1NHCA

Structural insights into the processivity of endopolygalacturonase i from aspergillus niger
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
336
structure length
336
Chain Sequence
STCTFTSASEASESISSCSDVVLSSIEVPAGETLDLSDAADGSTITFEGTTSFGYKEWKGPLIRFGGKDLTVTMADGAVIDGDGSRWWDSKGTNGGKTKPKFMYIHDVEDSTFKGINIKNTPVQAISVQATNVHLNDFTIDNSDGDDNGGHNTDGFDISESTGVYISGATVKNQDDCIAINSGESISFTGGTCSGGHGLSIGSVGGRDDNTVKNVTISDSTVSNSANGVRIKTIYKETGDVSEITYSNIQLSGITDYGIVIEQDYENGSPTGTPSTGIPITDVTVDGVTGTLEDDATQVYILCGDGSCSDWTWSGVDLSGGKTSDKCENVPSGASC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords Polygalacturonase I
total genus 127
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2002-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1nhcA00
2X85A 4MR0A 1OFLA 2X3HA 4U49A 1IA5A 2INVA 2VJIA 1OFMA 1XG2A 1O8DA 3JURA 4NK6A 4Z03A 4XORA 2O1DA 1AIRA 4YZQA 4OJPA 4PMHA 4NK8A 4OJ6A 4I84A 2VBEA 2O0VA 4W8SA 4XN0A 4XKWA 4XL9A 1O8EA 3LMWA 3KRGA 4XONA 1PLUA 4YZAA 4Z05A 4Z06A 2O17A 3VMVA 3GRHA 2QY1A 3B8YA 1JRGA 3GQ8A 3SUCA 4URRA 3VSUA 1O8LA 1KCDA 2EWEA 1BHEA 2INUA 1WMRA 2VBKA 4OZYA 4XLAA 1O8IA 3VSTA 3UW0A 1O8KA 4OJLA 2NTQA 4W8TA 1OGOX 2NZMA 4W8RA 1CZFA 4XOPA 4XLHA 1GQ8A 1O8GA 1OGMX 1QCXA 3B4NA 1BN8A 4YELA 4EW9A 2NT9A 4XQFA 2QX3A 2VBMA 1O8JA 4OZZA 4XMYA 1HG8A 3VSVA 2X6XA 3B90A 2X6YA 3VMWA 2QXZA 3ZPPA 1O8HA 1QJVA 2VJJA 2NSPA 2X6WA 2UVEA 1PXZA 4AVZA 4YEJA 1IDJA 2Z8GA 3EQOA 4XOTA 3WWGA 5AMVA 2NT6A 4OJOA 1RU4A 4U4BA 4XR6A 3GQ9A 3T9GA 4OJ5A 4YZ0A 1OOCA 3GQ7A 2O0WA 4XKVA 4XLEA 5C1EA 4XN3A 1RMGA 1O8FA 1EE6A 3FY3A 2PYGA 1K5CA 4YZXA 1IDKA 2ODLA 4W8QA 2NTPA 1KTWA 2NTBA 1IB4A 2UVFA 2O04A 2IQ7A 2PYHA 3EQNA 1O88A 2BSPA 4XM3A 4C2LA 5C1CA 1NHCA 2PECA 4XLCA 3GQAA 3ZSCA 1KCCA 1H80A 1X0CA 4XLFA 4XNFA 4HWVA 1DBGA 1DBOA 1VBLA 1PE9A 1RWRA 1JTAA 4MXNA 1O8MA 2NSTA
chains in the Genus database with same CATH superfamily
1K8FA 2IOUG 2X85A 4MR0A 1OFLA 3N6ZA 2X3HA 3PETA 4U49A 1IA5A 1TYVA 1QQ1A 1TYXA 2INVA 1OFMA 1XG2A 1O8DA 2VJIA 3JURA 3NB2A 4NK6A 4XORA 2O1DA 4YDTA 1AIRA 4Z03A 1K4ZA 2BM4A 4OJPA 4YZQA 4PMHA 4NK8A 4OJ6A 3SZEA 5JMCB 1OFDA 2VBEA 4I84A 1TYUA 2O0VA 4W8SA 4XN0A 4XKWA 4XL9A 2YUHA 2BX6A 1O8EA 3LMWA 3KRGA 3SYJA 4XONA 1PLUA 4YZAA 4Z05A 1QRCA 2BM7A 1OFEA 4Z06A 2O17A 3VMVA 3GRHA 2XTWA 2QY1A 1JRGA 3B8YA 3GQ8A 4YFOA 3SUCA 4URRA 3RIQA 3DU1X 3VSUA 1O8LA 1KCDA 2F3LA 2O6WA 2EWEA 1BHEA 1HF2A 2INUA 1WMRA 2VBKA 3LJYA 3N90A 3PSSA 4OZYA 4XLAA 3TH0A 1O8IA 2V5IA 2XC1A 2G0YA 3VSTA 3UW0A 2J8IA 1O8KA 3BH7B 4OJLA 2VFPA 3LYCA 1LLWA 2NTQA 4OM9A 1OGOX 4W8TA 2NZMA 2QYUA 4OPWA 4W8RA 1CZFA 2BM6A 4XLHA 1GQ8A 1LM1A 1O8GA 1OGMX 4XOPA 2XT2A 1QCXA 1KQ5A 4JRAC 3B4NA 1BN8A 4YELA 1LLZA 2NT9A 4EW9A 4XQFA 2QX3A 2VBMA 1O8JA 2VFMA 4OZZA 1EZGA 4XMYA 1HG8A 3VSVA 2X6XA 3B90A 3AK5A 2VFOA 2X6YA 3VMWA 3H09A 3PSZA 2QXZA 2VFNA 2XTXA 4V02C 3ZPPA 1O8HA 1QJVA 2VJJA 2NSPA 2X6WA 1TYWA 2UVEA 1PXZA 4AVZA 4YEJA 1IDJA 2Z8GA 4YCQA 3EQOA 4XOTA 3WWGA 3SY2A 3SQVA 1QA1A 5AMVA 2NT6A 4OJOA 2QZAA 1RU4A 4U4BA 4XR6A 3GQ9A 1QA3A 3T9GA 4OJ5A 4YZ0A 1OOCA 2J8KA 3GQ7A 2O0WA 4XKVA 4XLEA 5C1EA 4XN3A 3ML3A 4KH3A 1RMGA 1O8FA 1EE6A 3FY3A 2PYGA 2W7ZA 1K5CA 2XT4A 4YZXA 3JX8A 1IDKA 2ODLA 4W8QA 1WXRA 2NTPA 1KTWA 2NTBA 1IB4A 2UVFA 2O04A 2IQ7A 4YC5A 2PYHA 3EQNA 1O88A 2XTYA 2BSPA 1EA0A 4XM3A 4C2LA 3P4GA 5C1CA 1QA2A 1NHCA 2PECA 4XLCA 2B0RA 3NAWA 3GQAA 1L1IA 2BM5A 3ZSCA 5JLVC 1TSPA 1H80A 1X0CA 4XLFA 4XNFA 4HWVA 1DBGA 1DBOA 1KCCA 3BH6B 1VBLA 1DABA 2VFQA 1PE9A 1QRBA 1RWRA 1CLWA 5DNSA 1JTAA 4MXNA 4YEIA 1O8MA 2NSTA
chains in the Genus database with same CATH topology
2X85A 4MR0A 1OFLA 2X3HA 4U49A 1IA5A 2INVA 2VJIA 1OFMA 1XG2A 1O8DA 3JURA 4NK6A 4Z03A 4XORA 2O1DA 1AIRA 4YZQA 4OJPA 4PMHA 4NK8A 4OJ6A 4I84A 2VBEA 2O0VA 4W8SA 4XN0A 4XKWA 4XL9A 1O8EA 3LMWA 3KRGA 4XONA 1PLUA 4YZAA 4Z05A 4Z06A 2O17A 3VMVA 3GRHA 2QY1A 3B8YA 1JRGA 3GQ8A 3SUCA 4URRA 3VSUA 1O8LA 1KCDA 2EWEA 1BHEA 2INUA 1WMRA 2VBKA 4OZYA 4XLAA 1O8IA 3VSTA 3UW0A 1O8KA 4OJLA 2NTQA 4W8TA 1OGOX 2NZMA 4W8RA 1CZFA 4XOPA 4XLHA 1GQ8A 1O8GA 1OGMX 1QCXA 3B4NA 1BN8A 4YELA 4EW9A 2NT9A 4XQFA 2QX3A 2VBMA 1O8JA 4OZZA 4XMYA 1HG8A 3VSVA 2X6XA 3B90A 2X6YA 3VMWA 2QXZA 3ZPPA 1O8HA 1QJVA 2VJJA 2NSPA 2X6WA 2UVEA 1PXZA 4AVZA 4YEJA 1IDJA 2Z8GA 3EQOA 4XOTA 3WWGA 5AMVA 2NT6A 4OJOA 1RU4A 4U4BA 4XR6A 3GQ9A 3T9GA 4OJ5A 4YZ0A 1OOCA 3GQ7A 2O0WA 4XKVA 4XLEA 5C1EA 4XN3A 1RMGA 1O8FA 1EE6A 3FY3A 2PYGA 1K5CA 4YZXA 1IDKA 2ODLA 4W8QA 2NTPA 1KTWA 2NTBA 1IB4A 2UVFA 2O04A 2IQ7A 2PYHA 3EQNA 1O88A 2BSPA 4XM3A 4C2LA 5C1CA 1NHCA 2PECA 4XLCA 3GQAA 3ZSCA 1KCCA 1H80A 1X0CA 4XLFA 4XNFA 4HWVA 1DBGA 1DBOA 1VBLA 1PE9A 1RWRA 1JTAA 4MXNA 1O8MA 2NSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X85 A;  4MR0 A;  1OFL A;  2X3H A;  4U49 A;  1IA5 A;  2INV A;  2VJI A;  1OFM A;  1XG2 A;  1O8D A;  3JUR A;  4NK6 A;  4Z03 A;  4XOR A;  2O1D A;  1AIR A;  4YZQ A;  4OJP A;  4PMH A;  4NK8 A;  4OJ6 A;  4I84 A;  2VBE A;  2O0V A;  4W8S A;  4XN0 A;  4XKW A;  4XL9 A;  1O8E A;  3LMW A;  3KRG A;  4XON A;  1PLU A;  4YZA A;  4Z05 A;  4Z06 A;  2O17 A;  3VMV A;  3GRH A;  2QY1 A;  3B8Y A;  1JRG A;  3GQ8 A;  3SUC A;  4URR A;  3VSU A;  1O8L A;  1KCD A;  2EWE A;  1BHE A;  2INU A;  1WMR A;  2VBK A;  4OZY A;  4XLA A;  1O8I A;  3VST A;  3UW0 A;  1O8K A;  4OJL A;  2NTQ A;  4W8T A;  1OGO X;  2NZM A;  4W8R A;  1CZF A;  4XOP A;  4XLH A;  1GQ8 A;  1O8G A;  1OGM X;  1QCX A;  3B4N A;  1BN8 A;  4YEL A;  4EW9 A;  2NT9 A;  4XQF A;  2QX3 A;  2VBM A;  1O8J A;  4OZZ A;  4XMY A;  1HG8 A;  3VSV A;  2X6X A;  3B90 A;  2X6Y A;  3VMW A;  2QXZ A;  3ZPP A;  1O8H A;  1QJV A;  2VJJ A;  2NSP A;  2X6W A;  2UVE A;  1PXZ A;  4AVZ A;  4YEJ A;  1IDJ A;  2Z8G A;  3EQO A;  4XOT A;  3WWG A;  5AMV A;  2NT6 A;  4OJO A;  1RU4 A;  4U4B A;  4XR6 A;  3GQ9 A;  3T9G A;  4OJ5 A;  4YZ0 A;  1OOC A;  3GQ7 A;  2O0W A;  4XKV A;  4XLE A;  5C1E A;  4XN3 A;  1RMG A;  1O8F A;  1EE6 A;  3FY3 A;  2PYG A;  1K5C A;  4YZX A;  1IDK A;  2ODL A;  4W8Q A;  2NTP A;  1KTW A;  2NTB A;  1IB4 A;  2UVF A;  2O04 A;  2IQ7 A;  2PYH A;  3EQN A;  1O88 A;  2BSP A;  4XM3 A;  4C2L A;  5C1C A;  1NHC A;  2PEC A;  4XLC A;  3GQA A;  3ZSC A;  1KCC A;  1H80 A;  1X0C A;  4XLF A;  4XNF A;  4HWV A;  1DBG A;  1DBO A;  1VBL A;  1PE9 A;  1RWR A;  1JTA A;  4MXN A;  1O8M A;  2NST A; 
#chains in the Genus database with same CATH topology
 1K8F A;  2IOU G;  2X85 A;  4MR0 A;  1OFL A;  3N6Z A;  2X3H A;  3PET A;  4U49 A;  1IA5 A;  1TYV A;  1QQ1 A;  1TYX A;  2INV A;  1OFM A;  1XG2 A;  1O8D A;  2VJI A;  3JUR A;  3NB2 A;  4NK6 A;  4XOR A;  2O1D A;  4YDT A;  1AIR A;  4Z03 A;  1K4Z A;  2BM4 A;  4OJP A;  4YZQ A;  4PMH A;  4NK8 A;  4OJ6 A;  3SZE A;  5JMC B;  1OFD A;  2VBE A;  4I84 A;  1TYU A;  2O0V A;  4W8S A;  4XN0 A;  4XKW A;  4XL9 A;  2YUH A;  2BX6 A;  1O8E A;  3LMW A;  3KRG A;  3SYJ A;  4XON A;  1PLU A;  4YZA A;  4Z05 A;  1QRC A;  2BM7 A;  1OFE A;  4Z06 A;  2O17 A;  3VMV A;  3GRH A;  2XTW A;  2QY1 A;  1JRG A;  3B8Y A;  3GQ8 A;  4YFO A;  3SUC A;  4URR A;  3RIQ A;  3DU1 X;  3VSU A;  1O8L A;  1KCD A;  2F3L A;  2O6W A;  2EWE A;  1BHE A;  1HF2 A;  2INU A;  1WMR A;  2VBK A;  3LJY A;  3N90 A;  3PSS A;  4OZY A;  4XLA A;  3TH0 A;  1O8I A;  2V5I A;  2XC1 A;  2G0Y A;  3VST A;  3UW0 A;  2J8I A;  1O8K A;  3BH7 B;  4OJL A;  2VFP A;  3LYC A;  1LLW A;  2NTQ A;  4OM9 A;  1OGO X;  4W8T A;  2NZM A;  2QYU A;  4OPW A;  4W8R A;  1CZF A;  2BM6 A;  4XLH A;  1GQ8 A;  1LM1 A;  1O8G A;  1OGM X;  4XOP A;  2XT2 A;  1QCX A;  1KQ5 A;  4JRA C;  3B4N A;  1BN8 A;  4YEL A;  1LLZ A;  2NT9 A;  4EW9 A;  4XQF A;  2QX3 A;  2VBM A;  1O8J A;  2VFM A;  4OZZ A;  1EZG A;  4XMY A;  1HG8 A;  3VSV A;  2X6X A;  3B90 A;  3AK5 A;  2VFO A;  2X6Y A;  3VMW A;  3H09 A;  3PSZ A;  2QXZ A;  2VFN A;  2XTX A;  4V02 C;  3ZPP A;  1O8H A;  1QJV A;  2VJJ A;  2NSP A;  2X6W A;  1TYW A;  2UVE A;  1PXZ A;  4AVZ A;  4YEJ A;  1IDJ A;  2Z8G A;  4YCQ A;  3EQO A;  4XOT A;  3WWG A;  3SY2 A;  3SQV A;  1QA1 A;  5AMV A;  2NT6 A;  4OJO A;  2QZA A;  1RU4 A;  4U4B A;  4XR6 A;  3GQ9 A;  1QA3 A;  3T9G A;  4OJ5 A;  4YZ0 A;  1OOC A;  2J8K A;  3GQ7 A;  2O0W A;  4XKV A;  4XLE A;  5C1E A;  4XN3 A;  3ML3 A;  4KH3 A;  1RMG A;  1O8F A;  1EE6 A;  3FY3 A;  2PYG A;  2W7Z A;  1K5C A;  2XT4 A;  4YZX A;  3JX8 A;  1IDK A;  2ODL A;  4W8Q A;  1WXR A;  2NTP A;  1KTW A;  2NTB A;  1IB4 A;  2UVF A;  2O04 A;  2IQ7 A;  4YC5 A;  2PYH A;  3EQN A;  1O88 A;  2XTY A;  2BSP A;  1EA0 A;  4XM3 A;  4C2L A;  3P4G A;  5C1C A;  1QA2 A;  1NHC A;  2PEC A;  4XLC A;  2B0R A;  3NAW A;  3GQA A;  1L1I A;  2BM5 A;  3ZSC A;  5JLV C;  1TSP A;  1H80 A;  1X0C A;  4XLF A;  4XNF A;  4HWV A;  1DBG A;  1DBO A;  1KCC A;  3BH6 B;  1VBL A;  1DAB A;  2VFQ A;  1PE9 A;  1QRB A;  1RWR A;  1CLW A;  5DNS A;  1JTA A;  4MXN A;  4YEI A;  1O8M A;  2NST A; 
#chains in the Genus database with same CATH homology
 2X85 A;  4MR0 A;  1OFL A;  2X3H A;  4U49 A;  1IA5 A;  2INV A;  2VJI A;  1OFM A;  1XG2 A;  1O8D A;  3JUR A;  4NK6 A;  4Z03 A;  4XOR A;  2O1D A;  1AIR A;  4YZQ A;  4OJP A;  4PMH A;  4NK8 A;  4OJ6 A;  4I84 A;  2VBE A;  2O0V A;  4W8S A;  4XN0 A;  4XKW A;  4XL9 A;  1O8E A;  3LMW A;  3KRG A;  4XON A;  1PLU A;  4YZA A;  4Z05 A;  4Z06 A;  2O17 A;  3VMV A;  3GRH A;  2QY1 A;  3B8Y A;  1JRG A;  3GQ8 A;  3SUC A;  4URR A;  3VSU A;  1O8L A;  1KCD A;  2EWE A;  1BHE A;  2INU A;  1WMR A;  2VBK A;  4OZY A;  4XLA A;  1O8I A;  3VST A;  3UW0 A;  1O8K A;  4OJL A;  2NTQ A;  4W8T A;  1OGO X;  2NZM A;  4W8R A;  1CZF A;  4XOP A;  4XLH A;  1GQ8 A;  1O8G A;  1OGM X;  1QCX A;  3B4N A;  1BN8 A;  4YEL A;  4EW9 A;  2NT9 A;  4XQF A;  2QX3 A;  2VBM A;  1O8J A;  4OZZ A;  4XMY A;  1HG8 A;  3VSV A;  2X6X A;  3B90 A;  2X6Y A;  3VMW A;  2QXZ A;  3ZPP A;  1O8H A;  1QJV A;  2VJJ A;  2NSP A;  2X6W A;  2UVE A;  1PXZ A;  4AVZ A;  4YEJ A;  1IDJ A;  2Z8G A;  3EQO A;  4XOT A;  3WWG A;  5AMV A;  2NT6 A;  4OJO A;  1RU4 A;  4U4B A;  4XR6 A;  3GQ9 A;  3T9G A;  4OJ5 A;  4YZ0 A;  1OOC A;  3GQ7 A;  2O0W A;  4XKV A;  4XLE A;  5C1E A;  4XN3 A;  1RMG A;  1O8F A;  1EE6 A;  3FY3 A;  2PYG A;  1K5C A;  4YZX A;  1IDK A;  2ODL A;  4W8Q A;  2NTP A;  1KTW A;  2NTB A;  1IB4 A;  2UVF A;  2O04 A;  2IQ7 A;  2PYH A;  3EQN A;  1O88 A;  2BSP A;  4XM3 A;  4C2L A;  5C1C A;  1NHC A;  2PEC A;  4XLC A;  3GQA A;  3ZSC A;  1KCC A;  1H80 A;  1X0C A;  4XLF A;  4XNF A;  4HWV A;  1DBG A;  1DBO A;  1VBL A;  1PE9 A;  1RWR A;  1JTA A;  4MXN A;  1O8M A;  2NST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...