1NHCA

Structural insights into the processivity of endopolygalacturonase i from aspergillus niger
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
336
structure length
336
Chain Sequence
STCTFTSASEASESISSCSDVVLSSIEVPAGETLDLSDAADGSTITFEGTTSFGYKEWKGPLIRFGGKDLTVTMADGAVIDGDGSRWWDSKGTNGGKTKPKFMYIHDVEDSTFKGINIKNTPVQAISVQATNVHLNDFTIDNSDGDDNGGHNTDGFDISESTGVYISGATVKNQDDCIAINSGESISFTGGTCSGGHGLSIGSVGGRDDNTVKNVTISDSTVSNSANGVRIKTIYKETGDVSEITYSNIQLSGITDYGIVIEQDYENGSPTGTPSTGIPITDVTVDGVTGTLEDDATQVYILCGDGSCSDWTWSGVDLSGGKTSDKCENVPSGASC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords Polygalacturonase I
total genus 127
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2002-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1nhcA00
3EQOA 3B4NA 4OZZA 1DBGA 2QXZA 2NSPA 1O8HA 2NTPA 4EW9A 1EE6A 1HG8A 4XL9A 4OJLA 2INUA 1IDJA 2NSTA 1GQ8A 4XLFA 4XLEA 5C1EA 1WMRA 1QJVA 4XONA 2NZMA 4XNFA 2VBEA 3VMWA 1O8EA 4URRA 2BSPA 3T9GA 1PLUA 4XOTA 1IDKA 2PECA 1X0CA 3GQ7A 1JTAA 4YZAA 1CZFA 4XM3A 1KTWA 4I84A 1O8JA 1BHEA 1PE9A 2VJIA 3GQ9A 3ZSCA 5AMVA 4OJ6A 1O8GA 2X6WA 4XORA 4OJOA 3UW0A 3GRHA 3WWGA 1OGOX 1XG2A 2O0VA 2X6XA 3LMWA 1AIRA 4XKWA 1RU4A 2O04A 3EQNA 1RWRA 3FY3A 1NHCA 4HWVA 3B8YA 2EWEA 3GQAA 4MXNA 3VSVA 1IA5A 3VSUA 1BN8A 1O8LA 4OJ5A 1VBLA 1H80A 1O8FA 4XN0A 2PYHA 2QY1A 1O8DA 1QCXA 3B90A 4W8RA 1OFLA 3JURA 2VBKA 1KCDA 2NTQA 4XN3A 1O8MA 3KRGA 3ZPPA 1O8IA 4PMHA 4XLAA 4W8QA 2PYGA 2X3HA 1RMGA 1K5CA 5C1CA 4Z05A 2IQ7A 1O8KA 4YEJA 1DBOA 4NK8A 4YZ0A 1O88A 2QX3A 4XQFA 2NT6A 4YZQA 2O0WA 4XR6A 2NTBA 2X85A 2INVA 4NK6A 4YZXA 4Z03A 2ODLA 4U49A 2Z8GA 2NT9A 4XLHA 4U4BA 4YELA 1PXZA 2UVEA 4MR0A 2UVFA 1OFMA 4OJPA 3VMVA 1IB4A 1JRGA 2O1DA 4XOPA 3SUCA 4C2LA 4XLCA 4AVZA 4Z06A 1KCCA 4W8TA 3GQ8A 2VJJA 2O17A 1OOCA 2X6YA 4OZYA 4XKVA 1OGMX 2VBMA 3VSTA 4W8SA 4XMYA
chains in the Genus database with same CATH superfamily
3EQOA 3B4NA 4OZZA 1DBGA 2F3LA 1QRCA 2BM5A 2QXZA 2VFMA 1L1IA 2NSPA 2XTXA 2XT4A 1O8HA 2NTPA 4EW9A 1EE6A 1HG8A 3SQVA 1TYXA 4OJLA 4XL9A 2INUA 1IDJA 3JX8A 2NSTA 1GQ8A 2XTWA 4XLFA 4XLEA 1EZGA 5C1EA 2BM6A 1WMRA 1QJVA 1DABA 2V5IA 4XONA 2NZMA 3SZEA 4XNFA 2VBEA 3BH7B 5JMCB 4W8SA 1O8EA 1LLWA 2W7ZA 1TSPA 4URRA 2G0YA 3VMWA 2BSPA 3T9GA 1PLUA 4XOTA 3SY2A 1KQ5A 1IDKA 2PECA 1X0CA 3GQ7A 1JTAA 4YZAA 1CZFA 4XM3A 1KTWA 2BM7A 3PSZA 4I84A 1O8JA 1EA0A 1BHEA 1PE9A 2VJIA 3GQ9A 3ML3A 3ZSCA 5AMVA 2O6WA 4OJ6A 1O8GA 2X6WA 2VFOA 4XORA 1K8FA 4OJOA 3UW0A 3GRHA 3WWGA 4OPWA 1OGOX 1XG2A 2O0VA 2X6XA 3LMWA 1AIRA 1QA2A 2IOUG 4XKWA 1RU4A 2O04A 3EQNA 1RWRA 3FY3A 1NHCA 4HWVA 3B8YA 3N90A 2EWEA 2B0RA 2VFQA 3GQAA 4MXNA 2BX6A 3H09A 1BN8A 4V02C 3VSVA 3VSUA 1O8LA 4OJ5A 1VBLA 1H80A 1O8FA 5DNSA 4XN0A 2PYHA 2QY1A 1O8DA 2BM4A 1QCXA 2VFNA 3B90A 4W8RA 1OFLA 3LYCA 3JURA 1TYWA 2VBKA 3SYJA 3PSSA 3BH6B 2XT2A 1TYUA 2NTQA 4XN3A 1O8MA 3KRGA 3ZPPA 1KCDA 1O8IA 3N6ZA 4PMHA 2XC1A 4KH3A 4XLAA 1HF2A 1LLZA 2J8KA 4W8QA 2PYGA 2X3HA 1RMGA 1K5CA 5C1CA 3DU1X 2VFPA 3AK5A 4Z05A 1OFEA 2IQ7A 1O8KA 4YEJA 1DBOA 1OFDA 4NK8A 3LJYA 4YZ0A 1O88A 2QX3A 4XQFA 3NB2A 2NT6A 4YZQA 2O0WA 3TH0A 4YEIA 4XR6A 2NTBA 2X85A 2INVA 4NK6A 4YZXA 4Z03A 2ODLA 3PETA 4U49A 2NT9A 2Z8GA 4XLHA 2J8IA 2QZAA 4U4BA 4YELA 1PXZA 4JRAC 1K4ZA 2UVEA 1QRBA 4MR0A 3P4GA 2UVFA 4YDTA 1OFMA 4OJPA 1CLWA 3VMVA 1IB4A 4YCQA 1WXRA 1JRGA 2O1DA 4XOPA 3SUCA 4OM9A 2YUHA 1TYVA 4C2LA 4XLCA 4AVZA 1QA3A 4Z06A 3NAWA 4W8TA 3GQ8A 5JLVC 2VJJA 1KCCA 2O17A 3RIQA 1QA1A 1OOCA 4YC5A 4YFOA 2X6YA 4OZYA 4XKVA 1OGMX 2VBMA 3VSTA 1IA5A 1LM1A 2QYUA 2XTYA 1QQ1A 4XMYA
chains in the Genus database with same CATH topology
3EQOA 3B4NA 4OZZA 1DBGA 2QXZA 2NSPA 1O8HA 2NTPA 4EW9A 1EE6A 1HG8A 4XL9A 4OJLA 2INUA 1IDJA 2NSTA 1GQ8A 4XLFA 4XLEA 5C1EA 1WMRA 1QJVA 4XONA 2NZMA 4XNFA 2VBEA 3VMWA 1O8EA 4URRA 2BSPA 3T9GA 1PLUA 4XOTA 1IDKA 2PECA 1X0CA 3GQ7A 1JTAA 4YZAA 1CZFA 4XM3A 1KTWA 4I84A 1O8JA 1BHEA 1PE9A 2VJIA 3GQ9A 3ZSCA 5AMVA 4OJ6A 1O8GA 2X6WA 4XORA 4OJOA 3UW0A 3GRHA 3WWGA 1OGOX 1XG2A 2O0VA 2X6XA 3LMWA 1AIRA 4XKWA 1RU4A 2O04A 3EQNA 1RWRA 3FY3A 1NHCA 4HWVA 3B8YA 2EWEA 3GQAA 4MXNA 3VSVA 1IA5A 3VSUA 1BN8A 1O8LA 4OJ5A 1VBLA 1H80A 1O8FA 4XN0A 2PYHA 2QY1A 1O8DA 1QCXA 3B90A 4W8RA 1OFLA 3JURA 2VBKA 1KCDA 2NTQA 4XN3A 1O8MA 3KRGA 3ZPPA 1O8IA 4PMHA 4XLAA 4W8QA 2PYGA 2X3HA 1RMGA 1K5CA 5C1CA 4Z05A 2IQ7A 1O8KA 4YEJA 1DBOA 4NK8A 4YZ0A 1O88A 2QX3A 4XQFA 2NT6A 4YZQA 2O0WA 4XR6A 2NTBA 2X85A 2INVA 4NK6A 4YZXA 4Z03A 2ODLA 4U49A 2Z8GA 2NT9A 4XLHA 4U4BA 4YELA 1PXZA 2UVEA 4MR0A 2UVFA 1OFMA 4OJPA 3VMVA 1IB4A 1JRGA 2O1DA 4XOPA 3SUCA 4C2LA 4XLCA 4AVZA 4Z06A 1KCCA 4W8TA 3GQ8A 2VJJA 2O17A 1OOCA 2X6YA 4OZYA 4XKVA 1OGMX 2VBMA 3VSTA 4W8SA 4XMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQO A;  3B4N A;  4OZZ A;  1DBG A;  2QXZ A;  2NSP A;  1O8H A;  2NTP A;  4EW9 A;  1EE6 A;  1HG8 A;  4XL9 A;  4OJL A;  2INU A;  1IDJ A;  2NST A;  1GQ8 A;  4XLF A;  4XLE A;  5C1E A;  1WMR A;  1QJV A;  4XON A;  2NZM A;  4XNF A;  2VBE A;  3VMW A;  1O8E A;  4URR A;  2BSP A;  3T9G A;  1PLU A;  4XOT A;  1IDK A;  2PEC A;  1X0C A;  3GQ7 A;  1JTA A;  4YZA A;  1CZF A;  4XM3 A;  1KTW A;  4I84 A;  1O8J A;  1BHE A;  1PE9 A;  2VJI A;  3GQ9 A;  3ZSC A;  5AMV A;  4OJ6 A;  1O8G A;  2X6W A;  4XOR A;  4OJO A;  3UW0 A;  3GRH A;  3WWG A;  1OGO X;  1XG2 A;  2O0V A;  2X6X A;  3LMW A;  1AIR A;  4XKW A;  1RU4 A;  2O04 A;  3EQN A;  1RWR A;  3FY3 A;  1NHC A;  4HWV A;  3B8Y A;  2EWE A;  3GQA A;  4MXN A;  3VSV A;  1IA5 A;  3VSU A;  1BN8 A;  1O8L A;  4OJ5 A;  1VBL A;  1H80 A;  1O8F A;  4XN0 A;  2PYH A;  2QY1 A;  1O8D A;  1QCX A;  3B90 A;  4W8R A;  1OFL A;  3JUR A;  2VBK A;  1KCD A;  2NTQ A;  4XN3 A;  1O8M A;  3KRG A;  3ZPP A;  1O8I A;  4PMH A;  4XLA A;  4W8Q A;  2PYG A;  2X3H A;  1RMG A;  1K5C A;  5C1C A;  4Z05 A;  2IQ7 A;  1O8K A;  4YEJ A;  1DBO A;  4NK8 A;  4YZ0 A;  1O88 A;  2QX3 A;  4XQF A;  2NT6 A;  4YZQ A;  2O0W A;  4XR6 A;  2NTB A;  2X85 A;  2INV A;  4NK6 A;  4YZX A;  4Z03 A;  2ODL A;  4U49 A;  2Z8G A;  2NT9 A;  4XLH A;  4U4B A;  4YEL A;  1PXZ A;  2UVE A;  4MR0 A;  2UVF A;  1OFM A;  4OJP A;  3VMV A;  1IB4 A;  1JRG A;  2O1D A;  4XOP A;  3SUC A;  4C2L A;  4XLC A;  4AVZ A;  4Z06 A;  1KCC A;  4W8T A;  3GQ8 A;  2VJJ A;  2O17 A;  1OOC A;  2X6Y A;  4OZY A;  4XKV A;  1OGM X;  2VBM A;  3VST A;  4W8S A;  4XMY A; 
#chains in the Genus database with same CATH topology
 3EQO A;  3B4N A;  4OZZ A;  1DBG A;  2F3L A;  1QRC A;  2BM5 A;  2QXZ A;  2VFM A;  1L1I A;  2NSP A;  2XTX A;  2XT4 A;  1O8H A;  2NTP A;  4EW9 A;  1EE6 A;  1HG8 A;  3SQV A;  1TYX A;  4OJL A;  4XL9 A;  2INU A;  1IDJ A;  3JX8 A;  2NST A;  1GQ8 A;  2XTW A;  4XLF A;  4XLE A;  1EZG A;  5C1E A;  2BM6 A;  1WMR A;  1QJV A;  1DAB A;  2V5I A;  4XON A;  2NZM A;  3SZE A;  4XNF A;  2VBE A;  3BH7 B;  5JMC B;  4W8S A;  1O8E A;  1LLW A;  2W7Z A;  1TSP A;  4URR A;  2G0Y A;  3VMW A;  2BSP A;  3T9G A;  1PLU A;  4XOT A;  3SY2 A;  1KQ5 A;  1IDK A;  2PEC A;  1X0C A;  3GQ7 A;  1JTA A;  4YZA A;  1CZF A;  4XM3 A;  1KTW A;  2BM7 A;  3PSZ A;  4I84 A;  1O8J A;  1EA0 A;  1BHE A;  1PE9 A;  2VJI A;  3GQ9 A;  3ML3 A;  3ZSC A;  5AMV A;  2O6W A;  4OJ6 A;  1O8G A;  2X6W A;  2VFO A;  4XOR A;  1K8F A;  4OJO A;  3UW0 A;  3GRH A;  3WWG A;  4OPW A;  1OGO X;  1XG2 A;  2O0V A;  2X6X A;  3LMW A;  1AIR A;  1QA2 A;  2IOU G;  4XKW A;  1RU4 A;  2O04 A;  3EQN A;  1RWR A;  3FY3 A;  1NHC A;  4HWV A;  3B8Y A;  3N90 A;  2EWE A;  2B0R A;  2VFQ A;  3GQA A;  4MXN A;  2BX6 A;  3H09 A;  1BN8 A;  4V02 C;  3VSV A;  3VSU A;  1O8L A;  4OJ5 A;  1VBL A;  1H80 A;  1O8F A;  5DNS A;  4XN0 A;  2PYH A;  2QY1 A;  1O8D A;  2BM4 A;  1QCX A;  2VFN A;  3B90 A;  4W8R A;  1OFL A;  3LYC A;  3JUR A;  1TYW A;  2VBK A;  3SYJ A;  3PSS A;  3BH6 B;  2XT2 A;  1TYU A;  2NTQ A;  4XN3 A;  1O8M A;  3KRG A;  3ZPP A;  1KCD A;  1O8I A;  3N6Z A;  4PMH A;  2XC1 A;  4KH3 A;  4XLA A;  1HF2 A;  1LLZ A;  2J8K A;  4W8Q A;  2PYG A;  2X3H A;  1RMG A;  1K5C A;  5C1C A;  3DU1 X;  2VFP A;  3AK5 A;  4Z05 A;  1OFE A;  2IQ7 A;  1O8K A;  4YEJ A;  1DBO A;  1OFD A;  4NK8 A;  3LJY A;  4YZ0 A;  1O88 A;  2QX3 A;  4XQF A;  3NB2 A;  2NT6 A;  4YZQ A;  2O0W A;  3TH0 A;  4YEI A;  4XR6 A;  2NTB A;  2X85 A;  2INV A;  4NK6 A;  4YZX A;  4Z03 A;  2ODL A;  3PET A;  4U49 A;  2NT9 A;  2Z8G A;  4XLH A;  2J8I A;  2QZA A;  4U4B A;  4YEL A;  1PXZ A;  4JRA C;  1K4Z A;  2UVE A;  1QRB A;  4MR0 A;  3P4G A;  2UVF A;  4YDT A;  1OFM A;  4OJP A;  1CLW A;  3VMV A;  1IB4 A;  4YCQ A;  1WXR A;  1JRG A;  2O1D A;  4XOP A;  3SUC A;  4OM9 A;  2YUH A;  1TYV A;  4C2L A;  4XLC A;  4AVZ A;  1QA3 A;  4Z06 A;  3NAW A;  4W8T A;  3GQ8 A;  5JLV C;  2VJJ A;  1KCC A;  2O17 A;  3RIQ A;  1QA1 A;  1OOC A;  4YC5 A;  4YFO A;  2X6Y A;  4OZY A;  4XKV A;  1OGM X;  2VBM A;  3VST A;  1IA5 A;  1LM1 A;  2QYU A;  2XTY A;  1QQ1 A;  4XMY A; 
#chains in the Genus database with same CATH homology
 3EQO A;  3B4N A;  4OZZ A;  1DBG A;  2QXZ A;  2NSP A;  1O8H A;  2NTP A;  4EW9 A;  1EE6 A;  1HG8 A;  4XL9 A;  4OJL A;  2INU A;  1IDJ A;  2NST A;  1GQ8 A;  4XLF A;  4XLE A;  5C1E A;  1WMR A;  1QJV A;  4XON A;  2NZM A;  4XNF A;  2VBE A;  3VMW A;  1O8E A;  4URR A;  2BSP A;  3T9G A;  1PLU A;  4XOT A;  1IDK A;  2PEC A;  1X0C A;  3GQ7 A;  1JTA A;  4YZA A;  1CZF A;  4XM3 A;  1KTW A;  4I84 A;  1O8J A;  1BHE A;  1PE9 A;  2VJI A;  3GQ9 A;  3ZSC A;  5AMV A;  4OJ6 A;  1O8G A;  2X6W A;  4XOR A;  4OJO A;  3UW0 A;  3GRH A;  3WWG A;  1OGO X;  1XG2 A;  2O0V A;  2X6X A;  3LMW A;  1AIR A;  4XKW A;  1RU4 A;  2O04 A;  3EQN A;  1RWR A;  3FY3 A;  1NHC A;  4HWV A;  3B8Y A;  2EWE A;  3GQA A;  4MXN A;  3VSV A;  1IA5 A;  3VSU A;  1BN8 A;  1O8L A;  4OJ5 A;  1VBL A;  1H80 A;  1O8F A;  4XN0 A;  2PYH A;  2QY1 A;  1O8D A;  1QCX A;  3B90 A;  4W8R A;  1OFL A;  3JUR A;  2VBK A;  1KCD A;  2NTQ A;  4XN3 A;  1O8M A;  3KRG A;  3ZPP A;  1O8I A;  4PMH A;  4XLA A;  4W8Q A;  2PYG A;  2X3H A;  1RMG A;  1K5C A;  5C1C A;  4Z05 A;  2IQ7 A;  1O8K A;  4YEJ A;  1DBO A;  4NK8 A;  4YZ0 A;  1O88 A;  2QX3 A;  4XQF A;  2NT6 A;  4YZQ A;  2O0W A;  4XR6 A;  2NTB A;  2X85 A;  2INV A;  4NK6 A;  4YZX A;  4Z03 A;  2ODL A;  4U49 A;  2Z8G A;  2NT9 A;  4XLH A;  4U4B A;  4YEL A;  1PXZ A;  2UVE A;  4MR0 A;  2UVF A;  1OFM A;  4OJP A;  3VMV A;  1IB4 A;  1JRG A;  2O1D A;  4XOP A;  3SUC A;  4C2L A;  4XLC A;  4AVZ A;  4Z06 A;  1KCC A;  4W8T A;  3GQ8 A;  2VJJ A;  2O17 A;  1OOC A;  2X6Y A;  4OZY A;  4XKV A;  1OGM X;  2VBM A;  3VST A;  4W8S A;  4XMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...