1NHCA

Structural insights into the processivity of endopolygalacturonase i from aspergillus niger
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
336
structure length
336
Chain Sequence
b'STCTFTSASEASESISSCSDVVLSSIEVPAGETLDLSDAADGSTITFEGTTSFGYKEWKGPLIRFGGKDLTVTMADGAVIDGDGSRWWDSKGTNGGKTKPKFMYIHDVEDSTFKGINIKNTPVQAISVQATNVHLNDFTIDNSDGDDNGGHNTDGFDISESTGVYISGATVKNQDDCIAINSGESISFTGGTCSGGHGLSIGSVGGRDDNTVKNVTISDSTVSNSANGVRIKTIYKETGDVSEITYSNIQLSGITDYGIVIEQDYENGSPTGTPSTGIPITDVTVDGVTGTLEDDATQVYILCGDGSCSDWTWSGVDLSGGKTSDKCENVPSGASC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polygalacturonase I
publication title Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 127
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2002-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1nhcA00
3GQ7A 1H80A 4OJPA 2BSPA 4XQFA 3EQOA 4XKWA 2PECA 1O8HA 3FY3A 2X3HA 2NTBA 1OFMA 2QY1A 4XLCA 1K5CA 4XM3A 1O8MA 4OZZA 1PXZA 4XLHA 2INVA 4XONA 4YZAA 3GQ9A 3ZSCA 2VBEA 1O8LA 2IQ7A 4XN3A 2PYGA 1KTWA 1QCXA 4XKVA 5AMVA 1RU4A 3LMWA 4U49A 3T9GA 4XOTA 4EW9A 4XMYA 3GQAA 4HWVA 1VBLA 2NSTA 1RWRA 2QX3A 4W8SA 4W8TA 4C2LA 4XNFA 1O8FA 1DBOA 3GRHA 3VMWA 2NTPA 1IDKA 2EWEA 3UW0A 1IA5A 1XG2A 4OJOA 4YEJA 2UVFA 2O17A 1O8JA 1WMRA 4Z03A 1O8DA 4MR0A 4OJ5A 3VSVA 1OFLA 4YZXA 2VJJA 3WWGA 2X6WA 1O88A 2VBMA 3ZPPA 1NHCA 4YELA 4XOPA 2VJIA 3VSTA 1PLUA 2NSPA 4AVZA 1BHEA 5C1EA 4XR6A 3KRGA 4OJLA 3GQ8A 1CZFA 2PYHA 2O0VA 1HG8A 1DBGA 2Z8GA 4W8QA 2X6YA 1O8IA 3VMVA 3B8YA 2INUA 4MXNA 1JTAA 4U4BA 2NT6A 4XORA 1O8KA 3B4NA 1QJVA 4Z06A 2VBKA 1IB4A 4XLFA 1AIRA 1KCDA 2UVEA 3B90A 4NK6A 4YZQA 2O1DA 2X6XA 4W8RA 1O8GA 2O04A 4OJ6A 1OGMX 3JURA 2ODLA 1RMGA 1BN8A 1JRGA 1IDJA 1PE9A 4I84A 4PMHA 4YZ0A 4XN0A 4URRA 1GQ8A 4Z05A 3SUCA 4OZYA 2O0WA 4NK8A 2X85A 3EQNA 4XLAA 1EE6A 5C1CA 1O8EA 4XLEA 2NTQA 2NZMA 4XL9A 1KCCA 3VSUA 2QXZA 2NT9A 1X0CA 1OGOX 1OOCA
chains in the Genus database with same CATH superfamily
3GQ7A 1H80A 4OJPA 2BSPA 4XQFA 2J8IA 2VFMA 1K4ZA 3EQOA 4XKWA 3NAWA 2PECA 1O8HA 3FY3A 2X3HA 2NTBA 1OFMA 1LM1A 2QY1A 4XLCA 2VFQA 4XM3A 1K5CA 1O8MA 4OZZA 4JRAC 1PXZA 4XLHA 2INVA 4XONA 4YZAA 3GQ9A 3N90A 3ZSCA 2VBEA 1O8LA 2IQ7A 4XN3A 3SQVA 2PYGA 4OM9A 1QA1A 3NB2A 1KTWA 3PSZA 1QCXA 4XKVA 4YCQA 5AMVA 2O6WA 1RU4A 1TYXA 2V5IA 3LMWA 3RIQA 2XTYA 1DABA 4U49A 3SY2A 3T9GA 4XOTA 4EW9A 4XMYA 2XTXA 2VFOA 3SYJA 3GQAA 1TSPA 4HWVA 1VBLA 3PSSA 2NSTA 1RWRA 3TH0A 2QX3A 4W8SA 4W8TA 4C2LA 4XNFA 1O8FA 1DBOA 2BM5A 2QZAA 2VFPA 3GRHA 3VMWA 1TYUA 2NTPA 1IDKA 2EWEA 4KH3A 4YFOA 3UW0A 1XG2A 3JX8A 4OJOA 2UVFA 2O17A 4YEJA 1O8JA 4V02C 2B0RA 1OFEA 4YDTA 1WMRA 4Z03A 3BH7B 1O8DA 4MR0A 1OFDA 4OJ5A 3VSVA 1OFLA 4YZXA 2VJJA 1LLWA 1KQ5A 1LLZA 3DU1X 2W7ZA 3WWGA 1IA5A 2X6WA 1O88A 1EZGA 2VBMA 3ZPPA 1NHCA 4OPWA 4XOPA 4YC5A 4YELA 4YEIA 2VJIA 3VSTA 1PLUA 2NSPA 2XT4A 2F3LA 4AVZA 1BHEA 5C1EA 1TYWA 3KRGA 4XR6A 4OJLA 1QRBA 2XC1A 3GQ8A 1CZFA 2PYHA 2J8KA 2O0VA 1HG8A 1DBGA 2Z8GA 4W8QA 3PETA 2X6YA 1O8IA 3VMVA 3B8YA 3H09A 2INUA 3LJYA 4MXNA 1JTAA 4U4BA 2NT6A 4XORA 1O8KA 2G0YA 3B4NA 1QJVA 4Z06A 2VBKA 1IB4A 1QA3A 4XLFA 1AIRA 1KCDA 1L1IA 2UVEA 3B90A 2YUHA 4NK6A 4YZQA 2O1DA 2X6XA 4W8RA 2IOUG 1O8GA 3BH6B 2O04A 3N6ZA 4OJ6A 1OGMX 3JURA 2BM4A 2ODLA 1RMGA 1BN8A 1JRGA 1HF2A 1IDJA 1PE9A 1QQ1A 3LYCA 2BM7A 4I84A 4PMHA 4YZ0A 4XN0A 2XTWA 3SZEA 2QYUA 4URRA 5DNSA 1GQ8A 4Z05A 1TYVA 5JLVC 3SUCA 4OZYA 1QRCA 2XT2A 1WXRA 3ML3A 5JMCB 1CLWA 2O0WA 1EA0A 4NK8A 2X85A 3EQNA 4XLAA 1EE6A 5C1CA 1O8EA 2BM6A 1K8FA 4XLEA 2NTQA 3P4GA 2BX6A 2NZMA 1QA2A 4XL9A 1KCCA 3VSUA 2VFNA 2QXZA 2NT9A 1X0CA 3AK5A 1OGOX 1OOCA
chains in the Genus database with same CATH topology
3GQ7A 1H80A 4OJPA 2BSPA 4XQFA 3EQOA 4XKWA 2PECA 1O8HA 3FY3A 2X3HA 2NTBA 1OFMA 2QY1A 4XLCA 1K5CA 4XM3A 1O8MA 4OZZA 1PXZA 4XLHA 2INVA 4XONA 4YZAA 3GQ9A 3ZSCA 2VBEA 1O8LA 2IQ7A 4XN3A 2PYGA 1KTWA 1QCXA 4XKVA 5AMVA 1RU4A 3LMWA 4U49A 3T9GA 4XOTA 4EW9A 4XMYA 3GQAA 4HWVA 1VBLA 2NSTA 1RWRA 2QX3A 4W8SA 4W8TA 4C2LA 4XNFA 1O8FA 1DBOA 3GRHA 3VMWA 2NTPA 1IDKA 2EWEA 3UW0A 1IA5A 1XG2A 4OJOA 4YEJA 2UVFA 2O17A 1O8JA 1WMRA 4Z03A 1O8DA 4MR0A 4OJ5A 3VSVA 1OFLA 4YZXA 2VJJA 3WWGA 2X6WA 1O88A 2VBMA 3ZPPA 1NHCA 4YELA 4XOPA 2VJIA 3VSTA 1PLUA 2NSPA 4AVZA 1BHEA 5C1EA 4XR6A 3KRGA 4OJLA 3GQ8A 1CZFA 2PYHA 2O0VA 1HG8A 1DBGA 2Z8GA 4W8QA 2X6YA 1O8IA 3VMVA 3B8YA 2INUA 4MXNA 1JTAA 4U4BA 2NT6A 4XORA 1O8KA 3B4NA 1QJVA 4Z06A 2VBKA 1IB4A 4XLFA 1AIRA 1KCDA 2UVEA 3B90A 4NK6A 4YZQA 2O1DA 2X6XA 4W8RA 1O8GA 2O04A 4OJ6A 1OGMX 3JURA 2ODLA 1RMGA 1BN8A 1JRGA 1IDJA 1PE9A 4I84A 4PMHA 4YZ0A 4XN0A 4URRA 1GQ8A 4Z05A 3SUCA 4OZYA 2O0WA 4NK8A 2X85A 3EQNA 4XLAA 1EE6A 5C1CA 1O8EA 4XLEA 2NTQA 2NZMA 4XL9A 1KCCA 3VSUA 2QXZA 2NT9A 1X0CA 1OGOX 1OOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ7 A;  1H80 A;  4OJP A;  2BSP A;  4XQF A;  3EQO A;  4XKW A;  2PEC A;  1O8H A;  3FY3 A;  2X3H A;  2NTB A;  1OFM A;  2QY1 A;  4XLC A;  1K5C A;  4XM3 A;  1O8M A;  4OZZ A;  1PXZ A;  4XLH A;  2INV A;  4XON A;  4YZA A;  3GQ9 A;  3ZSC A;  2VBE A;  1O8L A;  2IQ7 A;  4XN3 A;  2PYG A;  1KTW A;  1QCX A;  4XKV A;  5AMV A;  1RU4 A;  3LMW A;  4U49 A;  3T9G A;  4XOT A;  4EW9 A;  4XMY A;  3GQA A;  4HWV A;  1VBL A;  2NST A;  1RWR A;  2QX3 A;  4W8S A;  4W8T A;  4C2L A;  4XNF A;  1O8F A;  1DBO A;  3GRH A;  3VMW A;  2NTP A;  1IDK A;  2EWE A;  3UW0 A;  1IA5 A;  1XG2 A;  4OJO A;  4YEJ A;  2UVF A;  2O17 A;  1O8J A;  1WMR A;  4Z03 A;  1O8D A;  4MR0 A;  4OJ5 A;  3VSV A;  1OFL A;  4YZX A;  2VJJ A;  3WWG A;  2X6W A;  1O88 A;  2VBM A;  3ZPP A;  1NHC A;  4YEL A;  4XOP A;  2VJI A;  3VST A;  1PLU A;  2NSP A;  4AVZ A;  1BHE A;  5C1E A;  4XR6 A;  3KRG A;  4OJL A;  3GQ8 A;  1CZF A;  2PYH A;  2O0V A;  1HG8 A;  1DBG A;  2Z8G A;  4W8Q A;  2X6Y A;  1O8I A;  3VMV A;  3B8Y A;  2INU A;  4MXN A;  1JTA A;  4U4B A;  2NT6 A;  4XOR A;  1O8K A;  3B4N A;  1QJV A;  4Z06 A;  2VBK A;  1IB4 A;  4XLF A;  1AIR A;  1KCD A;  2UVE A;  3B90 A;  4NK6 A;  4YZQ A;  2O1D A;  2X6X A;  4W8R A;  1O8G A;  2O04 A;  4OJ6 A;  1OGM X;  3JUR A;  2ODL A;  1RMG A;  1BN8 A;  1JRG A;  1IDJ A;  1PE9 A;  4I84 A;  4PMH A;  4YZ0 A;  4XN0 A;  4URR A;  1GQ8 A;  4Z05 A;  3SUC A;  4OZY A;  2O0W A;  4NK8 A;  2X85 A;  3EQN A;  4XLA A;  1EE6 A;  5C1C A;  1O8E A;  4XLE A;  2NTQ A;  2NZM A;  4XL9 A;  1KCC A;  3VSU A;  2QXZ A;  2NT9 A;  1X0C A;  1OGO X;  1OOC A; 
#chains in the Genus database with same CATH topology
 3GQ7 A;  1H80 A;  4OJP A;  2BSP A;  4XQF A;  2J8I A;  2VFM A;  1K4Z A;  3EQO A;  4XKW A;  3NAW A;  2PEC A;  1O8H A;  3FY3 A;  2X3H A;  2NTB A;  1OFM A;  1LM1 A;  2QY1 A;  4XLC A;  2VFQ A;  4XM3 A;  1K5C A;  1O8M A;  4OZZ A;  4JRA C;  1PXZ A;  4XLH A;  2INV A;  4XON A;  4YZA A;  3GQ9 A;  3N90 A;  3ZSC A;  2VBE A;  1O8L A;  2IQ7 A;  4XN3 A;  3SQV A;  2PYG A;  4OM9 A;  1QA1 A;  3NB2 A;  1KTW A;  3PSZ A;  1QCX A;  4XKV A;  4YCQ A;  5AMV A;  2O6W A;  1RU4 A;  1TYX A;  2V5I A;  3LMW A;  3RIQ A;  2XTY A;  1DAB A;  4U49 A;  3SY2 A;  3T9G A;  4XOT A;  4EW9 A;  4XMY A;  2XTX A;  2VFO A;  3SYJ A;  3GQA A;  1TSP A;  4HWV A;  1VBL A;  3PSS A;  2NST A;  1RWR A;  3TH0 A;  2QX3 A;  4W8S A;  4W8T A;  4C2L A;  4XNF A;  1O8F A;  1DBO A;  2BM5 A;  2QZA A;  2VFP A;  3GRH A;  3VMW A;  1TYU A;  2NTP A;  1IDK A;  2EWE A;  4KH3 A;  4YFO A;  3UW0 A;  1XG2 A;  3JX8 A;  4OJO A;  2UVF A;  2O17 A;  4YEJ A;  1O8J A;  4V02 C;  2B0R A;  1OFE A;  4YDT A;  1WMR A;  4Z03 A;  3BH7 B;  1O8D A;  4MR0 A;  1OFD A;  4OJ5 A;  3VSV A;  1OFL A;  4YZX A;  2VJJ A;  1LLW A;  1KQ5 A;  1LLZ A;  3DU1 X;  2W7Z A;  3WWG A;  1IA5 A;  2X6W A;  1O88 A;  1EZG A;  2VBM A;  3ZPP A;  1NHC A;  4OPW A;  4XOP A;  4YC5 A;  4YEL A;  4YEI A;  2VJI A;  3VST A;  1PLU A;  2NSP A;  2XT4 A;  2F3L A;  4AVZ A;  1BHE A;  5C1E A;  1TYW A;  3KRG A;  4XR6 A;  4OJL A;  1QRB A;  2XC1 A;  3GQ8 A;  1CZF A;  2PYH A;  2J8K A;  2O0V A;  1HG8 A;  1DBG A;  2Z8G A;  4W8Q A;  3PET A;  2X6Y A;  1O8I A;  3VMV A;  3B8Y A;  3H09 A;  2INU A;  3LJY A;  4MXN A;  1JTA A;  4U4B A;  2NT6 A;  4XOR A;  1O8K A;  2G0Y A;  3B4N A;  1QJV A;  4Z06 A;  2VBK A;  1IB4 A;  1QA3 A;  4XLF A;  1AIR A;  1KCD A;  1L1I A;  2UVE A;  3B90 A;  2YUH A;  4NK6 A;  4YZQ A;  2O1D A;  2X6X A;  4W8R A;  2IOU G;  1O8G A;  3BH6 B;  2O04 A;  3N6Z A;  4OJ6 A;  1OGM X;  3JUR A;  2BM4 A;  2ODL A;  1RMG A;  1BN8 A;  1JRG A;  1HF2 A;  1IDJ A;  1PE9 A;  1QQ1 A;  3LYC A;  2BM7 A;  4I84 A;  4PMH A;  4YZ0 A;  4XN0 A;  2XTW A;  3SZE A;  2QYU A;  4URR A;  5DNS A;  1GQ8 A;  4Z05 A;  1TYV A;  5JLV C;  3SUC A;  4OZY A;  1QRC A;  2XT2 A;  1WXR A;  3ML3 A;  5JMC B;  1CLW A;  2O0W A;  1EA0 A;  4NK8 A;  2X85 A;  3EQN A;  4XLA A;  1EE6 A;  5C1C A;  1O8E A;  2BM6 A;  1K8F A;  4XLE A;  2NTQ A;  3P4G A;  2BX6 A;  2NZM A;  1QA2 A;  4XL9 A;  1KCC A;  3VSU A;  2VFN A;  2QXZ A;  2NT9 A;  1X0C A;  3AK5 A;  1OGO X;  1OOC A; 
#chains in the Genus database with same CATH homology
 3GQ7 A;  1H80 A;  4OJP A;  2BSP A;  4XQF A;  3EQO A;  4XKW A;  2PEC A;  1O8H A;  3FY3 A;  2X3H A;  2NTB A;  1OFM A;  2QY1 A;  4XLC A;  1K5C A;  4XM3 A;  1O8M A;  4OZZ A;  1PXZ A;  4XLH A;  2INV A;  4XON A;  4YZA A;  3GQ9 A;  3ZSC A;  2VBE A;  1O8L A;  2IQ7 A;  4XN3 A;  2PYG A;  1KTW A;  1QCX A;  4XKV A;  5AMV A;  1RU4 A;  3LMW A;  4U49 A;  3T9G A;  4XOT A;  4EW9 A;  4XMY A;  3GQA A;  4HWV A;  1VBL A;  2NST A;  1RWR A;  2QX3 A;  4W8S A;  4W8T A;  4C2L A;  4XNF A;  1O8F A;  1DBO A;  3GRH A;  3VMW A;  2NTP A;  1IDK A;  2EWE A;  3UW0 A;  1IA5 A;  1XG2 A;  4OJO A;  4YEJ A;  2UVF A;  2O17 A;  1O8J A;  1WMR A;  4Z03 A;  1O8D A;  4MR0 A;  4OJ5 A;  3VSV A;  1OFL A;  4YZX A;  2VJJ A;  3WWG A;  2X6W A;  1O88 A;  2VBM A;  3ZPP A;  1NHC A;  4YEL A;  4XOP A;  2VJI A;  3VST A;  1PLU A;  2NSP A;  4AVZ A;  1BHE A;  5C1E A;  4XR6 A;  3KRG A;  4OJL A;  3GQ8 A;  1CZF A;  2PYH A;  2O0V A;  1HG8 A;  1DBG A;  2Z8G A;  4W8Q A;  2X6Y A;  1O8I A;  3VMV A;  3B8Y A;  2INU A;  4MXN A;  1JTA A;  4U4B A;  2NT6 A;  4XOR A;  1O8K A;  3B4N A;  1QJV A;  4Z06 A;  2VBK A;  1IB4 A;  4XLF A;  1AIR A;  1KCD A;  2UVE A;  3B90 A;  4NK6 A;  4YZQ A;  2O1D A;  2X6X A;  4W8R A;  1O8G A;  2O04 A;  4OJ6 A;  1OGM X;  3JUR A;  2ODL A;  1RMG A;  1BN8 A;  1JRG A;  1IDJ A;  1PE9 A;  4I84 A;  4PMH A;  4YZ0 A;  4XN0 A;  4URR A;  1GQ8 A;  4Z05 A;  3SUC A;  4OZY A;  2O0W A;  4NK8 A;  2X85 A;  3EQN A;  4XLA A;  1EE6 A;  5C1C A;  1O8E A;  4XLE A;  2NTQ A;  2NZM A;  4XL9 A;  1KCC A;  3VSU A;  2QXZ A;  2NT9 A;  1X0C A;  1OGO X;  1OOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...