2VBMA

Tailspike protein of bacteriophage sf6 complexed with tetrasaccharide
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
509
structure length
509
Chain Sequence
b'GPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE-PROTEIN
publication title An Intersubunit Active Site between Supercoiled Parallel Beta Helices in the Trimeric Tailspike Endorhamnosidase of Shigella Flexneri Phage Sf6.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Viral protein
total genus 187
structure length 509
sequence length 509
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vbmA00
4XNFA 4W8TA 4NK8A 4YELA 2PYHA 2NSPA 1PE9A 1AIRA 4XMYA 3B8YA 3JURA 3ZSCA 4MR0A 3UW0A 2INVA 4XLHA 4OJPA 1QJVA 3VSTA 1IA5A 4OZZA 1IB4A 4U4BA 3GQ7A 4W8QA 4XOPA 2NTBA 1OGMX 4YEJA 4URRA 4XLEA 3EQOA 4OJLA 2QXZA 2QX3A 2O1DA 2NT6A 3WWGA 2X6YA 4XOTA 4YZAA 4XKWA 5AMVA 1PXZA 4Z06A 1OOCA 2X85A 2EWEA 1IDKA 4YZ0A 3GQAA 4EW9A 1O88A 2NTQA 2INUA 4I84A 2O0VA 4PMHA 5C1EA 4XN0A 1O8LA 1O8JA 1BHEA 1CZFA 3VSUA 1KCDA 4XLAA 3VMVA 2QY1A 1X0CA 1DBOA 2O17A 4YZQA 3FY3A 1H80A 1OGOX 1RWRA 1HG8A 1NHCA 1WMRA 2VBEA 4XM3A 3SUCA 4U49A 1RMGA 1O8FA 5C1CA 1KTWA 3LMWA 3VSVA 3GRHA 1K5CA 4OZYA 4XL9A 4XORA 1PLUA 3GQ8A 2ODLA 4OJOA 4HWVA 4OJ6A 1JTAA 1KCCA 2O04A 4XQFA 2BSPA 2IQ7A 1O8DA 1JRGA 1OFMA 2VJIA 2PECA 2Z8GA 1EE6A 2PYGA 1DBGA 2X6XA 4W8SA 4MXNA 4XKVA 2NTPA 4AVZA 3ZPPA 4W8RA 3VMWA 3T9GA 2NT9A 1RU4A 4XLCA 4XR6A 4OJ5A 4YZXA 2NZMA 2UVEA 1O8HA 1GQ8A 1XG2A 3EQNA 2O0WA 4XN3A 4NK6A 2UVFA 4Z05A 3B90A 4XLFA 4XONA 1BN8A 2VBMA 3GQ9A 1O8GA 2X3HA 4Z03A 2NSTA 4C2LA 1O8KA 1VBLA 3KRGA 2VJJA 1O8EA 2VBKA 1IDJA 2X6WA 1OFLA 1O8MA 1QCXA 3B4NA 1O8IA
chains in the Genus database with same CATH superfamily
3LYCA 4W8TA 2QZAA 4XNFA 2VFMA 4NK8A 3BH6B 2W7ZA 4YELA 2PYHA 2NSPA 1PE9A 1AIRA 4XMYA 4YEIA 3SYJA 3B8YA 3JURA 3ZSCA 2QYUA 4MR0A 4OPWA 3UW0A 3LJYA 2INVA 1OFEA 4XLHA 4OJPA 1QJVA 2VFOA 3VSTA 1IA5A 4OZZA 1IB4A 4U4BA 4OM9A 2B0RA 3GQ7A 4W8QA 4XOPA 2NTBA 2IOUG 1OGMX 4YEJA 4URRA 4XLEA 3EQOA 3ML3A 1QA1A 4OJLA 2QXZA 2QX3A 1QRCA 2O1DA 2NT6A 3WWGA 2X6YA 4XOTA 4YZAA 2XTWA 4XKWA 5AMVA 1PXZA 1TSPA 4Z06A 4YC5A 1OOCA 2BM7A 2X85A 2EWEA 1IDKA 1EA0A 4YZ0A 3GQAA 4EW9A 1O88A 2NTQA 2INUA 4I84A 1HF2A 1QA3A 2O0VA 4PMHA 5C1EA 4XN0A 1O8LA 2XT2A 1O8JA 5JLVC 1OFDA 1BHEA 1CZFA 3VSUA 1KCDA 4XLAA 3VMVA 2BM6A 2G0YA 2QY1A 1LLZA 3H09A 1X0CA 3P4GA 3PSZA 1DBOA 2O17A 4YZQA 3FY3A 1H80A 1OGOX 1RWRA 1HG8A 3DU1X 1NHCA 1WMRA 2VBEA 3NB2A 1TYUA 4XM3A 3SUCA 4U49A 1RMGA 1L1IA 2BM5A 1O8FA 3BH7B 1KTWA 3LMWA 3N90A 5C1CA 3NAWA 3VSVA 1QA2A 3GRHA 1K5CA 4OZYA 4XL9A 4XORA 1PLUA 3GQ8A 2ODLA 1TYVA 4OJOA 4HWVA 4OJ6A 1JTAA 3SZEA 2VFNA 1KCCA 1EZGA 2O04A 4XQFA 2BSPA 2IQ7A 1O8DA 1JRGA 1OFMA 2VJIA 2XC1A 4YCQA 2PECA 1LM1A 2BX6A 2Z8GA 3PETA 1EE6A 3SQVA 5JMCB 2PYGA 1DBGA 1K4ZA 2O6WA 2X6XA 4KH3A 4MXNA 4W8SA 4XKVA 1K8FA 2NTPA 1QRBA 4AVZA 3ZPPA 4W8RA 3PSSA 2XTXA 3VMWA 2VFPA 3T9GA 2J8KA 4V02C 2YUHA 2NT9A 1RU4A 4XLCA 4XR6A 4OJ5A 4YZXA 3TH0A 1LLWA 2F3LA 2NZMA 4JRAC 3RIQA 1WXRA 2UVEA 1O8HA 2XT4A 4YDTA 1GQ8A 1XG2A 3EQNA 2O0WA 3N6ZA 4XN3A 4NK6A 2J8IA 2UVFA 4Z05A 3B90A 5DNSA 4XLFA 1KQ5A 2BM4A 4XONA 3SY2A 1DABA 1BN8A 2VBMA 3GQ9A 1O8GA 2X3HA 4Z03A 2NSTA 4C2LA 1O8KA 1CLWA 1VBLA 2XTYA 1TYWA 4YFOA 3KRGA 2VJJA 1O8EA 2VBKA 2V5IA 1IDJA 2X6WA 1OFLA 3AK5A 1O8MA 1QCXA 1QQ1A 3B4NA 1TYXA 3JX8A 1O8IA 2VFQA
chains in the Genus database with same CATH topology
4XNFA 4W8TA 4NK8A 4YELA 2PYHA 2NSPA 1PE9A 1AIRA 4XMYA 3B8YA 3JURA 3ZSCA 4MR0A 3UW0A 2INVA 4XLHA 4OJPA 1QJVA 3VSTA 1IA5A 4OZZA 1IB4A 4U4BA 3GQ7A 4W8QA 4XOPA 2NTBA 1OGMX 4YEJA 4URRA 4XLEA 3EQOA 4OJLA 2QXZA 2QX3A 2O1DA 2NT6A 3WWGA 2X6YA 4XOTA 4YZAA 4XKWA 5AMVA 1PXZA 4Z06A 1OOCA 2X85A 2EWEA 1IDKA 4YZ0A 3GQAA 4EW9A 1O88A 2NTQA 2INUA 4I84A 2O0VA 4PMHA 5C1EA 4XN0A 1O8LA 1O8JA 1BHEA 1CZFA 3VSUA 1KCDA 4XLAA 3VMVA 2QY1A 1X0CA 1DBOA 2O17A 4YZQA 3FY3A 1H80A 1OGOX 1RWRA 1HG8A 1NHCA 1WMRA 2VBEA 4XM3A 3SUCA 4U49A 1RMGA 1O8FA 5C1CA 1KTWA 3LMWA 3VSVA 3GRHA 1K5CA 4OZYA 4XL9A 4XORA 1PLUA 3GQ8A 2ODLA 4OJOA 4HWVA 4OJ6A 1JTAA 1KCCA 2O04A 4XQFA 2BSPA 2IQ7A 1O8DA 1JRGA 1OFMA 2VJIA 2PECA 2Z8GA 1EE6A 2PYGA 1DBGA 2X6XA 4W8SA 4MXNA 4XKVA 2NTPA 4AVZA 3ZPPA 4W8RA 3VMWA 3T9GA 2NT9A 1RU4A 4XLCA 4XR6A 4OJ5A 4YZXA 2NZMA 2UVEA 1O8HA 1GQ8A 1XG2A 3EQNA 2O0WA 4XN3A 4NK6A 2UVFA 4Z05A 3B90A 4XLFA 4XONA 1BN8A 2VBMA 3GQ9A 1O8GA 2X3HA 4Z03A 2NSTA 4C2LA 1O8KA 1VBLA 3KRGA 2VJJA 1O8EA 2VBKA 1IDJA 2X6WA 1OFLA 1O8MA 1QCXA 3B4NA 1O8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XNF A;  4W8T A;  4NK8 A;  4YEL A;  2PYH A;  2NSP A;  1PE9 A;  1AIR A;  4XMY A;  3B8Y A;  3JUR A;  3ZSC A;  4MR0 A;  3UW0 A;  2INV A;  4XLH A;  4OJP A;  1QJV A;  3VST A;  1IA5 A;  4OZZ A;  1IB4 A;  4U4B A;  3GQ7 A;  4W8Q A;  4XOP A;  2NTB A;  1OGM X;  4YEJ A;  4URR A;  4XLE A;  3EQO A;  4OJL A;  2QXZ A;  2QX3 A;  2O1D A;  2NT6 A;  3WWG A;  2X6Y A;  4XOT A;  4YZA A;  4XKW A;  5AMV A;  1PXZ A;  4Z06 A;  1OOC A;  2X85 A;  2EWE A;  1IDK A;  4YZ0 A;  3GQA A;  4EW9 A;  1O88 A;  2NTQ A;  2INU A;  4I84 A;  2O0V A;  4PMH A;  5C1E A;  4XN0 A;  1O8L A;  1O8J A;  1BHE A;  1CZF A;  3VSU A;  1KCD A;  4XLA A;  3VMV A;  2QY1 A;  1X0C A;  1DBO A;  2O17 A;  4YZQ A;  3FY3 A;  1H80 A;  1OGO X;  1RWR A;  1HG8 A;  1NHC A;  1WMR A;  2VBE A;  4XM3 A;  3SUC A;  4U49 A;  1RMG A;  1O8F A;  5C1C A;  1KTW A;  3LMW A;  3VSV A;  3GRH A;  1K5C A;  4OZY A;  4XL9 A;  4XOR A;  1PLU A;  3GQ8 A;  2ODL A;  4OJO A;  4HWV A;  4OJ6 A;  1JTA A;  1KCC A;  2O04 A;  4XQF A;  2BSP A;  2IQ7 A;  1O8D A;  1JRG A;  1OFM A;  2VJI A;  2PEC A;  2Z8G A;  1EE6 A;  2PYG A;  1DBG A;  2X6X A;  4W8S A;  4MXN A;  4XKV A;  2NTP A;  4AVZ A;  3ZPP A;  4W8R A;  3VMW A;  3T9G A;  2NT9 A;  1RU4 A;  4XLC A;  4XR6 A;  4OJ5 A;  4YZX A;  2NZM A;  2UVE A;  1O8H A;  1GQ8 A;  1XG2 A;  3EQN A;  2O0W A;  4XN3 A;  4NK6 A;  2UVF A;  4Z05 A;  3B90 A;  4XLF A;  4XON A;  1BN8 A;  2VBM A;  3GQ9 A;  1O8G A;  2X3H A;  4Z03 A;  2NST A;  4C2L A;  1O8K A;  1VBL A;  3KRG A;  2VJJ A;  1O8E A;  2VBK A;  1IDJ A;  2X6W A;  1OFL A;  1O8M A;  1QCX A;  3B4N A;  1O8I A; 
#chains in the Genus database with same CATH topology
 3LYC A;  4W8T A;  2QZA A;  4XNF A;  2VFM A;  4NK8 A;  3BH6 B;  2W7Z A;  4YEL A;  2PYH A;  2NSP A;  1PE9 A;  1AIR A;  4XMY A;  4YEI A;  3SYJ A;  3B8Y A;  3JUR A;  3ZSC A;  2QYU A;  4MR0 A;  4OPW A;  3UW0 A;  3LJY A;  2INV A;  1OFE A;  4XLH A;  4OJP A;  1QJV A;  2VFO A;  3VST A;  1IA5 A;  4OZZ A;  1IB4 A;  4U4B A;  4OM9 A;  2B0R A;  3GQ7 A;  4W8Q A;  4XOP A;  2NTB A;  2IOU G;  1OGM X;  4YEJ A;  4URR A;  4XLE A;  3EQO A;  3ML3 A;  1QA1 A;  4OJL A;  2QXZ A;  2QX3 A;  1QRC A;  2O1D A;  2NT6 A;  3WWG A;  2X6Y A;  4XOT A;  4YZA A;  2XTW A;  4XKW A;  5AMV A;  1PXZ A;  1TSP A;  4Z06 A;  4YC5 A;  1OOC A;  2BM7 A;  2X85 A;  2EWE A;  1IDK A;  1EA0 A;  4YZ0 A;  3GQA A;  4EW9 A;  1O88 A;  2NTQ A;  2INU A;  4I84 A;  1HF2 A;  1QA3 A;  2O0V A;  4PMH A;  5C1E A;  4XN0 A;  1O8L A;  2XT2 A;  1O8J A;  5JLV C;  1OFD A;  1BHE A;  1CZF A;  3VSU A;  1KCD A;  4XLA A;  3VMV A;  2BM6 A;  2G0Y A;  2QY1 A;  1LLZ A;  3H09 A;  1X0C A;  3P4G A;  3PSZ A;  1DBO A;  2O17 A;  4YZQ A;  3FY3 A;  1H80 A;  1OGO X;  1RWR A;  1HG8 A;  3DU1 X;  1NHC A;  1WMR A;  2VBE A;  3NB2 A;  1TYU A;  4XM3 A;  3SUC A;  4U49 A;  1RMG A;  1L1I A;  2BM5 A;  1O8F A;  3BH7 B;  1KTW A;  3LMW A;  3N90 A;  5C1C A;  3NAW A;  3VSV A;  1QA2 A;  3GRH A;  1K5C A;  4OZY A;  4XL9 A;  4XOR A;  1PLU A;  3GQ8 A;  2ODL A;  1TYV A;  4OJO A;  4HWV A;  4OJ6 A;  1JTA A;  3SZE A;  2VFN A;  1KCC A;  1EZG A;  2O04 A;  4XQF A;  2BSP A;  2IQ7 A;  1O8D A;  1JRG A;  1OFM A;  2VJI A;  2XC1 A;  4YCQ A;  2PEC A;  1LM1 A;  2BX6 A;  2Z8G A;  3PET A;  1EE6 A;  3SQV A;  5JMC B;  2PYG A;  1DBG A;  1K4Z A;  2O6W A;  2X6X A;  4KH3 A;  4MXN A;  4W8S A;  4XKV A;  1K8F A;  2NTP A;  1QRB A;  4AVZ A;  3ZPP A;  4W8R A;  3PSS A;  2XTX A;  3VMW A;  2VFP A;  3T9G A;  2J8K A;  4V02 C;  2YUH A;  2NT9 A;  1RU4 A;  4XLC A;  4XR6 A;  4OJ5 A;  4YZX A;  3TH0 A;  1LLW A;  2F3L A;  2NZM A;  4JRA C;  3RIQ A;  1WXR A;  2UVE A;  1O8H A;  2XT4 A;  4YDT A;  1GQ8 A;  1XG2 A;  3EQN A;  2O0W A;  3N6Z A;  4XN3 A;  4NK6 A;  2J8I A;  2UVF A;  4Z05 A;  3B90 A;  5DNS A;  4XLF A;  1KQ5 A;  2BM4 A;  4XON A;  3SY2 A;  1DAB A;  1BN8 A;  2VBM A;  3GQ9 A;  1O8G A;  2X3H A;  4Z03 A;  2NST A;  4C2L A;  1O8K A;  1CLW A;  1VBL A;  2XTY A;  1TYW A;  4YFO A;  3KRG A;  2VJJ A;  1O8E A;  2VBK A;  2V5I A;  1IDJ A;  2X6W A;  1OFL A;  3AK5 A;  1O8M A;  1QCX A;  1QQ1 A;  3B4N A;  1TYX A;  3JX8 A;  1O8I A;  2VFQ A; 
#chains in the Genus database with same CATH homology
 4XNF A;  4W8T A;  4NK8 A;  4YEL A;  2PYH A;  2NSP A;  1PE9 A;  1AIR A;  4XMY A;  3B8Y A;  3JUR A;  3ZSC A;  4MR0 A;  3UW0 A;  2INV A;  4XLH A;  4OJP A;  1QJV A;  3VST A;  1IA5 A;  4OZZ A;  1IB4 A;  4U4B A;  3GQ7 A;  4W8Q A;  4XOP A;  2NTB A;  1OGM X;  4YEJ A;  4URR A;  4XLE A;  3EQO A;  4OJL A;  2QXZ A;  2QX3 A;  2O1D A;  2NT6 A;  3WWG A;  2X6Y A;  4XOT A;  4YZA A;  4XKW A;  5AMV A;  1PXZ A;  4Z06 A;  1OOC A;  2X85 A;  2EWE A;  1IDK A;  4YZ0 A;  3GQA A;  4EW9 A;  1O88 A;  2NTQ A;  2INU A;  4I84 A;  2O0V A;  4PMH A;  5C1E A;  4XN0 A;  1O8L A;  1O8J A;  1BHE A;  1CZF A;  3VSU A;  1KCD A;  4XLA A;  3VMV A;  2QY1 A;  1X0C A;  1DBO A;  2O17 A;  4YZQ A;  3FY3 A;  1H80 A;  1OGO X;  1RWR A;  1HG8 A;  1NHC A;  1WMR A;  2VBE A;  4XM3 A;  3SUC A;  4U49 A;  1RMG A;  1O8F A;  5C1C A;  1KTW A;  3LMW A;  3VSV A;  3GRH A;  1K5C A;  4OZY A;  4XL9 A;  4XOR A;  1PLU A;  3GQ8 A;  2ODL A;  4OJO A;  4HWV A;  4OJ6 A;  1JTA A;  1KCC A;  2O04 A;  4XQF A;  2BSP A;  2IQ7 A;  1O8D A;  1JRG A;  1OFM A;  2VJI A;  2PEC A;  2Z8G A;  1EE6 A;  2PYG A;  1DBG A;  2X6X A;  4W8S A;  4MXN A;  4XKV A;  2NTP A;  4AVZ A;  3ZPP A;  4W8R A;  3VMW A;  3T9G A;  2NT9 A;  1RU4 A;  4XLC A;  4XR6 A;  4OJ5 A;  4YZX A;  2NZM A;  2UVE A;  1O8H A;  1GQ8 A;  1XG2 A;  3EQN A;  2O0W A;  4XN3 A;  4NK6 A;  2UVF A;  4Z05 A;  3B90 A;  4XLF A;  4XON A;  1BN8 A;  2VBM A;  3GQ9 A;  1O8G A;  2X3H A;  4Z03 A;  2NST A;  4C2L A;  1O8K A;  1VBL A;  3KRG A;  2VJJ A;  1O8E A;  2VBK A;  1IDJ A;  2X6W A;  1OFL A;  1O8M A;  1QCX A;  3B4N A;  1O8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...