1TZLA 4MLOA 1WMRA 4RMNA 3H9JA 1KTWA 3VSTA 2LY2A 4E6KG 3VSUA 4OJPA 3H9QA 4XLCA 3EUKL 3MKYB 4XMYA 2R7RA 5CQGA 1O8MA 2XZPA 3AKZA 4PJMA 3ZCOA 3CF2A 3LFUA 2WZPP 4RM3A 2R7OA 2NTPA 2Y0SA 3OYBA 2ZXIA 3VMVA 2HVRA 1OB0A 3H35A 4BQNA 1MMAA 3OS0A 3AFHA 3FDYA 4OAZA 1FX0A 1SKYB 2ZZQA 4BUPA 2O1DA 1PE9A 4GQNA 2JDIA 4JMQA 4OZZA 4W8RA 3DKYA 2CV1A 2WADA 3K4JA 4C30A 4II2A 3RTRA 3AL0B 2VLAA 2R7TA 2LZJA 1DGWY 2MFZA 1X4PA 2PYGA 4F52A 1I8DA 1JTAA 4U4BA 3GQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NTB A;  1PXZ A;  3VMW A;  3T9G A;  3ZPP A;  2NSP A;  3FY3 A;  1BN8 A;  2PYH A;  4AVZ A;  4W8S A;  1NHC A;  1BHE A;  4YZQ A;  4YZX A;  1QJV A;  5C1C A;  1JRG A;  1OGM X;  4XLH A;  1X0C A;  2NTQ A;  1OFM A;  1O8D A;  1IDJ A;  4XM3 A;  2NT9 A;  2INV A;  1VBL A;  4XN3 A;  2X85 A;  4XN0 A;  1EE6 A;  1H80 A;  3B4N A;  3KRG A;  4XOP A;  3B90 A;  4MR0 A;  4XOR A;  3B8Y A;  1OGO X;  1PLU A;  1O8J A;  4OJO A;  3ZSC A;  3GRH A;  4URR A;  2QY1 A;  2NST A;  1O8I A;  2EWE A;  1IB4 A;  2NZM A;  4XQF A;  3GQ7 A;  2VBE A;  1KCC A;  3EQN A;  1HG8 A;  2BSP A;  2VJJ A;  2QXZ A;  4XLF A;  2O0W A;  3EQO A;  1QCX A;  1RMG A;  4XOT A;  1RWR A;  3VSV A;  1RU4 A;  4YZA A;  4XLE A;  4YZ0 A;  1XG2 A;  2X6X A;  4NK8 A;  1DBG A;  2O17 A;  4I84 A;  4OZY A;  5C1E A;  4MXN A;  1CZF A;  4NK6 A;  1O88 A;  2ODL A;  1O8K A;  2INU A;  5AMV A;  4XR6 A;  4HWV A;  4PMH A;  4XLA A;  4OJ6 A;  3WWG A;  1O8L A;  1AIR A;  4XNF A;  4YEL A;  3LMW A;  4XKV A;  2X6W A;  3GQ8 A;  2O04 A;  2QX3 A;  4Z03 A;  4W8Q A;  1O8H A;  1OFL A;  2PEC A;  4U4B A;  2NT6 A;  2X3H A;  2X6Y A;  4XL9 A;  4OJ5 A;  4Z05 A;  4W8T A;  4XON A;  2VBK A;  1WMR A;  3JUR A;  3VST A;  1KTW A;  2Z8G A;  3VSU A;  4OJP A;  4XLC A;  4XMY A;  4XKW A;  3GQ9 A;  1O8M A;  2IQ7 A;  2VBM A;  1IA5 A;  1KCD A;  1DBO A;  1O8E A;  2NTP A;  1O8G A;  4OJL A;  3UW0 A;  3VMV A;  4C2L A;  1OOC A;  4Z06 A;  2O0V A;  2O1D A;  3SUC A;  1PE9 A;  1IDK A;  4OZZ A;  1K5C A;  4U49 A;  1O8F A;  2UVF A;  4W8R A;  2VJI A;  4EW9 A;  3GQA A;  2PYG A;  1JTA A;  4YEJ A;  1GQ8 A;  2UVE A; 
#chains in the Genus database with same CATH topology
 3ZMT A;  1FP2 A;  5DDG A;  2BGC A;  1NB0 A;  3CMA I;  1ZM2 A;  1HA3 A;  3CMA B;  1BN8 A;  4A3B J;  2DLL A;  2DT6 A;  3E0J B;  1MBE A;  1R9T J;  5FKM A;  2IJL A;  2XT4 A;  2XF6 A;  2VI6 A;  3OYK A;  3AL0 C;  1X0C A;  4HF2 A;  2KQR A;  4M6V A;  3EUH C;  5L3D A;  1ZRE A;  4MEY F;  2F3L A;  3BT9 A;  4F7Z A;  1IB0 A;  4RB1 A;  4XN3 A;  3WU1 B;  2C5B A;  1U78 A;  1PJ5 A;  2P3M A;  3SLN A;  2F2E A;  2QWW A;  1Y0R A;  2BOL A;  2J7K A;  5HS9 A;  2JUC A;  4FE7 A;  3ZN1 A;  4MHG A;  1X2N A;  4BPR A;  2UZK A;  1ETV A;  3FXR A;  4NQW A;  4FAS D;  3OYH A;  3GCM A;  2XAF A;  2F4M B;  2HGC A;  4J00 A;  2X3U A;  1VQ9 I;  2W1O A;  1O8J A;  1VQ9 B;  3IAM 2;  2VL8 A;  2VE8 A;  3ZXS A;  4HEA 2;  1W4M A;  3L2U A;  1JKO C;  1HF0 A;  2GM4 A;  1R4N B;  1B2R A;  3CB4 A;  4X05 A;  1OB5 A;  1Z91 A;  1QVT A;  3KE2 A;  1YYV A;  3NWT A;  3C7J A;  2VQL A;  4JK1 X;  1K61 A;  2VQG A;  5DCM B;  1AOY A;  4B3F X;  2CS3 A;  1K8A D;  3HBL A;  2R3S A;  3HSR A;  2GK7 A;  1GXQ A;  2F5E A;  3HRU A;  3TGN A;  2M5W A;  5TJJ A;  1V5G A;  3WE2 A;  3DLA A;  1R71 A;  3OS1 A;  2X1C A;  3KLN A;  4CCM A;  1YRN B;  4BY1 J;  2HKX A;  1D0Z A;  2BBY A;  2ZJQ F;  2O6G E;  2ZBV A;  1X4O A;  2VXD A;  2XF7 A;  1JGS A;  3NE5 B;  3PA2 A;  3WQZ A;  4C2T A;  4BU2 A;  2FA5 A;  2WZN A;  3BCB A;  3HUG A;  4BKX A;  4IL6 C;  4TSF A;  3I54 A;  2STW A;  5B66 C;  3ZPL A;  1A6Q A;  3LVB A;  4HWV A;  1W1W E;  1T95 A;  4RGX A;  3S2D J;  2FQ3 A;  3ABU A;  1OGJ A;  5E20 A;  4Z2Y A;  4UAJ A;  5D4R A;  1LQ1 A;  4RD2 A;  1OYY A;  3WBJ A;  1BN5 A;  3BOQ A;  2K3F A;  2H94 A;  2RKH A;  4AYB A;  3QPT A;  4AIJ A;  2K85 A;  3QOE A;  1XGO A;  3MQ0 A;  1WJ5 A;  2JWT A;  2LF7 A;  2X1D A;  3BTI A;  1HA8 A;  2ELJ A;  4C3I J;  2X3H A;  2K9S A;  2VT2 A;  2EJR A;  5C3E J;  4IZZ A;  4R79 A;  2ZFW A;  3CCY A;  3ZR8 X;  2XRL A;  5FRN A;  3S14 J;  1AHD P;  3CPX A;  5F0H A;  5F0C A;  1ENH A;  2IS6 A;  3F0C A;  3BR0 A;  1VLO A;  5EZG A;  3CD6 I;  2K9L A;  3CCJ B;  1QX4 A;  1DU6 A;  5GAD J;  3IKT A;  1W9X A;  1VLY A;  3B73 A;  3G2B A;  2IQ7 A;  1QNT A;  3CCE I;  2KL4 A;  3QOP A;  2RNJ A;  3OSF A;  1IJF A;  5F4O A;  4G7H F;  2MC3 A;  3B82 A;  5AN9 A;  2Z6B D;  1VND A;  4DGW B;  3OYI A;  4RD6 A;  4TMT A;  4HX4 A;  3C2G A;  1H0M A;  4S05 A;  1E62 A;  3A8J A;  4LC0 A;  2O0V A;  4YDT A;  1S72 I;  1FTT A;  3SYJ A;  3O2P E;  1P4A A;  3SFZ A;  2FVG A;  1S72 B;  4HE6 A;  2DMN A;  3T1B A;  2E36 A;  1WP6 A;  2L0K A;  1H9G A;  4EVI A;  3S1R J;  4IHX A;  5EGO B;  3CCM I;  3QFT A;  3VNV A;  3GQA A;  3CCM B;  4NK8 A;  2Q2E A;  2DA1 A;  3LFK A;  4MO7 A;  2FE3 A;  1IN6 A;  3WYA A;  5K7F A;  2GJK A;  3NWS A;  3TO9 A;  3W6V A;  1UHW A;  3FXU A;  3MEX A;  2KJC A;  1CNF A;  3CP8 A;  4OPO A;  2RGV A;  3BJA A;  4E4H A;  1KK2 A;  2COM A;  5GV7 A;  5LMZ A;  2L7M P;  2VT3 A;  3WNC A;  4XM3 A;  4ZDP A;  3LA2 A;  4NC8 A;  1MRZ A;  3O3K A;  2KJB A;  3BG7 A;  1XG1 A;  3LSG A;  1U3E M;  4HNV A;  4M3D A;  1Z05 A;  1TL8 A;  3BZC A;  2PMH A;  3G1M A;  4KIS A;  2KIM A;  1D5V A;  1H80 A;  4FQG A;  3GTO J;  5FJ8 J;  1DQU A;  4NC6 A;  3GLX A;  5KSW B;  3PET A;  1OPC A;  3JRH A;  3B8Y A;  4P1V A;  1N25 A;  3FK7 A;  5LEK A;  4G7W A;  2GA1 A;  2XAH A;  3EYY A;  3QP5 A;  2LKS A;  5EG0 A;  1W2B B;  4URR A;  3PJR A;  2NST A;  1R6R A;  3ASO H;  4R71 A;  3M3Y J;  4CH7 A;  1FYM A;  3GO5 A;  2W85 A;  1G3T A;  5HOD A;  3AVW A;  4IHV A;  3VFZ A;  1QFY A;  3T53 B;  3A2K A;  2XNC A;  3D0S A;  4E7L A;  4LLL A;  4AC0 A;  1XMX A;  5K7H A;  3W5H A;  2QXZ A;  3FBI B;  2VUM J;  1NRK A;  1QUE A;  3LST A;  1IV6 A;  1WU8 A;  3SEQ A;  4ZH4 F;  2B5O A;  4J0Q A;  4LFU A;  1NDH A;  2A5Y B;  2QZA A;  3BH6 B;  1Y1V J;  1JT6 A;  3G1L A;  2C78 A;  1SFX A;  4ZYD A;  1R36 A;  1DBG A;  3ZMU A;  3LQ6 A;  4UY8 I;  2QA4 I;  4OZY A;  3V8K A;  2YS9 A;  2WB1 N;  5C4J J;  1JE8 A;  1WI9 A;  2RNG A;  1R00 A;  4JYK A;  4ZTJ A;  1R22 A;  2L9N A;  1O8K A;  4BHP A;  1KA8 A;  1B8I B;  4PGO A;  3F22 A;  4KH3 A;  4RA2 A;  2O3F A;  3VYR B;  1MH4 A;  5D6E A;  1ZRC A;  3BH4 A;  3FZV A;  2LSO A;  4P3Y A;  3C2B A;  5M3F J;  2VBX A;  4C3J J;  3LMW A;  4UV8 A;  5M5W J;  2K3P A;  1BX0 A;  1UHM A;  2AQF A;  3TQN A;  1MH3 A;  4DJA A;  3JRE A;  3VOD A;  2BMW A;  3SZG A;  4BQQ A;  2ZTG A;  4PAB A;  2DA5 A;  4XIC A;  1CF7 B;  3W5V A;  4CHU A;  1R5O A;  2L3D A;  3QYB A;  1HCR A;  3BG6 A;  1EF4 A;  1DPU A;  1QVG B;  1POG A;  1YJN B;  2XGX A;  3FKJ A;  5IYC J;  1H8E A;  4KN7 X;  3DV8 A;  1Z9C A;  3RJP A;  4DNC A;  4X6A J;  2E1M B;  2PI0 A;  2H6B A;  2XIG A;  3A1Y A;  2EQR A;  2V5I A;  1RPW A;  3FXK A;  1N77 A;  2BVN A;  3K69 A;  1QZE A;  3GXO A;  5F6F A;  4LLN A;  3E6D A;  5TGT A;  2DMQ A;  2DER A;  4UVC A;  1O8E A;  4OPS A;  2LKX A;  1YW7 A;  2CRV A;  3EPZ A;  1QU3 A;  3KYL A;  3H94 A;  3I56 I;  2HQA A;  3I56 B;  2DFF A;  1Q9S A;  1XTA A;  1ZR2 A;  2JVH A;  2FEZ A;  3KP6 A;  4QTR A;  2KDO A;  4IO9 F;  1TNT A;  3HKZ N;  3W2A A;  1OFE A;  1R1U A;  1GQ8 A;  2ELK A;  4Y17 A;  1E3O C;  4PSW A;  1S9H A;  1NB9 A;  2Y0M A;  3H92 A;  4H4K C;  2VQH A;  3VSL A;  1IAW A;  4CCO A;  3A1P A;  3BC8 A;  2ZXJ A;  4M2L A;  3ERM A;  3H36 A;  1MMN A;  1TSP A;  5J8C A;  1DU0 A;  2D5V A;  2NRA C;  4G9Y A;  1AU7 A;  3WBK A;  4II3 A;  5C1C A;  2Z5U A;  1WJA A;  1HLV A;  4B1R A;  4WWC A;  5IOZ A;  2BM6 A;  3VEP A;  2X85 A;  2AXL A;  4IRH A;  1MIJ A;  5HKK A;  5GPA A;  2HZT A;  2VE9 A;  2G0Y A;  3JRC A;  1ZLJ A;  3I4P A;  2RN7 A;  3GZN B;  2HS5 A;  3RZD J;  3PNY A;  3BCA A;  3AGP A;  2X0L A;  2VBS A;  4OJO A;  4E7J A;  2CFO A;  3L2V A;  4NBS A;  2LK2 A;  3OOC A;  1PJ6 A;  2R92 J;  3L00 A;  5J6X A;  2ZTN A;  3W2F A;  3KP7 A;  3WOD F;  3E97 A;  4HNU A;  3NRV A;  5A88 A;  4WK8 F;  1NG6 A;  1OIS A;  2P81 A;  3L2W A;  2HOS A;  2DT5 A;  3FM3 A;  4BEH B;  1K9M D;  1RNL A;  1X1C A;  3W3C A;  4XBF A;  1KQ8 A;  1QRC A;  3BCD A;  3MKW B;  5JVT A;  2R7W A;  4KNY A;  1F1Z A;  2OBT A;  1Y56 A;  2YX7 A;  3CW2 A;  4JP0 A;  4F93 B;  3J7A O;  2BN4 A;  2P6S A;  2ZXW H;  2GQQ A;  4RCZ A;  2FNA A;  1WWX A;  2M0M A;  1IHM A;  2A6E F;  3REO A;  1IDZ A;  3HGG A;  1J9I A;  2ZXH A;  4N3G A;  3VSK A;  1YI2 I;  1YI2 B;  2Z3Y A;  2DFH A;  2X6O A;  1FOW A;  1MBG A;  3I55 I;  1I39 A;  2WY7 Q;  1BC7 C;  2ZC2 A;  1HW5 A;  2J5O A;  1MDM B;  1EA3 A;  1XGS A;  3F72 A;  3GTM J;  3U2R A;  1MND A;  2A5W A;  3H3Z A;  4A2U A;  4FTH A;  3GFI A;  1RRJ A;  3B78 A;  1KMH A;  1GVD A;  3HPG A;  5IOY A;  2R5Z B;  1K78 B;  3BCF A;  3BY2 A;  1MZB A;  3BZK A;  2XKO A;  3SEJ A;  3RSN A;  1D0Y A;  2PJR A;  2JT1 A;  3WTW C;  4ACA A;  3FWE A;  1HBX G;  1OFL A;  3GBG A;  2Y30 A;  4PGG A;  3K7A J;  2R4G A;  3GFM A;  3F6V A;  1I1S A;  5CVU A;  3U1K A;  1ACI A;  1UD2 A;  1MJ9 A;  2BW3 A;  1WJD A;  3Q39 A;  5ICE A;  2JMW A;  2L2O A;  5HOO A;  5HDK A;  3CDL A;  3C18 A;  3BTL A;  2A3S A;  3V7C A;  3KP3 A;  2VC1 A;  3JU4 A;  2ZZG A;  3KYC B;  3FHN A;  3OYF A;  1HST A;  1ZGW A;  1A31 A;  3K70 D;  3HTU A;  4YCQ A;  3KLO A;  1PJ7 A;  2EFQ A;  3RZO J;  1UD5 A;  3J81 K;  2HPI A;  2HKO A;  5GTH C;  4Z06 A;  1J75 A;  3CLQ A;  4MTD A;  2OU2 A;  5CQE A;  3OMY A;  1GDT A;  5HXB A;  5JLW A;  3W2G A;  3A02 A;  2ISZ A;  4Y33 A;  1XD7 A;  2KDZ A;  4P6Y A;  4LMY A;  5A89 A;  1JT0 A;  1FRN A;  4KA4 A;  5FFZ A;  5HZA A;  3JX8 A;  4EW9 A;  2YSR A;  3QU6 A;  2E1C A;  4ZJZ A;  4HF1 A;  2UVE A;  4HZF A;  4U0V A;  3V7S A;  4U87 A;  2OJE D;  6PAX A;  4UUV A;  3I59 A;  1UG0 A;  1KK1 A;  1OHH A;  2MA3 A;  2LKP A;  3LAP A;  2V6E A;  1FIP A;  4HF0 A;  4OP7 A;  3ZIA A;  3FY3 A;  2L9S A;  1UST A;  5D5V B;  5BOX A;  1MNM C;  1G59 A;  4PSX A;  1E43 A;  2VBT A;  4RB3 C;  5K7Z A;  1D8J A;  4K1X A;  1HW1 A;  1BQE A;  2WBM A;  3LQE A;  3PEN A;  1RKT A;  2Z99 A;  3CUQ A;  4BE0 A;  3MAJ A;  3TH0 A;  1SAU A;  2QSF X;  5LHI A;  3K70 C;  1WQ2 A;  1ZM3 A;  3F6O A;  2V9P A;  3DPL C;  2OK7 A;  3LNQ A;  1QFJ A;  5TRD A;  5KNL A;  4ASN A;  2R7U A;  1WJC A;  3K4L A;  3R6J A;  1OCZ H;  4IX7 A;  3KP5 A;  3BG3 A;  4KKT A;  2W48 A;  2R5Y A;  2F1M A;  1LE8 A;  2XPU A;  3ZRG A;  1WXR A;  3DBH B;  2JTV A;  5DV5 A;  2R7V A;  1VF7 A;  1ZGA A;  2Y48 A;  3OIP A;  2DFI A;  4D0P A;  4LG0 B;  4ZGQ B;  3MMY B;  1PYV A;  3MZ8 A;  4B47 A;  3T8R A;  3ISP A;  2F4N A;  3Q0U A;  2M2E A;  1DPR A;  2QQA A;  3LSK A;  1J9Z A;  3S32 A;  5BMZ A;  1K4T A;  3T56 B;  5F08 A;  4CCL A;  4EM1 A;  1ITY A;  2F4O B;  4D7N A;  4L5E A;  3CUO A;  5JBQ A;  3O6B B;  1B72 A;  1XC5 A;  4M53 A;  2D3L A;  4U88 A;  4RM0 A;  3FK6 A;  1VQK I;  4V2F A;  4A93 J;  1CZF A;  1DDI A;  1EP2 B;  3K9T A;  1V55 H;  1A04 A;  2LOO A;  1GT0 C;  1ZRF A;  3ZBU A;  3WTT C;  3OYM A;  3WU0 A;  4QVA A;  4DQL A;  3PIO F;  3KET A;  1FNB A;  4WZK A;  3CDI A;  5CKT A;  4EMS A;  1U2W A;  1XCB A;  4RS8 A;  3GZ6 A;  2L4M A;  5ILS A;  1W34 A;  4BJ5 C;  2ZME B;  3IH4 A;  3U2Q A;  3AG4 H;  1YG2 A;  2DCU A;  1K7A A;  4WCG A;  2CQQ A;  3DPT A;  3A3B A;  3HOZ J;  2O04 A;  1JKR C;  5C44 J;  1BR4 A;  1TYU A;  3WXM A;  1SD5 A;  2LYC A;  2VBZ A;  2KT0 A;  4ESB A;  3H1C A;  3LSR A;  1XE1 A;  2B7C A;  3ASS A;  1PUF B;  2BM1 A;  3KCC A;  4RLF A;  4W8T A;  3FKI J;  1W7P B;  4MLO A;  4YEI A;  2VNK A;  4RMN A;  3BH7 B;  1TWF J;  3F8N A;  4R8H A;  4X1E A;  5LHG A;  3Q9S A;  1K79 A;  1TQI A;  2Y2Z A;  3HOX J;  5IT3 A;  3MZY A;  4I01 A;  5A2Q K;  1O8M A;  5HLI A;  2DOG A;  3S2W A;  5E1X A;  3CC7 I;  4LK1 F;  5EEG A;  2NS0 A;  4RM3 A;  3U6K A;  3CC7 B;  2HXI A;  1FOY A;  4J19 A;  4BQN A;  5BS6 A;  5F0F A;  1MMA A;  1SKY B;  2ZZQ A;  3I64 A;  4BUP A;  5IYR A;  5EEA A;  4RDL A;  2W7Z A;  4OZZ A;  3RKY A;  5E17 F;  1XGM A;  1ETY A;  1XN7 A;  5E3L A;  2NVY J;  3LA3 A;  4II2 A;  3AL0 B;  3RYR A;  2MFZ A;  2Q6L A;  1FND A;  1I8D A;  3Q6R A;  1ZAO A;  4UVB A;  3PO3 J;  2NTB A;  1MMS A;  2GZW A;  1D2E A;  3VMW A;  1QRY A;  5ICG A;  1VQP I;  4BQO A;  1QUF A;  1IJW C;  2X0K A;  1VQP B;  2TCT A;  3VYU B;  3MZH A;  3TDZ C;  1N08 A;  4MFE A;  1I5Z A;  3I53 A;  1I6H J;  1NHC A;  2BY0 A;  1BHE A;  3KEY A;  4B3A A;  1ZTR A;  2BY1 A;  4ZYH A;  2EFN A;  5F64 A;  3M07 A;  5F1R A;  3BPX A;  2XRN A;  4BBR J;  2XKP A;  3AGQ A;  2K4B A;  1WPC A;  1V4R A;  4ZV4 A;  3I58 A;  1VFC A;  2HNH A;  3VDX A;  1R49 A;  2HOT A;  4OIQ F;  5IYQ A;  4NQW B;  3IH3 A;  5IYN A;  3KRG A;  4Q4Z F;  4FCY A;  3K4C A;  5DD4 A;  4L9J A;  1EH7 A;  3B8H A;  3RKW A;  1WH5 A;  5CJ9 A;  4ANJ A;  4LB5 A;  1ZKG A;  2JSC A;  2PLF A;  1IUF A;  4CZC A;  3GRH A;  1B23 P;  1W5T A;  2CQX A;  1QGY A;  2QF7 A;  3O8G A;  4B8X A;  2KVO A;  2DU9 A;  1G4D A;  1SMT A;  4EAT A;  3G73 A;  1X2M A;  1GV5 A;  3S1N J;  1Y6I A;  2EB7 A;  5HLH A;  2AS5 F;  2RDP A;  3K4B A;  1BA5 A;  2Y69 H;  4IEJ A;  4I99 C;  2W57 A;  3QPL A;  1XMA A;  2V1U A;  5FLX K;  1RU4 A;  3JTG A;  1CGP A;  4XLE A;  4YZ0 A;  2XGD A;  4ZGN B;  1EP3 B;  2EIK H;  3RQI A;  1RR8 C;  2F43 A;  4FIS A;  2XEX A;  2OBS A;  4PC1 A;  4L9N A;  2DDA A;  2ZZE A;  3L2Q A;  5D5U B;  1X19 A;  5C1E A;  3HUG B;  1G7S A;  4RLZ A;  2HR3 A;  2O03 A;  4C9Y A;  2E1N A;  1RET A;  2H8R A;  2BSA A;  4XKC A;  4NC7 A;  1H42 A;  4XR6 A;  3WHC A;  3WGI A;  2HCJ B;  5IT9 Z;  2EIN H;  2DA2 A;  4Y15 A;  2LMD A;  1IN7 A;  1ZG3 A;  1J09 A;  2L9R A;  3D5S C;  4B44 A;  4LIV A;  1DP3 A;  1QA6 A;  3H3U A;  3TOA A;  2IOU G;  3DTI A;  4U0Y A;  3A0B C;  4PUS A;  3BR5 A;  3ZP5 A;  1U8B A;  4L9T A;  4A3L J;  3GX4 X;  1O7L A;  2E2H J;  2Z2S B;  1X58 A;  1QVU A;  2IW5 A;  1TWH J;  3PO2 J;  4F7D A;  2VPL A;  1T8I A;  2JA5 J;  4TMZ A;  2FSW A;  2MD0 A;  2QE7 A;  1OKR A;  2OZ6 A;  4XL9 A;  1V0F A;  3WND A;  1MBJ A;  1VQ7 I;  4PZJ A;  2GIV A;  2XAJ A;  1BW5 A;  1VQ7 B;  4NNJ A;  1F9N A;  1RI7 A;  2W24 A;  2F48 A;  4CCN A;  2NV4 A;  2XZL A;  3JRA A;  2CW8 A;  2CO5 A;  1D1C A;  2DA7 A;  4HNT A;  3AVU A;  4QPQ A;  3BG5 A;  5E1Z B;  3ZQG A;  3IRR A;  4CO8 A;  5JR3 A;  3GWZ A;  4PGH A;  2ICW G;  1ZLK A;  5B3S H;  1M1E B;  2OA4 A;  4E7K A;  2AQE A;  1RIO H;  1ZAR A;  4CZZ A;  2C4U A;  4G12 A;  2DMU A;  2GAU A;  2ZJ2 A;  2XZO A;  2Q2E B;  4ACB A;  5D8K B;  1BOA A;  3JAM K;  2VKH A;  4RAF A;  4ZZD A;  1MNE A;  1SVO A;  1LFP A;  3HJE A;  1G3S A;  3JCU C;  5AIQ A;  2XB0 X;  3DEU A;  5FKN A;  2M7B A;  2XPV A;  1F36 A;  1PXZ A;  3QAH A;  1RQR A;  1RKW A;  1JJ8 C;  3IC7 A;  5ILU A;  3CCQ I;  1XB4 A;  3CCQ B;  2EPF A;  2BM4 A;  3JRB A;  2OD5 A;  2QKM B;  2CK3 A;  4YZQ A;  2FQ4 A;  1QJV A;  5CLS A;  1VQ8 I;  1MMG A;  2XC7 A;  3V76 A;  2NTQ A;  4PCQ A;  1X3Z B;  5FKK A;  2HU9 A;  1P92 A;  2M8G X;  2DPU A;  2DOF A;  3FMR A;  4ENM A;  4IKF A;  1R5B A;  4M4S A;  5BSY A;  3P26 A;  3DTK A;  1VQ4 I;  4CYC A;  1VQ4 B;  3M1E A;  2WR8 A;  5FRM A;  3OW2 B;  3E5X A;  4A12 A;  1HC8 A;  3KEO A;  1HVX A;  2TRT A;  2KKO A;  3OSG A;  3SXY A;  3HXL A;  1IXS B;  5EG0 B;  2BHY A;  3R61 A;  5DYM A;  2ID6 A;  4PJN A;  4BHC A;  5DSZ A;  4UHT A;  1UD6 A;  3SKB A;  2O5R A;  3EUH A;  2QY1 A;  4XLN F;  4PC2 A;  1HQC A;  2L54 A;  2Y0S N;  3ABM H;  4YII A;  2V26 A;  1KK0 A;  3ZQ7 A;  1TYW A;  4RBO A;  1R7J A;  2XF5 A;  4HSR A;  3S3M A;  2XGJ A;  5E3O A;  1V54 H;  3OYC A;  1BJK A;  3LSH A;  3GLL A;  3ROU A;  3ZZU A;  2LBF A;  2XOK A;  1RMG A;  3TP0 A;  3OJW A;  1NG7 A;  3RPU D;  4UV9 A;  1OCC H;  2YX4 A;  2H8W A;  2VKE A;  1SFE A;  1ZG1 A;  1EXM A;  5M5Y J;  3SZP A;  1LNW A;  4UUS A;  4JX6 A;  3KP4 A;  3PUB A;  2PFB A;  5HDN A;  1YOV B;  3RKX A;  4XD7 A;  1FPQ A;  1TW3 A;  1KGS A;  4G8X A;  2PQ8 A;  5EJC A;  5L3F A;  4AIK A;  4K2E A;  4ZCL A;  2V7F A;  4NDL A;  2XVC A;  3HAG A;  4YAF A;  4OJ6 A;  4AC9 A;  1KZL A;  4CSW A;  2WAQ A;  3BTJ A;  2AXT C;  2PIA A;  1SFU A;  1M1K D;  1D1B A;  3FHZ A;  1MJB A;  1JGG A;  5JHU A;  3HB9 A;  1OCP A;  2XUB A;  5KAF C;  4Z4Y A;  1FNN A;  4MNU A;  1OCT C;  3PUM A;  3FXJ A;  5TIS C;  3N6Z A;  1YIT I;  3DKX A;  1EH8 A;  3OR2 C;  3S8P A;  3PSI A;  5LD2 C;  1A5J A;  1YIT B;  2C5H A;  4L18 B;  2V4D A;  1FBU A;  3NB2 A;  2A68 F;  4RB2 C;  2DOD A;  2VPR A;  1BJA A;  1E17 A;  1YX5 A;  1HKQ A;  3R0A A;  5CVJ A;  1PUE E;  4RD3 A;  1K4S A;  1MSF C;  3GZ5 A;  3ECH A;  2EZL A;  2P4W A;  1ELO A;  4P12 A;  1OYI A;  2JPC A;  3OYL A;  4YFK F;  2IA2 A;  2LLK A;  3Q38 A;  2G9W A;  2AHQ A;  4F55 A;  5IYW A;  1UEL B;  3DF8 A;  3K2A A;  3CPW B;  2HQN A;  2YWF A;  4P26 A;  5JLV C;  1LDJ A;  4N3N A;  1XSX A;  4HX7 A;  4MQV A;  2BVM A;  4O6J A;  5FL7 A;  1WFX A;  1TTY A;  5E18 F;  4OOI A;  1K5C A;  3HYI A;  4HLY A;  4U49 A;  3ML3 A;  4B48 A;  5HZB A;  1TQM A;  4IF4 A;  3EUA A;  3IL2 A;  5FKO A;  2GPJ A;  2IT0 A;  1P9Q C;  3ML6 A;  2KRH A;  2LR8 A;  2Z16 A;  4WX9 A;  3N4M A;  5DUI A;  2FXA A;  4FT8 A;  3CCJ I;  2I10 A;  2M3A A;  3KZI C;  3RKQ A;  3AAF A;  5D5W B;  4YZX A;  2NS8 A;  3OJX A;  2L7K A;  1DAR A;  2RV8 A;  3BG9 A;  3U1D A;  4PC6 A;  3BP8 A;  1LUJ B;  3P9K A;  2KFD A;  4HAM A;  4XKB A;  3ZQL A;  1QFZ A;  2WTE A;  2B9S A;  2C4T A;  3OW7 A;  2FF4 A;  2GOM A;  5FA6 A;  5K5Q A;  1HF2 A;  2INV A;  2PN6 A;  2HQR A;  1UFM A;  2FOW A;  5J4Y A;  2MYS A;  4YIF A;  3D5L A;  4EJW A;  1R5I D;  1V0E A;  3ZZ0 A;  2Y75 A;  1E63 A;  1NTC A;  4MR0 A;  2LFB A;  3KEQ A;  3DFG A;  3CTA A;  3CES A;  1JA0 A;  4Q5S F;  3K6G A;  3W2W A;  4HIZ A;  4LBZ A;  4M3B A;  2RVC A;  4BHB A;  3JRF A;  3J7Y J;  1T6S A;  2P5L C;  4E0F A;  1LJ9 A;  4N4N B;  2CU7 A;  4ZCM A;  3UR3 C;  2DTZ A;  4J01 A;  1Z3Y A;  2VFO A;  1LVK A;  1MSE C;  2O9L A;  2QZ8 A;  2RQQ A;  5DN6 A;  2DOE A;  1R58 A;  2O61 A;  1D1A A;  1NJI D;  2ACJ A;  3LYC A;  4YZA A;  2DJI A;  4LBY A;  2M87 A;  4Z6Y A;  3OPO A;  1WI3 A;  2W6I A;  3OIO A;  1U5T A;  1HKS A;  3FF5 A;  1W87 A;  4P9S A;  5E79 C;  3L09 A;  1BW6 A;  1KU9 A;  3LSP A;  4OIO F;  1H9T A;  2D45 A;  3BJO A;  2DYR H;  2HDN B;  4QIW N;  3A01 A;  4PMH A;  1WJB A;  1D1N A;  1WGX A;  4RPD A;  4YG2 F;  1Q81 D;  1U5T C;  2YR2 A;  3IUO A;  1FMV A;  2CUZ A;  2E35 A;  4Z4W A;  4BXX J;  2PJR B;  4KT6 A;  1ETX A;  2BY3 A;  3ELK A;  2R7X A;  1H8H A;  1E3P A;  2WA0 A;  2X51 A;  1KZH A;  3CMM A;  1KU3 A;  1P7I A;  4Z03 A;  4Y13 A;  2IS4 A;  3HOT A;  1E1R A;  3GEZ A;  5H5J A;  4HOB A;  1Y8Q B;  5GTI C;  3GTG J;  2F4I A;  2BW3 B;  2JSP A;  4IJA A;  5C4X J;  1GAQ A;  3EQL F;  3G3Z A;  1W36 D;  3PUF A;  4KMU X;  4B3X A;  2QCO A;  2VBK A;  2FBH A;  2MG4 A;  3ONY A;  1I27 A;  2P5V A;  3DKW A;  3SQN A;  4DNR B;  4MQ9 F;  5CVR A;  4XRS A;  1WKM A;  3OR1 C;  3CO6 C;  1Z67 A;  4M73 A;  3GVL A;  1KCD A;  3DEW A;  9ANT A;  3C3W A;  5DEQ A;  2ID3 A;  1OFD A;  3RI4 A;  4BS9 A;  5FRO A;  2WAE A;  1TVC A;  4X7E A;  5J1R A;  4LB6 B;  2PMD A;  3LQQ A;  1PP7 U;  3GQB A;  1CLW A;  3R60 A;  2VJI A;  4U0W A;  1VHE A;  5B5E C;  5BPI A;  2VB6 A;  3BR1 A;  3GW2 A;  4CQJ A;  3I59 B;  1OQY A;  2EIL H;  4M9Z A;  1YJN I;  4BBS J;  4HDV A;  1HDD C;  2P5K A;  1EH6 A;  2KIS A;  3ZPP A;  1BI2 A;  1B59 A;  4HPQ A;  3R0J A;  3TW6 A;  1KTV A;  2PYH A;  1QPI A;  5FB2 A;  4E7Z A;  3HTS B;  1H88 C;  1XSV A;  3TW7 A;  1R23 A;  1W36 C;  4XLH A;  1Z77 A;  3CUQ B;  4N9H A;  4CCK A;  2DN0 A;  1T6Y A;  1QGP A;  5FO1 A;  5A8A A;  2QSG X;  1SD6 A;  4UZF A;  1ZG5 A;  4I2O A;  1JJ6 C;  4Z4T A;  2DK5 A;  3BC9 A;  4WWV A;  1DP7 P;  2HMA A;  4A0X A;  1FYK A;  4RAY A;  4A3J J;  2KP6 A;  3MMP A;  1LKX A;  3L1P A;  3B90 A;  1DDG A;  1IW7 F;  3F8C A;  3JW4 A;  3GTL J;  2HVS A;  3CQZ J;  1YRN A;  1VF9 A;  4HLX A;  3V42 A;  5FO0 A;  5DM6 F;  1S6L A;  3WNB A;  4KFC A;  2STT A;  2DEU A;  2W25 A;  2D9R A;  1WPK A;  5DM7 F;  3VYT B;  2R7Z J;  2CG4 A;  4O3M A;  2P7C B;  2V9V A;  1ETK A;  1QGZ A;  1TBX A;  2JA2 A;  4PC3 A;  1IB4 A;  4D1Q A;  4ZCI A;  2ESH A;  4L5I A;  3G71 I;  2V79 A;  1VQ6 I;  2ZJR F;  2X9D A;  3G71 B;  1VQ6 B;  1QQ1 A;  2NZM A;  2VBE A;  3DU1 X;  5LGN A;  1IDY A;  4UNO A;  1SMY F;  5LLQ A;  4DK0 A;  1YLO A;  4A0Y A;  3QWL A;  4HW0 A;  3OEE A;  5J47 A;  2O0W A;  1QCX A;  4F3Q A;  1RWR A;  3QPH A;  3VB2 A;  4AID A;  4RD1 A;  4WXC A;  3C1D A;  2WSS A;  4LBV A;  4E7H A;  1N8R D;  5FFX A;  1WCM J;  1P2F A;  2E5Z A;  2MW8 A;  2E1O A;  3TO7 A;  1AKH A;  1OMI A;  1Z7U A;  3GTQ J;  2OZU A;  4QUZ A;  4ESF A;  5L3E A;  3JRG A;  1BJZ A;  2EBI A;  4HV6 A;  2DAO A;  1MJA A;  3RIR A;  2JA7 J;  1YQA A;  4WXD A;  2F5F A;  3UKG A;  4S04 A;  4LOC A;  1HW2 A;  2C6Y A;  4YAO A;  2JA6 J;  4NUB A;  1YE9 A;  1BR1 A;  1O3T A;  1BM9 A;  2A6T A;  1YO5 C;  2DT7 B;  4ENN A;  2PMU A;  4WXH A;  1ZHF A;  1N06 A;  3GQ8 A;  2RAE A;  4PC7 A;  1SKQ A;  1HOM A;  2EIJ H;  3BQJ A;  2EV5 A;  1O8H A;  3ULQ B;  5EDN A;  2MH9 A;  2FRH A;  1WOP A;  5EGO A;  4KMF A;  2O6W A;  3N90 A;  2V6C A;  2JJ7 A;  3VSU A;  2K4J A;  3LQR A;  4OJP A;  5IYD J;  3EUK L;  2VBU A;  2VBY A;  1LFB A;  2LNB A;  5CQG A;  5DCF A;  2R7R A;  1TC3 C;  4RD4 A;  3ZQF A;  2CW0 F;  1Y1W J;  1LM1 A;  4A0Z A;  3ZCO A;  1XPX A;  2Y9Y A;  2L4A A;  1N05 A;  3VMV A;  2TDX A;  4ETS A;  1OB0 A;  1R5G A;  3OS0 A;  1D5Y A;  3VNU A;  4UB8 C;  4EJV A;  1KK3 A;  3GSI A;  5CVV A;  5B1A H;  1K83 J;  1PE9 A;  4GQN A;  3K4J A;  4RJL A;  5HDG A;  1GXP A;  2QQ8 A;  2VLA A;  2R7T A;  4F52 A;  1JTA A;  3IWF A;  4U4B A;  1LEA A;  2DDB A;  2CMP A;  4UZE A;  5M3M J;  1OR7 C;  2HVQ A;  4FWT A;  3J81 k;  2WB1 A;  4HYE A;  1L1I A;  4AVZ A;  3HRT A;  1IF1 A;  5J35 A;  2LDU A;  3QYF A;  2GA2 A;  1UD3 A;  4BYY A;  2GIZ A;  2D1H A;  5KCM A;  1OFM A;  3CCU I;  3J80 Z;  2J8K A;  3CCU B;  2H1L A;  4L5J A;  3LOC A;  3IV5 A;  1FC3 A;  3QE2 A;  2KIU A;  1XCV A;  4C2U A;  1G8X A;  4RB0 A;  4Q7J B;  2OCC H;  1JKP C;  2QQB A;  4UUT A;  2KZG A;  2OC6 A;  3G6E I;  1XB2 A;  3G6E B;  5L3G A;  2V1X A;  2P7V B;  3IRQ A;  2LD5 A;  2OQR A;  3A3G A;  1OCO H;  3JQQ A;  2I1L A;  2DFE A;  3ABK H;  3T0Y A;  2D1V A;  3U21 A;  2YWE A;  4OIR F;  3ZSC A;  2M30 A;  1AWC A;  1UD4 A;  2FML A;  1QHH D;  1B8I A;  4BNC A;  2X4H A;  3PVD A;  4M3F A;  3FMS A;  1H85 A;  3A8K A;  4BE1 A;  2H6C A;  4XQF A;  2ME0 A;  1MBF A;  5ED4 A;  4LGW A;  2KPM A;  3WG7 H;  1VQO I;  1VQO B;  3HHH A;  2MLG A;  4B4D A;  1OB2 A;  2YUH A;  1Y8R B;  3PSS A;  4IHT A;  3I4M J;  2NXN B;  3RY8 A;  1IO2 A;  2ESN A;  2NNY A;  2VZL A;  3L2C A;  4GRI A;  5GV8 A;  3F23 A;  2L5Q A;  3CCR B;  3G05 A;  4YIR X;  1ZYR F;  3SYT A;  4CUG A;  2QM3 A;  2X53 S;  2D3N A;  1QQI A;  3JTH A;  1JTY A;  3OOU A;  1B1B A;  4TT3 A;  5CYV A;  2QBY A;  5IY5 H;  1S7A A;  2JQ7 A;  5AMV A;  4Y9U A;  3DTE A;  2HDD A;  4PAA A;  4XLA A;  1T56 A;  1I18 A;  1Q1V A;  1T6Z A;  3M8E A;  2OTL B;  3U6B A;  3KPH A;  4PFP A;  5JHF A;  3DPU A;  1B6A A;  5H2F C;  2Q8K A;  2BX6 A;  2DK8 A;  3OIQ A;  4GYI A;  4RM2 A;  3ZZT A;  3GYH X;  2PEC A;  4UVA A;  3BR2 A;  2X6Y A;  3FPK A;  1NK3 P;  4IVN A;  4A3E J;  1A8P A;  2YUS A;  2ZNY A;  3E1Y E;  4PDK A;  4YAL A;  2PMZ N;  2EZI A;  2K5C A;  2PG4 A;  1U0J A;  2NPF A;  2L01 A;  2ZL5 A;  1A36 A;  1SFK A;  3ES9 A;  4ZYA A;  2L9V A;  1R5H A;  1FSE A;  2R7S A;  1SD7 A;  3AG3 H;  1X1A A;  3V7A A;  1MW7 A;  4XLP F;  4A3C J;  2ZO4 A;  4ZYG A;  2DI3 A;  3QYE A;  4OU0 A;  3W2H A;  3PM1 A;  2LP0 A;  3SUC A;  3RIQ A;  2MH2 A;  1I3A A;  2VON A;  2BV3 A;  2HZD A;  3TL4 X;  3HRM A;  4OOS A;  3I3L A;  1IRX A;  2R7D A;  1BIB A;  1U9O A;  4KUM A;  3AG1 H;  4I0B A;  1LPQ A;  3BRO A;  1EJ9 A;  3DU5 A;  1OGI A;  1YTY A;  4C0S A;  4I0A A;  3NQO A;  2QTL A;  3WGH A;  4DQK A;  2VKV A;  1B9M A;  3HSE A;  3K2Z A;  2DPD A;  4CDG A;  5J1Y A;  2ZB9 A;  3OY9 A;  5JI6 A;  1OGM X;  2Q6I A;  3TBI A;  1IRF A;  1W5C C;  2XRO A;  1IDJ A;  3KIO A;  4EM2 A;  3F8F A;  1GLN A;  4BEH A;  3TED A;  4U9U A;  3FXQ A;  1SAX A;  4JX5 A;  5KAI C;  3N05 A;  1X3U A;  3ABL H;  1G3W A;  4ESJ A;  4L8J A;  2JVG A;  4XN0 A;  4XK4 A;  3W2V A;  1IC8 A;  3W5U A;  5J3O A;  4I98 B;  2EFO A;  4AIH A;  3FM5 A;  3GTJ J;  3E1S A;  2DO7 A;  2KHM A;  3OZV A;  4XOR A;  1X1B A;  2OPT A;  2QVO A;  1MMD A;  4FHT A;  5D6F A;  1PLU A;  1XSD A;  2QUF A;  1BBY A;  4Q48 A;  4OMY A;  1GVJ A;  2HEO A;  4RAZ A;  2JK3 A;  3LAJ A;  1RR7 A;  4OWR B;  3E6M A;  2V1N A;  4W97 A;  5JVG F;  4KDP A;  5AIP A;  2QGG A;  3JQR A;  2HI3 A;  2KIQ A;  3FBN B;  4Y4R A;  3FIW A;  4D7M A;  2VAS A;  5KW9 A;  4LBW A;  2WPD A;  3E6B A;  2CW5 A;  1VZ0 A;  2LBF B;  4DQ2 A;  1CNE A;  1YS7 A;  1FEX A;  4F91 B;  2R5Z A;  1K78 A;  1QBJ A;  4CGZ A;  1ONV A;  3BY6 A;  4Z1M A;  1Y39 A;  1YW9 A;  4UZU A;  4PK4 A;  4UUS B;  1W0T A;  2QYU A;  3SQV A;  1XG2 A;  3DBL B;  4G6Q A;  3QP6 A;  5HLT A;  2O17 A;  1UG2 A;  3ASQ A;  2EV0 A;  3GVA A;  4Z4V A;  4XRM A;  4N9I A;  5J3L A;  2ZCW A;  2O7O A;  2RRE A;  1K6Y A;  2GJR A;  1O88 A;  4F92 B;  1ZK8 A;  3G1O A;  4G7O F;  1D3Y A;  2MGQ A;  1T0F C;  1ON1 A;  3E7L A;  4BJT A;  3E20 A;  2VFN A;  5FLV A;  3JRI A;  5FO5 A;  4P96 A;  3D26 A;  2DIE A;  3LNN A;  1WJF A;  2BV6 A;  3PSF A;  1UCR A;  5DUK A;  1V5F A;  5IYB J;  2EWN A;  3OYG A;  3HL2 A;  5ILV A;  4ZDO A;  3H3V K;  4X8I A;  3VPR A;  1ZQ3 P;  2DY1 A;  3BLY A;  3ZGK A;  3CMY A;  3AVT A;  4BGD A;  1WSU A;  2BY2 A;  2QX3 A;  2VBW A;  4ENJ A;  1WH7 A;  2V7Q A;  2KMU A;  4G6T B;  2RC4 A;  4OJ5 A;  5CDF A;  1E2X A;  5E1W A;  2L7Z A;  1W0K A;  4DZP A;  1GJR A;  3NAR A;  3V8J A;  1GV2 A;  1Z6R A;  3ZN0 A;  3KX2 A;  2CJJ A;  1WRJ A;  4P5O A;  1OJL A;  2LC2 A;  4L0Z B;  1Q7Y D;  2VIX A;  4KKS A;  2BZT A;  1R4M B;  5J4V A;  1BPL A;  1O8G A;  4KIF A;  5H6R A;  3VR6 A;  2MC4 A;  2YU9 J;  2M9H A;  4N4O B;  3PFI A;  3K0L A;  2NS7 A;  1WDT A;  3EYI A;  1IDK A;  1EV7 A;  5IPA A;  2OV7 A;  2JRT A;  4GGG A;  4ZC3 A;  1GUU A;  5H6Q A;  3D1N I;  3NEU A;  3SDG A;  4BDY A;  4BXU A;  4Z4R A;  3CME B;  1JNY A;  2K40 A;  2BPO A;  2NSP A;  2V9K A;  1H89 C;  4AYB N;  4U7D A;  3BPV A;  4KIB A;  2OTJ B;  4X7D A;  3CO7 C;  3E5U A;  2QQ9 A;  4LG0 A;  3TP3 A;  1PKV A;  4HE5 A;  4IOC F;  2IGN A;  2XGC A;  5GAE J;  1DUX C;  3SZE A;  3GFL A;  3OOP A;  1VBL A;  1WTH D;  3R6K A;  2F5V A;  1BIA A;  4BE2 A;  3ONU A;  2B63 J;  3CF5 F;  3T8T A;  3PUN A;  4M9X A;  1A35 A;  2JUG A;  1IRZ A;  1E64 A;  2EA4 A;  3P4G A;  2W82 A;  1GR1 A;  3WHB A;  2DW4 A;  3CXC B;  1BL0 A;  2CFX A;  3A4C A;  4Z4U A;  4RLQ A;  3H9N A;  4EQQ A;  1PDN C;  1ORK A;  4RD0 A;  2VBV A;  4ZYE A;  2HDC A;  2WV0 A;  2DA3 A;  3E5Q A;  1F4K A;  2NAZ A;  1FOX A;  1KC8 D;  2BXY A;  4CA0 A;  1MAB A;  2JN6 A;  2O8X A;  1TT0 A;  4C43 A;  4KIT B;  2ZME A;  3WTX C;  2BSP A;  1Y0Y A;  1N78 A;  1VQL B;  1UB9 A;  1KQ0 A;  3OL3 A;  4Y7N J;  1PP8 F;  1BC8 C;  3W2E A;  4L0Y B;  3LSI A;  3VOE A;  1D8K A;  1IN8 A;  2Y31 A;  2ZSH B;  2EZK A;  5GP9 A;  2IP2 A;  2JA8 J;  1U5T B;  2X6X A;  1FSH A;  1E3Z A;  2F1L A;  1QPM A;  2V7V A;  2ZME C;  4EJU A;  1EKE A;  1PVE A;  1K4Z A;  3OEH A;  2IAI A;  1PUF A;  2G0E A;  1U9N A;  4XRF A;  1RUO A;  1E0E A;  2ZL6 A;  4QV2 A;  2V31 A;  2UV1 A;  3TO6 A;  1MKM A;  3A01 B;  2ZZF A;  2IPQ X;  4YAU A;  5HS7 A;  3QRF F;  4O5V A;  4N0B A;  3VMF A;  5IP9 J;  3ZQC A;  4Q47 A;  1ETO A;  1OLT A;  1S8N A;  3OYN A;  4RDJ A;  1X1P A;  5ICC A;  2B7B A;  1LVA A;  1L3L A;  2PE3 A;  2F5D A;  1EFU A;  1G7R A;  3TKY A;  3TDU C;  4FX4 A;  1ZGJ A;  2X6W A;  2VOD A;  2IGK A;  1KU7 A;  1Y0U A;  2AHO A;  4M71 A;  1IRG A;  3Q0W A;  5KVR A;  1E3H A;  5HS8 A;  4TKO B;  1M90 D;  4YFX F;  1SVM A;  4LIU A;  2F5C A;  4YAW A;  1VQM I;  4BL0 B;  1Z21 A;  2OQG A;  3DP7 A;  1VQM B;  3OYJ A;  3QQA A;  1ZH5 A;  2QDX A;  4WZE A;  3JUR A;  2GRE A;  5K5O A;  1O4X A;  1TLL A;  4IHS A;  2XPW A;  1T6X A;  4LIT A;  3FKS A;  4MYU A;  4A3G J;  4HDU A;  5IP7 J;  3NAW A;  3HG9 A;  3ONQ A;  2ZSI B;  1D8T A;  3LO8 A;  3ZC3 A;  3IAS 2;  4G1B A;  1W0U A;  2V1D A;  3KZZ A;  3CJT B;  4CXF A;  5TR9 A;  3F9K A;  1DBO A;  3CC2 I;  2W00 A;  2O8K A;  2HFH A;  1FX7 A;  3OZW A;  3CC2 B;  1TQP A;  3TMO A;  1BI0 A;  4S0H B;  1W0J A;  2E5N A;  4V2G A;  2ME6 A;  3QFR A;  2UXX A;  3CCS I;  4MFD A;  1E3X A;  4G1V A;  3CCS B;  3VO1 A;  3HEF A;  3RYP A;  1GHC A;  4AUX A;  3MN2 A;  4B43 A;  1O8F A;  2UVF A;  4A69 C;  5IT9 K;  3RPU A;  3HOW J;  5F4M A;  3ASP A;  4CIC A;  1UJ8 A;  4A3K J;  4A6D A;  4YEJ A;  2XTW A;  3CJR B;  1QA1 A;  4U7B A;  1J5Y A;  1Q1H A;  2XSD C;  4FK8 A;  1VHO A;  3T9G A;  1S7O A;  4JQF A;  3ECO A;  2M4G A;  1ODD A;  3BJ6 A;  4P2N A;  1I7P A;  2BM0 A;  2DA6 A;  2VN2 A;  1I3Q J;  2LVS A;  2X1E A;  3S15 J;  4YHB A;  3CLO A;  1MBK A;  4G6D A;  5DNS A;  3LJY A;  4LLG F;  2E34 A;  2ELH A;  3Q9V A;  2QSH X;  2J8I A;  1MGT A;  2EFG A;  1RES A;  3KFW X;  2XT2 A;  2MD5 A;  1O3Q A;  2YU3 A;  2HWV A;  3GME A;  2M34 A;  3Q0V A;  3RQ4 A;  1G3Y A;  3A0H C;  3QPS A;  3QSY A;  4KN4 X;  5J1U A;  1FNM A;  2GLO A;  2GWR A;  2QLZ A;  4IXA A;  1RZ4 A;  1SM4 A;  2WYR A;  1YIJ I;  3VO2 A;  4TV7 A;  1YIJ B;  3FXO A;  2W7N A;  4ITV A;  2BM5 A;  3S93 A;  3ZOB A;  2M0C A;  1O7F A;  2MSY A;  2E7W A;  3OYD A;  2PX9 A;  2UUZ A;  3HM5 A;  2NOJ B;  5LRR A;  4XID A;  3G4S I;  1V5V A;  4G7Z F;  1WSR A;  3G4S B;  3MHP A;  3ZMS A;  3F8B A;  1GVH A;  1JUS A;  3ASR A;  3KL9 A;  3PNT A;  3JR9 A;  4YFO A;  1G7C A;  3JSO A;  1KCC A;  3WU2 C;  5EEH A;  4QVJ A;  1JJ2 B;  3EQN A;  1P4W A;  4KT5 C;  1QZY A;  1U6G A;  2FNP A;  2BXZ A;  1LDK B;  4OAY A;  4XLF A;  4LK0 F;  2R93 J;  2FOK A;  2LH9 A;  2CF4 A;  1AKH B;  4M0L A;  4I84 A;  4M6X A;  1OCR H;  4AF7 A;  4BY7 J;  1P6R A;  2CGP A;  1ETQ A;  1WJE A;  3CD6 B;  2UXN A;  3HGY A;  3KEW A;  4OPV A;  3BDD A;  4ON0 A;  1ZM9 A;  3KYD B;  5HLG A;  5B6I A;  2GJP A;  3CCE B;  3LWF A;  4OPW A;  1S29 A;  3WWG A;  5D5X B;  3GVK A;  1O8L A;  2DQL A;  3L2R A;  5ICF A;  2XND A;  3EET A;  3GIR A;  3IWZ A;  3PL8 A;  1V3F A;  4Y9R A;  4XKV A;  4WZT A;  2BVL A;  2VNI A;  4FXU A;  3K10 A;  2GXA A;  2VFP A;  2B7E A;  4CYD A;  2IXS A;  4Y3O A;  2MAB A;  3VYS B;  1BX1 A;  1TWA J;  4ZDL A;  1XFO A;  2YPR A;  1FDR A;  1G2H A;  5JMC B;  1FBQ A;  3S3O A;  2IVM A;  3I71 A;  1F43 A;  1WOR A;  1HZE A;  1NH3 A;  1TZL A;  3GUD A;  3BQY A;  1CQT A;  2XNJ A;  2H09 A;  5FD6 A;  3H9J A;  1KTW A;  2CYY A;  3VST A;  2NNN A;  3MKY B;  1P7J A;  4Z4S A;  4XMY A;  4IRG A;  3P9C A;  5L46 A;  1IZ1 A;  4I7H A;  4XSZ F;  3M8F A;  1FOK A;  3GTP J;  3S17 J;  1WOS A;  1QRB A;  3OP1 A;  4HBL A;  4PJM A;  4I02 A;  3AKZ A;  3COA C;  4C2M J;  1OYW A;  3LFU A;  2VOP A;  2WZP P;  2NTP A;  2NVU B;  2Y0S A;  3OYB A;  2VNJ A;  5TY0 A;  3H35 A;  2ZKZ A;  2HOA A;  4QLC U;  1SD4 A;  3FDY A;  1VQN I;  1VQN B;  2O1D A;  1JB9 A;  3MCA A;  5FNZ A;  1I1G A;  1JKQ C;  1ZUN B;  4JMQ A;  3ASN H;  2XTY A;  1ON2 A;  3DKY A;  2CV1 A;  4W8R A;  3R4K A;  4C30 A;  1EZG A;  3RTR A;  2LZJ A;  1DGW Y;  1IV8 A;  1X4P A;  2XAQ A;  3TOB A;  2H1K A;  3GQ7 A;  3NAU A;  3OYA A;  1G7T A;  2V7U A;  2K9Q A;  3OS2 A;  2GXB A;  2EH3 A;  3C2H A;  1YW8 A;  4NHJ A;  1KU2 A;  3FX3 A;  3MKL A;  1F20 A;  4Y7C A;  3D5R C;  4QPO A;  2CBX A;  3BR3 A;  3RPQ A;  2WC2 A;  2ZL7 A;  3L7W A;  1ZM4 A;  1KYZ A;  1JUP A;  2W84 A;  3HOV J;  3Q5F A;  2Z9O A;  2JRM A;  3LL7 A;  1TW2 A;  2HTJ A;  4A5M A;  4IW3 B;  4GYG A;  2A6H F;  5J8F A;  3V8L A;  1XQB A;  2PBI A;  2RC5 A;  4M1K A;  1W35 A;  2CC2 A;  3S16 J;  4XOP A;  3ZUG A;  1YS6 A;  4FE4 A;  3KZY A;  1REP C;  2QMU A;  2QA4 B;  5LGU A;  4X0G A;  1K73 D;  2D2W A;  3V4G A;  5L3B A;  1OGO X;  2EA2 A;  4GO1 A;  1UAA A;  3M4O J;  2GBY A;  2K27 A;  1BR2 A;  2JIZ A;  2OK8 A;  2WJV A;  1QA2 A;  4XRS G;  1V5E A;  4C3H J;  3A8I A;  4M6Y A;  1ZR4 A;  2FBI A;  4P22 A;  4XSX F;  3QFS A;  3MKZ A;  1UMK A;  1Q86 D;  3WTZ A;  3DXJ F;  2BM7 A;  1MBH A;  3BY1 A;  2A05 A;  1QA3 A;  4MGR A;  3CCL I;  5DCM A;  3CCL B;  2WWY A;  4W1U A;  4XOT A;  1IUY A;  3HOU J;  2BF4 A;  3J7A Y;  4E7S A;  2YWG A;  5BQT A;  3HRS A;  2GQF A;  4IHY A;  1SAN A;  2JZY A;  4DIQ A;  1J7K A;  3MCZ A;  3K4N A;  4ABZ A;  3H0D A;  1T5E A;  2H27 A;  3OWT A;  4A3F J;  3J81 Z;  1Q82 D;  1R1T A;  2QBY B;  4KIG A;  2E2I J;  3LSM A;  3ZMD A;  5B1B H;  3DWL E;  2M1B A;  2R5Y B;  1XS9 A;  1IXR C;  1LE8 B;  2OYN A;  2R9V A;  4TMW A;  4QSH A;  2JJ2 A;  2PEX A;  4QHY A;  1UMQ A;  3ZMZ A;  2WY8 Q;  4A3M J;  5K1Y A;  1YHQ I;  1YHQ B;  2DYS H;  2OAZ A;  3H0G J;  3PNV A;  4EGZ A;  4X07 A;  1YFH A;  4M9S A;  3I1F A;  4A5N A;  1FP1 D;  1HXD A;  5EF6 A;  2QEX I;  2QEX B;  1TYV A;  4XNF A;  2CWE A;  1BLI A;  3MFK A;  3S1M J;  3AVX A;  2E2J J;  2JN9 A;  1S4M A;  3SLD A;  5F1J A;  1QG0 A;  5THX A;  2ECC A;  2M5S A;  4W8Q A;  1B72 B;  2CUJ A;  2VQC A;  1Z0X A;  1I50 J;  4P1W A;  1SC7 A;  3PA1 A;  3FIS A;  4GXO A;  4HST A;  2NYX A;  2Z33 A;  5BSX A;  2O0Y A;  1Y0N A;  1QH0 A;  1ERD A;  3M1C A;  2Z8G A;  4EJO A;  3GVJ A;  1LDD A;  2NVX J;  3H9G A;  4R1H A;  1HKT A;  2V7T A;  1J59 A;  2BEO A;  5ERI A;  2XGE A;  1IA5 A;  3AK5 A;  2BGJ A;  3PFY A;  2WV1 A;  3BNW A;  1S3J A;  4NBQ A;  1KQ9 A;  5DD8 A;  2XDV A;  4A6E A;  4P9U A;  1OOC A;  4BH9 A;  2A07 F;  3UW0 A;  3WG9 A;  5K5R A;  1EFR A;  2DMT A;  3K4K A;  3OYE A;  5FGM A;  2GK6 A;  1K8F A;  4OIP F;  1S0U A;  1U2R A;  3AG2 H;  1SFO J;  3T5X A;  3CRZ A;  2VC0 A;  1YX3 A;  1YJW I;  1EFT A;  1YJW B;  2VFQ A;  2FUG 2;  2VBM A;  2Y9Z A;  3ESW B;  1Z7L A;  3PIP F;  3AST A;  1TTT A;  1LFU P;  2Z1D A;  4BXF A;  3IHU A;  3P9I A;  4HV5 A;  3ZQQ A;  1RQP A;  2DMP A;  1JHF A;  3I5U A;  4V19 K;  1CQX A;  4RDU A;  4W8S A;  2EV6 A;  2ZFU A;  3ZPN A;  3CZ6 A;  2M8E A;  3Q6Q A;  3H09 A;  1JRG A;  2HPM A;  1IJE A;  1Z6T A;  5DTD A;  1ETW A;  1WVR A;  2NT9 A;  4PJJ A;  3I0T A;  3MD2 A;  4MTE A;  4NCN A;  2BHZ A;  4FX0 A;  1FJL A;  1OR7 A;  2CSO A;  4JOM A;  3A35 A;  1XGN A;  2KRF A;  1FIA A;  4M74 A;  4DK1 A;  4AD9 A;  1XX5 A;  2E1B A;  2AO9 A;  2PJP A;  2GOX B;  4MIM A;  2ZBU A;  4BAY A;  4HRI A;  4LD5 A;  4LG3 A;  4BJ6 C;  3SY2 A;  2V4J C;  4PJ0 C;  4E7I A;  2DYI A;  2IS1 A;  3I55 B;  1KQ5 A;  1O8I A;  1NHA A;  2IRF G;  1P4M A;  4JBA A;  5E8I A;  3W6K B;  4EEF G;  1RUN A;  4IRI A;  2M45 A;  4BAC A;  3EDP A;  3B6A A;  5J40 A;  4V02 C;  1QO0 D;  4EGY A;  3SDB A;  4KYW A;  3ISX A;  1HG8 A;  4TMV A;  2VFM A;  1DG1 G;  4I76 A;  2V7W A;  4GDF A;  3DEE A;  1FT9 A;  4DYQ A;  4CCJ A;  2IGM A;  4AM3 A;  5A2Q Z;  2VYQ A;  2QGU A;  5GPC A;  5KHD A;  1XMK A;  1F5T A;  3HOY J;  3E6C C;  4L9V A;  4DZJ A;  4QFM A;  2CQ7 A;  5H59 A;  2LY9 A;  4M72 A;  2CQN A;  1JTX A;  3I9V 2;  3DU6 A;  2NVQ J;  2UWM A;  2DTR A;  1XDU A;  2R0Q C;  1T38 A;  2I8D A;  1S5L C;  3OL4 A;  3OV8 A;  5LBQ A;  1Z3X A;  2CND A;  2W6J A;  2DCE A;  4Z4Z A;  2IEK A;  2ODL A;  2LG4 A;  2QYO A;  2INU A;  4X7F A;  4X0C A;  3P5J A;  5M5X J;  2OCE A;  4B3G A;  1FWZ A;  1JUM A;  1XDS A;  4UXN A;  2B0R A;  4HX8 A;  2P8T A;  2IS2 A;  3SZT A;  1QHG A;  1J2X A;  2I5U A;  3BR6 A;  4A3I J;  4YXW A;  3WTS C;  1AIR A;  2E1R A;  3HC7 A;  2NOG A;  2XV4 S;  1NK2 P;  1W5S A;  2CUE A;  2OF7 A;  2ZJP F;  5F27 A;  2VXZ A;  1IN4 A;  4B09 A;  3DQV C;  1B4A A;  4WF2 A;  4G5G A;  4AU7 A;  2E19 A;  2QKL B;  2EFW A;  2MBF A;  2CV2 A;  1JXS A;  4DYC A;  4X06 A;  5FIU A;  4HA8 A;  3M7G A;  2E71 A;  1CF7 A;  4Z05 A;  3ABT A;  2R7F A;  1AA7 A;  3CCR I;  1FBS A;  1APL C;  3HHG A;  3QOD A;  4XON A;  5LRS A;  4OOX A;  1X1D A;  2HQ5 A;  1R5N A;  3HOS A;  4I6Z A;  2XAS A;  3WTU C;  1GAW A;  3HKZ A;  3AVY A;  4XKW A;  5L3C A;  2XB5 A;  1TP4 A;  4YRV A;  3J7Z I;  1QVF B;  3FXM A;  5E8G A;  3DCF A;  5E3N A;  2IA1 A;  2DXI A;  4GFB A;  4RCY A;  1S7E A;  2KZV A;  3N97 A;  2OTL I;  2LTP A;  4OJL A;  4C2L A;  1TYX A;  3A03 A;  3W2I A;  4QWQ A;  3RCO A;  3SHF A;  4Y52 J;  4AVP A;  2R7Q A;  1O3R A;  2LY1 A;  2HLD A;  2E1M C;  1TWG J;  4RGU A;  4IQ4 A;  3S1Q J;  4EJT A;  4TMX A;  2ETH A;  2FBK A;  1YIO A;  4X7C A;  4UB6 C;  4DOZ A;  3IP4 B;  4D5F A;  3CUQ C;  2DJN A;  2IGO A;  1KRH A;  3K4M A;  2HYJ A;  3WTY C;  2EIX A;  5FLX Z;  5FLM J;  2C2W A;  5E3M A;  5EMN A;  4WZL A;  2VJ5 A;  1LLZ A;  3ZQH A;  1O8D A;  1FMW A;  2FU4 A;  4YFN F;  1JI8 A;  1FTZ A;  2HOE A;  1IGN A;  4HQE A;  2WAF A;  4G6I A;  1OFC X;  1WZ2 A;  2DBB A;  5DS9 A;  1COW A;  2M4K A;  3S3N A;  1O57 A;  4DYR A;  1ZN2 A;  1FY7 A;  3P27 A;  5E6T A;  1LLW A;  4EH1 A;  2XC1 A;  3SJP A;  1VQK B;  3LSJ A;  1UHS A;  3SJM A;  3K1M A;  1AIP A;  1VJS A;  1DAB A;  4KJZ A;  3CC4 I;  4M3E A;  2JJ1 A;  3CC4 B;  1ZEL A;  4ASU A;  2DQR A;  3LMM A;  3SEZ A;  2K86 A;  2RC6 A;  1D0X A;  3HZJ A;  3O8H A;  3UNG C;  1DDN A;  4I09 A;  2PLY A;  1YJ9 I;  3JQP A;  1YJ9 B;  5EZH A;  1N0U A;  3OAA A;  2XAG A;  2VJJ A;  5BNG A;  4CYC B;  5JFR A;  2K7L A;  3F3X A;  4PJL A;  3FPP A;  4IHW A;  1STZ A;  2VNH A;  4EM0 B;  2E7X A;  2GXG A;  1BOB A;  3CDH A;  2V7X A;  2XSJ C;  5IK2 A;  4A3D J;  4MXN A;  3CCV I;  2EIM H;  3CCV B;  1QZZ A;  3R6S A;  3I4N J;  4NK6 A;  3J80 K;  2ZBK A;  1QGA A;  2ZIT A;  4JX4 A;  5LHH A;  2FX3 A;  2A69 F;  2ECB A;  2IA0 A;  1LEB A;  1FRQ A;  3K1N A;  3P7N A;  2P0W A;  1O3S A;  2VJ4 A;  4OIN F;  2FMY A;  3JAM Z;  4G7X A;  2ZNZ A;  2M7A A;  1SEU A;  2G7U A;  3FMQ A;  1MDM A;  3E3V A;  2X48 A;  4G94 A;  4YEL A;  4FET A;  3WY9 A;  5IYP A;  3X2Q H;  1PJR A;  4P6V F;  1USS A;  2B0L A;  3QFC A;  3SJZ A;  1B9N A;  2A61 A;  3B02 A;  5KK1 A;  1K28 D;  4D5C A;  2NT6 A;  4LJZ F;  3M8J A;  2CH0 A;  4RAG A;  1T0F A;  2YWH A;  2K02 A;  3GTK J;  1BMF A;  3QU3 A;  2VOO A;  1TT5 B;  2WJY A;  4TN1 A;  3OE7 A;  3Q3S A;  3BQZ A;  3S2H J;  3U9G A;  4DBQ A;  1TWC J;  2J5P A;  2FX0 A;  3IKV A;  4IQJ A;  4KKU A;  4GCV A;  2W4S A;  2KRC A;  1FZP B;  1C0W A;  2R6H A;  3GQ9 A;  2CQK A;  4IPA A;  3HDD A;  1K6O A;  2DA4 A;  5LFA A;  4M3G A;  5HNH A;  5HNF A;  3WTV C;  2DET A;  4P55 A;  1GO2 A;  2CW7 A;  4JRA C;  2ADU A;  2BYV E;  1A6I A;  3GFJ A;  1BI3 A;  2K9N A;  5D8L B;  1KON A;  3H5R A;  2X8K A;  2NVT J;  1BI1 A;  3WE3 A;  3DLL F;  2XTX A;  1I6X A;  1TLH B;  3HPH A;  4DNT B;  2ISY A;  1FNC A;  4EV0 A;  2KLO A;  3M9A A;  2P6T A;  1EA0 A;  4E70 A;  2EFP A;  1NBM A;  2LF8 A;  3CJQ B;  4YC5 A;  2RQP A;  5D4S A;  4IOA F;  4RGS A;  2WAQ N;  1DGR M;  3SFI A;  3ERE D;  5GAH J;  2LRE A;  3RDI A;  1WOO A;  3DDY A;  1LB2 A;  3VWB A;  1VI0 A;  3HSF A;  4DW6 A;  2C77 A;  5LGT A;  3GF2 A;  3ZBT A;  5F4J A;  1MD0 A;  1T33 A;  2Q1Z B;  1KYW A;  1YX2 A;  2KIF A;  4OMZ A;  4D9J A;  2QTZ A;  1E1Q A;  4ROX A;  2XHK A;  2L7F P;  1FYL A;  1EE6 A;  3H5A A;  1IXC A;  1KJZ A;  3FJO A;  2HDW A;  3B4N A;  1TUI A;  3PSZ A;  1EP1 B;  1G6N A;  3W6J B;  3F8M A;  1IN5 A;  1E79 A;  3K1P A;  1AMO A;  3H5N A;  1KQS B;  2EK5 A;  5CPR B;  4H9G A;  2IBD A;  2OBP A;  3CME I;  1WSV A;  4RDK A;  4OOV A;  5GAG J;  1UZC A;  1SVL A;  4H0E A;  1VTN C;  2EWE A;  2PMZ A;  5BPD A;  1T39 A;  3BTC A;  5CVI A;  5AON A;  2JPB A;  1H8A C;  2EZH A;  2OTJ I;  1N0V C;  4NB5 A;  5HVQ C;  4RPB A;  2K9M A;  2L02 A;  3AVV A;  2QEN A;  4HQM A;  2CUF A;  3CJN A;  1T08 B;  4P25 A;  3FXL A;  2N8G A;  3LA7 A;  2Q6K A;  2COB A;  4AF6 A;  1N75 A;  3EQO A;  3VSV A;  2OBR A;  1WHU A;  4ZTF A;  1UD8 A;  1ULY A;  1FLI A;  1X3W B;  1YLF A;  3ZMV A;  2FJ1 A;  2CV0 A;  4WQM A;  2XAU A;  2F6C A;  1KD1 D;  3CP2 A;  1HSJ A;  2E60 A;  5JLX A;  5DS0 A;  5IP6 A;  4HG2 A;  3F21 A;  1W7P D;  4BDZ A;  2VKD A;  4FN5 A;  2QN6 A;  4KIC A;  1T98 A;  3HIF A;  4ENK A;  1JA1 A;  1L0O C;  3OFN A;  2HYG D;  1N07 A;  5H20 A;  2D74 A;  4OM9 A;  1JHH A;  5FD5 A;  3JSP A;  2FD5 A;  5FKL A;  2LRD A;  4MEX F;  2Q0O A;  1VQL I;  2DOA A;  4RGR A;  3DBR B;  1F60 A;  5TV2 A;  3T51 B;  1Z1D A;  3B6C A;  4DBR A;  2MLK A;  3BZ6 A;  3L9F A;  1IG7 A;  1HDP A;  3V7R A;  4PFO A;  1U8R A;  3IH2 A;  2CRG A;  2OUM A;  3WGG A;  1ZRD A;  2BE5 F;  1TNS A;  3PQJ A;  2Q6O A;  2BGI A;  1WMR A;  3ZQI A;  5F04 A;  3MVP A;  3JRD A;  4MYT A;  2LY2 A;  3KP2 A;  4E6K G;  3Q3A A;  3H9Q A;  1W7P A;  4XLC A;  4AWX B;  1T2K A;  2HYF A;  2XZP A;  3CF2 A;  2HXO A;  3OKX A;  1VQ8 B;  1RC9 A;  2R7O A;  1R1V A;  2ZXI A;  5EYR A;  2HVR A;  5LEJ A;  4BQA A;  1P4X A;  3OZU A;  4P9F A;  3AFH A;  4OAZ A;  2G7H A;  2HTS A;  1EFC A;  1FX0 A;  3MWM A;  1EWY A;  2JDI A;  4P3I A;  4B4C A;  2WAD A;  3BWG A;  3PQK A;  2PYG A;  1J0R A;  1VQ5 I;  4ZZL A;  1VQ5 B; 
#chains in the Genus database with same CATH homology
 2CMP A;  2NTB A;  3OYA A;  1OR7 C;  2HVQ A;  3VMW A;  3OS2 A;  3C2H A;  4BQO A;  5C1E A;  2WB1 A;  1BN8 A;  3VYU B;  4AVZ A;  3D5R C;  4QPO A;  2DT6 A;  3E0J B;  3QYF A;  1NHC A;  1BHE A;  1UD3 A;  2XF6 A;  3OYK A;  3KEY A;  3AL0 C;  1X0C A;  5KCM A;  1OFM A;  2KQR A;  3EUH C;  3LL7 A;  4XN3 A;  1WPC A;  4C2U A;  1G8X A;  2HNH A;  3VDX A;  2BOL A;  4NQW B;  2OC6 A;  3KRG A;  4XOP A;  4FAS D;  3K4C A;  3OYH A;  4X0G A;  3A3G A;  1OGO X;  4J00 A;  1UAA A;  4ANJ A;  2W1O A;  1O8J A;  3U21 A;  1BR2 A;  3ZSC A;  3IAM 2;  4CZC A;  2JIZ A;  3GRH A;  2VL8 A;  1UD4 A;  3ZXS A;  2WJV A;  1QHH D;  1V5E A;  4HEA 2;  3L2U A;  2KVO A;  4P22 A;  4EAT A;  4BE1 A;  1Y6I A;  4XQF A;  3NWT A;  3MKZ A;  2VQL A;  2VQG A;  3K4B A;  2KPM A;  4B3F X;  2CS3 A;  2GK7 A;  4XOT A;  3J7A Y;  4E7S A;  1RU4 A;  4XLE A;  4YZ0 A;  1V5G A;  4GRI A;  3DLA A;  4DIQ A;  2F43 A;  3K4N A;  3H0D A;  2L5Q A;  3OS1 A;  2X1C A;  1T5E A;  3G05 A;  3OWT A;  4CCM A;  3SYT A;  4CUG A;  1X19 A;  1D0Z A;  3L2Q A;  3HUG B;  2X53 S;  2ZZE A;  1X4O A;  2VXD A;  2XF7 A;  3LSM A;  2D3N A;  3NE5 B;  3DWL E;  4TT3 A;  3OOU A;  4C9Y A;  4BU2 A;  4C2T A;  2R9V A;  3WQZ A;  3BCB A;  4XKC A;  4TSF A;  4NC7 A;  2JJ2 A;  5AMV A;  4XR6 A;  3DTE A;  4HWV A;  2WY8 Q;  1T95 A;  4XLA A;  3PNV A;  1J09 A;  3D5S C;  1DP3 A;  4B44 A;  4LIV A;  1I18 A;  3DTI A;  4AYB A;  4XNF A;  1BLI A;  4PUS A;  3QOE A;  4PFP A;  5JHF A;  3DPU A;  1WJ5 A;  2Z2S B;  2X1D A;  2M5S A;  4W8Q A;  3OIQ A;  2CUJ A;  2VQC A;  4RM2 A;  2VPL A;  2PEC A;  1HA8 A;  2ELJ A;  4P1W A;  2MD0 A;  2X6Y A;  2X3H A;  2QE7 A;  4HST A;  4XL9 A;  1V0F A;  4IZZ A;  4R79 A;  5FRN A;  3ZR8 X;  4NNJ A;  2IS6 A;  1ERD A;  3M1C A;  2K5C A;  2Z8G A;  4CCN A;  1U0J A;  2K9L A;  3GVJ A;  2XZL A;  3H9G A;  1SFK A;  2CW8 A;  4ZYA A;  1W9X A;  1VLY A;  3G2B A;  2R7S A;  1D1C A;  4HNT A;  2IQ7 A;  1X1A A;  2KL4 A;  4QPQ A;  1MW7 A;  1IA5 A;  3PFY A;  2Z6B D;  4DGW B;  3OYI A;  3UW0 A;  2XDV A;  1OOC A;  3QYE A;  1EFR A;  3C2G A;  2O0V A;  3K4K A;  3OYE A;  2GK6 A;  4E7K A;  2AQE A;  3SUC A;  2HZD A;  1WP6 A;  1YX3 A;  3TL4 X;  2XZO A;  3I3L A;  1IRX A;  2Q2E B;  2VKH A;  2FUG 2;  2VBM A;  4NK8 A;  3GQA A;  1MNE A;  1LFP A;  3DU5 A;  1PXZ A;  1Z7L A;  2M7B A;  2GJK A;  3NWS A;  2Z1D A;  4BXF A;  3ZQQ A;  3CP8 A;  4W8S A;  2ZFU A;  2CK3 A;  2QKM B;  4E4H A;  4YZQ A;  3ZPN A;  3CZ6 A;  1QJV A;  3OY9 A;  1JRG A;  1OGM X;  1MMG A;  2XC7 A;  2NTQ A;  2HPM A;  3TBI A;  1IDJ A;  4XM3 A;  4ZDP A;  2HU9 A;  2NT9 A;  1GLN A;  4PJJ A;  4BEH A;  4IKF A;  4NC8 A;  3MD2 A;  3BG7 A;  3DTK A;  3N05 A;  4L8J A;  3LSG A;  2JVG A;  4XN0 A;  3W2V A;  5FRM A;  3A35 A;  4JOM A;  4KIS A;  1H80 A;  3E1S A;  1HVX A;  2KHM A;  4DK1 A;  1DQU A;  4XOR A;  3HXL A;  1X1B A;  2E1B A;  3B8Y A;  4PJN A;  1MMD A;  1UD6 A;  4G7W A;  1PLU A;  2GOX B;  4HRI A;  2O5R A;  4LG3 A;  4BJ6 C;  4URR A;  2V4J C;  3PJR A;  2NST A;  4E7I A;  2QY1 A;  2IS1 A;  1R6R A;  1O8I A;  4OWR B;  2V1N A;  4CH7 A;  2V26 A;  4BAC A;  3FBN B;  4Y4R A;  2VAS A;  2WPD A;  3SDB A;  3T53 B;  1HG8 A;  1VZ0 A;  2XF5 A;  4HSR A;  2LBF B;  4E7L A;  3S3M A;  3A2K A;  2XGJ A;  2QXZ A;  4F91 B;  3FBI B;  3DEE A;  3LSH A;  3OYC A;  4CCJ A;  2IGM A;  2LBF A;  1NRK A;  2XOK A;  4Z1M A;  1RMG A;  3SEQ A;  1NG7 A;  5KHD A;  3RPU D;  4UZU A;  4PK4 A;  1XG2 A;  5HLT A;  1DBG A;  2O17 A;  3I9V 2;  3DU6 A;  2UWM A;  4OZY A;  3PUB A;  2I8D A;  3OL4 A;  4XD7 A;  2RRE A;  1Z3X A;  2RNG A;  4ZTJ A;  1K6Y A;  2DCE A;  2GJR A;  2W6J A;  2L9N A;  2LG4 A;  4F92 B;  1O88 A;  1O8K A;  2INU A;  2ODL A;  1T0F C;  2V7F A;  4B3G A;  3VYR B;  4BJT A;  3HAG A;  4OJ6 A;  3BH4 A;  1KZL A;  4CSW A;  2WAQ A;  2DIE A;  3LNN A;  1WJF A;  2IS2 A;  1QHG A;  3PSF A;  4YXW A;  3HL2 A;  3OYG A;  1V5F A;  1AIR A;  4ZDO A;  3HC7 A;  1D1B A;  3LMW A;  2K3P A;  2AQF A;  4DJA A;  3BLY A;  3SZG A;  3ZGK A;  4BQQ A;  2VXZ A;  4BGD A;  2ZTG A;  2QX3 A;  3DQV C;  4AU7 A;  2QKL B;  2V7Q A;  2CV2 A;  3QYB A;  2KMU A;  4G6T B;  3BG6 A;  3DKX A;  3OR2 C;  3S8P A;  3PSI A;  5LD2 C;  4Z05 A;  4OJ5 A;  5CDF A;  1AA7 A;  2V4D A;  3QOD A;  4XON A;  1W0K A;  3FKJ A;  1X1D A;  1H8E A;  3HOS A;  1YX5 A;  2E1M B;  3A1Y A;  3HKZ A;  3KX2 A;  4XKW A;  4P5O A;  2LC2 A;  4YRV A;  3OYL A;  1N77 A;  5TGT A;  2VIX A;  2DXI A;  2KZV A;  4KKS A;  1BPL A;  4F55 A;  1O8E A;  1UEL B;  1O8G A;  4OJL A;  4C2L A;  3VR6 A;  2MC4 A;  3EPZ A;  1QU3 A;  3RCO A;  2BVM A;  2R7Q A;  4N4O B;  2LY1 A;  3KYL A;  2HLD A;  2E1M C;  2HQA A;  1WFX A;  3H94 A;  4IQ4 A;  5FL7 A;  1IDK A;  1K5C A;  4U49 A;  2OV7 A;  4B48 A;  2JVH A;  4ZC3 A;  4DOZ A;  2KDO A;  3W2A A;  3IP4 B;  2IGO A;  3EUA A;  1GQ8 A;  4BDY A;  3K4M A;  4PSW A;  1S9H A;  1P9Q C;  4H4K C;  2KRH A;  2VQH A;  2Z16 A;  3VSL A;  4CCO A;  3BC8 A;  2NSP A;  2V9K A;  2M3A A;  1MMN A;  4YZX A;  2L7K A;  2VJ5 A;  4II3 A;  5C1C A;  1O8D A;  4XKB A;  1PKV A;  3OW7 A;  2IGN A;  1FMW A;  1WJA A;  2GOM A;  1JI8 A;  2INV A;  1VBL A;  1WTH D;  2X85 A;  2F5V A;  2WAF A;  4G6I A;  4BE2 A;  2MYS A;  1COW A;  3D5L A;  5HKK A;  2M4K A;  3S3N A;  2JUG A;  1V0E A;  4MR0 A;  2W82 A;  3PNY A;  3BCA A;  1VJS A;  3CES A;  4KJZ A;  4OJO A;  3K6G A;  3A4C A;  3W2W A;  2JJ1 A;  4HIZ A;  4E7J A;  2CFO A;  1ZEL A;  4RLQ A;  3L2V A;  4ASU A;  3OOC A;  3LMM A;  3SEZ A;  2ZTN A;  4E0F A;  1D0X A;  4N4N B;  4HNU A;  3UNG C;  3UR3 C;  4J01 A;  1Z3Y A;  1NG6 A;  4CA0 A;  3L2W A;  1MAB A;  1TT0 A;  4BEH B;  1LVK A;  3OAA A;  4KIT B;  2BSP A;  1X1C A;  3W3C A;  1N78 A;  2VJJ A;  3BCD A;  2RQQ A;  3OL3 A;  3MKW B;  5DN6 A;  4PJL A;  2R7W A;  1Y56 A;  3LSI A;  3FPP A;  1D1A A;  4F93 B;  2ZSH B;  4YZA A;  2DJI A;  3OPO A;  1BOB A;  2X6X A;  1E3Z A;  2W6I A;  2M0M A;  2XSJ C;  5IK2 A;  3OEH A;  4MXN A;  1E0E A;  4NK6 A;  2V31 A;  2UV1 A;  2ZXH A;  3VSK A;  2ZZF A;  2WY7 Q;  2P0W A;  4PMH A;  1WJB A;  2VJ4 A;  1EA3 A;  4G7X A;  2M7A A;  1OLT A;  3IUO A;  1FMV A;  2CUZ A;  1MND A;  2A5W A;  3OYN A;  4YEL A;  1KMH A;  3HPG A;  3BCF A;  4FET A;  4KT6 A;  2PJR B;  2X6W A;  2IGK A;  1PJR A;  2R7X A;  2WA0 A;  2X51 A;  3RSN A;  1D0Y A;  3CMM A;  2PJR A;  1H8H A;  4Z03 A;  2IS4 A;  1OFL A;  3GBG A;  3HOT A;  1E1R A;  1K28 D;  4TKO B;  3M8J A;  2CH0 A;  2NT6 A;  4LIU A;  2R4G A;  2F4I A;  2BW3 B;  2JSP A;  4BL0 B;  1Z21 A;  1BMF A;  1W36 D;  3OYJ A;  1UD2 A;  2WJY A;  4B3X A;  2VBK A;  2BW3 A;  3OE7 A;  3JUR A;  1WJD A;  4DBQ A;  2L2O A;  5HOO A;  4LIT A;  4IQJ A;  3FKS A;  4KKU A;  2W4S A;  2KRC A;  3JU4 A;  2ZZG A;  3HG9 A;  3FHN A;  3ONQ A;  3GQ9 A;  3OYF A;  2ZSI B;  4DNR B;  3OR1 C;  3IAS 2;  3K70 D;  5LFA A;  3GVL A;  1KCD A;  5HNH A;  1DBO A;  3F9K A;  5HNF A;  2W00 A;  2CW7 A;  1UD5 A;  3TMO A;  1W0J A;  2E5N A;  2HPI A;  2WAE A;  5FRO A;  4BS9 A;  4Z06 A;  1E3X A;  1KON A;  3H5R A;  5CQE A;  3OMY A;  2X8K A;  3GQB A;  4Y33 A;  4B43 A;  1O8F A;  2UVF A;  2VJI A;  3HPH A;  4DNT B;  4EW9 A;  2VB6 A;  2KLO A;  4YEJ A;  4ZJZ A;  3CJR B;  2UVE A;  4U7B A;  1NBM A;  3CJQ B;  4U87 A;  1OHH A;  3T9G A;  1UG0 A;  4JQF A;  3ZPP A;  2V6E A;  1DGR M;  2M4G A;  4HPQ A;  3ZIA A;  3FY3 A;  2L9S A;  2PYH A;  2LRE A;  3DDY A;  3VWB A;  4E7Z A;  1G59 A;  4PSX A;  2X1E A;  1E43 A;  1W36 C;  4XLH A;  4CCK A;  2WBM A;  2Q1Z B;  4D9J A;  4BE0 A;  1E1Q A;  1SAU A;  3BC9 A;  1EE6 A;  3RQ4 A;  3H5A A;  2HDW A;  3B4N A;  3K70 C;  2KP6 A;  1LKX A;  3B90 A;  3DPL C;  1E79 A;  5KNL A;  2W7N A;  4ITV A;  2HVS A;  2R7U A;  1WJC A;  3K4L A;  3S93 A;  4IX7 A;  3H5N A;  3V42 A;  4KKT A;  5CPR B;  2F1M A;  3OYD A;  3VYT B;  2UUZ A;  2NOJ B;  3ZRG A;  2R7V A;  2JA2 A;  1VF7 A;  2PMZ A;  2EWE A;  3OIP A;  1IB4 A;  4D1Q A;  2NZM A;  3MMY B;  3PNT A;  1PYV A;  5HVQ C;  2K9M A;  2VBE A;  1KCC A;  4B47 A;  3EQN A;  4DK0 A;  3LSK A;  3S32 A;  4XLF A;  1LDK B;  4OAY A;  3OEE A;  1N75 A;  3T56 B;  2O0W A;  4CCL A;  4F3Q A;  1QCX A;  1RWR A;  3EQO A;  3VSV A;  2LH9 A;  2WSS A;  4E7H A;  4ZTF A;  1UD8 A;  2E5Z A;  2CV0 A;  2D3L A;  2XAU A;  2F6C A;  4I84 A;  3CP2 A;  1CZF A;  2E60 A;  2LOO A;  1WJE A;  4HG2 A;  4BDZ A;  2VKD A;  3OYM A;  5CKT A;  3KEW A;  3OFN A;  2GJP A;  3WWG A;  4BJ5 C;  3GVK A;  4NUB A;  1YE9 A;  3L2R A;  1O8L A;  1BR1 A;  2XND A;  2LRD A;  3PL8 A;  2A6T A;  3A3B A;  3DPT A;  2DOA A;  2DT7 B;  4XKV A;  3T51 B;  4DBR A;  2BVL A;  4FXU A;  3GQ8 A;  3K10 A;  2O04 A;  2IXS A;  4Y3O A;  2MAB A;  3VYS B;  1BR4 A;  1O8H A;  4ZDL A;  4PFO A;  2LYC A;  2OUM A;  3S3O A;  4RLF A;  4W8T A;  1HZE A;  1TZL A;  4MLO A;  1WMR A;  4RMN A;  3H9J A;  1KTW A;  3VST A;  2LY2 A;  4E6K G;  3VSU A;  4OJP A;  3H9Q A;  4XLC A;  3EUK L;  3MKY B;  4XMY A;  2R7R A;  5CQG A;  1O8M A;  2XZP A;  3AKZ A;  4PJM A;  3ZCO A;  3CF2 A;  3LFU A;  2WZP P;  4RM3 A;  2R7O A;  2NTP A;  2Y0S A;  3OYB A;  2ZXI A;  3VMV A;  2HVR A;  1OB0 A;  3H35 A;  4BQN A;  1MMA A;  3OS0 A;  3AFH A;  3FDY A;  4OAZ A;  1FX0 A;  1SKY B;  2ZZQ A;  4BUP A;  2O1D A;  1PE9 A;  4GQN A;  2JDI A;  4JMQ A;  4OZZ A;  4W8R A;  3DKY A;  2CV1 A;  2WAD A;  3K4J A;  4C30 A;  4II2 A;  3RTR A;  3AL0 B;  2VLA A;  2R7T A;  2LZJ A;  1DGW Y;  2MFZ A;  1X4P A;  2PYG A;  4F52 A;  1I8D A;  1JTA A;  4U4B A;  3GQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...