1O8IA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with no ca2+ added
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
b'ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8iA00
1O8KA 4U4BA 4W8QA 4XNFA 1NHCA 4OJOA 1O8GA 1H80A 2O0WA 4XKVA 2O0VA 4Z03A 4XR6A 3B90A 4XLAA 4Z06A 1O8HA 1HG8A 1O8JA 1OOCA 4XL9A 4YZ0A 4C2LA 2NZMA 4AVZA 1K5CA 1CZFA 2VBKA 5C1CA 2QY1A 4XLFA 4OZYA 2X85A 1QJVA 1X0CA 3T9GA 4XOPA 3JURA 1IDJA 1IB4A 1EE6A 1RMGA 4XORA 3VMWA 4W8TA 2NTBA 3B8YA 2PECA 2UVEA 3GQ7A 4NK8A 3ZSCA 2IQ7A 4OJ6A 3EQNA 1OGOX 2NTQA 1IDKA 1O8MA 2EWEA 1RWRA 1JRGA 2NSTA 1O8IA 4OJ5A 3VSTA 1JTAA 1XG2A 4W8SA 4YZQA 2NT6A 3B4NA 4XQFA 4XMYA 1OGMX 2NSPA 2X6WA 4URRA 3VSVA 2VJJA 4OJPA 5C1EA 2INUA 1AIRA 1O8FA 2O04A 3GQ9A 4Z05A 1GQ8A 4XLHA 4XOTA 4I84A 1QCXA 2VJIA 2X6YA 4YZXA 4YEJA 4MXNA 4XLEA 3VSUA 1OFLA 4EW9A 2ODLA 2QXZA 3KRGA 1OFMA 4XN3A 4HWVA 1BN8A 4OZZA 1WMRA 2UVFA 3WWGA 2PYHA 1O8EA 4YELA 1O88A 4PMHA 2QX3A 2PYGA 2X3HA 4XKWA 4YZAA 2O17A 2O1DA 1PE9A 1O8LA 3VMVA 3GQAA 1DBGA 4OJLA 4W8RA 1VBLA 1KTWA 4XN0A 1KCCA 4XONA 1IA5A 3FY3A 3EQOA 3GQ8A 2Z8GA 2BSPA 1RU4A 1O8DA 2NTPA 2X6XA 3LMWA 2INVA 2NT9A 3SUCA 4U49A 4XLCA 5AMVA 1DBOA 3UW0A 1BHEA 3ZPPA 1PXZA 2VBEA 4XM3A 1KCDA 1PLUA 2VBMA 4MR0A 3GRHA 4NK6A
chains in the Genus database with same CATH superfamily
5JLVC 1O8KA 2VFNA 4U4BA 4W8QA 4XNFA 1NHCA 1QQ1A 4OJOA 1O8GA 1H80A 2O0WA 1K4ZA 3PETA 4XKVA 2O0VA 4Z03A 1TYXA 4XR6A 1EA0A 3B90A 4XLAA 4Z06A 1TSPA 1O8HA 1HG8A 1O8JA 2XC1A 1OOCA 1EZGA 4XL9A 5JMCB 1TYWA 4YZ0A 4C2LA 2XT2A 2NZMA 4AVZA 3TH0A 1K5CA 1CZFA 2VBKA 5C1CA 2QY1A 3P4GA 3JX8A 2YUHA 3AK5A 4XLFA 4OZYA 2XTXA 2VFMA 2X85A 1QJVA 3NB2A 3RIQA 3N6ZA 2BM5A 2VFOA 1X0CA 3T9GA 4XOPA 2F3LA 3JURA 1IDJA 1CLWA 1LLZA 1IB4A 1EE6A 1RMGA 4KH3A 4XORA 2XTYA 3VMWA 4W8TA 2NTBA 3B8YA 2PECA 2UVEA 3GQ7A 4NK8A 3ZSCA 1OFDA 2J8IA 1QA3A 2B0RA 3SQVA 2IQ7A 4OJ6A 1QRBA 2IOUG 3EQNA 1OGOX 2NTQA 1IDKA 1O8MA 3N90A 2EWEA 1OFEA 1RWRA 1JRGA 2NSTA 3ML3A 1O8IA 4OJ5A 3VSTA 1JTAA 2QZAA 1XG2A 4W8SA 4YZQA 2NT6A 3B4NA 4XQFA 1HF2A 4XMYA 1L1IA 2XTWA 3LYCA 2QYUA 1OGMX 2NSPA 2X6WA 4URRA 3VSVA 2O6WA 2VJJA 4OJPA 5C1EA 1KQ5A 1AIRA 1O8FA 2INUA 2O04A 3GQ9A 4Z05A 1GQ8A 4XLHA 4XOTA 2XT4A 3BH6B 4I84A 1QCXA 2BM6A 2VJIA 2X6YA 4YZXA 3H09A 2BX6A 4MXNA 4YEJA 4XLEA 3VSUA 1OFLA 3PSZA 2ODLA 2QXZA 3SZEA 3KRGA 4EW9A 1OFMA 4XN3A 4HWVA 1BN8A 4OZZA 1WMRA 3BH7B 2UVFA 3SYJA 2PYHA 4YC5A 1O8EA 4YFOA 1O88A 4YELA 4PMHA 3WWGA 2QX3A 2PYGA 2X3HA 4XKWA 4YZAA 1WXRA 3NAWA 2V5IA 1QA2A 4YCQA 1K8FA 2O17A 2VFPA 2BM4A 2O1DA 3LJYA 2W7ZA 1PE9A 4YDTA 1O8LA 3VMVA 1QRCA 1TYUA 4OPWA 3GQAA 1DBGA 4OJLA 2VFQA 4W8RA 5DNSA 1VBLA 1KTWA 4OM9A 4XN0A 1KCCA 2G0YA 4XONA 4JRAC 3FY3A 3EQOA 1DABA 1IA5A 3GQ8A 2Z8GA 3SY2A 1LLWA 2BSPA 1RU4A 3PSSA 1O8DA 2NTPA 2X6XA 3LMWA 4YEIA 2INVA 2NT9A 3SUCA 2BM7A 4V02C 2J8KA 4U49A 4XLCA 3DU1X 1DBOA 5AMVA 3UW0A 1BHEA 3ZPPA 1TYVA 1PXZA 1LM1A 2VBEA 4XM3A 1QA1A 1KCDA 1PLUA 2VBMA 4MR0A 3GRHA 4NK6A
chains in the Genus database with same CATH topology
1O8KA 4U4BA 4W8QA 4XNFA 1NHCA 4OJOA 1O8GA 1H80A 2O0WA 4XKVA 2O0VA 4Z03A 4XR6A 3B90A 4XLAA 4Z06A 1O8HA 1HG8A 1O8JA 1OOCA 4XL9A 4YZ0A 4C2LA 2NZMA 4AVZA 1K5CA 1CZFA 2VBKA 5C1CA 2QY1A 4XLFA 4OZYA 2X85A 1QJVA 1X0CA 3T9GA 4XOPA 3JURA 1IDJA 1IB4A 1EE6A 1RMGA 4XORA 3VMWA 4W8TA 2NTBA 3B8YA 2PECA 2UVEA 3GQ7A 4NK8A 3ZSCA 2IQ7A 4OJ6A 3EQNA 1OGOX 2NTQA 1IDKA 1O8MA 2EWEA 1RWRA 1JRGA 2NSTA 1O8IA 4OJ5A 3VSTA 1JTAA 1XG2A 4W8SA 4YZQA 2NT6A 3B4NA 4XQFA 4XMYA 1OGMX 2NSPA 2X6WA 4URRA 3VSVA 2VJJA 4OJPA 5C1EA 2INUA 1AIRA 1O8FA 2O04A 3GQ9A 4Z05A 1GQ8A 4XLHA 4XOTA 4I84A 1QCXA 2VJIA 2X6YA 4YZXA 4YEJA 4MXNA 4XLEA 3VSUA 1OFLA 4EW9A 2ODLA 2QXZA 3KRGA 1OFMA 4XN3A 4HWVA 1BN8A 4OZZA 1WMRA 2UVFA 3WWGA 2PYHA 1O8EA 4YELA 1O88A 4PMHA 2QX3A 2PYGA 2X3HA 4XKWA 4YZAA 2O17A 2O1DA 1PE9A 1O8LA 3VMVA 3GQAA 1DBGA 4OJLA 4W8RA 1VBLA 1KTWA 4XN0A 1KCCA 4XONA 1IA5A 3FY3A 3EQOA 3GQ8A 2Z8GA 2BSPA 1RU4A 1O8DA 2NTPA 2X6XA 3LMWA 2INVA 2NT9A 3SUCA 4U49A 4XLCA 5AMVA 1DBOA 3UW0A 1BHEA 3ZPPA 1PXZA 2VBEA 4XM3A 1KCDA 1PLUA 2VBMA 4MR0A 3GRHA 4NK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8K A;  4U4B A;  4W8Q A;  4XNF A;  1NHC A;  4OJO A;  1O8G A;  1H80 A;  2O0W A;  4XKV A;  2O0V A;  4Z03 A;  4XR6 A;  3B90 A;  4XLA A;  4Z06 A;  1O8H A;  1HG8 A;  1O8J A;  1OOC A;  4XL9 A;  4YZ0 A;  4C2L A;  2NZM A;  4AVZ A;  1K5C A;  1CZF A;  2VBK A;  5C1C A;  2QY1 A;  4XLF A;  4OZY A;  2X85 A;  1QJV A;  1X0C A;  3T9G A;  4XOP A;  3JUR A;  1IDJ A;  1IB4 A;  1EE6 A;  1RMG A;  4XOR A;  3VMW A;  4W8T A;  2NTB A;  3B8Y A;  2PEC A;  2UVE A;  3GQ7 A;  4NK8 A;  3ZSC A;  2IQ7 A;  4OJ6 A;  3EQN A;  1OGO X;  2NTQ A;  1IDK A;  1O8M A;  2EWE A;  1RWR A;  1JRG A;  2NST A;  1O8I A;  4OJ5 A;  3VST A;  1JTA A;  1XG2 A;  4W8S A;  4YZQ A;  2NT6 A;  3B4N A;  4XQF A;  4XMY A;  1OGM X;  2NSP A;  2X6W A;  4URR A;  3VSV A;  2VJJ A;  4OJP A;  5C1E A;  2INU A;  1AIR A;  1O8F A;  2O04 A;  3GQ9 A;  4Z05 A;  1GQ8 A;  4XLH A;  4XOT A;  4I84 A;  1QCX A;  2VJI A;  2X6Y A;  4YZX A;  4YEJ A;  4MXN A;  4XLE A;  3VSU A;  1OFL A;  4EW9 A;  2ODL A;  2QXZ A;  3KRG A;  1OFM A;  4XN3 A;  4HWV A;  1BN8 A;  4OZZ A;  1WMR A;  2UVF A;  3WWG A;  2PYH A;  1O8E A;  4YEL A;  1O88 A;  4PMH A;  2QX3 A;  2PYG A;  2X3H A;  4XKW A;  4YZA A;  2O17 A;  2O1D A;  1PE9 A;  1O8L A;  3VMV A;  3GQA A;  1DBG A;  4OJL A;  4W8R A;  1VBL A;  1KTW A;  4XN0 A;  1KCC A;  4XON A;  1IA5 A;  3FY3 A;  3EQO A;  3GQ8 A;  2Z8G A;  2BSP A;  1RU4 A;  1O8D A;  2NTP A;  2X6X A;  3LMW A;  2INV A;  2NT9 A;  3SUC A;  4U49 A;  4XLC A;  5AMV A;  1DBO A;  3UW0 A;  1BHE A;  3ZPP A;  1PXZ A;  2VBE A;  4XM3 A;  1KCD A;  1PLU A;  2VBM A;  4MR0 A;  3GRH A;  4NK6 A; 
#chains in the Genus database with same CATH topology
 5JLV C;  1O8K A;  2VFN A;  4U4B A;  4W8Q A;  4XNF A;  1NHC A;  1QQ1 A;  4OJO A;  1O8G A;  1H80 A;  2O0W A;  1K4Z A;  3PET A;  4XKV A;  2O0V A;  4Z03 A;  1TYX A;  4XR6 A;  1EA0 A;  3B90 A;  4XLA A;  4Z06 A;  1TSP A;  1O8H A;  1HG8 A;  1O8J A;  2XC1 A;  1OOC A;  1EZG A;  4XL9 A;  5JMC B;  1TYW A;  4YZ0 A;  4C2L A;  2XT2 A;  2NZM A;  4AVZ A;  3TH0 A;  1K5C A;  1CZF A;  2VBK A;  5C1C A;  2QY1 A;  3P4G A;  3JX8 A;  2YUH A;  3AK5 A;  4XLF A;  4OZY A;  2XTX A;  2VFM A;  2X85 A;  1QJV A;  3NB2 A;  3RIQ A;  3N6Z A;  2BM5 A;  2VFO A;  1X0C A;  3T9G A;  4XOP A;  2F3L A;  3JUR A;  1IDJ A;  1CLW A;  1LLZ A;  1IB4 A;  1EE6 A;  1RMG A;  4KH3 A;  4XOR A;  2XTY A;  3VMW A;  4W8T A;  2NTB A;  3B8Y A;  2PEC A;  2UVE A;  3GQ7 A;  4NK8 A;  3ZSC A;  1OFD A;  2J8I A;  1QA3 A;  2B0R A;  3SQV A;  2IQ7 A;  4OJ6 A;  1QRB A;  2IOU G;  3EQN A;  1OGO X;  2NTQ A;  1IDK A;  1O8M A;  3N90 A;  2EWE A;  1OFE A;  1RWR A;  1JRG A;  2NST A;  3ML3 A;  1O8I A;  4OJ5 A;  3VST A;  1JTA A;  2QZA A;  1XG2 A;  4W8S A;  4YZQ A;  2NT6 A;  3B4N A;  4XQF A;  1HF2 A;  4XMY A;  1L1I A;  2XTW A;  3LYC A;  2QYU A;  1OGM X;  2NSP A;  2X6W A;  4URR A;  3VSV A;  2O6W A;  2VJJ A;  4OJP A;  5C1E A;  1KQ5 A;  1AIR A;  1O8F A;  2INU A;  2O04 A;  3GQ9 A;  4Z05 A;  1GQ8 A;  4XLH A;  4XOT A;  2XT4 A;  3BH6 B;  4I84 A;  1QCX A;  2BM6 A;  2VJI A;  2X6Y A;  4YZX A;  3H09 A;  2BX6 A;  4MXN A;  4YEJ A;  4XLE A;  3VSU A;  1OFL A;  3PSZ A;  2ODL A;  2QXZ A;  3SZE A;  3KRG A;  4EW9 A;  1OFM A;  4XN3 A;  4HWV A;  1BN8 A;  4OZZ A;  1WMR A;  3BH7 B;  2UVF A;  3SYJ A;  2PYH A;  4YC5 A;  1O8E A;  4YFO A;  1O88 A;  4YEL A;  4PMH A;  3WWG A;  2QX3 A;  2PYG A;  2X3H A;  4XKW A;  4YZA A;  1WXR A;  3NAW A;  2V5I A;  1QA2 A;  4YCQ A;  1K8F A;  2O17 A;  2VFP A;  2BM4 A;  2O1D A;  3LJY A;  2W7Z A;  1PE9 A;  4YDT A;  1O8L A;  3VMV A;  1QRC A;  1TYU A;  4OPW A;  3GQA A;  1DBG A;  4OJL A;  2VFQ A;  4W8R A;  5DNS A;  1VBL A;  1KTW A;  4OM9 A;  4XN0 A;  1KCC A;  2G0Y A;  4XON A;  4JRA C;  3FY3 A;  3EQO A;  1DAB A;  1IA5 A;  3GQ8 A;  2Z8G A;  3SY2 A;  1LLW A;  2BSP A;  1RU4 A;  3PSS A;  1O8D A;  2NTP A;  2X6X A;  3LMW A;  4YEI A;  2INV A;  2NT9 A;  3SUC A;  2BM7 A;  4V02 C;  2J8K A;  4U49 A;  4XLC A;  3DU1 X;  1DBO A;  5AMV A;  3UW0 A;  1BHE A;  3ZPP A;  1TYV A;  1PXZ A;  1LM1 A;  2VBE A;  4XM3 A;  1QA1 A;  1KCD A;  1PLU A;  2VBM A;  4MR0 A;  3GRH A;  4NK6 A; 
#chains in the Genus database with same CATH homology
 1O8K A;  4U4B A;  4W8Q A;  4XNF A;  1NHC A;  4OJO A;  1O8G A;  1H80 A;  2O0W A;  4XKV A;  2O0V A;  4Z03 A;  4XR6 A;  3B90 A;  4XLA A;  4Z06 A;  1O8H A;  1HG8 A;  1O8J A;  1OOC A;  4XL9 A;  4YZ0 A;  4C2L A;  2NZM A;  4AVZ A;  1K5C A;  1CZF A;  2VBK A;  5C1C A;  2QY1 A;  4XLF A;  4OZY A;  2X85 A;  1QJV A;  1X0C A;  3T9G A;  4XOP A;  3JUR A;  1IDJ A;  1IB4 A;  1EE6 A;  1RMG A;  4XOR A;  3VMW A;  4W8T A;  2NTB A;  3B8Y A;  2PEC A;  2UVE A;  3GQ7 A;  4NK8 A;  3ZSC A;  2IQ7 A;  4OJ6 A;  3EQN A;  1OGO X;  2NTQ A;  1IDK A;  1O8M A;  2EWE A;  1RWR A;  1JRG A;  2NST A;  1O8I A;  4OJ5 A;  3VST A;  1JTA A;  1XG2 A;  4W8S A;  4YZQ A;  2NT6 A;  3B4N A;  4XQF A;  4XMY A;  1OGM X;  2NSP A;  2X6W A;  4URR A;  3VSV A;  2VJJ A;  4OJP A;  5C1E A;  2INU A;  1AIR A;  1O8F A;  2O04 A;  3GQ9 A;  4Z05 A;  1GQ8 A;  4XLH A;  4XOT A;  4I84 A;  1QCX A;  2VJI A;  2X6Y A;  4YZX A;  4YEJ A;  4MXN A;  4XLE A;  3VSU A;  1OFL A;  4EW9 A;  2ODL A;  2QXZ A;  3KRG A;  1OFM A;  4XN3 A;  4HWV A;  1BN8 A;  4OZZ A;  1WMR A;  2UVF A;  3WWG A;  2PYH A;  1O8E A;  4YEL A;  1O88 A;  4PMH A;  2QX3 A;  2PYG A;  2X3H A;  4XKW A;  4YZA A;  2O17 A;  2O1D A;  1PE9 A;  1O8L A;  3VMV A;  3GQA A;  1DBG A;  4OJL A;  4W8R A;  1VBL A;  1KTW A;  4XN0 A;  1KCC A;  4XON A;  1IA5 A;  3FY3 A;  3EQO A;  3GQ8 A;  2Z8G A;  2BSP A;  1RU4 A;  1O8D A;  2NTP A;  2X6X A;  3LMW A;  2INV A;  2NT9 A;  3SUC A;  4U49 A;  4XLC A;  5AMV A;  1DBO A;  3UW0 A;  1BHE A;  3ZPP A;  1PXZ A;  2VBE A;  4XM3 A;  1KCD A;  1PLU A;  2VBM A;  4MR0 A;  3GRH A;  4NK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...