1O8IA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with no ca2+ added
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8iA00
3GQ7A 4OJPA 1NHCA 1XG2A 2ODLA 2X85A 3LMWA 5C1CA 1RWRA 2IQ7A 4OJ6A 3EQNA 4XL9A 3ZSCA 4OZYA 2PYHA 1K5CA 2UVEA 4I84A 1AIRA 4OJLA 4U4BA 1BN8A 2INUA 3VSUA 1OGOX 4XLEA 4XQFA 4XN0A 1IB4A 4XM3A 1O8MA 3B8YA 2X3HA 3GQ8A 1O8DA 4XKVA 4XLAA 1JRGA 4XLCA 1KCCA 3GQAA 2NTPA 4U49A 1KCDA 1EE6A 1PE9A 4EW9A 3B4NA 4XMYA 4XLHA 2NTQA 2NT6A 1BHEA 4NK8A 1QCXA 4XOTA 1O8KA 1O8EA 1O8GA 1PXZA 4XNFA 1OFLA 2O0VA 5AMVA 3VSTA 2VBMA 1O8IA 1RU4A 2O04A 2NSTA 4XN3A 4W8TA 2X6WA 1X0CA 2INVA 4YZ0A 2QXZA 4NK6A 1IDKA 2EWEA 4MR0A 4OJ5A 3EQOA 2VJJA 1O8LA 1OOCA 1KTWA 1H80A 1OGMX 3GRHA 4PMHA 4W8SA 4OZZA 1WMRA 2QX3A 1O88A 1O8FA 4MXNA 4Z03A 3VSVA 4XORA 2O0WA 2Z8GA 2X6XA 3KRGA 1QJVA 2VJIA 3JURA 4C2LA 1O8JA 2O1DA 1O8HA 4AVZA 5C1EA 1DBGA 2O17A 3ZPPA 2NTBA 4YELA 1CZFA 2X6YA 4YZQA 3GQ9A 4Z05A 3FY3A 4OJOA 2QY1A 4URRA 1DBOA 1JTAA 1OFMA 1HG8A 4XOPA 2BSPA 1VBLA 2NSPA 3T9GA 3SUCA 1RMGA 4XR6A 3WWGA 4W8RA 2VBEA 4HWVA 4YZXA 1IA5A 3VMVA 2PYGA 2VBKA 2NT9A 2NZMA 1IDJA 4Z06A 4YEJA 4YZAA 4XONA 3UW0A 2UVFA 3VMWA 4XKWA 1PLUA 1GQ8A 4XLFA 4W8QA 3B90A 2PECA
chains in the Genus database with same CATH superfamily
3GQ7A 4OJPA 1NHCA 1XG2A 2ODLA 2X85A 3LMWA 5C1CA 1RWRA 2IQ7A 4OJ6A 3EQNA 4XL9A 3ZSCA 4OZYA 2PYHA 1OFEA 2UVEA 1K5CA 2VFPA 4I84A 1AIRA 4OJLA 4U4BA 1BN8A 2INUA 1CLWA 2BX6A 4YCQA 3JX8A 3VSUA 1OGOX 4XLEA 4XQFA 4XN0A 1IB4A 5JMCB 2BM7A 4XM3A 3BH7B 1O8MA 4YC5A 3N90A 1TSPA 3B8YA 2X3HA 3GQ8A 1QRBA 3DU1X 1O8DA 3PETA 1OFDA 4XKVA 4YFOA 4XLAA 1JRGA 4XLCA 1KCCA 1TYXA 3GQAA 1LM1A 2NTPA 4U49A 1KCDA 1EE6A 1PE9A 1LLZA 3B4NA 3N6ZA 4XMYA 3SZEA 4EW9A 4XLHA 2NTQA 2NT6A 1BHEA 2XTYA 3PSZA 4NK8A 1QCXA 4XOTA 1TYWA 2VFOA 1O8KA 1O8EA 1O8GA 1PXZA 3P4GA 4XNFA 1OFLA 3RIQA 2O0VA 5AMVA 4OPWA 3VSTA 2VBMA 1O8IA 1RU4A 2O04A 2NSTA 3PSSA 4OM9A 4XN3A 2IOUG 4W8TA 2X6WA 1L1IA 1X0CA 2INVA 1TYUA 4YZ0A 2J8KA 4YDTA 2QXZA 4NK6A 1K4ZA 1IDKA 2EWEA 4MR0A 4OJ5A 3EQOA 1O8LA 2VJJA 1QA2A 1OOCA 1KTWA 1H80A 5JLVC 1OGMX 2G0YA 3GRHA 4PMHA 4W8SA 1EA0A 4OZZA 1WMRA 2QX3A 2XC1A 1O88A 1O8FA 2QZAA 4MXNA 4Z03A 3VSVA 2VFMA 2O0WA 4XORA 2Z8GA 3TH0A 1QA1A 2X6XA 3KRGA 1QJVA 2VJIA 3JURA 3SQVA 4C2LA 1O8JA 2O1DA 3NB2A 3LJYA 1O8HA 2BM4A 4AVZA 2V5IA 2VFQA 2BM6A 5C1EA 1DBGA 2O17A 3ZPPA 2NTBA 4YELA 1KQ5A 1CZFA 2X6YA 4V02C 4YZQA 3GQ9A 4Z05A 2F3LA 3FY3A 4OJOA 2QY1A 3AK5A 3SYJA 4URRA 1DBOA 2XTWA 1JTAA 1DABA 1OFMA 2QYUA 4JRAC 1HG8A 4XOPA 2BSPA 2O6WA 4KH3A 1EZGA 1VBLA 2J8IA 2NSPA 3T9GA 3SUCA 2W7ZA 1RMGA 4XR6A 3WWGA 4W8RA 2VBEA 2B0RA 5DNSA 3SY2A 1QA3A 4HWVA 4YZXA 4XLFA 1HF2A 1IA5A 3VMVA 2PYGA 2XT4A 2VBKA 2NT9A 2NZMA 2XT2A 1IDJA 1K8FA 1TYVA 4Z06A 4YEJA 4YZAA 1QQ1A 2XTXA 2YUHA 3ML3A 1WXRA 1QRCA 2VFNA 4XONA 3UW0A 2UVFA 3VMWA 4XKWA 3LYCA 4YEIA 3BH6B 1PLUA 3NAWA 2BM5A 1GQ8A 3H09A 4W8QA 1LLWA 3B90A 2PECA
chains in the Genus database with same CATH topology
3GQ7A 4OJPA 1NHCA 1XG2A 2ODLA 2X85A 3LMWA 5C1CA 1RWRA 2IQ7A 4OJ6A 3EQNA 4XL9A 3ZSCA 4OZYA 2PYHA 1K5CA 2UVEA 4I84A 1AIRA 4OJLA 4U4BA 1BN8A 2INUA 3VSUA 1OGOX 4XLEA 4XQFA 4XN0A 1IB4A 4XM3A 1O8MA 3B8YA 2X3HA 3GQ8A 1O8DA 4XKVA 4XLAA 1JRGA 4XLCA 1KCCA 3GQAA 2NTPA 4U49A 1KCDA 1EE6A 1PE9A 4EW9A 3B4NA 4XMYA 4XLHA 2NTQA 2NT6A 1BHEA 4NK8A 1QCXA 4XOTA 1O8KA 1O8EA 1O8GA 1PXZA 4XNFA 1OFLA 2O0VA 5AMVA 3VSTA 2VBMA 1O8IA 1RU4A 2O04A 2NSTA 4XN3A 4W8TA 2X6WA 1X0CA 2INVA 4YZ0A 2QXZA 4NK6A 1IDKA 2EWEA 4MR0A 4OJ5A 3EQOA 2VJJA 1O8LA 1OOCA 1KTWA 1H80A 1OGMX 3GRHA 4PMHA 4W8SA 4OZZA 1WMRA 2QX3A 1O88A 1O8FA 4MXNA 4Z03A 3VSVA 4XORA 2O0WA 2Z8GA 2X6XA 3KRGA 1QJVA 2VJIA 3JURA 4C2LA 1O8JA 2O1DA 1O8HA 4AVZA 5C1EA 1DBGA 2O17A 3ZPPA 2NTBA 4YELA 1CZFA 2X6YA 4YZQA 3GQ9A 4Z05A 3FY3A 4OJOA 2QY1A 4URRA 1DBOA 1JTAA 1OFMA 1HG8A 4XOPA 2BSPA 1VBLA 2NSPA 3T9GA 3SUCA 1RMGA 4XR6A 3WWGA 4W8RA 2VBEA 4HWVA 4YZXA 1IA5A 3VMVA 2PYGA 2VBKA 2NT9A 2NZMA 1IDJA 4Z06A 4YEJA 4YZAA 4XONA 3UW0A 2UVFA 3VMWA 4XKWA 1PLUA 1GQ8A 4XLFA 4W8QA 3B90A 2PECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ7 A;  4OJP A;  1NHC A;  1XG2 A;  2ODL A;  2X85 A;  3LMW A;  5C1C A;  1RWR A;  2IQ7 A;  4OJ6 A;  3EQN A;  4XL9 A;  3ZSC A;  4OZY A;  2PYH A;  1K5C A;  2UVE A;  4I84 A;  1AIR A;  4OJL A;  4U4B A;  1BN8 A;  2INU A;  3VSU A;  1OGO X;  4XLE A;  4XQF A;  4XN0 A;  1IB4 A;  4XM3 A;  1O8M A;  3B8Y A;  2X3H A;  3GQ8 A;  1O8D A;  4XKV A;  4XLA A;  1JRG A;  4XLC A;  1KCC A;  3GQA A;  2NTP A;  4U49 A;  1KCD A;  1EE6 A;  1PE9 A;  4EW9 A;  3B4N A;  4XMY A;  4XLH A;  2NTQ A;  2NT6 A;  1BHE A;  4NK8 A;  1QCX A;  4XOT A;  1O8K A;  1O8E A;  1O8G A;  1PXZ A;  4XNF A;  1OFL A;  2O0V A;  5AMV A;  3VST A;  2VBM A;  1O8I A;  1RU4 A;  2O04 A;  2NST A;  4XN3 A;  4W8T A;  2X6W A;  1X0C A;  2INV A;  4YZ0 A;  2QXZ A;  4NK6 A;  1IDK A;  2EWE A;  4MR0 A;  4OJ5 A;  3EQO A;  2VJJ A;  1O8L A;  1OOC A;  1KTW A;  1H80 A;  1OGM X;  3GRH A;  4PMH A;  4W8S A;  4OZZ A;  1WMR A;  2QX3 A;  1O88 A;  1O8F A;  4MXN A;  4Z03 A;  3VSV A;  4XOR A;  2O0W A;  2Z8G A;  2X6X A;  3KRG A;  1QJV A;  2VJI A;  3JUR A;  4C2L A;  1O8J A;  2O1D A;  1O8H A;  4AVZ A;  5C1E A;  1DBG A;  2O17 A;  3ZPP A;  2NTB A;  4YEL A;  1CZF A;  2X6Y A;  4YZQ A;  3GQ9 A;  4Z05 A;  3FY3 A;  4OJO A;  2QY1 A;  4URR A;  1DBO A;  1JTA A;  1OFM A;  1HG8 A;  4XOP A;  2BSP A;  1VBL A;  2NSP A;  3T9G A;  3SUC A;  1RMG A;  4XR6 A;  3WWG A;  4W8R A;  2VBE A;  4HWV A;  4YZX A;  1IA5 A;  3VMV A;  2PYG A;  2VBK A;  2NT9 A;  2NZM A;  1IDJ A;  4Z06 A;  4YEJ A;  4YZA A;  4XON A;  3UW0 A;  2UVF A;  3VMW A;  4XKW A;  1PLU A;  1GQ8 A;  4XLF A;  4W8Q A;  3B90 A;  2PEC A; 
#chains in the Genus database with same CATH topology
 3GQ7 A;  4OJP A;  1NHC A;  1XG2 A;  2ODL A;  2X85 A;  3LMW A;  5C1C A;  1RWR A;  2IQ7 A;  4OJ6 A;  3EQN A;  4XL9 A;  3ZSC A;  4OZY A;  2PYH A;  1OFE A;  2UVE A;  1K5C A;  2VFP A;  4I84 A;  1AIR A;  4OJL A;  4U4B A;  1BN8 A;  2INU A;  1CLW A;  2BX6 A;  4YCQ A;  3JX8 A;  3VSU A;  1OGO X;  4XLE A;  4XQF A;  4XN0 A;  1IB4 A;  5JMC B;  2BM7 A;  4XM3 A;  3BH7 B;  1O8M A;  4YC5 A;  3N90 A;  1TSP A;  3B8Y A;  2X3H A;  3GQ8 A;  1QRB A;  3DU1 X;  1O8D A;  3PET A;  1OFD A;  4XKV A;  4YFO A;  4XLA A;  1JRG A;  4XLC A;  1KCC A;  1TYX A;  3GQA A;  1LM1 A;  2NTP A;  4U49 A;  1KCD A;  1EE6 A;  1PE9 A;  1LLZ A;  3B4N A;  3N6Z A;  4XMY A;  3SZE A;  4EW9 A;  4XLH A;  2NTQ A;  2NT6 A;  1BHE A;  2XTY A;  3PSZ A;  4NK8 A;  1QCX A;  4XOT A;  1TYW A;  2VFO A;  1O8K A;  1O8E A;  1O8G A;  1PXZ A;  3P4G A;  4XNF A;  1OFL A;  3RIQ A;  2O0V A;  5AMV A;  4OPW A;  3VST A;  2VBM A;  1O8I A;  1RU4 A;  2O04 A;  2NST A;  3PSS A;  4OM9 A;  4XN3 A;  2IOU G;  4W8T A;  2X6W A;  1L1I A;  1X0C A;  2INV A;  1TYU A;  4YZ0 A;  2J8K A;  4YDT A;  2QXZ A;  4NK6 A;  1K4Z A;  1IDK A;  2EWE A;  4MR0 A;  4OJ5 A;  3EQO A;  1O8L A;  2VJJ A;  1QA2 A;  1OOC A;  1KTW A;  1H80 A;  5JLV C;  1OGM X;  2G0Y A;  3GRH A;  4PMH A;  4W8S A;  1EA0 A;  4OZZ A;  1WMR A;  2QX3 A;  2XC1 A;  1O88 A;  1O8F A;  2QZA A;  4MXN A;  4Z03 A;  3VSV A;  2VFM A;  2O0W A;  4XOR A;  2Z8G A;  3TH0 A;  1QA1 A;  2X6X A;  3KRG A;  1QJV A;  2VJI A;  3JUR A;  3SQV A;  4C2L A;  1O8J A;  2O1D A;  3NB2 A;  3LJY A;  1O8H A;  2BM4 A;  4AVZ A;  2V5I A;  2VFQ A;  2BM6 A;  5C1E A;  1DBG A;  2O17 A;  3ZPP A;  2NTB A;  4YEL A;  1KQ5 A;  1CZF A;  2X6Y A;  4V02 C;  4YZQ A;  3GQ9 A;  4Z05 A;  2F3L A;  3FY3 A;  4OJO A;  2QY1 A;  3AK5 A;  3SYJ A;  4URR A;  1DBO A;  2XTW A;  1JTA A;  1DAB A;  1OFM A;  2QYU A;  4JRA C;  1HG8 A;  4XOP A;  2BSP A;  2O6W A;  4KH3 A;  1EZG A;  1VBL A;  2J8I A;  2NSP A;  3T9G A;  3SUC A;  2W7Z A;  1RMG A;  4XR6 A;  3WWG A;  4W8R A;  2VBE A;  2B0R A;  5DNS A;  3SY2 A;  1QA3 A;  4HWV A;  4YZX A;  4XLF A;  1HF2 A;  1IA5 A;  3VMV A;  2PYG A;  2XT4 A;  2VBK A;  2NT9 A;  2NZM A;  2XT2 A;  1IDJ A;  1K8F A;  1TYV A;  4Z06 A;  4YEJ A;  4YZA A;  1QQ1 A;  2XTX A;  2YUH A;  3ML3 A;  1WXR A;  1QRC A;  2VFN A;  4XON A;  3UW0 A;  2UVF A;  3VMW A;  4XKW A;  3LYC A;  4YEI A;  3BH6 B;  1PLU A;  3NAW A;  2BM5 A;  1GQ8 A;  3H09 A;  4W8Q A;  1LLW A;  3B90 A;  2PEC A; 
#chains in the Genus database with same CATH homology
 3GQ7 A;  4OJP A;  1NHC A;  1XG2 A;  2ODL A;  2X85 A;  3LMW A;  5C1C A;  1RWR A;  2IQ7 A;  4OJ6 A;  3EQN A;  4XL9 A;  3ZSC A;  4OZY A;  2PYH A;  1K5C A;  2UVE A;  4I84 A;  1AIR A;  4OJL A;  4U4B A;  1BN8 A;  2INU A;  3VSU A;  1OGO X;  4XLE A;  4XQF A;  4XN0 A;  1IB4 A;  4XM3 A;  1O8M A;  3B8Y A;  2X3H A;  3GQ8 A;  1O8D A;  4XKV A;  4XLA A;  1JRG A;  4XLC A;  1KCC A;  3GQA A;  2NTP A;  4U49 A;  1KCD A;  1EE6 A;  1PE9 A;  4EW9 A;  3B4N A;  4XMY A;  4XLH A;  2NTQ A;  2NT6 A;  1BHE A;  4NK8 A;  1QCX A;  4XOT A;  1O8K A;  1O8E A;  1O8G A;  1PXZ A;  4XNF A;  1OFL A;  2O0V A;  5AMV A;  3VST A;  2VBM A;  1O8I A;  1RU4 A;  2O04 A;  2NST A;  4XN3 A;  4W8T A;  2X6W A;  1X0C A;  2INV A;  4YZ0 A;  2QXZ A;  4NK6 A;  1IDK A;  2EWE A;  4MR0 A;  4OJ5 A;  3EQO A;  2VJJ A;  1O8L A;  1OOC A;  1KTW A;  1H80 A;  1OGM X;  3GRH A;  4PMH A;  4W8S A;  4OZZ A;  1WMR A;  2QX3 A;  1O88 A;  1O8F A;  4MXN A;  4Z03 A;  3VSV A;  4XOR A;  2O0W A;  2Z8G A;  2X6X A;  3KRG A;  1QJV A;  2VJI A;  3JUR A;  4C2L A;  1O8J A;  2O1D A;  1O8H A;  4AVZ A;  5C1E A;  1DBG A;  2O17 A;  3ZPP A;  2NTB A;  4YEL A;  1CZF A;  2X6Y A;  4YZQ A;  3GQ9 A;  4Z05 A;  3FY3 A;  4OJO A;  2QY1 A;  4URR A;  1DBO A;  1JTA A;  1OFM A;  1HG8 A;  4XOP A;  2BSP A;  1VBL A;  2NSP A;  3T9G A;  3SUC A;  1RMG A;  4XR6 A;  3WWG A;  4W8R A;  2VBE A;  4HWV A;  4YZX A;  1IA5 A;  3VMV A;  2PYG A;  2VBK A;  2NT9 A;  2NZM A;  1IDJ A;  4Z06 A;  4YEJ A;  4YZA A;  4XON A;  3UW0 A;  2UVF A;  3VMW A;  4XKW A;  1PLU A;  1GQ8 A;  4XLF A;  4W8Q A;  3B90 A;  2PEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...