2VBMA

Tailspike protein of bacteriophage sf6 complexed with tetrasaccharide
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
509
structure length
509
Chain Sequence
GPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An Intersubunit Active Site between Supercoiled Parallel Beta Helices in the Trimeric Tailspike Endorhamnosidase of Shigella Flexneri Phage Sf6.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Viral protein
molecule keywords TAILSPIKE-PROTEIN
total genus 187
structure length 509
sequence length 509
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vbmA00
4Z05A 3B4NA 2O17A 1O88A 5AMVA 4XORA 1IB4A 2O0WA 4XONA 3GQAA 4XLAA 3ZPPA 1EE6A 5C1CA 3KRGA 1PE9A 2X3HA 1O8LA 1OFLA 2EWEA 3GQ7A 1DBGA 2VBKA 2O0VA 4YEJA 1RU4A 2VJJA 2PECA 2NT6A 4OJ6A 1O8FA 1X0CA 1JRGA 4YZXA 1PXZA 2NZMA 4OJPA 2VBEA 1IDJA 3VMVA 3EQOA 2O04A 2QY1A 2NSPA 3GQ9A 1GQ8A 3FY3A 1BHEA 2UVFA 2X85A 2Z8GA 1HG8A 4Z03A 1QCXA 1KCDA 1JTAA 5C1EA 4W8RA 1BN8A 3VSUA 3GRHA 3ZSCA 2BSPA 3JURA 4XKWA 1WMRA 1O8GA 3GQ8A 1O8MA 1CZFA 4NK6A 4YZAA 4AVZA 4W8TA 1RMGA 1RWRA 4I84A 4XN0A 3WWGA 1AIRA 1PLUA 2NTBA 1NHCA 4XM3A 4W8QA 2IQ7A 4PMHA 4XMYA 4XR6A 2O1DA 4W8SA 2QX3A 3VSTA 2X6YA 4XLFA 4XOPA 1K5CA 2NTQA 1IDKA 1O8KA 2NSTA 1DBOA 2X6XA 1XG2A 1KTWA 1H80A 2ODLA 4XKVA 4NK8A 3T9GA 4OJOA 1OGMX 1O8JA 4URRA 1VBLA 2VJIA 1OOCA 1OFMA 4Z06A 2NTPA 4YELA 4XLCA 1O8DA 1OGOX 4XLEA 4YZ0A 1KCCA 1O8IA 4U49A 2X6WA 2INVA 4XNFA 2PYGA 4OJ5A 4XLHA 3VSVA 4OZYA 4EW9A 3B90A 2VBMA 1IA5A 3SUCA 4OJLA 4C2LA 4U4BA 4XQFA 2QXZA 3UW0A 4HWVA 4MXNA 2INUA 4XN3A 1QJVA 3LMWA 2PYHA 4OZZA 3B8YA 3VMWA 4MR0A 4XOTA 4YZQA 1O8EA 1O8HA 4XL9A 2UVEA 3EQNA 2NT9A
chains in the Genus database with same CATH superfamily
1K8FA 1LLZA 4YC5A 4Z05A 3B4NA 2O17A 1O88A 5AMVA 4XORA 1IB4A 2O0WA 4XONA 4V02C 3GQAA 1LM1A 4XLAA 3ZPPA 1EE6A 5C1CA 3KRGA 1PE9A 3JX8A 2X3HA 2QZAA 1O8LA 1OFLA 2EWEA 3GQ7A 1DBGA 2VBKA 2O0VA 2BM6A 4YEJA 3P4GA 1RU4A 3N6ZA 4YCQA 2VJJA 4YEIA 3SZEA 3PETA 2PECA 2NT6A 2F3LA 3ML3A 1O8FA 1X0CA 4OJ6A 2VFPA 1JRGA 1HF2A 4YZXA 1PXZA 3SQVA 2NZMA 4OJPA 2VBEA 1IDJA 2G0YA 3SY2A 3VMVA 2BM4A 3EQOA 2O04A 2QY1A 2IOUG 2NSPA 3GQ9A 1GQ8A 4YDTA 3PSSA 3FY3A 1K4ZA 1BHEA 2UVFA 2XC1A 1EA0A 2X85A 2XTWA 2Z8GA 1HG8A 4Z03A 1QCXA 1QQ1A 1KCDA 1DABA 3NAWA 1JTAA 3SYJA 5C1EA 4W8RA 1BN8A 3VSUA 3GRHA 3ZSCA 2VFQA 1EZGA 2XTXA 2BSPA 1OFEA 3JURA 1WXRA 2XTYA 3BH7B 1WMRA 2BX6A 1O8GA 4XKWA 3GQ8A 1O8MA 3LYCA 1CZFA 4NK6A 4YZAA 4AVZA 4W8TA 1RMGA 1RWRA 4I84A 4XN0A 3WWGA 1AIRA 1PLUA 2NTBA 2YUHA 4XM3A 1TYWA 1NHCA 4W8QA 2IQ7A 2V5IA 4PMHA 1L1IA 2J8KA 1TSPA 1QA1A 1LLWA 4XMYA 4XR6A 2O1DA 4W8SA 2QX3A 3VSTA 1TYVA 2X6YA 4XLFA 3DU1X 4XOPA 2NTQA 1K5CA 1IDKA 1O8KA 1QRBA 1DBOA 2NSTA 1XG2A 2X6XA 4OPWA 1KTWA 1H80A 2ODLA 4XKVA 4NK8A 5DNSA 3T9GA 2BM5A 4OJOA 1OGMX 1O8JA 3N90A 4URRA 4JRAC 1VBLA 2B0RA 4KH3A 2VJIA 3H09A 1OOCA 1QRCA 1OFMA 2J8IA 2NTPA 4YELA 4Z06A 4XLCA 1O8DA 3RIQA 1OGOX 2VFMA 2VFNA 4XLEA 3TH0A 2XT2A 1TYXA 4YZ0A 1KCCA 1O8IA 4U49A 2X6WA 5JLVC 2O6WA 5JMCB 1QA3A 2INVA 4XNFA 3AK5A 2PYGA 4OJ5A 4XLHA 1KQ5A 3VSVA 4OZYA 4EW9A 3B90A 2VBMA 3PSZA 1IA5A 3SUCA 4OJLA 4C2LA 2BM7A 4U4BA 4XQFA 2QXZA 3UW0A 4HWVA 2XT4A 4MXNA 3LJYA 2INUA 4XN3A 1QJVA 1OFDA 3LMWA 2PYHA 4OZZA 3B8YA 2W7ZA 1QA2A 3VMWA 3NB2A 2VFOA 4OM9A 4MR0A 1CLWA 4YFOA 2QYUA 1TYUA 4XOTA 4YZQA 1O8EA 1O8HA 4XL9A 3BH6B 2UVEA 3EQNA 2NT9A
chains in the Genus database with same CATH topology
4Z05A 3B4NA 2O17A 1O88A 5AMVA 4XORA 1IB4A 2O0WA 4XONA 3GQAA 4XLAA 3ZPPA 1EE6A 5C1CA 3KRGA 1PE9A 2X3HA 1O8LA 1OFLA 2EWEA 3GQ7A 1DBGA 2VBKA 2O0VA 4YEJA 1RU4A 2VJJA 2PECA 2NT6A 4OJ6A 1O8FA 1X0CA 1JRGA 4YZXA 1PXZA 2NZMA 4OJPA 2VBEA 1IDJA 3VMVA 3EQOA 2O04A 2QY1A 2NSPA 3GQ9A 1GQ8A 3FY3A 1BHEA 2UVFA 2X85A 2Z8GA 1HG8A 4Z03A 1QCXA 1KCDA 1JTAA 5C1EA 4W8RA 1BN8A 3VSUA 3GRHA 3ZSCA 2BSPA 3JURA 4XKWA 1WMRA 1O8GA 3GQ8A 1O8MA 1CZFA 4NK6A 4YZAA 4AVZA 4W8TA 1RMGA 1RWRA 4I84A 4XN0A 3WWGA 1AIRA 1PLUA 2NTBA 1NHCA 4XM3A 4W8QA 2IQ7A 4PMHA 4XMYA 4XR6A 2O1DA 4W8SA 2QX3A 3VSTA 2X6YA 4XLFA 4XOPA 1K5CA 2NTQA 1IDKA 1O8KA 2NSTA 1DBOA 2X6XA 1XG2A 1KTWA 1H80A 2ODLA 4XKVA 4NK8A 3T9GA 4OJOA 1OGMX 1O8JA 4URRA 1VBLA 2VJIA 1OOCA 1OFMA 4Z06A 2NTPA 4YELA 4XLCA 1O8DA 1OGOX 4XLEA 4YZ0A 1KCCA 1O8IA 4U49A 2X6WA 2INVA 4XNFA 2PYGA 4OJ5A 4XLHA 3VSVA 4OZYA 4EW9A 3B90A 2VBMA 1IA5A 3SUCA 4OJLA 4C2LA 4U4BA 4XQFA 2QXZA 3UW0A 4HWVA 4MXNA 2INUA 4XN3A 1QJVA 3LMWA 2PYHA 4OZZA 3B8YA 3VMWA 4MR0A 4XOTA 4YZQA 1O8EA 1O8HA 4XL9A 2UVEA 3EQNA 2NT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z05 A;  3B4N A;  2O17 A;  1O88 A;  5AMV A;  4XOR A;  1IB4 A;  2O0W A;  4XON A;  3GQA A;  4XLA A;  3ZPP A;  1EE6 A;  5C1C A;  3KRG A;  1PE9 A;  2X3H A;  1O8L A;  1OFL A;  2EWE A;  3GQ7 A;  1DBG A;  2VBK A;  2O0V A;  4YEJ A;  1RU4 A;  2VJJ A;  2PEC A;  2NT6 A;  4OJ6 A;  1O8F A;  1X0C A;  1JRG A;  4YZX A;  1PXZ A;  2NZM A;  4OJP A;  2VBE A;  1IDJ A;  3VMV A;  3EQO A;  2O04 A;  2QY1 A;  2NSP A;  3GQ9 A;  1GQ8 A;  3FY3 A;  1BHE A;  2UVF A;  2X85 A;  2Z8G A;  1HG8 A;  4Z03 A;  1QCX A;  1KCD A;  1JTA A;  5C1E A;  4W8R A;  1BN8 A;  3VSU A;  3GRH A;  3ZSC A;  2BSP A;  3JUR A;  4XKW A;  1WMR A;  1O8G A;  3GQ8 A;  1O8M A;  1CZF A;  4NK6 A;  4YZA A;  4AVZ A;  4W8T A;  1RMG A;  1RWR A;  4I84 A;  4XN0 A;  3WWG A;  1AIR A;  1PLU A;  2NTB A;  1NHC A;  4XM3 A;  4W8Q A;  2IQ7 A;  4PMH A;  4XMY A;  4XR6 A;  2O1D A;  4W8S A;  2QX3 A;  3VST A;  2X6Y A;  4XLF A;  4XOP A;  1K5C A;  2NTQ A;  1IDK A;  1O8K A;  2NST A;  1DBO A;  2X6X A;  1XG2 A;  1KTW A;  1H80 A;  2ODL A;  4XKV A;  4NK8 A;  3T9G A;  4OJO A;  1OGM X;  1O8J A;  4URR A;  1VBL A;  2VJI A;  1OOC A;  1OFM A;  4Z06 A;  2NTP A;  4YEL A;  4XLC A;  1O8D A;  1OGO X;  4XLE A;  4YZ0 A;  1KCC A;  1O8I A;  4U49 A;  2X6W A;  2INV A;  4XNF A;  2PYG A;  4OJ5 A;  4XLH A;  3VSV A;  4OZY A;  4EW9 A;  3B90 A;  2VBM A;  1IA5 A;  3SUC A;  4OJL A;  4C2L A;  4U4B A;  4XQF A;  2QXZ A;  3UW0 A;  4HWV A;  4MXN A;  2INU A;  4XN3 A;  1QJV A;  3LMW A;  2PYH A;  4OZZ A;  3B8Y A;  3VMW A;  4MR0 A;  4XOT A;  4YZQ A;  1O8E A;  1O8H A;  4XL9 A;  2UVE A;  3EQN A;  2NT9 A; 
#chains in the Genus database with same CATH topology
 1K8F A;  1LLZ A;  4YC5 A;  4Z05 A;  3B4N A;  2O17 A;  1O88 A;  5AMV A;  4XOR A;  1IB4 A;  2O0W A;  4XON A;  4V02 C;  3GQA A;  1LM1 A;  4XLA A;  3ZPP A;  1EE6 A;  5C1C A;  3KRG A;  1PE9 A;  3JX8 A;  2X3H A;  2QZA A;  1O8L A;  1OFL A;  2EWE A;  3GQ7 A;  1DBG A;  2VBK A;  2O0V A;  2BM6 A;  4YEJ A;  3P4G A;  1RU4 A;  3N6Z A;  4YCQ A;  2VJJ A;  4YEI A;  3SZE A;  3PET A;  2PEC A;  2NT6 A;  2F3L A;  3ML3 A;  1O8F A;  1X0C A;  4OJ6 A;  2VFP A;  1JRG A;  1HF2 A;  4YZX A;  1PXZ A;  3SQV A;  2NZM A;  4OJP A;  2VBE A;  1IDJ A;  2G0Y A;  3SY2 A;  3VMV A;  2BM4 A;  3EQO A;  2O04 A;  2QY1 A;  2IOU G;  2NSP A;  3GQ9 A;  1GQ8 A;  4YDT A;  3PSS A;  3FY3 A;  1K4Z A;  1BHE A;  2UVF A;  2XC1 A;  1EA0 A;  2X85 A;  2XTW A;  2Z8G A;  1HG8 A;  4Z03 A;  1QCX A;  1QQ1 A;  1KCD A;  1DAB A;  3NAW A;  1JTA A;  3SYJ A;  5C1E A;  4W8R A;  1BN8 A;  3VSU A;  3GRH A;  3ZSC A;  2VFQ A;  1EZG A;  2XTX A;  2BSP A;  1OFE A;  3JUR A;  1WXR A;  2XTY A;  3BH7 B;  1WMR A;  2BX6 A;  1O8G A;  4XKW A;  3GQ8 A;  1O8M A;  3LYC A;  1CZF A;  4NK6 A;  4YZA A;  4AVZ A;  4W8T A;  1RMG A;  1RWR A;  4I84 A;  4XN0 A;  3WWG A;  1AIR A;  1PLU A;  2NTB A;  2YUH A;  4XM3 A;  1TYW A;  1NHC A;  4W8Q A;  2IQ7 A;  2V5I A;  4PMH A;  1L1I A;  2J8K A;  1TSP A;  1QA1 A;  1LLW A;  4XMY A;  4XR6 A;  2O1D A;  4W8S A;  2QX3 A;  3VST A;  1TYV A;  2X6Y A;  4XLF A;  3DU1 X;  4XOP A;  2NTQ A;  1K5C A;  1IDK A;  1O8K A;  1QRB A;  1DBO A;  2NST A;  1XG2 A;  2X6X A;  4OPW A;  1KTW A;  1H80 A;  2ODL A;  4XKV A;  4NK8 A;  5DNS A;  3T9G A;  2BM5 A;  4OJO A;  1OGM X;  1O8J A;  3N90 A;  4URR A;  4JRA C;  1VBL A;  2B0R A;  4KH3 A;  2VJI A;  3H09 A;  1OOC A;  1QRC A;  1OFM A;  2J8I A;  2NTP A;  4YEL A;  4Z06 A;  4XLC A;  1O8D A;  3RIQ A;  1OGO X;  2VFM A;  2VFN A;  4XLE A;  3TH0 A;  2XT2 A;  1TYX A;  4YZ0 A;  1KCC A;  1O8I A;  4U49 A;  2X6W A;  5JLV C;  2O6W A;  5JMC B;  1QA3 A;  2INV A;  4XNF A;  3AK5 A;  2PYG A;  4OJ5 A;  4XLH A;  1KQ5 A;  3VSV A;  4OZY A;  4EW9 A;  3B90 A;  2VBM A;  3PSZ A;  1IA5 A;  3SUC A;  4OJL A;  4C2L A;  2BM7 A;  4U4B A;  4XQF A;  2QXZ A;  3UW0 A;  4HWV A;  2XT4 A;  4MXN A;  3LJY A;  2INU A;  4XN3 A;  1QJV A;  1OFD A;  3LMW A;  2PYH A;  4OZZ A;  3B8Y A;  2W7Z A;  1QA2 A;  3VMW A;  3NB2 A;  2VFO A;  4OM9 A;  4MR0 A;  1CLW A;  4YFO A;  2QYU A;  1TYU A;  4XOT A;  4YZQ A;  1O8E A;  1O8H A;  4XL9 A;  3BH6 B;  2UVE A;  3EQN A;  2NT9 A; 
#chains in the Genus database with same CATH homology
 4Z05 A;  3B4N A;  2O17 A;  1O88 A;  5AMV A;  4XOR A;  1IB4 A;  2O0W A;  4XON A;  3GQA A;  4XLA A;  3ZPP A;  1EE6 A;  5C1C A;  3KRG A;  1PE9 A;  2X3H A;  1O8L A;  1OFL A;  2EWE A;  3GQ7 A;  1DBG A;  2VBK A;  2O0V A;  4YEJ A;  1RU4 A;  2VJJ A;  2PEC A;  2NT6 A;  4OJ6 A;  1O8F A;  1X0C A;  1JRG A;  4YZX A;  1PXZ A;  2NZM A;  4OJP A;  2VBE A;  1IDJ A;  3VMV A;  3EQO A;  2O04 A;  2QY1 A;  2NSP A;  3GQ9 A;  1GQ8 A;  3FY3 A;  1BHE A;  2UVF A;  2X85 A;  2Z8G A;  1HG8 A;  4Z03 A;  1QCX A;  1KCD A;  1JTA A;  5C1E A;  4W8R A;  1BN8 A;  3VSU A;  3GRH A;  3ZSC A;  2BSP A;  3JUR A;  4XKW A;  1WMR A;  1O8G A;  3GQ8 A;  1O8M A;  1CZF A;  4NK6 A;  4YZA A;  4AVZ A;  4W8T A;  1RMG A;  1RWR A;  4I84 A;  4XN0 A;  3WWG A;  1AIR A;  1PLU A;  2NTB A;  1NHC A;  4XM3 A;  4W8Q A;  2IQ7 A;  4PMH A;  4XMY A;  4XR6 A;  2O1D A;  4W8S A;  2QX3 A;  3VST A;  2X6Y A;  4XLF A;  4XOP A;  1K5C A;  2NTQ A;  1IDK A;  1O8K A;  2NST A;  1DBO A;  2X6X A;  1XG2 A;  1KTW A;  1H80 A;  2ODL A;  4XKV A;  4NK8 A;  3T9G A;  4OJO A;  1OGM X;  1O8J A;  4URR A;  1VBL A;  2VJI A;  1OOC A;  1OFM A;  4Z06 A;  2NTP A;  4YEL A;  4XLC A;  1O8D A;  1OGO X;  4XLE A;  4YZ0 A;  1KCC A;  1O8I A;  4U49 A;  2X6W A;  2INV A;  4XNF A;  2PYG A;  4OJ5 A;  4XLH A;  3VSV A;  4OZY A;  4EW9 A;  3B90 A;  2VBM A;  1IA5 A;  3SUC A;  4OJL A;  4C2L A;  4U4B A;  4XQF A;  2QXZ A;  3UW0 A;  4HWV A;  4MXN A;  2INU A;  4XN3 A;  1QJV A;  3LMW A;  2PYH A;  4OZZ A;  3B8Y A;  3VMW A;  4MR0 A;  4XOT A;  4YZQ A;  1O8E A;  1O8H A;  4XL9 A;  2UVE A;  3EQN A;  2NT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...