2QXZA

Pectate lyase r236f from xanthomonas campestris
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
330
structure length
330
Chain Sequence
GPVGYGAATTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRFGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pectate lyase II
publication title Improvement of the thermostability and activity of a pectate lyase by single amino acid substitutions, using a strategy based on melting-temperature-guided sequence alignment.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Lyase
total genus 127
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qxzA00
3GRHA 4XR6A 2INVA 4OJ6A 4XONA 4YZ0A 3B4NA 4U49A 2PECA 2VJJA 1HG8A 3KRGA 4NK6A 1KCDA 1H80A 2NTBA 4YELA 4YZQA 4XL9A 1O8MA 4XLEA 3FY3A 2X85A 4URRA 2O0WA 2VJIA 2ODLA 2INUA 5AMVA 4YZAA 3SUCA 4Z05A 3WWGA 1OFLA 5C1EA 1K5CA 2UVFA 2X6XA 2UVEA 2QX3A 4HWVA 4XQFA 1JTAA 1BN8A 3EQOA 2NT9A 2VBMA 1O8LA 1IA5A 1IB4A 4XLFA 1IDJA 1PE9A 2NTPA 4XLHA 3ZPPA 1KTWA 1GQ8A 4PMHA 4W8TA 2EWEA 1JRGA 2QY1A 4W8RA 1NHCA 4XNFA 4XN3A 2IQ7A 2NTQA 2O0VA 1QCXA 4XOPA 1X0CA 4AVZA 2O1DA 4OZZA 3VMWA 4XMYA 4I84A 3T9GA 1O8EA 4OJ5A 1WMRA 2O17A 2Z8GA 1EE6A 2NSTA 2X6YA 2QXZA 4XN0A 1RU4A 4XKWA 4XKVA 5C1CA 1IDKA 4NK8A 4XORA 4YZXA 1OGOX 2PYHA 4XOTA 3ZSCA 4Z03A 3VSVA 4XM3A 3UW0A 4MR0A 4XLCA 4OJOA 3VSTA 1O8JA 1RWRA 2X3HA 2PYGA 4EW9A 2NT6A 4U4BA 1O8GA 3VSUA 1AIRA 1CZFA 1OGMX 3VMVA 1KCCA 4W8QA 1O8KA 2NSPA 3GQAA 3GQ7A 2VBKA 1QJVA 3B90A 3GQ9A 3JURA 1PLUA 4Z06A 1O8IA 1DBOA 2O04A 3B8YA 1DBGA 3LMWA 3EQNA 2X6WA 1BHEA 1VBLA 4MXNA 1O8FA 2NZMA 1PXZA 1RMGA 4C2LA 4OJLA 1OFMA 4XLAA 4OZYA 3GQ8A 4YEJA 1O88A 2BSPA 1O8HA 2VBEA 4OJPA 1XG2A 1OOCA 1O8DA 4W8SA
chains in the Genus database with same CATH superfamily
1QRCA 1KQ5A 3GRHA 4OPWA 3RIQA 3NAWA 4XR6A 2INVA 2VFPA 4OJ6A 4XONA 3B4NA 4U49A 2PECA 4YZ0A 1QA1A 1L1IA 1QA3A 2VJJA 2QYUA 1HG8A 1HF2A 1QA2A 3KRGA 4NK6A 3SY2A 2VFOA 4YFOA 1KCDA 1H80A 2NTBA 4YELA 4YZQA 4XL9A 1TYWA 1O8MA 4W8SA 4XLEA 1LLWA 2X85A 3FY3A 4URRA 2O0WA 2VJIA 2ODLA 2INUA 1CLWA 2J8KA 4YZAA 5AMVA 3BH6B 3SUCA 4YEIA 2VFQA 3LYCA 4Z05A 3WWGA 1OFLA 1QRBA 5C1EA 2QZAA 3AK5A 1K5CA 1QQ1A 2UVFA 2X6XA 1TYXA 2UVEA 2QX3A 3LJYA 2J8IA 4HWVA 1OFDA 1JTAA 1BN8A 3EQOA 4XQFA 2NT9A 2VBMA 1O8LA 2YUHA 1IA5A 1IB4A 4XLFA 1IDJA 1PE9A 2NTPA 4XLHA 1K4ZA 3ZPPA 1KTWA 4V02C 1GQ8A 4PMHA 4W8TA 1TYVA 2EWEA 1JRGA 2QY1A 4W8RA 1NHCA 4XNFA 2W7ZA 1TSPA 2IQ7A 4OM9A 4XN3A 3P4GA 2NTQA 2O0VA 3DU1X 1QCXA 2G0YA 4XOPA 3JX8A 3PETA 1X0CA 2BM5A 2XC1A 4AVZA 2BM4A 2O1DA 2VFMA 2XTYA 4OZZA 3VMWA 4XMYA 2V5IA 4I84A 3T9GA 3H09A 1O8EA 3N6ZA 4OJ5A 5JLVC 1WMRA 2O17A 2Z8GA 1EE6A 2NSTA 2X6YA 2QXZA 4XN0A 4YCQA 1RU4A 2XTXA 4JRAC 4XKWA 4XKVA 5C1CA 1IDKA 4NK8A 1DABA 4XORA 4YZXA 3SYJA 1OGOX 2PYHA 4XOTA 2XT4A 2F3LA 3ZSCA 2BX6A 4Z03A 3SZEA 3VSVA 4XM3A 3UW0A 3PSSA 4MR0A 4XLCA 4OJOA 2IOUG 1O8JA 3VSTA 1RWRA 2X3HA 2PYGA 4EW9A 2NT6A 4U4BA 1O8GA 2XT2A 3VSUA 1LM1A 1EZGA 1AIRA 1CZFA 3PSZA 1OGMX 3VMVA 2O6WA 1OFEA 1O8KA 4W8QA 1KCCA 2NSPA 3BH7B 3GQAA 3GQ7A 2VBKA 1QJVA 3NB2A 3B90A 3GQ9A 3JURA 1PLUA 2VFNA 4Z06A 1O8IA 1EA0A 2XTWA 3N90A 1WXRA 1DBOA 2O04A 3B8YA 1DBGA 3LMWA 4YC5A 3EQNA 2X6WA 5DNSA 1BHEA 1K8FA 1LLZA 1VBLA 4MXNA 5JMCB 1O8FA 2NZMA 1PXZA 1RMGA 4C2LA 4OJLA 1OFMA 4XLAA 4OZYA 3GQ8A 2B0RA 2BM7A 4YEJA 2BM6A 1O88A 4YDTA 3SQVA 3TH0A 2BSPA 4KH3A 1O8HA 2VBEA 4OJPA 3ML3A 1XG2A 1OOCA 1O8DA 1TYUA
chains in the Genus database with same CATH topology
3GRHA 4XR6A 2INVA 4OJ6A 4XONA 4YZ0A 3B4NA 4U49A 2PECA 2VJJA 1HG8A 3KRGA 4NK6A 1KCDA 1H80A 2NTBA 4YELA 4YZQA 4XL9A 1O8MA 4XLEA 3FY3A 2X85A 4URRA 2O0WA 2VJIA 2ODLA 2INUA 5AMVA 4YZAA 3SUCA 4Z05A 3WWGA 1OFLA 5C1EA 1K5CA 2UVFA 2X6XA 2UVEA 2QX3A 4HWVA 4XQFA 1JTAA 1BN8A 3EQOA 2NT9A 2VBMA 1O8LA 1IA5A 1IB4A 4XLFA 1IDJA 1PE9A 2NTPA 4XLHA 3ZPPA 1KTWA 1GQ8A 4PMHA 4W8TA 2EWEA 1JRGA 2QY1A 4W8RA 1NHCA 4XNFA 4XN3A 2IQ7A 2NTQA 2O0VA 1QCXA 4XOPA 1X0CA 4AVZA 2O1DA 4OZZA 3VMWA 4XMYA 4I84A 3T9GA 1O8EA 4OJ5A 1WMRA 2O17A 2Z8GA 1EE6A 2NSTA 2X6YA 2QXZA 4XN0A 1RU4A 4XKWA 4XKVA 5C1CA 1IDKA 4NK8A 4XORA 4YZXA 1OGOX 2PYHA 4XOTA 3ZSCA 4Z03A 3VSVA 4XM3A 3UW0A 4MR0A 4XLCA 4OJOA 3VSTA 1O8JA 1RWRA 2X3HA 2PYGA 4EW9A 2NT6A 4U4BA 1O8GA 3VSUA 1AIRA 1CZFA 1OGMX 3VMVA 1KCCA 4W8QA 1O8KA 2NSPA 3GQAA 3GQ7A 2VBKA 1QJVA 3B90A 3GQ9A 3JURA 1PLUA 4Z06A 1O8IA 1DBOA 2O04A 3B8YA 1DBGA 3LMWA 3EQNA 2X6WA 1BHEA 1VBLA 4MXNA 1O8FA 2NZMA 1PXZA 1RMGA 4C2LA 4OJLA 1OFMA 4XLAA 4OZYA 3GQ8A 4YEJA 1O88A 2BSPA 1O8HA 2VBEA 4OJPA 1XG2A 1OOCA 1O8DA 4W8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRH A;  4XR6 A;  2INV A;  4OJ6 A;  4XON A;  4YZ0 A;  3B4N A;  4U49 A;  2PEC A;  2VJJ A;  1HG8 A;  3KRG A;  4NK6 A;  1KCD A;  1H80 A;  2NTB A;  4YEL A;  4YZQ A;  4XL9 A;  1O8M A;  4XLE A;  3FY3 A;  2X85 A;  4URR A;  2O0W A;  2VJI A;  2ODL A;  2INU A;  5AMV A;  4YZA A;  3SUC A;  4Z05 A;  3WWG A;  1OFL A;  5C1E A;  1K5C A;  2UVF A;  2X6X A;  2UVE A;  2QX3 A;  4HWV A;  4XQF A;  1JTA A;  1BN8 A;  3EQO A;  2NT9 A;  2VBM A;  1O8L A;  1IA5 A;  1IB4 A;  4XLF A;  1IDJ A;  1PE9 A;  2NTP A;  4XLH A;  3ZPP A;  1KTW A;  1GQ8 A;  4PMH A;  4W8T A;  2EWE A;  1JRG A;  2QY1 A;  4W8R A;  1NHC A;  4XNF A;  4XN3 A;  2IQ7 A;  2NTQ A;  2O0V A;  1QCX A;  4XOP A;  1X0C A;  4AVZ A;  2O1D A;  4OZZ A;  3VMW A;  4XMY A;  4I84 A;  3T9G A;  1O8E A;  4OJ5 A;  1WMR A;  2O17 A;  2Z8G A;  1EE6 A;  2NST A;  2X6Y A;  2QXZ A;  4XN0 A;  1RU4 A;  4XKW A;  4XKV A;  5C1C A;  1IDK A;  4NK8 A;  4XOR A;  4YZX A;  1OGO X;  2PYH A;  4XOT A;  3ZSC A;  4Z03 A;  3VSV A;  4XM3 A;  3UW0 A;  4MR0 A;  4XLC A;  4OJO A;  3VST A;  1O8J A;  1RWR A;  2X3H A;  2PYG A;  4EW9 A;  2NT6 A;  4U4B A;  1O8G A;  3VSU A;  1AIR A;  1CZF A;  1OGM X;  3VMV A;  1KCC A;  4W8Q A;  1O8K A;  2NSP A;  3GQA A;  3GQ7 A;  2VBK A;  1QJV A;  3B90 A;  3GQ9 A;  3JUR A;  1PLU A;  4Z06 A;  1O8I A;  1DBO A;  2O04 A;  3B8Y A;  1DBG A;  3LMW A;  3EQN A;  2X6W A;  1BHE A;  1VBL A;  4MXN A;  1O8F A;  2NZM A;  1PXZ A;  1RMG A;  4C2L A;  4OJL A;  1OFM A;  4XLA A;  4OZY A;  3GQ8 A;  4YEJ A;  1O88 A;  2BSP A;  1O8H A;  2VBE A;  4OJP A;  1XG2 A;  1OOC A;  1O8D A;  4W8S A; 
#chains in the Genus database with same CATH topology
 1QRC A;  1KQ5 A;  3GRH A;  4OPW A;  3RIQ A;  3NAW A;  4XR6 A;  2INV A;  2VFP A;  4OJ6 A;  4XON A;  3B4N A;  4U49 A;  2PEC A;  4YZ0 A;  1QA1 A;  1L1I A;  1QA3 A;  2VJJ A;  2QYU A;  1HG8 A;  1HF2 A;  1QA2 A;  3KRG A;  4NK6 A;  3SY2 A;  2VFO A;  4YFO A;  1KCD A;  1H80 A;  2NTB A;  4YEL A;  4YZQ A;  4XL9 A;  1TYW A;  1O8M A;  4W8S A;  4XLE A;  1LLW A;  2X85 A;  3FY3 A;  4URR A;  2O0W A;  2VJI A;  2ODL A;  2INU A;  1CLW A;  2J8K A;  4YZA A;  5AMV A;  3BH6 B;  3SUC A;  4YEI A;  2VFQ A;  3LYC A;  4Z05 A;  3WWG A;  1OFL A;  1QRB A;  5C1E A;  2QZA A;  3AK5 A;  1K5C A;  1QQ1 A;  2UVF A;  2X6X A;  1TYX A;  2UVE A;  2QX3 A;  3LJY A;  2J8I A;  4HWV A;  1OFD A;  1JTA A;  1BN8 A;  3EQO A;  4XQF A;  2NT9 A;  2VBM A;  1O8L A;  2YUH A;  1IA5 A;  1IB4 A;  4XLF A;  1IDJ A;  1PE9 A;  2NTP A;  4XLH A;  1K4Z A;  3ZPP A;  1KTW A;  4V02 C;  1GQ8 A;  4PMH A;  4W8T A;  1TYV A;  2EWE A;  1JRG A;  2QY1 A;  4W8R A;  1NHC A;  4XNF A;  2W7Z A;  1TSP A;  2IQ7 A;  4OM9 A;  4XN3 A;  3P4G A;  2NTQ A;  2O0V A;  3DU1 X;  1QCX A;  2G0Y A;  4XOP A;  3JX8 A;  3PET A;  1X0C A;  2BM5 A;  2XC1 A;  4AVZ A;  2BM4 A;  2O1D A;  2VFM A;  2XTY A;  4OZZ A;  3VMW A;  4XMY A;  2V5I A;  4I84 A;  3T9G A;  3H09 A;  1O8E A;  3N6Z A;  4OJ5 A;  5JLV C;  1WMR A;  2O17 A;  2Z8G A;  1EE6 A;  2NST A;  2X6Y A;  2QXZ A;  4XN0 A;  4YCQ A;  1RU4 A;  2XTX A;  4JRA C;  4XKW A;  4XKV A;  5C1C A;  1IDK A;  4NK8 A;  1DAB A;  4XOR A;  4YZX A;  3SYJ A;  1OGO X;  2PYH A;  4XOT A;  2XT4 A;  2F3L A;  3ZSC A;  2BX6 A;  4Z03 A;  3SZE A;  3VSV A;  4XM3 A;  3UW0 A;  3PSS A;  4MR0 A;  4XLC A;  4OJO A;  2IOU G;  1O8J A;  3VST A;  1RWR A;  2X3H A;  2PYG A;  4EW9 A;  2NT6 A;  4U4B A;  1O8G A;  2XT2 A;  3VSU A;  1LM1 A;  1EZG A;  1AIR A;  1CZF A;  3PSZ A;  1OGM X;  3VMV A;  2O6W A;  1OFE A;  1O8K A;  4W8Q A;  1KCC A;  2NSP A;  3BH7 B;  3GQA A;  3GQ7 A;  2VBK A;  1QJV A;  3NB2 A;  3B90 A;  3GQ9 A;  3JUR A;  1PLU A;  2VFN A;  4Z06 A;  1O8I A;  1EA0 A;  2XTW A;  3N90 A;  1WXR A;  1DBO A;  2O04 A;  3B8Y A;  1DBG A;  3LMW A;  4YC5 A;  3EQN A;  2X6W A;  5DNS A;  1BHE A;  1K8F A;  1LLZ A;  1VBL A;  4MXN A;  5JMC B;  1O8F A;  2NZM A;  1PXZ A;  1RMG A;  4C2L A;  4OJL A;  1OFM A;  4XLA A;  4OZY A;  3GQ8 A;  2B0R A;  2BM7 A;  4YEJ A;  2BM6 A;  1O88 A;  4YDT A;  3SQV A;  3TH0 A;  2BSP A;  4KH3 A;  1O8H A;  2VBE A;  4OJP A;  3ML3 A;  1XG2 A;  1OOC A;  1O8D A;  1TYU A; 
#chains in the Genus database with same CATH homology
 3GRH A;  4XR6 A;  2INV A;  4OJ6 A;  4XON A;  4YZ0 A;  3B4N A;  4U49 A;  2PEC A;  2VJJ A;  1HG8 A;  3KRG A;  4NK6 A;  1KCD A;  1H80 A;  2NTB A;  4YEL A;  4YZQ A;  4XL9 A;  1O8M A;  4XLE A;  3FY3 A;  2X85 A;  4URR A;  2O0W A;  2VJI A;  2ODL A;  2INU A;  5AMV A;  4YZA A;  3SUC A;  4Z05 A;  3WWG A;  1OFL A;  5C1E A;  1K5C A;  2UVF A;  2X6X A;  2UVE A;  2QX3 A;  4HWV A;  4XQF A;  1JTA A;  1BN8 A;  3EQO A;  2NT9 A;  2VBM A;  1O8L A;  1IA5 A;  1IB4 A;  4XLF A;  1IDJ A;  1PE9 A;  2NTP A;  4XLH A;  3ZPP A;  1KTW A;  1GQ8 A;  4PMH A;  4W8T A;  2EWE A;  1JRG A;  2QY1 A;  4W8R A;  1NHC A;  4XNF A;  4XN3 A;  2IQ7 A;  2NTQ A;  2O0V A;  1QCX A;  4XOP A;  1X0C A;  4AVZ A;  2O1D A;  4OZZ A;  3VMW A;  4XMY A;  4I84 A;  3T9G A;  1O8E A;  4OJ5 A;  1WMR A;  2O17 A;  2Z8G A;  1EE6 A;  2NST A;  2X6Y A;  2QXZ A;  4XN0 A;  1RU4 A;  4XKW A;  4XKV A;  5C1C A;  1IDK A;  4NK8 A;  4XOR A;  4YZX A;  1OGO X;  2PYH A;  4XOT A;  3ZSC A;  4Z03 A;  3VSV A;  4XM3 A;  3UW0 A;  4MR0 A;  4XLC A;  4OJO A;  3VST A;  1O8J A;  1RWR A;  2X3H A;  2PYG A;  4EW9 A;  2NT6 A;  4U4B A;  1O8G A;  3VSU A;  1AIR A;  1CZF A;  1OGM X;  3VMV A;  1KCC A;  4W8Q A;  1O8K A;  2NSP A;  3GQA A;  3GQ7 A;  2VBK A;  1QJV A;  3B90 A;  3GQ9 A;  3JUR A;  1PLU A;  4Z06 A;  1O8I A;  1DBO A;  2O04 A;  3B8Y A;  1DBG A;  3LMW A;  3EQN A;  2X6W A;  1BHE A;  1VBL A;  4MXN A;  1O8F A;  2NZM A;  1PXZ A;  1RMG A;  4C2L A;  4OJL A;  1OFM A;  4XLA A;  4OZY A;  3GQ8 A;  4YEJ A;  1O88 A;  2BSP A;  1O8H A;  2VBE A;  4OJP A;  1XG2 A;  1OOC A;  1O8D A;  4W8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...