1QCXA

Pectin lyase b
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
AGVVGAAEGFAHGVTGGGSASPVYPTTTDELVSYLGDNEPRVIILDQTFDFTGTEGTETTTGCAPWGTASQCQVAINLHSWCDNYQASAPKVSVTYDKAGILPITVNSNKSIVGQGTKGVIKGKGLRVVSGAKNVIIQNIAVTDINPKYVWGGDAITVDDSDLVWIDHVTTARIGRQHIVLGTSADNRVTISYSLIDGRSDYSATCNGHHYWGVYLDGSNDMVTLKGNYFYNLSGRMPKVQGNTLLHAVNNLFHNFDGHAFEIGTGGYVLAEGNVFQDVNVVVETPISGQLFSSPDANTNQQCASVFGRSCQLNAFGNSGSMSGSDTSIISKFAGKTIAAAHPPGAIAQWTMKNAGQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords PECTIN LYASE B
publication title The tree-dimensional structure of aspergillus niger pectin lyase B at 1.7-A resolution.
pubmed doi rcsb
total genus 137
structure length 359
sequence length 359
ec nomenclature ec 4.2.2.10: Pectin lyase.
pdb deposition date 1999-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1qcxA00
4XN3A 1O8MA 1CZFA 4MXNA 1PLUA 1PXZA 1RMGA 4W8SA 1BHEA 4XN0A 1X0CA 1NHCA 1O88A 3VSUA 4MR0A 4URRA 4XLEA 3VMVA 1O8LA 2O1DA 3B90A 3ZSCA 3B4NA 2NSTA 4OZZA 1O8FA 2ODLA 2X6YA 4YZ0A 4YZXA 4Z06A 2VJIA 3UW0A 3EQNA 1RU4A 4U4BA 1JRGA 4HWVA 1XG2A 2NTPA 4XLAA 1QCXA 3GQAA 1OFMA 1OOCA 2IQ7A 1K5CA 2NTQA 1VBLA 4XONA 4XNFA 3ZPPA 5C1CA 2QY1A 2QXZA 1PE9A 1EE6A 2X6WA 2NT9A 1BN8A 4PMHA 4NK6A 2PYHA 3T9GA 4C2LA 2UVFA 1IDKA 4U49A 3KRGA 2O04A 3WWGA 4W8QA 2NT6A 2NZMA 2O17A 1IB4A 1O8HA 4YZAA 4XOPA 1QJVA 3GQ9A 3VSTA 1RWRA 4XMYA 1AIRA 3VMWA 1DBGA 2X85A 1JTAA 1KTWA 4EW9A 1KCCA 3B8YA 4YELA 4Z03A 1O8EA 2O0WA 2PECA 1H80A 1O8GA 3SUCA 4I84A 3GQ8A 3GRHA 1OGOX 4OJ5A 2NTBA 1O8JA 4XLCA 4XM3A 2NSPA 4Z05A 3FY3A 4OZYA 4XOTA 2QX3A 2X6XA 3EQOA 5AMVA 1OGMX 4XLFA 3JURA 2Z8GA 2O0VA 4XKWA 2VBEA 3VSVA 1O8KA 2BSPA 1WMRA 1O8IA 1DBOA 5C1EA 4OJ6A 4W8RA 4YEJA 2VBMA 4OJPA 1KCDA 2PYGA 4XL9A 4YZQA 4XORA 3LMWA 4XKVA 2VBKA 2INUA 2INVA 1GQ8A 1O8DA 4OJOA 4XQFA 2VJJA 1OFLA 4XLHA 4OJLA 4W8TA 1HG8A 2UVEA 2X3HA 3GQ7A 4NK8A 4XR6A 1IA5A 2EWEA 1IDJA 4AVZA
chains in the Genus database with same CATH superfamily
4XN3A 1O8MA 1CLWA 1QA1A 2J8KA 1CZFA 4MXNA 5JLVC 1PLUA 1PXZA 1RMGA 1OFEA 4W8SA 4YFOA 1BHEA 2XTYA 3PETA 4XN0A 1X0CA 1TYWA 1NHCA 1O88A 2VFQA 3VSUA 4MR0A 4URRA 5DNSA 4KH3A 4XLEA 3VMVA 1WXRA 1O8LA 2O1DA 3B90A 2XT4A 3NAWA 3B4NA 3ZSCA 2NSTA 4OZZA 1O8FA 2ODLA 2X6YA 2VFNA 4YZ0A 1L1IA 2BM7A 4YZXA 1TYUA 4Z06A 2VJIA 3UW0A 3EQNA 1RU4A 1LLWA 3N6ZA 1JRGA 2VFMA 4U4BA 1QA2A 4HWVA 3VSVA 1XG2A 2NTPA 4XLAA 3RIQA 1QCXA 3GQAA 1OFMA 1TSPA 1OOCA 2IQ7A 1K5CA 2NTQA 1VBLA 4XONA 4XNFA 3ZPPA 5C1CA 2QY1A 3LJYA 2QXZA 1PE9A 2B0RA 1EE6A 2J8IA 2X6WA 2XTWA 3NB2A 3TH0A 2NT9A 3SZEA 1BN8A 4PMHA 4NK6A 2PYHA 3T9GA 4C2LA 4YC5A 2UVFA 1IDKA 4U49A 3KRGA 2O04A 3WWGA 4W8QA 2NT6A 3N90A 4OM9A 3SYJA 5JMCB 2NZMA 2O17A 1DABA 1IB4A 1EA0A 1O8HA 4YZAA 2YUHA 4XOPA 1QJVA 4OPWA 3GQ9A 3VSTA 4YEIA 1RWRA 4XMYA 1AIRA 3VMWA 1DBGA 2X85A 1JTAA 3JX8A 1KTWA 4EW9A 1KCCA 3B8YA 4YELA 1QRBA 4Z03A 2VFOA 1O8EA 2O0WA 2PECA 1H80A 1O8GA 2F3LA 3SUCA 2BM5A 4I84A 2W7ZA 3GQ8A 3GRHA 1OGOX 4OJ5A 2IOUG 2NTBA 1TYVA 2O6WA 1O8JA 3BH7B 3H09A 4XLCA 1HF2A 2NSPA 3FY3A 4OZYA 1TYXA 4XOTA 4XM3A 4Z05A 2QX3A 2X6XA 2XTXA 3EQOA 5AMVA 1OGMX 4XLFA 1K8FA 3JURA 2Z8GA 1QRCA 2BX6A 1OFDA 2O0VA 2VBEA 4V02C 1O8KA 1EZGA 3P4GA 4XKWA 2BSPA 1WMRA 3SY2A 1QA3A 1O8IA 1DBOA 4YDTA 5C1EA 1KQ5A 3LYCA 3SQVA 4OJ6A 2V5IA 4W8RA 4YCQA 4YEJA 3AK5A 2VBMA 3BH6B 4OJPA 1KCDA 1QQ1A 2QZAA 1K4ZA 3DU1X 2PYGA 4XL9A 4JRAC 4YZQA 4XORA 1LM1A 3LMWA 3PSZA 4XKVA 2VBKA 2INUA 2BM6A 2VFPA 2INVA 1GQ8A 1O8DA 4OJOA 4XQFA 2VJJA 1OFLA 1LLZA 2BM4A 4XLHA 3ML3A 4OJLA 1HG8A 4W8TA 2XT2A 2QYUA 2UVEA 2X3HA 3GQ7A 4NK8A 4XR6A 2G0YA 1IA5A 2EWEA 3PSSA 1IDJA 4AVZA 2XC1A
chains in the Genus database with same CATH topology
4XN3A 1O8MA 1CZFA 4MXNA 1PLUA 1PXZA 1RMGA 4W8SA 1BHEA 4XN0A 1X0CA 1NHCA 1O88A 3VSUA 4MR0A 4URRA 4XLEA 3VMVA 1O8LA 2O1DA 3B90A 3ZSCA 3B4NA 2NSTA 4OZZA 1O8FA 2ODLA 2X6YA 4YZ0A 4YZXA 4Z06A 2VJIA 3UW0A 3EQNA 1RU4A 4U4BA 1JRGA 4HWVA 1XG2A 2NTPA 4XLAA 1QCXA 3GQAA 1OFMA 1OOCA 2IQ7A 1K5CA 2NTQA 1VBLA 4XONA 4XNFA 3ZPPA 5C1CA 2QY1A 2QXZA 1PE9A 1EE6A 2X6WA 2NT9A 1BN8A 4PMHA 4NK6A 2PYHA 3T9GA 4C2LA 2UVFA 1IDKA 4U49A 3KRGA 2O04A 3WWGA 4W8QA 2NT6A 2NZMA 2O17A 1IB4A 1O8HA 4YZAA 4XOPA 1QJVA 3GQ9A 3VSTA 1RWRA 4XMYA 1AIRA 3VMWA 1DBGA 2X85A 1JTAA 1KTWA 4EW9A 1KCCA 3B8YA 4YELA 4Z03A 1O8EA 2O0WA 2PECA 1H80A 1O8GA 3SUCA 4I84A 3GQ8A 3GRHA 1OGOX 4OJ5A 2NTBA 1O8JA 4XLCA 4XM3A 2NSPA 4Z05A 3FY3A 4OZYA 4XOTA 2QX3A 2X6XA 3EQOA 5AMVA 1OGMX 4XLFA 3JURA 2Z8GA 2O0VA 4XKWA 2VBEA 3VSVA 1O8KA 2BSPA 1WMRA 1O8IA 1DBOA 5C1EA 4OJ6A 4W8RA 4YEJA 2VBMA 4OJPA 1KCDA 2PYGA 4XL9A 4YZQA 4XORA 3LMWA 4XKVA 2VBKA 2INUA 2INVA 1GQ8A 1O8DA 4OJOA 4XQFA 2VJJA 1OFLA 4XLHA 4OJLA 4W8TA 1HG8A 2UVEA 2X3HA 3GQ7A 4NK8A 4XR6A 1IA5A 2EWEA 1IDJA 4AVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XN3 A;  1O8M A;  1CZF A;  4MXN A;  1PLU A;  1PXZ A;  1RMG A;  4W8S A;  1BHE A;  4XN0 A;  1X0C A;  1NHC A;  1O88 A;  3VSU A;  4MR0 A;  4URR A;  4XLE A;  3VMV A;  1O8L A;  2O1D A;  3B90 A;  3ZSC A;  3B4N A;  2NST A;  4OZZ A;  1O8F A;  2ODL A;  2X6Y A;  4YZ0 A;  4YZX A;  4Z06 A;  2VJI A;  3UW0 A;  3EQN A;  1RU4 A;  4U4B A;  1JRG A;  4HWV A;  1XG2 A;  2NTP A;  4XLA A;  1QCX A;  3GQA A;  1OFM A;  1OOC A;  2IQ7 A;  1K5C A;  2NTQ A;  1VBL A;  4XON A;  4XNF A;  3ZPP A;  5C1C A;  2QY1 A;  2QXZ A;  1PE9 A;  1EE6 A;  2X6W A;  2NT9 A;  1BN8 A;  4PMH A;  4NK6 A;  2PYH A;  3T9G A;  4C2L A;  2UVF A;  1IDK A;  4U49 A;  3KRG A;  2O04 A;  3WWG A;  4W8Q A;  2NT6 A;  2NZM A;  2O17 A;  1IB4 A;  1O8H A;  4YZA A;  4XOP A;  1QJV A;  3GQ9 A;  3VST A;  1RWR A;  4XMY A;  1AIR A;  3VMW A;  1DBG A;  2X85 A;  1JTA A;  1KTW A;  4EW9 A;  1KCC A;  3B8Y A;  4YEL A;  4Z03 A;  1O8E A;  2O0W A;  2PEC A;  1H80 A;  1O8G A;  3SUC A;  4I84 A;  3GQ8 A;  3GRH A;  1OGO X;  4OJ5 A;  2NTB A;  1O8J A;  4XLC A;  4XM3 A;  2NSP A;  4Z05 A;  3FY3 A;  4OZY A;  4XOT A;  2QX3 A;  2X6X A;  3EQO A;  5AMV A;  1OGM X;  4XLF A;  3JUR A;  2Z8G A;  2O0V A;  4XKW A;  2VBE A;  3VSV A;  1O8K A;  2BSP A;  1WMR A;  1O8I A;  1DBO A;  5C1E A;  4OJ6 A;  4W8R A;  4YEJ A;  2VBM A;  4OJP A;  1KCD A;  2PYG A;  4XL9 A;  4YZQ A;  4XOR A;  3LMW A;  4XKV A;  2VBK A;  2INU A;  2INV A;  1GQ8 A;  1O8D A;  4OJO A;  4XQF A;  2VJJ A;  1OFL A;  4XLH A;  4OJL A;  4W8T A;  1HG8 A;  2UVE A;  2X3H A;  3GQ7 A;  4NK8 A;  4XR6 A;  1IA5 A;  2EWE A;  1IDJ A;  4AVZ A; 
#chains in the Genus database with same CATH topology
 4XN3 A;  1O8M A;  1CLW A;  1QA1 A;  2J8K A;  1CZF A;  4MXN A;  5JLV C;  1PLU A;  1PXZ A;  1RMG A;  1OFE A;  4W8S A;  4YFO A;  1BHE A;  2XTY A;  3PET A;  4XN0 A;  1X0C A;  1TYW A;  1NHC A;  1O88 A;  2VFQ A;  3VSU A;  4MR0 A;  4URR A;  5DNS A;  4KH3 A;  4XLE A;  3VMV A;  1WXR A;  1O8L A;  2O1D A;  3B90 A;  2XT4 A;  3NAW A;  3B4N A;  3ZSC A;  2NST A;  4OZZ A;  1O8F A;  2ODL A;  2X6Y A;  2VFN A;  4YZ0 A;  1L1I A;  2BM7 A;  4YZX A;  1TYU A;  4Z06 A;  2VJI A;  3UW0 A;  3EQN A;  1RU4 A;  1LLW A;  3N6Z A;  1JRG A;  2VFM A;  4U4B A;  1QA2 A;  4HWV A;  3VSV A;  1XG2 A;  2NTP A;  4XLA A;  3RIQ A;  1QCX A;  3GQA A;  1OFM A;  1TSP A;  1OOC A;  2IQ7 A;  1K5C A;  2NTQ A;  1VBL A;  4XON A;  4XNF A;  3ZPP A;  5C1C A;  2QY1 A;  3LJY A;  2QXZ A;  1PE9 A;  2B0R A;  1EE6 A;  2J8I A;  2X6W A;  2XTW A;  3NB2 A;  3TH0 A;  2NT9 A;  3SZE A;  1BN8 A;  4PMH A;  4NK6 A;  2PYH A;  3T9G A;  4C2L A;  4YC5 A;  2UVF A;  1IDK A;  4U49 A;  3KRG A;  2O04 A;  3WWG A;  4W8Q A;  2NT6 A;  3N90 A;  4OM9 A;  3SYJ A;  5JMC B;  2NZM A;  2O17 A;  1DAB A;  1IB4 A;  1EA0 A;  1O8H A;  4YZA A;  2YUH A;  4XOP A;  1QJV A;  4OPW A;  3GQ9 A;  3VST A;  4YEI A;  1RWR A;  4XMY A;  1AIR A;  3VMW A;  1DBG A;  2X85 A;  1JTA A;  3JX8 A;  1KTW A;  4EW9 A;  1KCC A;  3B8Y A;  4YEL A;  1QRB A;  4Z03 A;  2VFO A;  1O8E A;  2O0W A;  2PEC A;  1H80 A;  1O8G A;  2F3L A;  3SUC A;  2BM5 A;  4I84 A;  2W7Z A;  3GQ8 A;  3GRH A;  1OGO X;  4OJ5 A;  2IOU G;  2NTB A;  1TYV A;  2O6W A;  1O8J A;  3BH7 B;  3H09 A;  4XLC A;  1HF2 A;  2NSP A;  3FY3 A;  4OZY A;  1TYX A;  4XOT A;  4XM3 A;  4Z05 A;  2QX3 A;  2X6X A;  2XTX A;  3EQO A;  5AMV A;  1OGM X;  4XLF A;  1K8F A;  3JUR A;  2Z8G A;  1QRC A;  2BX6 A;  1OFD A;  2O0V A;  2VBE A;  4V02 C;  1O8K A;  1EZG A;  3P4G A;  4XKW A;  2BSP A;  1WMR A;  3SY2 A;  1QA3 A;  1O8I A;  1DBO A;  4YDT A;  5C1E A;  1KQ5 A;  3LYC A;  3SQV A;  4OJ6 A;  2V5I A;  4W8R A;  4YCQ A;  4YEJ A;  3AK5 A;  2VBM A;  3BH6 B;  4OJP A;  1KCD A;  1QQ1 A;  2QZA A;  1K4Z A;  3DU1 X;  2PYG A;  4XL9 A;  4JRA C;  4YZQ A;  4XOR A;  1LM1 A;  3LMW A;  3PSZ A;  4XKV A;  2VBK A;  2INU A;  2BM6 A;  2VFP A;  2INV A;  1GQ8 A;  1O8D A;  4OJO A;  4XQF A;  2VJJ A;  1OFL A;  1LLZ A;  2BM4 A;  4XLH A;  3ML3 A;  4OJL A;  1HG8 A;  4W8T A;  2XT2 A;  2QYU A;  2UVE A;  2X3H A;  3GQ7 A;  4NK8 A;  4XR6 A;  2G0Y A;  1IA5 A;  2EWE A;  3PSS A;  1IDJ A;  4AVZ A;  2XC1 A; 
#chains in the Genus database with same CATH homology
 4XN3 A;  1O8M A;  1CZF A;  4MXN A;  1PLU A;  1PXZ A;  1RMG A;  4W8S A;  1BHE A;  4XN0 A;  1X0C A;  1NHC A;  1O88 A;  3VSU A;  4MR0 A;  4URR A;  4XLE A;  3VMV A;  1O8L A;  2O1D A;  3B90 A;  3ZSC A;  3B4N A;  2NST A;  4OZZ A;  1O8F A;  2ODL A;  2X6Y A;  4YZ0 A;  4YZX A;  4Z06 A;  2VJI A;  3UW0 A;  3EQN A;  1RU4 A;  4U4B A;  1JRG A;  4HWV A;  1XG2 A;  2NTP A;  4XLA A;  1QCX A;  3GQA A;  1OFM A;  1OOC A;  2IQ7 A;  1K5C A;  2NTQ A;  1VBL A;  4XON A;  4XNF A;  3ZPP A;  5C1C A;  2QY1 A;  2QXZ A;  1PE9 A;  1EE6 A;  2X6W A;  2NT9 A;  1BN8 A;  4PMH A;  4NK6 A;  2PYH A;  3T9G A;  4C2L A;  2UVF A;  1IDK A;  4U49 A;  3KRG A;  2O04 A;  3WWG A;  4W8Q A;  2NT6 A;  2NZM A;  2O17 A;  1IB4 A;  1O8H A;  4YZA A;  4XOP A;  1QJV A;  3GQ9 A;  3VST A;  1RWR A;  4XMY A;  1AIR A;  3VMW A;  1DBG A;  2X85 A;  1JTA A;  1KTW A;  4EW9 A;  1KCC A;  3B8Y A;  4YEL A;  4Z03 A;  1O8E A;  2O0W A;  2PEC A;  1H80 A;  1O8G A;  3SUC A;  4I84 A;  3GQ8 A;  3GRH A;  1OGO X;  4OJ5 A;  2NTB A;  1O8J A;  4XLC A;  4XM3 A;  2NSP A;  4Z05 A;  3FY3 A;  4OZY A;  4XOT A;  2QX3 A;  2X6X A;  3EQO A;  5AMV A;  1OGM X;  4XLF A;  3JUR A;  2Z8G A;  2O0V A;  4XKW A;  2VBE A;  3VSV A;  1O8K A;  2BSP A;  1WMR A;  1O8I A;  1DBO A;  5C1E A;  4OJ6 A;  4W8R A;  4YEJ A;  2VBM A;  4OJP A;  1KCD A;  2PYG A;  4XL9 A;  4YZQ A;  4XOR A;  3LMW A;  4XKV A;  2VBK A;  2INU A;  2INV A;  1GQ8 A;  1O8D A;  4OJO A;  4XQF A;  2VJJ A;  1OFL A;  4XLH A;  4OJL A;  4W8T A;  1HG8 A;  2UVE A;  2X3H A;  3GQ7 A;  4NK8 A;  4XR6 A;  1IA5 A;  2EWE A;  1IDJ A;  4AVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...