2QXZA

Pectate lyase r236f from xanthomonas campestris
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
330
structure length
330
Chain Sequence
GPVGYGAATTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRFGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improvement of the thermostability and activity of a pectate lyase by single amino acid substitutions, using a strategy based on melting-temperature-guided sequence alignment.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Lyase
molecule keywords pectate lyase II
total genus 127
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qxzA00
1DBGA 4XMYA 1OGOX 2VJJA 2NZMA 1O8JA 4YZAA 2PECA 2QX3A 4W8RA 4YZXA 1IDJA 2VBEA 4OZYA 1GQ8A 2O0WA 3FY3A 4YELA 3UW0A 1QJVA 1O88A 4YEJA 1CZFA 2QY1A 1O8MA 4W8QA 1AIRA 4XLFA 4XN0A 3ZSCA 2O0VA 2NSPA 3GRHA 4XM3A 4XKVA 4YZ0A 3JURA 1HG8A 1H80A 1OOCA 4OJOA 2VJIA 2ODLA 4OZZA 1IA5A 2O1DA 1OFMA 3LMWA 1KCDA 1JTAA 4XN3A 3GQ8A 4XKWA 1K5CA 2EWEA 2VBKA 2X6YA 4PMHA 4Z06A 1PXZA 1RU4A 3T9GA 3EQOA 4U49A 4XLCA 3EQNA 5C1CA 3VSVA 2INUA 1PLUA 3SUCA 3VMVA 1O8GA 2NTQA 1KCCA 1BHEA 1VBLA 1JRGA 4Z03A 1O8KA 4OJ6A 4XOTA 4EW9A 1KTWA 2QXZA 2UVFA 1O8HA 3ZPPA 3GQ9A 4OJ5A 1WMRA 4XLEA 3B8YA 1O8EA 2NT9A 1EE6A 2X85A 1O8IA 4XNFA 2PYHA 4XLHA 4NK8A 1IDKA 1OGMX 2NT6A 2O17A 2BSPA 3B90A 4Z05A 5AMVA 2INVA 4YZQA 1IB4A 1BN8A 1RWRA 4OJPA 1NHCA 3GQ7A 2NTBA 5C1EA 3VSUA 2X3HA 1O8DA 3B4NA 4XLAA 1DBOA 2IQ7A 4XORA 4AVZA 4XR6A 4C2LA 1X0CA 1OFLA 4XL9A 3KRGA 4URRA 3WWGA 1O8FA 4W8SA 4MXNA 4XONA 4OJLA 4MR0A 2X6WA 3GQAA 2VBMA 1XG2A 2NTPA 4I84A 4XOPA 3VMWA 1O8LA 2PYGA 2O04A 4W8TA 1PE9A 4HWVA 2NSTA 2Z8GA 2X6XA 4NK6A 1RMGA 3VSTA 4U4BA 1QCXA 4XQFA 2UVEA
chains in the Genus database with same CATH superfamily
5JLVC 1DBGA 4XMYA 1OGOX 4YDTA 2V5IA 2VJJA 2NZMA 1O8JA 4OM9A 4YZAA 1TSPA 2BM7A 2PECA 2QX3A 1LLZA 3PSZA 4W8RA 4YC5A 2XT4A 4YZXA 1IDJA 2VBEA 2YUHA 4OZYA 1GQ8A 2O0WA 3FY3A 2G0YA 4YELA 3UW0A 1QJVA 4YEIA 3DU1X 3SZEA 1O88A 4YEJA 1CZFA 3SYJA 2QY1A 1O8MA 4W8QA 1AIRA 2VFPA 3BH7B 4XLFA 3RIQA 3JX8A 2XT2A 1QRBA 1LLWA 3H09A 4XN0A 3ZSCA 2O0VA 2NSPA 3GRHA 4XM3A 4XKVA 4YZ0A 3JURA 1HG8A 4KH3A 1H80A 1OOCA 1TYXA 2J8KA 4OJOA 2VJIA 2ODLA 4OZZA 1QQ1A 1IA5A 1WXRA 2O1DA 1OFMA 3LMWA 3SY2A 1KCDA 1JTAA 1TYUA 3GQ8A 4XN3A 4XKWA 1K5CA 2EWEA 2VBKA 2J8IA 2X6YA 2IOUG 4PMHA 4Z06A 1PXZA 1RU4A 2VFNA 3T9GA 3EQOA 5JMCB 1DABA 4YCQA 5DNSA 1QA1A 4U49A 3AK5A 4XLCA 3N6ZA 3EQNA 4JRAC 1LM1A 5C1CA 3VSVA 2INUA 1PLUA 2O6WA 3SUCA 3VMVA 1O8GA 2NTQA 3P4GA 2VFMA 4V02C 1QA2A 3PETA 1KCCA 3NAWA 1BHEA 1VBLA 1JRGA 4Z03A 1O8KA 4OJ6A 4XOTA 3PSSA 4EW9A 1TYWA 1KTWA 2QXZA 4YFOA 2UVFA 1O8HA 1EZGA 1OFDA 3GQ9A 4OJ5A 3ZPPA 1WMRA 4XLEA 3B8YA 1L1IA 2BM6A 1O8EA 2NT9A 3NB2A 1EE6A 3LJYA 2X85A 1O8IA 4XNFA 2PYHA 4XLHA 4NK8A 1IDKA 1OGMX 2NT6A 2O17A 2XTYA 2BSPA 3B90A 4Z05A 2BM4A 3BH6B 3N90A 2INVA 4YZQA 5AMVA 1IB4A 1BN8A 1RWRA 4OJPA 1NHCA 3GQ7A 1QRCA 2NTBA 5C1EA 1TYVA 3LYCA 1OFEA 3VSUA 2X3HA 1O8DA 3B4NA 4XLAA 1DBOA 2IQ7A 3ML3A 4XORA 4AVZA 4XR6A 4C2LA 1X0CA 1OFLA 4XL9A 3KRGA 4URRA 4OPWA 2VFOA 3WWGA 1QA3A 1O8FA 2QYUA 4W8SA 4MXNA 4XONA 2XTXA 4OJLA 3SQVA 2BM5A 4MR0A 2X6WA 3GQAA 2VBMA 1KQ5A 1XG2A 2BX6A 2NTPA 4I84A 2XC1A 4XOPA 3VMWA 2QZAA 1O8LA 2PYGA 2O04A 4W8TA 1PE9A 4HWVA 1K8FA 3TH0A 2NSTA 2Z8GA 2F3LA 2X6XA 4NK6A 2VFQA 2XTWA 1K4ZA 1RMGA 3VSTA 1HF2A 2B0RA 4U4BA 1QCXA 4XQFA 1EA0A 2UVEA 2W7ZA 1CLWA
chains in the Genus database with same CATH topology
1DBGA 4XMYA 1OGOX 2VJJA 2NZMA 1O8JA 4YZAA 2PECA 2QX3A 4W8RA 4YZXA 1IDJA 2VBEA 4OZYA 1GQ8A 2O0WA 3FY3A 4YELA 3UW0A 1QJVA 1O88A 4YEJA 1CZFA 2QY1A 1O8MA 4W8QA 1AIRA 4XLFA 4XN0A 3ZSCA 2O0VA 2NSPA 3GRHA 4XM3A 4XKVA 4YZ0A 3JURA 1HG8A 1H80A 1OOCA 4OJOA 2VJIA 2ODLA 4OZZA 1IA5A 2O1DA 1OFMA 3LMWA 1KCDA 1JTAA 4XN3A 3GQ8A 4XKWA 1K5CA 2EWEA 2VBKA 2X6YA 4PMHA 4Z06A 1PXZA 1RU4A 3T9GA 3EQOA 4U49A 4XLCA 3EQNA 5C1CA 3VSVA 2INUA 1PLUA 3SUCA 3VMVA 1O8GA 2NTQA 1KCCA 1BHEA 1VBLA 1JRGA 4Z03A 1O8KA 4OJ6A 4XOTA 4EW9A 1KTWA 2QXZA 2UVFA 1O8HA 3ZPPA 3GQ9A 4OJ5A 1WMRA 4XLEA 3B8YA 1O8EA 2NT9A 1EE6A 2X85A 1O8IA 4XNFA 2PYHA 4XLHA 4NK8A 1IDKA 1OGMX 2NT6A 2O17A 2BSPA 3B90A 4Z05A 5AMVA 2INVA 4YZQA 1IB4A 1BN8A 1RWRA 4OJPA 1NHCA 3GQ7A 2NTBA 5C1EA 3VSUA 2X3HA 1O8DA 3B4NA 4XLAA 1DBOA 2IQ7A 4XORA 4AVZA 4XR6A 4C2LA 1X0CA 1OFLA 4XL9A 3KRGA 4URRA 3WWGA 1O8FA 4W8SA 4MXNA 4XONA 4OJLA 4MR0A 2X6WA 3GQAA 2VBMA 1XG2A 2NTPA 4I84A 4XOPA 3VMWA 1O8LA 2PYGA 2O04A 4W8TA 1PE9A 4HWVA 2NSTA 2Z8GA 2X6XA 4NK6A 1RMGA 3VSTA 4U4BA 1QCXA 4XQFA 2UVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBG A;  4XMY A;  1OGO X;  2VJJ A;  2NZM A;  1O8J A;  4YZA A;  2PEC A;  2QX3 A;  4W8R A;  4YZX A;  1IDJ A;  2VBE A;  4OZY A;  1GQ8 A;  2O0W A;  3FY3 A;  4YEL A;  3UW0 A;  1QJV A;  1O88 A;  4YEJ A;  1CZF A;  2QY1 A;  1O8M A;  4W8Q A;  1AIR A;  4XLF A;  4XN0 A;  3ZSC A;  2O0V A;  2NSP A;  3GRH A;  4XM3 A;  4XKV A;  4YZ0 A;  3JUR A;  1HG8 A;  1H80 A;  1OOC A;  4OJO A;  2VJI A;  2ODL A;  4OZZ A;  1IA5 A;  2O1D A;  1OFM A;  3LMW A;  1KCD A;  1JTA A;  4XN3 A;  3GQ8 A;  4XKW A;  1K5C A;  2EWE A;  2VBK A;  2X6Y A;  4PMH A;  4Z06 A;  1PXZ A;  1RU4 A;  3T9G A;  3EQO A;  4U49 A;  4XLC A;  3EQN A;  5C1C A;  3VSV A;  2INU A;  1PLU A;  3SUC A;  3VMV A;  1O8G A;  2NTQ A;  1KCC A;  1BHE A;  1VBL A;  1JRG A;  4Z03 A;  1O8K A;  4OJ6 A;  4XOT A;  4EW9 A;  1KTW A;  2QXZ A;  2UVF A;  1O8H A;  3ZPP A;  3GQ9 A;  4OJ5 A;  1WMR A;  4XLE A;  3B8Y A;  1O8E A;  2NT9 A;  1EE6 A;  2X85 A;  1O8I A;  4XNF A;  2PYH A;  4XLH A;  4NK8 A;  1IDK A;  1OGM X;  2NT6 A;  2O17 A;  2BSP A;  3B90 A;  4Z05 A;  5AMV A;  2INV A;  4YZQ A;  1IB4 A;  1BN8 A;  1RWR A;  4OJP A;  1NHC A;  3GQ7 A;  2NTB A;  5C1E A;  3VSU A;  2X3H A;  1O8D A;  3B4N A;  4XLA A;  1DBO A;  2IQ7 A;  4XOR A;  4AVZ A;  4XR6 A;  4C2L A;  1X0C A;  1OFL A;  4XL9 A;  3KRG A;  4URR A;  3WWG A;  1O8F A;  4W8S A;  4MXN A;  4XON A;  4OJL A;  4MR0 A;  2X6W A;  3GQA A;  2VBM A;  1XG2 A;  2NTP A;  4I84 A;  4XOP A;  3VMW A;  1O8L A;  2PYG A;  2O04 A;  4W8T A;  1PE9 A;  4HWV A;  2NST A;  2Z8G A;  2X6X A;  4NK6 A;  1RMG A;  3VST A;  4U4B A;  1QCX A;  4XQF A;  2UVE A; 
#chains in the Genus database with same CATH topology
 5JLV C;  1DBG A;  4XMY A;  1OGO X;  4YDT A;  2V5I A;  2VJJ A;  2NZM A;  1O8J A;  4OM9 A;  4YZA A;  1TSP A;  2BM7 A;  2PEC A;  2QX3 A;  1LLZ A;  3PSZ A;  4W8R A;  4YC5 A;  2XT4 A;  4YZX A;  1IDJ A;  2VBE A;  2YUH A;  4OZY A;  1GQ8 A;  2O0W A;  3FY3 A;  2G0Y A;  4YEL A;  3UW0 A;  1QJV A;  4YEI A;  3DU1 X;  3SZE A;  1O88 A;  4YEJ A;  1CZF A;  3SYJ A;  2QY1 A;  1O8M A;  4W8Q A;  1AIR A;  2VFP A;  3BH7 B;  4XLF A;  3RIQ A;  3JX8 A;  2XT2 A;  1QRB A;  1LLW A;  3H09 A;  4XN0 A;  3ZSC A;  2O0V A;  2NSP A;  3GRH A;  4XM3 A;  4XKV A;  4YZ0 A;  3JUR A;  1HG8 A;  4KH3 A;  1H80 A;  1OOC A;  1TYX A;  2J8K A;  4OJO A;  2VJI A;  2ODL A;  4OZZ A;  1QQ1 A;  1IA5 A;  1WXR A;  2O1D A;  1OFM A;  3LMW A;  3SY2 A;  1KCD A;  1JTA A;  1TYU A;  3GQ8 A;  4XN3 A;  4XKW A;  1K5C A;  2EWE A;  2VBK A;  2J8I A;  2X6Y A;  2IOU G;  4PMH A;  4Z06 A;  1PXZ A;  1RU4 A;  2VFN A;  3T9G A;  3EQO A;  5JMC B;  1DAB A;  4YCQ A;  5DNS A;  1QA1 A;  4U49 A;  3AK5 A;  4XLC A;  3N6Z A;  3EQN A;  4JRA C;  1LM1 A;  5C1C A;  3VSV A;  2INU A;  1PLU A;  2O6W A;  3SUC A;  3VMV A;  1O8G A;  2NTQ A;  3P4G A;  2VFM A;  4V02 C;  1QA2 A;  3PET A;  1KCC A;  3NAW A;  1BHE A;  1VBL A;  1JRG A;  4Z03 A;  1O8K A;  4OJ6 A;  4XOT A;  3PSS A;  4EW9 A;  1TYW A;  1KTW A;  2QXZ A;  4YFO A;  2UVF A;  1O8H A;  1EZG A;  1OFD A;  3GQ9 A;  4OJ5 A;  3ZPP A;  1WMR A;  4XLE A;  3B8Y A;  1L1I A;  2BM6 A;  1O8E A;  2NT9 A;  3NB2 A;  1EE6 A;  3LJY A;  2X85 A;  1O8I A;  4XNF A;  2PYH A;  4XLH A;  4NK8 A;  1IDK A;  1OGM X;  2NT6 A;  2O17 A;  2XTY A;  2BSP A;  3B90 A;  4Z05 A;  2BM4 A;  3BH6 B;  3N90 A;  2INV A;  4YZQ A;  5AMV A;  1IB4 A;  1BN8 A;  1RWR A;  4OJP A;  1NHC A;  3GQ7 A;  1QRC A;  2NTB A;  5C1E A;  1TYV A;  3LYC A;  1OFE A;  3VSU A;  2X3H A;  1O8D A;  3B4N A;  4XLA A;  1DBO A;  2IQ7 A;  3ML3 A;  4XOR A;  4AVZ A;  4XR6 A;  4C2L A;  1X0C A;  1OFL A;  4XL9 A;  3KRG A;  4URR A;  4OPW A;  2VFO A;  3WWG A;  1QA3 A;  1O8F A;  2QYU A;  4W8S A;  4MXN A;  4XON A;  2XTX A;  4OJL A;  3SQV A;  2BM5 A;  4MR0 A;  2X6W A;  3GQA A;  2VBM A;  1KQ5 A;  1XG2 A;  2BX6 A;  2NTP A;  4I84 A;  2XC1 A;  4XOP A;  3VMW A;  2QZA A;  1O8L A;  2PYG A;  2O04 A;  4W8T A;  1PE9 A;  4HWV A;  1K8F A;  3TH0 A;  2NST A;  2Z8G A;  2F3L A;  2X6X A;  4NK6 A;  2VFQ A;  2XTW A;  1K4Z A;  1RMG A;  3VST A;  1HF2 A;  2B0R A;  4U4B A;  1QCX A;  4XQF A;  1EA0 A;  2UVE A;  2W7Z A;  1CLW A; 
#chains in the Genus database with same CATH homology
 1DBG A;  4XMY A;  1OGO X;  2VJJ A;  2NZM A;  1O8J A;  4YZA A;  2PEC A;  2QX3 A;  4W8R A;  4YZX A;  1IDJ A;  2VBE A;  4OZY A;  1GQ8 A;  2O0W A;  3FY3 A;  4YEL A;  3UW0 A;  1QJV A;  1O88 A;  4YEJ A;  1CZF A;  2QY1 A;  1O8M A;  4W8Q A;  1AIR A;  4XLF A;  4XN0 A;  3ZSC A;  2O0V A;  2NSP A;  3GRH A;  4XM3 A;  4XKV A;  4YZ0 A;  3JUR A;  1HG8 A;  1H80 A;  1OOC A;  4OJO A;  2VJI A;  2ODL A;  4OZZ A;  1IA5 A;  2O1D A;  1OFM A;  3LMW A;  1KCD A;  1JTA A;  4XN3 A;  3GQ8 A;  4XKW A;  1K5C A;  2EWE A;  2VBK A;  2X6Y A;  4PMH A;  4Z06 A;  1PXZ A;  1RU4 A;  3T9G A;  3EQO A;  4U49 A;  4XLC A;  3EQN A;  5C1C A;  3VSV A;  2INU A;  1PLU A;  3SUC A;  3VMV A;  1O8G A;  2NTQ A;  1KCC A;  1BHE A;  1VBL A;  1JRG A;  4Z03 A;  1O8K A;  4OJ6 A;  4XOT A;  4EW9 A;  1KTW A;  2QXZ A;  2UVF A;  1O8H A;  3ZPP A;  3GQ9 A;  4OJ5 A;  1WMR A;  4XLE A;  3B8Y A;  1O8E A;  2NT9 A;  1EE6 A;  2X85 A;  1O8I A;  4XNF A;  2PYH A;  4XLH A;  4NK8 A;  1IDK A;  1OGM X;  2NT6 A;  2O17 A;  2BSP A;  3B90 A;  4Z05 A;  5AMV A;  2INV A;  4YZQ A;  1IB4 A;  1BN8 A;  1RWR A;  4OJP A;  1NHC A;  3GQ7 A;  2NTB A;  5C1E A;  3VSU A;  2X3H A;  1O8D A;  3B4N A;  4XLA A;  1DBO A;  2IQ7 A;  4XOR A;  4AVZ A;  4XR6 A;  4C2L A;  1X0C A;  1OFL A;  4XL9 A;  3KRG A;  4URR A;  3WWG A;  1O8F A;  4W8S A;  4MXN A;  4XON A;  4OJL A;  4MR0 A;  2X6W A;  3GQA A;  2VBM A;  1XG2 A;  2NTP A;  4I84 A;  4XOP A;  3VMW A;  1O8L A;  2PYG A;  2O04 A;  4W8T A;  1PE9 A;  4HWV A;  2NST A;  2Z8G A;  2X6X A;  4NK6 A;  1RMG A;  3VST A;  4U4B A;  1QCX A;  4XQF A;  2UVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...