2VBMA

Tailspike protein of bacteriophage sf6 complexed with tetrasaccharide
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
509
structure length
509
Chain Sequence
GPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords TAILSPIKE-PROTEIN
publication title An Intersubunit Active Site between Supercoiled Parallel Beta Helices in the Trimeric Tailspike Endorhamnosidase of Shigella Flexneri Phage Sf6.
pubmed doi rcsb
source organism Enterobacteria phage sf6
total genus 187
structure length 509
sequence length 509
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vbmA00
4XLFA 2QXZA 2ODLA 3B90A 2PECA 4OJOA 1O8GA 2X3HA 4XN3A 4XORA 3GQAA 1O8KA 3VMWA 1JRGA 1CZFA 2NZMA 3EQOA 2NTBA 4XQFA 4OJPA 2O0VA 3GRHA 1O8JA 1IA5A 3LMWA 2O1DA 3ZPPA 1OGMX 4NK8A 1H80A 3EQNA 2INVA 2VBKA 4W8RA 1PE9A 4OJ5A 3SUCA 4XLHA 4XKVA 1RMGA 3GQ7A 4Z05A 4XLEA 1O8LA 1GQ8A 3WWGA 1O8IA 4NK6A 2NSTA 1DBOA 4OZYA 1OFLA 1IB4A 1KCCA 2X85A 2EWEA 1O8EA 1RU4A 3VSTA 2X6YA 4XKWA 4YZQA 3VSUA 5C1EA 1BN8A 1K5CA 3GQ8A 4YZXA 2NSPA 4YEJA 2UVFA 2VBMA 1AIRA 2VJIA 4Z03A 2IQ7A 4XM3A 1IDKA 1BHEA 2X6XA 1OFMA 4U49A 1KTWA 3VMVA 2BSPA 1O88A 2Z8GA 4YELA 4MXNA 3VSVA 2VBEA 4OZZA 4URRA 4W8QA 1OOCA 4XR6A 4EW9A 3FY3A 4AVZA 1WMRA 5C1CA 1KCDA 4YZ0A 5AMVA 1O8MA 4PMHA 4XL9A 4XNFA 4OJ6A 1QJVA 2QX3A 4HWVA 4MR0A 4YZAA 1JTAA 1PLUA 2INUA 4I84A 2PYHA 4XLCA 2NT9A 1HG8A 1PXZA 1QCXA 1XG2A 4Z06A 2O0WA 1IDJA 2NTPA 2PYGA 2NTQA 2O04A 4XN0A 4OJLA 2QY1A 1RWRA 4XMYA 4W8SA 3GQ9A 4XOTA 4W8TA 1O8HA 3KRGA 3T9GA 2O17A 1O8FA 4XOPA 4C2LA 4XONA 1EE6A 3ZSCA 3JURA 1O8DA 2UVEA 2X6WA 1NHCA 2VJJA 4XLAA 2NT6A 3B8YA 1DBGA 1X0CA 3UW0A 4U4BA 1VBLA 3B4NA 1OGOX
chains in the Genus database with same CATH superfamily
4XLFA 4KH3A 2QXZA 2ODLA 3B90A 1QA2A 2BM7A 2PECA 4JRAC 4OJOA 1O8GA 2X3HA 4XN3A 4XORA 3GQAA 1O8KA 1EA0A 3SY2A 3VMWA 1JRGA 1CZFA 2NZMA 3EQOA 2NTBA 4XQFA 2BM5A 4OJPA 2W7ZA 2O0VA 3GRHA 3SZEA 1QQ1A 4YDTA 1O8JA 1CLWA 1IA5A 4YEIA 4V02C 3LMWA 2IOUG 2O1DA 2VFMA 3ZPPA 1OGMX 3BH7B 2QZAA 4NK8A 1OFDA 1H80A 3EQNA 2J8KA 2INVA 2VBKA 4W8RA 3JX8A 2XC1A 1PE9A 4OJ5A 3SUCA 4XLHA 4XKVA 5JLVC 1RMGA 2XTWA 3GQ7A 4XLEA 4Z05A 1O8LA 1GQ8A 3NAWA 3WWGA 1O8IA 4NK6A 2NSTA 1DBOA 4OZYA 1OFLA 1IB4A 1KCCA 2X85A 3LJYA 2EWEA 1O8EA 1RU4A 2VFOA 3VSTA 2X6YA 4XKWA 1LM1A 4YZQA 3VSUA 5C1EA 3N6ZA 2O6WA 1BN8A 1K5CA 3GQ8A 1TYWA 4YZXA 4YCQA 2QYUA 2NSPA 4YFOA 3SYJA 4YEJA 2UVFA 2VBMA 1AIRA 2VJIA 3SQVA 4OPWA 3RIQA 4Z03A 1QA3A 2IQ7A 4XM3A 1IDKA 1BHEA 2X6XA 3LYCA 2VFNA 1HF2A 3AK5A 1OFMA 4U49A 1KTWA 3VMVA 5JMCB 2BSPA 1O88A 1TSPA 2Z8GA 4MXNA 4YELA 3VSVA 1QA1A 2VBEA 4OZZA 4URRA 4W8QA 1OOCA 3N90A 4XR6A 4EW9A 3FY3A 3DU1X 4AVZA 2B0RA 1WMRA 5C1CA 1K4ZA 4YZ0A 5AMVA 1O8MA 1KCDA 2XT4A 4PMHA 4XL9A 4OJ6A 4XNFA 1QJVA 2BX6A 2QX3A 4HWVA 3PSZA 4MR0A 4OM9A 1JTAA 1PLUA 1LLWA 2INUA 4YZAA 3BH6B 4I84A 2PYHA 4XLCA 2NT9A 1HG8A 1PXZA 1QCXA 1QRBA 1XG2A 4Z06A 2O0WA 2XT2A 1IDJA 1TYVA 2NTPA 2PYGA 2NTQA 2O04A 3PSSA 4XN0A 4OJLA 1RWRA 2QY1A 3P4GA 3NB2A 2YUHA 4W8SA 1K8FA 3GQ9A 4XMYA 5DNSA 1LLZA 4XOTA 4W8TA 1O8HA 1EZGA 3PETA 3H09A 3KRGA 1DABA 3T9GA 2VFQA 2O17A 1O8FA 4XOPA 2V5IA 2F3LA 4C2LA 1WXRA 3ML3A 1EE6A 4XONA 3ZSCA 2XTXA 3JURA 1O8DA 2BM6A 2UVEA 2X6WA 1NHCA 2G0YA 2VJJA 4XLAA 2NT6A 1QRCA 1KQ5A 2VFPA 1OFEA 3B8YA 1DBGA 4YC5A 1X0CA 1TYXA 3UW0A 2XTYA 4U4BA 3TH0A 1VBLA 1L1IA 3B4NA 1OGOX 2J8IA 2BM4A 1TYUA
chains in the Genus database with same CATH topology
4XLFA 2QXZA 2ODLA 3B90A 2PECA 4OJOA 1O8GA 2X3HA 4XN3A 4XORA 3GQAA 1O8KA 3VMWA 1JRGA 1CZFA 2NZMA 3EQOA 2NTBA 4XQFA 4OJPA 2O0VA 3GRHA 1O8JA 1IA5A 3LMWA 2O1DA 3ZPPA 1OGMX 4NK8A 1H80A 3EQNA 2INVA 2VBKA 4W8RA 1PE9A 4OJ5A 3SUCA 4XLHA 4XKVA 1RMGA 3GQ7A 4Z05A 4XLEA 1O8LA 1GQ8A 3WWGA 1O8IA 4NK6A 2NSTA 1DBOA 4OZYA 1OFLA 1IB4A 1KCCA 2X85A 2EWEA 1O8EA 1RU4A 3VSTA 2X6YA 4XKWA 4YZQA 3VSUA 5C1EA 1BN8A 1K5CA 3GQ8A 4YZXA 2NSPA 4YEJA 2UVFA 2VBMA 1AIRA 2VJIA 4Z03A 2IQ7A 4XM3A 1IDKA 1BHEA 2X6XA 1OFMA 4U49A 1KTWA 3VMVA 2BSPA 1O88A 2Z8GA 4YELA 4MXNA 3VSVA 2VBEA 4OZZA 4URRA 4W8QA 1OOCA 4XR6A 4EW9A 3FY3A 4AVZA 1WMRA 5C1CA 1KCDA 4YZ0A 5AMVA 1O8MA 4PMHA 4XL9A 4XNFA 4OJ6A 1QJVA 2QX3A 4HWVA 4MR0A 4YZAA 1JTAA 1PLUA 2INUA 4I84A 2PYHA 4XLCA 2NT9A 1HG8A 1PXZA 1QCXA 1XG2A 4Z06A 2O0WA 1IDJA 2NTPA 2PYGA 2NTQA 2O04A 4XN0A 4OJLA 2QY1A 1RWRA 4XMYA 4W8SA 3GQ9A 4XOTA 4W8TA 1O8HA 3KRGA 3T9GA 2O17A 1O8FA 4XOPA 4C2LA 4XONA 1EE6A 3ZSCA 3JURA 1O8DA 2UVEA 2X6WA 1NHCA 2VJJA 4XLAA 2NT6A 3B8YA 1DBGA 1X0CA 3UW0A 4U4BA 1VBLA 3B4NA 1OGOX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLF A;  2QXZ A;  2ODL A;  3B90 A;  2PEC A;  4OJO A;  1O8G A;  2X3H A;  4XN3 A;  4XOR A;  3GQA A;  1O8K A;  3VMW A;  1JRG A;  1CZF A;  2NZM A;  3EQO A;  2NTB A;  4XQF A;  4OJP A;  2O0V A;  3GRH A;  1O8J A;  1IA5 A;  3LMW A;  2O1D A;  3ZPP A;  1OGM X;  4NK8 A;  1H80 A;  3EQN A;  2INV A;  2VBK A;  4W8R A;  1PE9 A;  4OJ5 A;  3SUC A;  4XLH A;  4XKV A;  1RMG A;  3GQ7 A;  4Z05 A;  4XLE A;  1O8L A;  1GQ8 A;  3WWG A;  1O8I A;  4NK6 A;  2NST A;  1DBO A;  4OZY A;  1OFL A;  1IB4 A;  1KCC A;  2X85 A;  2EWE A;  1O8E A;  1RU4 A;  3VST A;  2X6Y A;  4XKW A;  4YZQ A;  3VSU A;  5C1E A;  1BN8 A;  1K5C A;  3GQ8 A;  4YZX A;  2NSP A;  4YEJ A;  2UVF A;  2VBM A;  1AIR A;  2VJI A;  4Z03 A;  2IQ7 A;  4XM3 A;  1IDK A;  1BHE A;  2X6X A;  1OFM A;  4U49 A;  1KTW A;  3VMV A;  2BSP A;  1O88 A;  2Z8G A;  4YEL A;  4MXN A;  3VSV A;  2VBE A;  4OZZ A;  4URR A;  4W8Q A;  1OOC A;  4XR6 A;  4EW9 A;  3FY3 A;  4AVZ A;  1WMR A;  5C1C A;  1KCD A;  4YZ0 A;  5AMV A;  1O8M A;  4PMH A;  4XL9 A;  4XNF A;  4OJ6 A;  1QJV A;  2QX3 A;  4HWV A;  4MR0 A;  4YZA A;  1JTA A;  1PLU A;  2INU A;  4I84 A;  2PYH A;  4XLC A;  2NT9 A;  1HG8 A;  1PXZ A;  1QCX A;  1XG2 A;  4Z06 A;  2O0W A;  1IDJ A;  2NTP A;  2PYG A;  2NTQ A;  2O04 A;  4XN0 A;  4OJL A;  2QY1 A;  1RWR A;  4XMY A;  4W8S A;  3GQ9 A;  4XOT A;  4W8T A;  1O8H A;  3KRG A;  3T9G A;  2O17 A;  1O8F A;  4XOP A;  4C2L A;  4XON A;  1EE6 A;  3ZSC A;  3JUR A;  1O8D A;  2UVE A;  2X6W A;  1NHC A;  2VJJ A;  4XLA A;  2NT6 A;  3B8Y A;  1DBG A;  1X0C A;  3UW0 A;  4U4B A;  1VBL A;  3B4N A;  1OGO X; 
#chains in the Genus database with same CATH topology
 4XLF A;  4KH3 A;  2QXZ A;  2ODL A;  3B90 A;  1QA2 A;  2BM7 A;  2PEC A;  4JRA C;  4OJO A;  1O8G A;  2X3H A;  4XN3 A;  4XOR A;  3GQA A;  1O8K A;  1EA0 A;  3SY2 A;  3VMW A;  1JRG A;  1CZF A;  2NZM A;  3EQO A;  2NTB A;  4XQF A;  2BM5 A;  4OJP A;  2W7Z A;  2O0V A;  3GRH A;  3SZE A;  1QQ1 A;  4YDT A;  1O8J A;  1CLW A;  1IA5 A;  4YEI A;  4V02 C;  3LMW A;  2IOU G;  2O1D A;  2VFM A;  3ZPP A;  1OGM X;  3BH7 B;  2QZA A;  4NK8 A;  1OFD A;  1H80 A;  3EQN A;  2J8K A;  2INV A;  2VBK A;  4W8R A;  3JX8 A;  2XC1 A;  1PE9 A;  4OJ5 A;  3SUC A;  4XLH A;  4XKV A;  5JLV C;  1RMG A;  2XTW A;  3GQ7 A;  4XLE A;  4Z05 A;  1O8L A;  1GQ8 A;  3NAW A;  3WWG A;  1O8I A;  4NK6 A;  2NST A;  1DBO A;  4OZY A;  1OFL A;  1IB4 A;  1KCC A;  2X85 A;  3LJY A;  2EWE A;  1O8E A;  1RU4 A;  2VFO A;  3VST A;  2X6Y A;  4XKW A;  1LM1 A;  4YZQ A;  3VSU A;  5C1E A;  3N6Z A;  2O6W A;  1BN8 A;  1K5C A;  3GQ8 A;  1TYW A;  4YZX A;  4YCQ A;  2QYU A;  2NSP A;  4YFO A;  3SYJ A;  4YEJ A;  2UVF A;  2VBM A;  1AIR A;  2VJI A;  3SQV A;  4OPW A;  3RIQ A;  4Z03 A;  1QA3 A;  2IQ7 A;  4XM3 A;  1IDK A;  1BHE A;  2X6X A;  3LYC A;  2VFN A;  1HF2 A;  3AK5 A;  1OFM A;  4U49 A;  1KTW A;  3VMV A;  5JMC B;  2BSP A;  1O88 A;  1TSP A;  2Z8G A;  4MXN A;  4YEL A;  3VSV A;  1QA1 A;  2VBE A;  4OZZ A;  4URR A;  4W8Q A;  1OOC A;  3N90 A;  4XR6 A;  4EW9 A;  3FY3 A;  3DU1 X;  4AVZ A;  2B0R A;  1WMR A;  5C1C A;  1K4Z A;  4YZ0 A;  5AMV A;  1O8M A;  1KCD A;  2XT4 A;  4PMH A;  4XL9 A;  4OJ6 A;  4XNF A;  1QJV A;  2BX6 A;  2QX3 A;  4HWV A;  3PSZ A;  4MR0 A;  4OM9 A;  1JTA A;  1PLU A;  1LLW A;  2INU A;  4YZA A;  3BH6 B;  4I84 A;  2PYH A;  4XLC A;  2NT9 A;  1HG8 A;  1PXZ A;  1QCX A;  1QRB A;  1XG2 A;  4Z06 A;  2O0W A;  2XT2 A;  1IDJ A;  1TYV A;  2NTP A;  2PYG A;  2NTQ A;  2O04 A;  3PSS A;  4XN0 A;  4OJL A;  1RWR A;  2QY1 A;  3P4G A;  3NB2 A;  2YUH A;  4W8S A;  1K8F A;  3GQ9 A;  4XMY A;  5DNS A;  1LLZ A;  4XOT A;  4W8T A;  1O8H A;  1EZG A;  3PET A;  3H09 A;  3KRG A;  1DAB A;  3T9G A;  2VFQ A;  2O17 A;  1O8F A;  4XOP A;  2V5I A;  2F3L A;  4C2L A;  1WXR A;  3ML3 A;  1EE6 A;  4XON A;  3ZSC A;  2XTX A;  3JUR A;  1O8D A;  2BM6 A;  2UVE A;  2X6W A;  1NHC A;  2G0Y A;  2VJJ A;  4XLA A;  2NT6 A;  1QRC A;  1KQ5 A;  2VFP A;  1OFE A;  3B8Y A;  1DBG A;  4YC5 A;  1X0C A;  1TYX A;  3UW0 A;  2XTY A;  4U4B A;  3TH0 A;  1VBL A;  1L1I A;  3B4N A;  1OGO X;  2J8I A;  2BM4 A;  1TYU A; 
#chains in the Genus database with same CATH homology
 4XLF A;  2QXZ A;  2ODL A;  3B90 A;  2PEC A;  4OJO A;  1O8G A;  2X3H A;  4XN3 A;  4XOR A;  3GQA A;  1O8K A;  3VMW A;  1JRG A;  1CZF A;  2NZM A;  3EQO A;  2NTB A;  4XQF A;  4OJP A;  2O0V A;  3GRH A;  1O8J A;  1IA5 A;  3LMW A;  2O1D A;  3ZPP A;  1OGM X;  4NK8 A;  1H80 A;  3EQN A;  2INV A;  2VBK A;  4W8R A;  1PE9 A;  4OJ5 A;  3SUC A;  4XLH A;  4XKV A;  1RMG A;  3GQ7 A;  4Z05 A;  4XLE A;  1O8L A;  1GQ8 A;  3WWG A;  1O8I A;  4NK6 A;  2NST A;  1DBO A;  4OZY A;  1OFL A;  1IB4 A;  1KCC A;  2X85 A;  2EWE A;  1O8E A;  1RU4 A;  3VST A;  2X6Y A;  4XKW A;  4YZQ A;  3VSU A;  5C1E A;  1BN8 A;  1K5C A;  3GQ8 A;  4YZX A;  2NSP A;  4YEJ A;  2UVF A;  2VBM A;  1AIR A;  2VJI A;  4Z03 A;  2IQ7 A;  4XM3 A;  1IDK A;  1BHE A;  2X6X A;  1OFM A;  4U49 A;  1KTW A;  3VMV A;  2BSP A;  1O88 A;  2Z8G A;  4YEL A;  4MXN A;  3VSV A;  2VBE A;  4OZZ A;  4URR A;  4W8Q A;  1OOC A;  4XR6 A;  4EW9 A;  3FY3 A;  4AVZ A;  1WMR A;  5C1C A;  1KCD A;  4YZ0 A;  5AMV A;  1O8M A;  4PMH A;  4XL9 A;  4XNF A;  4OJ6 A;  1QJV A;  2QX3 A;  4HWV A;  4MR0 A;  4YZA A;  1JTA A;  1PLU A;  2INU A;  4I84 A;  2PYH A;  4XLC A;  2NT9 A;  1HG8 A;  1PXZ A;  1QCX A;  1XG2 A;  4Z06 A;  2O0W A;  1IDJ A;  2NTP A;  2PYG A;  2NTQ A;  2O04 A;  4XN0 A;  4OJL A;  2QY1 A;  1RWR A;  4XMY A;  4W8S A;  3GQ9 A;  4XOT A;  4W8T A;  1O8H A;  3KRG A;  3T9G A;  2O17 A;  1O8F A;  4XOP A;  4C2L A;  4XON A;  1EE6 A;  3ZSC A;  3JUR A;  1O8D A;  2UVE A;  2X6W A;  1NHC A;  2VJJ A;  4XLA A;  2NT6 A;  3B8Y A;  1DBG A;  1X0C A;  3UW0 A;  4U4B A;  1VBL A;  3B4N A;  1OGO X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...