1O88A

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 30mm ca2+
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
352
structure length
352
Chain Sequence
b'ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 141
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o88A00
3LMWA 4XLCA 3VSUA 1O8KA 3T9GA 2EWEA 1IDKA 2BSPA 2PYGA 2O04A 2NTBA 1OOCA 1IA5A 4OZZA 4OJLA 4OZYA 3EQOA 1O8FA 3KRGA 4XOTA 5C1CA 1OGMX 1O8EA 1VBLA 4W8RA 1JRGA 1BHEA 4XR6A 4XM3A 1KTWA 1BN8A 4U49A 2X3HA 4XOPA 2QY1A 4XLFA 3GQ9A 4NK8A 4YZQA 2O17A 2X6YA 3B90A 1DBGA 4I84A 4YZAA 1NHCA 1OFMA 1DBOA 1AIRA 3FY3A 2NT6A 2VJJA 2Z8GA 1QCXA 1IDJA 1QJVA 4URRA 4YEJA 4W8QA 2NTPA 2X6WA 1H80A 1X0CA 3GQ8A 3GQ7A 4XLAA 2NSPA 4C2LA 2NSTA 2NZMA 3EQNA 3GQAA 2VBMA 2O1DA 4XORA 1WMRA 1PE9A 2UVFA 1K5CA 1PLUA 2O0WA 1XG2A 3B8YA 4OJ5A 4OJPA 4AVZA 1O88A 4Z06A 4XNFA 1CZFA 2O0VA 4MXNA 3VSVA 1EE6A 4XKVA 4HWVA 4XN0A 2NTQA 3VMVA 2VJIA 4W8SA 4XL9A 2VBKA 3SUCA 4XONA 4EW9A 4XMYA 1RWRA 4OJ6A 1O8HA 1O8GA 1O8DA 4XLEA 4Z05A 4U4BA 3ZPPA 2INVA 4XLHA 5C1EA 4YZ0A 2QX3A 4XQFA 3WWGA 1KCCA 3GRHA 4NK6A 1OGOX 2X6XA 1HG8A 1PXZA 1O8IA 4YELA 3ZSCA 1IB4A 1KCDA 2ODLA 1O8LA 4XN3A 2PECA 4YZXA 3UW0A 2QXZA 2INUA 2UVEA 1O8MA 2PYHA 3B4NA 2NT9A 1RU4A 3JURA 4W8TA 3VMWA 3VSTA 1O8JA 4XKWA 2VBEA 4OJOA 1JTAA 4PMHA 1RMGA 5AMVA 4Z03A 4MR0A 1OFLA 2X85A 1GQ8A 2IQ7A
chains in the Genus database with same CATH superfamily
3LMWA 4XLCA 3RIQA 4YEIA 2O6WA 3VSUA 1O8KA 3T9GA 1QA3A 2EWEA 1IDKA 2BSPA 3SY2A 2PYGA 2O04A 2NTBA 1OOCA 4JRAC 1IA5A 4OZZA 2YUHA 4OJLA 4OM9A 1TYWA 4OZYA 3EQOA 1O8FA 3KRGA 4XOTA 3SQVA 5C1CA 1OGMX 1O8EA 1VBLA 4W8RA 2BM5A 3NAWA 1JRGA 2XC1A 2X85A 1BHEA 4XR6A 4XM3A 3AK5A 1KTWA 1BN8A 2QZAA 3BH6B 4U49A 2X3HA 4XOPA 2QY1A 2QYUA 2J8KA 4XLFA 3GQ9A 4NK8A 4YZQA 2XT4A 3LJYA 2O17A 4YC5A 2X6YA 3B90A 3PSSA 1DBGA 2VFNA 4I84A 1QA2A 4YZAA 1NHCA 1OFMA 2VFMA 1DBOA 1AIRA 2V5IA 2NT6A 2VJJA 2Z8GA 2VFOA 3FY3A 4KH3A 1QCXA 1IDJA 1QJVA 1QRBA 4URRA 4YEJA 3SYJA 1CLWA 2G0YA 2NTPA 1H80A 1X0CA 2X6WA 3GQ8A 3GQ7A 4W8QA 2NSPA 4XLAA 2NSTA 2NZMA 4C2LA 3EQNA 2VFQA 2BM6A 2XT2A 3H09A 3ML3A 3GQAA 2VBMA 1LLWA 4YCQA 1L1IA 1EA0A 2BM4A 3DU1X 4V02C 2O1DA 2F3LA 1WMRA 1TYXA 1PE9A 4XORA 2UVFA 5JMCB 1QQ1A 4YFOA 3N6ZA 1K5CA 1PLUA 2O0WA 1XG2A 3B8YA 1TSPA 2IOUG 4OJ5A 4OJPA 4AVZA 1O88A 4Z06A 1WXRA 4XNFA 2XTYA 1CZFA 2O0VA 5DNSA 1QA1A 4MXNA 3VSVA 1EE6A 4XKVA 4HWVA 4XN0A 1KQ5A 1QRCA 2NTQA 1OFEA 2VJIA 4YDTA 2BM7A 1HF2A 3PETA 4W8SA 3VMVA 4XL9A 2VBKA 3SUCA 1TYVA 3P4GA 4XONA 4EW9A 4XMYA 1RWRA 4OJ6A 1O8HA 1O8GA 1O8DA 1LM1A 4XLEA 4U4BA 4Z05A 1DABA 3ZPPA 2INVA 4XLHA 5C1EA 4YZ0A 2QX3A 4XQFA 3WWGA 1KCCA 4OPWA 1TYUA 3GRHA 4NK6A 1OGOX 2W7ZA 2X6XA 3TH0A 1HG8A 1PXZA 1O8IA 4YELA 3ZSCA 2B0RA 2VFPA 3LYCA 3N90A 1IB4A 2XTWA 1KCDA 2ODLA 1O8LA 1OFDA 3PSZA 4XN3A 2PECA 4YZXA 1EZGA 2QXZA 3SZEA 3UW0A 3BH7B 2INUA 2UVEA 1O8MA 2PYHA 3B4NA 2J8IA 2NT9A 1RU4A 3JURA 4W8TA 3VMWA 3VSTA 1O8JA 1K4ZA 2BX6A 2VBEA 4XKWA 4OJOA 5JLVC 1JTAA 4PMHA 1RMGA 2XTXA 5AMVA 3NB2A 4MR0A 1OFLA 3JX8A 1LLZA 1GQ8A 4Z03A 1K8FA 2IQ7A
chains in the Genus database with same CATH topology
3LMWA 4XLCA 3VSUA 1O8KA 3T9GA 2EWEA 1IDKA 2BSPA 2PYGA 2O04A 2NTBA 1OOCA 1IA5A 4OZZA 4OJLA 4OZYA 3EQOA 1O8FA 3KRGA 4XOTA 5C1CA 1OGMX 1O8EA 1VBLA 4W8RA 1JRGA 1BHEA 4XR6A 4XM3A 1KTWA 1BN8A 4U49A 2X3HA 4XOPA 2QY1A 4XLFA 3GQ9A 4NK8A 4YZQA 2O17A 2X6YA 3B90A 1DBGA 4I84A 4YZAA 1NHCA 1OFMA 1DBOA 1AIRA 3FY3A 2NT6A 2VJJA 2Z8GA 1QCXA 1IDJA 1QJVA 4URRA 4YEJA 4W8QA 2NTPA 2X6WA 1H80A 1X0CA 3GQ8A 3GQ7A 4XLAA 2NSPA 4C2LA 2NSTA 2NZMA 3EQNA 3GQAA 2VBMA 2O1DA 4XORA 1WMRA 1PE9A 2UVFA 1K5CA 1PLUA 2O0WA 1XG2A 3B8YA 4OJ5A 4OJPA 4AVZA 1O88A 4Z06A 4XNFA 1CZFA 2O0VA 4MXNA 3VSVA 1EE6A 4XKVA 4HWVA 4XN0A 2NTQA 3VMVA 2VJIA 4W8SA 4XL9A 2VBKA 3SUCA 4XONA 4EW9A 4XMYA 1RWRA 4OJ6A 1O8HA 1O8GA 1O8DA 4XLEA 4Z05A 4U4BA 3ZPPA 2INVA 4XLHA 5C1EA 4YZ0A 2QX3A 4XQFA 3WWGA 1KCCA 3GRHA 4NK6A 1OGOX 2X6XA 1HG8A 1PXZA 1O8IA 4YELA 3ZSCA 1IB4A 1KCDA 2ODLA 1O8LA 4XN3A 2PECA 4YZXA 3UW0A 2QXZA 2INUA 2UVEA 1O8MA 2PYHA 3B4NA 2NT9A 1RU4A 3JURA 4W8TA 3VMWA 3VSTA 1O8JA 4XKWA 2VBEA 4OJOA 1JTAA 4PMHA 1RMGA 5AMVA 4Z03A 4MR0A 1OFLA 2X85A 1GQ8A 2IQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LMW A;  4XLC A;  3VSU A;  1O8K A;  3T9G A;  2EWE A;  1IDK A;  2BSP A;  2PYG A;  2O04 A;  2NTB A;  1OOC A;  1IA5 A;  4OZZ A;  4OJL A;  4OZY A;  3EQO A;  1O8F A;  3KRG A;  4XOT A;  5C1C A;  1OGM X;  1O8E A;  1VBL A;  4W8R A;  1JRG A;  1BHE A;  4XR6 A;  4XM3 A;  1KTW A;  1BN8 A;  4U49 A;  2X3H A;  4XOP A;  2QY1 A;  4XLF A;  3GQ9 A;  4NK8 A;  4YZQ A;  2O17 A;  2X6Y A;  3B90 A;  1DBG A;  4I84 A;  4YZA A;  1NHC A;  1OFM A;  1DBO A;  1AIR A;  3FY3 A;  2NT6 A;  2VJJ A;  2Z8G A;  1QCX A;  1IDJ A;  1QJV A;  4URR A;  4YEJ A;  4W8Q A;  2NTP A;  2X6W A;  1H80 A;  1X0C A;  3GQ8 A;  3GQ7 A;  4XLA A;  2NSP A;  4C2L A;  2NST A;  2NZM A;  3EQN A;  3GQA A;  2VBM A;  2O1D A;  4XOR A;  1WMR A;  1PE9 A;  2UVF A;  1K5C A;  1PLU A;  2O0W A;  1XG2 A;  3B8Y A;  4OJ5 A;  4OJP A;  4AVZ A;  1O88 A;  4Z06 A;  4XNF A;  1CZF A;  2O0V A;  4MXN A;  3VSV A;  1EE6 A;  4XKV A;  4HWV A;  4XN0 A;  2NTQ A;  3VMV A;  2VJI A;  4W8S A;  4XL9 A;  2VBK A;  3SUC A;  4XON A;  4EW9 A;  4XMY A;  1RWR A;  4OJ6 A;  1O8H A;  1O8G A;  1O8D A;  4XLE A;  4Z05 A;  4U4B A;  3ZPP A;  2INV A;  4XLH A;  5C1E A;  4YZ0 A;  2QX3 A;  4XQF A;  3WWG A;  1KCC A;  3GRH A;  4NK6 A;  1OGO X;  2X6X A;  1HG8 A;  1PXZ A;  1O8I A;  4YEL A;  3ZSC A;  1IB4 A;  1KCD A;  2ODL A;  1O8L A;  4XN3 A;  2PEC A;  4YZX A;  3UW0 A;  2QXZ A;  2INU A;  2UVE A;  1O8M A;  2PYH A;  3B4N A;  2NT9 A;  1RU4 A;  3JUR A;  4W8T A;  3VMW A;  3VST A;  1O8J A;  4XKW A;  2VBE A;  4OJO A;  1JTA A;  4PMH A;  1RMG A;  5AMV A;  4Z03 A;  4MR0 A;  1OFL A;  2X85 A;  1GQ8 A;  2IQ7 A; 
#chains in the Genus database with same CATH topology
 3LMW A;  4XLC A;  3RIQ A;  4YEI A;  2O6W A;  3VSU A;  1O8K A;  3T9G A;  1QA3 A;  2EWE A;  1IDK A;  2BSP A;  3SY2 A;  2PYG A;  2O04 A;  2NTB A;  1OOC A;  4JRA C;  1IA5 A;  4OZZ A;  2YUH A;  4OJL A;  4OM9 A;  1TYW A;  4OZY A;  3EQO A;  1O8F A;  3KRG A;  4XOT A;  3SQV A;  5C1C A;  1OGM X;  1O8E A;  1VBL A;  4W8R A;  2BM5 A;  3NAW A;  1JRG A;  2XC1 A;  2X85 A;  1BHE A;  4XR6 A;  4XM3 A;  3AK5 A;  1KTW A;  1BN8 A;  2QZA A;  3BH6 B;  4U49 A;  2X3H A;  4XOP A;  2QY1 A;  2QYU A;  2J8K A;  4XLF A;  3GQ9 A;  4NK8 A;  4YZQ A;  2XT4 A;  3LJY A;  2O17 A;  4YC5 A;  2X6Y A;  3B90 A;  3PSS A;  1DBG A;  2VFN A;  4I84 A;  1QA2 A;  4YZA A;  1NHC A;  1OFM A;  2VFM A;  1DBO A;  1AIR A;  2V5I A;  2NT6 A;  2VJJ A;  2Z8G A;  2VFO A;  3FY3 A;  4KH3 A;  1QCX A;  1IDJ A;  1QJV A;  1QRB A;  4URR A;  4YEJ A;  3SYJ A;  1CLW A;  2G0Y A;  2NTP A;  1H80 A;  1X0C A;  2X6W A;  3GQ8 A;  3GQ7 A;  4W8Q A;  2NSP A;  4XLA A;  2NST A;  2NZM A;  4C2L A;  3EQN A;  2VFQ A;  2BM6 A;  2XT2 A;  3H09 A;  3ML3 A;  3GQA A;  2VBM A;  1LLW A;  4YCQ A;  1L1I A;  1EA0 A;  2BM4 A;  3DU1 X;  4V02 C;  2O1D A;  2F3L A;  1WMR A;  1TYX A;  1PE9 A;  4XOR A;  2UVF A;  5JMC B;  1QQ1 A;  4YFO A;  3N6Z A;  1K5C A;  1PLU A;  2O0W A;  1XG2 A;  3B8Y A;  1TSP A;  2IOU G;  4OJ5 A;  4OJP A;  4AVZ A;  1O88 A;  4Z06 A;  1WXR A;  4XNF A;  2XTY A;  1CZF A;  2O0V A;  5DNS A;  1QA1 A;  4MXN A;  3VSV A;  1EE6 A;  4XKV A;  4HWV A;  4XN0 A;  1KQ5 A;  1QRC A;  2NTQ A;  1OFE A;  2VJI A;  4YDT A;  2BM7 A;  1HF2 A;  3PET A;  4W8S A;  3VMV A;  4XL9 A;  2VBK A;  3SUC A;  1TYV A;  3P4G A;  4XON A;  4EW9 A;  4XMY A;  1RWR A;  4OJ6 A;  1O8H A;  1O8G A;  1O8D A;  1LM1 A;  4XLE A;  4U4B A;  4Z05 A;  1DAB A;  3ZPP A;  2INV A;  4XLH A;  5C1E A;  4YZ0 A;  2QX3 A;  4XQF A;  3WWG A;  1KCC A;  4OPW A;  1TYU A;  3GRH A;  4NK6 A;  1OGO X;  2W7Z A;  2X6X A;  3TH0 A;  1HG8 A;  1PXZ A;  1O8I A;  4YEL A;  3ZSC A;  2B0R A;  2VFP A;  3LYC A;  3N90 A;  1IB4 A;  2XTW A;  1KCD A;  2ODL A;  1O8L A;  1OFD A;  3PSZ A;  4XN3 A;  2PEC A;  4YZX A;  1EZG A;  2QXZ A;  3SZE A;  3UW0 A;  3BH7 B;  2INU A;  2UVE A;  1O8M A;  2PYH A;  3B4N A;  2J8I A;  2NT9 A;  1RU4 A;  3JUR A;  4W8T A;  3VMW A;  3VST A;  1O8J A;  1K4Z A;  2BX6 A;  2VBE A;  4XKW A;  4OJO A;  5JLV C;  1JTA A;  4PMH A;  1RMG A;  2XTX A;  5AMV A;  3NB2 A;  4MR0 A;  1OFL A;  3JX8 A;  1LLZ A;  1GQ8 A;  4Z03 A;  1K8F A;  2IQ7 A; 
#chains in the Genus database with same CATH homology
 3LMW A;  4XLC A;  3VSU A;  1O8K A;  3T9G A;  2EWE A;  1IDK A;  2BSP A;  2PYG A;  2O04 A;  2NTB A;  1OOC A;  1IA5 A;  4OZZ A;  4OJL A;  4OZY A;  3EQO A;  1O8F A;  3KRG A;  4XOT A;  5C1C A;  1OGM X;  1O8E A;  1VBL A;  4W8R A;  1JRG A;  1BHE A;  4XR6 A;  4XM3 A;  1KTW A;  1BN8 A;  4U49 A;  2X3H A;  4XOP A;  2QY1 A;  4XLF A;  3GQ9 A;  4NK8 A;  4YZQ A;  2O17 A;  2X6Y A;  3B90 A;  1DBG A;  4I84 A;  4YZA A;  1NHC A;  1OFM A;  1DBO A;  1AIR A;  3FY3 A;  2NT6 A;  2VJJ A;  2Z8G A;  1QCX A;  1IDJ A;  1QJV A;  4URR A;  4YEJ A;  4W8Q A;  2NTP A;  2X6W A;  1H80 A;  1X0C A;  3GQ8 A;  3GQ7 A;  4XLA A;  2NSP A;  4C2L A;  2NST A;  2NZM A;  3EQN A;  3GQA A;  2VBM A;  2O1D A;  4XOR A;  1WMR A;  1PE9 A;  2UVF A;  1K5C A;  1PLU A;  2O0W A;  1XG2 A;  3B8Y A;  4OJ5 A;  4OJP A;  4AVZ A;  1O88 A;  4Z06 A;  4XNF A;  1CZF A;  2O0V A;  4MXN A;  3VSV A;  1EE6 A;  4XKV A;  4HWV A;  4XN0 A;  2NTQ A;  3VMV A;  2VJI A;  4W8S A;  4XL9 A;  2VBK A;  3SUC A;  4XON A;  4EW9 A;  4XMY A;  1RWR A;  4OJ6 A;  1O8H A;  1O8G A;  1O8D A;  4XLE A;  4Z05 A;  4U4B A;  3ZPP A;  2INV A;  4XLH A;  5C1E A;  4YZ0 A;  2QX3 A;  4XQF A;  3WWG A;  1KCC A;  3GRH A;  4NK6 A;  1OGO X;  2X6X A;  1HG8 A;  1PXZ A;  1O8I A;  4YEL A;  3ZSC A;  1IB4 A;  1KCD A;  2ODL A;  1O8L A;  4XN3 A;  2PEC A;  4YZX A;  3UW0 A;  2QXZ A;  2INU A;  2UVE A;  1O8M A;  2PYH A;  3B4N A;  2NT9 A;  1RU4 A;  3JUR A;  4W8T A;  3VMW A;  3VST A;  1O8J A;  4XKW A;  2VBE A;  4OJO A;  1JTA A;  4PMH A;  1RMG A;  5AMV A;  4Z03 A;  4MR0 A;  1OFL A;  2X85 A;  1GQ8 A;  2IQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...