4YELA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
molecule keywords Tail spike protein
total genus 228
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yelA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yelA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yelA02
2NSPA 1GQ8A 4OZZA 1O8FA 1IA5A 2O17A 2NTBA 3EQOA 3VSVA 4YZAA 2IQ7A 4NK8A 2O04A 4EW9A 2NTQA 4HWVA 4XOPA 4YELA 1CZFA 3GQ8A 3VSUA 5C1CA 1O88A 1KCCA 3B4NA 2X3HA 3UW0A 4OJLA 4XLCA 2VJIA 1OGMX 1PE9A 4XNFA 1O8LA 4W8SA 3VMWA 1O8MA 2EWEA 3JURA 2QXZA 3ZPPA 3WWGA 2PECA 4XLFA 1QCXA 3GQ7A 4OZYA 4XLAA 3FY3A 4XONA 2QX3A 5AMVA 1KTWA 2QY1A 3VMVA 1NHCA 2ODLA 4XKWA 2INUA 1AIRA 1JRGA 2O1DA 5C1EA 4AVZA 1VBLA 4XOTA 2VBEA 2PYHA 1K5CA 4W8QA 4YEJA 1O8IA 4YZ0A 4I84A 1JTAA 2INVA 4XMYA 4NK6A 3B90A 3KRGA 1O8EA 4XQFA 4OJ5A 1OFLA 1HG8A 1PLUA 3VSTA 4XLEA 3T9GA 2Z8GA 1QJVA 2UVFA 1O8DA 2VBKA 4YZXA 1IDKA 4C2LA 1IDJA 4U49A 1OGOX 3LMWA 4Z05A 4URRA 3GQAA 1EE6A 4Z06A 3GRHA 1O8JA 1PXZA 1BHEA 1IB4A 1OOCA 2BSPA 1WMRA 2O0WA 4XM3A 3GQ9A 2O0VA 1XG2A 2X6YA 2VJJA 1DBOA 4MXNA 3EQNA 4XN3A 4MR0A 2X6WA 1O8HA 4YZQA 4U4BA 1O8KA 1BN8A 4W8RA 4XL9A 1RWRA 2NT6A 4XKVA 3B8YA 4XR6A 1H80A 2VBMA 1O8GA 1OFMA 3SUCA 2NT9A 4OJ6A 4XLHA 2PYGA 4Z03A 2NZMA 2UVEA 3ZSCA 1KCDA 1X0CA 4PMHA 2X85A 2NSTA 4XN0A 4XORA 1RMGA 4OJPA 1RU4A 1DBGA 4W8TA 2NTPA 2X6XA 4OJOA
chains in the Genus database with same CATH superfamily
1JHFA 1B72A 1GV2A 1T38A 1S72B 1K61A 1V0EA 1BOAA 1VHEA 3E0JB 4M74A 4B1RA 4E7LA 3HOUJ 2YU9J 2KP6A 3VSVA 5HODA 1O3RA 3NAUA 3JSPA 1KK0A 2O04A 4NNJA 4EW9A 3F23A 1O7FA 4BY7J 2ISYA 1QVTA 1VQLI 3VSUA 1KU9A 4Y7CA 4ON0A 4ZYGA 2XGXA 2V7QA 5IOZA 2K27A 3SJMA 1EP1B 3GZ5A 2VKHA 1O8MA 2ICWG 1GLNA 5EEGA 3TOBA 2YU3A 4IZZA 1BIBA 3BR0A 1BQEA 4F52A 2RQPA 5IT9K 1G7TA 1K4TA 1BW5A 2ZITA 1O3QA 3QRFF 3BZCA 3DLLF 2D5VA 2WBMA 3LOCA 3UKGA 4XONA 4NCNA 1R5NA 3AL0C 1T5EA 5ED4A 5TRDA 2GPJA 2K9SA 2FU4A 3G2BA 4EVIA 5HLTA 3GW2A 3WHBA 3EUHC 3B78A 3OOUA 5TGTA 3S14J 4ANJA 1QA1A 1XSDA 1IN7A 2XC1A 2FEZA 3OYKA 2RNGA 3HRSA 2MLKA 3C7JA 2V7TA 2K3FA 3AFHA 4U7BA 3AL0B 2OCEA 3SQVA 2P5VA 3CJRB 2M5WA 1P9QC 1Q1VA 3LSKA 2YX7A 1F9NA 3OWTA 4W97A 1WFXA 4AVPA 5LHHA 2CG4A 1WPCA 4ENJA 2R92J 1X1AA 3A35A 2EZHA 4PJJA 4G9YA 2JVHA 1S4MA 2HU9A 3FK7A 1HKQA 2VYQA 2M8EA 1GAQA 2X6OA 2ISZA 4YIIA 2R7QA 3Q5FA 1JUMA 2R7VA 1BR4A 4DIQA 4M72A 2OYNA 3GVKA 1OGOX 3W5HA 4YEIA 2HWVA 5F0FA 1UG0A 4LJZF 2FA5A 3Q0VA 4B3XA 1BC8C 2IBDA 1DU0A 3B73A 3ZMDA 4U7DA 1LLZA 3V7CA 4B3FX 3C1DA 3H3UA 2EFWA 4G7HF 1NRKA 3IHUA 4RAYA 3GLXA 1TQPA 3Q38A 2LBFA 3M1EA 5CYVA 4G7OF 1ZYRF 3M8FA 5IP9J 3CCRB 1OYIA 1UELB 3OYNA 5DTDA 3H9JA 3QODA 5GV8A 3CD6B 1X3ZB 2XB0X 4BS9A 5DDGA 1B23P 3K4BA 3VB2A 3HPGA 1L3LA 4L5JA 3ROUA 2JVGA 1AOYA 2WY7Q 2CJJA 1U8BA 4ZCMA 1J75A 1QFJA 1DGWY 2WJVA 3GVAA 1A8PA 3MN2A 4AYBN 4RLFA 3J7AY 4CXFA 2PLYA 1YHQI 3W3CA 4FASD 1Y0YA 5TR9A 3FXKA 3CCJB 3ISXA 3JCUC 1ZTRA 4HX4A 3MAJA 3S1QJ 3ASNH 4J00A 2JUCA 1FNMA 3ZSCA 1I6HJ 2F2EA 1LQ1A 5CQGA 2L7FP 3FXRA 1YX2A 4DK1A 4UV9A 1TC3C 2DJNA 1RMGA 4B44A 2K7LA 1XSXA 2DODA 2ZL5A 4G6DA 4KNYA 2RREA 5J4YA 2XVCA 2XPVA 2FSWA 2JWTA 1GQ8A 3TO9A 2XPUA 3IV5A 4QUZA 1X2MA 2A05A 2NTBA 2BVNA 3WTWC 4KUMA 4ETSA 4YCQA 2IQ7A 3BJAA 1T8IA 4QVJA 5E3MA 1KYWA 3H3ZA 1KCCA 2OK7A 2DOEA 3LO8A 3G4SB 3S3OA 3OL3A 5FLMJ 2EIKH 2F43A 4NB5A 1PE9A 3RPUA 1X1CA 1N08A 5IYBJ 3KP6A 2KJBA 2NNNA 3WGGA 2VNJA 3DU5A 5B6IA 1SANA 5DD4A 3WGHA 2H09A 2IGMA 2XOKA 1IXSB 1T39A 2NS7A 3QOEA 4BUPA 3CUQA 5E3OA 4OWRB 3KP7A 5IOYA 1Z7UA 1UMKA 5FJ8J 5J3OA 1I3QJ 1PKVA 1JKOC 2R93J 2ZXIA 3CTAA 2P6SA 3CCSI 5BPDA 1LEBA 1E43A 3ZC3A 3QU3A 3I55I 3VYUB 3I1FA 3BG7A 3VO2A 3CCEB 2R9VA 1VBLA 3PIPF 2PYHA 4NBSA 2ZMEA 4P26A 4UZUA 3WQZA 2BW3A 2ZMEC 1FP2A 2B7BA 3LNQA 5HLIA 1O57A 3RKYA 5GAEJ 3KZZA 2DMUA 4PDKA 1IV8A 4K1XA 3KRGA 2RNJA 4XQFA 4C9YA 3LQQA 1PLUA 3AVTA 2ELKA 2WC2A 1DPUA 2WV0A 5THXA 4LK0F 5KAFC 4YZXA 3X2QH 2IS1A 5BMZA 1GXPA 3F21A 3CCVB 4RCYA 3BQJA 1MJAA 3HRTA 5E17F 3WHCA 2JTVA 4D5CA 2RC6A 4Z05A 4ZTFA 1JA1A 4OIPF 1TVCA 1WTHD 2XHKA 2AXTC 1I18A 4YFOA 1O8JA 2O61A 1FDRA 2B5OA 3ABMH 1VTNC 1YTYA 3FJOA 1BR2A 3LWFA 4YAOA 1OB2A 2O6WA 2V1XA 1MIJA 4I02A 3GIRA 4QWQA 3P4GA 3MQ0A 4LG0B 2A68F 2Y30A 3I5UA 4H4KC 4L5IA 4II2A 2QA4B 1QRCA 3VO1A 3E1YE 2PJPA 3FZVA 3VFZA 4ZZLA 2BGIA 4U4BA 4C3IJ 3AG3H 3BPXA 2WAEA 3ELKA 3I58A 4I01A 4B43A 2EFOA 4CCJA 2HOEA 5IY5H 4UV8A 1R00A 5LGUA 1QA6A 1YJNB 3AVXA 2FOKA 2W57A 1ETVA 3SUCA 3V8LA 4P1VA 3OJXA 4BQNA 1MNDA 4CCNA 4JMQA 2AHQA 1HA8A 4JOMA 3ZPNA 3I53A 3H5RA 3ASOH 3K1MA 1YJ9I 4U0WA 2EIMH 3ZQGA 2RGVA 2V4JC 2PMUA 2VB6A 3PNYA 3W6VA 3Q9VA 3WTSC 2L9RA 1CGPA 2OK8A 1O7LA 2IGNA 4X1EA 3K4CA 2O6GE 1J2XA 2Z1DA 4RA2A 4RB0A 3OP1A 1K28D 1DARA 3H5NA 3Q0WA 1SM4A 1BM9A 2CFXA 3GTQJ 1KU2A 2RKHA 2VBUA 3PUNA 3CLQA 3FBNB 1VJSA 4YZAA 1IUFA 4B4DA 2DBBA 3KE2A 1ETWA 1G6NA 1T0FA 4XRSG 3UW0A 5HDKA 2IJLA 3ES9A 5F6FA 5EDNA 2FBHA 2EA2A 3BG9A 1FWZA 2BM1A 1VQNI 3CCJI 1CF7A 2DTRA 2QCOA 2O8XA 1WI9A 3ULQB 4DQKA 3TW6A 1PUFB 4HF2A 2H6CA 2BY2A 3DBRB 1JTYA 2GREA 3VMVA 1IN6A 4R71A 2HYGD 4IQJA 1NHCA 3FXMA 1Z67A 2M4GA 4P6YA 4V2GA 1NB9A 3GVJA 1KYZA 5LEKA 1JT0A 3VR6A 1WWXA 4D9JA 1WSVA 1OISA 3CD6I 5TY0A 1GXQA 2PJRB 2CUEA 4LITA 2JN6A 4E7ZA 3J7ZI 4AUXA 2XSDC 3GTLJ 3CCUB 2VFQA 4W8QA 3BR3A 5CKTA 3U1DA 1ZH5A 1ETKA 2IW5A 4IOCF 1X1DA 4BDZA 2FUG2 1WZ2A 2BM7A 2D3LA 2HMAA 2Y2ZA 4YHBA 1BI1A 3NB2A 1FNDA 4X6AJ 2DOGA 1FIPA 3PNTA 1O8EA 3S3MA 4E7HA 4PCQA 2CQXA 1MH4A 4EATA 2EV0A 1UD2A 3T9GA 1PJRA 3BPVA 4L5EA 1LM1A 3VPRA 3V7SA 4AC0A 1J9IA 1QVGB 2P8TA 2X51A 5DUIA 5KSWB 1T95A 3FWEA 1I6XA 3CCUI 1BBYA 2CFOA 3P9CA 3QU6A 2QSHX 1GR1A 1KD1D 3QYEA 3P26A 2GOMA 4Z06A 3J81k 4HZFA 4U0VA 3DKYA 4XBFA 4Y13A 2ZCWA 1VFCA 4DBRA 1KK1A 4EM0B 2JPCA 3HEFA 3B6CA 1ZAOA 3GQ9A 3HC7A 2E1MB 1AKHA 1I50J 2VQLA 2XROA 4YAUA 4EEFG 2X6WA 4W1UA 1VQNB 1BN8A 2QGUA 1D1CA 1ORKA 1S5LC 3G1OA 1XMXA 4UHTA 2LKPA 3RCOA 2NT6A 4HYEA 2DO7A 2X9DA 4D7MA 1ZQ3P 1UZCA 4FX4A 1MSEC 1EV7A 5K7HA 4RM0A 1OPCA 2WAFA 2O0YA 3V42A 2VN2A 1RR8C 1EH7A 4ZZDA 2OBTA 2V1NA 4PJ0C 5FRMA 4M6YA 4XLHA 1ELOA 4M53A 2R7ZJ 2BX6A 4OPSA 3A0BC 3L1PA 1YRNB 3KPHA 3DLAA 2J5PA 4KICA 2DA2A 3MEXA 1JGGA 1U78A 3TH0A 1V5FA 3VODA 4BGDA 3DPLC 1HKTA 2KIMA 3ML3A 4GQNA 1YITI 1S7AA 3HZJA 2LOOA 4FWTA 3QQAA 4KKUA 4OZZA 5D8LB 1V5GA 1WPKA 3S2HJ 1MKMA 1K5CA 1LEAA 2ZJQF 1WOPA 3OJWA 4P9UA 1X1PA 1EP3B 4PSXA 1TT5B 2YWFA 1JT6A 4MNUA 2V4DA 2LBFB 3HGGA 5BNGA 1VQ5I 5E3LA 5JLWA 4HX7A 3ZXSA 3W2GA 1ENHA 2M30A 3DFGA 2PECA 4DYCA 1QVFB 5AIPA 4F7DA 3BQZA 4JX5A 1HXDA 1LNWA 2QQBA 4Y52J 3JRFA 2QX3A 1OCOH 2DMPA 2FRHA 1VQMI 1KJZA 2H6BA 3BCFA 4CCKA 4S05A 5CVRA 1JJ8C 2BM6A 1MMGA 5DEQA 3DBHB 3SEQA 5KAIC 1FIAA 3PNVA 1KA8A 4HNTA 1P4WA 1TWHJ 3L2RA 2ZTGA 4E7JA 2XIGA 1R58A 4ZYDA 2E2IJ 3JRBA 3LSJA 5GPAA 2QUFA 4QV2A 5HZAA 1MBGA 1L0OC 2BZTA 3L09A 3HB9A 3BJ6A 1UHSA 4BY1J 4LLNA 2RC4A 3HHHA 3KX2A 3CF2A 4XRFA 1QHGA 3EETA 1RRJA 3QSYA 3Q3SA 2GQFA 3JX8A 2XAJA 4QTRA 4A93J 3PQJA 2M7BA 2B63J 1QJVA 1NHAA 4X07A 1A6IA 3DXJF 2DK5A 4CA0A 5F1JA 4HF1A 4U49A 4WZEA 2D1VA 1J0RA 4YFNF 3LQEA 2WADA 4TMXA 3K7AJ 3E6CC 3K4NA 1D8KA 3T56B 4TN1A 1XD7A 5GP9A 2R5ZA 1WSUA 4HIZA 3AK5A 4LLLA 2NVUB 1HQCA 3LMMA 1WOSA 5DSZA 4ZGNB 4HE6A 4G12A 2OD5A 2NVYJ 4IOAF 1BMFA 1HA3A 3HOVJ 4WX9A 2DDBA 2GIZA 4GYIA 2CQKA 4Y4RA 2X6YA 3OMYA 1H85A 3S8PA 4L8JA 2K40A 3SYTA 4RB3C 3C3WA 2HS5A 2CC2A 5D5UB 3E3VA 4IHTA 1KQ9A 4PFPA 3BROA 2ELJA 3KP3A 5J1UA 5LHIA 1FRNA 1OB5A 1TYUA 4OIQF 4OOSA 3R6KA 2FX3A 2HDNB 5FNZA 3H36A 1TWCJ 2KRHA 4FK8A 4ZH4F 3K4JA 5FL7A 3ZBTA 1TSPA 5BSYA 3HUGB 1D0ZA 1IW7F 2CW7A 2E36A 2NZMA 2HOTA 1IDZA 1SKYB 4OINF 3RQIA 1D5YA 2L7MP 2AQFA 2PE3A 4XKBA 2H8RA 1T6YA 5EEHA 2AO9A 1J9ZA 2G7HA 3I0TA 2CF4A 4G7WA 5FKKA 2EFNA 4N0BA 3BC8A 3RTRA 1ZGAA 1D2EA 2NPFA 1YW8A 2LY2A 1LPQA 1R71A 2BM0A 2F5VA 4NK8A 5CQEA 2VOOA 3PUFA 3WBJA 1VQ8B 3RY8A 3KFWX 1K83J 1ZLKA 1FYMA 2M9HA 1V5EA 4M9SA 1WHUA 1H88C 1YW7A 2KRCA 1JB9A 3H0DA 1EKEA 1AWCA 2AQEA 2DPUA 4GO1A 1BPLA 1WRJA 3PO3J 4ZYEA 1UFMA 2EWEA 4FT8A 1W7PA 4O6JA 3U2QA 3DPTA 1MMNA 3AVWA 4J01A 2MA3A 2EZKA 2OAZA 4E7KA 1E79A 3B8HA 5E6TA 2YPRA 1VQ4B 2QBYA 3K10A 3LFUA 3CCRI 3PSFA 2LH9A 3KZIC 3W2EA 2DJIA 4BAYA 2QY1A 5GAHJ 3OYCA 3C2HA 3JW4A 1ZKGA 5JMCB 3WTTC 2LFBA 2M34A 3DBLB 3ZQHA 2WZNA 4OOVA 1XFOA 1WP6A 3P9KA 4AVZA 1IO2A 1F36A 1ITYA 3DDYA 5B1BH 1Y0RA 2VNHA 5F64A 4C2UA 3BCAA 3PVDA 4I99C 2A3SA 3LSIA 2LKSA 2IS2A 3TDZC 3DU1X 3BG5A 1OYYA 2E7WA 2NS8A 2TCTA 3KYDB 1RNLA 5BSXA 1SFEA 1E62A 2LG4A 4U88A 2HVQA 4RAGA 2VLAA 3OEEA 3BCDA 1V0FA 3OYGA 3JRHA 2OJED 2ID3A 3G1LA 2W00A 3HXLA 2RN7A 4IPAA 4MFEA 2P3MA 1HW5A 2MW8A 2DERA 5E8IA 4YIFA 1YRNA 3PSZA 3OAAA 1HDPA 4JK1X 3CXCB 4RM2A 2E34A 3JSOA 1WU8A 4EMSA 2EWNA 1B6AA 4L9NA 4QSHA 4F93B 2V9PA 3OYJA 1APLC 1ERDA 2FNPA 3LSPA 3ZMTA 1ETYA 4G6TB 3ZN0A 4X0CA 4XM3A 1A04A 3SFIA 3SHFA 3H35A 2GZWA 3ZMZA 2K5CA 4XN3A 4HQEA 5E1WA 1IV6A 3ZPLA 1TYXA 3PSSA 2R7DA 3MCAA 1CNEA 1RWRA 1M1KD 3CDLA 3WODF 2XSJC 2KKOA 2XNCA 3FX3A 1I1GA 2VBWA 4ITVA 3GFLA 2IA0A 3E5QA 4I0AA 2BVMA 3JRDA 1BIAA 2LLKA 3WG7H 3A1YA 4G8XA 1I5ZA 3BY6A 1RR7A 2OUMA 2FNAA 3DQVC 4XD7A 3WTVC 1DDNA 4MFDA 4A3IJ 2KQRA 2WYRA 1S72I 1KCDA 2YSRA 3QPLA 1LJ9A 2PX9A 2O03A 5JFRA 2IPQX 1DP7P 3SDBA 1X0CA 5ICCA 1YQAA 1J5YA 3BG6A 2PI0A 1M90D 3FKIJ 2XTXA 2EQRA 1ZM9A 2XTYA 3E6DA 4XORA 3FDYA 3DPUA 4A3MJ 4PABA 2WAQN 2ESHA 3PFIA 1RU4A 4DJAA 3CCMB 4U9UA 2EV5A 2G0YA 4J0QA 4ASUA 4DW6A 1IXRC 1Z9CA 3W6JB 2LSOA 3BR5A 4P6VF 1G3YA 1N05A 2C77A 2QTZA 1TNTA 2OTJB 1E1RA 1TBXA 4N4NB 2F4MB 4C30A 3MWMA 1VF9A 3ZQFA 5FKOA 4XOPA 4YELA 3CO6C 1AU7A 4A3KJ 2DIEA 1EH6A 2XRLA 4ZCIA 4U0YA 4YXWA 1F1ZA 4WWVA 2A6TA 1EXMA 3FK6A 1J7KA 2M87A 2ZKZA 3KP4A 4CO8A 4BE1A 2XV4S 1ZRFA 2EIXA 3MHPA 3VNVA 3ZPPA 1FTZA 2F1MA 3WBKA 1EA0A 3J7YJ 2W7NA 3CPXA 3HSRA 4M3BA 4RD3A 2EA4A 1QGZA 3I64A 3TMOA 2QKLB 5D5XB 5E79C 4TMTA 2MC4A 1GV5A 4X7FA 3VYTB 2E5ZA 4YIRX 3S16J 2QEXB 5IPAA 2ZNYA 1FOXA 2CV1A 1W5TA 3L2WA 2TDXA 4XOTA 3SEZA 2R5YA 2VBEA 1LLWA 4ENMA 3H9GA 3ZR8X 2DYIA 3LYCA 3OYIA 3E6MA 2HQNA 1WORA 5JR3A 4IW3B 2NAZA 5BS6A 1IUYA 1NBMA 4XMYA 2WY8Q 3ZMUA 3B90A 2QYUA 4NK6A 2O9LA 1QO0D 1NJID 2Y31A 5EGOA 2NVTJ 2QE7A 2X4HA 2JRMA 2DMQA 1YW9A 2LNBA 4MQ9F 2X1EA 1MD0A 1BX1A 2ETHA 2HYJA 2ZTNA 3Q39A 3U2RA 4AIKA 2KZVA 3H9NA 3MKWB 2O7OA 1IDJA 3CCLB 4I84A 4PJMA 1EWYA 5FIUA 2E35A 3OSFA 3AG2H 2QA4I 3HAGA 5DCFA 2QTLA 3KEWA 3ASTA 2B9SA 3BTJA 1G7SA 3QFCA 1BHEA 2G0EA 2DOFA 4QHYA 2GXBA 1D8TA 3HPHA 1G59A 1MBEA 4KT5C 1LDJA 4HX8A 3W6KB 2FMLA 2KJCA 2QSGX 2BY3A 3QAHA 5HDGA 1ZRCA 3FXOA 3GTOJ 3HOWJ 4C0SA 1I39A 1TTYA 2H1LA 5HNHA 4XICA 1UJ8A 4BJ5C 5C4JJ 4HDUA 3FM3A 1RPWA 4ZC3A 3WG9A 4E4HA 1VQPI 4KKTA 1XX5A 1IRFA 2PFBA 3TKYA 3BTIA 1DU6A 3HSFA 3TO7A 3VSLA 1ZGWA 3TW7A 3SKBA 1O8GA 3K70C 1VQPB 1BJZA 1H89C 3J7AO 4Z2YA 1SVLA 5F4MA 2B7EA 4ZJZA 3PSIA 4IHWA 1EH8A 3FKSA 3HYIA 2LDUA 1ZG5A 4RDLA 2XTWA 1SC7A 3Q3AA 4FE4A 4HAMA 5J8FA 2NSTA 4M3GA 4LB5A 4CYDA 3CMEI 3W2VA 2R3SA 3ZGKA 4D5FA 2ECBA 1OB0A 2BVLA 1Z77A 1QG0A 1EP2B 3LSTA 4N9HA 1R22A 3L7WA 3CC4I 4HEA2 4RD2A 2NTPA 3MKLA 4KH3A 1IJWC 2HI3A 3KP2A 4GDFA 2GWRA 4RGSA 2FBIA 3V7AA 3N90A 4L0ZB 1CQTA 2V79A 2JZYA 3ZQCA 1U8RA 1YIJB 3WY9A 1SFXA 2GXGA 4U87A 2LP0A 3GZNB 1SVOA 1YIJI 4HWVA 1BX0A 3FXJA 1QNTA 2FBKA 1SFUA 2PMZA 2VI6A 2CMPA 2HNHA 3HTUA 4M3EA 1DPRA 3REOA 1Q86D 1CNFA 2ZJRF 1WKMA 1YE9A 3ECHA 4A3LJ 2ZZFA 4BXUA 2EFPA 2BXZA 1LE8A 4Z4YA 2WA0A 3QP6A 2QQAA 2DFEA 3WYAA 3M07A 1OYWA 4A0XA 3CMAB 2VL8A 4BH9A 2O5RA 1W36C 4P55A 4IRGA 4L9JA 2CW8A 2M8GX 5J40A 4FN5A 4LFUA 5DD8A 1KTVA 2ZB9A 5A2QZ 1XGOA 3CUOA 3CPWB 4RB2C 1VHOA 3ZCOA 3L2QA 2ME0A 4QFMA 3AG1H 2GXAA 1SD7A 6PAXA 1FX7A 5FLXK 1OKRA 1OR7C 1QUFA 1HF0A 2VNIA 4V2FA 3LVBA 3K0LA 4IQ4A 3KCCA 1XTAA 1RETA 3F8NA 2OU2A 4YZ0A 1D1AA 3ONUA 3KEYA 4LLGF 2CK3A 2BN4A 3WU0A 3IH4A 2INVA 2CO5A 1J09A 3HHGA 1ZRDA 1TWFJ 2E1RA 3JQPA 4Z4TA 3WNDA 2Z5UA 4L9VA 4BEHB 2GK7A 3KIOA 2X1CA 5DM6F 1O8DA 1VQKB 2M0MA 4LBVA 1GVHA 5EMNA 4P5OA 1Y6IA 5FO0A 5LBQA 3QYBA 2KHMA 3SQNA 2Z6BD 3A8KA 1SAUA 4Q47A 2WV1A 1NG7A 1K6OA 2X0KA 3IL2A 3F0CA 3GO5A 4G7ZF 4FE7A 5J1YA 1SMYF 1Y8RB 2IT0A 4PC2A 1MW7A 2P4WA 3AVYA 2A6HF 4L9TA 2UXXA 1UD6A 4M2LA 4B09A 2VIXA 2DYRH 2EZIA 3BR1A 1BI0A 3HOXJ 1WMRA 2WB1A 4KA4A 5FRNA 1VQ5B 4CH7A 2NVQJ 3HKZA 1V55H 2EH3A 4RAZA 1PUEE 3DEUA 3G71B 2A6EF 1WJDA 1ZM3A 5B5EC 4W8RA 1KONA 3GF2A 1R5HA 5J8CA 2VFPA 4NDLA 1TT0A 4HBLA 1T6XA 3BP8A 3MVPA 2XEXA 1IDYA 2LY1A 3R6JA 5M5XJ 3M8JA 1BL0A 3GX4X 2I10A 2IGKA 1R9TJ 2GIVA 2LF7A 2NVXJ 2UV1A 1GT0C 3PO2J 1UMQA 2XGDA 2GA2A 1TYWA 3BT9A 1VQ4I 3PFYA 2LR8A 4LIUA 1V3FA 4LMYA 1EFTA 3LA3A 4FQGA 3VDXA 1D5VA 4UZEA 1QQ1A 1ZR2A 2PIAA 3F72A 5HKKA 4FXUA 4PC6A 2JSPA 4QIWN 4BQOA 1UD5A 4IVNA 2WJYA 3L2CA 3C2BA 2XF7A 3OZUA 1XG2A 4I76A 1SMTA 3FXUA 3OYBA 1F20A 1UB9A 1IA5A 2E2JJ 2O17A 1XMKA 3F8MA 4S04A 2M3AA 5L3CA 1YFHA 4ZYHA 1LUJB 2E19A 2GK6A 4N4OB 1T2KA 2OQRA 2DTZA 3R6SA 3W2FA 3I4MJ 4I0BA 2D2WA 5ILUA 1VQ6B 4R79A 3ZUGA 2M5SA 1VQLB 4ZCLA 4ESFA 5ICEA 2VJIA 3ASQA 5EZGA 1O8LA 2F5FA 1PJ5A 1W5SA 1YO5C 3GCMA 3HBLA 4DQLA 1QCXA 4TKOB 4QVAA 1R1VA 2L9VA 3QE2A 1MABA 4WZTA 5DN6A 3GQBA 4YALA 2ZL7A 2BEOA 3VSKA 3I4PA 2JA7J 3ZZ0A 3ML6A 2V31A 5DS9A 2Y75A 1KU7A 3WXMA 3VYSB 2M7AA 3H92A 4CGZA 1FYKA 2XGJA 4JBAA 3MMYB 2QZAA 3T1BA 1MSFC 2K9QA 2Z99A 2QMUA 3W2IA 4A3BJ 1WJFA 4MTEA 1P6RA 1Z91A 5D4RA 4I7HA 2I5UA 2L3DA 1JTAA 2HQ5A 2BF4A 3N05A 1E17A 4KMFA 1LE8B 2DQLA 3CJQB 4HSTA 2E1MC 4XSZF 5FD6A 2P5LC 2FE3A 2CW0F 2BV6A 4A5MA 4P12A 4X8IA 1OFLA 2N8GA 4Z1MA 4QLCU 2Z2SB 4NQWA 2YWHA 4Y9UA 1MBKA 3S1RJ 1QGAA 1CLWA 3WTZA 2UVFA 5JVGF 2LZJA 5CDFA 3UNGC 1L1IA 3BG3A 1FSEA 2RAEA 4KIFA 4BHPA 4DBQA 4Y7NJ 1JJ6C 1NTCA 4HRIA 1T6ZA 3F6VA 1MMDA 1ULYA 5FKMA 1TLHB 2ACJA 4PJNA 3RKQA 1ZUNB 1MJBA 4N3NA 3ZQLA 1TW2A 1VQ7I 2A5WA 2Q0OA 1QPIA 3HG9A 3AGPA 3U9GA 1G3TA 2CSOA 3OYFA 2ID6A 4WCGA 5KNLA 2VBYA 2ZZGA 3OYMA 3ZIAA 2BGCA 3L2VA 1BOBA 1PP8F 4DNCA 2CUZA 2M0CA 2DCUA 1N78A 1I7PA 4ENNA 2E7XA 2VFMA 3H94A 1HVXA 4E7SA 2L01A 1BLIA 2XZLA 3RDIA 1FP1D 4XK4A 4GFBA 4BPRA 1JNYA 1EF4A 1IHMA 4RPBA 1Q81D 4OOXA 2DW4A 2IGOA 1PUFA 1OMIA 2VC0A 2DA5A 2I8DA 3MCZA 4KN7X 5F0CA 3ZRGA 1H80A 1T6SA 3BR2A 1MDMA 5LD2C 1USSA 1CF7B 3A2KA 4C2MJ 3GTMJ 1SKQA 2GOXB 2IEKA 2NYXA 4G7XA 2XF5A 1H8HA 3CDIA 2NT9A 1KU3A 2F1LA 2KIQA 4X0GA 1C0WA 4IHVA 4Z03A 2QF7A 1ZK8A 5J6XA 1RC9A 4EJOA 2G9WA 2ECCA 1LFUP 4M6VA 1RUNA 4TT3A 2XZPA 4F3QA 2LYCA 4UUVA 1HKSA 2F3LA 1UAAA 2IXSA 4OJPA 2XGEA 1TWAJ 3RQ4A 1E3XA 4X05A 2MC3A 4BNCA 1N0UA 2AS5F 2EV6A 1K6YA 2ZJ2A 2KT0A 3SXYA 2HOAA 2C6YA 1JHHA 5LEJA 1GUUA 4L18B 1T08B 1UCRA 1B9NA 4WXDA 4A3JJ 4A2UA 2HXOA 1S8NA 4UB8C 1JUSA 2JSCA 1W7PD 2XAUA 2OQGA 4JX4A 2VJ4A 2HFHA 5CVJA 5HDNA 4FETA 5JHFA 2EPFA 3OIQA 5KK1A 1GHCA 3A8JA 1OCCH 2XKPA 1W0TA 3U6KA 2F5EA 1HZEA 4FCYA 3ZZUA 3FF5A 1ON1A 3DEEA 4MQVA 3CCQI 4UNOA 2BMWA 2CRVA 2M1BA 3PA2A 3PENA 2DXIA 2HTJA 3OIOA 1WJEA 2VQGA 2KZGA 1I27A 3TO6A 3H3VK 1ACIA 2Z16A 5BOXA 1V5VA 5TV2A 2G7UA 4L0YB 3FMRA 1BA5A 2F4OB 3LQ6A 4UUSB 3IRQA 1OHHA 4BE2A 1MBHA 1YG2A 2JJ7A 4AM3A 1PJ7A 1R1UA 1RKWA 2C2WA 5CLSA 2O1DA 2F4NA 3H0GJ 1YX3A 2DA6A 4DZPA 5JI6A 4OM9A 5TJJA 1IGNA 2STTA 1GO2A 4EJUA 3QP5A 2BM5A 2K9LA 1V54H 2Y9YA 2HVSA 3I71A 4XLPF 4GRIA 2DLLA 1ONVA 1SVMA 1FLIA 3PM1A 4MHGA 2L54A 1HF2A 2RVCA 1QVUA 3PUBA 3O3KA 2J5OA 2BSAA 2NV4A 3K1NA 5KCMA 2Y0MA 2UWMA 1MGTA 3WTXC 5F27A 1K8AD 2ZZEA 3DTKA 3ZMSA 2MD0A 1BC7C 1YITB 3L00A 2XUBA 3CB4A 5D4SA 3LAJA 2CUJA 1Q9SA 1B1BA 2GAUA 5JHUA 3LSGA 3OYLA 4HSRA 1G7CA 4RMNA 2BPOA 2VBTA 4R8HA 2V1DA 5DV5A 2PLFA 3ASSA 1ZREA 3S17J 3IH2A 3L9FA 2L9NA 4BE0A 1QFZA 2QN6A 4MR0A 2XNDA 1YJWB 1K78B 3OY9A 2OPTA 3CJNA 4TMVA 3CUQB 3B6AA 4CZZA 1VQOI 3S3NA 1N25A 2VQCA 3E1SA 1T33A 3JU4A 2XAGA 1YOVB 2Y48A 1B59A 1S7EA 3WTUC 2QEXI 1IRXA 5J1RA 2C4TA 1G2HA 1E3ZA 1FBUA 1W7PB 2EK5A 3O8GA 4BXXJ 4PC3A 3V8JA 1X58A 4O3MA 5DUKA 2CBXA 4X7EA 2LY9A 3A3BA 3BH6B 2ELHA 2ZSIB 1FBQA 1VF7A 3ZQIA 1Z3YA 4EJVA 2X48A 1VQMB 4Z6YA 3H1CA 2ZO4A 4DYRA 1KMHA 3ASRA 3RIQA 1MBFA 5FKNA 3JRIA 3FHNA 1Z6TA 2ZNZA 3DF8A 3I55B 1RESA 2EJRA 5L3BA 5C3EJ 4CCOA 1MDMB 4MYTA 1ZM4A 4W8TA 2HDWA 4YG2F 3VWBA 5HVQC 1WDTA 2HR3A 5IP6A 1Y0UA 5F1RA 1TQIA 4EQQA 1IJFA 1TTTA 4RDUA 1XDUA 3EQOA 1TP4A 5ERIA 4LC0A 5FA6A 2R7SA 2QKMB 3CZ6A 2WAQA 5CVUA 3RYPA 1LDDA 2COMA 2ADUA 2F4IA 1R7JA 4G1VA 1HCRA 2QVOA 5K5QA 2BHZA 3COAC 1YS6A 5EEAA 3I9V2 2DU9A 4NC8A 5E1ZB 2CS3A 4PAAA 1W4MA 1R4MB 5HLHA 5LRRA 1OJLA 2DQRA 1ZGJA 2VFOA 3GQ7A 4N3GA 2CQ7A 2XGCA 1WVRA 3M9AA 3OZVA 3GZ6A 1YJ9B 2V7FA 1O3TA 1AMOA 2VT2A 2CQQA 4YRVA 3OS0A 2W7ZA 4P1WA 1KTWA 1X4PA 1D8JA 3SLDA 4Z4SA 1P2FA 3S15J 1G4DA 1F4KA 4TMZA 1TZLA 5F08A 1W0UA 1A31A 5ILVA 2H94A 3SZEA 4NC6A 2YR2A 1Z0XA 4A69C 4KDPA 2ZBUA 2LKXA 1FNBA 5FFXA 4KIGA 2ZBKA 2AXLA 4DGWB 4KN4X 1NG6A 2R5ZB 2CGPA 3BZKA 2GA1A 3ECOA 3N4MA 3ONQA 3I56B 2CV2A 4A6DA 3A03A 3J81K 3FPPA 5DNSA 2CWEA 3JR9A 1E0EA 2ZL6A 1YHQB 2Z8GA 2MG4A 1Y8QB 1TLLA 2CNDA 4RJLA 2VBKA 4A3CJ 1BR1A 1MBJA 1U5TC 3QPTA 1OGJA 1R23A 1NK2P 4GYGA 3CESA 3VEPA 3M7GA 1EE6A 3ZN1A 3NWSA 3F22A 2BV3A 3MD2A 1NH3A 1ZELA 2ZSHB 3K69A 1RKTA 2HOSA 2IAIA 4II3A 4XKCA 1XE1A 4UB6C 1G7RA 3WTYC 4A12A 4AIHA 2VJJA 2VT3A 3EQNA 2JA2A 4M3FA 4OMZA 3W2WA 1IG7A 5CJ9A 2IA2A 1YIOA 3TDUC 1U9OA 1R5GA 1W0KA 4DNTB 1IAWA 1DUXC 4M3DA 3RI4A 2STWA 2R0QC 2VKVA 3HOZJ 5IT3A 2YX4A 5IT9Z 4HDVA 4ENKA 3CCSB 2V6CA 2E60A 1GVDA 4PUSA 1K8FA 3WE2A 4TV7A 2ZXJA 5DYMA 2IRFG 4LIVA 4LBYA 4LBZA 4PGHA 2UVEA 5D5WB 3A01A 4PMHA 5H6QA 1OCTC 2JJ2A 3F8FA 2GJPA 1P4XA 4IRIA 3P9IA 2Y9ZA 5KVRA 2V7UA 1LFPA 2K4BA 3S93A 3M3YJ 1S29A 3ZQ7A 2ME6A 3DV8A 5D6FA 4XIDA 1VQKI 3CW2A 2J8IA 4DNRB 3JRGA 4KJZA 5J35A 1STZA 1IC8A 2KL4A 3A8IA 5IYQA 4AIDA 1G3SA 3GTPJ 1JKQC 2JJ1A 3W5VA 4C43A 4RPDA 3CMEB 3D5RC 1B8IB 2XASA 3HTSB 3W5UA 3RZDJ 2XT4A 3ESWB 5L3GA 1WCMJ 2X1DA 1P7JA 5H2FC 1VQ8I 1NB0A 1ZLJA 4ACBA 4OIRF 2NTQA 1K79A 2E2HJ 1IN8A 1S9HA 2IP2A 3BR6A 3MKYB 1EJ9A 3BTCA 2WSSA 1D0YA 1XB2A 3B4NA 2CU7A 4MTDA 1W0JA 2C5HA 1EFRA 1RUOA 1QA2A 1XQBA 3EPZA 3OE7A 3PQKA 1KZLA 4XLFA 4YAFA 2KDOA 4CZCA 1R5BA 2D9RA 3OIPA 1JKRC 3WU1B 1UD4A 3NE5B 5AMVA 1I3AA 3ERED 2Q6KA 4JYKA 4BXFA 2NS0A 1VQOB 1N0VC 4ZYAA 2WB1N 2V7VA 1FPQA 1YJWI 3Q9SA 3IKVA 1DDGA 2V6EA 4D0PA 3CMYA 1HC8A 1H42A 1F43A 3VMFA 1KQ5A 1G3WA 4K2EA 2PQ8A 3TOAA 5CVVA 4YEJA 1O8IA 4RGUA 3T53B 4KITB 1BJKA 4G6IA 5FROA 2FOWA 3OPOA 1Y1VJ 3F9KA 1F5TA 1KQ8A 2YUSA 4XLEA 3LSRA 3Q0UA 1J59A 1BI3A 2P7CB 3JRAA 3KL9A 1VZ0A 5EG0A 2R7FA 1TUIA 2GJKA 2R7XA 2QENA 2UZKA 2R7RA 2WTEA 1KZHA 2I1LA 3LA2A 3OV8A 4ABZA 1ZG1A 2HDDA 4CHUA 1XDSA 4A3DJ 1DABA 4HPQA 3U21A 2DFIA 2MFZA 2OTLI 3GQAA 4URRA 1VNDA 1YLOA 4BJTA 4GCVA 4E0FA 1FC3A 4ZGQB 1X4OA 3V8KA 4RD1A 3E5UA 2ZXWH 2PJRA 3W2HA 1ZHFA 4OAZA 4EH1A 3F8CA 1PVEA 2BBYA 2DK8A 2DA3A 3CJTB 3OOPA 3T8TA 4F91B 1R49A 1DBOA 4UVCA 1JI8A 2K9MA 1F60A 1ETOA 1W5CC 1HDDC 1TW3A 3BC9A 1BJAA 5C44J 3SY2A 4IHXA 2Q1ZB 3LQRA 1D0XA 2HZTA 3D1NI 2D45A 2COBA 1A5JA 3HOSA 1WOOA 5F4OA 2DT5A 2OBPA 2W24A 5ICGA 4RM3A 4C3HJ 5L3FA 5L3DA 1CQXA 3CMAI 3S1NJ 5JVTA 3QFTA 2J8KA 3HL2A 1OLTA 3QFSA 3PA1A 4UAJA 4AF7A 2VKDA 1SD4A 4YFXF 3K70D 3D5LA 4F7ZA 4M0LA 2R7OA 2VJ5A 5J3LA 3CCLI 4X7DA 3H5AA 4I98B 4XN0A 3R0JA 4DK0A 5M5WJ 2VBVA 3LNNA 2JT1A 1R36A 5DM7F 5A8AA 2X6XA 3PUMA 2ESNA 2O3FA 3M1CA 1EFCA 2IS4A 3MZ8A 5K7ZA 2CRGA 3G4SI 2Q6IA 1E2XA 3RIRA 1UD8A 1ZN2A 1O8FA 1FX0A 5L46A 2YWGA 1YI2I 4CICA 4IF4A 2CYYA 5F0HA 1WH7A 3DTIA 3NAWA 4FX0A 1Y1WJ 5KHDA 3SYJA 2DI3A 2IVMA 1JUPA 2XRNA 4LBWA 5EGOB 4GXOA 1E3PA 3VMWA 3JURA 2K4JA 1FNNA 2EB7A 3K4KA 1H8AC 1TYVA 3WWGA 4WXCA 2WZPP 3K6GA 3V7RA 5AIQA 4XLAA 4B48A 3Q6QA 2PMZN 1JTXA 9ANTA 1FMWA 3FM5A 4UXNA 5LLQA 4IX7A 1R1TA 4I09A 1TQMA 2PG4A 2HGCA 3F3XA 1R5ID 4XRMA 4UVAA 2DY1A 1XGNA 2B0RA 3CC7I 4ESBA 1AIRA 4I6ZA 2L9SA 5C1EA 3ERMA 4X06A 1BN5A 1KGSA 2XAHA 4PSWA 1E63A 2EBIA 1GDTA 4RD4A 1B72B 4A0YA 3K4LA 4H9GA 4CSWA 3OYEA 5FD5A 5J4VA 5FGMA 4AIJA 2R5YB 1X3UA 3HRUA 2HKOA 2ZC2A 1ETXA 3JQRA 4Z4RA 3SJZA 3S32A 3C2GA 1HG8A 3E7LA 1X3WB 4FHTA 1H9TA 4Q5SF 2UUZA 3ABUA 4RAFA 2EIJH 1YS7A 1Z6RA 1Q1HA 2LK2A 2MD5A 3P27A 4B3GA 1IDKA 4UUSA 1SFOJ 3JTGA 1AKHB 4FTHA 3K4MA 4WF2A 4TMWA 3G3ZA 1JXSA 5DCMB 1PYVA 3ZP5A 4EM2A 1D1BA 1AHDP 1YYVA 4EJWA 2RDPA 5FKLA 2HPIA 1RQPA 1OFDA 3IWFA 3I59A 2OF7A 4MIMA 3OS2A 1Q7YD 3MKZA 1D3YA 1WGXA 2FQ3A 3D5SC 5HS7A 1NK3P 2GM4A 1FNCA 5IYPA 2EZLA 4YC5A 2JMWA 1T0FC 2FF4A 1U6GA 1IB0A 2MH9A 1K78A 4IXAA 4Q4ZF 4HE5A 2O0VA 2VBSA 2GLOA 4MXNA 4LB6B 2D1HA 4AYBA 2R7WA 4YDTA 4Y9RA 3GFJA 2H1KA 2X3UA 4RGRA 5IYDJ 1B9MA 2F6CA 1UD3A 3GUDA 1JE8A 4Q7JB 1QZEA 2W25A 3RPQA 2HDCA 1JA0A 3KYCB 5GADJ 1FRQA 1PP7U 3BY2A 1QQIA 2L4MA 4I2OA 2W6IA 4BL0B 3DEWA 3OW7A 5HNFA 1OFMA 1FOYA 3EQLF 2JPBA 3EUAA 1RI7A 2IOUG 1WJ5A 3FXLA 4WWCA 4IO9F 2DA1A 3FIWA 3P5JA 2LRDA 3RKWA 2Z33A 4EJTA 5K1YA 4WQMA 3DKWA 3HRMA 1ON2A 5D8KB 1PDNC 3O8HA 1FMVA 1S3JA 3JRCA 2JDIA 2P81A 3D26A 4X7CA 3CC7B 2VNKA 4B8XA 2BM4A 1WH5A 1DBGA 5LHGA 1LVKA 2DA4A 1Z05A 2V7WA 3O6BB 4BHCA 2W82A 1QA3A 1A6QA 2NSPA 2X53S 3BLYA 4KIBA 3NRVA 4PK4A 4FISA 3ZQQA 4MLOA 1QBJA 2XKOA 2W1OA 2NXNB 3CCMI 2LF8A 4BBSJ 1P92A 5ILSA 3OYDA 1CZFA 5E18F 2XAFA 4M9XA 2LD5A 1O88A 4BDYA 2X3HA 2R7TA 2QZ8A 4WZLA 4YAWA 3JTHA 4XNFA 4G5GA 1MJ9A 2KIUA 4ESJA 5C4XJ 5BPIA 3DWLE 4RS8A 3K9TA 5J47A 5HS9A 2AHOA 3OYAA 4OZYA 2DFHA 1POGA 2GBYA 3FY3A 1TNSA 3MZYA 2L0KA 2X0LA 2VXDA 4Y3OA 2Q8KA 3LAPA 3OS1A 5KW9A 2JN9A 1AIPA 1Z1DA 1TWGJ 3SZGA 3H9QA 1TL8A 5JLVC 2K9NA 1A35A 1QGYA 3HKZN 1X19A 2OCCH 2XDVA 4MGRA 3HIFA 2XF6A 1U2WA 2BOLA 1O3SA 2QYOA 3CC4B 2VFNA 4LOCA 1KQ0A 1ZG3A 3ONYA 2OBRA 3KLNA 2GJRA 4CDGA 2QBYB 4P96A 5E8GA 5EYRA 3I3LA 4IL6C 1K9MD 1VQ9I 4B47A 2JQ7A 5TISC 1W35A 2KMUA 4WZKA 1W87A 3U6BA 1N75A 1GJRA 3VSTA 3L2UA 4MYUA 4V19K 4P3IA 1OQYA 5LRSA 1UG2A 3VOEA 3GSIA 3GWZA 4PJLA 1W36D 2RC5A 2YUHA 2BE5F 2LMDA 1K4ZA 2DPDA 3SDGA 2L5QA 3GFIA 3GVLA 3BH7B 1XN7A 3EUHA 2RQQA 4G1BA 1KC8D 2VOPA 2C4UA 3BH4A 2BW3B 2DCEA 1PXZA 2ZMEB 4RDKA 2KISA 3ABTA 2VONA 1DGRM 4P25A 5AN9A 3ZOBA 1FOWA 2FQ4A 2K86A 4HOBA 2KDZA 3G6EI 1ZM2A 3CLOA 3P7NA 1I8DA 3V4GA 4AD9A 3O2PE 2ZBVA 1E3HA 2FXAA 4OAYA 2OTLB 1IN4A 1U9NA 1AA7A 3QFRA 1W1WE 1D1NA 4RLQA 4EM1A 2W4SA 3B8YA 2H8WA 2B7CA 5CVIA 1WJCA 3IAM2 5K7FA 4IKFA 2YWEA 3CCQB 2D3NA 3HUGA 1FZPB 3G73A 3Q6RA 5FO5A 2L7KA 2VBMA 3S1MJ 4OPVA 3I59B 1GAWA 4P9SA 3WU2C 2R6HA 1U0JA 2CQNA 1VQ9B 4B4CA 2E5NA 3GFMA 2V26A 1RZ4A 3WNCA 3EYIA 1DQUA 1QZYA 5GV7A 1KRHA 5HOOA 4N9IA 4HV6A 5EJCA 3IC7A 1RIOH 4PGGA 2DAOA 3RPUD 1QRBA 2JA6J 5EG0B 5EZHA 4NC7A 4BYYA 2QQ9A 4XRSA 2IS6A 2XT2A 2DDAA 2OC6A 2X85A 1R6RA 5IYWA 2HVRA 4B3AA 1QH0A 5M3MJ 3OR2C 3IH3A 3R60A 5M3FJ 3JQQA 1E1QA 3R4KA 3G1MA 3GLLA 3C18A 1SAXA 5E3NA 1JJ2B 2OZ6A 1SEUA 2CH0A 3CC2B 3E97A 1R5OA 3A02A 4AWXB 2JA8J 3OR1C 5HZBA 1U3EM 2JIZA 4A3FJ 3PL8A 3GQ8A 3K1PA 4M73A 1KK2A 3F6OA 4LK1F 3KP5A 4XLNF 1QFYA 2QWWA 2VPRA 4NQWB 4W8SA 1I1SA 4P3YA 3TP0A 4ZV4A 3LJYA 2W84A 5H6RA 2KLOA 1Y0NA 1VQ6I 3BDDA 3JREA 2K3PA 3IAS2 1K7AA 3MMPA 2CUFA 4CQJA 2O8KA 4IHYA 3M8EA 3BQYA 4F55A 4ROXA 4P2NA 2ODLA 4LGWA 4XKWA 1PJ6A 1VI0A 1FJLA 2LREA 3SZTA 3W2AA 4GGGA 4KYWA 3BCBA 2NNYA 5A89A 4AU7A 4DYQA 3LL7A 3K2AA 2Y69H 2HCJB 3ASPA 2P6TA 4HA8A 3U1KA 5A88A 1LFBA 5FFZA 1N8RD 3SEJA 1HOMA 1RQRA 1XB4A 1Z3XA 3CP8A 2QQ8A 4HLXA 4MEYF 3IRRA 1Y39A 2FVGA 2R7UA 2VASA 4JP0A 3AVVA 4J19A 4HLYA 5FO1A 5FLXZ 1SFKA 3T5XA 3CF5F 3J80K 1MMSA 3E20A 2A69F 3UR3C 1LB2A 4NHJA 4BKXA 4Y17A 3A01B 2M45A 3CUQC 1LKXA 4ZDPA 4EGZA 3LMWA 2JUGA 1S6LA 4PC7A 3NARA 5ICFA 2PN6A 2X8KA 3GRHA 2YS9A 2E71A 4KKSA 4O5VA 5GTHC 1HSTA 2UXNA 2DOAA 2LC2A 2BSPA 1QX4A 4RD6A 3JAMZ 5IYRA 5D5VB 4IHSA 2P5KA 1B8IA 2OA4A 2E1NA 2HTSA 2V5IA 4XKVA 3OW2B 4CCLA 2VZLA 2XB5A 4XR6A 4P22A 5B1AH 2Q6LA 3HJEA 3SJPA 2CV0A 2VUMJ 1N77A 2VC1A 5CPRB 2WR8A 1MH3A 3KLOA 3LSMA 2F5DA 4CYCA 2V9VA 2MH2A 3OFNA 1H0MA 1Z7LA 2P7VB 3E5XA 4OJ6A 2A07F 1XGMA 4LD5A 4HQMA 2QGGA 1FY7A 1FTTA 1H8EA 3SLNA 2K02A 1W34A 3BOQA 3OYHA 4RBOA 1ETQA 5LGTA 4KISA 4OIOF 3TQNA 2VODA 1LDKB 5BQTA 2ZFUA 1NDHA 4PC1A 1WSRA 4UY8I 2XZOA 2DETA 1ZR4A 2VPLA 3VNUA 4Z4UA 2BY0A 4P9FA 2OTJI 4CCMA 1UHMA 3H09A 2OV7A 2DT7B 3HSEA 1T98A 2LTPA 3TBIA 5M5YJ 4OJOA 4CUGA 3K2ZA 1XCVA 2MABA 4HNUA 3GYHX 1FT9A 1MMAA 4EGYA 4A3EJ 3CC2I 2W48A 5GPCA 1WXRA 3N97A 3B02A 3HOYJ 2MGQA 3TP3A 4OMYA 1MZBA 3RJPA 3I4NJ 5C1CA 2M4KA 3IKTA 3S2DJ 1GVJA 3HOTA 1OR7A 2KRFA 3BTLA 4BACA 4OJLA 1SD5A 3LA7A 4EV0A 3ZZTA 2HQAA 1FOKA 2F5CA 4HG2A 2V1UA 4BEHA 4Z4WA 4DZJA 4R1HA 3M4OJ 4AC9A 1QGPA 1REPC 3CP2A 3D0SA 4C3JJ 5K5OA 4V02C 2CW5A 3DCFA 4ZTJA 3QWLA 2DMTA 2IA1A 4MO7A 2MYSA 3FKJA 3SZPA 2PMDA 4RD0A 1U5TB 2D74A 2L7ZA 2FX0A 4KFCA 1JRGA 1R4NB 1QZZA 3WGIA 4RDJA 4XSXF 2QM3A 4E7IA 3ABKH 4M6XA 4DOZA 3KETA 1QUEA 2GQQA 4WXHA 4AF6A 4BU2A 1XG1A 2H27A 5H59A 1EFUA 3NQOA 4A5NA 2E1OA 2Z9OA 5LFAA 4ZDOA 2PEXA 4Y33A 2L4AA 3TGNA 3GTGJ 1FSHA 4D7NA 3NWTA 3BZ6A 1HSJA 3FMSA 1Y56A 2M2EA 3RKXA 3LFKA 4HNVA 3EUKL 5AONA 4JQFA 4BBRJ 2R4GA 5B66C 1JGSA 1G8XA 4DQ2A 1COWA 1N07A 3BNWA 4NBQA 1OFCX 4OPOA 2HPMA 4HW0A 1MRZA 4UZFA 2FMYA 1Q82D 3BY1A 4BHBA 4C2TA 2DA7A 4HV5A 4A0ZA 1IB4A 5EF6A 1OOCA 3PIOF 1BI2A 2FJ1A 2XAQA 1VLYA 1P7IA 5D6EA 3R0AA 3DU6A 3OKXA 5HLGA 2O0WA 5H20A 3G71I 3CCEI 2VE8A 3B82A 2VQHA 3IUOA 2JRTA 2Y0SA 5JBQA 1H9GA 3DP7A 1O8HA 2HXIA 2F48A 2W85A 1B4AA 1WQ2A 2Q2EA 3WE3A 1XC5A 4RGXA 2ZFWA 5E1XA 2ZZQA 1E64A 3CRZA 3A0HC 3ABLH 1KQSB 1WI3A 4G94A 4M1KA 3CO7C 2MSYA 3CMMA 5IP7J 2ZJPF 3AG4H 3CQZJ 2C78A 3FHZA 5HS8A 3V76A 2QLZA 2Z3YA 3DKXA 3FBIB 2WPDA 3GTJJ 1QPMA 2EFQA 5LGNA 2Q2EB 5E20A 1HLVA 2ZXHA 1O4XA 1DG1G 2OBSA 3RYRA 4RB1A 2OZUA 2Q6OA 1A36A 4A6EA 4Z4ZA 1V4RA 2XPWA 2DYSH 3BWGA 3J81Z 3WNBA 2NOJB 3EYYA 4ASNA 4F92B 2MBFA 5GAGJ 5H5JA 1IRGA 3RSNA 1E3OC 5DS0A 3T8RA 3BJOA 5IYCJ 3G05A 1OFEA 5GTIC 3QOPA 1HBXG 2A5YB 3FMQA 3A3GA 3GMEA 3OZWA 4JRAC 5JLXA 1UHWA 1WJAA 4IJAA 1QU3A 1ODDA 1S7OA 4A3GJ 3IWZA 2J7KA 5IYNA 1XPXA 2XNJA 4M71A 5A2QK 1IJEA 3NEUA 3PJRA 2BGJA 3A1PA 1KK3A 4PGOA 4Y15A 2L02A 2DMNA 4D1QA 3MFKA 3AKZA 3DTEA 4OOIA 3S2WA 2KIFA 4XLCA 1XS9A 1DP3A 2V7XA 2XC7A 4RLZA 1OGMX 1Z21A 2QXZA 5IK2A 2Y0SN 1P4MA 3QPSA 3RZOJ 5FB2A 2HLDA 2NRAC 1YI2B 4ACAA 1XSVA 2A61A 3OL4A 1K73D 1LVAA 5F04A 1X2NA 1YJNI 3ZBUA 3KEQA 4KMUX 3ZMVA 2JA5J 4LG3A 3AVUA 3JAMK 2EFGA 2INUA 2DFFA 1IXCA 1IZ1A 2VE9A 1YLFA 3GBGA 2PBIA 5L3EA 3TEDA 1MNMC 1EA3A 4Z4VA 4LG0A 3PETA 1XCBA 3FPKA 1XGSA 4JX6A 3T51B 3A4CA 1QHHD 1IF1A 3OOCA 3FISA 1K4SA 1XMAA 1FYLA 1P4AA 4ZDLA 1IRZA 2C5BA 4OP7A 1W9XA 4TSFA 2P0WA 2E1CA 4OJ5A 2TRTA 2B0LA 1WJBA 3GEZA 2FD5A 3FXQA 4Q48A 4M4SA 5K5RA 3KEOA 4BQAA 3HDDA 2L2OA 3CDHA 4PFOA 3G6EB 3J80Z 4E6KG 4C2LA 3KYLA 1USTA 3CCVI 1JKPC 4OU0A 2BXYA 2PMHA 4E70A 1SD6A 3EDPA 1OCZH 4S0HB 3AGQA 2K85A 3E6BA 2KVOA 2QDXA 5B3SH 1BW6A 1IN5A 4G6QA 4RCZA 2DEUA 3AAFA 1U2RA 2DN0A 3KZYA 5LMZA 2LVSA 1FBSA 2BHYA 2KFDA 2RV8A 4PZJA 2KPMA 4QPQA 3OSGA 5HXBA 1VQ7B 3R61A 4HF0A 3QPHA 2VBXA 2BYVE 3F8BA 3IP4B 4IEJA 4YFKF 1S0UA 1MNEA 1OCPA 4YZQA 1U5TA 1N06A 2VBZA 1O8KA 4UVBA 4XL9A 1EZGA 2VXZA 3CCYA 4BJ6C 1HW2A 2QSFX 3GXOA 3HM5A 1X1BA 2NOGA 2HQRA 2HKXA 3I54A 3MZHA 1QRYA 4QPOA 3I56I 2WWYA 4CYCB 1OCRH 2MLGA 2JK3A 4H0EA 2EINH 1B2RA 1OGIA 2VKEA 4KT6A 4NUBA 1DDIA 2HZDA 5DCMA 4M9ZA 1YX5A 4BQQA 2PYGA 1W2BB 1VLOA 4IRHA 3SFZA 3N6ZA 4WK8F 2BY1A 1HW1A 4UUTA 1FEXA 3ISPA 1M1EB 2HEOA 3VYRB 2HYFA 5F4JA 3T0YA 4OPWA 3GTKJ 1T56A 2DT6A 1ZARA 3HGYA 5FLVA 2W6JA 2E1BA 3TL4X 2EILH 2V9KA 3OEHA 3QYFA 4MEXF 3LSHA
chains in the Genus database with same CATH topology
2NSPA 5CQEA 2X53S 3BLYA 1V0EA 3E0JB 4PK4A 4E7LA 3VSVA 2KP6A 3ZQQA 2XAUA 4MLOA 2VJ4A 2W1OA 4EW9A 4NK8A 2O04A 4NNJA 4FETA 5JHFA 3OIQA 1V5EA 3OYDA 1CZFA 3VSUA 2KRCA 3H0DA 1O88A 4BDYA 2AQEA 2V7QA 2R7TA 1HZEA 2X3HA 1BPLA 3DEEA 4XNFA 2VKHA 1O8MA 4IZZA 1GLNA 2DXIA 2EWEA 3DWLE 4F52A 1WJEA 3DPTA 2VQGA 1MMNA 3OYAA 4J01A 4OZYA 2Z16A 3FY3A 4E7KA 1E79A 2WBMA 4Y3OA 2VXDA 4XONA 3OS1A 3AL0C 3K10A 1T5EA 3LFUA 3PSFA 2LH9A 2DJIA 2QY1A 1OHHA 3G2BA 3SZGA 3H9QA 3OYCA 5HLTA 4BE2A 3C2HA 1X19A 2XDVA 3EUHC 3OOUA 5TGTA 4ANJA 2XF6A 2O1DA 2BOLA 4AVZA 1YX3A 3OYKA 2RNGA 3DDYA 3AFHA 4U7BA 3BCAA 4C2UA 2GJRA 3AL0B 3I3LA 3LSIA 2IS2A 3CJRB 2K9LA 1P9QC 4B47A 3LSKA 2HVSA 3OWTA 4GRIA 1WFXA 2KMUA 1WPCA 1N75A 3VSTA 1X1AA 2LG4A 3L2UA 3A35A 2HVQA 4PJJA 2VLAA 3OEEA 2JVHA 3BCDA 1V0FA 2HU9A 3OYGA 3HXLA 4PJLA 2W00A 1W36D 3PUBA 5KCMA 2R7QA 2UWMA 3GVKA 2R7VA 1BR4A 4DIQA 3OAAA 2L5QA 1OGOX 4RM2A 2ZZEA 3DTKA 3GVLA 2RQQA 2MD0A 1UG0A 4B3XA 4F93B 4B3FX 3BH4A 2BW3B 2CUJA 2DCEA 3OYLA 1PXZA 3LSGA 3OYJA 4HSRA 1NRKA 4RMNA 1ERDA 1DGRM 2LBFA 4G6TB 4XM3A 1I8DA 1UELB 3OYNA 3H35A 3H9JA 2L9NA 4BE0A 3QODA 2K5CA 4OAYA 4XN3A 4BS9A 4MR0A 3K4BA 1AA7A 2XNDA 3HPGA 3OY9A 4RLQA 1RWRA 2W4SA 3B8YA 2JVGA 1WJCA 3IAM2 2XSJC 2WY7Q 4IKFA 4ITVA 2D3NA 3S3NA 2VQCA 3E1SA 2L7KA 2VBMA 3JU4A 2BVMA 1DGWY 2WJVA 1IRXA 1E3ZA 4RLFA 1U0JA 3J7AY 3A1YA 3W3CA 4FASD 2E5NA 2OUMA 2V26A 3DQVC 4XD7A 1DQUA 3A3BA 2ZSIB 2KQRA 5HOOA 1VF7A 4J00A 1Z3YA 3RPUD 3ZSCA 1KCDA 1X0CA 4NC7A 3SDBA 2IS6A 2OC6A 1KMHA 2X85A 1R6RA 3BG6A 5CQGA 4DK1A 2HVRA 3FHNA 4XORA 3DPUA 3FDYA 4B44A 3OR2C 1RMGA 1RU4A 4CCOA 2RREA 4DJAA 1E1QA 4W8TA 4ASUA 2HDWA 3VWBA 5HVQC 1GQ8A 2CH0A 2NTBA 3EQOA 1E1RA 3OR1C 4N4NB 2R7SA 2QKMB 3CZ6A 2WAQA 2IQ7A 4C30A 2JIZA 3PL8A 4XOPA 2F4IA 4YELA 3GQ8A 1KCCA 2DIEA 3S3OA 4YXWA 3OL3A 2F43A 2A6TA 3I9V2 4NQWB 1PE9A 4NC8A 1X1CA 4W8SA 2CS3A 4BE1A 3ZPPA 3DU5A 2KLOA 2F1MA 3GQ7A 2XOKA 2IGMA 2W7NA 2K3PA 3IAS2 3QOEA 4BUPA 2V7FA 4YRVA 3OS0A 4P1WA 3TMOA 1KTWA 1X4PA 2QKLB 4OWRB 4F55A 1PKVA 2ODLA 2ZXIA 4XKWA 1TZLA 1E43A 2LREA 2MC4A 3W2AA 3VYTB 2E5ZA 3VYUB 3BCBA 3BG7A 2R9VA 2CV1A 4AU7A 3L2WA 3LL7A 1VBLA 4XOTA 2VBEA 3SEZA 2PYHA 3WQZA 3H9GA 3ZR8X 2BW3A 4DGWB 4UZUA 3OYIA 1NG6A 1NBMA 3CP8A 1Z3XA 4XMYA 2WY8Q 4NK6A 3B90A 3KRGA 3ONQA 4XQFA 2VASA 4C9YA 2R7UA 2CV2A 1PLUA 3FPPA 1E0EA 1SFKA 2Z8GA 2QE7A 2ZTNA 3UR3C 2X1EA 2VBKA 4YZXA 1BR1A 2IS1A 1LKXA 2KZVA 3MKWB 1IDJA 4ZDPA 3LMWA 2JUGA 4PJMA 3CESA 4Z05A 1EE6A 4ZTFA 2X8KA 1WTHD 3NWSA 3HAGA 1I18A 3GRHA 3KEWA 1O8JA 3MD2A 4KKSA 1ZELA 2ZSHB 1BR2A 4II3A 4XKCA 1BHEA 2DOAA 3HPHA 2LC2A 2BSPA 1G59A 4H4KC 4II2A 2VJJA 3EQNA 2JA2A 3W2WA 4U4BA 5HNHA 4BJ5C 1W0KA 4XKVA 4ZC3A 4CCLA 4E4HA 4XR6A 4P22A 4DNTB 4B43A 2WAEA 4KKTA 4CCJA 2CV0A 1N77A 5CPRB 3VSLA 3LSMA 2E60A 4PUSA 1O8GA 3OFNA 1Z7LA 3SUCA 3K70C 4BQNA 1MNDA 4CCNA 4JMQA 4OJ6A 1HA8A 4JOMA 4ZJZA 3PSIA 3FKSA 4LIVA 3ZPNA 3H5RA 1H8EA 2UVEA 2V4JC 3OYHA 4PMHA 4KISA 2JJ2A 2VB6A 3PNYA 2GJPA 2NSTA 1LDKB 2ZFUA 2IGNA 2XZOA 2VPLA 3W2VA 1LFPA 3S93A 3K4CA 3ZGKA 1OB0A 2BVLA 4CCMA 2OV7A 2DT7B 2Z1DA 4DNRB 2NTPA 4HEA2 3TBIA 4OJOA 4KJZA 4CUGA 1K28D 2MABA 2KL4A 3H5NA 4HNUA 1MMAA 2JJ1A 3D5RC 3FBNB 1VJSA 4YZAA 2X1DA 4U87A 2NTQA 4HWVA 1S9HA 2PMZA 3MKYB 2CMPA 2HNHA 2WSSA 2M4KA 1D0YA 5C1CA 3B4NA 3HOTA 4BACA 1W0JA 4OJLA 3UW0A 1EFRA 2HQAA 4HG2A 1YE9A 3EPZA 3OE7A 4BEHA 2ZZFA 1KZLA 4XLFA 2WA0A 2KDOA 4CZCA 3CP2A 3OIPA 4ZTJA 1UD4A 5AMVA 3NE5B 2VL8A 2O5RA 1W36C 2MYSA 3FKJA 2CW8A 4BXFA 3VMVA 1NHCA 4IQJA 4ZYAA 2M4GA 3GVJA 3ZCOA 3L2QA 1JRGA 3VR6A 4D9JA 4E7IA 1OR7C 2V6EA 4DOZA 2PJRB 4IQ4A 4LITA 4W8QA 4BU2A 4E7ZA 1K5CA 4YEJA 1O8IA 4YZ0A 1D1AA 5CKTA 3KEYA 3T53B 4KITB 4BDZA 4I84A 1X1DA 4ZDOA 2FUG2 5LFAA 2CK3A 5FROA 4Y33A 2D3LA 4G6IA 2INVA 1J09A 3OPOA 1O8EA 3PNTA 3F9KA 4BEHB 3S3MA 3NWTA 4E7HA 2GK7A 1Y56A 4EATA 4XLEA 1UD2A 3T9GA 3EUKL 1PJRA 4JQFA 1VZ0A 2X1CA 1O8DA 2GJKA 2R4GA 2R7XA 2M0MA 1G8XA 2R7RA 2X51A 1Y6IA 4P5OA 1COWA 1T95A 3QYBA 2KHMA 2Z6BD 1SAUA 2CFOA 4HPQA 3U21A 2MFZA 2HPMA 3QYEA 3GQAA 4URRA 1NG7A 2GOMA 4Z06A 4C2TA 4BJTA 1MW7A 4E0FA 1X4OA 3DKYA 1IB4A 4DBRA 1UD6A 1OOCA 2VIXA 2PJRA 4OAZA 1VLYA 4F91B 3DU6A 1WMRA 2WB1A 5FRNA 2O0WA 3GQ9A 4CH7A 3HKZA 3HC7A 2E1MB 2VQLA 2VQHA 3IUOA 2Y0SA 1DBOA 1JI8A 2X6WA 1O8HA 1WJDA 2K9MA 3BC9A 1BN8A 4W8RA 1D1CA 1KONA 2NT6A 3RCOA 2Q1ZB 2ZZQA 1D0XA 1TT0A 3HOSA 2LY1A 4RM3A 2WAFA 3V42A 3CMMA 3M8JA 2V1NA 2IGKA 5FRMA 4XLHA 2UV1A 3HL2A 1OLTA 3DKXA 3FBIB 3DLAA 3PFYA 2VKDA 4LIUA 2WPDA 3VDXA 2Q2EB 3K70D 3D5LA 2ZXHA 5HKKA 2R7OA 2VJ5A 4FXUA 2JSPA 1V5FA 3H5AA 4XN0A 4BGDA 4DK0A 3DPLC 3LNNA 4BQOA 1UD5A 2WJYA 2NOJB 4F92B 4GQNA 2XF7A 3RSNA 1XG2A 2X6XA 2LOOA 3M1CA 3G05A 3OYBA 3A3GA 2IS4A 4KKUA 4OZZA 1UD8A 1O8FA 1IA5A 1WJAA 1QU3A 1FX0A 2O17A 2M3AA 1V5GA 2GK6A 4N4OB 3PJRA 4PSXA 3DTIA 2V4DA 4R79A 2LBFB 4D1QA 5KHDA 2M5SA 3AKZA 3DTEA 1DP3A 4XLCA 2VJIA 1OGMX 3ZXSA 2XC7A 1O8LA 3VMWA 3JURA 1Z21A 2QXZA 5IK2A 3K4KA 3WWGA 2PECA 2WZPP 3K6GA 1QCXA 2HLDA 4XLAA 4TKOB 4B48A 1MABA 1FMWA 5DN6A 4IX7A 2QX3A 3GQBA 1K6YA 3OL4A 3VSKA 3BCFA 4CCKA 4LG3A 2V31A 1MMGA 2INUA 3VYSB 1AIRA 2M7AA 3SEQA 3PNVA 3GBGA 4HNTA 2L9SA 3L2RA 2XGJA 2ZTGA 5C1EA 1EA3A 3MMYB 4E7JA 4PSWA 3T51B 3A4CA 1QHHD 3OOCA 1WJFA 3K4LA 4CSWA 3OYEA 4ZDLA 4TSFA 1JTAA 1W9XA 3KX2A 2P0WA 3CF2A 3N05A 1QHGA 3CJQB 1WP6A 4HSTA 2E1MC 4OJ5A 3S32A 1OFLA 3C2GA 1HG8A 4Z1MA 2Z2SB 2UUZA 1WJBA 2M7BA 1QJVA 2UVFA 2LZJA 5CDFA 4B3GA 3UNGC 2L2OA 1IDKA 4PFOA 4CA0A 4C2LA 4E6KG 3KYLA 4DBQA 4HRIA 3K4MA 4U49A 1PYVA 1MMDA 4PJNA 1D1BA 2WADA 3K4NA 2HPIA 2A5WA 3HG9A 3T56B 4HIZA 3OS2A 2KVOA 3MKZA 3D5SC 3OYFA 5KNLA 3LMMA 1T0FC 2ZZGA 3OYMA 3ZIAA 3L2VA 1BOBA 1BMFA 2CUZA 4QPQA 2KPMA 4Y4RA 1N78A 2X6YA 2O0VA 3OMYA 4MXNA 3H94A 1HVXA 3S8PA 3IP4B 4E7SA 4L8JA 4AYBA 2R7WA 1MNEA 4YZQA 3SYTA 1BLIA 2XZLA 1O8KA 4XL9A 2VXZA 4BJ6C 1X1BA 2F6CA 4PFPA 2IGOA 1UD3A 2I8DA 3ZRGA 2ELJA 1H80A 4QPOA 5LD2C 3A2KA 2GOXB 2W6IA 4BL0B 3OW7A 5HNFA 4G7XA 1OFMA 2XF5A 1H8HA 2NT9A 2KRHA 5FL7A 4KT6A 3K4JA 4NUBA 2HZDA 4X0GA 3HUGB 1D0ZA 1YX5A 4BQQA 2CW7A 2PYGA 3EUAA 4Z03A 1WJ5A 2NZMA 2LRDA 1SKYB 3VYRB 2AQFA 4TT3A 2XZPA 4XKBA 1FMVA 4F3QA 2LYCA 2JDIA 2DT6A 4G7WA 1UAAA 2IXSA 3BC8A 3RTRA 2W6JA 1DBGA 4OJPA 2E1BA 2LY2A 1LVKA 3RQ4A 3TL4X 3LSHA 1E3XA 2V9KA 3OEHA 3QYFA 2F5VA 2W82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSP A;  1GQ8 A;  4OZZ A;  1O8F A;  1IA5 A;  2O17 A;  2NTB A;  3EQO A;  3VSV A;  4YZA A;  2IQ7 A;  4NK8 A;  2O04 A;  4EW9 A;  2NTQ A;  4HWV A;  4XOP A;  4YEL A;  1CZF A;  3GQ8 A;  3VSU A;  5C1C A;  1O88 A;  1KCC A;  3B4N A;  2X3H A;  3UW0 A;  4OJL A;  4XLC A;  2VJI A;  1OGM X;  1PE9 A;  4XNF A;  1O8L A;  4W8S A;  3VMW A;  1O8M A;  2EWE A;  3JUR A;  2QXZ A;  3ZPP A;  3WWG A;  2PEC A;  4XLF A;  1QCX A;  3GQ7 A;  4OZY A;  4XLA A;  3FY3 A;  4XON A;  2QX3 A;  5AMV A;  1KTW A;  2QY1 A;  3VMV A;  1NHC A;  2ODL A;  4XKW A;  2INU A;  1AIR A;  1JRG A;  2O1D A;  5C1E A;  4AVZ A;  1VBL A;  4XOT A;  2VBE A;  2PYH A;  1K5C A;  4W8Q A;  4YEJ A;  1O8I A;  4YZ0 A;  4I84 A;  1JTA A;  2INV A;  4XMY A;  4NK6 A;  3B90 A;  3KRG A;  1O8E A;  4XQF A;  4OJ5 A;  1OFL A;  1HG8 A;  1PLU A;  3VST A;  4XLE A;  3T9G A;  2Z8G A;  1QJV A;  2UVF A;  1O8D A;  2VBK A;  4YZX A;  1IDK A;  4C2L A;  1IDJ A;  4U49 A;  1OGO X;  3LMW A;  4Z05 A;  4URR A;  3GQA A;  1EE6 A;  4Z06 A;  3GRH A;  1O8J A;  1PXZ A;  1BHE A;  1IB4 A;  1OOC A;  2BSP A;  1WMR A;  2O0W A;  4XM3 A;  3GQ9 A;  2O0V A;  1XG2 A;  2X6Y A;  2VJJ A;  1DBO A;  4MXN A;  3EQN A;  4XN3 A;  4MR0 A;  2X6W A;  1O8H A;  4YZQ A;  4U4B A;  1O8K A;  1BN8 A;  4W8R A;  4XL9 A;  1RWR A;  2NT6 A;  4XKV A;  3B8Y A;  4XR6 A;  1H80 A;  2VBM A;  1O8G A;  1OFM A;  3SUC A;  2NT9 A;  4OJ6 A;  4XLH A;  2PYG A;  4Z03 A;  2NZM A;  2UVE A;  3ZSC A;  1KCD A;  1X0C A;  4PMH A;  2X85 A;  2NST A;  4XN0 A;  4XOR A;  1RMG A;  4OJP A;  1RU4 A;  1DBG A;  4W8T A;  2NTP A;  2X6X A;  4OJO A; 
#chains in the Genus database with same CATH topology
 1JHF A;  1B72 A;  1GV2 A;  1T38 A;  1S72 B;  1K61 A;  1V0E A;  1BOA A;  1VHE A;  3E0J B;  4M74 A;  4B1R A;  4E7L A;  3HOU J;  2YU9 J;  2KP6 A;  3VSV A;  5HOD A;  1O3R A;  3NAU A;  3JSP A;  1KK0 A;  2O04 A;  4NNJ A;  4EW9 A;  3F23 A;  1O7F A;  4BY7 J;  2ISY A;  1QVT A;  1VQL I;  3VSU A;  1KU9 A;  4Y7C A;  4ON0 A;  4ZYG A;  2XGX A;  2V7Q A;  5IOZ A;  2K27 A;  3SJM A;  1EP1 B;  3GZ5 A;  2VKH A;  1O8M A;  2ICW G;  1GLN A;  5EEG A;  3TOB A;  2YU3 A;  4IZZ A;  1BIB A;  3BR0 A;  1BQE A;  4F52 A;  2RQP A;  5IT9 K;  1G7T A;  1K4T A;  1BW5 A;  2ZIT A;  1O3Q A;  3QRF F;  3BZC A;  3DLL F;  2D5V A;  2WBM A;  3LOC A;  3UKG A;  4XON A;  4NCN A;  1R5N A;  3AL0 C;  1T5E A;  5ED4 A;  5TRD A;  2GPJ A;  2K9S A;  2FU4 A;  3G2B A;  4EVI A;  5HLT A;  3GW2 A;  3WHB A;  3EUH C;  3B78 A;  3OOU A;  5TGT A;  3S14 J;  4ANJ A;  1QA1 A;  1XSD A;  1IN7 A;  2XC1 A;  2FEZ A;  3OYK A;  2RNG A;  3HRS A;  2MLK A;  3C7J A;  2V7T A;  2K3F A;  3AFH A;  4U7B A;  3AL0 B;  2OCE A;  3SQV A;  2P5V A;  3CJR B;  2M5W A;  1P9Q C;  1Q1V A;  3LSK A;  2YX7 A;  1F9N A;  3OWT A;  4W97 A;  1WFX A;  4AVP A;  5LHH A;  2CG4 A;  1WPC A;  4ENJ A;  2R92 J;  1X1A A;  3A35 A;  2EZH A;  4PJJ A;  4G9Y A;  2JVH A;  1S4M A;  2HU9 A;  3FK7 A;  1HKQ A;  2VYQ A;  2M8E A;  1GAQ A;  2X6O A;  2ISZ A;  4YII A;  2R7Q A;  3Q5F A;  1JUM A;  2R7V A;  1BR4 A;  4DIQ A;  4M72 A;  2OYN A;  3GVK A;  1OGO X;  3W5H A;  4YEI A;  2HWV A;  5F0F A;  1UG0 A;  4LJZ F;  2FA5 A;  3Q0V A;  4B3X A;  1BC8 C;  2IBD A;  1DU0 A;  3B73 A;  3ZMD A;  4U7D A;  1LLZ A;  3V7C A;  4B3F X;  3C1D A;  3H3U A;  2EFW A;  4G7H F;  1NRK A;  3IHU A;  4RAY A;  3GLX A;  1TQP A;  3Q38 A;  2LBF A;  3M1E A;  5CYV A;  4G7O F;  1ZYR F;  3M8F A;  5IP9 J;  3CCR B;  1OYI A;  1UEL B;  3OYN A;  5DTD A;  3H9J A;  3QOD A;  5GV8 A;  3CD6 B;  1X3Z B;  2XB0 X;  4BS9 A;  5DDG A;  1B23 P;  3K4B A;  3VB2 A;  3HPG A;  1L3L A;  4L5J A;  3ROU A;  2JVG A;  1AOY A;  2WY7 Q;  2CJJ A;  1U8B A;  4ZCM A;  1J75 A;  1QFJ A;  1DGW Y;  2WJV A;  3GVA A;  1A8P A;  3MN2 A;  4AYB N;  4RLF A;  3J7A Y;  4CXF A;  2PLY A;  1YHQ I;  3W3C A;  4FAS D;  1Y0Y A;  5TR9 A;  3FXK A;  3CCJ B;  3ISX A;  3JCU C;  1ZTR A;  4HX4 A;  3MAJ A;  3S1Q J;  3ASN H;  4J00 A;  2JUC A;  1FNM A;  3ZSC A;  1I6H J;  2F2E A;  1LQ1 A;  5CQG A;  2L7F P;  3FXR A;  1YX2 A;  4DK1 A;  4UV9 A;  1TC3 C;  2DJN A;  1RMG A;  4B44 A;  2K7L A;  1XSX A;  2DOD A;  2ZL5 A;  4G6D A;  4KNY A;  2RRE A;  5J4Y A;  2XVC A;  2XPV A;  2FSW A;  2JWT A;  1GQ8 A;  3TO9 A;  2XPU A;  3IV5 A;  4QUZ A;  1X2M A;  2A05 A;  2NTB A;  2BVN A;  3WTW C;  4KUM A;  4ETS A;  4YCQ A;  2IQ7 A;  3BJA A;  1T8I A;  4QVJ A;  5E3M A;  1KYW A;  3H3Z A;  1KCC A;  2OK7 A;  2DOE A;  3LO8 A;  3G4S B;  3S3O A;  3OL3 A;  5FLM J;  2EIK H;  2F43 A;  4NB5 A;  1PE9 A;  3RPU A;  1X1C A;  1N08 A;  5IYB J;  3KP6 A;  2KJB A;  2NNN A;  3WGG A;  2VNJ A;  3DU5 A;  5B6I A;  1SAN A;  5DD4 A;  3WGH A;  2H09 A;  2IGM A;  2XOK A;  1IXS B;  1T39 A;  2NS7 A;  3QOE A;  4BUP A;  3CUQ A;  5E3O A;  4OWR B;  3KP7 A;  5IOY A;  1Z7U A;  1UMK A;  5FJ8 J;  5J3O A;  1I3Q J;  1PKV A;  1JKO C;  2R93 J;  2ZXI A;  3CTA A;  2P6S A;  3CCS I;  5BPD A;  1LEB A;  1E43 A;  3ZC3 A;  3QU3 A;  3I55 I;  3VYU B;  3I1F A;  3BG7 A;  3VO2 A;  3CCE B;  2R9V A;  1VBL A;  3PIP F;  2PYH A;  4NBS A;  2ZME A;  4P26 A;  4UZU A;  3WQZ A;  2BW3 A;  2ZME C;  1FP2 A;  2B7B A;  3LNQ A;  5HLI A;  1O57 A;  3RKY A;  5GAE J;  3KZZ A;  2DMU A;  4PDK A;  1IV8 A;  4K1X A;  3KRG A;  2RNJ A;  4XQF A;  4C9Y A;  3LQQ A;  1PLU A;  3AVT A;  2ELK A;  2WC2 A;  1DPU A;  2WV0 A;  5THX A;  4LK0 F;  5KAF C;  4YZX A;  3X2Q H;  2IS1 A;  5BMZ A;  1GXP A;  3F21 A;  3CCV B;  4RCY A;  3BQJ A;  1MJA A;  3HRT A;  5E17 F;  3WHC A;  2JTV A;  4D5C A;  2RC6 A;  4Z05 A;  4ZTF A;  1JA1 A;  4OIP F;  1TVC A;  1WTH D;  2XHK A;  2AXT C;  1I18 A;  4YFO A;  1O8J A;  2O61 A;  1FDR A;  2B5O A;  3ABM H;  1VTN C;  1YTY A;  3FJO A;  1BR2 A;  3LWF A;  4YAO A;  1OB2 A;  2O6W A;  2V1X A;  1MIJ A;  4I02 A;  3GIR A;  4QWQ A;  3P4G A;  3MQ0 A;  4LG0 B;  2A68 F;  2Y30 A;  3I5U A;  4H4K C;  4L5I A;  4II2 A;  2QA4 B;  1QRC A;  3VO1 A;  3E1Y E;  2PJP A;  3FZV A;  3VFZ A;  4ZZL A;  2BGI A;  4U4B A;  4C3I J;  3AG3 H;  3BPX A;  2WAE A;  3ELK A;  3I58 A;  4I01 A;  4B43 A;  2EFO A;  4CCJ A;  2HOE A;  5IY5 H;  4UV8 A;  1R00 A;  5LGU A;  1QA6 A;  1YJN B;  3AVX A;  2FOK A;  2W57 A;  1ETV A;  3SUC A;  3V8L A;  4P1V A;  3OJX A;  4BQN A;  1MND A;  4CCN A;  4JMQ A;  2AHQ A;  1HA8 A;  4JOM A;  3ZPN A;  3I53 A;  3H5R A;  3ASO H;  3K1M A;  1YJ9 I;  4U0W A;  2EIM H;  3ZQG A;  2RGV A;  2V4J C;  2PMU A;  2VB6 A;  3PNY A;  3W6V A;  3Q9V A;  3WTS C;  2L9R A;  1CGP A;  2OK8 A;  1O7L A;  2IGN A;  4X1E A;  3K4C A;  2O6G E;  1J2X A;  2Z1D A;  4RA2 A;  4RB0 A;  3OP1 A;  1K28 D;  1DAR A;  3H5N A;  3Q0W A;  1SM4 A;  1BM9 A;  2CFX A;  3GTQ J;  1KU2 A;  2RKH A;  2VBU A;  3PUN A;  3CLQ A;  3FBN B;  1VJS A;  4YZA A;  1IUF A;  4B4D A;  2DBB A;  3KE2 A;  1ETW A;  1G6N A;  1T0F A;  4XRS G;  3UW0 A;  5HDK A;  2IJL A;  3ES9 A;  5F6F A;  5EDN A;  2FBH A;  2EA2 A;  3BG9 A;  1FWZ A;  2BM1 A;  1VQN I;  3CCJ I;  1CF7 A;  2DTR A;  2QCO A;  2O8X A;  1WI9 A;  3ULQ B;  4DQK A;  3TW6 A;  1PUF B;  4HF2 A;  2H6C A;  2BY2 A;  3DBR B;  1JTY A;  2GRE A;  3VMV A;  1IN6 A;  4R71 A;  2HYG D;  4IQJ A;  1NHC A;  3FXM A;  1Z67 A;  2M4G A;  4P6Y A;  4V2G A;  1NB9 A;  3GVJ A;  1KYZ A;  5LEK A;  1JT0 A;  3VR6 A;  1WWX A;  4D9J A;  1WSV A;  1OIS A;  3CD6 I;  5TY0 A;  1GXQ A;  2PJR B;  2CUE A;  4LIT A;  2JN6 A;  4E7Z A;  3J7Z I;  4AUX A;  2XSD C;  3GTL J;  3CCU B;  2VFQ A;  4W8Q A;  3BR3 A;  5CKT A;  3U1D A;  1ZH5 A;  1ETK A;  2IW5 A;  4IOC F;  1X1D A;  4BDZ A;  2FUG 2;  1WZ2 A;  2BM7 A;  2D3L A;  2HMA A;  2Y2Z A;  4YHB A;  1BI1 A;  3NB2 A;  1FND A;  4X6A J;  2DOG A;  1FIP A;  3PNT A;  1O8E A;  3S3M A;  4E7H A;  4PCQ A;  2CQX A;  1MH4 A;  4EAT A;  2EV0 A;  1UD2 A;  3T9G A;  1PJR A;  3BPV A;  4L5E A;  1LM1 A;  3VPR A;  3V7S A;  4AC0 A;  1J9I A;  1QVG B;  2P8T A;  2X51 A;  5DUI A;  5KSW B;  1T95 A;  3FWE A;  1I6X A;  3CCU I;  1BBY A;  2CFO A;  3P9C A;  3QU6 A;  2QSH X;  1GR1 A;  1KD1 D;  3QYE A;  3P26 A;  2GOM A;  4Z06 A;  3J81 k;  4HZF A;  4U0V A;  3DKY A;  4XBF A;  4Y13 A;  2ZCW A;  1VFC A;  4DBR A;  1KK1 A;  4EM0 B;  2JPC A;  3HEF A;  3B6C A;  1ZAO A;  3GQ9 A;  3HC7 A;  2E1M B;  1AKH A;  1I50 J;  2VQL A;  2XRO A;  4YAU A;  4EEF G;  2X6W A;  4W1U A;  1VQN B;  1BN8 A;  2QGU A;  1D1C A;  1ORK A;  1S5L C;  3G1O A;  1XMX A;  4UHT A;  2LKP A;  3RCO A;  2NT6 A;  4HYE A;  2DO7 A;  2X9D A;  4D7M A;  1ZQ3 P;  1UZC A;  4FX4 A;  1MSE C;  1EV7 A;  5K7H A;  4RM0 A;  1OPC A;  2WAF A;  2O0Y A;  3V42 A;  2VN2 A;  1RR8 C;  1EH7 A;  4ZZD A;  2OBT A;  2V1N A;  4PJ0 C;  5FRM A;  4M6Y A;  4XLH A;  1ELO A;  4M53 A;  2R7Z J;  2BX6 A;  4OPS A;  3A0B C;  3L1P A;  1YRN B;  3KPH A;  3DLA A;  2J5P A;  4KIC A;  2DA2 A;  3MEX A;  1JGG A;  1U78 A;  3TH0 A;  1V5F A;  3VOD A;  4BGD A;  3DPL C;  1HKT A;  2KIM A;  3ML3 A;  4GQN A;  1YIT I;  1S7A A;  3HZJ A;  2LOO A;  4FWT A;  3QQA A;  4KKU A;  4OZZ A;  5D8L B;  1V5G A;  1WPK A;  3S2H J;  1MKM A;  1K5C A;  1LEA A;  2ZJQ F;  1WOP A;  3OJW A;  4P9U A;  1X1P A;  1EP3 B;  4PSX A;  1TT5 B;  2YWF A;  1JT6 A;  4MNU A;  2V4D A;  2LBF B;  3HGG A;  5BNG A;  1VQ5 I;  5E3L A;  5JLW A;  4HX7 A;  3ZXS A;  3W2G A;  1ENH A;  2M30 A;  3DFG A;  2PEC A;  4DYC A;  1QVF B;  5AIP A;  4F7D A;  3BQZ A;  4JX5 A;  1HXD A;  1LNW A;  2QQB A;  4Y52 J;  3JRF A;  2QX3 A;  1OCO H;  2DMP A;  2FRH A;  1VQM I;  1KJZ A;  2H6B A;  3BCF A;  4CCK A;  4S05 A;  5CVR A;  1JJ8 C;  2BM6 A;  1MMG A;  5DEQ A;  3DBH B;  3SEQ A;  5KAI C;  1FIA A;  3PNV A;  1KA8 A;  4HNT A;  1P4W A;  1TWH J;  3L2R A;  2ZTG A;  4E7J A;  2XIG A;  1R58 A;  4ZYD A;  2E2I J;  3JRB A;  3LSJ A;  5GPA A;  2QUF A;  4QV2 A;  5HZA A;  1MBG A;  1L0O C;  2BZT A;  3L09 A;  3HB9 A;  3BJ6 A;  1UHS A;  4BY1 J;  4LLN A;  2RC4 A;  3HHH A;  3KX2 A;  3CF2 A;  4XRF A;  1QHG A;  3EET A;  1RRJ A;  3QSY A;  3Q3S A;  2GQF A;  3JX8 A;  2XAJ A;  4QTR A;  4A93 J;  3PQJ A;  2M7B A;  2B63 J;  1QJV A;  1NHA A;  4X07 A;  1A6I A;  3DXJ F;  2DK5 A;  4CA0 A;  5F1J A;  4HF1 A;  4U49 A;  4WZE A;  2D1V A;  1J0R A;  4YFN F;  3LQE A;  2WAD A;  4TMX A;  3K7A J;  3E6C C;  3K4N A;  1D8K A;  3T56 B;  4TN1 A;  1XD7 A;  5GP9 A;  2R5Z A;  1WSU A;  4HIZ A;  3AK5 A;  4LLL A;  2NVU B;  1HQC A;  3LMM A;  1WOS A;  5DSZ A;  4ZGN B;  4HE6 A;  4G12 A;  2OD5 A;  2NVY J;  4IOA F;  1BMF A;  1HA3 A;  3HOV J;  4WX9 A;  2DDB A;  2GIZ A;  4GYI A;  2CQK A;  4Y4R A;  2X6Y A;  3OMY A;  1H85 A;  3S8P A;  4L8J A;  2K40 A;  3SYT A;  4RB3 C;  3C3W A;  2HS5 A;  2CC2 A;  5D5U B;  3E3V A;  4IHT A;  1KQ9 A;  4PFP A;  3BRO A;  2ELJ A;  3KP3 A;  5J1U A;  5LHI A;  1FRN A;  1OB5 A;  1TYU A;  4OIQ F;  4OOS A;  3R6K A;  2FX3 A;  2HDN B;  5FNZ A;  3H36 A;  1TWC J;  2KRH A;  4FK8 A;  4ZH4 F;  3K4J A;  5FL7 A;  3ZBT A;  1TSP A;  5BSY A;  3HUG B;  1D0Z A;  1IW7 F;  2CW7 A;  2E36 A;  2NZM A;  2HOT A;  1IDZ A;  1SKY B;  4OIN F;  3RQI A;  1D5Y A;  2L7M P;  2AQF A;  2PE3 A;  4XKB A;  2H8R A;  1T6Y A;  5EEH A;  2AO9 A;  1J9Z A;  2G7H A;  3I0T A;  2CF4 A;  4G7W A;  5FKK A;  2EFN A;  4N0B A;  3BC8 A;  3RTR A;  1ZGA A;  1D2E A;  2NPF A;  1YW8 A;  2LY2 A;  1LPQ A;  1R71 A;  2BM0 A;  2F5V A;  4NK8 A;  5CQE A;  2VOO A;  3PUF A;  3WBJ A;  1VQ8 B;  3RY8 A;  3KFW X;  1K83 J;  1ZLK A;  1FYM A;  2M9H A;  1V5E A;  4M9S A;  1WHU A;  1H88 C;  1YW7 A;  2KRC A;  1JB9 A;  3H0D A;  1EKE A;  1AWC A;  2AQE A;  2DPU A;  4GO1 A;  1BPL A;  1WRJ A;  3PO3 J;  4ZYE A;  1UFM A;  2EWE A;  4FT8 A;  1W7P A;  4O6J A;  3U2Q A;  3DPT A;  1MMN A;  3AVW A;  4J01 A;  2MA3 A;  2EZK A;  2OAZ A;  4E7K A;  1E79 A;  3B8H A;  5E6T A;  2YPR A;  1VQ4 B;  2QBY A;  3K10 A;  3LFU A;  3CCR I;  3PSF A;  2LH9 A;  3KZI C;  3W2E A;  2DJI A;  4BAY A;  2QY1 A;  5GAH J;  3OYC A;  3C2H A;  3JW4 A;  1ZKG A;  5JMC B;  3WTT C;  2LFB A;  2M34 A;  3DBL B;  3ZQH A;  2WZN A;  4OOV A;  1XFO A;  1WP6 A;  3P9K A;  4AVZ A;  1IO2 A;  1F36 A;  1ITY A;  3DDY A;  5B1B H;  1Y0R A;  2VNH A;  5F64 A;  4C2U A;  3BCA A;  3PVD A;  4I99 C;  2A3S A;  3LSI A;  2LKS A;  2IS2 A;  3TDZ C;  3DU1 X;  3BG5 A;  1OYY A;  2E7W A;  2NS8 A;  2TCT A;  3KYD B;  1RNL A;  5BSX A;  1SFE A;  1E62 A;  2LG4 A;  4U88 A;  2HVQ A;  4RAG A;  2VLA A;  3OEE A;  3BCD A;  1V0F A;  3OYG A;  3JRH A;  2OJE D;  2ID3 A;  3G1L A;  2W00 A;  3HXL A;  2RN7 A;  4IPA A;  4MFE A;  2P3M A;  1HW5 A;  2MW8 A;  2DER A;  5E8I A;  4YIF A;  1YRN A;  3PSZ A;  3OAA A;  1HDP A;  4JK1 X;  3CXC B;  4RM2 A;  2E34 A;  3JSO A;  1WU8 A;  4EMS A;  2EWN A;  1B6A A;  4L9N A;  4QSH A;  4F93 B;  2V9P A;  3OYJ A;  1APL C;  1ERD A;  2FNP A;  3LSP A;  3ZMT A;  1ETY A;  4G6T B;  3ZN0 A;  4X0C A;  4XM3 A;  1A04 A;  3SFI A;  3SHF A;  3H35 A;  2GZW A;  3ZMZ A;  2K5C A;  4XN3 A;  4HQE A;  5E1W A;  1IV6 A;  3ZPL A;  1TYX A;  3PSS A;  2R7D A;  3MCA A;  1CNE A;  1RWR A;  1M1K D;  3CDL A;  3WOD F;  2XSJ C;  2KKO A;  2XNC A;  3FX3 A;  1I1G A;  2VBW A;  4ITV A;  3GFL A;  2IA0 A;  3E5Q A;  4I0A A;  2BVM A;  3JRD A;  1BIA A;  2LLK A;  3WG7 H;  3A1Y A;  4G8X A;  1I5Z A;  3BY6 A;  1RR7 A;  2OUM A;  2FNA A;  3DQV C;  4XD7 A;  3WTV C;  1DDN A;  4MFD A;  4A3I J;  2KQR A;  2WYR A;  1S72 I;  1KCD A;  2YSR A;  3QPL A;  1LJ9 A;  2PX9 A;  2O03 A;  5JFR A;  2IPQ X;  1DP7 P;  3SDB A;  1X0C A;  5ICC A;  1YQA A;  1J5Y A;  3BG6 A;  2PI0 A;  1M90 D;  3FKI J;  2XTX A;  2EQR A;  1ZM9 A;  2XTY A;  3E6D A;  4XOR A;  3FDY A;  3DPU A;  4A3M J;  4PAB A;  2WAQ N;  2ESH A;  3PFI A;  1RU4 A;  4DJA A;  3CCM B;  4U9U A;  2EV5 A;  2G0Y A;  4J0Q A;  4ASU A;  4DW6 A;  1IXR C;  1Z9C A;  3W6J B;  2LSO A;  3BR5 A;  4P6V F;  1G3Y A;  1N05 A;  2C77 A;  2QTZ A;  1TNT A;  2OTJ B;  1E1R A;  1TBX A;  4N4N B;  2F4M B;  4C30 A;  3MWM A;  1VF9 A;  3ZQF A;  5FKO A;  4XOP A;  4YEL A;  3CO6 C;  1AU7 A;  4A3K J;  2DIE A;  1EH6 A;  2XRL A;  4ZCI A;  4U0Y A;  4YXW A;  1F1Z A;  4WWV A;  2A6T A;  1EXM A;  3FK6 A;  1J7K A;  2M87 A;  2ZKZ A;  3KP4 A;  4CO8 A;  4BE1 A;  2XV4 S;  1ZRF A;  2EIX A;  3MHP A;  3VNV A;  3ZPP A;  1FTZ A;  2F1M A;  3WBK A;  1EA0 A;  3J7Y J;  2W7N A;  3CPX A;  3HSR A;  4M3B A;  4RD3 A;  2EA4 A;  1QGZ A;  3I64 A;  3TMO A;  2QKL B;  5D5X B;  5E79 C;  4TMT A;  2MC4 A;  1GV5 A;  4X7F A;  3VYT B;  2E5Z A;  4YIR X;  3S16 J;  2QEX B;  5IPA A;  2ZNY A;  1FOX A;  2CV1 A;  1W5T A;  3L2W A;  2TDX A;  4XOT A;  3SEZ A;  2R5Y A;  2VBE A;  1LLW A;  4ENM A;  3H9G A;  3ZR8 X;  2DYI A;  3LYC A;  3OYI A;  3E6M A;  2HQN A;  1WOR A;  5JR3 A;  4IW3 B;  2NAZ A;  5BS6 A;  1IUY A;  1NBM A;  4XMY A;  2WY8 Q;  3ZMU A;  3B90 A;  2QYU A;  4NK6 A;  2O9L A;  1QO0 D;  1NJI D;  2Y31 A;  5EGO A;  2NVT J;  2QE7 A;  2X4H A;  2JRM A;  2DMQ A;  1YW9 A;  2LNB A;  4MQ9 F;  2X1E A;  1MD0 A;  1BX1 A;  2ETH A;  2HYJ A;  2ZTN A;  3Q39 A;  3U2R A;  4AIK A;  2KZV A;  3H9N A;  3MKW B;  2O7O A;  1IDJ A;  3CCL B;  4I84 A;  4PJM A;  1EWY A;  5FIU A;  2E35 A;  3OSF A;  3AG2 H;  2QA4 I;  3HAG A;  5DCF A;  2QTL A;  3KEW A;  3AST A;  2B9S A;  3BTJ A;  1G7S A;  3QFC A;  1BHE A;  2G0E A;  2DOF A;  4QHY A;  2GXB A;  1D8T A;  3HPH A;  1G59 A;  1MBE A;  4KT5 C;  1LDJ A;  4HX8 A;  3W6K B;  2FML A;  2KJC A;  2QSG X;  2BY3 A;  3QAH A;  5HDG A;  1ZRC A;  3FXO A;  3GTO J;  3HOW J;  4C0S A;  1I39 A;  1TTY A;  2H1L A;  5HNH A;  4XIC A;  1UJ8 A;  4BJ5 C;  5C4J J;  4HDU A;  3FM3 A;  1RPW A;  4ZC3 A;  3WG9 A;  4E4H A;  1VQP I;  4KKT A;  1XX5 A;  1IRF A;  2PFB A;  3TKY A;  3BTI A;  1DU6 A;  3HSF A;  3TO7 A;  3VSL A;  1ZGW A;  3TW7 A;  3SKB A;  1O8G A;  3K70 C;  1VQP B;  1BJZ A;  1H89 C;  3J7A O;  4Z2Y A;  1SVL A;  5F4M A;  2B7E A;  4ZJZ A;  3PSI A;  4IHW A;  1EH8 A;  3FKS A;  3HYI A;  2LDU A;  1ZG5 A;  4RDL A;  2XTW A;  1SC7 A;  3Q3A A;  4FE4 A;  4HAM A;  5J8F A;  2NST A;  4M3G A;  4LB5 A;  4CYD A;  3CME I;  3W2V A;  2R3S A;  3ZGK A;  4D5F A;  2ECB A;  1OB0 A;  2BVL A;  1Z77 A;  1QG0 A;  1EP2 B;  3LST A;  4N9H A;  1R22 A;  3L7W A;  3CC4 I;  4HEA 2;  4RD2 A;  2NTP A;  3MKL A;  4KH3 A;  1IJW C;  2HI3 A;  3KP2 A;  4GDF A;  2GWR A;  4RGS A;  2FBI A;  3V7A A;  3N90 A;  4L0Z B;  1CQT A;  2V79 A;  2JZY A;  3ZQC A;  1U8R A;  1YIJ B;  3WY9 A;  1SFX A;  2GXG A;  4U87 A;  2LP0 A;  3GZN B;  1SVO A;  1YIJ I;  4HWV A;  1BX0 A;  3FXJ A;  1QNT A;  2FBK A;  1SFU A;  2PMZ A;  2VI6 A;  2CMP A;  2HNH A;  3HTU A;  4M3E A;  1DPR A;  3REO A;  1Q86 D;  1CNF A;  2ZJR F;  1WKM A;  1YE9 A;  3ECH A;  4A3L J;  2ZZF A;  4BXU A;  2EFP A;  2BXZ A;  1LE8 A;  4Z4Y A;  2WA0 A;  3QP6 A;  2QQA A;  2DFE A;  3WYA A;  3M07 A;  1OYW A;  4A0X A;  3CMA B;  2VL8 A;  4BH9 A;  2O5R A;  1W36 C;  4P55 A;  4IRG A;  4L9J A;  2CW8 A;  2M8G X;  5J40 A;  4FN5 A;  4LFU A;  5DD8 A;  1KTV A;  2ZB9 A;  5A2Q Z;  1XGO A;  3CUO A;  3CPW B;  4RB2 C;  1VHO A;  3ZCO A;  3L2Q A;  2ME0 A;  4QFM A;  3AG1 H;  2GXA A;  1SD7 A;  6PAX A;  1FX7 A;  5FLX K;  1OKR A;  1OR7 C;  1QUF A;  1HF0 A;  2VNI A;  4V2F A;  3LVB A;  3K0L A;  4IQ4 A;  3KCC A;  1XTA A;  1RET A;  3F8N A;  2OU2 A;  4YZ0 A;  1D1A A;  3ONU A;  3KEY A;  4LLG F;  2CK3 A;  2BN4 A;  3WU0 A;  3IH4 A;  2INV A;  2CO5 A;  1J09 A;  3HHG A;  1ZRD A;  1TWF J;  2E1R A;  3JQP A;  4Z4T A;  3WND A;  2Z5U A;  4L9V A;  4BEH B;  2GK7 A;  3KIO A;  2X1C A;  5DM6 F;  1O8D A;  1VQK B;  2M0M A;  4LBV A;  1GVH A;  5EMN A;  4P5O A;  1Y6I A;  5FO0 A;  5LBQ A;  3QYB A;  2KHM A;  3SQN A;  2Z6B D;  3A8K A;  1SAU A;  4Q47 A;  2WV1 A;  1NG7 A;  1K6O A;  2X0K A;  3IL2 A;  3F0C A;  3GO5 A;  4G7Z F;  4FE7 A;  5J1Y A;  1SMY F;  1Y8R B;  2IT0 A;  4PC2 A;  1MW7 A;  2P4W A;  3AVY A;  2A6H F;  4L9T A;  2UXX A;  1UD6 A;  4M2L A;  4B09 A;  2VIX A;  2DYR H;  2EZI A;  3BR1 A;  1BI0 A;  3HOX J;  1WMR A;  2WB1 A;  4KA4 A;  5FRN A;  1VQ5 B;  4CH7 A;  2NVQ J;  3HKZ A;  1V55 H;  2EH3 A;  4RAZ A;  1PUE E;  3DEU A;  3G71 B;  2A6E F;  1WJD A;  1ZM3 A;  5B5E C;  4W8R A;  1KON A;  3GF2 A;  1R5H A;  5J8C A;  2VFP A;  4NDL A;  1TT0 A;  4HBL A;  1T6X A;  3BP8 A;  3MVP A;  2XEX A;  1IDY A;  2LY1 A;  3R6J A;  5M5X J;  3M8J A;  1BL0 A;  3GX4 X;  2I10 A;  2IGK A;  1R9T J;  2GIV A;  2LF7 A;  2NVX J;  2UV1 A;  1GT0 C;  3PO2 J;  1UMQ A;  2XGD A;  2GA2 A;  1TYW A;  3BT9 A;  1VQ4 I;  3PFY A;  2LR8 A;  4LIU A;  1V3F A;  4LMY A;  1EFT A;  3LA3 A;  4FQG A;  3VDX A;  1D5V A;  4UZE A;  1QQ1 A;  1ZR2 A;  2PIA A;  3F72 A;  5HKK A;  4FXU A;  4PC6 A;  2JSP A;  4QIW N;  4BQO A;  1UD5 A;  4IVN A;  2WJY A;  3L2C A;  3C2B A;  2XF7 A;  3OZU A;  1XG2 A;  4I76 A;  1SMT A;  3FXU A;  3OYB A;  1F20 A;  1UB9 A;  1IA5 A;  2E2J J;  2O17 A;  1XMK A;  3F8M A;  4S04 A;  2M3A A;  5L3C A;  1YFH A;  4ZYH A;  1LUJ B;  2E19 A;  2GK6 A;  4N4O B;  1T2K A;  2OQR A;  2DTZ A;  3R6S A;  3W2F A;  3I4M J;  4I0B A;  2D2W A;  5ILU A;  1VQ6 B;  4R79 A;  3ZUG A;  2M5S A;  1VQL B;  4ZCL A;  4ESF A;  5ICE A;  2VJI A;  3ASQ A;  5EZG A;  1O8L A;  2F5F A;  1PJ5 A;  1W5S A;  1YO5 C;  3GCM A;  3HBL A;  4DQL A;  1QCX A;  4TKO B;  4QVA A;  1R1V A;  2L9V A;  3QE2 A;  1MAB A;  4WZT A;  5DN6 A;  3GQB A;  4YAL A;  2ZL7 A;  2BEO A;  3VSK A;  3I4P A;  2JA7 J;  3ZZ0 A;  3ML6 A;  2V31 A;  5DS9 A;  2Y75 A;  1KU7 A;  3WXM A;  3VYS B;  2M7A A;  3H92 A;  4CGZ A;  1FYK A;  2XGJ A;  4JBA A;  3MMY B;  2QZA A;  3T1B A;  1MSF C;  2K9Q A;  2Z99 A;  2QMU A;  3W2I A;  4A3B J;  1WJF A;  4MTE A;  1P6R A;  1Z91 A;  5D4R A;  4I7H A;  2I5U A;  2L3D A;  1JTA A;  2HQ5 A;  2BF4 A;  3N05 A;  1E17 A;  4KMF A;  1LE8 B;  2DQL A;  3CJQ B;  4HST A;  2E1M C;  4XSZ F;  5FD6 A;  2P5L C;  2FE3 A;  2CW0 F;  2BV6 A;  4A5M A;  4P12 A;  4X8I A;  1OFL A;  2N8G A;  4Z1M A;  4QLC U;  2Z2S B;  4NQW A;  2YWH A;  4Y9U A;  1MBK A;  3S1R J;  1QGA A;  1CLW A;  3WTZ A;  2UVF A;  5JVG F;  2LZJ A;  5CDF A;  3UNG C;  1L1I A;  3BG3 A;  1FSE A;  2RAE A;  4KIF A;  4BHP A;  4DBQ A;  4Y7N J;  1JJ6 C;  1NTC A;  4HRI A;  1T6Z A;  3F6V A;  1MMD A;  1ULY A;  5FKM A;  1TLH B;  2ACJ A;  4PJN A;  3RKQ A;  1ZUN B;  1MJB A;  4N3N A;  3ZQL A;  1TW2 A;  1VQ7 I;  2A5W A;  2Q0O A;  1QPI A;  3HG9 A;  3AGP A;  3U9G A;  1G3T A;  2CSO A;  3OYF A;  2ID6 A;  4WCG A;  5KNL A;  2VBY A;  2ZZG A;  3OYM A;  3ZIA A;  2BGC A;  3L2V A;  1BOB A;  1PP8 F;  4DNC A;  2CUZ A;  2M0C A;  2DCU A;  1N78 A;  1I7P A;  4ENN A;  2E7X A;  2VFM A;  3H94 A;  1HVX A;  4E7S A;  2L01 A;  1BLI A;  2XZL A;  3RDI A;  1FP1 D;  4XK4 A;  4GFB A;  4BPR A;  1JNY A;  1EF4 A;  1IHM A;  4RPB A;  1Q81 D;  4OOX A;  2DW4 A;  2IGO A;  1PUF A;  1OMI A;  2VC0 A;  2DA5 A;  2I8D A;  3MCZ A;  4KN7 X;  5F0C A;  3ZRG A;  1H80 A;  1T6S A;  3BR2 A;  1MDM A;  5LD2 C;  1USS A;  1CF7 B;  3A2K A;  4C2M J;  3GTM J;  1SKQ A;  2GOX B;  2IEK A;  2NYX A;  4G7X A;  2XF5 A;  1H8H A;  3CDI A;  2NT9 A;  1KU3 A;  2F1L A;  2KIQ A;  4X0G A;  1C0W A;  4IHV A;  4Z03 A;  2QF7 A;  1ZK8 A;  5J6X A;  1RC9 A;  4EJO A;  2G9W A;  2ECC A;  1LFU P;  4M6V A;  1RUN A;  4TT3 A;  2XZP A;  4F3Q A;  2LYC A;  4UUV A;  1HKS A;  2F3L A;  1UAA A;  2IXS A;  4OJP A;  2XGE A;  1TWA J;  3RQ4 A;  1E3X A;  4X05 A;  2MC3 A;  4BNC A;  1N0U A;  2AS5 F;  2EV6 A;  1K6Y A;  2ZJ2 A;  2KT0 A;  3SXY A;  2HOA A;  2C6Y A;  1JHH A;  5LEJ A;  1GUU A;  4L18 B;  1T08 B;  1UCR A;  1B9N A;  4WXD A;  4A3J J;  4A2U A;  2HXO A;  1S8N A;  4UB8 C;  1JUS A;  2JSC A;  1W7P D;  2XAU A;  2OQG A;  4JX4 A;  2VJ4 A;  2HFH A;  5CVJ A;  5HDN A;  4FET A;  5JHF A;  2EPF A;  3OIQ A;  5KK1 A;  1GHC A;  3A8J A;  1OCC H;  2XKP A;  1W0T A;  3U6K A;  2F5E A;  1HZE A;  4FCY A;  3ZZU A;  3FF5 A;  1ON1 A;  3DEE A;  4MQV A;  3CCQ I;  4UNO A;  2BMW A;  2CRV A;  2M1B A;  3PA2 A;  3PEN A;  2DXI A;  2HTJ A;  3OIO A;  1WJE A;  2VQG A;  2KZG A;  1I27 A;  3TO6 A;  3H3V K;  1ACI A;  2Z16 A;  5BOX A;  1V5V A;  5TV2 A;  2G7U A;  4L0Y B;  3FMR A;  1BA5 A;  2F4O B;  3LQ6 A;  4UUS B;  3IRQ A;  1OHH A;  4BE2 A;  1MBH A;  1YG2 A;  2JJ7 A;  4AM3 A;  1PJ7 A;  1R1U A;  1RKW A;  2C2W A;  5CLS A;  2O1D A;  2F4N A;  3H0G J;  1YX3 A;  2DA6 A;  4DZP A;  5JI6 A;  4OM9 A;  5TJJ A;  1IGN A;  2STT A;  1GO2 A;  4EJU A;  3QP5 A;  2BM5 A;  2K9L A;  1V54 H;  2Y9Y A;  2HVS A;  3I71 A;  4XLP F;  4GRI A;  2DLL A;  1ONV A;  1SVM A;  1FLI A;  3PM1 A;  4MHG A;  2L54 A;  1HF2 A;  2RVC A;  1QVU A;  3PUB A;  3O3K A;  2J5O A;  2BSA A;  2NV4 A;  3K1N A;  5KCM A;  2Y0M A;  2UWM A;  1MGT A;  3WTX C;  5F27 A;  1K8A D;  2ZZE A;  3DTK A;  3ZMS A;  2MD0 A;  1BC7 C;  1YIT B;  3L00 A;  2XUB A;  3CB4 A;  5D4S A;  3LAJ A;  2CUJ A;  1Q9S A;  1B1B A;  2GAU A;  5JHU A;  3LSG A;  3OYL A;  4HSR A;  1G7C A;  4RMN A;  2BPO A;  2VBT A;  4R8H A;  2V1D A;  5DV5 A;  2PLF A;  3ASS A;  1ZRE A;  3S17 J;  3IH2 A;  3L9F A;  2L9N A;  4BE0 A;  1QFZ A;  2QN6 A;  4MR0 A;  2XND A;  1YJW B;  1K78 B;  3OY9 A;  2OPT A;  3CJN A;  4TMV A;  3CUQ B;  3B6A A;  4CZZ A;  1VQO I;  3S3N A;  1N25 A;  2VQC A;  3E1S A;  1T33 A;  3JU4 A;  2XAG A;  1YOV B;  2Y48 A;  1B59 A;  1S7E A;  3WTU C;  2QEX I;  1IRX A;  5J1R A;  2C4T A;  1G2H A;  1E3Z A;  1FBU A;  1W7P B;  2EK5 A;  3O8G A;  4BXX J;  4PC3 A;  3V8J A;  1X58 A;  4O3M A;  5DUK A;  2CBX A;  4X7E A;  2LY9 A;  3A3B A;  3BH6 B;  2ELH A;  2ZSI B;  1FBQ A;  1VF7 A;  3ZQI A;  1Z3Y A;  4EJV A;  2X48 A;  1VQM B;  4Z6Y A;  3H1C A;  2ZO4 A;  4DYR A;  1KMH A;  3ASR A;  3RIQ A;  1MBF A;  5FKN A;  3JRI A;  3FHN A;  1Z6T A;  2ZNZ A;  3DF8 A;  3I55 B;  1RES A;  2EJR A;  5L3B A;  5C3E J;  4CCO A;  1MDM B;  4MYT A;  1ZM4 A;  4W8T A;  2HDW A;  4YG2 F;  3VWB A;  5HVQ C;  1WDT A;  2HR3 A;  5IP6 A;  1Y0U A;  5F1R A;  1TQI A;  4EQQ A;  1IJF A;  1TTT A;  4RDU A;  1XDU A;  3EQO A;  1TP4 A;  5ERI A;  4LC0 A;  5FA6 A;  2R7S A;  2QKM B;  3CZ6 A;  2WAQ A;  5CVU A;  3RYP A;  1LDD A;  2COM A;  2ADU A;  2F4I A;  1R7J A;  4G1V A;  1HCR A;  2QVO A;  5K5Q A;  2BHZ A;  3COA C;  1YS6 A;  5EEA A;  3I9V 2;  2DU9 A;  4NC8 A;  5E1Z B;  2CS3 A;  4PAA A;  1W4M A;  1R4M B;  5HLH A;  5LRR A;  1OJL A;  2DQR A;  1ZGJ A;  2VFO A;  3GQ7 A;  4N3G A;  2CQ7 A;  2XGC A;  1WVR A;  3M9A A;  3OZV A;  3GZ6 A;  1YJ9 B;  2V7F A;  1O3T A;  1AMO A;  2VT2 A;  2CQQ A;  4YRV A;  3OS0 A;  2W7Z A;  4P1W A;  1KTW A;  1X4P A;  1D8J A;  3SLD A;  4Z4S A;  1P2F A;  3S15 J;  1G4D A;  1F4K A;  4TMZ A;  1TZL A;  5F08 A;  1W0U A;  1A31 A;  5ILV A;  2H94 A;  3SZE A;  4NC6 A;  2YR2 A;  1Z0X A;  4A69 C;  4KDP A;  2ZBU A;  2LKX A;  1FNB A;  5FFX A;  4KIG A;  2ZBK A;  2AXL A;  4DGW B;  4KN4 X;  1NG6 A;  2R5Z B;  2CGP A;  3BZK A;  2GA1 A;  3ECO A;  3N4M A;  3ONQ A;  3I56 B;  2CV2 A;  4A6D A;  3A03 A;  3J81 K;  3FPP A;  5DNS A;  2CWE A;  3JR9 A;  1E0E A;  2ZL6 A;  1YHQ B;  2Z8G A;  2MG4 A;  1Y8Q B;  1TLL A;  2CND A;  4RJL A;  2VBK A;  4A3C J;  1BR1 A;  1MBJ A;  1U5T C;  3QPT A;  1OGJ A;  1R23 A;  1NK2 P;  4GYG A;  3CES A;  3VEP A;  3M7G A;  1EE6 A;  3ZN1 A;  3NWS A;  3F22 A;  2BV3 A;  3MD2 A;  1NH3 A;  1ZEL A;  2ZSH B;  3K69 A;  1RKT A;  2HOS A;  2IAI A;  4II3 A;  4XKC A;  1XE1 A;  4UB6 C;  1G7R A;  3WTY C;  4A12 A;  4AIH A;  2VJJ A;  2VT3 A;  3EQN A;  2JA2 A;  4M3F A;  4OMZ A;  3W2W A;  1IG7 A;  5CJ9 A;  2IA2 A;  1YIO A;  3TDU C;  1U9O A;  1R5G A;  1W0K A;  4DNT B;  1IAW A;  1DUX C;  4M3D A;  3RI4 A;  2STW A;  2R0Q C;  2VKV A;  3HOZ J;  5IT3 A;  2YX4 A;  5IT9 Z;  4HDV A;  4ENK A;  3CCS B;  2V6C A;  2E60 A;  1GVD A;  4PUS A;  1K8F A;  3WE2 A;  4TV7 A;  2ZXJ A;  5DYM A;  2IRF G;  4LIV A;  4LBY A;  4LBZ A;  4PGH A;  2UVE A;  5D5W B;  3A01 A;  4PMH A;  5H6Q A;  1OCT C;  2JJ2 A;  3F8F A;  2GJP A;  1P4X A;  4IRI A;  3P9I A;  2Y9Z A;  5KVR A;  2V7U A;  1LFP A;  2K4B A;  3S93 A;  3M3Y J;  1S29 A;  3ZQ7 A;  2ME6 A;  3DV8 A;  5D6F A;  4XID A;  1VQK I;  3CW2 A;  2J8I A;  4DNR B;  3JRG A;  4KJZ A;  5J35 A;  1STZ A;  1IC8 A;  2KL4 A;  3A8I A;  5IYQ A;  4AID A;  1G3S A;  3GTP J;  1JKQ C;  2JJ1 A;  3W5V A;  4C43 A;  4RPD A;  3CME B;  3D5R C;  1B8I B;  2XAS A;  3HTS B;  3W5U A;  3RZD J;  2XT4 A;  3ESW B;  5L3G A;  1WCM J;  2X1D A;  1P7J A;  5H2F C;  1VQ8 I;  1NB0 A;  1ZLJ A;  4ACB A;  4OIR F;  2NTQ A;  1K79 A;  2E2H J;  1IN8 A;  1S9H A;  2IP2 A;  3BR6 A;  3MKY B;  1EJ9 A;  3BTC A;  2WSS A;  1D0Y A;  1XB2 A;  3B4N A;  2CU7 A;  4MTD A;  1W0J A;  2C5H A;  1EFR A;  1RUO A;  1QA2 A;  1XQB A;  3EPZ A;  3OE7 A;  3PQK A;  1KZL A;  4XLF A;  4YAF A;  2KDO A;  4CZC A;  1R5B A;  2D9R A;  3OIP A;  1JKR C;  3WU1 B;  1UD4 A;  3NE5 B;  5AMV A;  1I3A A;  3ERE D;  2Q6K A;  4JYK A;  4BXF A;  2NS0 A;  1VQO B;  1N0V C;  4ZYA A;  2WB1 N;  2V7V A;  1FPQ A;  1YJW I;  3Q9S A;  3IKV A;  1DDG A;  2V6E A;  4D0P A;  3CMY A;  1HC8 A;  1H42 A;  1F43 A;  3VMF A;  1KQ5 A;  1G3W A;  4K2E A;  2PQ8 A;  3TOA A;  5CVV A;  4YEJ A;  1O8I A;  4RGU A;  3T53 B;  4KIT B;  1BJK A;  4G6I A;  5FRO A;  2FOW A;  3OPO A;  1Y1V J;  3F9K A;  1F5T A;  1KQ8 A;  2YUS A;  4XLE A;  3LSR A;  3Q0U A;  1J59 A;  1BI3 A;  2P7C B;  3JRA A;  3KL9 A;  1VZ0 A;  5EG0 A;  2R7F A;  1TUI A;  2GJK A;  2R7X A;  2QEN A;  2UZK A;  2R7R A;  2WTE A;  1KZH A;  2I1L A;  3LA2 A;  3OV8 A;  4ABZ A;  1ZG1 A;  2HDD A;  4CHU A;  1XDS A;  4A3D J;  1DAB A;  4HPQ A;  3U21 A;  2DFI A;  2MFZ A;  2OTL I;  3GQA A;  4URR A;  1VND A;  1YLO A;  4BJT A;  4GCV A;  4E0F A;  1FC3 A;  4ZGQ B;  1X4O A;  3V8K A;  4RD1 A;  3E5U A;  2ZXW H;  2PJR A;  3W2H A;  1ZHF A;  4OAZ A;  4EH1 A;  3F8C A;  1PVE A;  2BBY A;  2DK8 A;  2DA3 A;  3CJT B;  3OOP A;  3T8T A;  4F91 B;  1R49 A;  1DBO A;  4UVC A;  1JI8 A;  2K9M A;  1F60 A;  1ETO A;  1W5C C;  1HDD C;  1TW3 A;  3BC9 A;  1BJA A;  5C44 J;  3SY2 A;  4IHX A;  2Q1Z B;  3LQR A;  1D0X A;  2HZT A;  3D1N I;  2D45 A;  2COB A;  1A5J A;  3HOS A;  1WOO A;  5F4O A;  2DT5 A;  2OBP A;  2W24 A;  5ICG A;  4RM3 A;  4C3H J;  5L3F A;  5L3D A;  1CQX A;  3CMA I;  3S1N J;  5JVT A;  3QFT A;  2J8K A;  3HL2 A;  1OLT A;  3QFS A;  3PA1 A;  4UAJ A;  4AF7 A;  2VKD A;  1SD4 A;  4YFX F;  3K70 D;  3D5L A;  4F7Z A;  4M0L A;  2R7O A;  2VJ5 A;  5J3L A;  3CCL I;  4X7D A;  3H5A A;  4I98 B;  4XN0 A;  3R0J A;  4DK0 A;  5M5W J;  2VBV A;  3LNN A;  2JT1 A;  1R36 A;  5DM7 F;  5A8A A;  2X6X A;  3PUM A;  2ESN A;  2O3F A;  3M1C A;  1EFC A;  2IS4 A;  3MZ8 A;  5K7Z A;  2CRG A;  3G4S I;  2Q6I A;  1E2X A;  3RIR A;  1UD8 A;  1ZN2 A;  1O8F A;  1FX0 A;  5L46 A;  2YWG A;  1YI2 I;  4CIC A;  4IF4 A;  2CYY A;  5F0H A;  1WH7 A;  3DTI A;  3NAW A;  4FX0 A;  1Y1W J;  5KHD A;  3SYJ A;  2DI3 A;  2IVM A;  1JUP A;  2XRN A;  4LBW A;  5EGO B;  4GXO A;  1E3P A;  3VMW A;  3JUR A;  2K4J A;  1FNN A;  2EB7 A;  3K4K A;  1H8A C;  1TYV A;  3WWG A;  4WXC A;  2WZP P;  3K6G A;  3V7R A;  5AIQ A;  4XLA A;  4B48 A;  3Q6Q A;  2PMZ N;  1JTX A;  9ANT A;  1FMW A;  3FM5 A;  4UXN A;  5LLQ A;  4IX7 A;  1R1T A;  4I09 A;  1TQM A;  2PG4 A;  2HGC A;  3F3X A;  1R5I D;  4XRM A;  4UVA A;  2DY1 A;  1XGN A;  2B0R A;  3CC7 I;  4ESB A;  1AIR A;  4I6Z A;  2L9S A;  5C1E A;  3ERM A;  4X06 A;  1BN5 A;  1KGS A;  2XAH A;  4PSW A;  1E63 A;  2EBI A;  1GDT A;  4RD4 A;  1B72 B;  4A0Y A;  3K4L A;  4H9G A;  4CSW A;  3OYE A;  5FD5 A;  5J4V A;  5FGM A;  4AIJ A;  2R5Y B;  1X3U A;  3HRU A;  2HKO A;  2ZC2 A;  1ETX A;  3JQR A;  4Z4R A;  3SJZ A;  3S32 A;  3C2G A;  1HG8 A;  3E7L A;  1X3W B;  4FHT A;  1H9T A;  4Q5S F;  2UUZ A;  3ABU A;  4RAF A;  2EIJ H;  1YS7 A;  1Z6R A;  1Q1H A;  2LK2 A;  2MD5 A;  3P27 A;  4B3G A;  1IDK A;  4UUS A;  1SFO J;  3JTG A;  1AKH B;  4FTH A;  3K4M A;  4WF2 A;  4TMW A;  3G3Z A;  1JXS A;  5DCM B;  1PYV A;  3ZP5 A;  4EM2 A;  1D1B A;  1AHD P;  1YYV A;  4EJW A;  2RDP A;  5FKL A;  2HPI A;  1RQP A;  1OFD A;  3IWF A;  3I59 A;  2OF7 A;  4MIM A;  3OS2 A;  1Q7Y D;  3MKZ A;  1D3Y A;  1WGX A;  2FQ3 A;  3D5S C;  5HS7 A;  1NK3 P;  2GM4 A;  1FNC A;  5IYP A;  2EZL A;  4YC5 A;  2JMW A;  1T0F C;  2FF4 A;  1U6G A;  1IB0 A;  2MH9 A;  1K78 A;  4IXA A;  4Q4Z F;  4HE5 A;  2O0V A;  2VBS A;  2GLO A;  4MXN A;  4LB6 B;  2D1H A;  4AYB A;  2R7W A;  4YDT A;  4Y9R A;  3GFJ A;  2H1K A;  2X3U A;  4RGR A;  5IYD J;  1B9M A;  2F6C A;  1UD3 A;  3GUD A;  1JE8 A;  4Q7J B;  1QZE A;  2W25 A;  3RPQ A;  2HDC A;  1JA0 A;  3KYC B;  5GAD J;  1FRQ A;  1PP7 U;  3BY2 A;  1QQI A;  2L4M A;  4I2O A;  2W6I A;  4BL0 B;  3DEW A;  3OW7 A;  5HNF A;  1OFM A;  1FOY A;  3EQL F;  2JPB A;  3EUA A;  1RI7 A;  2IOU G;  1WJ5 A;  3FXL A;  4WWC A;  4IO9 F;  2DA1 A;  3FIW A;  3P5J A;  2LRD A;  3RKW A;  2Z33 A;  4EJT A;  5K1Y A;  4WQM A;  3DKW A;  3HRM A;  1ON2 A;  5D8K B;  1PDN C;  3O8H A;  1FMV A;  1S3J A;  3JRC A;  2JDI A;  2P81 A;  3D26 A;  4X7C A;  3CC7 B;  2VNK A;  4B8X A;  2BM4 A;  1WH5 A;  1DBG A;  5LHG A;  1LVK A;  2DA4 A;  1Z05 A;  2V7W A;  3O6B B;  4BHC A;  2W82 A;  1QA3 A;  1A6Q A;  2NSP A;  2X53 S;  3BLY A;  4KIB A;  3NRV A;  4PK4 A;  4FIS A;  3ZQQ A;  4MLO A;  1QBJ A;  2XKO A;  2W1O A;  2NXN B;  3CCM I;  2LF8 A;  4BBS J;  1P92 A;  5ILS A;  3OYD A;  1CZF A;  5E18 F;  2XAF A;  4M9X A;  2LD5 A;  1O88 A;  4BDY A;  2X3H A;  2R7T A;  2QZ8 A;  4WZL A;  4YAW A;  3JTH A;  4XNF A;  4G5G A;  1MJ9 A;  2KIU A;  4ESJ A;  5C4X J;  5BPI A;  3DWL E;  4RS8 A;  3K9T A;  5J47 A;  5HS9 A;  2AHO A;  3OYA A;  4OZY A;  2DFH A;  1POG A;  2GBY A;  3FY3 A;  1TNS A;  3MZY A;  2L0K A;  2X0L A;  2VXD A;  4Y3O A;  2Q8K A;  3LAP A;  3OS1 A;  5KW9 A;  2JN9 A;  1AIP A;  1Z1D A;  1TWG J;  3SZG A;  3H9Q A;  1TL8 A;  5JLV C;  2K9N A;  1A35 A;  1QGY A;  3HKZ N;  1X19 A;  2OCC H;  2XDV A;  4MGR A;  3HIF A;  2XF6 A;  1U2W A;  2BOL A;  1O3S A;  2QYO A;  3CC4 B;  2VFN A;  4LOC A;  1KQ0 A;  1ZG3 A;  3ONY A;  2OBR A;  3KLN A;  2GJR A;  4CDG A;  2QBY B;  4P96 A;  5E8G A;  5EYR A;  3I3L A;  4IL6 C;  1K9M D;  1VQ9 I;  4B47 A;  2JQ7 A;  5TIS C;  1W35 A;  2KMU A;  4WZK A;  1W87 A;  3U6B A;  1N75 A;  1GJR A;  3VST A;  3L2U A;  4MYU A;  4V19 K;  4P3I A;  1OQY A;  5LRS A;  1UG2 A;  3VOE A;  3GSI A;  3GWZ A;  4PJL A;  1W36 D;  2RC5 A;  2YUH A;  2BE5 F;  2LMD A;  1K4Z A;  2DPD A;  3SDG A;  2L5Q A;  3GFI A;  3GVL A;  3BH7 B;  1XN7 A;  3EUH A;  2RQQ A;  4G1B A;  1KC8 D;  2VOP A;  2C4U A;  3BH4 A;  2BW3 B;  2DCE A;  1PXZ A;  2ZME B;  4RDK A;  2KIS A;  3ABT A;  2VON A;  1DGR M;  4P25 A;  5AN9 A;  3ZOB A;  1FOW A;  2FQ4 A;  2K86 A;  4HOB A;  2KDZ A;  3G6E I;  1ZM2 A;  3CLO A;  3P7N A;  1I8D A;  3V4G A;  4AD9 A;  3O2P E;  2ZBV A;  1E3H A;  2FXA A;  4OAY A;  2OTL B;  1IN4 A;  1U9N A;  1AA7 A;  3QFR A;  1W1W E;  1D1N A;  4RLQ A;  4EM1 A;  2W4S A;  3B8Y A;  2H8W A;  2B7C A;  5CVI A;  1WJC A;  3IAM 2;  5K7F A;  4IKF A;  2YWE A;  3CCQ B;  2D3N A;  3HUG A;  1FZP B;  3G73 A;  3Q6R A;  5FO5 A;  2L7K A;  2VBM A;  3S1M J;  4OPV A;  3I59 B;  1GAW A;  4P9S A;  3WU2 C;  2R6H A;  1U0J A;  2CQN A;  1VQ9 B;  4B4C A;  2E5N A;  3GFM A;  2V26 A;  1RZ4 A;  3WNC A;  3EYI A;  1DQU A;  1QZY A;  5GV7 A;  1KRH A;  5HOO A;  4N9I A;  4HV6 A;  5EJC A;  3IC7 A;  1RIO H;  4PGG A;  2DAO A;  3RPU D;  1QRB A;  2JA6 J;  5EG0 B;  5EZH A;  4NC7 A;  4BYY A;  2QQ9 A;  4XRS A;  2IS6 A;  2XT2 A;  2DDA A;  2OC6 A;  2X85 A;  1R6R A;  5IYW A;  2HVR A;  4B3A A;  1QH0 A;  5M3M J;  3OR2 C;  3IH3 A;  3R60 A;  5M3F J;  3JQQ A;  1E1Q A;  3R4K A;  3G1M A;  3GLL A;  3C18 A;  1SAX A;  5E3N A;  1JJ2 B;  2OZ6 A;  1SEU A;  2CH0 A;  3CC2 B;  3E97 A;  1R5O A;  3A02 A;  4AWX B;  2JA8 J;  3OR1 C;  5HZB A;  1U3E M;  2JIZ A;  4A3F J;  3PL8 A;  3GQ8 A;  3K1P A;  4M73 A;  1KK2 A;  3F6O A;  4LK1 F;  3KP5 A;  4XLN F;  1QFY A;  2QWW A;  2VPR A;  4NQW B;  4W8S A;  1I1S A;  4P3Y A;  3TP0 A;  4ZV4 A;  3LJY A;  2W84 A;  5H6R A;  2KLO A;  1Y0N A;  1VQ6 I;  3BDD A;  3JRE A;  2K3P A;  3IAS 2;  1K7A A;  3MMP A;  2CUF A;  4CQJ A;  2O8K A;  4IHY A;  3M8E A;  3BQY A;  4F55 A;  4ROX A;  4P2N A;  2ODL A;  4LGW A;  4XKW A;  1PJ6 A;  1VI0 A;  1FJL A;  2LRE A;  3SZT A;  3W2A A;  4GGG A;  4KYW A;  3BCB A;  2NNY A;  5A89 A;  4AU7 A;  4DYQ A;  3LL7 A;  3K2A A;  2Y69 H;  2HCJ B;  3ASP A;  2P6T A;  4HA8 A;  3U1K A;  5A88 A;  1LFB A;  5FFZ A;  1N8R D;  3SEJ A;  1HOM A;  1RQR A;  1XB4 A;  1Z3X A;  3CP8 A;  2QQ8 A;  4HLX A;  4MEY F;  3IRR A;  1Y39 A;  2FVG A;  2R7U A;  2VAS A;  4JP0 A;  3AVV A;  4J19 A;  4HLY A;  5FO1 A;  5FLX Z;  1SFK A;  3T5X A;  3CF5 F;  3J80 K;  1MMS A;  3E20 A;  2A69 F;  3UR3 C;  1LB2 A;  4NHJ A;  4BKX A;  4Y17 A;  3A01 B;  2M45 A;  3CUQ C;  1LKX A;  4ZDP A;  4EGZ A;  3LMW A;  2JUG A;  1S6L A;  4PC7 A;  3NAR A;  5ICF A;  2PN6 A;  2X8K A;  3GRH A;  2YS9 A;  2E71 A;  4KKS A;  4O5V A;  5GTH C;  1HST A;  2UXN A;  2DOA A;  2LC2 A;  2BSP A;  1QX4 A;  4RD6 A;  3JAM Z;  5IYR A;  5D5V B;  4IHS A;  2P5K A;  1B8I A;  2OA4 A;  2E1N A;  2HTS A;  2V5I A;  4XKV A;  3OW2 B;  4CCL A;  2VZL A;  2XB5 A;  4XR6 A;  4P22 A;  5B1A H;  2Q6L A;  3HJE A;  3SJP A;  2CV0 A;  2VUM J;  1N77 A;  2VC1 A;  5CPR B;  2WR8 A;  1MH3 A;  3KLO A;  3LSM A;  2F5D A;  4CYC A;  2V9V A;  2MH2 A;  3OFN A;  1H0M A;  1Z7L A;  2P7V B;  3E5X A;  4OJ6 A;  2A07 F;  1XGM A;  4LD5 A;  4HQM A;  2QGG A;  1FY7 A;  1FTT A;  1H8E A;  3SLN A;  2K02 A;  1W34 A;  3BOQ A;  3OYH A;  4RBO A;  1ETQ A;  5LGT A;  4KIS A;  4OIO F;  3TQN A;  2VOD A;  1LDK B;  5BQT A;  2ZFU A;  1NDH A;  4PC1 A;  1WSR A;  4UY8 I;  2XZO A;  2DET A;  1ZR4 A;  2VPL A;  3VNU A;  4Z4U A;  2BY0 A;  4P9F A;  2OTJ I;  4CCM A;  1UHM A;  3H09 A;  2OV7 A;  2DT7 B;  3HSE A;  1T98 A;  2LTP A;  3TBI A;  5M5Y J;  4OJO A;  4CUG A;  3K2Z A;  1XCV A;  2MAB A;  4HNU A;  3GYH X;  1FT9 A;  1MMA A;  4EGY A;  4A3E J;  3CC2 I;  2W48 A;  5GPC A;  1WXR A;  3N97 A;  3B02 A;  3HOY J;  2MGQ A;  3TP3 A;  4OMY A;  1MZB A;  3RJP A;  3I4N J;  5C1C A;  2M4K A;  3IKT A;  3S2D J;  1GVJ A;  3HOT A;  1OR7 A;  2KRF A;  3BTL A;  4BAC A;  4OJL A;  1SD5 A;  3LA7 A;  4EV0 A;  3ZZT A;  2HQA A;  1FOK A;  2F5C A;  4HG2 A;  2V1U A;  4BEH A;  4Z4W A;  4DZJ A;  4R1H A;  3M4O J;  4AC9 A;  1QGP A;  1REP C;  3CP2 A;  3D0S A;  4C3J J;  5K5O A;  4V02 C;  2CW5 A;  3DCF A;  4ZTJ A;  3QWL A;  2DMT A;  2IA1 A;  4MO7 A;  2MYS A;  3FKJ A;  3SZP A;  2PMD A;  4RD0 A;  1U5T B;  2D74 A;  2L7Z A;  2FX0 A;  4KFC A;  1JRG A;  1R4N B;  1QZZ A;  3WGI A;  4RDJ A;  4XSX F;  2QM3 A;  4E7I A;  3ABK H;  4M6X A;  4DOZ A;  3KET A;  1QUE A;  2GQQ A;  4WXH A;  4AF6 A;  4BU2 A;  1XG1 A;  2H27 A;  5H59 A;  1EFU A;  3NQO A;  4A5N A;  2E1O A;  2Z9O A;  5LFA A;  4ZDO A;  2PEX A;  4Y33 A;  2L4A A;  3TGN A;  3GTG J;  1FSH A;  4D7N A;  3NWT A;  3BZ6 A;  1HSJ A;  3FMS A;  1Y56 A;  2M2E A;  3RKX A;  3LFK A;  4HNV A;  3EUK L;  5AON A;  4JQF A;  4BBR J;  2R4G A;  5B66 C;  1JGS A;  1G8X A;  4DQ2 A;  1COW A;  1N07 A;  3BNW A;  4NBQ A;  1OFC X;  4OPO A;  2HPM A;  4HW0 A;  1MRZ A;  4UZF A;  2FMY A;  1Q82 D;  3BY1 A;  4BHB A;  4C2T A;  2DA7 A;  4HV5 A;  4A0Z A;  1IB4 A;  5EF6 A;  1OOC A;  3PIO F;  1BI2 A;  2FJ1 A;  2XAQ A;  1VLY A;  1P7I A;  5D6E A;  3R0A A;  3DU6 A;  3OKX A;  5HLG A;  2O0W A;  5H20 A;  3G71 I;  3CCE I;  2VE8 A;  3B82 A;  2VQH A;  3IUO A;  2JRT A;  2Y0S A;  5JBQ A;  1H9G A;  3DP7 A;  1O8H A;  2HXI A;  2F48 A;  2W85 A;  1B4A A;  1WQ2 A;  2Q2E A;  3WE3 A;  1XC5 A;  4RGX A;  2ZFW A;  5E1X A;  2ZZQ A;  1E64 A;  3CRZ A;  3A0H C;  3ABL H;  1KQS B;  1WI3 A;  4G94 A;  4M1K A;  3CO7 C;  2MSY A;  3CMM A;  5IP7 J;  2ZJP F;  3AG4 H;  3CQZ J;  2C78 A;  3FHZ A;  5HS8 A;  3V76 A;  2QLZ A;  2Z3Y A;  3DKX A;  3FBI B;  2WPD A;  3GTJ J;  1QPM A;  2EFQ A;  5LGN A;  2Q2E B;  5E20 A;  1HLV A;  2ZXH A;  1O4X A;  1DG1 G;  2OBS A;  3RYR A;  4RB1 A;  2OZU A;  2Q6O A;  1A36 A;  4A6E A;  4Z4Z A;  1V4R A;  2XPW A;  2DYS H;  3BWG A;  3J81 Z;  3WNB A;  2NOJ B;  3EYY A;  4ASN A;  4F92 B;  2MBF A;  5GAG J;  5H5J A;  1IRG A;  3RSN A;  1E3O C;  5DS0 A;  3T8R A;  3BJO A;  5IYC J;  3G05 A;  1OFE A;  5GTI C;  3QOP A;  1HBX G;  2A5Y B;  3FMQ A;  3A3G A;  3GME A;  3OZW A;  4JRA C;  5JLX A;  1UHW A;  1WJA A;  4IJA A;  1QU3 A;  1ODD A;  1S7O A;  4A3G J;  3IWZ A;  2J7K A;  5IYN A;  1XPX A;  2XNJ A;  4M71 A;  5A2Q K;  1IJE A;  3NEU A;  3PJR A;  2BGJ A;  3A1P A;  1KK3 A;  4PGO A;  4Y15 A;  2L02 A;  2DMN A;  4D1Q A;  3MFK A;  3AKZ A;  3DTE A;  4OOI A;  3S2W A;  2KIF A;  4XLC A;  1XS9 A;  1DP3 A;  2V7X A;  2XC7 A;  4RLZ A;  1OGM X;  1Z21 A;  2QXZ A;  5IK2 A;  2Y0S N;  1P4M A;  3QPS A;  3RZO J;  5FB2 A;  2HLD A;  2NRA C;  1YI2 B;  4ACA A;  1XSV A;  2A61 A;  3OL4 A;  1K73 D;  1LVA A;  5F04 A;  1X2N A;  1YJN I;  3ZBU A;  3KEQ A;  4KMU X;  3ZMV A;  2JA5 J;  4LG3 A;  3AVU A;  3JAM K;  2EFG A;  2INU A;  2DFF A;  1IXC A;  1IZ1 A;  2VE9 A;  1YLF A;  3GBG A;  2PBI A;  5L3E A;  3TED A;  1MNM C;  1EA3 A;  4Z4V A;  4LG0 A;  3PET A;  1XCB A;  3FPK A;  1XGS A;  4JX6 A;  3T51 B;  3A4C A;  1QHH D;  1IF1 A;  3OOC A;  3FIS A;  1K4S A;  1XMA A;  1FYL A;  1P4A A;  4ZDL A;  1IRZ A;  2C5B A;  4OP7 A;  1W9X A;  4TSF A;  2P0W A;  2E1C A;  4OJ5 A;  2TRT A;  2B0L A;  1WJB A;  3GEZ A;  2FD5 A;  3FXQ A;  4Q48 A;  4M4S A;  5K5R A;  3KEO A;  4BQA A;  3HDD A;  2L2O A;  3CDH A;  4PFO A;  3G6E B;  3J80 Z;  4E6K G;  4C2L A;  3KYL A;  1UST A;  3CCV I;  1JKP C;  4OU0 A;  2BXY A;  2PMH A;  4E70 A;  1SD6 A;  3EDP A;  1OCZ H;  4S0H B;  3AGQ A;  2K85 A;  3E6B A;  2KVO A;  2QDX A;  5B3S H;  1BW6 A;  1IN5 A;  4G6Q A;  4RCZ A;  2DEU A;  3AAF A;  1U2R A;  2DN0 A;  3KZY A;  5LMZ A;  2LVS A;  1FBS A;  2BHY A;  2KFD A;  2RV8 A;  4PZJ A;  2KPM A;  4QPQ A;  3OSG A;  5HXB A;  1VQ7 B;  3R61 A;  4HF0 A;  3QPH A;  2VBX A;  2BYV E;  3F8B A;  3IP4 B;  4IEJ A;  4YFK F;  1S0U A;  1MNE A;  1OCP A;  4YZQ A;  1U5T A;  1N06 A;  2VBZ A;  1O8K A;  4UVB A;  4XL9 A;  1EZG A;  2VXZ A;  3CCY A;  4BJ6 C;  1HW2 A;  2QSF X;  3GXO A;  3HM5 A;  1X1B A;  2NOG A;  2HQR A;  2HKX A;  3I54 A;  3MZH A;  1QRY A;  4QPO A;  3I56 I;  2WWY A;  4CYC B;  1OCR H;  2MLG A;  2JK3 A;  4H0E A;  2EIN H;  1B2R A;  1OGI A;  2VKE A;  4KT6 A;  4NUB A;  1DDI A;  2HZD A;  5DCM A;  4M9Z A;  1YX5 A;  4BQQ A;  2PYG A;  1W2B B;  1VLO A;  4IRH A;  3SFZ A;  3N6Z A;  4WK8 F;  2BY1 A;  1HW1 A;  4UUT A;  1FEX A;  3ISP A;  1M1E B;  2HEO A;  3VYR B;  2HYF A;  5F4J A;  3T0Y A;  4OPW A;  3GTK J;  1T56 A;  2DT6 A;  1ZAR A;  3HGY A;  5FLV A;  2W6J A;  2E1B A;  3TL4 X;  2EIL H;  2V9K A;  3OEH A;  3QYF A;  4MEX F;  3LSH A; 
#chains in the Genus database with same CATH homology
 2NSP A;  5CQE A;  2X53 S;  3BLY A;  1V0E A;  3E0J B;  4PK4 A;  4E7L A;  3VSV A;  2KP6 A;  3ZQQ A;  2XAU A;  4MLO A;  2VJ4 A;  2W1O A;  4EW9 A;  4NK8 A;  2O04 A;  4NNJ A;  4FET A;  5JHF A;  3OIQ A;  1V5E A;  3OYD A;  1CZF A;  3VSU A;  2KRC A;  3H0D A;  1O88 A;  4BDY A;  2AQE A;  2V7Q A;  2R7T A;  1HZE A;  2X3H A;  1BPL A;  3DEE A;  4XNF A;  2VKH A;  1O8M A;  4IZZ A;  1GLN A;  2DXI A;  2EWE A;  3DWL E;  4F52 A;  1WJE A;  3DPT A;  2VQG A;  1MMN A;  3OYA A;  4J01 A;  4OZY A;  2Z16 A;  3FY3 A;  4E7K A;  1E79 A;  2WBM A;  4Y3O A;  2VXD A;  4XON A;  3OS1 A;  3AL0 C;  3K10 A;  1T5E A;  3LFU A;  3PSF A;  2LH9 A;  2DJI A;  2QY1 A;  1OHH A;  3G2B A;  3SZG A;  3H9Q A;  3OYC A;  5HLT A;  4BE2 A;  3C2H A;  1X19 A;  2XDV A;  3EUH C;  3OOU A;  5TGT A;  4ANJ A;  2XF6 A;  2O1D A;  2BOL A;  4AVZ A;  1YX3 A;  3OYK A;  2RNG A;  3DDY A;  3AFH A;  4U7B A;  3BCA A;  4C2U A;  2GJR A;  3AL0 B;  3I3L A;  3LSI A;  2IS2 A;  3CJR B;  2K9L A;  1P9Q C;  4B47 A;  3LSK A;  2HVS A;  3OWT A;  4GRI A;  1WFX A;  2KMU A;  1WPC A;  1N75 A;  3VST A;  1X1A A;  2LG4 A;  3L2U A;  3A35 A;  2HVQ A;  4PJJ A;  2VLA A;  3OEE A;  2JVH A;  3BCD A;  1V0F A;  2HU9 A;  3OYG A;  3HXL A;  4PJL A;  2W00 A;  1W36 D;  3PUB A;  5KCM A;  2R7Q A;  2UWM A;  3GVK A;  2R7V A;  1BR4 A;  4DIQ A;  3OAA A;  2L5Q A;  1OGO X;  4RM2 A;  2ZZE A;  3DTK A;  3GVL A;  2RQQ A;  2MD0 A;  1UG0 A;  4B3X A;  4F93 B;  4B3F X;  3BH4 A;  2BW3 B;  2CUJ A;  2DCE A;  3OYL A;  1PXZ A;  3LSG A;  3OYJ A;  4HSR A;  1NRK A;  4RMN A;  1ERD A;  1DGR M;  2LBF A;  4G6T B;  4XM3 A;  1I8D A;  1UEL B;  3OYN A;  3H35 A;  3H9J A;  2L9N A;  4BE0 A;  3QOD A;  2K5C A;  4OAY A;  4XN3 A;  4BS9 A;  4MR0 A;  3K4B A;  1AA7 A;  2XND A;  3HPG A;  3OY9 A;  4RLQ A;  1RWR A;  2W4S A;  3B8Y A;  2JVG A;  1WJC A;  3IAM 2;  2XSJ C;  2WY7 Q;  4IKF A;  4ITV A;  2D3N A;  3S3N A;  2VQC A;  3E1S A;  2L7K A;  2VBM A;  3JU4 A;  2BVM A;  1DGW Y;  2WJV A;  1IRX A;  1E3Z A;  4RLF A;  1U0J A;  3J7A Y;  3A1Y A;  3W3C A;  4FAS D;  2E5N A;  2OUM A;  2V26 A;  3DQV C;  4XD7 A;  1DQU A;  3A3B A;  2ZSI B;  2KQR A;  5HOO A;  1VF7 A;  4J00 A;  1Z3Y A;  3RPU D;  3ZSC A;  1KCD A;  1X0C A;  4NC7 A;  3SDB A;  2IS6 A;  2OC6 A;  1KMH A;  2X85 A;  1R6R A;  3BG6 A;  5CQG A;  4DK1 A;  2HVR A;  3FHN A;  4XOR A;  3DPU A;  3FDY A;  4B44 A;  3OR2 C;  1RMG A;  1RU4 A;  4CCO A;  2RRE A;  4DJA A;  1E1Q A;  4W8T A;  4ASU A;  2HDW A;  3VWB A;  5HVQ C;  1GQ8 A;  2CH0 A;  2NTB A;  3EQO A;  1E1R A;  3OR1 C;  4N4N B;  2R7S A;  2QKM B;  3CZ6 A;  2WAQ A;  2IQ7 A;  4C30 A;  2JIZ A;  3PL8 A;  4XOP A;  2F4I A;  4YEL A;  3GQ8 A;  1KCC A;  2DIE A;  3S3O A;  4YXW A;  3OL3 A;  2F43 A;  2A6T A;  3I9V 2;  4NQW B;  1PE9 A;  4NC8 A;  1X1C A;  4W8S A;  2CS3 A;  4BE1 A;  3ZPP A;  3DU5 A;  2KLO A;  2F1M A;  3GQ7 A;  2XOK A;  2IGM A;  2W7N A;  2K3P A;  3IAS 2;  3QOE A;  4BUP A;  2V7F A;  4YRV A;  3OS0 A;  4P1W A;  3TMO A;  1KTW A;  1X4P A;  2QKL B;  4OWR B;  4F55 A;  1PKV A;  2ODL A;  2ZXI A;  4XKW A;  1TZL A;  1E43 A;  2LRE A;  2MC4 A;  3W2A A;  3VYT B;  2E5Z A;  3VYU B;  3BCB A;  3BG7 A;  2R9V A;  2CV1 A;  4AU7 A;  3L2W A;  3LL7 A;  1VBL A;  4XOT A;  2VBE A;  3SEZ A;  2PYH A;  3WQZ A;  3H9G A;  3ZR8 X;  2BW3 A;  4DGW B;  4UZU A;  3OYI A;  1NG6 A;  1NBM A;  3CP8 A;  1Z3X A;  4XMY A;  2WY8 Q;  4NK6 A;  3B90 A;  3KRG A;  3ONQ A;  4XQF A;  2VAS A;  4C9Y A;  2R7U A;  2CV2 A;  1PLU A;  3FPP A;  1E0E A;  1SFK A;  2Z8G A;  2QE7 A;  2ZTN A;  3UR3 C;  2X1E A;  2VBK A;  4YZX A;  1BR1 A;  2IS1 A;  1LKX A;  2KZV A;  3MKW B;  1IDJ A;  4ZDP A;  3LMW A;  2JUG A;  4PJM A;  3CES A;  4Z05 A;  1EE6 A;  4ZTF A;  2X8K A;  1WTH D;  3NWS A;  3HAG A;  1I18 A;  3GRH A;  3KEW A;  1O8J A;  3MD2 A;  4KKS A;  1ZEL A;  2ZSH B;  1BR2 A;  4II3 A;  4XKC A;  1BHE A;  2DOA A;  3HPH A;  2LC2 A;  2BSP A;  1G59 A;  4H4K C;  4II2 A;  2VJJ A;  3EQN A;  2JA2 A;  3W2W A;  4U4B A;  5HNH A;  4BJ5 C;  1W0K A;  4XKV A;  4ZC3 A;  4CCL A;  4E4H A;  4XR6 A;  4P22 A;  4DNT B;  4B43 A;  2WAE A;  4KKT A;  4CCJ A;  2CV0 A;  1N77 A;  5CPR B;  3VSL A;  3LSM A;  2E60 A;  4PUS A;  1O8G A;  3OFN A;  1Z7L A;  3SUC A;  3K70 C;  4BQN A;  1MND A;  4CCN A;  4JMQ A;  4OJ6 A;  1HA8 A;  4JOM A;  4ZJZ A;  3PSI A;  3FKS A;  4LIV A;  3ZPN A;  3H5R A;  1H8E A;  2UVE A;  2V4J C;  3OYH A;  4PMH A;  4KIS A;  2JJ2 A;  2VB6 A;  3PNY A;  2GJP A;  2NST A;  1LDK B;  2ZFU A;  2IGN A;  2XZO A;  2VPL A;  3W2V A;  1LFP A;  3S93 A;  3K4C A;  3ZGK A;  1OB0 A;  2BVL A;  4CCM A;  2OV7 A;  2DT7 B;  2Z1D A;  4DNR B;  2NTP A;  4HEA 2;  3TBI A;  4OJO A;  4KJZ A;  4CUG A;  1K28 D;  2MAB A;  2KL4 A;  3H5N A;  4HNU A;  1MMA A;  2JJ1 A;  3D5R C;  3FBN B;  1VJS A;  4YZA A;  2X1D A;  4U87 A;  2NTQ A;  4HWV A;  1S9H A;  2PMZ A;  3MKY B;  2CMP A;  2HNH A;  2WSS A;  2M4K A;  1D0Y A;  5C1C A;  3B4N A;  3HOT A;  4BAC A;  1W0J A;  4OJL A;  3UW0 A;  1EFR A;  2HQA A;  4HG2 A;  1YE9 A;  3EPZ A;  3OE7 A;  4BEH A;  2ZZF A;  1KZL A;  4XLF A;  2WA0 A;  2KDO A;  4CZC A;  3CP2 A;  3OIP A;  4ZTJ A;  1UD4 A;  5AMV A;  3NE5 B;  2VL8 A;  2O5R A;  1W36 C;  2MYS A;  3FKJ A;  2CW8 A;  4BXF A;  3VMV A;  1NHC A;  4IQJ A;  4ZYA A;  2M4G A;  3GVJ A;  3ZCO A;  3L2Q A;  1JRG A;  3VR6 A;  4D9J A;  4E7I A;  1OR7 C;  2V6E A;  4DOZ A;  2PJR B;  4IQ4 A;  4LIT A;  4W8Q A;  4BU2 A;  4E7Z A;  1K5C A;  4YEJ A;  1O8I A;  4YZ0 A;  1D1A A;  5CKT A;  3KEY A;  3T53 B;  4KIT B;  4BDZ A;  4I84 A;  1X1D A;  4ZDO A;  2FUG 2;  5LFA A;  2CK3 A;  5FRO A;  4Y33 A;  2D3L A;  4G6I A;  2INV A;  1J09 A;  3OPO A;  1O8E A;  3PNT A;  3F9K A;  4BEH B;  3S3M A;  3NWT A;  4E7H A;  2GK7 A;  1Y56 A;  4EAT A;  4XLE A;  1UD2 A;  3T9G A;  3EUK L;  1PJR A;  4JQF A;  1VZ0 A;  2X1C A;  1O8D A;  2GJK A;  2R4G A;  2R7X A;  2M0M A;  1G8X A;  2R7R A;  2X51 A;  1Y6I A;  4P5O A;  1COW A;  1T95 A;  3QYB A;  2KHM A;  2Z6B D;  1SAU A;  2CFO A;  4HPQ A;  3U21 A;  2MFZ A;  2HPM A;  3QYE A;  3GQA A;  4URR A;  1NG7 A;  2GOM A;  4Z06 A;  4C2T A;  4BJT A;  1MW7 A;  4E0F A;  1X4O A;  3DKY A;  1IB4 A;  4DBR A;  1UD6 A;  1OOC A;  2VIX A;  2PJR A;  4OAZ A;  1VLY A;  4F91 B;  3DU6 A;  1WMR A;  2WB1 A;  5FRN A;  2O0W A;  3GQ9 A;  4CH7 A;  3HKZ A;  3HC7 A;  2E1M B;  2VQL A;  2VQH A;  3IUO A;  2Y0S A;  1DBO A;  1JI8 A;  2X6W A;  1O8H A;  1WJD A;  2K9M A;  3BC9 A;  1BN8 A;  4W8R A;  1D1C A;  1KON A;  2NT6 A;  3RCO A;  2Q1Z B;  2ZZQ A;  1D0X A;  1TT0 A;  3HOS A;  2LY1 A;  4RM3 A;  2WAF A;  3V42 A;  3CMM A;  3M8J A;  2V1N A;  2IGK A;  5FRM A;  4XLH A;  2UV1 A;  3HL2 A;  1OLT A;  3DKX A;  3FBI B;  3DLA A;  3PFY A;  2VKD A;  4LIU A;  2WPD A;  3VDX A;  2Q2E B;  3K70 D;  3D5L A;  2ZXH A;  5HKK A;  2R7O A;  2VJ5 A;  4FXU A;  2JSP A;  1V5F A;  3H5A A;  4XN0 A;  4BGD A;  4DK0 A;  3DPL C;  3LNN A;  4BQO A;  1UD5 A;  2WJY A;  2NOJ B;  4F92 B;  4GQN A;  2XF7 A;  3RSN A;  1XG2 A;  2X6X A;  2LOO A;  3M1C A;  3G05 A;  3OYB A;  3A3G A;  2IS4 A;  4KKU A;  4OZZ A;  1UD8 A;  1O8F A;  1IA5 A;  1WJA A;  1QU3 A;  1FX0 A;  2O17 A;  2M3A A;  1V5G A;  2GK6 A;  4N4O B;  3PJR A;  4PSX A;  3DTI A;  2V4D A;  4R79 A;  2LBF B;  4D1Q A;  5KHD A;  2M5S A;  3AKZ A;  3DTE A;  1DP3 A;  4XLC A;  2VJI A;  1OGM X;  3ZXS A;  2XC7 A;  1O8L A;  3VMW A;  3JUR A;  1Z21 A;  2QXZ A;  5IK2 A;  3K4K A;  3WWG A;  2PEC A;  2WZP P;  3K6G A;  1QCX A;  2HLD A;  4XLA A;  4TKO B;  4B48 A;  1MAB A;  1FMW A;  5DN6 A;  4IX7 A;  2QX3 A;  3GQB A;  1K6Y A;  3OL4 A;  3VSK A;  3BCF A;  4CCK A;  4LG3 A;  2V31 A;  1MMG A;  2INU A;  3VYS B;  1AIR A;  2M7A A;  3SEQ A;  3PNV A;  3GBG A;  4HNT A;  2L9S A;  3L2R A;  2XGJ A;  2ZTG A;  5C1E A;  1EA3 A;  3MMY B;  4E7J A;  4PSW A;  3T51 B;  3A4C A;  1QHH D;  3OOC A;  1WJF A;  3K4L A;  4CSW A;  3OYE A;  4ZDL A;  4TSF A;  1JTA A;  1W9X A;  3KX2 A;  2P0W A;  3CF2 A;  3N05 A;  1QHG A;  3CJQ B;  1WP6 A;  4HST A;  2E1M C;  4OJ5 A;  3S32 A;  1OFL A;  3C2G A;  1HG8 A;  4Z1M A;  2Z2S B;  2UUZ A;  1WJB A;  2M7B A;  1QJV A;  2UVF A;  2LZJ A;  5CDF A;  4B3G A;  3UNG C;  2L2O A;  1IDK A;  4PFO A;  4CA0 A;  4C2L A;  4E6K G;  3KYL A;  4DBQ A;  4HRI A;  3K4M A;  4U49 A;  1PYV A;  1MMD A;  4PJN A;  1D1B A;  2WAD A;  3K4N A;  2HPI A;  2A5W A;  3HG9 A;  3T56 B;  4HIZ A;  3OS2 A;  2KVO A;  3MKZ A;  3D5S C;  3OYF A;  5KNL A;  3LMM A;  1T0F C;  2ZZG A;  3OYM A;  3ZIA A;  3L2V A;  1BOB A;  1BMF A;  2CUZ A;  4QPQ A;  2KPM A;  4Y4R A;  1N78 A;  2X6Y A;  2O0V A;  3OMY A;  4MXN A;  3H94 A;  1HVX A;  3S8P A;  3IP4 B;  4E7S A;  4L8J A;  4AYB A;  2R7W A;  1MNE A;  4YZQ A;  3SYT A;  1BLI A;  2XZL A;  1O8K A;  4XL9 A;  2VXZ A;  4BJ6 C;  1X1B A;  2F6C A;  4PFP A;  2IGO A;  1UD3 A;  2I8D A;  3ZRG A;  2ELJ A;  1H80 A;  4QPO A;  5LD2 C;  3A2K A;  2GOX B;  2W6I A;  4BL0 B;  3OW7 A;  5HNF A;  4G7X A;  1OFM A;  2XF5 A;  1H8H A;  2NT9 A;  2KRH A;  5FL7 A;  4KT6 A;  3K4J A;  4NUB A;  2HZD A;  4X0G A;  3HUG B;  1D0Z A;  1YX5 A;  4BQQ A;  2CW7 A;  2PYG A;  3EUA A;  4Z03 A;  1WJ5 A;  2NZM A;  2LRD A;  1SKY B;  3VYR B;  2AQF A;  4TT3 A;  2XZP A;  4XKB A;  1FMV A;  4F3Q A;  2LYC A;  2JDI A;  2DT6 A;  4G7W A;  1UAA A;  2IXS A;  3BC8 A;  3RTR A;  2W6J A;  1DBG A;  4OJP A;  2E1B A;  2LY2 A;  1LVK A;  3RQ4 A;  3TL4 X;  3LSH A;  1E3X A;  2V9K A;  3OEH A;  3QYF A;  2F5V A;  2W82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...