2VBMA

Tailspike protein of bacteriophage sf6 complexed with tetrasaccharide
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
509
structure length
509
Chain Sequence
GPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An Intersubunit Active Site between Supercoiled Parallel Beta Helices in the Trimeric Tailspike Endorhamnosidase of Shigella Flexneri Phage Sf6.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Viral protein
molecule keywords TAILSPIKE-PROTEIN
total genus 187
structure length 509
sequence length 509
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vbmA00
4I84A 4XLCA 1BN8A 4XM3A 3T9GA 1X0CA 4EW9A 2NTPA 2ODLA 3KRGA 4XR6A 4OZYA 1O8GA 3SUCA 2PYHA 1DBGA 4OZZA 1HG8A 1IA5A 1BHEA 3GQ8A 2NT6A 1EE6A 1OFMA 2NTQA 1O8MA 4NK6A 3VMVA 3B4NA 4XONA 5AMVA 3B90A 4YZAA 2VBMA 1O8EA 2IQ7A 1QJVA 1NHCA 2X85A 4XNFA 3B8YA 3FY3A 4YZXA 4W8RA 4URRA 2O17A 1JTAA 2X6YA 1KTWA 4MR0A 4NK8A 4XKVA 2PYGA 2QY1A 4W8QA 2QXZA 2O1DA 4AVZA 1GQ8A 2O0WA 3VSTA 4XOPA 1XG2A 1KCDA 4XOTA 2X6XA 3WWGA 3JURA 4XKWA 1O8DA 1CZFA 1OFLA 1RMGA 2NT9A 2BSPA 2VJIA 4XORA 1RWRA 1O8LA 2UVFA 1O8KA 4XN0A 2EWEA 3VMWA 4W8SA 4Z06A 1OGOX 2O04A 4XMYA 1IDKA 3ZPPA 1IB4A 2VJJA 4HWVA 1QCXA 2NZMA 1DBOA 1O8JA 1H80A 3EQNA 4C2LA 2Z8GA 4OJLA 3VSUA 3GQ9A 2NTBA 5C1EA 3VSVA 4YZ0A 4Z03A 4OJOA 1O8HA 2VBKA 1PLUA 2PECA 4U4BA 1PXZA 4OJPA 1K5CA 4Z05A 4XLHA 4OJ6A 4PMHA 3GRHA 2INUA 1O88A 4YEJA 4XQFA 2NSPA 4W8TA 1JRGA 2INVA 3EQOA 1AIRA 4XL9A 2O0VA 3GQ7A 2NSTA 3GQAA 1OOCA 3LMWA 4YELA 1KCCA 1O8FA 2UVEA 4YZQA 1OGMX 5C1CA 1VBLA 1PE9A 4XLEA 2X6WA 1O8IA 3ZSCA 3UW0A 1IDJA 4XN3A 4U49A 4XLFA 1WMRA 1RU4A 4MXNA 4OJ5A 2VBEA 2X3HA 2QX3A 4XLAA
chains in the Genus database with same CATH superfamily
3DU1X 4I84A 4XLCA 1BN8A 4XM3A 4YFOA 1X0CA 3T9GA 2NTPA 2ODLA 3KRGA 3SZEA 2B0RA 2QX3A 3NB2A 4OZYA 4XR6A 1O8GA 3SUCA 3AK5A 2PYHA 1DBGA 4OZZA 2BM6A 1HG8A 3N6ZA 1IA5A 1BHEA 3GQ8A 2NT6A 1K8FA 1EE6A 1OFMA 2NTQA 1O8MA 2QYUA 4NK6A 4V02C 3B4NA 4XONA 5AMVA 3B90A 3VMVA 1QA1A 4YZAA 1OFEA 2VBMA 1O8EA 2VFNA 2IQ7A 4YC5A 1TYVA 1QJVA 1NHCA 2X85A 2J8KA 4XNFA 2VFOA 3B8YA 3FY3A 4YZXA 4W8RA 4URRA 2O17A 1JTAA 2X6YA 5JLVC 1KTWA 3PSZA 4YCQA 4MR0A 4NK8A 1TYXA 1TYUA 4XKVA 1QA3A 2F3LA 2V5IA 3ML3A 2PYGA 2QY1A 4W8QA 2QXZA 3JX8A 2BM7A 2O1DA 2XTXA 4AVZA 1EA0A 1QRCA 1GQ8A 2O0WA 3VSTA 1DABA 1LLZA 4XOPA 1XG2A 1KCDA 4XOTA 2X6XA 3SQVA 3RIQA 3WWGA 3LYCA 2XTYA 3JURA 1WXRA 4XKWA 3SY2A 1O8DA 1CZFA 1OFLA 1RMGA 2NT9A 2BSPA 4EW9A 2VJIA 4XORA 1HF2A 1O8LA 1RWRA 1O8KA 2UVFA 4XN0A 1QQ1A 2EWEA 3SYJA 3VMWA 4W8SA 2XTWA 1TSPA 4Z06A 2XT4A 1OGOX 1K4ZA 2O04A 1KQ5A 1IDKA 4XMYA 3PSSA 3ZPPA 2VFQA 1IB4A 4KH3A 1TYWA 2BX6A 2VJJA 4HWVA 1QCXA 2BM4A 2NZMA 2VFPA 1DBOA 1O8JA 1H80A 3BH7B 3EQNA 2XC1A 3TH0A 4C2LA 1EZGA 2Z8GA 4JRAC 4OJLA 3VSUA 3GQ9A 2NTBA 5C1EA 3VSVA 2O6WA 2YUHA 1QA2A 4YZ0A 4Z03A 3P4GA 4OJOA 1O8HA 2QZAA 2VBKA 1PLUA 1LM1A 2PECA 2J8IA 3LJYA 4U4BA 1PXZA 4OJPA 4YDTA 1K5CA 4Z05A 2IOUG 4XLHA 4OJ6A 4PMHA 5DNSA 3GRHA 2INUA 1O88A 3NAWA 4YEJA 4XQFA 2G0YA 2W7ZA 2NSPA 2BM5A 4W8TA 1JRGA 2INVA 3EQOA 4OM9A 1AIRA 4XL9A 2O0VA 3GQ7A 1CLWA 2NSTA 3GQAA 1OOCA 3LMWA 4YELA 1L1IA 1KCCA 1O8FA 2UVEA 1QRBA 1LLWA 4YZQA 1OGMX 5C1CA 1VBLA 1OFDA 1PE9A 2XT2A 3H09A 4XLEA 3N90A 2X6WA 1O8IA 3PETA 5JMCB 3ZSCA 3UW0A 1IDJA 4XN3A 4U49A 4YEIA 2VFMA 4XLFA 1WMRA 3BH6B 4MXNA 4OJ5A 2VBEA 2X3HA 1RU4A 4OPWA 4XLAA
chains in the Genus database with same CATH topology
4I84A 4XLCA 1BN8A 4XM3A 3T9GA 1X0CA 4EW9A 2NTPA 2ODLA 3KRGA 4XR6A 4OZYA 1O8GA 3SUCA 2PYHA 1DBGA 4OZZA 1HG8A 1IA5A 1BHEA 3GQ8A 2NT6A 1EE6A 1OFMA 2NTQA 1O8MA 4NK6A 3VMVA 3B4NA 4XONA 5AMVA 3B90A 4YZAA 2VBMA 1O8EA 2IQ7A 1QJVA 1NHCA 2X85A 4XNFA 3B8YA 3FY3A 4YZXA 4W8RA 4URRA 2O17A 1JTAA 2X6YA 1KTWA 4MR0A 4NK8A 4XKVA 2PYGA 2QY1A 4W8QA 2QXZA 2O1DA 4AVZA 1GQ8A 2O0WA 3VSTA 4XOPA 1XG2A 1KCDA 4XOTA 2X6XA 3WWGA 3JURA 4XKWA 1O8DA 1CZFA 1OFLA 1RMGA 2NT9A 2BSPA 2VJIA 4XORA 1RWRA 1O8LA 2UVFA 1O8KA 4XN0A 2EWEA 3VMWA 4W8SA 4Z06A 1OGOX 2O04A 4XMYA 1IDKA 3ZPPA 1IB4A 2VJJA 4HWVA 1QCXA 2NZMA 1DBOA 1O8JA 1H80A 3EQNA 4C2LA 2Z8GA 4OJLA 3VSUA 3GQ9A 2NTBA 5C1EA 3VSVA 4YZ0A 4Z03A 4OJOA 1O8HA 2VBKA 1PLUA 2PECA 4U4BA 1PXZA 4OJPA 1K5CA 4Z05A 4XLHA 4OJ6A 4PMHA 3GRHA 2INUA 1O88A 4YEJA 4XQFA 2NSPA 4W8TA 1JRGA 2INVA 3EQOA 1AIRA 4XL9A 2O0VA 3GQ7A 2NSTA 3GQAA 1OOCA 3LMWA 4YELA 1KCCA 1O8FA 2UVEA 4YZQA 1OGMX 5C1CA 1VBLA 1PE9A 4XLEA 2X6WA 1O8IA 3ZSCA 3UW0A 1IDJA 4XN3A 4U49A 4XLFA 1WMRA 1RU4A 4MXNA 4OJ5A 2VBEA 2X3HA 2QX3A 4XLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I84 A;  4XLC A;  1BN8 A;  4XM3 A;  3T9G A;  1X0C A;  4EW9 A;  2NTP A;  2ODL A;  3KRG A;  4XR6 A;  4OZY A;  1O8G A;  3SUC A;  2PYH A;  1DBG A;  4OZZ A;  1HG8 A;  1IA5 A;  1BHE A;  3GQ8 A;  2NT6 A;  1EE6 A;  1OFM A;  2NTQ A;  1O8M A;  4NK6 A;  3VMV A;  3B4N A;  4XON A;  5AMV A;  3B90 A;  4YZA A;  2VBM A;  1O8E A;  2IQ7 A;  1QJV A;  1NHC A;  2X85 A;  4XNF A;  3B8Y A;  3FY3 A;  4YZX A;  4W8R A;  4URR A;  2O17 A;  1JTA A;  2X6Y A;  1KTW A;  4MR0 A;  4NK8 A;  4XKV A;  2PYG A;  2QY1 A;  4W8Q A;  2QXZ A;  2O1D A;  4AVZ A;  1GQ8 A;  2O0W A;  3VST A;  4XOP A;  1XG2 A;  1KCD A;  4XOT A;  2X6X A;  3WWG A;  3JUR A;  4XKW A;  1O8D A;  1CZF A;  1OFL A;  1RMG A;  2NT9 A;  2BSP A;  2VJI A;  4XOR A;  1RWR A;  1O8L A;  2UVF A;  1O8K A;  4XN0 A;  2EWE A;  3VMW A;  4W8S A;  4Z06 A;  1OGO X;  2O04 A;  4XMY A;  1IDK A;  3ZPP A;  1IB4 A;  2VJJ A;  4HWV A;  1QCX A;  2NZM A;  1DBO A;  1O8J A;  1H80 A;  3EQN A;  4C2L A;  2Z8G A;  4OJL A;  3VSU A;  3GQ9 A;  2NTB A;  5C1E A;  3VSV A;  4YZ0 A;  4Z03 A;  4OJO A;  1O8H A;  2VBK A;  1PLU A;  2PEC A;  4U4B A;  1PXZ A;  4OJP A;  1K5C A;  4Z05 A;  4XLH A;  4OJ6 A;  4PMH A;  3GRH A;  2INU A;  1O88 A;  4YEJ A;  4XQF A;  2NSP A;  4W8T A;  1JRG A;  2INV A;  3EQO A;  1AIR A;  4XL9 A;  2O0V A;  3GQ7 A;  2NST A;  3GQA A;  1OOC A;  3LMW A;  4YEL A;  1KCC A;  1O8F A;  2UVE A;  4YZQ A;  1OGM X;  5C1C A;  1VBL A;  1PE9 A;  4XLE A;  2X6W A;  1O8I A;  3ZSC A;  3UW0 A;  1IDJ A;  4XN3 A;  4U49 A;  4XLF A;  1WMR A;  1RU4 A;  4MXN A;  4OJ5 A;  2VBE A;  2X3H A;  2QX3 A;  4XLA A; 
#chains in the Genus database with same CATH topology
 3DU1 X;  4I84 A;  4XLC A;  1BN8 A;  4XM3 A;  4YFO A;  1X0C A;  3T9G A;  2NTP A;  2ODL A;  3KRG A;  3SZE A;  2B0R A;  2QX3 A;  3NB2 A;  4OZY A;  4XR6 A;  1O8G A;  3SUC A;  3AK5 A;  2PYH A;  1DBG A;  4OZZ A;  2BM6 A;  1HG8 A;  3N6Z A;  1IA5 A;  1BHE A;  3GQ8 A;  2NT6 A;  1K8F A;  1EE6 A;  1OFM A;  2NTQ A;  1O8M A;  2QYU A;  4NK6 A;  4V02 C;  3B4N A;  4XON A;  5AMV A;  3B90 A;  3VMV A;  1QA1 A;  4YZA A;  1OFE A;  2VBM A;  1O8E A;  2VFN A;  2IQ7 A;  4YC5 A;  1TYV A;  1QJV A;  1NHC A;  2X85 A;  2J8K A;  4XNF A;  2VFO A;  3B8Y A;  3FY3 A;  4YZX A;  4W8R A;  4URR A;  2O17 A;  1JTA A;  2X6Y A;  5JLV C;  1KTW A;  3PSZ A;  4YCQ A;  4MR0 A;  4NK8 A;  1TYX A;  1TYU A;  4XKV A;  1QA3 A;  2F3L A;  2V5I A;  3ML3 A;  2PYG A;  2QY1 A;  4W8Q A;  2QXZ A;  3JX8 A;  2BM7 A;  2O1D A;  2XTX A;  4AVZ A;  1EA0 A;  1QRC A;  1GQ8 A;  2O0W A;  3VST A;  1DAB A;  1LLZ A;  4XOP A;  1XG2 A;  1KCD A;  4XOT A;  2X6X A;  3SQV A;  3RIQ A;  3WWG A;  3LYC A;  2XTY A;  3JUR A;  1WXR A;  4XKW A;  3SY2 A;  1O8D A;  1CZF A;  1OFL A;  1RMG A;  2NT9 A;  2BSP A;  4EW9 A;  2VJI A;  4XOR A;  1HF2 A;  1O8L A;  1RWR A;  1O8K A;  2UVF A;  4XN0 A;  1QQ1 A;  2EWE A;  3SYJ A;  3VMW A;  4W8S A;  2XTW A;  1TSP A;  4Z06 A;  2XT4 A;  1OGO X;  1K4Z A;  2O04 A;  1KQ5 A;  1IDK A;  4XMY A;  3PSS A;  3ZPP A;  2VFQ A;  1IB4 A;  4KH3 A;  1TYW A;  2BX6 A;  2VJJ A;  4HWV A;  1QCX A;  2BM4 A;  2NZM A;  2VFP A;  1DBO A;  1O8J A;  1H80 A;  3BH7 B;  3EQN A;  2XC1 A;  3TH0 A;  4C2L A;  1EZG A;  2Z8G A;  4JRA C;  4OJL A;  3VSU A;  3GQ9 A;  2NTB A;  5C1E A;  3VSV A;  2O6W A;  2YUH A;  1QA2 A;  4YZ0 A;  4Z03 A;  3P4G A;  4OJO A;  1O8H A;  2QZA A;  2VBK A;  1PLU A;  1LM1 A;  2PEC A;  2J8I A;  3LJY A;  4U4B A;  1PXZ A;  4OJP A;  4YDT A;  1K5C A;  4Z05 A;  2IOU G;  4XLH A;  4OJ6 A;  4PMH A;  5DNS A;  3GRH A;  2INU A;  1O88 A;  3NAW A;  4YEJ A;  4XQF A;  2G0Y A;  2W7Z A;  2NSP A;  2BM5 A;  4W8T A;  1JRG A;  2INV A;  3EQO A;  4OM9 A;  1AIR A;  4XL9 A;  2O0V A;  3GQ7 A;  1CLW A;  2NST A;  3GQA A;  1OOC A;  3LMW A;  4YEL A;  1L1I A;  1KCC A;  1O8F A;  2UVE A;  1QRB A;  1LLW A;  4YZQ A;  1OGM X;  5C1C A;  1VBL A;  1OFD A;  1PE9 A;  2XT2 A;  3H09 A;  4XLE A;  3N90 A;  2X6W A;  1O8I A;  3PET A;  5JMC B;  3ZSC A;  3UW0 A;  1IDJ A;  4XN3 A;  4U49 A;  4YEI A;  2VFM A;  4XLF A;  1WMR A;  3BH6 B;  4MXN A;  4OJ5 A;  2VBE A;  2X3H A;  1RU4 A;  4OPW A;  4XLA A; 
#chains in the Genus database with same CATH homology
 4I84 A;  4XLC A;  1BN8 A;  4XM3 A;  3T9G A;  1X0C A;  4EW9 A;  2NTP A;  2ODL A;  3KRG A;  4XR6 A;  4OZY A;  1O8G A;  3SUC A;  2PYH A;  1DBG A;  4OZZ A;  1HG8 A;  1IA5 A;  1BHE A;  3GQ8 A;  2NT6 A;  1EE6 A;  1OFM A;  2NTQ A;  1O8M A;  4NK6 A;  3VMV A;  3B4N A;  4XON A;  5AMV A;  3B90 A;  4YZA A;  2VBM A;  1O8E A;  2IQ7 A;  1QJV A;  1NHC A;  2X85 A;  4XNF A;  3B8Y A;  3FY3 A;  4YZX A;  4W8R A;  4URR A;  2O17 A;  1JTA A;  2X6Y A;  1KTW A;  4MR0 A;  4NK8 A;  4XKV A;  2PYG A;  2QY1 A;  4W8Q A;  2QXZ A;  2O1D A;  4AVZ A;  1GQ8 A;  2O0W A;  3VST A;  4XOP A;  1XG2 A;  1KCD A;  4XOT A;  2X6X A;  3WWG A;  3JUR A;  4XKW A;  1O8D A;  1CZF A;  1OFL A;  1RMG A;  2NT9 A;  2BSP A;  2VJI A;  4XOR A;  1RWR A;  1O8L A;  2UVF A;  1O8K A;  4XN0 A;  2EWE A;  3VMW A;  4W8S A;  4Z06 A;  1OGO X;  2O04 A;  4XMY A;  1IDK A;  3ZPP A;  1IB4 A;  2VJJ A;  4HWV A;  1QCX A;  2NZM A;  1DBO A;  1O8J A;  1H80 A;  3EQN A;  4C2L A;  2Z8G A;  4OJL A;  3VSU A;  3GQ9 A;  2NTB A;  5C1E A;  3VSV A;  4YZ0 A;  4Z03 A;  4OJO A;  1O8H A;  2VBK A;  1PLU A;  2PEC A;  4U4B A;  1PXZ A;  4OJP A;  1K5C A;  4Z05 A;  4XLH A;  4OJ6 A;  4PMH A;  3GRH A;  2INU A;  1O88 A;  4YEJ A;  4XQF A;  2NSP A;  4W8T A;  1JRG A;  2INV A;  3EQO A;  1AIR A;  4XL9 A;  2O0V A;  3GQ7 A;  2NST A;  3GQA A;  1OOC A;  3LMW A;  4YEL A;  1KCC A;  1O8F A;  2UVE A;  4YZQ A;  1OGM X;  5C1C A;  1VBL A;  1PE9 A;  4XLE A;  2X6W A;  1O8I A;  3ZSC A;  3UW0 A;  1IDJ A;  4XN3 A;  4U49 A;  4XLF A;  1WMR A;  1RU4 A;  4MXN A;  4OJ5 A;  2VBE A;  2X3H A;  2QX3 A;  4XLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...