2QXZA

Pectate lyase r236f from xanthomonas campestris
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
330
structure length
330
Chain Sequence
GPVGYGAATTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRFGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords pectate lyase II
publication title Improvement of the thermostability and activity of a pectate lyase by single amino acid substitutions, using a strategy based on melting-temperature-guided sequence alignment.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 127
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qxzA00
1EE6A 1CZFA 2INUA 4NK8A 4OJPA 3GQ9A 3GQ7A 3GRHA 3UW0A 4XL9A 4W8RA 2O04A 3ZPPA 1PE9A 2EWEA 1OGMX 2NT6A 2O17A 1QCXA 4XLHA 1O8EA 1O8LA 4XN0A 3T9GA 4NK6A 4EW9A 2X6XA 4AVZA 4XONA 2PYGA 3VSTA 1IDKA 1OFMA 2O1DA 1NHCA 3B8YA 4OJ6A 1RWRA 4C2LA 1RMGA 3SUCA 1QJVA 1KCDA 1XG2A 4OJLA 4OJ5A 4Z03A 4W8SA 1O88A 4URRA 4YZXA 2O0VA 4Z06A 4XMYA 4XOTA 2VJIA 2NSPA 3VSUA 2QY1A 1X0CA 5C1CA 1WMRA 1IA5A 2BSPA 4I84A 2UVEA 2X6WA 1VBLA 1H80A 4U49A 4XOPA 1OOCA 2PECA 3VMVA 4HWVA 3WWGA 1HG8A 3JURA 4YELA 1O8MA 4W8QA 4YEJA 2PYHA 2NZMA 4XN3A 2QX3A 2QXZA 2X6YA 3B90A 2NTBA 4XKVA 4YZAA 3GQ8A 4XM3A 3VSVA 1O8JA 1PXZA 1OGOX 2VJJA 1JTAA 2VBKA 3B4NA 3VMWA 5AMVA 2IQ7A 1BN8A 4OZYA 1IB4A 5C1EA 1DBOA 4YZ0A 1KTWA 4XNFA 1GQ8A 2UVFA 4YZQA 2Z8GA 1O8DA 2X85A 4XQFA 4XKWA 2NTQA 3ZSCA 1PLUA 1K5CA 4W8TA 4XLAA 1DBGA 1AIRA 3FY3A 2X3HA 1RU4A 3GQAA 4XR6A 3LMWA 1JRGA 4PMHA 1O8HA 2NSTA 4MR0A 4U4BA 2VBMA 1O8FA 4XLEA 1O8GA 1BHEA 4MXNA 1O8KA 2NT9A 3EQOA 4Z05A 4OZZA 2ODLA 1OFLA 1KCCA 2O0WA 4XLFA 2INVA 1O8IA 4OJOA 1IDJA 4XLCA 2NTPA 2VBEA 4XORA 3EQNA 3KRGA
chains in the Genus database with same CATH superfamily
3NAWA 1EE6A 1CZFA 2INUA 2QZAA 1EA0A 4NK8A 4OJPA 3GQ9A 3GQ7A 3GRHA 2VFPA 3SZEA 3UW0A 1TYUA 4W8RA 4XL9A 3DU1X 2O04A 3ZPPA 1PE9A 2B0RA 2EWEA 1OGMX 2BM4A 2NT6A 2O17A 1QCXA 2XT4A 4XLHA 1O8EA 1O8LA 2VFQA 4XN0A 4NK6A 3T9GA 2BM5A 4EW9A 2X6XA 4YDTA 4AVZA 4XONA 2PYGA 3VSTA 2XTWA 1IDKA 3LJYA 3H09A 1KQ5A 5DNSA 1OFMA 2O1DA 1NHCA 3B8YA 4OJ6A 1RWRA 4C2LA 1RMGA 1LLWA 3SUCA 1QJVA 4XORA 1KCDA 1XG2A 4OJLA 4OJ5A 2J8KA 4Z03A 4W8SA 2XT2A 1O88A 4URRA 4YZXA 2XTYA 2O0VA 4Z06A 4XMYA 4XOTA 4YCQA 2VJIA 2NSPA 3BH7B 3VSUA 2G0YA 1QA1A 2IOUG 2QY1A 1X0CA 5C1CA 1WMRA 1IA5A 4JRAC 2VFMA 1OFEA 2BSPA 2QYUA 5JLVC 4I84A 2UVEA 1TYVA 1VBLA 1H80A 2VFOA 2X6WA 4U49A 4XOPA 4YEIA 1OOCA 2PECA 3VMVA 4HWVA 1QRCA 2O6WA 3WWGA 1HG8A 2XC1A 3JURA 4YELA 1O8MA 4W8QA 4YEJA 4OM9A 2YUHA 2PYHA 1K8FA 1QQ1A 2NZMA 4XN3A 3TH0A 4OPWA 2QX3A 2QXZA 3AK5A 2X6YA 3B90A 3JX8A 2NTBA 3BH6B 3P4GA 3SQVA 4XKVA 4YZAA 4YFOA 3GQ8A 2W7ZA 4XM3A 3VSVA 1O8JA 1PXZA 3N6ZA 1OGOX 1OFDA 2VJJA 3LYCA 1WXRA 1JTAA 2VBKA 3B4NA 3VMWA 5AMVA 3RIQA 3PSZA 1CLWA 1QA3A 2IQ7A 1BN8A 4OZYA 1QRBA 1IB4A 5C1EA 2XTXA 1DBOA 4YZ0A 1KTWA 3N90A 4XNFA 1GQ8A 2UVFA 2V5IA 4YZQA 2Z8GA 1O8DA 1DABA 2X85A 4XQFA 4XKWA 2NTQA 1LM1A 3ZSCA 1PLUA 1K5CA 4W8TA 4XLAA 1DBGA 1K4ZA 1AIRA 3ML3A 3FY3A 1L1IA 1TYXA 2X3HA 1RU4A 3PETA 3GQAA 4XR6A 3LMWA 2VFNA 3PSSA 1JRGA 5JMCB 4PMHA 1O8HA 2NSTA 1QA2A 4KH3A 4MR0A 1HF2A 1LLZA 1O8FA 2VBMA 4U4BA 4XLEA 2J8IA 2F3LA 1O8GA 1BHEA 4MXNA 1O8KA 2NT9A 3EQOA 4V02C 4Z05A 4OZZA 2ODLA 1OFLA 3SY2A 1KCCA 2O0WA 4XLFA 2INVA 1TSPA 3NB2A 1O8IA 4OJOA 1IDJA 4XLCA 3SYJA 2NTPA 2VBEA 1EZGA 2BM6A 1TYWA 2BX6A 2BM7A 3EQNA 4YC5A 3KRGA
chains in the Genus database with same CATH topology
1EE6A 1CZFA 2INUA 4NK8A 4OJPA 3GQ9A 3GQ7A 3GRHA 3UW0A 4XL9A 4W8RA 2O04A 3ZPPA 1PE9A 2EWEA 1OGMX 2NT6A 2O17A 1QCXA 4XLHA 1O8EA 1O8LA 4XN0A 3T9GA 4NK6A 4EW9A 2X6XA 4AVZA 4XONA 2PYGA 3VSTA 1IDKA 1OFMA 2O1DA 1NHCA 3B8YA 4OJ6A 1RWRA 4C2LA 1RMGA 3SUCA 1QJVA 1KCDA 1XG2A 4OJLA 4OJ5A 4Z03A 4W8SA 1O88A 4URRA 4YZXA 2O0VA 4Z06A 4XMYA 4XOTA 2VJIA 2NSPA 3VSUA 2QY1A 1X0CA 5C1CA 1WMRA 1IA5A 2BSPA 4I84A 2UVEA 2X6WA 1VBLA 1H80A 4U49A 4XOPA 1OOCA 2PECA 3VMVA 4HWVA 3WWGA 1HG8A 3JURA 4YELA 1O8MA 4W8QA 4YEJA 2PYHA 2NZMA 4XN3A 2QX3A 2QXZA 2X6YA 3B90A 2NTBA 4XKVA 4YZAA 3GQ8A 4XM3A 3VSVA 1O8JA 1PXZA 1OGOX 2VJJA 1JTAA 2VBKA 3B4NA 3VMWA 5AMVA 2IQ7A 1BN8A 4OZYA 1IB4A 5C1EA 1DBOA 4YZ0A 1KTWA 4XNFA 1GQ8A 2UVFA 4YZQA 2Z8GA 1O8DA 2X85A 4XQFA 4XKWA 2NTQA 3ZSCA 1PLUA 1K5CA 4W8TA 4XLAA 1DBGA 1AIRA 3FY3A 2X3HA 1RU4A 3GQAA 4XR6A 3LMWA 1JRGA 4PMHA 1O8HA 2NSTA 4MR0A 4U4BA 2VBMA 1O8FA 4XLEA 1O8GA 1BHEA 4MXNA 1O8KA 2NT9A 3EQOA 4Z05A 4OZZA 2ODLA 1OFLA 1KCCA 2O0WA 4XLFA 2INVA 1O8IA 4OJOA 1IDJA 4XLCA 2NTPA 2VBEA 4XORA 3EQNA 3KRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EE6 A;  1CZF A;  2INU A;  4NK8 A;  4OJP A;  3GQ9 A;  3GQ7 A;  3GRH A;  3UW0 A;  4XL9 A;  4W8R A;  2O04 A;  3ZPP A;  1PE9 A;  2EWE A;  1OGM X;  2NT6 A;  2O17 A;  1QCX A;  4XLH A;  1O8E A;  1O8L A;  4XN0 A;  3T9G A;  4NK6 A;  4EW9 A;  2X6X A;  4AVZ A;  4XON A;  2PYG A;  3VST A;  1IDK A;  1OFM A;  2O1D A;  1NHC A;  3B8Y A;  4OJ6 A;  1RWR A;  4C2L A;  1RMG A;  3SUC A;  1QJV A;  1KCD A;  1XG2 A;  4OJL A;  4OJ5 A;  4Z03 A;  4W8S A;  1O88 A;  4URR A;  4YZX A;  2O0V A;  4Z06 A;  4XMY A;  4XOT A;  2VJI A;  2NSP A;  3VSU A;  2QY1 A;  1X0C A;  5C1C A;  1WMR A;  1IA5 A;  2BSP A;  4I84 A;  2UVE A;  2X6W A;  1VBL A;  1H80 A;  4U49 A;  4XOP A;  1OOC A;  2PEC A;  3VMV A;  4HWV A;  3WWG A;  1HG8 A;  3JUR A;  4YEL A;  1O8M A;  4W8Q A;  4YEJ A;  2PYH A;  2NZM A;  4XN3 A;  2QX3 A;  2QXZ A;  2X6Y A;  3B90 A;  2NTB A;  4XKV A;  4YZA A;  3GQ8 A;  4XM3 A;  3VSV A;  1O8J A;  1PXZ A;  1OGO X;  2VJJ A;  1JTA A;  2VBK A;  3B4N A;  3VMW A;  5AMV A;  2IQ7 A;  1BN8 A;  4OZY A;  1IB4 A;  5C1E A;  1DBO A;  4YZ0 A;  1KTW A;  4XNF A;  1GQ8 A;  2UVF A;  4YZQ A;  2Z8G A;  1O8D A;  2X85 A;  4XQF A;  4XKW A;  2NTQ A;  3ZSC A;  1PLU A;  1K5C A;  4W8T A;  4XLA A;  1DBG A;  1AIR A;  3FY3 A;  2X3H A;  1RU4 A;  3GQA A;  4XR6 A;  3LMW A;  1JRG A;  4PMH A;  1O8H A;  2NST A;  4MR0 A;  4U4B A;  2VBM A;  1O8F A;  4XLE A;  1O8G A;  1BHE A;  4MXN A;  1O8K A;  2NT9 A;  3EQO A;  4Z05 A;  4OZZ A;  2ODL A;  1OFL A;  1KCC A;  2O0W A;  4XLF A;  2INV A;  1O8I A;  4OJO A;  1IDJ A;  4XLC A;  2NTP A;  2VBE A;  4XOR A;  3EQN A;  3KRG A; 
#chains in the Genus database with same CATH topology
 3NAW A;  1EE6 A;  1CZF A;  2INU A;  2QZA A;  1EA0 A;  4NK8 A;  4OJP A;  3GQ9 A;  3GQ7 A;  3GRH A;  2VFP A;  3SZE A;  3UW0 A;  1TYU A;  4W8R A;  4XL9 A;  3DU1 X;  2O04 A;  3ZPP A;  1PE9 A;  2B0R A;  2EWE A;  1OGM X;  2BM4 A;  2NT6 A;  2O17 A;  1QCX A;  2XT4 A;  4XLH A;  1O8E A;  1O8L A;  2VFQ A;  4XN0 A;  4NK6 A;  3T9G A;  2BM5 A;  4EW9 A;  2X6X A;  4YDT A;  4AVZ A;  4XON A;  2PYG A;  3VST A;  2XTW A;  1IDK A;  3LJY A;  3H09 A;  1KQ5 A;  5DNS A;  1OFM A;  2O1D A;  1NHC A;  3B8Y A;  4OJ6 A;  1RWR A;  4C2L A;  1RMG A;  1LLW A;  3SUC A;  1QJV A;  4XOR A;  1KCD A;  1XG2 A;  4OJL A;  4OJ5 A;  2J8K A;  4Z03 A;  4W8S A;  2XT2 A;  1O88 A;  4URR A;  4YZX A;  2XTY A;  2O0V A;  4Z06 A;  4XMY A;  4XOT A;  4YCQ A;  2VJI A;  2NSP A;  3BH7 B;  3VSU A;  2G0Y A;  1QA1 A;  2IOU G;  2QY1 A;  1X0C A;  5C1C A;  1WMR A;  1IA5 A;  4JRA C;  2VFM A;  1OFE A;  2BSP A;  2QYU A;  5JLV C;  4I84 A;  2UVE A;  1TYV A;  1VBL A;  1H80 A;  2VFO A;  2X6W A;  4U49 A;  4XOP A;  4YEI A;  1OOC A;  2PEC A;  3VMV A;  4HWV A;  1QRC A;  2O6W A;  3WWG A;  1HG8 A;  2XC1 A;  3JUR A;  4YEL A;  1O8M A;  4W8Q A;  4YEJ A;  4OM9 A;  2YUH A;  2PYH A;  1K8F A;  1QQ1 A;  2NZM A;  4XN3 A;  3TH0 A;  4OPW A;  2QX3 A;  2QXZ A;  3AK5 A;  2X6Y A;  3B90 A;  3JX8 A;  2NTB A;  3BH6 B;  3P4G A;  3SQV A;  4XKV A;  4YZA A;  4YFO A;  3GQ8 A;  2W7Z A;  4XM3 A;  3VSV A;  1O8J A;  1PXZ A;  3N6Z A;  1OGO X;  1OFD A;  2VJJ A;  3LYC A;  1WXR A;  1JTA A;  2VBK A;  3B4N A;  3VMW A;  5AMV A;  3RIQ A;  3PSZ A;  1CLW A;  1QA3 A;  2IQ7 A;  1BN8 A;  4OZY A;  1QRB A;  1IB4 A;  5C1E A;  2XTX A;  1DBO A;  4YZ0 A;  1KTW A;  3N90 A;  4XNF A;  1GQ8 A;  2UVF A;  2V5I A;  4YZQ A;  2Z8G A;  1O8D A;  1DAB A;  2X85 A;  4XQF A;  4XKW A;  2NTQ A;  1LM1 A;  3ZSC A;  1PLU A;  1K5C A;  4W8T A;  4XLA A;  1DBG A;  1K4Z A;  1AIR A;  3ML3 A;  3FY3 A;  1L1I A;  1TYX A;  2X3H A;  1RU4 A;  3PET A;  3GQA A;  4XR6 A;  3LMW A;  2VFN A;  3PSS A;  1JRG A;  5JMC B;  4PMH A;  1O8H A;  2NST A;  1QA2 A;  4KH3 A;  4MR0 A;  1HF2 A;  1LLZ A;  1O8F A;  2VBM A;  4U4B A;  4XLE A;  2J8I A;  2F3L A;  1O8G A;  1BHE A;  4MXN A;  1O8K A;  2NT9 A;  3EQO A;  4V02 C;  4Z05 A;  4OZZ A;  2ODL A;  1OFL A;  3SY2 A;  1KCC A;  2O0W A;  4XLF A;  2INV A;  1TSP A;  3NB2 A;  1O8I A;  4OJO A;  1IDJ A;  4XLC A;  3SYJ A;  2NTP A;  2VBE A;  1EZG A;  2BM6 A;  1TYW A;  2BX6 A;  2BM7 A;  3EQN A;  4YC5 A;  3KRG A; 
#chains in the Genus database with same CATH homology
 1EE6 A;  1CZF A;  2INU A;  4NK8 A;  4OJP A;  3GQ9 A;  3GQ7 A;  3GRH A;  3UW0 A;  4XL9 A;  4W8R A;  2O04 A;  3ZPP A;  1PE9 A;  2EWE A;  1OGM X;  2NT6 A;  2O17 A;  1QCX A;  4XLH A;  1O8E A;  1O8L A;  4XN0 A;  3T9G A;  4NK6 A;  4EW9 A;  2X6X A;  4AVZ A;  4XON A;  2PYG A;  3VST A;  1IDK A;  1OFM A;  2O1D A;  1NHC A;  3B8Y A;  4OJ6 A;  1RWR A;  4C2L A;  1RMG A;  3SUC A;  1QJV A;  1KCD A;  1XG2 A;  4OJL A;  4OJ5 A;  4Z03 A;  4W8S A;  1O88 A;  4URR A;  4YZX A;  2O0V A;  4Z06 A;  4XMY A;  4XOT A;  2VJI A;  2NSP A;  3VSU A;  2QY1 A;  1X0C A;  5C1C A;  1WMR A;  1IA5 A;  2BSP A;  4I84 A;  2UVE A;  2X6W A;  1VBL A;  1H80 A;  4U49 A;  4XOP A;  1OOC A;  2PEC A;  3VMV A;  4HWV A;  3WWG A;  1HG8 A;  3JUR A;  4YEL A;  1O8M A;  4W8Q A;  4YEJ A;  2PYH A;  2NZM A;  4XN3 A;  2QX3 A;  2QXZ A;  2X6Y A;  3B90 A;  2NTB A;  4XKV A;  4YZA A;  3GQ8 A;  4XM3 A;  3VSV A;  1O8J A;  1PXZ A;  1OGO X;  2VJJ A;  1JTA A;  2VBK A;  3B4N A;  3VMW A;  5AMV A;  2IQ7 A;  1BN8 A;  4OZY A;  1IB4 A;  5C1E A;  1DBO A;  4YZ0 A;  1KTW A;  4XNF A;  1GQ8 A;  2UVF A;  4YZQ A;  2Z8G A;  1O8D A;  2X85 A;  4XQF A;  4XKW A;  2NTQ A;  3ZSC A;  1PLU A;  1K5C A;  4W8T A;  4XLA A;  1DBG A;  1AIR A;  3FY3 A;  2X3H A;  1RU4 A;  3GQA A;  4XR6 A;  3LMW A;  1JRG A;  4PMH A;  1O8H A;  2NST A;  4MR0 A;  4U4B A;  2VBM A;  1O8F A;  4XLE A;  1O8G A;  1BHE A;  4MXN A;  1O8K A;  2NT9 A;  3EQO A;  4Z05 A;  4OZZ A;  2ODL A;  1OFL A;  1KCC A;  2O0W A;  4XLF A;  2INV A;  1O8I A;  4OJO A;  1IDJ A;  4XLC A;  2NTP A;  2VBE A;  4XOR A;  3EQN A;  3KRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...