2QXZA

Pectate lyase r236f from xanthomonas campestris
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
330
structure length
330
Chain Sequence
b'GPVGYGAATTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRFGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pectate lyase II
publication title Improvement of the thermostability and activity of a pectate lyase by single amino acid substitutions, using a strategy based on melting-temperature-guided sequence alignment.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Lyase
total genus 127
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qxzA00
4OJLA 3FY3A 4U49A 3VSVA 1CZFA 2VJIA 4OZYA 2PYGA 1H80A 2PECA 3KRGA 1O8MA 1O8KA 1JRGA 1IDJA 4YZXA 1PLUA 4YZQA 4XLCA 4W8SA 4Z06A 4AVZA 4XORA 3B90A 1RWRA 1PE9A 2UVEA 4XOTA 4Z03A 3VSTA 4XQFA 3JURA 3GRHA 4OJ5A 4W8TA 1IDKA 2X6WA 4MXNA 2VBKA 1NHCA 3LMWA 3VMVA 3VSUA 4XNFA 1HG8A 4W8QA 2Z8GA 4YZ0A 1DBOA 4XL9A 1JTAA 3EQNA 4YELA 4OJ6A 1OGMX 1O8DA 2X3HA 4XMYA 2O0WA 2NTPA 2QXZA 4NK6A 2QY1A 3SUCA 3T9GA 3WWGA 2IQ7A 2NSPA 1O88A 1RMGA 2NTQA 4XLAA 2NT6A 2VBEA 1IA5A 2O17A 1OFLA 1BHEA 1BN8A 5C1EA 1O8EA 3B8YA 4EW9A 5AMVA 1KCDA 3GQ9A 2O1DA 1X0CA 1QJVA 4URRA 4C2LA 2PYHA 1EE6A 4HWVA 4YZAA 3GQ7A 1OOCA 1O8GA 4YEJA 4W8RA 3VMWA 2INVA 3EQOA 4XM3A 1QCXA 3GQAA 1VBLA 2O0VA 4OJOA 2O04A 4OJPA 1KTWA 1O8HA 2EWEA 3B4NA 1KCCA 1RU4A 2VBMA 2X6YA 2VJJA 2NSTA 4XLEA 1IB4A 4NK8A 1O8IA 1K5CA 2X85A 1O8FA 1OGOX 2BSPA 1O8JA 2ODLA 4PMHA 3UW0A 4XLHA 1DBGA 1OFMA 2NT9A 5C1CA 4I84A 1GQ8A 4XR6A 1O8LA 4XOPA 4Z05A 4XLFA 2NTBA 4U4BA 3ZPPA 2NZMA 4OZZA 4MR0A 1WMRA 1AIRA 2X6XA 1PXZA 1XG2A 2INUA 2UVFA 4XKWA 4XN3A 4XN0A 3ZSCA 2QX3A 4XONA 3GQ8A 4XKVA
chains in the Genus database with same CATH superfamily
4OJLA 3FY3A 1CLWA 4U49A 3VSVA 4YFOA 1CZFA 2VJIA 1TYWA 2B0RA 2PYGA 1H80A 2PECA 2W7ZA 4OZYA 3KRGA 1O8MA 1O8KA 1JRGA 1IDJA 1KQ5A 4YZXA 1PLUA 4YZQA 4XLCA 4W8SA 4Z06A 4AVZA 4XORA 3B90A 3RIQA 1RWRA 1PE9A 2XC1A 1QA3A 2UVEA 4XOTA 4Z03A 3TH0A 3PSSA 3VSTA 1TYUA 4XQFA 3JURA 1WXRA 3N90A 2G0YA 3N6ZA 3GRHA 1EZGA 4OJ5A 4W8TA 1TSPA 1IDKA 2X6WA 1K4ZA 4MXNA 2VBKA 1NHCA 2VFPA 3LMWA 3VMVA 3VSUA 4XNFA 1HG8A 4W8QA 2Z8GA 1QRBA 1DBOA 4YZ0A 4XL9A 1EA0A 2BM6A 4KH3A 4V02C 1JTAA 3EQNA 4YELA 2F3LA 4OJ6A 1QRCA 3NAWA 1OGMX 1O8DA 2X3HA 4XMYA 1L1IA 2O0WA 2NTPA 2QXZA 3AK5A 4NK6A 1QQ1A 2QY1A 3NB2A 5DNSA 3SUCA 3LYCA 3T9GA 3WWGA 2IQ7A 1RMGA 1O88A 2NSPA 2NTQA 2VFOA 3SQVA 4XLAA 2NT6A 1LLZA 2VBEA 2O17A 1OFLA 4OPWA 1BHEA 1BN8A 1IA5A 5C1EA 2XT4A 2QYUA 2BX6A 1O8EA 3B8YA 2BM5A 3P4GA 4EW9A 5AMVA 1KCDA 3SZEA 2XTYA 3GQ9A 3BH7B 2O1DA 1OFEA 3ML3A 1X0CA 1QJVA 3JX8A 4URRA 4C2LA 4JRAC 2PYHA 1EE6A 2XTXA 2V5IA 1LM1A 2VFMA 3GQ7A 2VFQA 4HWVA 4YZAA 1OOCA 2XTWA 1O8GA 5JLVC 1QA1A 4YEJA 1DABA 3SY2A 4W8RA 5JMCB 3VMWA 2INVA 3BH6B 3EQOA 1QCXA 3GQAA 4XM3A 1VBLA 2O0VA 4OJOA 2O04A 2BM4A 1KTWA 1O8HA 4OJPA 4YDTA 2EWEA 3B4NA 1KCCA 1RU4A 4XN0A 2VBMA 2X6YA 2VJJA 2NSTA 4XLEA 2O6WA 4NK8A 1TYVA 4YCQA 1IB4A 1O8IA 1K5CA 2X85A 1O8FA 4OM9A 3DU1X 2YUHA 1OGOX 2BSPA 1O8JA 2ODLA 2VFNA 1OFDA 4PMHA 4XLHA 1DBGA 1OFMA 3UW0A 2NT9A 5C1CA 4I84A 1GQ8A 3LJYA 4XR6A 1TYXA 1O8LA 3PETA 4XOPA 2IOUG 1K8FA 4Z05A 4XLFA 2NTBA 4U4BA 2XT2A 3ZPPA 2NZMA 4OZZA 4YC5A 4MR0A 3PSZA 1WMRA 3SYJA 1AIRA 1HF2A 2INUA 1PXZA 2J8KA 1XG2A 2J8IA 2QZAA 2UVFA 2X6XA 3H09A 2BM7A 4XKWA 4XN3A 3ZSCA 4YEIA 1LLWA 2QX3A 1QA2A 4XONA 3GQ8A 4XKVA
chains in the Genus database with same CATH topology
4OJLA 3FY3A 4U49A 3VSVA 1CZFA 2VJIA 4OZYA 2PYGA 1H80A 2PECA 3KRGA 1O8MA 1O8KA 1JRGA 1IDJA 4YZXA 1PLUA 4YZQA 4XLCA 4W8SA 4Z06A 4AVZA 4XORA 3B90A 1RWRA 1PE9A 2UVEA 4XOTA 4Z03A 3VSTA 4XQFA 3JURA 3GRHA 4OJ5A 4W8TA 1IDKA 2X6WA 4MXNA 2VBKA 1NHCA 3LMWA 3VMVA 3VSUA 4XNFA 1HG8A 4W8QA 2Z8GA 4YZ0A 1DBOA 4XL9A 1JTAA 3EQNA 4YELA 4OJ6A 1OGMX 1O8DA 2X3HA 4XMYA 2O0WA 2NTPA 2QXZA 4NK6A 2QY1A 3SUCA 3T9GA 3WWGA 2IQ7A 2NSPA 1O88A 1RMGA 2NTQA 4XLAA 2NT6A 2VBEA 1IA5A 2O17A 1OFLA 1BHEA 1BN8A 5C1EA 1O8EA 3B8YA 4EW9A 5AMVA 1KCDA 3GQ9A 2O1DA 1X0CA 1QJVA 4URRA 4C2LA 2PYHA 1EE6A 4HWVA 4YZAA 3GQ7A 1OOCA 1O8GA 4YEJA 4W8RA 3VMWA 2INVA 3EQOA 4XM3A 1QCXA 3GQAA 1VBLA 2O0VA 4OJOA 2O04A 4OJPA 1KTWA 1O8HA 2EWEA 3B4NA 1KCCA 1RU4A 2VBMA 2X6YA 2VJJA 2NSTA 4XLEA 1IB4A 4NK8A 1O8IA 1K5CA 2X85A 1O8FA 1OGOX 2BSPA 1O8JA 2ODLA 4PMHA 3UW0A 4XLHA 1DBGA 1OFMA 2NT9A 5C1CA 4I84A 1GQ8A 4XR6A 1O8LA 4XOPA 4Z05A 4XLFA 2NTBA 4U4BA 3ZPPA 2NZMA 4OZZA 4MR0A 1WMRA 1AIRA 2X6XA 1PXZA 1XG2A 2INUA 2UVFA 4XKWA 4XN3A 4XN0A 3ZSCA 2QX3A 4XONA 3GQ8A 4XKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJL A;  3FY3 A;  4U49 A;  3VSV A;  1CZF A;  2VJI A;  4OZY A;  2PYG A;  1H80 A;  2PEC A;  3KRG A;  1O8M A;  1O8K A;  1JRG A;  1IDJ A;  4YZX A;  1PLU A;  4YZQ A;  4XLC A;  4W8S A;  4Z06 A;  4AVZ A;  4XOR A;  3B90 A;  1RWR A;  1PE9 A;  2UVE A;  4XOT A;  4Z03 A;  3VST A;  4XQF A;  3JUR A;  3GRH A;  4OJ5 A;  4W8T A;  1IDK A;  2X6W A;  4MXN A;  2VBK A;  1NHC A;  3LMW A;  3VMV A;  3VSU A;  4XNF A;  1HG8 A;  4W8Q A;  2Z8G A;  4YZ0 A;  1DBO A;  4XL9 A;  1JTA A;  3EQN A;  4YEL A;  4OJ6 A;  1OGM X;  1O8D A;  2X3H A;  4XMY A;  2O0W A;  2NTP A;  2QXZ A;  4NK6 A;  2QY1 A;  3SUC A;  3T9G A;  3WWG A;  2IQ7 A;  2NSP A;  1O88 A;  1RMG A;  2NTQ A;  4XLA A;  2NT6 A;  2VBE A;  1IA5 A;  2O17 A;  1OFL A;  1BHE A;  1BN8 A;  5C1E A;  1O8E A;  3B8Y A;  4EW9 A;  5AMV A;  1KCD A;  3GQ9 A;  2O1D A;  1X0C A;  1QJV A;  4URR A;  4C2L A;  2PYH A;  1EE6 A;  4HWV A;  4YZA A;  3GQ7 A;  1OOC A;  1O8G A;  4YEJ A;  4W8R A;  3VMW A;  2INV A;  3EQO A;  4XM3 A;  1QCX A;  3GQA A;  1VBL A;  2O0V A;  4OJO A;  2O04 A;  4OJP A;  1KTW A;  1O8H A;  2EWE A;  3B4N A;  1KCC A;  1RU4 A;  2VBM A;  2X6Y A;  2VJJ A;  2NST A;  4XLE A;  1IB4 A;  4NK8 A;  1O8I A;  1K5C A;  2X85 A;  1O8F A;  1OGO X;  2BSP A;  1O8J A;  2ODL A;  4PMH A;  3UW0 A;  4XLH A;  1DBG A;  1OFM A;  2NT9 A;  5C1C A;  4I84 A;  1GQ8 A;  4XR6 A;  1O8L A;  4XOP A;  4Z05 A;  4XLF A;  2NTB A;  4U4B A;  3ZPP A;  2NZM A;  4OZZ A;  4MR0 A;  1WMR A;  1AIR A;  2X6X A;  1PXZ A;  1XG2 A;  2INU A;  2UVF A;  4XKW A;  4XN3 A;  4XN0 A;  3ZSC A;  2QX3 A;  4XON A;  3GQ8 A;  4XKV A; 
#chains in the Genus database with same CATH topology
 4OJL A;  3FY3 A;  1CLW A;  4U49 A;  3VSV A;  4YFO A;  1CZF A;  2VJI A;  1TYW A;  2B0R A;  2PYG A;  1H80 A;  2PEC A;  2W7Z A;  4OZY A;  3KRG A;  1O8M A;  1O8K A;  1JRG A;  1IDJ A;  1KQ5 A;  4YZX A;  1PLU A;  4YZQ A;  4XLC A;  4W8S A;  4Z06 A;  4AVZ A;  4XOR A;  3B90 A;  3RIQ A;  1RWR A;  1PE9 A;  2XC1 A;  1QA3 A;  2UVE A;  4XOT A;  4Z03 A;  3TH0 A;  3PSS A;  3VST A;  1TYU A;  4XQF A;  3JUR A;  1WXR A;  3N90 A;  2G0Y A;  3N6Z A;  3GRH A;  1EZG A;  4OJ5 A;  4W8T A;  1TSP A;  1IDK A;  2X6W A;  1K4Z A;  4MXN A;  2VBK A;  1NHC A;  2VFP A;  3LMW A;  3VMV A;  3VSU A;  4XNF A;  1HG8 A;  4W8Q A;  2Z8G A;  1QRB A;  1DBO A;  4YZ0 A;  4XL9 A;  1EA0 A;  2BM6 A;  4KH3 A;  4V02 C;  1JTA A;  3EQN A;  4YEL A;  2F3L A;  4OJ6 A;  1QRC A;  3NAW A;  1OGM X;  1O8D A;  2X3H A;  4XMY A;  1L1I A;  2O0W A;  2NTP A;  2QXZ A;  3AK5 A;  4NK6 A;  1QQ1 A;  2QY1 A;  3NB2 A;  5DNS A;  3SUC A;  3LYC A;  3T9G A;  3WWG A;  2IQ7 A;  1RMG A;  1O88 A;  2NSP A;  2NTQ A;  2VFO A;  3SQV A;  4XLA A;  2NT6 A;  1LLZ A;  2VBE A;  2O17 A;  1OFL A;  4OPW A;  1BHE A;  1BN8 A;  1IA5 A;  5C1E A;  2XT4 A;  2QYU A;  2BX6 A;  1O8E A;  3B8Y A;  2BM5 A;  3P4G A;  4EW9 A;  5AMV A;  1KCD A;  3SZE A;  2XTY A;  3GQ9 A;  3BH7 B;  2O1D A;  1OFE A;  3ML3 A;  1X0C A;  1QJV A;  3JX8 A;  4URR A;  4C2L A;  4JRA C;  2PYH A;  1EE6 A;  2XTX A;  2V5I A;  1LM1 A;  2VFM A;  3GQ7 A;  2VFQ A;  4HWV A;  4YZA A;  1OOC A;  2XTW A;  1O8G A;  5JLV C;  1QA1 A;  4YEJ A;  1DAB A;  3SY2 A;  4W8R A;  5JMC B;  3VMW A;  2INV A;  3BH6 B;  3EQO A;  1QCX A;  3GQA A;  4XM3 A;  1VBL A;  2O0V A;  4OJO A;  2O04 A;  2BM4 A;  1KTW A;  1O8H A;  4OJP A;  4YDT A;  2EWE A;  3B4N A;  1KCC A;  1RU4 A;  4XN0 A;  2VBM A;  2X6Y A;  2VJJ A;  2NST A;  4XLE A;  2O6W A;  4NK8 A;  1TYV A;  4YCQ A;  1IB4 A;  1O8I A;  1K5C A;  2X85 A;  1O8F A;  4OM9 A;  3DU1 X;  2YUH A;  1OGO X;  2BSP A;  1O8J A;  2ODL A;  2VFN A;  1OFD A;  4PMH A;  4XLH A;  1DBG A;  1OFM A;  3UW0 A;  2NT9 A;  5C1C A;  4I84 A;  1GQ8 A;  3LJY A;  4XR6 A;  1TYX A;  1O8L A;  3PET A;  4XOP A;  2IOU G;  1K8F A;  4Z05 A;  4XLF A;  2NTB A;  4U4B A;  2XT2 A;  3ZPP A;  2NZM A;  4OZZ A;  4YC5 A;  4MR0 A;  3PSZ A;  1WMR A;  3SYJ A;  1AIR A;  1HF2 A;  2INU A;  1PXZ A;  2J8K A;  1XG2 A;  2J8I A;  2QZA A;  2UVF A;  2X6X A;  3H09 A;  2BM7 A;  4XKW A;  4XN3 A;  3ZSC A;  4YEI A;  1LLW A;  2QX3 A;  1QA2 A;  4XON A;  3GQ8 A;  4XKV A; 
#chains in the Genus database with same CATH homology
 4OJL A;  3FY3 A;  4U49 A;  3VSV A;  1CZF A;  2VJI A;  4OZY A;  2PYG A;  1H80 A;  2PEC A;  3KRG A;  1O8M A;  1O8K A;  1JRG A;  1IDJ A;  4YZX A;  1PLU A;  4YZQ A;  4XLC A;  4W8S A;  4Z06 A;  4AVZ A;  4XOR A;  3B90 A;  1RWR A;  1PE9 A;  2UVE A;  4XOT A;  4Z03 A;  3VST A;  4XQF A;  3JUR A;  3GRH A;  4OJ5 A;  4W8T A;  1IDK A;  2X6W A;  4MXN A;  2VBK A;  1NHC A;  3LMW A;  3VMV A;  3VSU A;  4XNF A;  1HG8 A;  4W8Q A;  2Z8G A;  4YZ0 A;  1DBO A;  4XL9 A;  1JTA A;  3EQN A;  4YEL A;  4OJ6 A;  1OGM X;  1O8D A;  2X3H A;  4XMY A;  2O0W A;  2NTP A;  2QXZ A;  4NK6 A;  2QY1 A;  3SUC A;  3T9G A;  3WWG A;  2IQ7 A;  2NSP A;  1O88 A;  1RMG A;  2NTQ A;  4XLA A;  2NT6 A;  2VBE A;  1IA5 A;  2O17 A;  1OFL A;  1BHE A;  1BN8 A;  5C1E A;  1O8E A;  3B8Y A;  4EW9 A;  5AMV A;  1KCD A;  3GQ9 A;  2O1D A;  1X0C A;  1QJV A;  4URR A;  4C2L A;  2PYH A;  1EE6 A;  4HWV A;  4YZA A;  3GQ7 A;  1OOC A;  1O8G A;  4YEJ A;  4W8R A;  3VMW A;  2INV A;  3EQO A;  4XM3 A;  1QCX A;  3GQA A;  1VBL A;  2O0V A;  4OJO A;  2O04 A;  4OJP A;  1KTW A;  1O8H A;  2EWE A;  3B4N A;  1KCC A;  1RU4 A;  2VBM A;  2X6Y A;  2VJJ A;  2NST A;  4XLE A;  1IB4 A;  4NK8 A;  1O8I A;  1K5C A;  2X85 A;  1O8F A;  1OGO X;  2BSP A;  1O8J A;  2ODL A;  4PMH A;  3UW0 A;  4XLH A;  1DBG A;  1OFM A;  2NT9 A;  5C1C A;  4I84 A;  1GQ8 A;  4XR6 A;  1O8L A;  4XOP A;  4Z05 A;  4XLF A;  2NTB A;  4U4B A;  3ZPP A;  2NZM A;  4OZZ A;  4MR0 A;  1WMR A;  1AIR A;  2X6X A;  1PXZ A;  1XG2 A;  2INU A;  2UVF A;  4XKW A;  4XN3 A;  4XN0 A;  3ZSC A;  2QX3 A;  4XON A;  3GQ8 A;  4XKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...