2QXZA

Pectate lyase r236f from xanthomonas campestris
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
330
structure length
330
Chain Sequence
GPVGYGAATTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRFGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improvement of the thermostability and activity of a pectate lyase by single amino acid substitutions, using a strategy based on melting-temperature-guided sequence alignment.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Lyase
molecule keywords pectate lyase II
total genus 127
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qxzA00
1OFMA 4AVZA 4XN3A 1O8JA 1QJVA 2NSTA 3KRGA 3B4NA 2Z8GA 4C2LA 5C1EA 4XN0A 3VMWA 2X3HA 4U4BA 3VSTA 3ZPPA 2PECA 1QCXA 3EQOA 3SUCA 4EW9A 1OGMX 2INUA 1VBLA 3FY3A 1PXZA 4PMHA 1JRGA 4XKVA 2UVFA 3VSUA 1IDJA 3ZSCA 4NK6A 4XLFA 2VJJA 4OZYA 3GQ8A 1X0CA 4Z06A 2PYHA 1NHCA 2O0WA 2NSPA 3B90A 3VSVA 2UVEA 3LMWA 4XOPA 4MXNA 1DBOA 4Z05A 1IA5A 1RMGA 3UW0A 1KTWA 2NTBA 2VJIA 3EQNA 4XLEA 1O88A 1OFLA 2QX3A 1RWRA 4XLAA 5AMVA 1HG8A 4OJOA 4XM3A 1K5CA 2NTPA 1WMRA 4OJ5A 1O8HA 4XL9A 1H80A 1O8DA 4YELA 2VBMA 3WWGA 4W8QA 4URRA 1RU4A 4XKWA 4XLCA 4YZ0A 4XNFA 2NTQA 1OOCA 2O0VA 3GQ7A 2QY1A 1IB4A 5C1CA 1PLUA 4HWVA 2O1DA 3GQAA 4Z03A 4YEJA 4OJPA 1AIRA 2VBEA 1O8GA 4XQFA 1IDKA 1O8LA 4YZXA 4U49A 4W8RA 4YZQA 4YZAA 1O8KA 4XMYA 1JTAA 2VBKA 1XG2A 4NK8A 1O8IA 4MR0A 2ODLA 3GQ9A 3JURA 2INVA 4I84A 3T9GA 4XOTA 2O04A 2BSPA 4W8SA 2O17A 1O8EA 1GQ8A 2NT9A 2NZMA 2X6WA 1BN8A 2X85A 1OGOX 3B8YA 1O8MA 3VMVA 1EE6A 1O8FA 1PE9A 2EWEA 2IQ7A 2NT6A 1BHEA 4XONA 1KCCA 4XR6A 1CZFA 4OJ6A 1KCDA 2X6XA 2PYGA 2X6YA 3GRHA 2QXZA 4XORA 4XLHA 1DBGA 4OJLA 4OZZA 4W8TA
chains in the Genus database with same CATH superfamily
2VFPA 1OFMA 1EZGA 4AVZA 4XN3A 1O8JA 1QJVA 2NSTA 3KRGA 3B4NA 2XT4A 2Z8GA 1K8FA 2V5IA 4C2LA 5C1EA 2F3LA 4XN0A 3VMWA 2X3HA 4U4BA 3VSTA 3ZPPA 2PECA 1QCXA 3EQOA 3SUCA 1TYWA 4EW9A 1OGMX 2INUA 1VBLA 3FY3A 1PXZA 4PMHA 1JRGA 1KQ5A 1LLZA 4XKVA 2UVFA 4KH3A 3VSUA 1IDJA 3ZSCA 4NK6A 4XLFA 2VJJA 4OZYA 3GQ8A 1X0CA 4Z06A 2PYHA 1NHCA 2YUHA 2O0WA 2NSPA 1TYXA 3B90A 3SQVA 3VSVA 2UVEA 3LMWA 4XOPA 4MXNA 1DBOA 4Z05A 3LYCA 1IA5A 1RMGA 3UW0A 1KTWA 2QYUA 2NTBA 2VJIA 3EQNA 1TYVA 3N90A 2IOUG 4YC5A 4XLEA 1O88A 1OFLA 2QX3A 1RWRA 4XLAA 3JX8A 5AMVA 3PSSA 1HG8A 4OZZA 2BM4A 4OJOA 4XM3A 1LM1A 2NTPA 3RIQA 1DABA 1K5CA 3SZEA 3N6ZA 3NAWA 1WMRA 2XT2A 4OJ5A 1TSPA 1O8HA 3PETA 3SY2A 4XL9A 1H80A 1O8DA 2XTYA 1WXRA 4YELA 2VBMA 3WWGA 4W8QA 2J8KA 1RU4A 4URRA 4XKWA 2XTXA 4XLCA 4YZ0A 1QA1A 2VFMA 4XNFA 2NTQA 1OOCA 2O0VA 3GQ7A 2QY1A 1IB4A 5C1CA 2XC1A 1PLUA 4V02C 3SYJA 2W7ZA 4HWVA 2O1DA 2BM7A 2BX6A 4OPWA 1K4ZA 3GQAA 4Z03A 4YEJA 4OJPA 5JMCB 1AIRA 2VBEA 3P4GA 1O8GA 1HF2A 4YFOA 4XQFA 3PSZA 2BM6A 1IDKA 1O8LA 2VFNA 4JRAC 4YZXA 4U49A 4W8RA 1CLWA 1OFDA 3BH6B 4YZQA 4YZAA 5JLVC 1O8KA 3LJYA 4OM9A 1JTAA 1QRBA 2VBKA 1XG2A 4XMYA 1QQ1A 4YEIA 4NK8A 1O8IA 1EA0A 2VFOA 1TYUA 4MR0A 1LLWA 2QZAA 1QA2A 1L1IA 2ODLA 3GQ9A 3JURA 2INVA 4I84A 4YCQA 3T9GA 4XOTA 2O04A 2BSPA 4W8SA 3ML3A 2B0RA 1O8EA 1GQ8A 2NT9A 2O17A 3TH0A 1QRCA 2VFQA 2NZMA 2X6WA 1BN8A 1OFEA 2X85A 1OGOX 3B8YA 3DU1X 1O8MA 2O6WA 4YDTA 3VMVA 1EE6A 1O8FA 1PE9A 2EWEA 2IQ7A 2NT6A 1BHEA 2XTWA 3H09A 4XONA 1KCCA 1QA3A 4XR6A 1CZFA 2J8IA 4OJ6A 1KCDA 2X6XA 2PYGA 2X6YA 5DNSA 3GRHA 2QXZA 4XORA 2G0YA 4XLHA 1DBGA 2BM5A 4OJLA 3NB2A 3BH7B 4W8TA 3AK5A
chains in the Genus database with same CATH topology
1OFMA 4AVZA 4XN3A 1O8JA 1QJVA 2NSTA 3KRGA 3B4NA 2Z8GA 4C2LA 5C1EA 4XN0A 3VMWA 2X3HA 4U4BA 3VSTA 3ZPPA 2PECA 1QCXA 3EQOA 3SUCA 4EW9A 1OGMX 2INUA 1VBLA 3FY3A 1PXZA 4PMHA 1JRGA 4XKVA 2UVFA 3VSUA 1IDJA 3ZSCA 4NK6A 4XLFA 2VJJA 4OZYA 3GQ8A 1X0CA 4Z06A 2PYHA 1NHCA 2O0WA 2NSPA 3B90A 3VSVA 2UVEA 3LMWA 4XOPA 4MXNA 1DBOA 4Z05A 1IA5A 1RMGA 3UW0A 1KTWA 2NTBA 2VJIA 3EQNA 4XLEA 1O88A 1OFLA 2QX3A 1RWRA 4XLAA 5AMVA 1HG8A 4OJOA 4XM3A 1K5CA 2NTPA 1WMRA 4OJ5A 1O8HA 4XL9A 1H80A 1O8DA 4YELA 2VBMA 3WWGA 4W8QA 4URRA 1RU4A 4XKWA 4XLCA 4YZ0A 4XNFA 2NTQA 1OOCA 2O0VA 3GQ7A 2QY1A 1IB4A 5C1CA 1PLUA 4HWVA 2O1DA 3GQAA 4Z03A 4YEJA 4OJPA 1AIRA 2VBEA 1O8GA 4XQFA 1IDKA 1O8LA 4YZXA 4U49A 4W8RA 4YZQA 4YZAA 1O8KA 4XMYA 1JTAA 2VBKA 1XG2A 4NK8A 1O8IA 4MR0A 2ODLA 3GQ9A 3JURA 2INVA 4I84A 3T9GA 4XOTA 2O04A 2BSPA 4W8SA 2O17A 1O8EA 1GQ8A 2NT9A 2NZMA 2X6WA 1BN8A 2X85A 1OGOX 3B8YA 1O8MA 3VMVA 1EE6A 1O8FA 1PE9A 2EWEA 2IQ7A 2NT6A 1BHEA 4XONA 1KCCA 4XR6A 1CZFA 4OJ6A 1KCDA 2X6XA 2PYGA 2X6YA 3GRHA 2QXZA 4XORA 4XLHA 1DBGA 4OJLA 4OZZA 4W8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OFM A;  4AVZ A;  4XN3 A;  1O8J A;  1QJV A;  2NST A;  3KRG A;  3B4N A;  2Z8G A;  4C2L A;  5C1E A;  4XN0 A;  3VMW A;  2X3H A;  4U4B A;  3VST A;  3ZPP A;  2PEC A;  1QCX A;  3EQO A;  3SUC A;  4EW9 A;  1OGM X;  2INU A;  1VBL A;  3FY3 A;  1PXZ A;  4PMH A;  1JRG A;  4XKV A;  2UVF A;  3VSU A;  1IDJ A;  3ZSC A;  4NK6 A;  4XLF A;  2VJJ A;  4OZY A;  3GQ8 A;  1X0C A;  4Z06 A;  2PYH A;  1NHC A;  2O0W A;  2NSP A;  3B90 A;  3VSV A;  2UVE A;  3LMW A;  4XOP A;  4MXN A;  1DBO A;  4Z05 A;  1IA5 A;  1RMG A;  3UW0 A;  1KTW A;  2NTB A;  2VJI A;  3EQN A;  4XLE A;  1O88 A;  1OFL A;  2QX3 A;  1RWR A;  4XLA A;  5AMV A;  1HG8 A;  4OJO A;  4XM3 A;  1K5C A;  2NTP A;  1WMR A;  4OJ5 A;  1O8H A;  4XL9 A;  1H80 A;  1O8D A;  4YEL A;  2VBM A;  3WWG A;  4W8Q A;  4URR A;  1RU4 A;  4XKW A;  4XLC A;  4YZ0 A;  4XNF A;  2NTQ A;  1OOC A;  2O0V A;  3GQ7 A;  2QY1 A;  1IB4 A;  5C1C A;  1PLU A;  4HWV A;  2O1D A;  3GQA A;  4Z03 A;  4YEJ A;  4OJP A;  1AIR A;  2VBE A;  1O8G A;  4XQF A;  1IDK A;  1O8L A;  4YZX A;  4U49 A;  4W8R A;  4YZQ A;  4YZA A;  1O8K A;  4XMY A;  1JTA A;  2VBK A;  1XG2 A;  4NK8 A;  1O8I A;  4MR0 A;  2ODL A;  3GQ9 A;  3JUR A;  2INV A;  4I84 A;  3T9G A;  4XOT A;  2O04 A;  2BSP A;  4W8S A;  2O17 A;  1O8E A;  1GQ8 A;  2NT9 A;  2NZM A;  2X6W A;  1BN8 A;  2X85 A;  1OGO X;  3B8Y A;  1O8M A;  3VMV A;  1EE6 A;  1O8F A;  1PE9 A;  2EWE A;  2IQ7 A;  2NT6 A;  1BHE A;  4XON A;  1KCC A;  4XR6 A;  1CZF A;  4OJ6 A;  1KCD A;  2X6X A;  2PYG A;  2X6Y A;  3GRH A;  2QXZ A;  4XOR A;  4XLH A;  1DBG A;  4OJL A;  4OZZ A;  4W8T A; 
#chains in the Genus database with same CATH topology
 2VFP A;  1OFM A;  1EZG A;  4AVZ A;  4XN3 A;  1O8J A;  1QJV A;  2NST A;  3KRG A;  3B4N A;  2XT4 A;  2Z8G A;  1K8F A;  2V5I A;  4C2L A;  5C1E A;  2F3L A;  4XN0 A;  3VMW A;  2X3H A;  4U4B A;  3VST A;  3ZPP A;  2PEC A;  1QCX A;  3EQO A;  3SUC A;  1TYW A;  4EW9 A;  1OGM X;  2INU A;  1VBL A;  3FY3 A;  1PXZ A;  4PMH A;  1JRG A;  1KQ5 A;  1LLZ A;  4XKV A;  2UVF A;  4KH3 A;  3VSU A;  1IDJ A;  3ZSC A;  4NK6 A;  4XLF A;  2VJJ A;  4OZY A;  3GQ8 A;  1X0C A;  4Z06 A;  2PYH A;  1NHC A;  2YUH A;  2O0W A;  2NSP A;  1TYX A;  3B90 A;  3SQV A;  3VSV A;  2UVE A;  3LMW A;  4XOP A;  4MXN A;  1DBO A;  4Z05 A;  3LYC A;  1IA5 A;  1RMG A;  3UW0 A;  1KTW A;  2QYU A;  2NTB A;  2VJI A;  3EQN A;  1TYV A;  3N90 A;  2IOU G;  4YC5 A;  4XLE A;  1O88 A;  1OFL A;  2QX3 A;  1RWR A;  4XLA A;  3JX8 A;  5AMV A;  3PSS A;  1HG8 A;  4OZZ A;  2BM4 A;  4OJO A;  4XM3 A;  1LM1 A;  2NTP A;  3RIQ A;  1DAB A;  1K5C A;  3SZE A;  3N6Z A;  3NAW A;  1WMR A;  2XT2 A;  4OJ5 A;  1TSP A;  1O8H A;  3PET A;  3SY2 A;  4XL9 A;  1H80 A;  1O8D A;  2XTY A;  1WXR A;  4YEL A;  2VBM A;  3WWG A;  4W8Q A;  2J8K A;  1RU4 A;  4URR A;  4XKW A;  2XTX A;  4XLC A;  4YZ0 A;  1QA1 A;  2VFM A;  4XNF A;  2NTQ A;  1OOC A;  2O0V A;  3GQ7 A;  2QY1 A;  1IB4 A;  5C1C A;  2XC1 A;  1PLU A;  4V02 C;  3SYJ A;  2W7Z A;  4HWV A;  2O1D A;  2BM7 A;  2BX6 A;  4OPW A;  1K4Z A;  3GQA A;  4Z03 A;  4YEJ A;  4OJP A;  5JMC B;  1AIR A;  2VBE A;  3P4G A;  1O8G A;  1HF2 A;  4YFO A;  4XQF A;  3PSZ A;  2BM6 A;  1IDK A;  1O8L A;  2VFN A;  4JRA C;  4YZX A;  4U49 A;  4W8R A;  1CLW A;  1OFD A;  3BH6 B;  4YZQ A;  4YZA A;  5JLV C;  1O8K A;  3LJY A;  4OM9 A;  1JTA A;  1QRB A;  2VBK A;  1XG2 A;  4XMY A;  1QQ1 A;  4YEI A;  4NK8 A;  1O8I A;  1EA0 A;  2VFO A;  1TYU A;  4MR0 A;  1LLW A;  2QZA A;  1QA2 A;  1L1I A;  2ODL A;  3GQ9 A;  3JUR A;  2INV A;  4I84 A;  4YCQ A;  3T9G A;  4XOT A;  2O04 A;  2BSP A;  4W8S A;  3ML3 A;  2B0R A;  1O8E A;  1GQ8 A;  2NT9 A;  2O17 A;  3TH0 A;  1QRC A;  2VFQ A;  2NZM A;  2X6W A;  1BN8 A;  1OFE A;  2X85 A;  1OGO X;  3B8Y A;  3DU1 X;  1O8M A;  2O6W A;  4YDT A;  3VMV A;  1EE6 A;  1O8F A;  1PE9 A;  2EWE A;  2IQ7 A;  2NT6 A;  1BHE A;  2XTW A;  3H09 A;  4XON A;  1KCC A;  1QA3 A;  4XR6 A;  1CZF A;  2J8I A;  4OJ6 A;  1KCD A;  2X6X A;  2PYG A;  2X6Y A;  5DNS A;  3GRH A;  2QXZ A;  4XOR A;  2G0Y A;  4XLH A;  1DBG A;  2BM5 A;  4OJL A;  3NB2 A;  3BH7 B;  4W8T A;  3AK5 A; 
#chains in the Genus database with same CATH homology
 1OFM A;  4AVZ A;  4XN3 A;  1O8J A;  1QJV A;  2NST A;  3KRG A;  3B4N A;  2Z8G A;  4C2L A;  5C1E A;  4XN0 A;  3VMW A;  2X3H A;  4U4B A;  3VST A;  3ZPP A;  2PEC A;  1QCX A;  3EQO A;  3SUC A;  4EW9 A;  1OGM X;  2INU A;  1VBL A;  3FY3 A;  1PXZ A;  4PMH A;  1JRG A;  4XKV A;  2UVF A;  3VSU A;  1IDJ A;  3ZSC A;  4NK6 A;  4XLF A;  2VJJ A;  4OZY A;  3GQ8 A;  1X0C A;  4Z06 A;  2PYH A;  1NHC A;  2O0W A;  2NSP A;  3B90 A;  3VSV A;  2UVE A;  3LMW A;  4XOP A;  4MXN A;  1DBO A;  4Z05 A;  1IA5 A;  1RMG A;  3UW0 A;  1KTW A;  2NTB A;  2VJI A;  3EQN A;  4XLE A;  1O88 A;  1OFL A;  2QX3 A;  1RWR A;  4XLA A;  5AMV A;  1HG8 A;  4OJO A;  4XM3 A;  1K5C A;  2NTP A;  1WMR A;  4OJ5 A;  1O8H A;  4XL9 A;  1H80 A;  1O8D A;  4YEL A;  2VBM A;  3WWG A;  4W8Q A;  4URR A;  1RU4 A;  4XKW A;  4XLC A;  4YZ0 A;  4XNF A;  2NTQ A;  1OOC A;  2O0V A;  3GQ7 A;  2QY1 A;  1IB4 A;  5C1C A;  1PLU A;  4HWV A;  2O1D A;  3GQA A;  4Z03 A;  4YEJ A;  4OJP A;  1AIR A;  2VBE A;  1O8G A;  4XQF A;  1IDK A;  1O8L A;  4YZX A;  4U49 A;  4W8R A;  4YZQ A;  4YZA A;  1O8K A;  4XMY A;  1JTA A;  2VBK A;  1XG2 A;  4NK8 A;  1O8I A;  4MR0 A;  2ODL A;  3GQ9 A;  3JUR A;  2INV A;  4I84 A;  3T9G A;  4XOT A;  2O04 A;  2BSP A;  4W8S A;  2O17 A;  1O8E A;  1GQ8 A;  2NT9 A;  2NZM A;  2X6W A;  1BN8 A;  2X85 A;  1OGO X;  3B8Y A;  1O8M A;  3VMV A;  1EE6 A;  1O8F A;  1PE9 A;  2EWE A;  2IQ7 A;  2NT6 A;  1BHE A;  4XON A;  1KCC A;  4XR6 A;  1CZF A;  4OJ6 A;  1KCD A;  2X6X A;  2PYG A;  2X6Y A;  3GRH A;  2QXZ A;  4XOR A;  4XLH A;  1DBG A;  4OJL A;  4OZZ A;  4W8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...