1QCXA

Pectin lyase b
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
AGVVGAAEGFAHGVTGGGSASPVYPTTTDELVSYLGDNEPRVIILDQTFDFTGTEGTETTTGCAPWGTASQCQVAINLHSWCDNYQASAPKVSVTYDKAGILPITVNSNKSIVGQGTKGVIKGKGLRVVSGAKNVIIQNIAVTDINPKYVWGGDAITVDDSDLVWIDHVTTARIGRQHIVLGTSADNRVTISYSLIDGRSDYSATCNGHHYWGVYLDGSNDMVTLKGNYFYNLSGRMPKVQGNTLLHAVNNLFHNFDGHAFEIGTGGYVLAEGNVFQDVNVVVETPISGQLFSSPDANTNQQCASVFGRSCQLNAFGNSGSMSGSDTSIISKFAGKTIAAAHPPGAIAQWTMKNAGQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTIN LYASE B
publication title The tree-dimensional structure of aspergillus niger pectin lyase B at 1.7-A resolution.
pubmed doi rcsb
molecule tags Lyase
total genus 137
structure length 359
sequence length 359
ec nomenclature ec 4.2.2.10: Pectin lyase.
pdb deposition date 1999-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1qcxA00
1RMGA 1AIRA 1IDJA 1QCXA 4W8TA 1XG2A 4PMHA 1GQ8A 4OZYA 1JRGA 4YZ0A 4XLEA 2VJJA 2X85A 2NSTA 4Z05A 4YELA 1HG8A 4Z03A 2INVA 4OJPA 1BHEA 1O8MA 4U4BA 4NK6A 4YZAA 4YEJA 3VSVA 1X0CA 4XLFA 1IDKA 4MR0A 5C1EA 4MXNA 3ZPPA 1K5CA 4YZQA 1KCDA 1RU4A 2NTQA 2O04A 1DBOA 3FY3A 4XQFA 4XLHA 4XN0A 3EQOA 2O0WA 4XLAA 2VBMA 2X6YA 4OJLA 1PXZA 3GQ8A 5AMVA 1KCCA 2INUA 1OFMA 1IB4A 4XORA 1O8JA 2IQ7A 3GQ7A 3B90A 1IA5A 1O8DA 2NZMA 4OZZA 4OJ5A 3B4NA 1O88A 1PLUA 2QY1A 4U49A 2QX3A 4Z06A 2QXZA 1H80A 2PYGA 4XLCA 3VSUA 3EQNA 4OJOA 4I84A 4XKWA 1O8EA 1BN8A 2X3HA 4XONA 3VSTA 1OGMX 3SUCA 1O8LA 2O1DA 1CZFA 3GQ9A 2VBKA 2X6XA 3WWGA 1O8GA 2EWEA 2NTPA 4XL9A 4XR6A 1RWRA 1EE6A 1O8HA 1OGOX 3B8YA 4AVZA 2NTBA 2NT9A 1NHCA 4XOTA 2UVEA 4YZXA 2NSPA 4C2LA 3ZSCA 3T9GA 3VMWA 4XOPA 3GQAA 5C1CA 3JURA 4XM3A 3KRGA 1JTAA 2NT6A 4XN3A 1WMRA 3LMWA 4EW9A 2O17A 1QJVA 1OOCA 3UW0A 3VMVA 1OFLA 4URRA 1PE9A 2ODLA 1KTWA 2X6WA 4HWVA 2O0VA 2VBEA 4XKVA 1DBGA 4W8SA 4W8RA 2BSPA 3GRHA 1VBLA 2PYHA 2VJIA 4XNFA 2Z8GA 2UVFA 4NK8A 2PECA 1O8FA 1O8KA 4OJ6A 4XMYA 4W8QA 1O8IA
chains in the Genus database with same CATH superfamily
1RMGA 1AIRA 1K4ZA 1QRCA 5JLVC 3TH0A 1IDJA 1KQ5A 1QCXA 2BM6A 2VFOA 4OM9A 1QA2A 4W8TA 2G0YA 1XG2A 2BM4A 4PMHA 3ML3A 1GQ8A 4OZYA 1JRGA 4YZ0A 4XLEA 2O6WA 2VJJA 1EA0A 1TYVA 2X85A 2QZAA 2NSTA 3BH7B 3NB2A 4Z05A 4YELA 1HG8A 4Z03A 2INVA 4OJPA 1BHEA 3DU1X 1WXRA 1O8MA 4U4BA 4NK6A 4YZAA 4YEJA 3SY2A 3VSVA 3RIQA 1X0CA 2J8KA 4XLFA 1IDKA 1TYWA 2XTXA 4MR0A 4YFOA 5C1EA 4MXNA 3ZPPA 1DABA 2BX6A 4YZQA 1K5CA 1RU4A 1KCDA 2NTQA 2O04A 1DBOA 3FY3A 4XQFA 4XLHA 4XN0A 4YDTA 4YEIA 3EQOA 2O0WA 4XLAA 2VBMA 2X6YA 4KH3A 1HF2A 4V02C 4OJLA 1LLWA 2BM5A 3H09A 2W7ZA 2YUHA 1PXZA 3GQ8A 3NAWA 3P4GA 5AMVA 2INUA 1KCCA 3AK5A 1OFMA 1TYXA 1IB4A 4XORA 1O8JA 3JX8A 2IQ7A 3GQ7A 3B90A 1IA5A 1O8DA 2NZMA 4OZZA 4OJ5A 2V5IA 3B4NA 1O88A 1PLUA 2QY1A 2VFPA 2QX3A 2B0RA 2QXZA 1H80A 2PYGA 2XT4A 4U49A 4XLCA 3EQNA 4YCQA 3VSUA 2J8IA 4OJOA 4I84A 4JRAC 3LYCA 4XKWA 2VFQA 1O8EA 1BN8A 2QYUA 3PETA 2X3HA 4XONA 1TSPA 3VSTA 1OGMX 1LM1A 2VFNA 1O8LA 2O1DA 1CZFA 3GQ9A 2VBKA 3SUCA 2X6XA 3WWGA 1O8GA 1OFDA 3PSZA 2XT2A 2EWEA 2NTPA 3N6ZA 4XL9A 1OFEA 4XR6A 2IOUG 1RWRA 2XTYA 1EE6A 1O8HA 1OGOX 3B8YA 4AVZA 5DNSA 1EZGA 2NTBA 3PSSA 3BH6B 3LJYA 2NT9A 4Z06A 1K8FA 4XOTA 1NHCA 2UVEA 4YZXA 2NSPA 4C2LA 3SZEA 3ZSCA 3T9GA 3VMWA 1QA3A 4XOPA 3GQAA 3SQVA 3JURA 4XM3A 5C1CA 3KRGA 1JTAA 2NT6A 4YC5A 4XN3A 1WMRA 3LMWA 4EW9A 2O17A 1QJVA 2XC1A 2VFMA 1OOCA 3UW0A 5JMCB 3VMVA 1OFLA 1TYUA 4URRA 1QQ1A 1PE9A 1QRBA 2ODLA 1KTWA 3SYJA 2X6WA 3N90A 1CLWA 4HWVA 2O0VA 2VBEA 4XKVA 1DBGA 4OPWA 4W8SA 4W8RA 1QA1A 2BSPA 1LLZA 3GRHA 1VBLA 2PYHA 2BM7A 2VJIA 4XNFA 2Z8GA 2UVFA 2XTWA 2PECA 4NK8A 1L1IA 1O8FA 1O8KA 4OJ6A 2F3LA 4XMYA 4W8QA 1O8IA
chains in the Genus database with same CATH topology
1RMGA 1AIRA 1IDJA 1QCXA 4W8TA 1XG2A 4PMHA 1GQ8A 4OZYA 1JRGA 4YZ0A 4XLEA 2VJJA 2X85A 2NSTA 4Z05A 4YELA 1HG8A 4Z03A 2INVA 4OJPA 1BHEA 1O8MA 4U4BA 4NK6A 4YZAA 4YEJA 3VSVA 1X0CA 4XLFA 1IDKA 4MR0A 5C1EA 4MXNA 3ZPPA 1K5CA 4YZQA 1KCDA 1RU4A 2NTQA 2O04A 1DBOA 3FY3A 4XQFA 4XLHA 4XN0A 3EQOA 2O0WA 4XLAA 2VBMA 2X6YA 4OJLA 1PXZA 3GQ8A 5AMVA 1KCCA 2INUA 1OFMA 1IB4A 4XORA 1O8JA 2IQ7A 3GQ7A 3B90A 1IA5A 1O8DA 2NZMA 4OZZA 4OJ5A 3B4NA 1O88A 1PLUA 2QY1A 4U49A 2QX3A 4Z06A 2QXZA 1H80A 2PYGA 4XLCA 3VSUA 3EQNA 4OJOA 4I84A 4XKWA 1O8EA 1BN8A 2X3HA 4XONA 3VSTA 1OGMX 3SUCA 1O8LA 2O1DA 1CZFA 3GQ9A 2VBKA 2X6XA 3WWGA 1O8GA 2EWEA 2NTPA 4XL9A 4XR6A 1RWRA 1EE6A 1O8HA 1OGOX 3B8YA 4AVZA 2NTBA 2NT9A 1NHCA 4XOTA 2UVEA 4YZXA 2NSPA 4C2LA 3ZSCA 3T9GA 3VMWA 4XOPA 3GQAA 5C1CA 3JURA 4XM3A 3KRGA 1JTAA 2NT6A 4XN3A 1WMRA 3LMWA 4EW9A 2O17A 1QJVA 1OOCA 3UW0A 3VMVA 1OFLA 4URRA 1PE9A 2ODLA 1KTWA 2X6WA 4HWVA 2O0VA 2VBEA 4XKVA 1DBGA 4W8SA 4W8RA 2BSPA 3GRHA 1VBLA 2PYHA 2VJIA 4XNFA 2Z8GA 2UVFA 4NK8A 2PECA 1O8FA 1O8KA 4OJ6A 4XMYA 4W8QA 1O8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMG A;  1AIR A;  1IDJ A;  1QCX A;  4W8T A;  1XG2 A;  4PMH A;  1GQ8 A;  4OZY A;  1JRG A;  4YZ0 A;  4XLE A;  2VJJ A;  2X85 A;  2NST A;  4Z05 A;  4YEL A;  1HG8 A;  4Z03 A;  2INV A;  4OJP A;  1BHE A;  1O8M A;  4U4B A;  4NK6 A;  4YZA A;  4YEJ A;  3VSV A;  1X0C A;  4XLF A;  1IDK A;  4MR0 A;  5C1E A;  4MXN A;  3ZPP A;  1K5C A;  4YZQ A;  1KCD A;  1RU4 A;  2NTQ A;  2O04 A;  1DBO A;  3FY3 A;  4XQF A;  4XLH A;  4XN0 A;  3EQO A;  2O0W A;  4XLA A;  2VBM A;  2X6Y A;  4OJL A;  1PXZ A;  3GQ8 A;  5AMV A;  1KCC A;  2INU A;  1OFM A;  1IB4 A;  4XOR A;  1O8J A;  2IQ7 A;  3GQ7 A;  3B90 A;  1IA5 A;  1O8D A;  2NZM A;  4OZZ A;  4OJ5 A;  3B4N A;  1O88 A;  1PLU A;  2QY1 A;  4U49 A;  2QX3 A;  4Z06 A;  2QXZ A;  1H80 A;  2PYG A;  4XLC A;  3VSU A;  3EQN A;  4OJO A;  4I84 A;  4XKW A;  1O8E A;  1BN8 A;  2X3H A;  4XON A;  3VST A;  1OGM X;  3SUC A;  1O8L A;  2O1D A;  1CZF A;  3GQ9 A;  2VBK A;  2X6X A;  3WWG A;  1O8G A;  2EWE A;  2NTP A;  4XL9 A;  4XR6 A;  1RWR A;  1EE6 A;  1O8H A;  1OGO X;  3B8Y A;  4AVZ A;  2NTB A;  2NT9 A;  1NHC A;  4XOT A;  2UVE A;  4YZX A;  2NSP A;  4C2L A;  3ZSC A;  3T9G A;  3VMW A;  4XOP A;  3GQA A;  5C1C A;  3JUR A;  4XM3 A;  3KRG A;  1JTA A;  2NT6 A;  4XN3 A;  1WMR A;  3LMW A;  4EW9 A;  2O17 A;  1QJV A;  1OOC A;  3UW0 A;  3VMV A;  1OFL A;  4URR A;  1PE9 A;  2ODL A;  1KTW A;  2X6W A;  4HWV A;  2O0V A;  2VBE A;  4XKV A;  1DBG A;  4W8S A;  4W8R A;  2BSP A;  3GRH A;  1VBL A;  2PYH A;  2VJI A;  4XNF A;  2Z8G A;  2UVF A;  4NK8 A;  2PEC A;  1O8F A;  1O8K A;  4OJ6 A;  4XMY A;  4W8Q A;  1O8I A; 
#chains in the Genus database with same CATH topology
 1RMG A;  1AIR A;  1K4Z A;  1QRC A;  5JLV C;  3TH0 A;  1IDJ A;  1KQ5 A;  1QCX A;  2BM6 A;  2VFO A;  4OM9 A;  1QA2 A;  4W8T A;  2G0Y A;  1XG2 A;  2BM4 A;  4PMH A;  3ML3 A;  1GQ8 A;  4OZY A;  1JRG A;  4YZ0 A;  4XLE A;  2O6W A;  2VJJ A;  1EA0 A;  1TYV A;  2X85 A;  2QZA A;  2NST A;  3BH7 B;  3NB2 A;  4Z05 A;  4YEL A;  1HG8 A;  4Z03 A;  2INV A;  4OJP A;  1BHE A;  3DU1 X;  1WXR A;  1O8M A;  4U4B A;  4NK6 A;  4YZA A;  4YEJ A;  3SY2 A;  3VSV A;  3RIQ A;  1X0C A;  2J8K A;  4XLF A;  1IDK A;  1TYW A;  2XTX A;  4MR0 A;  4YFO A;  5C1E A;  4MXN A;  3ZPP A;  1DAB A;  2BX6 A;  4YZQ A;  1K5C A;  1RU4 A;  1KCD A;  2NTQ A;  2O04 A;  1DBO A;  3FY3 A;  4XQF A;  4XLH A;  4XN0 A;  4YDT A;  4YEI A;  3EQO A;  2O0W A;  4XLA A;  2VBM A;  2X6Y A;  4KH3 A;  1HF2 A;  4V02 C;  4OJL A;  1LLW A;  2BM5 A;  3H09 A;  2W7Z A;  2YUH A;  1PXZ A;  3GQ8 A;  3NAW A;  3P4G A;  5AMV A;  2INU A;  1KCC A;  3AK5 A;  1OFM A;  1TYX A;  1IB4 A;  4XOR A;  1O8J A;  3JX8 A;  2IQ7 A;  3GQ7 A;  3B90 A;  1IA5 A;  1O8D A;  2NZM A;  4OZZ A;  4OJ5 A;  2V5I A;  3B4N A;  1O88 A;  1PLU A;  2QY1 A;  2VFP A;  2QX3 A;  2B0R A;  2QXZ A;  1H80 A;  2PYG A;  2XT4 A;  4U49 A;  4XLC A;  3EQN A;  4YCQ A;  3VSU A;  2J8I A;  4OJO A;  4I84 A;  4JRA C;  3LYC A;  4XKW A;  2VFQ A;  1O8E A;  1BN8 A;  2QYU A;  3PET A;  2X3H A;  4XON A;  1TSP A;  3VST A;  1OGM X;  1LM1 A;  2VFN A;  1O8L A;  2O1D A;  1CZF A;  3GQ9 A;  2VBK A;  3SUC A;  2X6X A;  3WWG A;  1O8G A;  1OFD A;  3PSZ A;  2XT2 A;  2EWE A;  2NTP A;  3N6Z A;  4XL9 A;  1OFE A;  4XR6 A;  2IOU G;  1RWR A;  2XTY A;  1EE6 A;  1O8H A;  1OGO X;  3B8Y A;  4AVZ A;  5DNS A;  1EZG A;  2NTB A;  3PSS A;  3BH6 B;  3LJY A;  2NT9 A;  4Z06 A;  1K8F A;  4XOT A;  1NHC A;  2UVE A;  4YZX A;  2NSP A;  4C2L A;  3SZE A;  3ZSC A;  3T9G A;  3VMW A;  1QA3 A;  4XOP A;  3GQA A;  3SQV A;  3JUR A;  4XM3 A;  5C1C A;  3KRG A;  1JTA A;  2NT6 A;  4YC5 A;  4XN3 A;  1WMR A;  3LMW A;  4EW9 A;  2O17 A;  1QJV A;  2XC1 A;  2VFM A;  1OOC A;  3UW0 A;  5JMC B;  3VMV A;  1OFL A;  1TYU A;  4URR A;  1QQ1 A;  1PE9 A;  1QRB A;  2ODL A;  1KTW A;  3SYJ A;  2X6W A;  3N90 A;  1CLW A;  4HWV A;  2O0V A;  2VBE A;  4XKV A;  1DBG A;  4OPW A;  4W8S A;  4W8R A;  1QA1 A;  2BSP A;  1LLZ A;  3GRH A;  1VBL A;  2PYH A;  2BM7 A;  2VJI A;  4XNF A;  2Z8G A;  2UVF A;  2XTW A;  2PEC A;  4NK8 A;  1L1I A;  1O8F A;  1O8K A;  4OJ6 A;  2F3L A;  4XMY A;  4W8Q A;  1O8I A; 
#chains in the Genus database with same CATH homology
 1RMG A;  1AIR A;  1IDJ A;  1QCX A;  4W8T A;  1XG2 A;  4PMH A;  1GQ8 A;  4OZY A;  1JRG A;  4YZ0 A;  4XLE A;  2VJJ A;  2X85 A;  2NST A;  4Z05 A;  4YEL A;  1HG8 A;  4Z03 A;  2INV A;  4OJP A;  1BHE A;  1O8M A;  4U4B A;  4NK6 A;  4YZA A;  4YEJ A;  3VSV A;  1X0C A;  4XLF A;  1IDK A;  4MR0 A;  5C1E A;  4MXN A;  3ZPP A;  1K5C A;  4YZQ A;  1KCD A;  1RU4 A;  2NTQ A;  2O04 A;  1DBO A;  3FY3 A;  4XQF A;  4XLH A;  4XN0 A;  3EQO A;  2O0W A;  4XLA A;  2VBM A;  2X6Y A;  4OJL A;  1PXZ A;  3GQ8 A;  5AMV A;  1KCC A;  2INU A;  1OFM A;  1IB4 A;  4XOR A;  1O8J A;  2IQ7 A;  3GQ7 A;  3B90 A;  1IA5 A;  1O8D A;  2NZM A;  4OZZ A;  4OJ5 A;  3B4N A;  1O88 A;  1PLU A;  2QY1 A;  4U49 A;  2QX3 A;  4Z06 A;  2QXZ A;  1H80 A;  2PYG A;  4XLC A;  3VSU A;  3EQN A;  4OJO A;  4I84 A;  4XKW A;  1O8E A;  1BN8 A;  2X3H A;  4XON A;  3VST A;  1OGM X;  3SUC A;  1O8L A;  2O1D A;  1CZF A;  3GQ9 A;  2VBK A;  2X6X A;  3WWG A;  1O8G A;  2EWE A;  2NTP A;  4XL9 A;  4XR6 A;  1RWR A;  1EE6 A;  1O8H A;  1OGO X;  3B8Y A;  4AVZ A;  2NTB A;  2NT9 A;  1NHC A;  4XOT A;  2UVE A;  4YZX A;  2NSP A;  4C2L A;  3ZSC A;  3T9G A;  3VMW A;  4XOP A;  3GQA A;  5C1C A;  3JUR A;  4XM3 A;  3KRG A;  1JTA A;  2NT6 A;  4XN3 A;  1WMR A;  3LMW A;  4EW9 A;  2O17 A;  1QJV A;  1OOC A;  3UW0 A;  3VMV A;  1OFL A;  4URR A;  1PE9 A;  2ODL A;  1KTW A;  2X6W A;  4HWV A;  2O0V A;  2VBE A;  4XKV A;  1DBG A;  4W8S A;  4W8R A;  2BSP A;  3GRH A;  1VBL A;  2PYH A;  2VJI A;  4XNF A;  2Z8G A;  2UVF A;  4NK8 A;  2PEC A;  1O8F A;  1O8K A;  4OJ6 A;  4XMY A;  4W8Q A;  1O8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...