2VBMA

Tailspike protein of bacteriophage sf6 complexed with tetrasaccharide
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
509
structure length
509
Chain Sequence
GPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An Intersubunit Active Site between Supercoiled Parallel Beta Helices in the Trimeric Tailspike Endorhamnosidase of Shigella Flexneri Phage Sf6.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Viral protein
molecule keywords TAILSPIKE-PROTEIN
total genus 187
structure length 509
sequence length 509
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vbmA00
1O8DA 2NTPA 2VJJA 1RMGA 2X6WA 2O17A 4W8RA 1GQ8A 4Z06A 2Z8GA 2NSTA 4YZ0A 1KTWA 4XKWA 3GQ8A 2O0WA 2VBEA 3GQ7A 4OZYA 1O8FA 1DBGA 1O8KA 2UVFA 4YZXA 1IB4A 1QJVA 1O88A 2IQ7A 4W8SA 4XM3A 1JTAA 1OGOX 4EW9A 4XOTA 4C2LA 3LMWA 1IA5A 3GRHA 1BN8A 2EWEA 1PE9A 2PECA 3VSTA 3WWGA 2QX3A 1O8LA 1OGMX 3VMVA 5C1EA 2NTBA 2UVEA 2BSPA 1PLUA 4MR0A 1BHEA 1DBOA 1IDKA 4XOPA 1X0CA 3UW0A 4OJOA 1KCDA 3B8YA 4NK8A 1NHCA 3JURA 1XG2A 1AIRA 3ZSCA 4OJPA 4XKVA 3KRGA 2NT9A 4U49A 3EQNA 2NT6A 1H80A 2X6YA 2NZMA 1CZFA 4I84A 4OJLA 4XR6A 4YZAA 1OFLA 2O04A 4OJ5A 4HWVA 4OZZA 4Z03A 1O8MA 1VBLA 4YELA 3FY3A 2INUA 4Z05A 4NK6A 4XLAA 4XORA 4URRA 1RWRA 4U4BA 2QXZA 1QCXA 3B90A 4OJ6A 4PMHA 3B4NA 1RU4A 4XNFA 1OOCA 4XL9A 4XQFA 4XLHA 2NTQA 4YZQA 1KCCA 3VSVA 2PYGA 1JRGA 4YEJA 2ODLA 1WMRA 2O1DA 3VSUA 1HG8A 4XLFA 1OFMA 1K5CA 3EQOA 1O8EA 3SUCA 1O8HA 5AMVA 2VBMA 2O0VA 2NSPA 1O8GA 4XN3A 3T9GA 4XLEA 2X85A 5C1CA 1O8IA 1EE6A 1IDJA 4MXNA 4AVZA 2QY1A 2VJIA 4XN0A 2VBKA 3GQ9A 4W8TA 3ZPPA 4W8QA 2PYHA 4XONA 3GQAA 3VMWA 2INVA 1O8JA 1PXZA 2X6XA 2X3HA 4XMYA 4XLCA
chains in the Genus database with same CATH superfamily
1O8DA 2VFNA 2NTPA 2VJJA 1RMGA 2XC1A 2V5IA 2X6WA 2XT4A 2O17A 4W8RA 1GQ8A 4Z06A 2Z8GA 2NSTA 2BM6A 4OPWA 1TSPA 1KTWA 4YZ0A 4XKWA 2QZAA 3GQ8A 2O0WA 3LJYA 2VBEA 3GQ7A 4OZYA 1TYVA 2VFOA 2XTWA 1DBGA 1O8FA 1O8KA 2UVFA 4YZXA 1IB4A 1QJVA 1O88A 2IQ7A 4W8SA 4XM3A 1JTAA 3SQVA 1OGOX 4EW9A 2BM5A 3SY2A 4XOTA 4C2LA 3LMWA 1IA5A 3GRHA 1BN8A 2EWEA 1PE9A 2PECA 1QQ1A 1CLWA 2BM4A 3VSTA 1HF2A 2QX3A 1O8LA 1OGMX 3VMVA 3WWGA 5C1EA 3SYJA 2NTBA 2BSPA 1PLUA 2UVEA 4MR0A 1BHEA 1DBOA 1IDKA 4XOPA 3AK5A 1X0CA 3UW0A 4OJOA 4V02C 3PSZA 1KCDA 4YCQA 3B8YA 4KH3A 2VFMA 4NK8A 1NHCA 2VFPA 3JURA 1XG2A 1OFDA 1AIRA 3ZSCA 5DNSA 4OJPA 2IOUG 3LYCA 1EA0A 4XKVA 3KRGA 1TYWA 2NT9A 4U49A 3N6ZA 3EQNA 1LLWA 2NT6A 2BM7A 4YDTA 1QA1A 1H80A 2X6YA 2NZMA 2XTXA 1CZFA 4I84A 4OJLA 4XR6A 4YZAA 1OFLA 4YC5A 5JMCB 2BX6A 2O04A 2B0RA 2W7ZA 3P4GA 4OJ5A 1K8FA 1TYXA 3H09A 1QRBA 4OM9A 4HWVA 4OZZA 4Z03A 1O8MA 1VBLA 4YELA 3FY3A 2INUA 4Z05A 3RIQA 4NK6A 4XLAA 1TYUA 3PETA 1QA2A 4XORA 2J8IA 4URRA 2QYUA 1RWRA 4U4BA 2QXZA 2XT2A 2F3LA 1QA3A 1QCXA 3B90A 4OJ6A 1WXRA 2J8KA 1L1IA 3NAWA 3B4NA 4PMHA 4YFOA 3BH7B 1RU4A 4XNFA 1OOCA 4XL9A 4XQFA 2XTYA 2VFQA 4XLHA 2G0YA 2NTQA 3TH0A 1LM1A 4YZQA 3PSSA 4AVZA 1KCCA 3ML3A 3VSVA 1KQ5A 1OFEA 2PYGA 1JRGA 4YEJA 2ODLA 1WMRA 2O1DA 3VSUA 1HG8A 1LLZA 3N90A 4XLFA 1OFMA 4JRAC 1QRCA 1K5CA 3EQOA 1O8EA 3DU1X 1DABA 2O6WA 3JX8A 1O8HA 5AMVA 3SUCA 2VBMA 5JLVC 2O0VA 2NSPA 1O8GA 4XN3A 3T9GA 4XLEA 2X85A 5C1CA 4YEIA 1O8IA 1EE6A 1IDJA 4MXNA 2YUHA 2QY1A 2VJIA 4XN0A 2VBKA 3GQ9A 4W8TA 1K4ZA 3ZPPA 4W8QA 1EZGA 2PYHA 3BH6B 4XONA 3GQAA 3SZEA 3VMWA 2INVA 3NB2A 1O8JA 1PXZA 2X6XA 2X3HA 4XMYA 4XLCA
chains in the Genus database with same CATH topology
1O8DA 2NTPA 2VJJA 1RMGA 2X6WA 2O17A 4W8RA 1GQ8A 4Z06A 2Z8GA 2NSTA 4YZ0A 1KTWA 4XKWA 3GQ8A 2O0WA 2VBEA 3GQ7A 4OZYA 1O8FA 1DBGA 1O8KA 2UVFA 4YZXA 1IB4A 1QJVA 1O88A 2IQ7A 4W8SA 4XM3A 1JTAA 1OGOX 4EW9A 4XOTA 4C2LA 3LMWA 1IA5A 3GRHA 1BN8A 2EWEA 1PE9A 2PECA 3VSTA 3WWGA 2QX3A 1O8LA 1OGMX 3VMVA 5C1EA 2NTBA 2UVEA 2BSPA 1PLUA 4MR0A 1BHEA 1DBOA 1IDKA 4XOPA 1X0CA 3UW0A 4OJOA 1KCDA 3B8YA 4NK8A 1NHCA 3JURA 1XG2A 1AIRA 3ZSCA 4OJPA 4XKVA 3KRGA 2NT9A 4U49A 3EQNA 2NT6A 1H80A 2X6YA 2NZMA 1CZFA 4I84A 4OJLA 4XR6A 4YZAA 1OFLA 2O04A 4OJ5A 4HWVA 4OZZA 4Z03A 1O8MA 1VBLA 4YELA 3FY3A 2INUA 4Z05A 4NK6A 4XLAA 4XORA 4URRA 1RWRA 4U4BA 2QXZA 1QCXA 3B90A 4OJ6A 4PMHA 3B4NA 1RU4A 4XNFA 1OOCA 4XL9A 4XQFA 4XLHA 2NTQA 4YZQA 1KCCA 3VSVA 2PYGA 1JRGA 4YEJA 2ODLA 1WMRA 2O1DA 3VSUA 1HG8A 4XLFA 1OFMA 1K5CA 3EQOA 1O8EA 3SUCA 1O8HA 5AMVA 2VBMA 2O0VA 2NSPA 1O8GA 4XN3A 3T9GA 4XLEA 2X85A 5C1CA 1O8IA 1EE6A 1IDJA 4MXNA 4AVZA 2QY1A 2VJIA 4XN0A 2VBKA 3GQ9A 4W8TA 3ZPPA 4W8QA 2PYHA 4XONA 3GQAA 3VMWA 2INVA 1O8JA 1PXZA 2X6XA 2X3HA 4XMYA 4XLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8D A;  2NTP A;  2VJJ A;  1RMG A;  2X6W A;  2O17 A;  4W8R A;  1GQ8 A;  4Z06 A;  2Z8G A;  2NST A;  4YZ0 A;  1KTW A;  4XKW A;  3GQ8 A;  2O0W A;  2VBE A;  3GQ7 A;  4OZY A;  1O8F A;  1DBG A;  1O8K A;  2UVF A;  4YZX A;  1IB4 A;  1QJV A;  1O88 A;  2IQ7 A;  4W8S A;  4XM3 A;  1JTA A;  1OGO X;  4EW9 A;  4XOT A;  4C2L A;  3LMW A;  1IA5 A;  3GRH A;  1BN8 A;  2EWE A;  1PE9 A;  2PEC A;  3VST A;  3WWG A;  2QX3 A;  1O8L A;  1OGM X;  3VMV A;  5C1E A;  2NTB A;  2UVE A;  2BSP A;  1PLU A;  4MR0 A;  1BHE A;  1DBO A;  1IDK A;  4XOP A;  1X0C A;  3UW0 A;  4OJO A;  1KCD A;  3B8Y A;  4NK8 A;  1NHC A;  3JUR A;  1XG2 A;  1AIR A;  3ZSC A;  4OJP A;  4XKV A;  3KRG A;  2NT9 A;  4U49 A;  3EQN A;  2NT6 A;  1H80 A;  2X6Y A;  2NZM A;  1CZF A;  4I84 A;  4OJL A;  4XR6 A;  4YZA A;  1OFL A;  2O04 A;  4OJ5 A;  4HWV A;  4OZZ A;  4Z03 A;  1O8M A;  1VBL A;  4YEL A;  3FY3 A;  2INU A;  4Z05 A;  4NK6 A;  4XLA A;  4XOR A;  4URR A;  1RWR A;  4U4B A;  2QXZ A;  1QCX A;  3B90 A;  4OJ6 A;  4PMH A;  3B4N A;  1RU4 A;  4XNF A;  1OOC A;  4XL9 A;  4XQF A;  4XLH A;  2NTQ A;  4YZQ A;  1KCC A;  3VSV A;  2PYG A;  1JRG A;  4YEJ A;  2ODL A;  1WMR A;  2O1D A;  3VSU A;  1HG8 A;  4XLF A;  1OFM A;  1K5C A;  3EQO A;  1O8E A;  3SUC A;  1O8H A;  5AMV A;  2VBM A;  2O0V A;  2NSP A;  1O8G A;  4XN3 A;  3T9G A;  4XLE A;  2X85 A;  5C1C A;  1O8I A;  1EE6 A;  1IDJ A;  4MXN A;  4AVZ A;  2QY1 A;  2VJI A;  4XN0 A;  2VBK A;  3GQ9 A;  4W8T A;  3ZPP A;  4W8Q A;  2PYH A;  4XON A;  3GQA A;  3VMW A;  2INV A;  1O8J A;  1PXZ A;  2X6X A;  2X3H A;  4XMY A;  4XLC A; 
#chains in the Genus database with same CATH topology
 1O8D A;  2VFN A;  2NTP A;  2VJJ A;  1RMG A;  2XC1 A;  2V5I A;  2X6W A;  2XT4 A;  2O17 A;  4W8R A;  1GQ8 A;  4Z06 A;  2Z8G A;  2NST A;  2BM6 A;  4OPW A;  1TSP A;  1KTW A;  4YZ0 A;  4XKW A;  2QZA A;  3GQ8 A;  2O0W A;  3LJY A;  2VBE A;  3GQ7 A;  4OZY A;  1TYV A;  2VFO A;  2XTW A;  1DBG A;  1O8F A;  1O8K A;  2UVF A;  4YZX A;  1IB4 A;  1QJV A;  1O88 A;  2IQ7 A;  4W8S A;  4XM3 A;  1JTA A;  3SQV A;  1OGO X;  4EW9 A;  2BM5 A;  3SY2 A;  4XOT A;  4C2L A;  3LMW A;  1IA5 A;  3GRH A;  1BN8 A;  2EWE A;  1PE9 A;  2PEC A;  1QQ1 A;  1CLW A;  2BM4 A;  3VST A;  1HF2 A;  2QX3 A;  1O8L A;  1OGM X;  3VMV A;  3WWG A;  5C1E A;  3SYJ A;  2NTB A;  2BSP A;  1PLU A;  2UVE A;  4MR0 A;  1BHE A;  1DBO A;  1IDK A;  4XOP A;  3AK5 A;  1X0C A;  3UW0 A;  4OJO A;  4V02 C;  3PSZ A;  1KCD A;  4YCQ A;  3B8Y A;  4KH3 A;  2VFM A;  4NK8 A;  1NHC A;  2VFP A;  3JUR A;  1XG2 A;  1OFD A;  1AIR A;  3ZSC A;  5DNS A;  4OJP A;  2IOU G;  3LYC A;  1EA0 A;  4XKV A;  3KRG A;  1TYW A;  2NT9 A;  4U49 A;  3N6Z A;  3EQN A;  1LLW A;  2NT6 A;  2BM7 A;  4YDT A;  1QA1 A;  1H80 A;  2X6Y A;  2NZM A;  2XTX A;  1CZF A;  4I84 A;  4OJL A;  4XR6 A;  4YZA A;  1OFL A;  4YC5 A;  5JMC B;  2BX6 A;  2O04 A;  2B0R A;  2W7Z A;  3P4G A;  4OJ5 A;  1K8F A;  1TYX A;  3H09 A;  1QRB A;  4OM9 A;  4HWV A;  4OZZ A;  4Z03 A;  1O8M A;  1VBL A;  4YEL A;  3FY3 A;  2INU A;  4Z05 A;  3RIQ A;  4NK6 A;  4XLA A;  1TYU A;  3PET A;  1QA2 A;  4XOR A;  2J8I A;  4URR A;  2QYU A;  1RWR A;  4U4B A;  2QXZ A;  2XT2 A;  2F3L A;  1QA3 A;  1QCX A;  3B90 A;  4OJ6 A;  1WXR A;  2J8K A;  1L1I A;  3NAW A;  3B4N A;  4PMH A;  4YFO A;  3BH7 B;  1RU4 A;  4XNF A;  1OOC A;  4XL9 A;  4XQF A;  2XTY A;  2VFQ A;  4XLH A;  2G0Y A;  2NTQ A;  3TH0 A;  1LM1 A;  4YZQ A;  3PSS A;  4AVZ A;  1KCC A;  3ML3 A;  3VSV A;  1KQ5 A;  1OFE A;  2PYG A;  1JRG A;  4YEJ A;  2ODL A;  1WMR A;  2O1D A;  3VSU A;  1HG8 A;  1LLZ A;  3N90 A;  4XLF A;  1OFM A;  4JRA C;  1QRC A;  1K5C A;  3EQO A;  1O8E A;  3DU1 X;  1DAB A;  2O6W A;  3JX8 A;  1O8H A;  5AMV A;  3SUC A;  2VBM A;  5JLV C;  2O0V A;  2NSP A;  1O8G A;  4XN3 A;  3T9G A;  4XLE A;  2X85 A;  5C1C A;  4YEI A;  1O8I A;  1EE6 A;  1IDJ A;  4MXN A;  2YUH A;  2QY1 A;  2VJI A;  4XN0 A;  2VBK A;  3GQ9 A;  4W8T A;  1K4Z A;  3ZPP A;  4W8Q A;  1EZG A;  2PYH A;  3BH6 B;  4XON A;  3GQA A;  3SZE A;  3VMW A;  2INV A;  3NB2 A;  1O8J A;  1PXZ A;  2X6X A;  2X3H A;  4XMY A;  4XLC A; 
#chains in the Genus database with same CATH homology
 1O8D A;  2NTP A;  2VJJ A;  1RMG A;  2X6W A;  2O17 A;  4W8R A;  1GQ8 A;  4Z06 A;  2Z8G A;  2NST A;  4YZ0 A;  1KTW A;  4XKW A;  3GQ8 A;  2O0W A;  2VBE A;  3GQ7 A;  4OZY A;  1O8F A;  1DBG A;  1O8K A;  2UVF A;  4YZX A;  1IB4 A;  1QJV A;  1O88 A;  2IQ7 A;  4W8S A;  4XM3 A;  1JTA A;  1OGO X;  4EW9 A;  4XOT A;  4C2L A;  3LMW A;  1IA5 A;  3GRH A;  1BN8 A;  2EWE A;  1PE9 A;  2PEC A;  3VST A;  3WWG A;  2QX3 A;  1O8L A;  1OGM X;  3VMV A;  5C1E A;  2NTB A;  2UVE A;  2BSP A;  1PLU A;  4MR0 A;  1BHE A;  1DBO A;  1IDK A;  4XOP A;  1X0C A;  3UW0 A;  4OJO A;  1KCD A;  3B8Y A;  4NK8 A;  1NHC A;  3JUR A;  1XG2 A;  1AIR A;  3ZSC A;  4OJP A;  4XKV A;  3KRG A;  2NT9 A;  4U49 A;  3EQN A;  2NT6 A;  1H80 A;  2X6Y A;  2NZM A;  1CZF A;  4I84 A;  4OJL A;  4XR6 A;  4YZA A;  1OFL A;  2O04 A;  4OJ5 A;  4HWV A;  4OZZ A;  4Z03 A;  1O8M A;  1VBL A;  4YEL A;  3FY3 A;  2INU A;  4Z05 A;  4NK6 A;  4XLA A;  4XOR A;  4URR A;  1RWR A;  4U4B A;  2QXZ A;  1QCX A;  3B90 A;  4OJ6 A;  4PMH A;  3B4N A;  1RU4 A;  4XNF A;  1OOC A;  4XL9 A;  4XQF A;  4XLH A;  2NTQ A;  4YZQ A;  1KCC A;  3VSV A;  2PYG A;  1JRG A;  4YEJ A;  2ODL A;  1WMR A;  2O1D A;  3VSU A;  1HG8 A;  4XLF A;  1OFM A;  1K5C A;  3EQO A;  1O8E A;  3SUC A;  1O8H A;  5AMV A;  2VBM A;  2O0V A;  2NSP A;  1O8G A;  4XN3 A;  3T9G A;  4XLE A;  2X85 A;  5C1C A;  1O8I A;  1EE6 A;  1IDJ A;  4MXN A;  4AVZ A;  2QY1 A;  2VJI A;  4XN0 A;  2VBK A;  3GQ9 A;  4W8T A;  3ZPP A;  4W8Q A;  2PYH A;  4XON A;  3GQA A;  3VMW A;  2INV A;  1O8J A;  1PXZ A;  2X6X A;  2X3H A;  4XMY A;  4XLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...