1NHCA

Structural insights into the processivity of endopolygalacturonase i from aspergillus niger
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
336
structure length
336
Chain Sequence
STCTFTSASEASESISSCSDVVLSSIEVPAGETLDLSDAADGSTITFEGTTSFGYKEWKGPLIRFGGKDLTVTMADGAVIDGDGSRWWDSKGTNGGKTKPKFMYIHDVEDSTFKGINIKNTPVQAISVQATNVHLNDFTIDNSDGDDNGGHNTDGFDISESTGVYISGATVKNQDDCIAINSGESISFTGGTCSGGHGLSIGSVGGRDDNTVKNVTISDSTVSNSANGVRIKTIYKETGDVSEITYSNIQLSGITDYGIVIEQDYENGSPTGTPSTGIPITDVTVDGVTGTLEDDATQVYILCGDGSCSDWTWSGVDLSGGKTSDKCENVPSGASC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Polygalacturonase I
publication title Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger.
pubmed doi rcsb
source organism Aspergillus niger
total genus 127
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2002-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1nhcA00
3FY3A 5C1EA 4OZYA 4XLCA 1K5CA 4OZZA 1DBOA 2VBEA 1OGMX 3WWGA 1O8HA 1RMGA 1IDKA 4XNFA 2INUA 1O8DA 4XR6A 4XM3A 1O8IA 1VBLA 1WMRA 4OJLA 4YELA 3SUCA 4W8RA 4OJ6A 3GQAA 4OJPA 2NZMA 4XKWA 4OJ5A 3B8YA 4NK6A 1CZFA 2NSPA 2X6WA 4XMYA 1OGOX 2O17A 4I84A 3JURA 1IDJA 2QXZA 2VBMA 4EW9A 2EWEA 3ZPPA 2NT9A 3GQ7A 1O8KA 2O0VA 1KTWA 2X3HA 1PLUA 1O8LA 1O8FA 3UW0A 4XLHA 2NTPA 4XLAA 1OOCA 4XL9A 4YZQA 4PMHA 4YZAA 4XLFA 4Z03A 4U4BA 4C2LA 2UVEA 2Z8GA 1QJVA 4XOPA 4XN0A 4AVZA 2O0WA 3VMVA 2PYHA 4Z05A 2INVA 4YEJA 4XN3A 4XORA 1H80A 4YZXA 1HG8A 4URRA 2O04A 2PYGA 1EE6A 2VJJA 3GRHA 4OJOA 3T9GA 3LMWA 4W8QA 4HWVA 2NTQA 4XKVA 4MR0A 1X0CA 3VSTA 2X6XA 1PXZA 4U49A 3VSUA 1OFMA 4MXNA 1IB4A 3VSVA 1DBGA 1PE9A 3GQ8A 4XONA 3ZSCA 1O88A 2NTBA 4YZ0A 1BHEA 3KRGA 5AMVA 1RU4A 2QX3A 1O8MA 2O1DA 2BSPA 4XQFA 3B4NA 4W8TA 4Z06A 5C1CA 4NK8A 1BN8A 3VMWA 2IQ7A 2X85A 2X6YA 1KCCA 1GQ8A 2QY1A 1KCDA 1JTAA 2PECA 4XLEA 1NHCA 4W8SA 2VJIA 1AIRA 2NT6A 2NSTA 1OFLA 1O8GA 1O8EA 2UVFA 3EQOA 1QCXA 3GQ9A 4XOTA 3EQNA 1JRGA 3B90A 1IA5A 1O8JA 2VBKA 1RWRA 1XG2A 2ODLA
chains in the Genus database with same CATH superfamily
4YDTA 3FY3A 5C1EA 4OZYA 4XLCA 1K5CA 4OZZA 1DBOA 2VBEA 1OGMX 1TSPA 1WXRA 3H09A 2VFOA 3WWGA 3BH7B 1O8HA 1RMGA 1IDKA 4XNFA 2QYUA 2INUA 1O8DA 3BH6B 4XR6A 4XM3A 1O8IA 1VBLA 2YUHA 1WMRA 4OJLA 4YFOA 4YELA 3SUCA 4W8RA 4OJ6A 2QZAA 3SZEA 1LM1A 3GQAA 4YEIA 3N6ZA 4YC5A 3AK5A 4OJPA 2NZMA 2VBKA 2BM4A 4JRAC 1OFEA 4XKWA 4OM9A 3NB2A 4OJ5A 3B8YA 4NK6A 1CZFA 2NSPA 2X6WA 1TYXA 4KH3A 4XMYA 3P4GA 1OGOX 2BM5A 2O17A 2BM7A 4I84A 2V5IA 1IDJA 3JURA 2J8KA 5JMCB 2QXZA 1LLZA 2VBMA 4EW9A 1HF2A 2EWEA 3ZPPA 2NT9A 3GQ7A 1O8KA 2O0VA 2VFNA 1KTWA 2X3HA 1PLUA 1O8LA 1O8FA 2F3LA 3SQVA 4XLHA 2NTPA 4XLAA 3UW0A 1OOCA 4XL9A 4YZQA 4PMHA 1QA3A 4YZAA 4XLFA 1LLWA 4YCQA 4Z03A 2W7ZA 4U4BA 1L1IA 4C2LA 2UVEA 2XC1A 2VFQA 2Z8GA 2G0YA 3SYJA 1QJVA 2VFPA 4XN0A 4XOPA 4AVZA 2O0WA 2XTWA 3VMVA 2PYHA 4Z05A 1TYUA 2INVA 3DU1X 3ML3A 3N90A 4V02C 4YEJA 4XN3A 4XORA 1H80A 3TH0A 4YZXA 1HG8A 4URRA 2O04A 2PYGA 1EE6A 1K8FA 2VJJA 3GRHA 4OJOA 3T9GA 1EA0A 3LMWA 2B0RA 3PETA 4W8QA 4HWVA 2NTQA 3PSSA 4XKVA 4MR0A 1X0CA 3VSTA 1EZGA 1QQ1A 1PXZA 2X6XA 4OPWA 4U49A 1OFMA 3NAWA 5DNSA 1K4ZA 4MXNA 3RIQA 3VSVA 3VSUA 1IB4A 1DBGA 1PE9A 3GQ8A 4XONA 1QRBA 2ODLA 3ZSCA 1O88A 3LJYA 2NTBA 4YZ0A 1BHEA 2XTXA 3KRGA 3LYCA 5AMVA 1RU4A 2QX3A 2XTYA 1DABA 3JX8A 2O1DA 2BSPA 4XQFA 3B4NA 2XT2A 4W8TA 4Z06A 5C1CA 5JLVC 1OFDA 4NK8A 1BN8A 3VMWA 2J8IA 2IQ7A 1TYWA 2XT4A 2X85A 2X6YA 1KCCA 1GQ8A 2QY1A 1KCDA 1JTAA 2BX6A 3PSZA 2PECA 4XLEA 1NHCA 2BM6A 4W8SA 2VJIA 1TYVA 1AIRA 2NT6A 2NSTA 1OFLA 1CLWA 1O8EA 1O8GA 2UVFA 3EQOA 2VFMA 1QCXA 3GQ9A 4XOTA 3SY2A 3EQNA 1JRGA 2O6WA 3B90A 1IA5A 1QA2A 1KQ5A 2IOUG 1O8JA 1QA1A 1O8MA 1RWRA 1XG2A 1QRCA
chains in the Genus database with same CATH topology
3FY3A 5C1EA 4OZYA 4XLCA 1K5CA 4OZZA 1DBOA 2VBEA 1OGMX 3WWGA 1O8HA 1RMGA 1IDKA 4XNFA 2INUA 1O8DA 4XR6A 4XM3A 1O8IA 1VBLA 1WMRA 4OJLA 4YELA 3SUCA 4W8RA 4OJ6A 3GQAA 4OJPA 2NZMA 4XKWA 4OJ5A 3B8YA 4NK6A 1CZFA 2NSPA 2X6WA 4XMYA 1OGOX 2O17A 4I84A 3JURA 1IDJA 2QXZA 2VBMA 4EW9A 2EWEA 3ZPPA 2NT9A 3GQ7A 1O8KA 2O0VA 1KTWA 2X3HA 1PLUA 1O8LA 1O8FA 3UW0A 4XLHA 2NTPA 4XLAA 1OOCA 4XL9A 4YZQA 4PMHA 4YZAA 4XLFA 4Z03A 4U4BA 4C2LA 2UVEA 2Z8GA 1QJVA 4XOPA 4XN0A 4AVZA 2O0WA 3VMVA 2PYHA 4Z05A 2INVA 4YEJA 4XN3A 4XORA 1H80A 4YZXA 1HG8A 4URRA 2O04A 2PYGA 1EE6A 2VJJA 3GRHA 4OJOA 3T9GA 3LMWA 4W8QA 4HWVA 2NTQA 4XKVA 4MR0A 1X0CA 3VSTA 2X6XA 1PXZA 4U49A 3VSUA 1OFMA 4MXNA 1IB4A 3VSVA 1DBGA 1PE9A 3GQ8A 4XONA 3ZSCA 1O88A 2NTBA 4YZ0A 1BHEA 3KRGA 5AMVA 1RU4A 2QX3A 1O8MA 2O1DA 2BSPA 4XQFA 3B4NA 4W8TA 4Z06A 5C1CA 4NK8A 1BN8A 3VMWA 2IQ7A 2X85A 2X6YA 1KCCA 1GQ8A 2QY1A 1KCDA 1JTAA 2PECA 4XLEA 1NHCA 4W8SA 2VJIA 1AIRA 2NT6A 2NSTA 1OFLA 1O8GA 1O8EA 2UVFA 3EQOA 1QCXA 3GQ9A 4XOTA 3EQNA 1JRGA 3B90A 1IA5A 1O8JA 2VBKA 1RWRA 1XG2A 2ODLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FY3 A;  5C1E A;  4OZY A;  4XLC A;  1K5C A;  4OZZ A;  1DBO A;  2VBE A;  1OGM X;  3WWG A;  1O8H A;  1RMG A;  1IDK A;  4XNF A;  2INU A;  1O8D A;  4XR6 A;  4XM3 A;  1O8I A;  1VBL A;  1WMR A;  4OJL A;  4YEL A;  3SUC A;  4W8R A;  4OJ6 A;  3GQA A;  4OJP A;  2NZM A;  4XKW A;  4OJ5 A;  3B8Y A;  4NK6 A;  1CZF A;  2NSP A;  2X6W A;  4XMY A;  1OGO X;  2O17 A;  4I84 A;  3JUR A;  1IDJ A;  2QXZ A;  2VBM A;  4EW9 A;  2EWE A;  3ZPP A;  2NT9 A;  3GQ7 A;  1O8K A;  2O0V A;  1KTW A;  2X3H A;  1PLU A;  1O8L A;  1O8F A;  3UW0 A;  4XLH A;  2NTP A;  4XLA A;  1OOC A;  4XL9 A;  4YZQ A;  4PMH A;  4YZA A;  4XLF A;  4Z03 A;  4U4B A;  4C2L A;  2UVE A;  2Z8G A;  1QJV A;  4XOP A;  4XN0 A;  4AVZ A;  2O0W A;  3VMV A;  2PYH A;  4Z05 A;  2INV A;  4YEJ A;  4XN3 A;  4XOR A;  1H80 A;  4YZX A;  1HG8 A;  4URR A;  2O04 A;  2PYG A;  1EE6 A;  2VJJ A;  3GRH A;  4OJO A;  3T9G A;  3LMW A;  4W8Q A;  4HWV A;  2NTQ A;  4XKV A;  4MR0 A;  1X0C A;  3VST A;  2X6X A;  1PXZ A;  4U49 A;  3VSU A;  1OFM A;  4MXN A;  1IB4 A;  3VSV A;  1DBG A;  1PE9 A;  3GQ8 A;  4XON A;  3ZSC A;  1O88 A;  2NTB A;  4YZ0 A;  1BHE A;  3KRG A;  5AMV A;  1RU4 A;  2QX3 A;  1O8M A;  2O1D A;  2BSP A;  4XQF A;  3B4N A;  4W8T A;  4Z06 A;  5C1C A;  4NK8 A;  1BN8 A;  3VMW A;  2IQ7 A;  2X85 A;  2X6Y A;  1KCC A;  1GQ8 A;  2QY1 A;  1KCD A;  1JTA A;  2PEC A;  4XLE A;  1NHC A;  4W8S A;  2VJI A;  1AIR A;  2NT6 A;  2NST A;  1OFL A;  1O8G A;  1O8E A;  2UVF A;  3EQO A;  1QCX A;  3GQ9 A;  4XOT A;  3EQN A;  1JRG A;  3B90 A;  1IA5 A;  1O8J A;  2VBK A;  1RWR A;  1XG2 A;  2ODL A; 
#chains in the Genus database with same CATH topology
 4YDT A;  3FY3 A;  5C1E A;  4OZY A;  4XLC A;  1K5C A;  4OZZ A;  1DBO A;  2VBE A;  1OGM X;  1TSP A;  1WXR A;  3H09 A;  2VFO A;  3WWG A;  3BH7 B;  1O8H A;  1RMG A;  1IDK A;  4XNF A;  2QYU A;  2INU A;  1O8D A;  3BH6 B;  4XR6 A;  4XM3 A;  1O8I A;  1VBL A;  2YUH A;  1WMR A;  4OJL A;  4YFO A;  4YEL A;  3SUC A;  4W8R A;  4OJ6 A;  2QZA A;  3SZE A;  1LM1 A;  3GQA A;  4YEI A;  3N6Z A;  4YC5 A;  3AK5 A;  4OJP A;  2NZM A;  2VBK A;  2BM4 A;  4JRA C;  1OFE A;  4XKW A;  4OM9 A;  3NB2 A;  4OJ5 A;  3B8Y A;  4NK6 A;  1CZF A;  2NSP A;  2X6W A;  1TYX A;  4KH3 A;  4XMY A;  3P4G A;  1OGO X;  2BM5 A;  2O17 A;  2BM7 A;  4I84 A;  2V5I A;  1IDJ A;  3JUR A;  2J8K A;  5JMC B;  2QXZ A;  1LLZ A;  2VBM A;  4EW9 A;  1HF2 A;  2EWE A;  3ZPP A;  2NT9 A;  3GQ7 A;  1O8K A;  2O0V A;  2VFN A;  1KTW A;  2X3H A;  1PLU A;  1O8L A;  1O8F A;  2F3L A;  3SQV A;  4XLH A;  2NTP A;  4XLA A;  3UW0 A;  1OOC A;  4XL9 A;  4YZQ A;  4PMH A;  1QA3 A;  4YZA A;  4XLF A;  1LLW A;  4YCQ A;  4Z03 A;  2W7Z A;  4U4B A;  1L1I A;  4C2L A;  2UVE A;  2XC1 A;  2VFQ A;  2Z8G A;  2G0Y A;  3SYJ A;  1QJV A;  2VFP A;  4XN0 A;  4XOP A;  4AVZ A;  2O0W A;  2XTW A;  3VMV A;  2PYH A;  4Z05 A;  1TYU A;  2INV A;  3DU1 X;  3ML3 A;  3N90 A;  4V02 C;  4YEJ A;  4XN3 A;  4XOR A;  1H80 A;  3TH0 A;  4YZX A;  1HG8 A;  4URR A;  2O04 A;  2PYG A;  1EE6 A;  1K8F A;  2VJJ A;  3GRH A;  4OJO A;  3T9G A;  1EA0 A;  3LMW A;  2B0R A;  3PET A;  4W8Q A;  4HWV A;  2NTQ A;  3PSS A;  4XKV A;  4MR0 A;  1X0C A;  3VST A;  1EZG A;  1QQ1 A;  1PXZ A;  2X6X A;  4OPW A;  4U49 A;  1OFM A;  3NAW A;  5DNS A;  1K4Z A;  4MXN A;  3RIQ A;  3VSV A;  3VSU A;  1IB4 A;  1DBG A;  1PE9 A;  3GQ8 A;  4XON A;  1QRB A;  2ODL A;  3ZSC A;  1O88 A;  3LJY A;  2NTB A;  4YZ0 A;  1BHE A;  2XTX A;  3KRG A;  3LYC A;  5AMV A;  1RU4 A;  2QX3 A;  2XTY A;  1DAB A;  3JX8 A;  2O1D A;  2BSP A;  4XQF A;  3B4N A;  2XT2 A;  4W8T A;  4Z06 A;  5C1C A;  5JLV C;  1OFD A;  4NK8 A;  1BN8 A;  3VMW A;  2J8I A;  2IQ7 A;  1TYW A;  2XT4 A;  2X85 A;  2X6Y A;  1KCC A;  1GQ8 A;  2QY1 A;  1KCD A;  1JTA A;  2BX6 A;  3PSZ A;  2PEC A;  4XLE A;  1NHC A;  2BM6 A;  4W8S A;  2VJI A;  1TYV A;  1AIR A;  2NT6 A;  2NST A;  1OFL A;  1CLW A;  1O8E A;  1O8G A;  2UVF A;  3EQO A;  2VFM A;  1QCX A;  3GQ9 A;  4XOT A;  3SY2 A;  3EQN A;  1JRG A;  2O6W A;  3B90 A;  1IA5 A;  1QA2 A;  1KQ5 A;  2IOU G;  1O8J A;  1QA1 A;  1O8M A;  1RWR A;  1XG2 A;  1QRC A; 
#chains in the Genus database with same CATH homology
 3FY3 A;  5C1E A;  4OZY A;  4XLC A;  1K5C A;  4OZZ A;  1DBO A;  2VBE A;  1OGM X;  3WWG A;  1O8H A;  1RMG A;  1IDK A;  4XNF A;  2INU A;  1O8D A;  4XR6 A;  4XM3 A;  1O8I A;  1VBL A;  1WMR A;  4OJL A;  4YEL A;  3SUC A;  4W8R A;  4OJ6 A;  3GQA A;  4OJP A;  2NZM A;  4XKW A;  4OJ5 A;  3B8Y A;  4NK6 A;  1CZF A;  2NSP A;  2X6W A;  4XMY A;  1OGO X;  2O17 A;  4I84 A;  3JUR A;  1IDJ A;  2QXZ A;  2VBM A;  4EW9 A;  2EWE A;  3ZPP A;  2NT9 A;  3GQ7 A;  1O8K A;  2O0V A;  1KTW A;  2X3H A;  1PLU A;  1O8L A;  1O8F A;  3UW0 A;  4XLH A;  2NTP A;  4XLA A;  1OOC A;  4XL9 A;  4YZQ A;  4PMH A;  4YZA A;  4XLF A;  4Z03 A;  4U4B A;  4C2L A;  2UVE A;  2Z8G A;  1QJV A;  4XOP A;  4XN0 A;  4AVZ A;  2O0W A;  3VMV A;  2PYH A;  4Z05 A;  2INV A;  4YEJ A;  4XN3 A;  4XOR A;  1H80 A;  4YZX A;  1HG8 A;  4URR A;  2O04 A;  2PYG A;  1EE6 A;  2VJJ A;  3GRH A;  4OJO A;  3T9G A;  3LMW A;  4W8Q A;  4HWV A;  2NTQ A;  4XKV A;  4MR0 A;  1X0C A;  3VST A;  2X6X A;  1PXZ A;  4U49 A;  3VSU A;  1OFM A;  4MXN A;  1IB4 A;  3VSV A;  1DBG A;  1PE9 A;  3GQ8 A;  4XON A;  3ZSC A;  1O88 A;  2NTB A;  4YZ0 A;  1BHE A;  3KRG A;  5AMV A;  1RU4 A;  2QX3 A;  1O8M A;  2O1D A;  2BSP A;  4XQF A;  3B4N A;  4W8T A;  4Z06 A;  5C1C A;  4NK8 A;  1BN8 A;  3VMW A;  2IQ7 A;  2X85 A;  2X6Y A;  1KCC A;  1GQ8 A;  2QY1 A;  1KCD A;  1JTA A;  2PEC A;  4XLE A;  1NHC A;  4W8S A;  2VJI A;  1AIR A;  2NT6 A;  2NST A;  1OFL A;  1O8G A;  1O8E A;  2UVF A;  3EQO A;  1QCX A;  3GQ9 A;  4XOT A;  3EQN A;  1JRG A;  3B90 A;  1IA5 A;  1O8J A;  2VBK A;  1RWR A;  1XG2 A;  2ODL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...