1QCXA

Pectin lyase b
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
359
structure length
359
Chain Sequence
AGVVGAAEGFAHGVTGGGSASPVYPTTTDELVSYLGDNEPRVIILDQTFDFTGTEGTETTTGCAPWGTASQCQVAINLHSWCDNYQASAPKVSVTYDKAGILPITVNSNKSIVGQGTKGVIKGKGLRVVSGAKNVIIQNIAVTDINPKYVWGGDAITVDDSDLVWIDHVTTARIGRQHIVLGTSADNRVTISYSLIDGRSDYSATCNGHHYWGVYLDGSNDMVTLKGNYFYNLSGRMPKVQGNTLLHAVNNLFHNFDGHAFEIGTGGYVLAEGNVFQDVNVVVETPISGQLFSSPDANTNQQCASVFGRSCQLNAFGNSGSMSGSDTSIISKFAGKTIAAAHPPGAIAQWTMKNAGQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The tree-dimensional structure of aspergillus niger pectin lyase B at 1.7-A resolution.
pubmed doi rcsb
molecule tags Lyase
molecule keywords PECTIN LYASE B
total genus 137
structure length 359
sequence length 359
ec nomenclature ec 4.2.2.10: Pectin lyase.
pdb deposition date 1999-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1qcxA00
1IDJA 2NZMA 1O8KA 1JRGA 4XLAA 4XKVA 3EQOA 2QXZA 1KCCA 1OFLA 3JURA 4W8SA 3B4NA 1JTAA 1VBLA 1K5CA 2PYGA 1PXZA 2VJIA 1RWRA 4PMHA 4OZZA 1WMRA 1PE9A 4OJLA 4XORA 2PYHA 3GQ8A 3UW0A 2NTBA 4W8QA 1O8LA 1OFMA 4XONA 1XG2A 4YELA 1IDKA 1OGMX 3GQ7A 2VBMA 1O8JA 2VBKA 1QCXA 4XOPA 1GQ8A 2INVA 4MXNA 3ZSCA 3GRHA 1X0CA 4XKWA 4Z06A 2EWEA 2X6YA 1NHCA 1EE6A 3B90A 4XR6A 4YZAA 4NK8A 2Z8GA 2ODLA 4MR0A 1HG8A 2BSPA 4Z03A 4YZ0A 4YEJA 1DBOA 2X85A 2VJJA 1O8MA 4HWVA 3FY3A 3SUCA 4XLHA 1OOCA 4URRA 3VMWA 1O8IA 4XL9A 4XLEA 3EQNA 2PECA 4XN3A 4OJPA 5AMVA 2X6WA 4C2LA 1RMGA 1CZFA 4U4BA 4U49A 1IA5A 1AIRA 4EW9A 2UVFA 3VSVA 3LMWA 2NT9A 4XLFA 3VMVA 2NT6A 1H80A 1BN8A 4YZXA 2VBEA 3KRGA 3ZPPA 4XOTA 4NK6A 2NSTA 2IQ7A 4XNFA 1KTWA 4W8TA 2X3HA 1OGOX 2NSPA 1O88A 1O8DA 1QJVA 3GQ9A 1PLUA 4XN0A 2UVEA 2O1DA 4OJ5A 2X6XA 3VSUA 4OJOA 4Z05A 2INUA 2NTQA 4XQFA 2O17A 1O8GA 4AVZA 5C1CA 2NTPA 2QX3A 4W8RA 3T9GA 3GQAA 4XLCA 1KCDA 4XMYA 1O8FA 2O0VA 1O8EA 2O04A 1O8HA 1BHEA 1DBGA 3VSTA 1RU4A 5C1EA 3WWGA 1IB4A 4I84A 4XM3A 4OZYA 2O0WA 4YZQA 4OJ6A 2QY1A 3B8YA
chains in the Genus database with same CATH superfamily
5DNSA 1IDJA 1CLWA 2VFPA 2NZMA 3NAWA 3BH7B 3ML3A 4KH3A 4YCQA 1QQ1A 1O8KA 1JRGA 3SYJA 3H09A 2XC1A 2BM7A 3N90A 4XLAA 3EQOA 4XKVA 4YC5A 2QXZA 1QA1A 3LJYA 3SY2A 1KCCA 1OFLA 3JURA 4W8SA 3B4NA 1JTAA 1VBLA 1K5CA 2PYGA 1PXZA 1QRCA 2VJIA 1RWRA 3NB2A 4PMHA 4OZZA 1WMRA 1PE9A 2BM4A 4OJLA 4XORA 2PYHA 3GQ8A 3JX8A 3UW0A 3PSZA 2NTBA 4W8QA 1O8LA 1OFMA 2QYUA 4XONA 1XG2A 4YELA 1OFEA 1IDKA 1OGMX 2V5IA 2VBMA 3GQ7A 4YDTA 2O6WA 1O8JA 2VBKA 1EA0A 1QCXA 1TYXA 1GQ8A 1K4ZA 2INVA 4MXNA 4XOPA 3ZSCA 3GRHA 1X0CA 3N6ZA 4XKWA 2VFNA 4Z06A 2EWEA 2X6YA 1NHCA 1QA3A 1EE6A 3B90A 4V02C 4XR6A 2J8IA 4YZAA 3TH0A 4NK8A 3RIQA 2Z8GA 2ODLA 3B8YA 1HG8A 4MR0A 2BSPA 1DABA 4Z03A 2XTWA 4YZ0A 3LYCA 2BM6A 4YEJA 1DBOA 2G0YA 2X85A 1QRBA 2VJJA 4YFOA 4OM9A 3BH6B 4HWVA 2VFQA 3FY3A 2XTXA 3SUCA 4XLHA 1OOCA 2W7ZA 4URRA 3VMWA 1O8IA 4XL9A 4XLEA 3EQNA 2PECA 4XN3A 4OJPA 3DU1X 5AMVA 1WXRA 2X6WA 4OPWA 4C2LA 1RMGA 1CZFA 1LLWA 4U49A 4U4BA 1IA5A 1AIRA 4EW9A 2UVFA 4JRAC 3VSVA 3LMWA 2NT9A 1EZGA 2QZAA 1OFDA 4XLFA 3VMVA 2NT6A 1TSPA 1H80A 1LLZA 1L1IA 1BN8A 2J8KA 3PETA 4YZXA 2VBEA 2XTYA 3KRGA 3PSSA 4NK6A 4XOTA 3ZPPA 2NSTA 2IQ7A 4XNFA 1KTWA 1TYUA 4W8TA 2X3HA 1OGOX 2XT4A 2NSPA 1K8FA 1O88A 1O8DA 1QJVA 1TYVA 2VFMA 1PLUA 1TYWA 1HF2A 3GQ9A 4XN0A 4YEIA 2UVEA 2O1DA 4OJ5A 5JLVC 2X6XA 3VSUA 4OJOA 4Z05A 2INUA 2NTQA 4XQFA 2O17A 1O8GA 2IOUG 4AVZA 2NTPA 2QX3A 4W8RA 1KQ5A 2XT2A 3T9GA 5C1CA 5JMCB 1QA2A 2BM5A 2F3LA 3SQVA 3P4GA 3GQAA 4XLCA 1KCDA 4XMYA 1O8FA 2BX6A 2O0VA 1O8EA 2O04A 1O8HA 1BHEA 1DBGA 3VSTA 1RU4A 5C1EA 3WWGA 1LM1A 2YUHA 3SZEA 3AK5A 2B0RA 1IB4A 4I84A 4XM3A 4OZYA 2O0WA 4YZQA 4OJ6A 2QY1A 2VFOA 1O8MA
chains in the Genus database with same CATH topology
1IDJA 2NZMA 1O8KA 1JRGA 4XLAA 4XKVA 3EQOA 2QXZA 1KCCA 1OFLA 3JURA 4W8SA 3B4NA 1JTAA 1VBLA 1K5CA 2PYGA 1PXZA 2VJIA 1RWRA 4PMHA 4OZZA 1WMRA 1PE9A 4OJLA 4XORA 2PYHA 3GQ8A 3UW0A 2NTBA 4W8QA 1O8LA 1OFMA 4XONA 1XG2A 4YELA 1IDKA 1OGMX 3GQ7A 2VBMA 1O8JA 2VBKA 1QCXA 4XOPA 1GQ8A 2INVA 4MXNA 3ZSCA 3GRHA 1X0CA 4XKWA 4Z06A 2EWEA 2X6YA 1NHCA 1EE6A 3B90A 4XR6A 4YZAA 4NK8A 2Z8GA 2ODLA 4MR0A 1HG8A 2BSPA 4Z03A 4YZ0A 4YEJA 1DBOA 2X85A 2VJJA 1O8MA 4HWVA 3FY3A 3SUCA 4XLHA 1OOCA 4URRA 3VMWA 1O8IA 4XL9A 4XLEA 3EQNA 2PECA 4XN3A 4OJPA 5AMVA 2X6WA 4C2LA 1RMGA 1CZFA 4U4BA 4U49A 1IA5A 1AIRA 4EW9A 2UVFA 3VSVA 3LMWA 2NT9A 4XLFA 3VMVA 2NT6A 1H80A 1BN8A 4YZXA 2VBEA 3KRGA 3ZPPA 4XOTA 4NK6A 2NSTA 2IQ7A 4XNFA 1KTWA 4W8TA 2X3HA 1OGOX 2NSPA 1O88A 1O8DA 1QJVA 3GQ9A 1PLUA 4XN0A 2UVEA 2O1DA 4OJ5A 2X6XA 3VSUA 4OJOA 4Z05A 2INUA 2NTQA 4XQFA 2O17A 1O8GA 4AVZA 5C1CA 2NTPA 2QX3A 4W8RA 3T9GA 3GQAA 4XLCA 1KCDA 4XMYA 1O8FA 2O0VA 1O8EA 2O04A 1O8HA 1BHEA 1DBGA 3VSTA 1RU4A 5C1EA 3WWGA 1IB4A 4I84A 4XM3A 4OZYA 2O0WA 4YZQA 4OJ6A 2QY1A 3B8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDJ A;  2NZM A;  1O8K A;  1JRG A;  4XLA A;  4XKV A;  3EQO A;  2QXZ A;  1KCC A;  1OFL A;  3JUR A;  4W8S A;  3B4N A;  1JTA A;  1VBL A;  1K5C A;  2PYG A;  1PXZ A;  2VJI A;  1RWR A;  4PMH A;  4OZZ A;  1WMR A;  1PE9 A;  4OJL A;  4XOR A;  2PYH A;  3GQ8 A;  3UW0 A;  2NTB A;  4W8Q A;  1O8L A;  1OFM A;  4XON A;  1XG2 A;  4YEL A;  1IDK A;  1OGM X;  3GQ7 A;  2VBM A;  1O8J A;  2VBK A;  1QCX A;  4XOP A;  1GQ8 A;  2INV A;  4MXN A;  3ZSC A;  3GRH A;  1X0C A;  4XKW A;  4Z06 A;  2EWE A;  2X6Y A;  1NHC A;  1EE6 A;  3B90 A;  4XR6 A;  4YZA A;  4NK8 A;  2Z8G A;  2ODL A;  4MR0 A;  1HG8 A;  2BSP A;  4Z03 A;  4YZ0 A;  4YEJ A;  1DBO A;  2X85 A;  2VJJ A;  1O8M A;  4HWV A;  3FY3 A;  3SUC A;  4XLH A;  1OOC A;  4URR A;  3VMW A;  1O8I A;  4XL9 A;  4XLE A;  3EQN A;  2PEC A;  4XN3 A;  4OJP A;  5AMV A;  2X6W A;  4C2L A;  1RMG A;  1CZF A;  4U4B A;  4U49 A;  1IA5 A;  1AIR A;  4EW9 A;  2UVF A;  3VSV A;  3LMW A;  2NT9 A;  4XLF A;  3VMV A;  2NT6 A;  1H80 A;  1BN8 A;  4YZX A;  2VBE A;  3KRG A;  3ZPP A;  4XOT A;  4NK6 A;  2NST A;  2IQ7 A;  4XNF A;  1KTW A;  4W8T A;  2X3H A;  1OGO X;  2NSP A;  1O88 A;  1O8D A;  1QJV A;  3GQ9 A;  1PLU A;  4XN0 A;  2UVE A;  2O1D A;  4OJ5 A;  2X6X A;  3VSU A;  4OJO A;  4Z05 A;  2INU A;  2NTQ A;  4XQF A;  2O17 A;  1O8G A;  4AVZ A;  5C1C A;  2NTP A;  2QX3 A;  4W8R A;  3T9G A;  3GQA A;  4XLC A;  1KCD A;  4XMY A;  1O8F A;  2O0V A;  1O8E A;  2O04 A;  1O8H A;  1BHE A;  1DBG A;  3VST A;  1RU4 A;  5C1E A;  3WWG A;  1IB4 A;  4I84 A;  4XM3 A;  4OZY A;  2O0W A;  4YZQ A;  4OJ6 A;  2QY1 A;  3B8Y A; 
#chains in the Genus database with same CATH topology
 5DNS A;  1IDJ A;  1CLW A;  2VFP A;  2NZM A;  3NAW A;  3BH7 B;  3ML3 A;  4KH3 A;  4YCQ A;  1QQ1 A;  1O8K A;  1JRG A;  3SYJ A;  3H09 A;  2XC1 A;  2BM7 A;  3N90 A;  4XLA A;  3EQO A;  4XKV A;  4YC5 A;  2QXZ A;  1QA1 A;  3LJY A;  3SY2 A;  1KCC A;  1OFL A;  3JUR A;  4W8S A;  3B4N A;  1JTA A;  1VBL A;  1K5C A;  2PYG A;  1PXZ A;  1QRC A;  2VJI A;  1RWR A;  3NB2 A;  4PMH A;  4OZZ A;  1WMR A;  1PE9 A;  2BM4 A;  4OJL A;  4XOR A;  2PYH A;  3GQ8 A;  3JX8 A;  3UW0 A;  3PSZ A;  2NTB A;  4W8Q A;  1O8L A;  1OFM A;  2QYU A;  4XON A;  1XG2 A;  4YEL A;  1OFE A;  1IDK A;  1OGM X;  2V5I A;  2VBM A;  3GQ7 A;  4YDT A;  2O6W A;  1O8J A;  2VBK A;  1EA0 A;  1QCX A;  1TYX A;  1GQ8 A;  1K4Z A;  2INV A;  4MXN A;  4XOP A;  3ZSC A;  3GRH A;  1X0C A;  3N6Z A;  4XKW A;  2VFN A;  4Z06 A;  2EWE A;  2X6Y A;  1NHC A;  1QA3 A;  1EE6 A;  3B90 A;  4V02 C;  4XR6 A;  2J8I A;  4YZA A;  3TH0 A;  4NK8 A;  3RIQ A;  2Z8G A;  2ODL A;  3B8Y A;  1HG8 A;  4MR0 A;  2BSP A;  1DAB A;  4Z03 A;  2XTW A;  4YZ0 A;  3LYC A;  2BM6 A;  4YEJ A;  1DBO A;  2G0Y A;  2X85 A;  1QRB A;  2VJJ A;  4YFO A;  4OM9 A;  3BH6 B;  4HWV A;  2VFQ A;  3FY3 A;  2XTX A;  3SUC A;  4XLH A;  1OOC A;  2W7Z A;  4URR A;  3VMW A;  1O8I A;  4XL9 A;  4XLE A;  3EQN A;  2PEC A;  4XN3 A;  4OJP A;  3DU1 X;  5AMV A;  1WXR A;  2X6W A;  4OPW A;  4C2L A;  1RMG A;  1CZF A;  1LLW A;  4U49 A;  4U4B A;  1IA5 A;  1AIR A;  4EW9 A;  2UVF A;  4JRA C;  3VSV A;  3LMW A;  2NT9 A;  1EZG A;  2QZA A;  1OFD A;  4XLF A;  3VMV A;  2NT6 A;  1TSP A;  1H80 A;  1LLZ A;  1L1I A;  1BN8 A;  2J8K A;  3PET A;  4YZX A;  2VBE A;  2XTY A;  3KRG A;  3PSS A;  4NK6 A;  4XOT A;  3ZPP A;  2NST A;  2IQ7 A;  4XNF A;  1KTW A;  1TYU A;  4W8T A;  2X3H A;  1OGO X;  2XT4 A;  2NSP A;  1K8F A;  1O88 A;  1O8D A;  1QJV A;  1TYV A;  2VFM A;  1PLU A;  1TYW A;  1HF2 A;  3GQ9 A;  4XN0 A;  4YEI A;  2UVE A;  2O1D A;  4OJ5 A;  5JLV C;  2X6X A;  3VSU A;  4OJO A;  4Z05 A;  2INU A;  2NTQ A;  4XQF A;  2O17 A;  1O8G A;  2IOU G;  4AVZ A;  2NTP A;  2QX3 A;  4W8R A;  1KQ5 A;  2XT2 A;  3T9G A;  5C1C A;  5JMC B;  1QA2 A;  2BM5 A;  2F3L A;  3SQV A;  3P4G A;  3GQA A;  4XLC A;  1KCD A;  4XMY A;  1O8F A;  2BX6 A;  2O0V A;  1O8E A;  2O04 A;  1O8H A;  1BHE A;  1DBG A;  3VST A;  1RU4 A;  5C1E A;  3WWG A;  1LM1 A;  2YUH A;  3SZE A;  3AK5 A;  2B0R A;  1IB4 A;  4I84 A;  4XM3 A;  4OZY A;  2O0W A;  4YZQ A;  4OJ6 A;  2QY1 A;  2VFO A;  1O8M A; 
#chains in the Genus database with same CATH homology
 1IDJ A;  2NZM A;  1O8K A;  1JRG A;  4XLA A;  4XKV A;  3EQO A;  2QXZ A;  1KCC A;  1OFL A;  3JUR A;  4W8S A;  3B4N A;  1JTA A;  1VBL A;  1K5C A;  2PYG A;  1PXZ A;  2VJI A;  1RWR A;  4PMH A;  4OZZ A;  1WMR A;  1PE9 A;  4OJL A;  4XOR A;  2PYH A;  3GQ8 A;  3UW0 A;  2NTB A;  4W8Q A;  1O8L A;  1OFM A;  4XON A;  1XG2 A;  4YEL A;  1IDK A;  1OGM X;  3GQ7 A;  2VBM A;  1O8J A;  2VBK A;  1QCX A;  4XOP A;  1GQ8 A;  2INV A;  4MXN A;  3ZSC A;  3GRH A;  1X0C A;  4XKW A;  4Z06 A;  2EWE A;  2X6Y A;  1NHC A;  1EE6 A;  3B90 A;  4XR6 A;  4YZA A;  4NK8 A;  2Z8G A;  2ODL A;  4MR0 A;  1HG8 A;  2BSP A;  4Z03 A;  4YZ0 A;  4YEJ A;  1DBO A;  2X85 A;  2VJJ A;  1O8M A;  4HWV A;  3FY3 A;  3SUC A;  4XLH A;  1OOC A;  4URR A;  3VMW A;  1O8I A;  4XL9 A;  4XLE A;  3EQN A;  2PEC A;  4XN3 A;  4OJP A;  5AMV A;  2X6W A;  4C2L A;  1RMG A;  1CZF A;  4U4B A;  4U49 A;  1IA5 A;  1AIR A;  4EW9 A;  2UVF A;  3VSV A;  3LMW A;  2NT9 A;  4XLF A;  3VMV A;  2NT6 A;  1H80 A;  1BN8 A;  4YZX A;  2VBE A;  3KRG A;  3ZPP A;  4XOT A;  4NK6 A;  2NST A;  2IQ7 A;  4XNF A;  1KTW A;  4W8T A;  2X3H A;  1OGO X;  2NSP A;  1O88 A;  1O8D A;  1QJV A;  3GQ9 A;  1PLU A;  4XN0 A;  2UVE A;  2O1D A;  4OJ5 A;  2X6X A;  3VSU A;  4OJO A;  4Z05 A;  2INU A;  2NTQ A;  4XQF A;  2O17 A;  1O8G A;  4AVZ A;  5C1C A;  2NTP A;  2QX3 A;  4W8R A;  3T9G A;  3GQA A;  4XLC A;  1KCD A;  4XMY A;  1O8F A;  2O0V A;  1O8E A;  2O04 A;  1O8H A;  1BHE A;  1DBG A;  3VST A;  1RU4 A;  5C1E A;  3WWG A;  1IB4 A;  4I84 A;  4XM3 A;  4OZY A;  2O0W A;  4YZQ A;  4OJ6 A;  2QY1 A;  3B8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...