1O8IA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with no ca2+ added
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8iA00
3B4NA 2VBMA 2VBEA 2NSPA 4OJ5A 4XKVA 1RWRA 2X3HA 4OJOA 1GQ8A 2Z8GA 2NTQA 3GRHA 2O0WA 4YZQA 1WMRA 1AIRA 4I84A 3WWGA 4HWVA 1BN8A 3EQNA 2O17A 4MR0A 3VSUA 4NK8A 1IDKA 1O8MA 2NZMA 4XLCA 4YZ0A 2VJIA 3VSTA 3KRGA 3B8YA 2PYHA 2QY1A 5AMVA 2NTBA 4Z05A 4XONA 3UW0A 2QXZA 4PMHA 2PYGA 1IDJA 4W8RA 1KCCA 1K5CA 1O8IA 2QX3A 2X6WA 3VSVA 2INUA 4W8TA 4XLHA 2EWEA 4URRA 1O8JA 2NTPA 3LMWA 2X85A 1PE9A 2ODLA 1OGOX 2NT9A 3FY3A 4Z06A 1OGMX 1DBGA 2X6XA 4XLFA 1O8FA 3EQOA 4YELA 1PLUA 1O8EA 3JURA 1RMGA 4MXNA 2VBKA 3VMWA 5C1CA 4YZXA 1QCXA 1BHEA 4OZZA 2O0VA 1PXZA 4XL9A 2O04A 4C2LA 4U49A 5C1EA 1O8GA 4YEJA 3B90A 1QJVA 4XQFA 4AVZA 1IA5A 2NT6A 2PECA 3GQAA 4XR6A 1HG8A 3GQ7A 1XG2A 4XMYA 1VBLA 1JRGA 4W8QA 4W8SA 4XORA 4OJLA 1O8DA 3ZSCA 4YZAA 3SUCA 4XN0A 1O88A 1O8HA 4XKWA 2UVFA 4OZYA 2INVA 1X0CA 1O8KA 1OFMA 1EE6A 1KCDA 3GQ9A 1IB4A 1DBOA 3GQ8A 2X6YA 4OJ6A 4EW9A 4OJPA 2O1DA 3T9GA 4XOPA 3ZPPA 1H80A 2NSTA 2UVEA 1O8LA 4XOTA 4XN3A 1RU4A 4NK6A 1JTAA 2VJJA 1CZFA 3VMVA 1KTWA 1NHCA 1OOCA 4XNFA 1OFLA 2BSPA 4Z03A 4XLEA 4XM3A 4U4BA 4XLAA 2IQ7A
chains in the Genus database with same CATH superfamily
3B4NA 3LYCA 2VBMA 2VBEA 2NSPA 4OJ5A 4XKVA 1RWRA 1LLZA 2X3HA 4OJOA 1K4ZA 1GQ8A 2Z8GA 3SZEA 2NTQA 2IOUG 1QA2A 3NB2A 3GRHA 2O0WA 4YZQA 1WMRA 1AIRA 4I84A 1LLWA 3WWGA 4HWVA 2XT4A 2QYUA 1BN8A 2B0RA 3EQNA 2O17A 4MR0A 3VSUA 4NK8A 2XTYA 3PSSA 1QRCA 1CLWA 1IDKA 1O8MA 2XTXA 2NZMA 4XLCA 3ML3A 4YZ0A 1WXRA 2VJIA 3VSTA 1KQ5A 3B8YA 2PYHA 2QY1A 3KRGA 5AMVA 2NTBA 2J8KA 4Z05A 4XONA 3UW0A 2QXZA 4PMHA 2PYGA 1IDJA 4W8RA 1KCCA 1K5CA 1O8IA 1LM1A 2QX3A 2X6WA 3VSVA 2INUA 4YC5A 2XC1A 4W8TA 4XLHA 2EWEA 3PETA 1K8FA 2BM7A 3SYJA 1TSPA 2F3LA 1O8JA 2VFMA 2BM5A 4URRA 2NTPA 3LMWA 2X85A 1PE9A 2ODLA 1OGOX 2NT9A 3FY3A 4Z06A 1OGMX 2VFQA 1DBGA 2X6XA 5JMCB 4OM9A 1O8FA 3EQOA 4XLFA 1PLUA 4YDTA 4YELA 1QA3A 2VFPA 1O8EA 5DNSA 2XT2A 3JURA 1TYUA 1RMGA 2J8IA 1QA1A 4MXNA 2VBKA 1OFEA 3VMWA 2O6WA 4YZXA 5C1CA 1QCXA 1BHEA 4OZZA 2O0VA 1PXZA 4JRAC 4V02C 4XL9A 3SY2A 2O04A 4C2LA 3JX8A 4U49A 5C1EA 2VFNA 1O8GA 2QZAA 4YEJA 3TH0A 3B90A 1QRBA 1HF2A 1QJVA 4XQFA 4AVZA 1IA5A 2NT6A 1QQ1A 3BH6B 4KH3A 2PECA 3GQAA 4XR6A 4OPWA 1HG8A 3GQ7A 1XG2A 4XMYA 2BX6A 1VBLA 3SQVA 1JRGA 4W8QA 4W8SA 4XORA 3H09A 3N90A 4OJLA 1O8DA 3ZSCA 4YZAA 4YFOA 3SUCA 1EA0A 4XN0A 1O88A 1O8HA 3P4GA 3BH7B 2UVFA 4XKWA 2VFOA 3DU1X 1EZGA 3N6ZA 1OFDA 5JLVC 4OZYA 2INVA 1X0CA 1O8KA 1OFMA 1EE6A 1KCDA 3GQ9A 3PSZA 1TYWA 1IB4A 1L1IA 1DBOA 3GQ8A 3NAWA 3AK5A 2X6YA 1TYXA 2YUHA 4OJ6A 4EW9A 4OJPA 2O1DA 3T9GA 4XOPA 4YEIA 3ZPPA 1H80A 2NSTA 2UVEA 1O8LA 4XOTA 3LJYA 1RU4A 4NK6A 1TYVA 1JTAA 4XN3A 2VJJA 1CZFA 3VMVA 1KTWA 4YCQA 1OOCA 4XNFA 3RIQA 1OFLA 2BSPA 4Z03A 1NHCA 4XLEA 2V5IA 4XM3A 2G0YA 4U4BA 2BM6A 2IQ7A 4XLAA 2W7ZA 2BM4A 1DABA 2XTWA
chains in the Genus database with same CATH topology
3B4NA 2VBMA 2VBEA 2NSPA 4OJ5A 4XKVA 1RWRA 2X3HA 4OJOA 1GQ8A 2Z8GA 2NTQA 3GRHA 2O0WA 4YZQA 1WMRA 1AIRA 4I84A 3WWGA 4HWVA 1BN8A 3EQNA 2O17A 4MR0A 3VSUA 4NK8A 1IDKA 1O8MA 2NZMA 4XLCA 4YZ0A 2VJIA 3VSTA 3KRGA 3B8YA 2PYHA 2QY1A 5AMVA 2NTBA 4Z05A 4XONA 3UW0A 2QXZA 4PMHA 2PYGA 1IDJA 4W8RA 1KCCA 1K5CA 1O8IA 2QX3A 2X6WA 3VSVA 2INUA 4W8TA 4XLHA 2EWEA 4URRA 1O8JA 2NTPA 3LMWA 2X85A 1PE9A 2ODLA 1OGOX 2NT9A 3FY3A 4Z06A 1OGMX 1DBGA 2X6XA 4XLFA 1O8FA 3EQOA 4YELA 1PLUA 1O8EA 3JURA 1RMGA 4MXNA 2VBKA 3VMWA 5C1CA 4YZXA 1QCXA 1BHEA 4OZZA 2O0VA 1PXZA 4XL9A 2O04A 4C2LA 4U49A 5C1EA 1O8GA 4YEJA 3B90A 1QJVA 4XQFA 4AVZA 1IA5A 2NT6A 2PECA 3GQAA 4XR6A 1HG8A 3GQ7A 1XG2A 4XMYA 1VBLA 1JRGA 4W8QA 4W8SA 4XORA 4OJLA 1O8DA 3ZSCA 4YZAA 3SUCA 4XN0A 1O88A 1O8HA 4XKWA 2UVFA 4OZYA 2INVA 1X0CA 1O8KA 1OFMA 1EE6A 1KCDA 3GQ9A 1IB4A 1DBOA 3GQ8A 2X6YA 4OJ6A 4EW9A 4OJPA 2O1DA 3T9GA 4XOPA 3ZPPA 1H80A 2NSTA 2UVEA 1O8LA 4XOTA 4XN3A 1RU4A 4NK6A 1JTAA 2VJJA 1CZFA 3VMVA 1KTWA 1NHCA 1OOCA 4XNFA 1OFLA 2BSPA 4Z03A 4XLEA 4XM3A 4U4BA 4XLAA 2IQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4N A;  2VBM A;  2VBE A;  2NSP A;  4OJ5 A;  4XKV A;  1RWR A;  2X3H A;  4OJO A;  1GQ8 A;  2Z8G A;  2NTQ A;  3GRH A;  2O0W A;  4YZQ A;  1WMR A;  1AIR A;  4I84 A;  3WWG A;  4HWV A;  1BN8 A;  3EQN A;  2O17 A;  4MR0 A;  3VSU A;  4NK8 A;  1IDK A;  1O8M A;  2NZM A;  4XLC A;  4YZ0 A;  2VJI A;  3VST A;  3KRG A;  3B8Y A;  2PYH A;  2QY1 A;  5AMV A;  2NTB A;  4Z05 A;  4XON A;  3UW0 A;  2QXZ A;  4PMH A;  2PYG A;  1IDJ A;  4W8R A;  1KCC A;  1K5C A;  1O8I A;  2QX3 A;  2X6W A;  3VSV A;  2INU A;  4W8T A;  4XLH A;  2EWE A;  4URR A;  1O8J A;  2NTP A;  3LMW A;  2X85 A;  1PE9 A;  2ODL A;  1OGO X;  2NT9 A;  3FY3 A;  4Z06 A;  1OGM X;  1DBG A;  2X6X A;  4XLF A;  1O8F A;  3EQO A;  4YEL A;  1PLU A;  1O8E A;  3JUR A;  1RMG A;  4MXN A;  2VBK A;  3VMW A;  5C1C A;  4YZX A;  1QCX A;  1BHE A;  4OZZ A;  2O0V A;  1PXZ A;  4XL9 A;  2O04 A;  4C2L A;  4U49 A;  5C1E A;  1O8G A;  4YEJ A;  3B90 A;  1QJV A;  4XQF A;  4AVZ A;  1IA5 A;  2NT6 A;  2PEC A;  3GQA A;  4XR6 A;  1HG8 A;  3GQ7 A;  1XG2 A;  4XMY A;  1VBL A;  1JRG A;  4W8Q A;  4W8S A;  4XOR A;  4OJL A;  1O8D A;  3ZSC A;  4YZA A;  3SUC A;  4XN0 A;  1O88 A;  1O8H A;  4XKW A;  2UVF A;  4OZY A;  2INV A;  1X0C A;  1O8K A;  1OFM A;  1EE6 A;  1KCD A;  3GQ9 A;  1IB4 A;  1DBO A;  3GQ8 A;  2X6Y A;  4OJ6 A;  4EW9 A;  4OJP A;  2O1D A;  3T9G A;  4XOP A;  3ZPP A;  1H80 A;  2NST A;  2UVE A;  1O8L A;  4XOT A;  4XN3 A;  1RU4 A;  4NK6 A;  1JTA A;  2VJJ A;  1CZF A;  3VMV A;  1KTW A;  1NHC A;  1OOC A;  4XNF A;  1OFL A;  2BSP A;  4Z03 A;  4XLE A;  4XM3 A;  4U4B A;  4XLA A;  2IQ7 A; 
#chains in the Genus database with same CATH topology
 3B4N A;  3LYC A;  2VBM A;  2VBE A;  2NSP A;  4OJ5 A;  4XKV A;  1RWR A;  1LLZ A;  2X3H A;  4OJO A;  1K4Z A;  1GQ8 A;  2Z8G A;  3SZE A;  2NTQ A;  2IOU G;  1QA2 A;  3NB2 A;  3GRH A;  2O0W A;  4YZQ A;  1WMR A;  1AIR A;  4I84 A;  1LLW A;  3WWG A;  4HWV A;  2XT4 A;  2QYU A;  1BN8 A;  2B0R A;  3EQN A;  2O17 A;  4MR0 A;  3VSU A;  4NK8 A;  2XTY A;  3PSS A;  1QRC A;  1CLW A;  1IDK A;  1O8M A;  2XTX A;  2NZM A;  4XLC A;  3ML3 A;  4YZ0 A;  1WXR A;  2VJI A;  3VST A;  1KQ5 A;  3B8Y A;  2PYH A;  2QY1 A;  3KRG A;  5AMV A;  2NTB A;  2J8K A;  4Z05 A;  4XON A;  3UW0 A;  2QXZ A;  4PMH A;  2PYG A;  1IDJ A;  4W8R A;  1KCC A;  1K5C A;  1O8I A;  1LM1 A;  2QX3 A;  2X6W A;  3VSV A;  2INU A;  4YC5 A;  2XC1 A;  4W8T A;  4XLH A;  2EWE A;  3PET A;  1K8F A;  2BM7 A;  3SYJ A;  1TSP A;  2F3L A;  1O8J A;  2VFM A;  2BM5 A;  4URR A;  2NTP A;  3LMW A;  2X85 A;  1PE9 A;  2ODL A;  1OGO X;  2NT9 A;  3FY3 A;  4Z06 A;  1OGM X;  2VFQ A;  1DBG A;  2X6X A;  5JMC B;  4OM9 A;  1O8F A;  3EQO A;  4XLF A;  1PLU A;  4YDT A;  4YEL A;  1QA3 A;  2VFP A;  1O8E A;  5DNS A;  2XT2 A;  3JUR A;  1TYU A;  1RMG A;  2J8I A;  1QA1 A;  4MXN A;  2VBK A;  1OFE A;  3VMW A;  2O6W A;  4YZX A;  5C1C A;  1QCX A;  1BHE A;  4OZZ A;  2O0V A;  1PXZ A;  4JRA C;  4V02 C;  4XL9 A;  3SY2 A;  2O04 A;  4C2L A;  3JX8 A;  4U49 A;  5C1E A;  2VFN A;  1O8G A;  2QZA A;  4YEJ A;  3TH0 A;  3B90 A;  1QRB A;  1HF2 A;  1QJV A;  4XQF A;  4AVZ A;  1IA5 A;  2NT6 A;  1QQ1 A;  3BH6 B;  4KH3 A;  2PEC A;  3GQA A;  4XR6 A;  4OPW A;  1HG8 A;  3GQ7 A;  1XG2 A;  4XMY A;  2BX6 A;  1VBL A;  3SQV A;  1JRG A;  4W8Q A;  4W8S A;  4XOR A;  3H09 A;  3N90 A;  4OJL A;  1O8D A;  3ZSC A;  4YZA A;  4YFO A;  3SUC A;  1EA0 A;  4XN0 A;  1O88 A;  1O8H A;  3P4G A;  3BH7 B;  2UVF A;  4XKW A;  2VFO A;  3DU1 X;  1EZG A;  3N6Z A;  1OFD A;  5JLV C;  4OZY A;  2INV A;  1X0C A;  1O8K A;  1OFM A;  1EE6 A;  1KCD A;  3GQ9 A;  3PSZ A;  1TYW A;  1IB4 A;  1L1I A;  1DBO A;  3GQ8 A;  3NAW A;  3AK5 A;  2X6Y A;  1TYX A;  2YUH A;  4OJ6 A;  4EW9 A;  4OJP A;  2O1D A;  3T9G A;  4XOP A;  4YEI A;  3ZPP A;  1H80 A;  2NST A;  2UVE A;  1O8L A;  4XOT A;  3LJY A;  1RU4 A;  4NK6 A;  1TYV A;  1JTA A;  4XN3 A;  2VJJ A;  1CZF A;  3VMV A;  1KTW A;  4YCQ A;  1OOC A;  4XNF A;  3RIQ A;  1OFL A;  2BSP A;  4Z03 A;  1NHC A;  4XLE A;  2V5I A;  4XM3 A;  2G0Y A;  4U4B A;  2BM6 A;  2IQ7 A;  4XLA A;  2W7Z A;  2BM4 A;  1DAB A;  2XTW A; 
#chains in the Genus database with same CATH homology
 3B4N A;  2VBM A;  2VBE A;  2NSP A;  4OJ5 A;  4XKV A;  1RWR A;  2X3H A;  4OJO A;  1GQ8 A;  2Z8G A;  2NTQ A;  3GRH A;  2O0W A;  4YZQ A;  1WMR A;  1AIR A;  4I84 A;  3WWG A;  4HWV A;  1BN8 A;  3EQN A;  2O17 A;  4MR0 A;  3VSU A;  4NK8 A;  1IDK A;  1O8M A;  2NZM A;  4XLC A;  4YZ0 A;  2VJI A;  3VST A;  3KRG A;  3B8Y A;  2PYH A;  2QY1 A;  5AMV A;  2NTB A;  4Z05 A;  4XON A;  3UW0 A;  2QXZ A;  4PMH A;  2PYG A;  1IDJ A;  4W8R A;  1KCC A;  1K5C A;  1O8I A;  2QX3 A;  2X6W A;  3VSV A;  2INU A;  4W8T A;  4XLH A;  2EWE A;  4URR A;  1O8J A;  2NTP A;  3LMW A;  2X85 A;  1PE9 A;  2ODL A;  1OGO X;  2NT9 A;  3FY3 A;  4Z06 A;  1OGM X;  1DBG A;  2X6X A;  4XLF A;  1O8F A;  3EQO A;  4YEL A;  1PLU A;  1O8E A;  3JUR A;  1RMG A;  4MXN A;  2VBK A;  3VMW A;  5C1C A;  4YZX A;  1QCX A;  1BHE A;  4OZZ A;  2O0V A;  1PXZ A;  4XL9 A;  2O04 A;  4C2L A;  4U49 A;  5C1E A;  1O8G A;  4YEJ A;  3B90 A;  1QJV A;  4XQF A;  4AVZ A;  1IA5 A;  2NT6 A;  2PEC A;  3GQA A;  4XR6 A;  1HG8 A;  3GQ7 A;  1XG2 A;  4XMY A;  1VBL A;  1JRG A;  4W8Q A;  4W8S A;  4XOR A;  4OJL A;  1O8D A;  3ZSC A;  4YZA A;  3SUC A;  4XN0 A;  1O88 A;  1O8H A;  4XKW A;  2UVF A;  4OZY A;  2INV A;  1X0C A;  1O8K A;  1OFM A;  1EE6 A;  1KCD A;  3GQ9 A;  1IB4 A;  1DBO A;  3GQ8 A;  2X6Y A;  4OJ6 A;  4EW9 A;  4OJP A;  2O1D A;  3T9G A;  4XOP A;  3ZPP A;  1H80 A;  2NST A;  2UVE A;  1O8L A;  4XOT A;  4XN3 A;  1RU4 A;  4NK6 A;  1JTA A;  2VJJ A;  1CZF A;  3VMV A;  1KTW A;  1NHC A;  1OOC A;  4XNF A;  1OFL A;  2BSP A;  4Z03 A;  4XLE A;  4XM3 A;  4U4B A;  4XLA A;  2IQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...