1NHCA

Structural insights into the processivity of endopolygalacturonase i from aspergillus niger
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
336
structure length
336
Chain Sequence
STCTFTSASEASESISSCSDVVLSSIEVPAGETLDLSDAADGSTITFEGTTSFGYKEWKGPLIRFGGKDLTVTMADGAVIDGDGSRWWDSKGTNGGKTKPKFMYIHDVEDSTFKGINIKNTPVQAISVQATNVHLNDFTIDNSDGDDNGGHNTDGFDISESTGVYISGATVKNQDDCIAINSGESISFTGGTCSGGHGLSIGSVGGRDDNTVKNVTISDSTVSNSANGVRIKTIYKETGDVSEITYSNIQLSGITDYGIVIEQDYENGSPTGTPSTGIPITDVTVDGVTGTLEDDATQVYILCGDGSCSDWTWSGVDLSGGKTSDKCENVPSGASC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polygalacturonase I
publication title Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 127
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2002-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1nhcA00
1QCXA 1CZFA 2NT9A 3B90A 3EQOA 4C2LA 1OGOX 2BSPA 2X85A 1K5CA 4W8SA 2O17A 3VMWA 1O8DA 1KCDA 5C1CA 1PE9A 4W8QA 3KRGA 3VMVA 2O1DA 1IDJA 1DBOA 1XG2A 1PXZA 4XONA 1BHEA 1PLUA 3B8YA 1KTWA 3JURA 1AIRA 4XN3A 4HWVA 1OOCA 4YELA 4OJOA 4U49A 1O8GA 4I84A 4YZAA 3B4NA 1QJVA 4W8TA 4XOPA 2X3HA 4XKWA 4XQFA 2EWEA 4PMHA 4XOTA 1NHCA 1OFMA 1IA5A 2IQ7A 1O8MA 4OJ5A 4URRA 2O0WA 2QXZA 2X6XA 1RU4A 1OFLA 1EE6A 3VSTA 1IB4A 3EQNA 1HG8A 4W8RA 3VSVA 4XL9A 1IDKA 4OJLA 4OZYA 4XORA 1GQ8A 3WWGA 2NZMA 2PECA 1BN8A 4XLFA 1O8IA 4OJPA 2VBEA 4YZXA 3UW0A 4YZ0A 2PYGA 1O8KA 4YZQA 2INVA 3ZSCA 1DBGA 3FY3A 4NK8A 2NTBA 3GQ9A 1O8LA 2O0VA 4XLHA 1JTAA 4Z03A 2QY1A 4XLAA 2UVEA 4OZZA 4XNFA 2INUA 4XN0A 3SUCA 4XMYA 4YEJA 2VBMA 1JRGA 1O8JA 1O8EA 4OJ6A 1O8HA 1OGMX 3GQ8A 2NTQA 2NSTA 2NT6A 1RWRA 4Z06A 3GRHA 2O04A 2VBKA 4XR6A 1O88A 2X6WA 1WMRA 2QX3A 1KCCA 2VJIA 2UVFA 2NTPA 4XLCA 1X0CA 4AVZA 2NSPA 4NK6A 4XLEA 1O8FA 4Z05A 2X6YA 3ZPPA 2Z8GA 4XM3A 3VSUA 2ODLA 4EW9A 4MXNA 3T9GA 3LMWA 2VJJA 1RMGA 4XKVA 1H80A 3GQAA 4U4BA 3GQ7A 5AMVA 1VBLA 4MR0A 5C1EA 2PYHA
chains in the Genus database with same CATH superfamily
1QCXA 3PSSA 1TYUA 1CZFA 2BM5A 2NT9A 3B90A 3EQOA 4OM9A 2YUHA 4C2LA 1OGOX 2BSPA 2X85A 1K5CA 2XTXA 4W8SA 2O17A 4YDTA 3VMWA 2VFMA 1O8DA 1KCDA 2G0YA 2XC1A 5C1CA 1KQ5A 1PE9A 4W8QA 2QYUA 3SZEA 4V02C 3KRGA 3VMVA 1QA3A 2O1DA 2XT4A 3LJYA 1IDJA 1DBOA 1XG2A 3N6ZA 1PXZA 4XONA 1K8FA 2J8IA 1BHEA 1PLUA 1TYWA 3B8YA 1KTWA 1CLWA 3JURA 1AIRA 4XN3A 4HWVA 1OFEA 1OOCA 4YELA 4OJOA 3DU1X 2IOUG 4U49A 1O8GA 4I84A 3BH6B 4YZAA 3B4NA 1QJVA 2XT2A 4W8TA 4XOPA 4YEIA 2X3HA 3NAWA 1EZGA 4XKWA 2O6WA 1EA0A 4XQFA 2EWEA 3JX8A 4PMHA 3N90A 4XOTA 1NHCA 1OFMA 2VFOA 3SYJA 1QRCA 1IA5A 2IQ7A 1O8MA 4OJ5A 4URRA 2O0WA 2QXZA 2X6XA 1RU4A 1OFLA 1EE6A 3VSTA 1IB4A 3EQNA 1HG8A 1DABA 4W8RA 3VSVA 3H09A 1QRBA 4XL9A 1IDKA 2F3LA 3LYCA 3NB2A 4OJLA 1L1IA 4OZYA 3BH7B 1QA2A 4XORA 1GQ8A 3WWGA 1OFDA 2B0RA 2NZMA 3RIQA 4KH3A 2PECA 2J8KA 4YFOA 1BN8A 3P4GA 4XLFA 5JLVC 1O8IA 4OJPA 1WXRA 2VBEA 4YZXA 3UW0A 4YZ0A 2PYGA 1O8KA 2BX6A 4YZQA 2INVA 3ZSCA 1DBGA 3ML3A 3FY3A 4NK8A 2NTBA 3GQ9A 1K4ZA 1O8LA 1QA1A 4OPWA 2XTWA 2O0VA 1LM1A 2V5IA 4XLHA 5DNSA 1JTAA 4Z03A 2QY1A 4XLAA 2UVEA 4OZZA 4XNFA 2INUA 4XN0A 3TH0A 3SUCA 3PSZA 4XMYA 4YEJA 2VBMA 1JRGA 1O8JA 1O8EA 2VFPA 3SQVA 4OJ6A 1O8HA 3SY2A 1OGMX 3GQ8A 2NTQA 2NSTA 2NT6A 1RWRA 4Z06A 2VFNA 3GRHA 2O04A 1QQ1A 2VBKA 1TYXA 2VFQA 1O88A 2BM4A 1WMRA 2QX3A 2X6WA 2VJIA 4XR6A 1KCCA 2BM7A 5JMCB 2UVFA 1LLWA 1LLZA 2NTPA 4XLCA 1X0CA 4AVZA 2NSPA 1TYVA 4NK6A 4XLEA 1O8FA 4Z05A 2X6YA 2XTYA 3ZPPA 2Z8GA 4XM3A 2BM6A 4JRAC 3VSUA 1TSPA 2ODLA 1HF2A 4YC5A 4EW9A 4MXNA 3T9GA 3LMWA 3AK5A 2VJJA 1RMGA 4XKVA 1H80A 3GQAA 2QZAA 4U4BA 3GQ7A 5AMVA 1VBLA 3PETA 4MR0A 5C1EA 2PYHA 2W7ZA 4YCQA
chains in the Genus database with same CATH topology
1QCXA 1CZFA 2NT9A 3B90A 3EQOA 4C2LA 1OGOX 2BSPA 2X85A 1K5CA 4W8SA 2O17A 3VMWA 1O8DA 1KCDA 5C1CA 1PE9A 4W8QA 3KRGA 3VMVA 2O1DA 1IDJA 1DBOA 1XG2A 1PXZA 4XONA 1BHEA 1PLUA 3B8YA 1KTWA 3JURA 1AIRA 4XN3A 4HWVA 1OOCA 4YELA 4OJOA 4U49A 1O8GA 4I84A 4YZAA 3B4NA 1QJVA 4W8TA 4XOPA 2X3HA 4XKWA 4XQFA 2EWEA 4PMHA 4XOTA 1NHCA 1OFMA 1IA5A 2IQ7A 1O8MA 4OJ5A 4URRA 2O0WA 2QXZA 2X6XA 1RU4A 1OFLA 1EE6A 3VSTA 1IB4A 3EQNA 1HG8A 4W8RA 3VSVA 4XL9A 1IDKA 4OJLA 4OZYA 4XORA 1GQ8A 3WWGA 2NZMA 2PECA 1BN8A 4XLFA 1O8IA 4OJPA 2VBEA 4YZXA 3UW0A 4YZ0A 2PYGA 1O8KA 4YZQA 2INVA 3ZSCA 1DBGA 3FY3A 4NK8A 2NTBA 3GQ9A 1O8LA 2O0VA 4XLHA 1JTAA 4Z03A 2QY1A 4XLAA 2UVEA 4OZZA 4XNFA 2INUA 4XN0A 3SUCA 4XMYA 4YEJA 2VBMA 1JRGA 1O8JA 1O8EA 4OJ6A 1O8HA 1OGMX 3GQ8A 2NTQA 2NSTA 2NT6A 1RWRA 4Z06A 3GRHA 2O04A 2VBKA 4XR6A 1O88A 2X6WA 1WMRA 2QX3A 1KCCA 2VJIA 2UVFA 2NTPA 4XLCA 1X0CA 4AVZA 2NSPA 4NK6A 4XLEA 1O8FA 4Z05A 2X6YA 3ZPPA 2Z8GA 4XM3A 3VSUA 2ODLA 4EW9A 4MXNA 3T9GA 3LMWA 2VJJA 1RMGA 4XKVA 1H80A 3GQAA 4U4BA 3GQ7A 5AMVA 1VBLA 4MR0A 5C1EA 2PYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCX A;  1CZF A;  2NT9 A;  3B90 A;  3EQO A;  4C2L A;  1OGO X;  2BSP A;  2X85 A;  1K5C A;  4W8S A;  2O17 A;  3VMW A;  1O8D A;  1KCD A;  5C1C A;  1PE9 A;  4W8Q A;  3KRG A;  3VMV A;  2O1D A;  1IDJ A;  1DBO A;  1XG2 A;  1PXZ A;  4XON A;  1BHE A;  1PLU A;  3B8Y A;  1KTW A;  3JUR A;  1AIR A;  4XN3 A;  4HWV A;  1OOC A;  4YEL A;  4OJO A;  4U49 A;  1O8G A;  4I84 A;  4YZA A;  3B4N A;  1QJV A;  4W8T A;  4XOP A;  2X3H A;  4XKW A;  4XQF A;  2EWE A;  4PMH A;  4XOT A;  1NHC A;  1OFM A;  1IA5 A;  2IQ7 A;  1O8M A;  4OJ5 A;  4URR A;  2O0W A;  2QXZ A;  2X6X A;  1RU4 A;  1OFL A;  1EE6 A;  3VST A;  1IB4 A;  3EQN A;  1HG8 A;  4W8R A;  3VSV A;  4XL9 A;  1IDK A;  4OJL A;  4OZY A;  4XOR A;  1GQ8 A;  3WWG A;  2NZM A;  2PEC A;  1BN8 A;  4XLF A;  1O8I A;  4OJP A;  2VBE A;  4YZX A;  3UW0 A;  4YZ0 A;  2PYG A;  1O8K A;  4YZQ A;  2INV A;  3ZSC A;  1DBG A;  3FY3 A;  4NK8 A;  2NTB A;  3GQ9 A;  1O8L A;  2O0V A;  4XLH A;  1JTA A;  4Z03 A;  2QY1 A;  4XLA A;  2UVE A;  4OZZ A;  4XNF A;  2INU A;  4XN0 A;  3SUC A;  4XMY A;  4YEJ A;  2VBM A;  1JRG A;  1O8J A;  1O8E A;  4OJ6 A;  1O8H A;  1OGM X;  3GQ8 A;  2NTQ A;  2NST A;  2NT6 A;  1RWR A;  4Z06 A;  3GRH A;  2O04 A;  2VBK A;  4XR6 A;  1O88 A;  2X6W A;  1WMR A;  2QX3 A;  1KCC A;  2VJI A;  2UVF A;  2NTP A;  4XLC A;  1X0C A;  4AVZ A;  2NSP A;  4NK6 A;  4XLE A;  1O8F A;  4Z05 A;  2X6Y A;  3ZPP A;  2Z8G A;  4XM3 A;  3VSU A;  2ODL A;  4EW9 A;  4MXN A;  3T9G A;  3LMW A;  2VJJ A;  1RMG A;  4XKV A;  1H80 A;  3GQA A;  4U4B A;  3GQ7 A;  5AMV A;  1VBL A;  4MR0 A;  5C1E A;  2PYH A; 
#chains in the Genus database with same CATH topology
 1QCX A;  3PSS A;  1TYU A;  1CZF A;  2BM5 A;  2NT9 A;  3B90 A;  3EQO A;  4OM9 A;  2YUH A;  4C2L A;  1OGO X;  2BSP A;  2X85 A;  1K5C A;  2XTX A;  4W8S A;  2O17 A;  4YDT A;  3VMW A;  2VFM A;  1O8D A;  1KCD A;  2G0Y A;  2XC1 A;  5C1C A;  1KQ5 A;  1PE9 A;  4W8Q A;  2QYU A;  3SZE A;  4V02 C;  3KRG A;  3VMV A;  1QA3 A;  2O1D A;  2XT4 A;  3LJY A;  1IDJ A;  1DBO A;  1XG2 A;  3N6Z A;  1PXZ A;  4XON A;  1K8F A;  2J8I A;  1BHE A;  1PLU A;  1TYW A;  3B8Y A;  1KTW A;  1CLW A;  3JUR A;  1AIR A;  4XN3 A;  4HWV A;  1OFE A;  1OOC A;  4YEL A;  4OJO A;  3DU1 X;  2IOU G;  4U49 A;  1O8G A;  4I84 A;  3BH6 B;  4YZA A;  3B4N A;  1QJV A;  2XT2 A;  4W8T A;  4XOP A;  4YEI A;  2X3H A;  3NAW A;  1EZG A;  4XKW A;  2O6W A;  1EA0 A;  4XQF A;  2EWE A;  3JX8 A;  4PMH A;  3N90 A;  4XOT A;  1NHC A;  1OFM A;  2VFO A;  3SYJ A;  1QRC A;  1IA5 A;  2IQ7 A;  1O8M A;  4OJ5 A;  4URR A;  2O0W A;  2QXZ A;  2X6X A;  1RU4 A;  1OFL A;  1EE6 A;  3VST A;  1IB4 A;  3EQN A;  1HG8 A;  1DAB A;  4W8R A;  3VSV A;  3H09 A;  1QRB A;  4XL9 A;  1IDK A;  2F3L A;  3LYC A;  3NB2 A;  4OJL A;  1L1I A;  4OZY A;  3BH7 B;  1QA2 A;  4XOR A;  1GQ8 A;  3WWG A;  1OFD A;  2B0R A;  2NZM A;  3RIQ A;  4KH3 A;  2PEC A;  2J8K A;  4YFO A;  1BN8 A;  3P4G A;  4XLF A;  5JLV C;  1O8I A;  4OJP A;  1WXR A;  2VBE A;  4YZX A;  3UW0 A;  4YZ0 A;  2PYG A;  1O8K A;  2BX6 A;  4YZQ A;  2INV A;  3ZSC A;  1DBG A;  3ML3 A;  3FY3 A;  4NK8 A;  2NTB A;  3GQ9 A;  1K4Z A;  1O8L A;  1QA1 A;  4OPW A;  2XTW A;  2O0V A;  1LM1 A;  2V5I A;  4XLH A;  5DNS A;  1JTA A;  4Z03 A;  2QY1 A;  4XLA A;  2UVE A;  4OZZ A;  4XNF A;  2INU A;  4XN0 A;  3TH0 A;  3SUC A;  3PSZ A;  4XMY A;  4YEJ A;  2VBM A;  1JRG A;  1O8J A;  1O8E A;  2VFP A;  3SQV A;  4OJ6 A;  1O8H A;  3SY2 A;  1OGM X;  3GQ8 A;  2NTQ A;  2NST A;  2NT6 A;  1RWR A;  4Z06 A;  2VFN A;  3GRH A;  2O04 A;  1QQ1 A;  2VBK A;  1TYX A;  2VFQ A;  1O88 A;  2BM4 A;  1WMR A;  2QX3 A;  2X6W A;  2VJI A;  4XR6 A;  1KCC A;  2BM7 A;  5JMC B;  2UVF A;  1LLW A;  1LLZ A;  2NTP A;  4XLC A;  1X0C A;  4AVZ A;  2NSP A;  1TYV A;  4NK6 A;  4XLE A;  1O8F A;  4Z05 A;  2X6Y A;  2XTY A;  3ZPP A;  2Z8G A;  4XM3 A;  2BM6 A;  4JRA C;  3VSU A;  1TSP A;  2ODL A;  1HF2 A;  4YC5 A;  4EW9 A;  4MXN A;  3T9G A;  3LMW A;  3AK5 A;  2VJJ A;  1RMG A;  4XKV A;  1H80 A;  3GQA A;  2QZA A;  4U4B A;  3GQ7 A;  5AMV A;  1VBL A;  3PET A;  4MR0 A;  5C1E A;  2PYH A;  2W7Z A;  4YCQ A; 
#chains in the Genus database with same CATH homology
 1QCX A;  1CZF A;  2NT9 A;  3B90 A;  3EQO A;  4C2L A;  1OGO X;  2BSP A;  2X85 A;  1K5C A;  4W8S A;  2O17 A;  3VMW A;  1O8D A;  1KCD A;  5C1C A;  1PE9 A;  4W8Q A;  3KRG A;  3VMV A;  2O1D A;  1IDJ A;  1DBO A;  1XG2 A;  1PXZ A;  4XON A;  1BHE A;  1PLU A;  3B8Y A;  1KTW A;  3JUR A;  1AIR A;  4XN3 A;  4HWV A;  1OOC A;  4YEL A;  4OJO A;  4U49 A;  1O8G A;  4I84 A;  4YZA A;  3B4N A;  1QJV A;  4W8T A;  4XOP A;  2X3H A;  4XKW A;  4XQF A;  2EWE A;  4PMH A;  4XOT A;  1NHC A;  1OFM A;  1IA5 A;  2IQ7 A;  1O8M A;  4OJ5 A;  4URR A;  2O0W A;  2QXZ A;  2X6X A;  1RU4 A;  1OFL A;  1EE6 A;  3VST A;  1IB4 A;  3EQN A;  1HG8 A;  4W8R A;  3VSV A;  4XL9 A;  1IDK A;  4OJL A;  4OZY A;  4XOR A;  1GQ8 A;  3WWG A;  2NZM A;  2PEC A;  1BN8 A;  4XLF A;  1O8I A;  4OJP A;  2VBE A;  4YZX A;  3UW0 A;  4YZ0 A;  2PYG A;  1O8K A;  4YZQ A;  2INV A;  3ZSC A;  1DBG A;  3FY3 A;  4NK8 A;  2NTB A;  3GQ9 A;  1O8L A;  2O0V A;  4XLH A;  1JTA A;  4Z03 A;  2QY1 A;  4XLA A;  2UVE A;  4OZZ A;  4XNF A;  2INU A;  4XN0 A;  3SUC A;  4XMY A;  4YEJ A;  2VBM A;  1JRG A;  1O8J A;  1O8E A;  4OJ6 A;  1O8H A;  1OGM X;  3GQ8 A;  2NTQ A;  2NST A;  2NT6 A;  1RWR A;  4Z06 A;  3GRH A;  2O04 A;  2VBK A;  4XR6 A;  1O88 A;  2X6W A;  1WMR A;  2QX3 A;  1KCC A;  2VJI A;  2UVF A;  2NTP A;  4XLC A;  1X0C A;  4AVZ A;  2NSP A;  4NK6 A;  4XLE A;  1O8F A;  4Z05 A;  2X6Y A;  3ZPP A;  2Z8G A;  4XM3 A;  3VSU A;  2ODL A;  4EW9 A;  4MXN A;  3T9G A;  3LMW A;  2VJJ A;  1RMG A;  4XKV A;  1H80 A;  3GQA A;  4U4B A;  3GQ7 A;  5AMV A;  1VBL A;  4MR0 A;  5C1E A;  2PYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...