1O88A

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 30mm ca2+
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 141
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o88A00
3LMWA 1PLUA 1DBOA 2X85A 3UW0A 3KRGA 1O8DA 1K5CA 1IA5A 3B4NA 4XR6A 3T9GA 3VSTA 4XQFA 1O8LA 4XLAA 4XN3A 2UVEA 1XG2A 2X6WA 4OJPA 4YZQA 1JTAA 4Z05A 4NK8A 2VBEA 1O8IA 1IDJA 2QX3A 2BSPA 4OJLA 1WMRA 2NT6A 1PE9A 4OZYA 1CZFA 1O8GA 3VSUA 3GQ9A 1QJVA 4XN0A 2O1DA 3VMVA 2NT9A 4NK6A 5C1EA 4U49A 1OGMX 4PMHA 1O8JA 4YELA 1HG8A 1RWRA 4Z06A 1KTWA 2NSTA 3VMWA 3SUCA 4XLFA 1O88A 2NZMA 4YZAA 1IDKA 4MR0A 4XORA 2O04A 2X6XA 4W8QA 3WWGA 2NSPA 4URRA 1O8FA 3B8YA 4XNFA 2UVFA 2IQ7A 4XLHA 4YEJA 4C2LA 1OOCA 2O0VA 4W8TA 4XMYA 1JRGA 4MXNA 2NTBA 2Z8GA 3EQNA 2NTQA 4W8RA 4XLCA 4XLEA 2PYHA 4I84A 2QXZA 4XOTA 3ZSCA 1EE6A 1H80A 1O8HA 3GQAA 3ZPPA 1OFMA 2PYGA 1OGOX 3VSVA 3B90A 4OJ6A 2X6YA 1BHEA 2INVA 2O17A 2VJIA 1BN8A 4U4BA 1NHCA 2QY1A 3GQ7A 2PECA 4XM3A 4XOPA 2X3HA 4W8SA 1PXZA 3GQ8A 3JURA 1RMGA 4YZ0A 1DBGA 1IB4A 2NTPA 1X0CA 4XKWA 4YZXA 4OJOA 4EW9A 1KCDA 2VJJA 3EQOA 1QCXA 4XL9A 2INUA 2EWEA 1GQ8A 4OZZA 3GRHA 1KCCA 5AMVA 1O8EA 2ODLA 3FY3A 4OJ5A 4XONA 4HWVA 4Z03A 2O0WA 1O8KA 1OFLA 4XKVA 1O8MA 1VBLA 4AVZA 2VBKA 1RU4A 5C1CA 2VBMA 1AIRA
chains in the Genus database with same CATH superfamily
1EA0A 3LMWA 1PLUA 1K4ZA 1DBOA 2X85A 4YDTA 3UW0A 3KRGA 1O8DA 1K5CA 1IA5A 3B4NA 3LYCA 3NAWA 4XR6A 3RIQA 3T9GA 3VSTA 4XQFA 1O8LA 4XLAA 4XN3A 2UVEA 1XG2A 2X6WA 4OJPA 2BX6A 1QA2A 4YZQA 1JTAA 1LLZA 4Z05A 3NB2A 5JLVC 2BM7A 4NK8A 2VBEA 2XTXA 1O8IA 4YCQA 2XTWA 1IDJA 1K8FA 2QX3A 1TYWA 2BSPA 2J8KA 2V5IA 2YUHA 4OJLA 1WMRA 2NT6A 5JMCB 2BM5A 1PE9A 4OZYA 1WXRA 1CZFA 1O8GA 3VSUA 3GQ9A 1QJVA 4XN0A 2O1DA 3VMVA 1QA1A 2G0YA 2NT9A 3DU1X 4NK6A 1KQ5A 5C1EA 4YEIA 3N6ZA 4U49A 1OGMX 4PMHA 1LLWA 1O8JA 2VFQA 4YELA 1HG8A 1RWRA 4Z06A 1L1IA 3BH7B 1KTWA 1TYUA 2NSTA 3VMWA 3SUCA 4XLFA 1O88A 2NZMA 4YZAA 1IDKA 2XT2A 2IOUG 2VFMA 4MR0A 2BM4A 4JRAC 4XORA 2O04A 3AK5A 2X6XA 2VFNA 4W8QA 3H09A 3WWGA 1QRBA 1QQ1A 2NSPA 4KH3A 4URRA 1O8FA 2QZAA 3B8YA 2UVFA 4XNFA 4YC5A 2IQ7A 4XLHA 4YEJA 4OM9A 4C2LA 1OOCA 3N90A 2O6WA 2O0VA 4W8TA 4XMYA 1JRGA 4MXNA 2NTBA 2Z8GA 3EQNA 2NTQA 4W8RA 4XLCA 4V02C 4XLEA 2PYHA 3JX8A 4I84A 2QXZA 2BM6A 1OFDA 4XOTA 4OPWA 2F3LA 3ZSCA 1TYVA 1EE6A 3PSSA 1H80A 1O8HA 3GQAA 1QRCA 3ZPPA 1OFMA 2PYGA 1OGOX 1DABA 3P4GA 3VSVA 1TYXA 2VFOA 3B90A 4OJ6A 1HF2A 2X6YA 1BHEA 1LM1A 2XTYA 3BH6B 1TSPA 3SQVA 2INVA 2O17A 2VJIA 1BN8A 4U4BA 1NHCA 2QY1A 2XT4A 2PECA 3GQ7A 1EZGA 2VFPA 4XM3A 4XOPA 2X3HA 4W8SA 1PXZA 1CLWA 3GQ8A 3JURA 1RMGA 4YZ0A 1OFEA 2W7ZA 1DBGA 1IB4A 2NTPA 1X0CA 4XKWA 4YZXA 4OJOA 3SYJA 4EW9A 3PETA 1KCDA 2VJJA 3EQOA 1QCXA 4XL9A 3ML3A 2INUA 5DNSA 2EWEA 1GQ8A 2XC1A 4OZZA 3GRHA 1KCCA 5AMVA 1O8EA 2ODLA 3FY3A 4OJ5A 4XONA 4HWVA 2QYUA 4YFOA 4Z03A 2O0WA 3TH0A 3LJYA 1O8KA 1OFLA 2B0RA 4XKVA 3SY2A 1O8MA 1QA3A 1VBLA 2J8IA 4AVZA 2VBKA 1RU4A 3SZEA 5C1CA 2VBMA 1AIRA 3PSZA
chains in the Genus database with same CATH topology
3LMWA 1PLUA 1DBOA 2X85A 3UW0A 3KRGA 1O8DA 1K5CA 1IA5A 3B4NA 4XR6A 3T9GA 3VSTA 4XQFA 1O8LA 4XLAA 4XN3A 2UVEA 1XG2A 2X6WA 4OJPA 4YZQA 1JTAA 4Z05A 4NK8A 2VBEA 1O8IA 1IDJA 2QX3A 2BSPA 4OJLA 1WMRA 2NT6A 1PE9A 4OZYA 1CZFA 1O8GA 3VSUA 3GQ9A 1QJVA 4XN0A 2O1DA 3VMVA 2NT9A 4NK6A 5C1EA 4U49A 1OGMX 4PMHA 1O8JA 4YELA 1HG8A 1RWRA 4Z06A 1KTWA 2NSTA 3VMWA 3SUCA 4XLFA 1O88A 2NZMA 4YZAA 1IDKA 4MR0A 4XORA 2O04A 2X6XA 4W8QA 3WWGA 2NSPA 4URRA 1O8FA 3B8YA 4XNFA 2UVFA 2IQ7A 4XLHA 4YEJA 4C2LA 1OOCA 2O0VA 4W8TA 4XMYA 1JRGA 4MXNA 2NTBA 2Z8GA 3EQNA 2NTQA 4W8RA 4XLCA 4XLEA 2PYHA 4I84A 2QXZA 4XOTA 3ZSCA 1EE6A 1H80A 1O8HA 3GQAA 3ZPPA 1OFMA 2PYGA 1OGOX 3VSVA 3B90A 4OJ6A 2X6YA 1BHEA 2INVA 2O17A 2VJIA 1BN8A 4U4BA 1NHCA 2QY1A 3GQ7A 2PECA 4XM3A 4XOPA 2X3HA 4W8SA 1PXZA 3GQ8A 3JURA 1RMGA 4YZ0A 1DBGA 1IB4A 2NTPA 1X0CA 4XKWA 4YZXA 4OJOA 4EW9A 1KCDA 2VJJA 3EQOA 1QCXA 4XL9A 2INUA 2EWEA 1GQ8A 4OZZA 3GRHA 1KCCA 5AMVA 1O8EA 2ODLA 3FY3A 4OJ5A 4XONA 4HWVA 4Z03A 2O0WA 1O8KA 1OFLA 4XKVA 1O8MA 1VBLA 4AVZA 2VBKA 1RU4A 5C1CA 2VBMA 1AIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LMW A;  1PLU A;  1DBO A;  2X85 A;  3UW0 A;  3KRG A;  1O8D A;  1K5C A;  1IA5 A;  3B4N A;  4XR6 A;  3T9G A;  3VST A;  4XQF A;  1O8L A;  4XLA A;  4XN3 A;  2UVE A;  1XG2 A;  2X6W A;  4OJP A;  4YZQ A;  1JTA A;  4Z05 A;  4NK8 A;  2VBE A;  1O8I A;  1IDJ A;  2QX3 A;  2BSP A;  4OJL A;  1WMR A;  2NT6 A;  1PE9 A;  4OZY A;  1CZF A;  1O8G A;  3VSU A;  3GQ9 A;  1QJV A;  4XN0 A;  2O1D A;  3VMV A;  2NT9 A;  4NK6 A;  5C1E A;  4U49 A;  1OGM X;  4PMH A;  1O8J A;  4YEL A;  1HG8 A;  1RWR A;  4Z06 A;  1KTW A;  2NST A;  3VMW A;  3SUC A;  4XLF A;  1O88 A;  2NZM A;  4YZA A;  1IDK A;  4MR0 A;  4XOR A;  2O04 A;  2X6X A;  4W8Q A;  3WWG A;  2NSP A;  4URR A;  1O8F A;  3B8Y A;  4XNF A;  2UVF A;  2IQ7 A;  4XLH A;  4YEJ A;  4C2L A;  1OOC A;  2O0V A;  4W8T A;  4XMY A;  1JRG A;  4MXN A;  2NTB A;  2Z8G A;  3EQN A;  2NTQ A;  4W8R A;  4XLC A;  4XLE A;  2PYH A;  4I84 A;  2QXZ A;  4XOT A;  3ZSC A;  1EE6 A;  1H80 A;  1O8H A;  3GQA A;  3ZPP A;  1OFM A;  2PYG A;  1OGO X;  3VSV A;  3B90 A;  4OJ6 A;  2X6Y A;  1BHE A;  2INV A;  2O17 A;  2VJI A;  1BN8 A;  4U4B A;  1NHC A;  2QY1 A;  3GQ7 A;  2PEC A;  4XM3 A;  4XOP A;  2X3H A;  4W8S A;  1PXZ A;  3GQ8 A;  3JUR A;  1RMG A;  4YZ0 A;  1DBG A;  1IB4 A;  2NTP A;  1X0C A;  4XKW A;  4YZX A;  4OJO A;  4EW9 A;  1KCD A;  2VJJ A;  3EQO A;  1QCX A;  4XL9 A;  2INU A;  2EWE A;  1GQ8 A;  4OZZ A;  3GRH A;  1KCC A;  5AMV A;  1O8E A;  2ODL A;  3FY3 A;  4OJ5 A;  4XON A;  4HWV A;  4Z03 A;  2O0W A;  1O8K A;  1OFL A;  4XKV A;  1O8M A;  1VBL A;  4AVZ A;  2VBK A;  1RU4 A;  5C1C A;  2VBM A;  1AIR A; 
#chains in the Genus database with same CATH topology
 1EA0 A;  3LMW A;  1PLU A;  1K4Z A;  1DBO A;  2X85 A;  4YDT A;  3UW0 A;  3KRG A;  1O8D A;  1K5C A;  1IA5 A;  3B4N A;  3LYC A;  3NAW A;  4XR6 A;  3RIQ A;  3T9G A;  3VST A;  4XQF A;  1O8L A;  4XLA A;  4XN3 A;  2UVE A;  1XG2 A;  2X6W A;  4OJP A;  2BX6 A;  1QA2 A;  4YZQ A;  1JTA A;  1LLZ A;  4Z05 A;  3NB2 A;  5JLV C;  2BM7 A;  4NK8 A;  2VBE A;  2XTX A;  1O8I A;  4YCQ A;  2XTW A;  1IDJ A;  1K8F A;  2QX3 A;  1TYW A;  2BSP A;  2J8K A;  2V5I A;  2YUH A;  4OJL A;  1WMR A;  2NT6 A;  5JMC B;  2BM5 A;  1PE9 A;  4OZY A;  1WXR A;  1CZF A;  1O8G A;  3VSU A;  3GQ9 A;  1QJV A;  4XN0 A;  2O1D A;  3VMV A;  1QA1 A;  2G0Y A;  2NT9 A;  3DU1 X;  4NK6 A;  1KQ5 A;  5C1E A;  4YEI A;  3N6Z A;  4U49 A;  1OGM X;  4PMH A;  1LLW A;  1O8J A;  2VFQ A;  4YEL A;  1HG8 A;  1RWR A;  4Z06 A;  1L1I A;  3BH7 B;  1KTW A;  1TYU A;  2NST A;  3VMW A;  3SUC A;  4XLF A;  1O88 A;  2NZM A;  4YZA A;  1IDK A;  2XT2 A;  2IOU G;  2VFM A;  4MR0 A;  2BM4 A;  4JRA C;  4XOR A;  2O04 A;  3AK5 A;  2X6X A;  2VFN A;  4W8Q A;  3H09 A;  3WWG A;  1QRB A;  1QQ1 A;  2NSP A;  4KH3 A;  4URR A;  1O8F A;  2QZA A;  3B8Y A;  2UVF A;  4XNF A;  4YC5 A;  2IQ7 A;  4XLH A;  4YEJ A;  4OM9 A;  4C2L A;  1OOC A;  3N90 A;  2O6W A;  2O0V A;  4W8T A;  4XMY A;  1JRG A;  4MXN A;  2NTB A;  2Z8G A;  3EQN A;  2NTQ A;  4W8R A;  4XLC A;  4V02 C;  4XLE A;  2PYH A;  3JX8 A;  4I84 A;  2QXZ A;  2BM6 A;  1OFD A;  4XOT A;  4OPW A;  2F3L A;  3ZSC A;  1TYV A;  1EE6 A;  3PSS A;  1H80 A;  1O8H A;  3GQA A;  1QRC A;  3ZPP A;  1OFM A;  2PYG A;  1OGO X;  1DAB A;  3P4G A;  3VSV A;  1TYX A;  2VFO A;  3B90 A;  4OJ6 A;  1HF2 A;  2X6Y A;  1BHE A;  1LM1 A;  2XTY A;  3BH6 B;  1TSP A;  3SQV A;  2INV A;  2O17 A;  2VJI A;  1BN8 A;  4U4B A;  1NHC A;  2QY1 A;  2XT4 A;  2PEC A;  3GQ7 A;  1EZG A;  2VFP A;  4XM3 A;  4XOP A;  2X3H A;  4W8S A;  1PXZ A;  1CLW A;  3GQ8 A;  3JUR A;  1RMG A;  4YZ0 A;  1OFE A;  2W7Z A;  1DBG A;  1IB4 A;  2NTP A;  1X0C A;  4XKW A;  4YZX A;  4OJO A;  3SYJ A;  4EW9 A;  3PET A;  1KCD A;  2VJJ A;  3EQO A;  1QCX A;  4XL9 A;  3ML3 A;  2INU A;  5DNS A;  2EWE A;  1GQ8 A;  2XC1 A;  4OZZ A;  3GRH A;  1KCC A;  5AMV A;  1O8E A;  2ODL A;  3FY3 A;  4OJ5 A;  4XON A;  4HWV A;  2QYU A;  4YFO A;  4Z03 A;  2O0W A;  3TH0 A;  3LJY A;  1O8K A;  1OFL A;  2B0R A;  4XKV A;  3SY2 A;  1O8M A;  1QA3 A;  1VBL A;  2J8I A;  4AVZ A;  2VBK A;  1RU4 A;  3SZE A;  5C1C A;  2VBM A;  1AIR A;  3PSZ A; 
#chains in the Genus database with same CATH homology
 3LMW A;  1PLU A;  1DBO A;  2X85 A;  3UW0 A;  3KRG A;  1O8D A;  1K5C A;  1IA5 A;  3B4N A;  4XR6 A;  3T9G A;  3VST A;  4XQF A;  1O8L A;  4XLA A;  4XN3 A;  2UVE A;  1XG2 A;  2X6W A;  4OJP A;  4YZQ A;  1JTA A;  4Z05 A;  4NK8 A;  2VBE A;  1O8I A;  1IDJ A;  2QX3 A;  2BSP A;  4OJL A;  1WMR A;  2NT6 A;  1PE9 A;  4OZY A;  1CZF A;  1O8G A;  3VSU A;  3GQ9 A;  1QJV A;  4XN0 A;  2O1D A;  3VMV A;  2NT9 A;  4NK6 A;  5C1E A;  4U49 A;  1OGM X;  4PMH A;  1O8J A;  4YEL A;  1HG8 A;  1RWR A;  4Z06 A;  1KTW A;  2NST A;  3VMW A;  3SUC A;  4XLF A;  1O88 A;  2NZM A;  4YZA A;  1IDK A;  4MR0 A;  4XOR A;  2O04 A;  2X6X A;  4W8Q A;  3WWG A;  2NSP A;  4URR A;  1O8F A;  3B8Y A;  4XNF A;  2UVF A;  2IQ7 A;  4XLH A;  4YEJ A;  4C2L A;  1OOC A;  2O0V A;  4W8T A;  4XMY A;  1JRG A;  4MXN A;  2NTB A;  2Z8G A;  3EQN A;  2NTQ A;  4W8R A;  4XLC A;  4XLE A;  2PYH A;  4I84 A;  2QXZ A;  4XOT A;  3ZSC A;  1EE6 A;  1H80 A;  1O8H A;  3GQA A;  3ZPP A;  1OFM A;  2PYG A;  1OGO X;  3VSV A;  3B90 A;  4OJ6 A;  2X6Y A;  1BHE A;  2INV A;  2O17 A;  2VJI A;  1BN8 A;  4U4B A;  1NHC A;  2QY1 A;  3GQ7 A;  2PEC A;  4XM3 A;  4XOP A;  2X3H A;  4W8S A;  1PXZ A;  3GQ8 A;  3JUR A;  1RMG A;  4YZ0 A;  1DBG A;  1IB4 A;  2NTP A;  1X0C A;  4XKW A;  4YZX A;  4OJO A;  4EW9 A;  1KCD A;  2VJJ A;  3EQO A;  1QCX A;  4XL9 A;  2INU A;  2EWE A;  1GQ8 A;  4OZZ A;  3GRH A;  1KCC A;  5AMV A;  1O8E A;  2ODL A;  3FY3 A;  4OJ5 A;  4XON A;  4HWV A;  4Z03 A;  2O0W A;  1O8K A;  1OFL A;  4XKV A;  1O8M A;  1VBL A;  4AVZ A;  2VBK A;  1RU4 A;  5C1C A;  2VBM A;  1AIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...