2QXZA

Pectate lyase r236f from xanthomonas campestris
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
330
structure length
330
Chain Sequence
GPVGYGAATTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRFGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pectate lyase II
publication title Improvement of the thermostability and activity of a pectate lyase by single amino acid substitutions, using a strategy based on melting-temperature-guided sequence alignment.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Lyase
total genus 127
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qxzA00
4XOPA 4Z03A 3VMVA 1RMGA 3GQ9A 1GQ8A 4XLEA 1O8IA 1RWRA 2O04A 1O8GA 2O1DA 2UVFA 1O8JA 1IDKA 1OFLA 4U49A 1BHEA 1JTAA 4OZYA 1KCCA 4PMHA 1H80A 1O8MA 4XN0A 4Z05A 1X0CA 2QY1A 4XLCA 1EE6A 1IDJA 2QXZA 3GQAA 4W8TA 4XORA 1CZFA 1KTWA 2NSPA 4C2LA 2NSTA 1NHCA 4XQFA 2NZMA 2VBKA 1KCDA 4YZQA 3ZPPA 3VSVA 3JURA 3SUCA 4XKVA 2NT9A 2PYHA 2PECA 2NTPA 4AVZA 3KRGA 4YELA 2ODLA 3GQ7A 4W8QA 4XLHA 4XM3A 1BN8A 2VJJA 4OJOA 1DBGA 1O88A 4MXNA 4XN3A 3T9GA 1AIRA 4YZ0A 1IB4A 2VBEA 1DBOA 4XLAA 4XR6A 4OJPA 1PLUA 2O0VA 4MR0A 4HWVA 3GQ8A 2BSPA 1PXZA 4XKWA 1OGOX 2IQ7A 4Z06A 4YEJA 1HG8A 1OOCA 2X6WA 3LMWA 1PE9A 4OZZA 1XG2A 3WWGA 2PYGA 2VBMA 3EQNA 4OJLA 4OJ6A 4U4BA 1RU4A 4W8SA 2Z8GA 2X6XA 2QX3A 4YZAA 5C1CA 1O8HA 4I84A 1OGMX 1QCXA 2O0WA 2NTBA 4W8RA 3B8YA 1O8KA 2INUA 1IA5A 2EWEA 2O17A 5C1EA 4NK6A 3UW0A 1JRGA 2NT6A 3VMWA 4XONA 1O8FA 2INVA 1K5CA 3B90A 4URRA 1O8EA 4XOTA 1WMRA 2NTQA 4YZXA 4XLFA 4XMYA 2VJIA 2X85A 3ZSCA 4OJ5A 3EQOA 1QJVA 1O8LA 3VSTA 3VSUA 4NK8A 4XNFA 1VBLA 1O8DA 2X3HA 2X6YA 4EW9A 3B4NA 2UVEA 4XL9A 5AMVA 1OFMA 3FY3A 3GRHA
chains in the Genus database with same CATH superfamily
2VFMA 4V02C 4XOPA 4Z03A 1QA1A 2F3LA 3VMVA 1RMGA 5DNSA 3GQ9A 3NB2A 1GQ8A 3P4GA 4XLEA 1O8IA 3DU1X 1RWRA 2O04A 1O8GA 2O1DA 2UVFA 1O8JA 1IDKA 1OFLA 4U49A 1WXRA 1BHEA 1JTAA 4OZYA 1KCCA 3H09A 4PMHA 2YUHA 1H80A 1O8MA 3N6ZA 1TYXA 2O6WA 1X0CA 4XN0A 2W7ZA 1K4ZA 3BH6B 4Z05A 2QY1A 1K8FA 4XLCA 1LLZA 1EE6A 1IDJA 2QXZA 3GQAA 1L1IA 4W8TA 4XORA 3BH7B 1CZFA 1KTWA 2NSPA 2V5IA 4C2LA 2NSTA 1NHCA 4YDTA 4XQFA 2NZMA 2VBKA 4YC5A 2BM5A 1KCDA 1CLWA 2BM6A 4YZQA 3ZPPA 3VSVA 3JURA 3SUCA 2XT4A 1LLWA 4XKVA 2B0RA 2NT9A 2PYHA 2NTPA 2PECA 2IOUG 4OPWA 4AVZA 3LJYA 3KRGA 4YELA 2ODLA 3GQ7A 4YFOA 2J8KA 4W8QA 4XLHA 4XM3A 1BN8A 2VJJA 1QQ1A 4OJOA 1DBGA 1TSPA 3RIQA 1O88A 1EZGA 4MXNA 4XN3A 3PETA 3T9GA 1AIRA 4YZ0A 1IB4A 2VBEA 1DBOA 1TYVA 4YCQA 3TH0A 4XLAA 2XTWA 4XR6A 4OJPA 1PLUA 2O0VA 4MR0A 3ML3A 3GQ8A 4HWVA 2BSPA 2XTYA 1PXZA 4XKWA 1OGOX 3AK5A 2IQ7A 4JRAC 3NAWA 4Z06A 1DABA 2BM7A 2XC1A 4YEJA 5JLVC 3PSZA 1HG8A 1OOCA 3SZEA 2X6WA 3SY2A 3LMWA 1PE9A 5JMCB 1QRCA 4OZZA 1XG2A 3WWGA 2PYGA 2VBMA 3EQNA 4OJLA 4OJ6A 4U4BA 1RU4A 2VFPA 4YEIA 4W8SA 2Z8GA 2X6XA 2QX3A 4YZAA 5C1CA 1O8HA 3PSSA 4I84A 2VFNA 1OGMX 1QCXA 4KH3A 3N90A 2O0WA 2NTBA 2VFQA 1QRBA 4W8RA 1EA0A 1QA3A 1TYWA 3B8YA 2BX6A 1O8KA 2INUA 1IA5A 1OFEA 2EWEA 2O17A 5C1EA 4NK6A 3UW0A 1JRGA 2NT6A 2XTXA 2XT2A 3VMWA 4XONA 1O8FA 2INVA 1K5CA 3B90A 2VFOA 1O8EA 4URRA 2J8IA 4XOTA 1HF2A 1WMRA 2NTQA 4YZXA 4XLFA 4XMYA 1OFDA 2VJIA 2X85A 3ZSCA 3LYCA 4OJ5A 1TYUA 3EQOA 1QJVA 2QYUA 3FY3A 3SYJA 1O8LA 3VSTA 3VSUA 2G0YA 2QZAA 4NK8A 2BM4A 4XNFA 1VBLA 3JX8A 1O8DA 2X3HA 2X6YA 4EW9A 3B4NA 2UVEA 1LM1A 4XL9A 5AMVA 3SQVA 4OM9A 1QA2A 1OFMA 1KQ5A 3GRHA
chains in the Genus database with same CATH topology
4XOPA 4Z03A 3VMVA 1RMGA 3GQ9A 1GQ8A 4XLEA 1O8IA 1RWRA 2O04A 1O8GA 2O1DA 2UVFA 1O8JA 1IDKA 1OFLA 4U49A 1BHEA 1JTAA 4OZYA 1KCCA 4PMHA 1H80A 1O8MA 4XN0A 4Z05A 1X0CA 2QY1A 4XLCA 1EE6A 1IDJA 2QXZA 3GQAA 4W8TA 4XORA 1CZFA 1KTWA 2NSPA 4C2LA 2NSTA 1NHCA 4XQFA 2NZMA 2VBKA 1KCDA 4YZQA 3ZPPA 3VSVA 3JURA 3SUCA 4XKVA 2NT9A 2PYHA 2PECA 2NTPA 4AVZA 3KRGA 4YELA 2ODLA 3GQ7A 4W8QA 4XLHA 4XM3A 1BN8A 2VJJA 4OJOA 1DBGA 1O88A 4MXNA 4XN3A 3T9GA 1AIRA 4YZ0A 1IB4A 2VBEA 1DBOA 4XLAA 4XR6A 4OJPA 1PLUA 2O0VA 4MR0A 4HWVA 3GQ8A 2BSPA 1PXZA 4XKWA 1OGOX 2IQ7A 4Z06A 4YEJA 1HG8A 1OOCA 2X6WA 3LMWA 1PE9A 4OZZA 1XG2A 3WWGA 2PYGA 2VBMA 3EQNA 4OJLA 4OJ6A 4U4BA 1RU4A 4W8SA 2Z8GA 2X6XA 2QX3A 4YZAA 5C1CA 1O8HA 4I84A 1OGMX 1QCXA 2O0WA 2NTBA 4W8RA 3B8YA 1O8KA 2INUA 1IA5A 2EWEA 2O17A 5C1EA 4NK6A 3UW0A 1JRGA 2NT6A 3VMWA 4XONA 1O8FA 2INVA 1K5CA 3B90A 4URRA 1O8EA 4XOTA 1WMRA 2NTQA 4YZXA 4XLFA 4XMYA 2VJIA 2X85A 3ZSCA 4OJ5A 3EQOA 1QJVA 1O8LA 3VSTA 3VSUA 4NK8A 4XNFA 1VBLA 1O8DA 2X3HA 2X6YA 4EW9A 3B4NA 2UVEA 4XL9A 5AMVA 1OFMA 3FY3A 3GRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XOP A;  4Z03 A;  3VMV A;  1RMG A;  3GQ9 A;  1GQ8 A;  4XLE A;  1O8I A;  1RWR A;  2O04 A;  1O8G A;  2O1D A;  2UVF A;  1O8J A;  1IDK A;  1OFL A;  4U49 A;  1BHE A;  1JTA A;  4OZY A;  1KCC A;  4PMH A;  1H80 A;  1O8M A;  4XN0 A;  4Z05 A;  1X0C A;  2QY1 A;  4XLC A;  1EE6 A;  1IDJ A;  2QXZ A;  3GQA A;  4W8T A;  4XOR A;  1CZF A;  1KTW A;  2NSP A;  4C2L A;  2NST A;  1NHC A;  4XQF A;  2NZM A;  2VBK A;  1KCD A;  4YZQ A;  3ZPP A;  3VSV A;  3JUR A;  3SUC A;  4XKV A;  2NT9 A;  2PYH A;  2PEC A;  2NTP A;  4AVZ A;  3KRG A;  4YEL A;  2ODL A;  3GQ7 A;  4W8Q A;  4XLH A;  4XM3 A;  1BN8 A;  2VJJ A;  4OJO A;  1DBG A;  1O88 A;  4MXN A;  4XN3 A;  3T9G A;  1AIR A;  4YZ0 A;  1IB4 A;  2VBE A;  1DBO A;  4XLA A;  4XR6 A;  4OJP A;  1PLU A;  2O0V A;  4MR0 A;  4HWV A;  3GQ8 A;  2BSP A;  1PXZ A;  4XKW A;  1OGO X;  2IQ7 A;  4Z06 A;  4YEJ A;  1HG8 A;  1OOC A;  2X6W A;  3LMW A;  1PE9 A;  4OZZ A;  1XG2 A;  3WWG A;  2PYG A;  2VBM A;  3EQN A;  4OJL A;  4OJ6 A;  4U4B A;  1RU4 A;  4W8S A;  2Z8G A;  2X6X A;  2QX3 A;  4YZA A;  5C1C A;  1O8H A;  4I84 A;  1OGM X;  1QCX A;  2O0W A;  2NTB A;  4W8R A;  3B8Y A;  1O8K A;  2INU A;  1IA5 A;  2EWE A;  2O17 A;  5C1E A;  4NK6 A;  3UW0 A;  1JRG A;  2NT6 A;  3VMW A;  4XON A;  1O8F A;  2INV A;  1K5C A;  3B90 A;  4URR A;  1O8E A;  4XOT A;  1WMR A;  2NTQ A;  4YZX A;  4XLF A;  4XMY A;  2VJI A;  2X85 A;  3ZSC A;  4OJ5 A;  3EQO A;  1QJV A;  1O8L A;  3VST A;  3VSU A;  4NK8 A;  4XNF A;  1VBL A;  1O8D A;  2X3H A;  2X6Y A;  4EW9 A;  3B4N A;  2UVE A;  4XL9 A;  5AMV A;  1OFM A;  3FY3 A;  3GRH A; 
#chains in the Genus database with same CATH topology
 2VFM A;  4V02 C;  4XOP A;  4Z03 A;  1QA1 A;  2F3L A;  3VMV A;  1RMG A;  5DNS A;  3GQ9 A;  3NB2 A;  1GQ8 A;  3P4G A;  4XLE A;  1O8I A;  3DU1 X;  1RWR A;  2O04 A;  1O8G A;  2O1D A;  2UVF A;  1O8J A;  1IDK A;  1OFL A;  4U49 A;  1WXR A;  1BHE A;  1JTA A;  4OZY A;  1KCC A;  3H09 A;  4PMH A;  2YUH A;  1H80 A;  1O8M A;  3N6Z A;  1TYX A;  2O6W A;  1X0C A;  4XN0 A;  2W7Z A;  1K4Z A;  3BH6 B;  4Z05 A;  2QY1 A;  1K8F A;  4XLC A;  1LLZ A;  1EE6 A;  1IDJ A;  2QXZ A;  3GQA A;  1L1I A;  4W8T A;  4XOR A;  3BH7 B;  1CZF A;  1KTW A;  2NSP A;  2V5I A;  4C2L A;  2NST A;  1NHC A;  4YDT A;  4XQF A;  2NZM A;  2VBK A;  4YC5 A;  2BM5 A;  1KCD A;  1CLW A;  2BM6 A;  4YZQ A;  3ZPP A;  3VSV A;  3JUR A;  3SUC A;  2XT4 A;  1LLW A;  4XKV A;  2B0R A;  2NT9 A;  2PYH A;  2NTP A;  2PEC A;  2IOU G;  4OPW A;  4AVZ A;  3LJY A;  3KRG A;  4YEL A;  2ODL A;  3GQ7 A;  4YFO A;  2J8K A;  4W8Q A;  4XLH A;  4XM3 A;  1BN8 A;  2VJJ A;  1QQ1 A;  4OJO A;  1DBG A;  1TSP A;  3RIQ A;  1O88 A;  1EZG A;  4MXN A;  4XN3 A;  3PET A;  3T9G A;  1AIR A;  4YZ0 A;  1IB4 A;  2VBE A;  1DBO A;  1TYV A;  4YCQ A;  3TH0 A;  4XLA A;  2XTW A;  4XR6 A;  4OJP A;  1PLU A;  2O0V A;  4MR0 A;  3ML3 A;  3GQ8 A;  4HWV A;  2BSP A;  2XTY A;  1PXZ A;  4XKW A;  1OGO X;  3AK5 A;  2IQ7 A;  4JRA C;  3NAW A;  4Z06 A;  1DAB A;  2BM7 A;  2XC1 A;  4YEJ A;  5JLV C;  3PSZ A;  1HG8 A;  1OOC A;  3SZE A;  2X6W A;  3SY2 A;  3LMW A;  1PE9 A;  5JMC B;  1QRC A;  4OZZ A;  1XG2 A;  3WWG A;  2PYG A;  2VBM A;  3EQN A;  4OJL A;  4OJ6 A;  4U4B A;  1RU4 A;  2VFP A;  4YEI A;  4W8S A;  2Z8G A;  2X6X A;  2QX3 A;  4YZA A;  5C1C A;  1O8H A;  3PSS A;  4I84 A;  2VFN A;  1OGM X;  1QCX A;  4KH3 A;  3N90 A;  2O0W A;  2NTB A;  2VFQ A;  1QRB A;  4W8R A;  1EA0 A;  1QA3 A;  1TYW A;  3B8Y A;  2BX6 A;  1O8K A;  2INU A;  1IA5 A;  1OFE A;  2EWE A;  2O17 A;  5C1E A;  4NK6 A;  3UW0 A;  1JRG A;  2NT6 A;  2XTX A;  2XT2 A;  3VMW A;  4XON A;  1O8F A;  2INV A;  1K5C A;  3B90 A;  2VFO A;  1O8E A;  4URR A;  2J8I A;  4XOT A;  1HF2 A;  1WMR A;  2NTQ A;  4YZX A;  4XLF A;  4XMY A;  1OFD A;  2VJI A;  2X85 A;  3ZSC A;  3LYC A;  4OJ5 A;  1TYU A;  3EQO A;  1QJV A;  2QYU A;  3FY3 A;  3SYJ A;  1O8L A;  3VST A;  3VSU A;  2G0Y A;  2QZA A;  4NK8 A;  2BM4 A;  4XNF A;  1VBL A;  3JX8 A;  1O8D A;  2X3H A;  2X6Y A;  4EW9 A;  3B4N A;  2UVE A;  1LM1 A;  4XL9 A;  5AMV A;  3SQV A;  4OM9 A;  1QA2 A;  1OFM A;  1KQ5 A;  3GRH A; 
#chains in the Genus database with same CATH homology
 4XOP A;  4Z03 A;  3VMV A;  1RMG A;  3GQ9 A;  1GQ8 A;  4XLE A;  1O8I A;  1RWR A;  2O04 A;  1O8G A;  2O1D A;  2UVF A;  1O8J A;  1IDK A;  1OFL A;  4U49 A;  1BHE A;  1JTA A;  4OZY A;  1KCC A;  4PMH A;  1H80 A;  1O8M A;  4XN0 A;  4Z05 A;  1X0C A;  2QY1 A;  4XLC A;  1EE6 A;  1IDJ A;  2QXZ A;  3GQA A;  4W8T A;  4XOR A;  1CZF A;  1KTW A;  2NSP A;  4C2L A;  2NST A;  1NHC A;  4XQF A;  2NZM A;  2VBK A;  1KCD A;  4YZQ A;  3ZPP A;  3VSV A;  3JUR A;  3SUC A;  4XKV A;  2NT9 A;  2PYH A;  2PEC A;  2NTP A;  4AVZ A;  3KRG A;  4YEL A;  2ODL A;  3GQ7 A;  4W8Q A;  4XLH A;  4XM3 A;  1BN8 A;  2VJJ A;  4OJO A;  1DBG A;  1O88 A;  4MXN A;  4XN3 A;  3T9G A;  1AIR A;  4YZ0 A;  1IB4 A;  2VBE A;  1DBO A;  4XLA A;  4XR6 A;  4OJP A;  1PLU A;  2O0V A;  4MR0 A;  4HWV A;  3GQ8 A;  2BSP A;  1PXZ A;  4XKW A;  1OGO X;  2IQ7 A;  4Z06 A;  4YEJ A;  1HG8 A;  1OOC A;  2X6W A;  3LMW A;  1PE9 A;  4OZZ A;  1XG2 A;  3WWG A;  2PYG A;  2VBM A;  3EQN A;  4OJL A;  4OJ6 A;  4U4B A;  1RU4 A;  4W8S A;  2Z8G A;  2X6X A;  2QX3 A;  4YZA A;  5C1C A;  1O8H A;  4I84 A;  1OGM X;  1QCX A;  2O0W A;  2NTB A;  4W8R A;  3B8Y A;  1O8K A;  2INU A;  1IA5 A;  2EWE A;  2O17 A;  5C1E A;  4NK6 A;  3UW0 A;  1JRG A;  2NT6 A;  3VMW A;  4XON A;  1O8F A;  2INV A;  1K5C A;  3B90 A;  4URR A;  1O8E A;  4XOT A;  1WMR A;  2NTQ A;  4YZX A;  4XLF A;  4XMY A;  2VJI A;  2X85 A;  3ZSC A;  4OJ5 A;  3EQO A;  1QJV A;  1O8L A;  3VST A;  3VSU A;  4NK8 A;  4XNF A;  1VBL A;  1O8D A;  2X3H A;  2X6Y A;  4EW9 A;  3B4N A;  2UVE A;  4XL9 A;  5AMV A;  1OFM A;  3FY3 A;  3GRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...