1QCXA

Pectin lyase b
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
b'AGVVGAAEGFAHGVTGGGSASPVYPTTTDELVSYLGDNEPRVIILDQTFDFTGTEGTETTTGCAPWGTASQCQVAINLHSWCDNYQASAPKVSVTYDKAGILPITVNSNKSIVGQGTKGVIKGKGLRVVSGAKNVIIQNIAVTDINPKYVWGGDAITVDDSDLVWIDHVTTARIGRQHIVLGTSADNRVTISYSLIDGRSDYSATCNGHHYWGVYLDGSNDMVTLKGNYFYNLSGRMPKVQGNTLLHAVNNLFHNFDGHAFEIGTGGYVLAEGNVFQDVNVVVETPISGQLFSSPDANTNQQCASVFGRSCQLNAFGNSGSMSGSDTSIISKFAGKTIAAAHPPGAIAQWTMKNAGQGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTIN LYASE B
molecule tags Lyase
publication title The tree-dimensional structure of aspergillus niger pectin lyase B at 1.7-A resolution.
pubmed doi rcsb
total genus 137
structure length 359
sequence length 359
ec nomenclature ec 4.2.2.10: Pectin lyase.
pdb deposition date 1999-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1qcxA00
2X6XA 4XQFA 4MXNA 4MR0A 3VSUA 1DBOA 2QY1A 4XOTA 4OJOA 3KRGA 2IQ7A 3FY3A 4XORA 4I84A 3ZSCA 1OFMA 3VMVA 2PYGA 2VJIA 2X6WA 3LMWA 4W8TA 4XOPA 1WMRA 2X3HA 5C1EA 1BN8A 2QXZA 1PXZA 4XKWA 1K5CA 3T9GA 4HWVA 1O88A 3SUCA 1IB4A 4OJ6A 2NSTA 4XLFA 2EWEA 4OJLA 4YELA 3WWGA 4XKVA 4PMHA 2ODLA 2VBKA 2QX3A 4YZQA 1O8LA 2Z8GA 4W8RA 4U4BA 3B4NA 3ZPPA 2O1DA 3GQ7A 2X85A 1IDJA 4XMYA 2O04A 3GRHA 4XN3A 3VSTA 2X6YA 1O8HA 4XN0A 4OZYA 2INUA 3GQ8A 1O8EA 4YZAA 1O8IA 1X0CA 1O8KA 1O8DA 1PLUA 4XM3A 1NHCA 3EQOA 4C2LA 1OGMX 1O8GA 2O0WA 4XLAA 1QCXA 2O17A 1VBLA 2O0VA 1GQ8A 1XG2A 4AVZA 5C1CA 2NT9A 2UVFA 4XLCA 3EQNA 4W8SA 4NK8A 2NTQA 2NZMA 4XONA 3VMWA 2NTPA 1AIRA 1O8FA 2VBMA 3B90A 2UVEA 1JTAA 2VBEA 1IA5A 1BHEA 4XR6A 1PE9A 4OJPA 1DBGA 1KCDA 2PYHA 4OJ5A 1O8MA 1KTWA 2PECA 4OZZA 4XLEA 3GQ9A 1QJVA 1EE6A 2BSPA 2NTBA 1RMGA 1H80A 2NSPA 4W8QA 1CZFA 3UW0A 2NT6A 4U49A 4EW9A 1JRGA 4YZXA 4XLHA 4URRA 4Z06A 1OOCA 2VJJA 4XNFA 4YZ0A 4XL9A 1RU4A 5AMVA 1OGOX 1KCCA 3JURA 4YEJA 1HG8A 1OFLA 1O8JA 1IDKA 4NK6A 2INVA 4Z05A 3GQAA 3VSVA 4Z03A 1RWRA 3B8YA
chains in the Genus database with same CATH superfamily
2X6XA 1LLZA 2XT4A 4MXNA 4XQFA 4MR0A 3VSUA 1DBOA 2QY1A 4XOTA 1TYVA 3KRGA 4OJOA 2IQ7A 2XTWA 3DU1X 3FY3A 4KH3A 4YDTA 2BM5A 1QA1A 3ML3A 3PSZA 3N90A 4I84A 4XORA 2YUHA 3ZSCA 3NAWA 2BM7A 1OFMA 3VMVA 2IOUG 2PYGA 2VJIA 2X6WA 1QA2A 3LMWA 4YCQA 4W8TA 2VFQA 1K4ZA 4XOPA 1WMRA 2X3HA 5C1EA 1BN8A 3SZEA 2QXZA 3TH0A 1PXZA 2O6WA 1L1IA 4XKWA 1K5CA 1TYWA 2QZAA 4HWVA 1O88A 2BX6A 3SUCA 3T9GA 1IB4A 2VFNA 4OJ6A 2NSTA 4XLFA 3N6ZA 2EWEA 4OJLA 4YFOA 4YELA 3LJYA 4XKVA 3WWGA 4PMHA 2ODLA 2VBKA 5JLVC 2QX3A 4YZQA 1O8LA 2Z8GA 1QQ1A 2V5IA 2B0RA 4W8RA 4U4BA 1EZGA 1LM1A 3B4NA 3ZPPA 2O1DA 3GQ7A 2XTYA 2X85A 1LLWA 1IDJA 4YC5A 3AK5A 4XMYA 2O04A 3GRHA 1K8FA 4XN3A 3VSTA 2X6YA 1O8HA 1OFDA 4OZYA 2INUA 3GQ8A 4XN0A 1O8EA 4YZAA 1O8IA 1X0CA 1O8KA 1O8DA 1PLUA 3LYCA 4XM3A 1NHCA 3EQOA 4C2LA 1OGMX 1O8GA 1KQ5A 2O0WA 4XLAA 1QCXA 2O17A 1VBLA 2O0VA 3P4GA 1GQ8A 1XG2A 4AVZA 5C1CA 3SQVA 2NT9A 2UVFA 4XLCA 3JX8A 3EQNA 4W8SA 5JMCB 4NK8A 2NTQA 3SYJA 2NZMA 1HF2A 4XONA 3VMWA 2NTPA 1AIRA 1O8FA 1OFEA 2BM4A 2VBMA 3B90A 2UVEA 1CLWA 1JTAA 2VBEA 3RIQA 1IA5A 5DNSA 1BHEA 1TYXA 4XR6A 1PE9A 4OPWA 4V02C 2VFPA 4OJPA 1DBGA 1KCDA 1QA3A 1WXRA 2QYUA 2J8IA 3SY2A 3H09A 4YEIA 2PYHA 4OJ5A 1O8MA 2J8KA 1KTWA 2PECA 3BH7B 3GQ9A 4OZZA 1QJVA 4XLEA 1EE6A 2BSPA 2NTBA 1RMGA 2BM6A 1H80A 2NSPA 4W8QA 1TSPA 1CZFA 4OM9A 3UW0A 2NT6A 2F3LA 3NB2A 4JRAC 4U49A 2VFOA 4EW9A 1JRGA 4YZXA 2XTXA 4XLHA 4URRA 4Z06A 1OOCA 2VJJA 4XNFA 4YZ0A 4XL9A 2XT2A 1RU4A 2W7ZA 5AMVA 1OGOX 1KCCA 3JURA 4YEJA 1HG8A 1OFLA 1O8JA 1IDKA 3BH6B 3PETA 2G0YA 2INVA 3PSSA 4NK6A 1DABA 4Z05A 1QRBA 2XC1A 3GQAA 1TYUA 2VFMA 3VSVA 4Z03A 1RWRA 1EA0A 3B8YA 1QRCA
chains in the Genus database with same CATH topology
2X6XA 4XQFA 4MXNA 4MR0A 3VSUA 1DBOA 2QY1A 4XOTA 4OJOA 3KRGA 2IQ7A 3FY3A 4XORA 4I84A 3ZSCA 1OFMA 3VMVA 2PYGA 2VJIA 2X6WA 3LMWA 4W8TA 4XOPA 1WMRA 2X3HA 5C1EA 1BN8A 2QXZA 1PXZA 4XKWA 1K5CA 3T9GA 4HWVA 1O88A 3SUCA 1IB4A 4OJ6A 2NSTA 4XLFA 2EWEA 4OJLA 4YELA 3WWGA 4XKVA 4PMHA 2ODLA 2VBKA 2QX3A 4YZQA 1O8LA 2Z8GA 4W8RA 4U4BA 3B4NA 3ZPPA 2O1DA 3GQ7A 2X85A 1IDJA 4XMYA 2O04A 3GRHA 4XN3A 3VSTA 2X6YA 1O8HA 4XN0A 4OZYA 2INUA 3GQ8A 1O8EA 4YZAA 1O8IA 1X0CA 1O8KA 1O8DA 1PLUA 4XM3A 1NHCA 3EQOA 4C2LA 1OGMX 1O8GA 2O0WA 4XLAA 1QCXA 2O17A 1VBLA 2O0VA 1GQ8A 1XG2A 4AVZA 5C1CA 2NT9A 2UVFA 4XLCA 3EQNA 4W8SA 4NK8A 2NTQA 2NZMA 4XONA 3VMWA 2NTPA 1AIRA 1O8FA 2VBMA 3B90A 2UVEA 1JTAA 2VBEA 1IA5A 1BHEA 4XR6A 1PE9A 4OJPA 1DBGA 1KCDA 2PYHA 4OJ5A 1O8MA 1KTWA 2PECA 4OZZA 4XLEA 3GQ9A 1QJVA 1EE6A 2BSPA 2NTBA 1RMGA 1H80A 2NSPA 4W8QA 1CZFA 3UW0A 2NT6A 4U49A 4EW9A 1JRGA 4YZXA 4XLHA 4URRA 4Z06A 1OOCA 2VJJA 4XNFA 4YZ0A 4XL9A 1RU4A 5AMVA 1OGOX 1KCCA 3JURA 4YEJA 1HG8A 1OFLA 1O8JA 1IDKA 4NK6A 2INVA 4Z05A 3GQAA 3VSVA 4Z03A 1RWRA 3B8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6X A;  4XQF A;  4MXN A;  4MR0 A;  3VSU A;  1DBO A;  2QY1 A;  4XOT A;  4OJO A;  3KRG A;  2IQ7 A;  3FY3 A;  4XOR A;  4I84 A;  3ZSC A;  1OFM A;  3VMV A;  2PYG A;  2VJI A;  2X6W A;  3LMW A;  4W8T A;  4XOP A;  1WMR A;  2X3H A;  5C1E A;  1BN8 A;  2QXZ A;  1PXZ A;  4XKW A;  1K5C A;  3T9G A;  4HWV A;  1O88 A;  3SUC A;  1IB4 A;  4OJ6 A;  2NST A;  4XLF A;  2EWE A;  4OJL A;  4YEL A;  3WWG A;  4XKV A;  4PMH A;  2ODL A;  2VBK A;  2QX3 A;  4YZQ A;  1O8L A;  2Z8G A;  4W8R A;  4U4B A;  3B4N A;  3ZPP A;  2O1D A;  3GQ7 A;  2X85 A;  1IDJ A;  4XMY A;  2O04 A;  3GRH A;  4XN3 A;  3VST A;  2X6Y A;  1O8H A;  4XN0 A;  4OZY A;  2INU A;  3GQ8 A;  1O8E A;  4YZA A;  1O8I A;  1X0C A;  1O8K A;  1O8D A;  1PLU A;  4XM3 A;  1NHC A;  3EQO A;  4C2L A;  1OGM X;  1O8G A;  2O0W A;  4XLA A;  1QCX A;  2O17 A;  1VBL A;  2O0V A;  1GQ8 A;  1XG2 A;  4AVZ A;  5C1C A;  2NT9 A;  2UVF A;  4XLC A;  3EQN A;  4W8S A;  4NK8 A;  2NTQ A;  2NZM A;  4XON A;  3VMW A;  2NTP A;  1AIR A;  1O8F A;  2VBM A;  3B90 A;  2UVE A;  1JTA A;  2VBE A;  1IA5 A;  1BHE A;  4XR6 A;  1PE9 A;  4OJP A;  1DBG A;  1KCD A;  2PYH A;  4OJ5 A;  1O8M A;  1KTW A;  2PEC A;  4OZZ A;  4XLE A;  3GQ9 A;  1QJV A;  1EE6 A;  2BSP A;  2NTB A;  1RMG A;  1H80 A;  2NSP A;  4W8Q A;  1CZF A;  3UW0 A;  2NT6 A;  4U49 A;  4EW9 A;  1JRG A;  4YZX A;  4XLH A;  4URR A;  4Z06 A;  1OOC A;  2VJJ A;  4XNF A;  4YZ0 A;  4XL9 A;  1RU4 A;  5AMV A;  1OGO X;  1KCC A;  3JUR A;  4YEJ A;  1HG8 A;  1OFL A;  1O8J A;  1IDK A;  4NK6 A;  2INV A;  4Z05 A;  3GQA A;  3VSV A;  4Z03 A;  1RWR A;  3B8Y A; 
#chains in the Genus database with same CATH topology
 2X6X A;  1LLZ A;  2XT4 A;  4MXN A;  4XQF A;  4MR0 A;  3VSU A;  1DBO A;  2QY1 A;  4XOT A;  1TYV A;  3KRG A;  4OJO A;  2IQ7 A;  2XTW A;  3DU1 X;  3FY3 A;  4KH3 A;  4YDT A;  2BM5 A;  1QA1 A;  3ML3 A;  3PSZ A;  3N90 A;  4I84 A;  4XOR A;  2YUH A;  3ZSC A;  3NAW A;  2BM7 A;  1OFM A;  3VMV A;  2IOU G;  2PYG A;  2VJI A;  2X6W A;  1QA2 A;  3LMW A;  4YCQ A;  4W8T A;  2VFQ A;  1K4Z A;  4XOP A;  1WMR A;  2X3H A;  5C1E A;  1BN8 A;  3SZE A;  2QXZ A;  3TH0 A;  1PXZ A;  2O6W A;  1L1I A;  4XKW A;  1K5C A;  1TYW A;  2QZA A;  4HWV A;  1O88 A;  2BX6 A;  3SUC A;  3T9G A;  1IB4 A;  2VFN A;  4OJ6 A;  2NST A;  4XLF A;  3N6Z A;  2EWE A;  4OJL A;  4YFO A;  4YEL A;  3LJY A;  4XKV A;  3WWG A;  4PMH A;  2ODL A;  2VBK A;  5JLV C;  2QX3 A;  4YZQ A;  1O8L A;  2Z8G A;  1QQ1 A;  2V5I A;  2B0R A;  4W8R A;  4U4B A;  1EZG A;  1LM1 A;  3B4N A;  3ZPP A;  2O1D A;  3GQ7 A;  2XTY A;  2X85 A;  1LLW A;  1IDJ A;  4YC5 A;  3AK5 A;  4XMY A;  2O04 A;  3GRH A;  1K8F A;  4XN3 A;  3VST A;  2X6Y A;  1O8H A;  1OFD A;  4OZY A;  2INU A;  3GQ8 A;  4XN0 A;  1O8E A;  4YZA A;  1O8I A;  1X0C A;  1O8K A;  1O8D A;  1PLU A;  3LYC A;  4XM3 A;  1NHC A;  3EQO A;  4C2L A;  1OGM X;  1O8G A;  1KQ5 A;  2O0W A;  4XLA A;  1QCX A;  2O17 A;  1VBL A;  2O0V A;  3P4G A;  1GQ8 A;  1XG2 A;  4AVZ A;  5C1C A;  3SQV A;  2NT9 A;  2UVF A;  4XLC A;  3JX8 A;  3EQN A;  4W8S A;  5JMC B;  4NK8 A;  2NTQ A;  3SYJ A;  2NZM A;  1HF2 A;  4XON A;  3VMW A;  2NTP A;  1AIR A;  1O8F A;  1OFE A;  2BM4 A;  2VBM A;  3B90 A;  2UVE A;  1CLW A;  1JTA A;  2VBE A;  3RIQ A;  1IA5 A;  5DNS A;  1BHE A;  1TYX A;  4XR6 A;  1PE9 A;  4OPW A;  4V02 C;  2VFP A;  4OJP A;  1DBG A;  1KCD A;  1QA3 A;  1WXR A;  2QYU A;  2J8I A;  3SY2 A;  3H09 A;  4YEI A;  2PYH A;  4OJ5 A;  1O8M A;  2J8K A;  1KTW A;  2PEC A;  3BH7 B;  3GQ9 A;  4OZZ A;  1QJV A;  4XLE A;  1EE6 A;  2BSP A;  2NTB A;  1RMG A;  2BM6 A;  1H80 A;  2NSP A;  4W8Q A;  1TSP A;  1CZF A;  4OM9 A;  3UW0 A;  2NT6 A;  2F3L A;  3NB2 A;  4JRA C;  4U49 A;  2VFO A;  4EW9 A;  1JRG A;  4YZX A;  2XTX A;  4XLH A;  4URR A;  4Z06 A;  1OOC A;  2VJJ A;  4XNF A;  4YZ0 A;  4XL9 A;  2XT2 A;  1RU4 A;  2W7Z A;  5AMV A;  1OGO X;  1KCC A;  3JUR A;  4YEJ A;  1HG8 A;  1OFL A;  1O8J A;  1IDK A;  3BH6 B;  3PET A;  2G0Y A;  2INV A;  3PSS A;  4NK6 A;  1DAB A;  4Z05 A;  1QRB A;  2XC1 A;  3GQA A;  1TYU A;  2VFM A;  3VSV A;  4Z03 A;  1RWR A;  1EA0 A;  3B8Y A;  1QRC A; 
#chains in the Genus database with same CATH homology
 2X6X A;  4XQF A;  4MXN A;  4MR0 A;  3VSU A;  1DBO A;  2QY1 A;  4XOT A;  4OJO A;  3KRG A;  2IQ7 A;  3FY3 A;  4XOR A;  4I84 A;  3ZSC A;  1OFM A;  3VMV A;  2PYG A;  2VJI A;  2X6W A;  3LMW A;  4W8T A;  4XOP A;  1WMR A;  2X3H A;  5C1E A;  1BN8 A;  2QXZ A;  1PXZ A;  4XKW A;  1K5C A;  3T9G A;  4HWV A;  1O88 A;  3SUC A;  1IB4 A;  4OJ6 A;  2NST A;  4XLF A;  2EWE A;  4OJL A;  4YEL A;  3WWG A;  4XKV A;  4PMH A;  2ODL A;  2VBK A;  2QX3 A;  4YZQ A;  1O8L A;  2Z8G A;  4W8R A;  4U4B A;  3B4N A;  3ZPP A;  2O1D A;  3GQ7 A;  2X85 A;  1IDJ A;  4XMY A;  2O04 A;  3GRH A;  4XN3 A;  3VST A;  2X6Y A;  1O8H A;  4XN0 A;  4OZY A;  2INU A;  3GQ8 A;  1O8E A;  4YZA A;  1O8I A;  1X0C A;  1O8K A;  1O8D A;  1PLU A;  4XM3 A;  1NHC A;  3EQO A;  4C2L A;  1OGM X;  1O8G A;  2O0W A;  4XLA A;  1QCX A;  2O17 A;  1VBL A;  2O0V A;  1GQ8 A;  1XG2 A;  4AVZ A;  5C1C A;  2NT9 A;  2UVF A;  4XLC A;  3EQN A;  4W8S A;  4NK8 A;  2NTQ A;  2NZM A;  4XON A;  3VMW A;  2NTP A;  1AIR A;  1O8F A;  2VBM A;  3B90 A;  2UVE A;  1JTA A;  2VBE A;  1IA5 A;  1BHE A;  4XR6 A;  1PE9 A;  4OJP A;  1DBG A;  1KCD A;  2PYH A;  4OJ5 A;  1O8M A;  1KTW A;  2PEC A;  4OZZ A;  4XLE A;  3GQ9 A;  1QJV A;  1EE6 A;  2BSP A;  2NTB A;  1RMG A;  1H80 A;  2NSP A;  4W8Q A;  1CZF A;  3UW0 A;  2NT6 A;  4U49 A;  4EW9 A;  1JRG A;  4YZX A;  4XLH A;  4URR A;  4Z06 A;  1OOC A;  2VJJ A;  4XNF A;  4YZ0 A;  4XL9 A;  1RU4 A;  5AMV A;  1OGO X;  1KCC A;  3JUR A;  4YEJ A;  1HG8 A;  1OFL A;  1O8J A;  1IDK A;  4NK6 A;  2INV A;  4Z05 A;  3GQA A;  3VSV A;  4Z03 A;  1RWR A;  3B8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...