1O88A

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 30mm ca2+
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 141
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o88A00
4XM3A 2NTPA 1WMRA 3B8YA 3T9GA 1O8GA 4C2LA 3GQ8A 2NTQA 2NSTA 4XKWA 3EQNA 1O8IA 5C1CA 2VJIA 4MXNA 4XN0A 2PYHA 4YEJA 3VMVA 1IDJA 4OJOA 3B90A 1IA5A 2X85A 4XMYA 2QY1A 1OFMA 4URRA 1O88A 4W8QA 4XNFA 3VSVA 2ODLA 2QXZA 1JRGA 4W8RA 4XLHA 3WWGA 2O0VA 2UVFA 4YELA 1RU4A 3JURA 4W8TA 2Z8GA 4U4BA 2VJJA 1O8DA 4I84A 3GQAA 3ZPPA 1KCDA 4XLCA 4NK8A 4MR0A 1RWRA 2UVEA 4XLAA 4XQFA 3GQ7A 4Z03A 4Z06A 1PXZA 4Z05A 3ZSCA 1IDKA 2VBKA 2NTBA 1BHEA 1XG2A 1O8LA 4OZYA 1JTAA 2QX3A 2VBEA 2NT9A 4YZ0A 1OFLA 1OGMX 1VBLA 4XONA 1DBOA 2NT6A 1K5CA 4AVZA 1GQ8A 4W8SA 2NSPA 4XOTA 3VSTA 4HWVA 2O17A 1KTWA 1O8KA 2PECA 1RMGA 4OJ6A 1QCXA 3VMWA 2EWEA 2INVA 4XR6A 4PMHA 3GRHA 1DBGA 1BN8A 3UW0A 1PE9A 2O1DA 1AIRA 4XN3A 1IB4A 4XLEA 4XORA 1EE6A 2X6XA 3KRGA 2INUA 4NK6A 3B4NA 2BSPA 4EW9A 4OJ5A 1O8EA 5C1EA 4XL9A 4XKVA 1O8HA 1KCCA 1H80A 4YZAA 1CZFA 2X6YA 3VSUA 4OZZA 1HG8A 1O8FA 2PYGA 3LMWA 2X3HA 1X0CA 4OJLA 1O8MA 2IQ7A 1PLUA 5AMVA 4XLFA 1NHCA 3EQOA 1O8JA 4OJPA 2VBMA 4YZXA 4XOPA 2NZMA 2O0WA 3SUCA 1OGOX 3GQ9A 4U49A 1OOCA 3FY3A 1QJVA 2O04A 2X6WA 4YZQA
chains in the Genus database with same CATH superfamily
4XM3A 1QA1A 2NTPA 5JLVC 1WMRA 3B8YA 3PETA 3T9GA 1O8GA 4C2LA 3GQ8A 1L1IA 2NTQA 2NSTA 4XKWA 3EQNA 1O8IA 1LLZA 2B0RA 2VJIA 4MXNA 4XN0A 2PYHA 4YFOA 2XT4A 4YEJA 3VMVA 1IDJA 1OFEA 4OJOA 3B90A 3SYJA 3LJYA 1IA5A 2X85A 4KH3A 4XMYA 2QY1A 1OFMA 4URRA 1TYXA 1O88A 4W8QA 1OFDA 4XNFA 3DU1X 3VSVA 3P4GA 2ODLA 1WXRA 2QXZA 1JRGA 3JX8A 4W8RA 4XLHA 3WWGA 2O0VA 4YCQA 2XT2A 2F3LA 1EA0A 2UVFA 2BM7A 4YELA 2VFMA 1RU4A 5C1CA 3JURA 1LLWA 2Z8GA 4U4BA 4W8TA 4YC5A 2O6WA 2VJJA 2BM6A 1O8DA 4I84A 3BH6B 3GQAA 3ZPPA 4XLCA 1KCDA 2QYUA 4NK8A 4MR0A 2QZAA 1RWRA 3AK5A 2UVEA 2XTWA 1TSPA 4XLAA 4XQFA 3GQ7A 2J8IA 1LM1A 3SZEA 4Z03A 2XTYA 4Z06A 1PXZA 2YUHA 4Z05A 3ZSCA 1IDKA 2VBKA 2VFQA 2NTBA 2G0YA 3SY2A 1BHEA 1XG2A 3BH7B 1O8LA 1TYWA 4OZYA 1JTAA 2QX3A 2VBEA 2NT9A 4YZ0A 1OFLA 1OGMX 1VBLA 4XONA 1DBOA 2NT6A 4OPWA 1K5CA 4AVZA 1GQ8A 3PSSA 2NSPA 4W8SA 4XOTA 3VSTA 4HWVA 2O17A 1KTWA 1O8KA 4JRAC 2PECA 1RMGA 4OJ6A 4YDTA 1QCXA 4OM9A 3VMWA 4V02C 2EWEA 2INVA 4YEIA 1K8FA 4XR6A 1QRCA 3SQVA 4PMHA 3GRHA 1DBGA 1BN8A 3UW0A 1PE9A 2O1DA 1QA3A 1K4ZA 1AIRA 2VFPA 2VFOA 4XN3A 1IB4A 4XLEA 4XORA 3PSZA 1DABA 1EE6A 2X6XA 1HF2A 3KRGA 2INUA 4NK6A 3B4NA 2BSPA 4EW9A 1KQ5A 2IOUG 3ML3A 4OJ5A 2J8KA 3NAWA 3TH0A 1QQ1A 3LYCA 3NB2A 1O8EA 1QA2A 5C1EA 4XL9A 3N6ZA 4XKVA 3RIQA 5JMCB 1O8HA 2XTXA 1H80A 4YZAA 4YZQA 1CZFA 2X6YA 3VSUA 1KCCA 4OZZA 1HG8A 1O8FA 2PYGA 1CLWA 2X3HA 1X0CA 1TYUA 1O8MA 3LMWA 4OJLA 2IQ7A 1PLUA 5AMVA 4XLFA 1NHCA 3EQOA 1QRBA 2BX6A 1O8JA 4OJPA 2VBMA 2XC1A 2V5IA 5DNSA 4YZXA 4XOPA 2NZMA 2O0WA 2BM4A 2BM5A 3SUCA 1OGOX 3H09A 3GQ9A 2W7ZA 4U49A 2VFNA 1OOCA 3N90A 3FY3A 1QJVA 2O04A 1EZGA 2X6WA 1TYVA
chains in the Genus database with same CATH topology
4XM3A 2NTPA 1WMRA 3B8YA 3T9GA 1O8GA 4C2LA 3GQ8A 2NTQA 2NSTA 4XKWA 3EQNA 1O8IA 5C1CA 2VJIA 4MXNA 4XN0A 2PYHA 4YEJA 3VMVA 1IDJA 4OJOA 3B90A 1IA5A 2X85A 4XMYA 2QY1A 1OFMA 4URRA 1O88A 4W8QA 4XNFA 3VSVA 2ODLA 2QXZA 1JRGA 4W8RA 4XLHA 3WWGA 2O0VA 2UVFA 4YELA 1RU4A 3JURA 4W8TA 2Z8GA 4U4BA 2VJJA 1O8DA 4I84A 3GQAA 3ZPPA 1KCDA 4XLCA 4NK8A 4MR0A 1RWRA 2UVEA 4XLAA 4XQFA 3GQ7A 4Z03A 4Z06A 1PXZA 4Z05A 3ZSCA 1IDKA 2VBKA 2NTBA 1BHEA 1XG2A 1O8LA 4OZYA 1JTAA 2QX3A 2VBEA 2NT9A 4YZ0A 1OFLA 1OGMX 1VBLA 4XONA 1DBOA 2NT6A 1K5CA 4AVZA 1GQ8A 4W8SA 2NSPA 4XOTA 3VSTA 4HWVA 2O17A 1KTWA 1O8KA 2PECA 1RMGA 4OJ6A 1QCXA 3VMWA 2EWEA 2INVA 4XR6A 4PMHA 3GRHA 1DBGA 1BN8A 3UW0A 1PE9A 2O1DA 1AIRA 4XN3A 1IB4A 4XLEA 4XORA 1EE6A 2X6XA 3KRGA 2INUA 4NK6A 3B4NA 2BSPA 4EW9A 4OJ5A 1O8EA 5C1EA 4XL9A 4XKVA 1O8HA 1KCCA 1H80A 4YZAA 1CZFA 2X6YA 3VSUA 4OZZA 1HG8A 1O8FA 2PYGA 3LMWA 2X3HA 1X0CA 4OJLA 1O8MA 2IQ7A 1PLUA 5AMVA 4XLFA 1NHCA 3EQOA 1O8JA 4OJPA 2VBMA 4YZXA 4XOPA 2NZMA 2O0WA 3SUCA 1OGOX 3GQ9A 4U49A 1OOCA 3FY3A 1QJVA 2O04A 2X6WA 4YZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XM3 A;  2NTP A;  1WMR A;  3B8Y A;  3T9G A;  1O8G A;  4C2L A;  3GQ8 A;  2NTQ A;  2NST A;  4XKW A;  3EQN A;  1O8I A;  5C1C A;  2VJI A;  4MXN A;  4XN0 A;  2PYH A;  4YEJ A;  3VMV A;  1IDJ A;  4OJO A;  3B90 A;  1IA5 A;  2X85 A;  4XMY A;  2QY1 A;  1OFM A;  4URR A;  1O88 A;  4W8Q A;  4XNF A;  3VSV A;  2ODL A;  2QXZ A;  1JRG A;  4W8R A;  4XLH A;  3WWG A;  2O0V A;  2UVF A;  4YEL A;  1RU4 A;  3JUR A;  4W8T A;  2Z8G A;  4U4B A;  2VJJ A;  1O8D A;  4I84 A;  3GQA A;  3ZPP A;  1KCD A;  4XLC A;  4NK8 A;  4MR0 A;  1RWR A;  2UVE A;  4XLA A;  4XQF A;  3GQ7 A;  4Z03 A;  4Z06 A;  1PXZ A;  4Z05 A;  3ZSC A;  1IDK A;  2VBK A;  2NTB A;  1BHE A;  1XG2 A;  1O8L A;  4OZY A;  1JTA A;  2QX3 A;  2VBE A;  2NT9 A;  4YZ0 A;  1OFL A;  1OGM X;  1VBL A;  4XON A;  1DBO A;  2NT6 A;  1K5C A;  4AVZ A;  1GQ8 A;  4W8S A;  2NSP A;  4XOT A;  3VST A;  4HWV A;  2O17 A;  1KTW A;  1O8K A;  2PEC A;  1RMG A;  4OJ6 A;  1QCX A;  3VMW A;  2EWE A;  2INV A;  4XR6 A;  4PMH A;  3GRH A;  1DBG A;  1BN8 A;  3UW0 A;  1PE9 A;  2O1D A;  1AIR A;  4XN3 A;  1IB4 A;  4XLE A;  4XOR A;  1EE6 A;  2X6X A;  3KRG A;  2INU A;  4NK6 A;  3B4N A;  2BSP A;  4EW9 A;  4OJ5 A;  1O8E A;  5C1E A;  4XL9 A;  4XKV A;  1O8H A;  1KCC A;  1H80 A;  4YZA A;  1CZF A;  2X6Y A;  3VSU A;  4OZZ A;  1HG8 A;  1O8F A;  2PYG A;  3LMW A;  2X3H A;  1X0C A;  4OJL A;  1O8M A;  2IQ7 A;  1PLU A;  5AMV A;  4XLF A;  1NHC A;  3EQO A;  1O8J A;  4OJP A;  2VBM A;  4YZX A;  4XOP A;  2NZM A;  2O0W A;  3SUC A;  1OGO X;  3GQ9 A;  4U49 A;  1OOC A;  3FY3 A;  1QJV A;  2O04 A;  2X6W A;  4YZQ A; 
#chains in the Genus database with same CATH topology
 4XM3 A;  1QA1 A;  2NTP A;  5JLV C;  1WMR A;  3B8Y A;  3PET A;  3T9G A;  1O8G A;  4C2L A;  3GQ8 A;  1L1I A;  2NTQ A;  2NST A;  4XKW A;  3EQN A;  1O8I A;  1LLZ A;  2B0R A;  2VJI A;  4MXN A;  4XN0 A;  2PYH A;  4YFO A;  2XT4 A;  4YEJ A;  3VMV A;  1IDJ A;  1OFE A;  4OJO A;  3B90 A;  3SYJ A;  3LJY A;  1IA5 A;  2X85 A;  4KH3 A;  4XMY A;  2QY1 A;  1OFM A;  4URR A;  1TYX A;  1O88 A;  4W8Q A;  1OFD A;  4XNF A;  3DU1 X;  3VSV A;  3P4G A;  2ODL A;  1WXR A;  2QXZ A;  1JRG A;  3JX8 A;  4W8R A;  4XLH A;  3WWG A;  2O0V A;  4YCQ A;  2XT2 A;  2F3L A;  1EA0 A;  2UVF A;  2BM7 A;  4YEL A;  2VFM A;  1RU4 A;  5C1C A;  3JUR A;  1LLW A;  2Z8G A;  4U4B A;  4W8T A;  4YC5 A;  2O6W A;  2VJJ A;  2BM6 A;  1O8D A;  4I84 A;  3BH6 B;  3GQA A;  3ZPP A;  4XLC A;  1KCD A;  2QYU A;  4NK8 A;  4MR0 A;  2QZA A;  1RWR A;  3AK5 A;  2UVE A;  2XTW A;  1TSP A;  4XLA A;  4XQF A;  3GQ7 A;  2J8I A;  1LM1 A;  3SZE A;  4Z03 A;  2XTY A;  4Z06 A;  1PXZ A;  2YUH A;  4Z05 A;  3ZSC A;  1IDK A;  2VBK A;  2VFQ A;  2NTB A;  2G0Y A;  3SY2 A;  1BHE A;  1XG2 A;  3BH7 B;  1O8L A;  1TYW A;  4OZY A;  1JTA A;  2QX3 A;  2VBE A;  2NT9 A;  4YZ0 A;  1OFL A;  1OGM X;  1VBL A;  4XON A;  1DBO A;  2NT6 A;  4OPW A;  1K5C A;  4AVZ A;  1GQ8 A;  3PSS A;  2NSP A;  4W8S A;  4XOT A;  3VST A;  4HWV A;  2O17 A;  1KTW A;  1O8K A;  4JRA C;  2PEC A;  1RMG A;  4OJ6 A;  4YDT A;  1QCX A;  4OM9 A;  3VMW A;  4V02 C;  2EWE A;  2INV A;  4YEI A;  1K8F A;  4XR6 A;  1QRC A;  3SQV A;  4PMH A;  3GRH A;  1DBG A;  1BN8 A;  3UW0 A;  1PE9 A;  2O1D A;  1QA3 A;  1K4Z A;  1AIR A;  2VFP A;  2VFO A;  4XN3 A;  1IB4 A;  4XLE A;  4XOR A;  3PSZ A;  1DAB A;  1EE6 A;  2X6X A;  1HF2 A;  3KRG A;  2INU A;  4NK6 A;  3B4N A;  2BSP A;  4EW9 A;  1KQ5 A;  2IOU G;  3ML3 A;  4OJ5 A;  2J8K A;  3NAW A;  3TH0 A;  1QQ1 A;  3LYC A;  3NB2 A;  1O8E A;  1QA2 A;  5C1E A;  4XL9 A;  3N6Z A;  4XKV A;  3RIQ A;  5JMC B;  1O8H A;  2XTX A;  1H80 A;  4YZA A;  4YZQ A;  1CZF A;  2X6Y A;  3VSU A;  1KCC A;  4OZZ A;  1HG8 A;  1O8F A;  2PYG A;  1CLW A;  2X3H A;  1X0C A;  1TYU A;  1O8M A;  3LMW A;  4OJL A;  2IQ7 A;  1PLU A;  5AMV A;  4XLF A;  1NHC A;  3EQO A;  1QRB A;  2BX6 A;  1O8J A;  4OJP A;  2VBM A;  2XC1 A;  2V5I A;  5DNS A;  4YZX A;  4XOP A;  2NZM A;  2O0W A;  2BM4 A;  2BM5 A;  3SUC A;  1OGO X;  3H09 A;  3GQ9 A;  2W7Z A;  4U49 A;  2VFN A;  1OOC A;  3N90 A;  3FY3 A;  1QJV A;  2O04 A;  1EZG A;  2X6W A;  1TYV A; 
#chains in the Genus database with same CATH homology
 4XM3 A;  2NTP A;  1WMR A;  3B8Y A;  3T9G A;  1O8G A;  4C2L A;  3GQ8 A;  2NTQ A;  2NST A;  4XKW A;  3EQN A;  1O8I A;  5C1C A;  2VJI A;  4MXN A;  4XN0 A;  2PYH A;  4YEJ A;  3VMV A;  1IDJ A;  4OJO A;  3B90 A;  1IA5 A;  2X85 A;  4XMY A;  2QY1 A;  1OFM A;  4URR A;  1O88 A;  4W8Q A;  4XNF A;  3VSV A;  2ODL A;  2QXZ A;  1JRG A;  4W8R A;  4XLH A;  3WWG A;  2O0V A;  2UVF A;  4YEL A;  1RU4 A;  3JUR A;  4W8T A;  2Z8G A;  4U4B A;  2VJJ A;  1O8D A;  4I84 A;  3GQA A;  3ZPP A;  1KCD A;  4XLC A;  4NK8 A;  4MR0 A;  1RWR A;  2UVE A;  4XLA A;  4XQF A;  3GQ7 A;  4Z03 A;  4Z06 A;  1PXZ A;  4Z05 A;  3ZSC A;  1IDK A;  2VBK A;  2NTB A;  1BHE A;  1XG2 A;  1O8L A;  4OZY A;  1JTA A;  2QX3 A;  2VBE A;  2NT9 A;  4YZ0 A;  1OFL A;  1OGM X;  1VBL A;  4XON A;  1DBO A;  2NT6 A;  1K5C A;  4AVZ A;  1GQ8 A;  4W8S A;  2NSP A;  4XOT A;  3VST A;  4HWV A;  2O17 A;  1KTW A;  1O8K A;  2PEC A;  1RMG A;  4OJ6 A;  1QCX A;  3VMW A;  2EWE A;  2INV A;  4XR6 A;  4PMH A;  3GRH A;  1DBG A;  1BN8 A;  3UW0 A;  1PE9 A;  2O1D A;  1AIR A;  4XN3 A;  1IB4 A;  4XLE A;  4XOR A;  1EE6 A;  2X6X A;  3KRG A;  2INU A;  4NK6 A;  3B4N A;  2BSP A;  4EW9 A;  4OJ5 A;  1O8E A;  5C1E A;  4XL9 A;  4XKV A;  1O8H A;  1KCC A;  1H80 A;  4YZA A;  1CZF A;  2X6Y A;  3VSU A;  4OZZ A;  1HG8 A;  1O8F A;  2PYG A;  3LMW A;  2X3H A;  1X0C A;  4OJL A;  1O8M A;  2IQ7 A;  1PLU A;  5AMV A;  4XLF A;  1NHC A;  3EQO A;  1O8J A;  4OJP A;  2VBM A;  4YZX A;  4XOP A;  2NZM A;  2O0W A;  3SUC A;  1OGO X;  3GQ9 A;  4U49 A;  1OOC A;  3FY3 A;  1QJV A;  2O04 A;  2X6W A;  4YZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...