1O88A

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 30mm ca2+
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 141
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o88A00
1BHEA 2NT9A 1PE9A 4XKWA 2VJJA 2X6YA 2NSTA 1RU4A 1DBOA 2NTQA 3GQAA 4Z03A 2PECA 4NK8A 3FY3A 4XOTA 4XN0A 3ZSCA 3UW0A 2X3HA 4OZZA 4XKVA 4YZAA 4Z05A 4XQFA 4OZYA 4HWVA 3ZPPA 1O8IA 3EQNA 4XONA 4YZ0A 1JRGA 2QY1A 1DBGA 4XLFA 1KCDA 4I84A 2O04A 2BSPA 2INUA 2PYGA 5C1CA 1CZFA 4YZQA 4Z06A 4XLEA 3VSVA 3GQ8A 4PMHA 4XM3A 2O0WA 2UVEA 1O8JA 4MXNA 4OJPA 1AIRA 4OJ5A 4MR0A 2O17A 1PXZA 2QX3A 3WWGA 2X6XA 1IB4A 1K5CA 2X85A 1O8EA 3GQ7A 4XMYA 3JURA 1IA5A 3VMWA 1O8GA 2O0VA 1GQ8A 3B8YA 2EWEA 2INVA 4XORA 1IDKA 3T9GA 4YEJA 2NZMA 3EQOA 4YZXA 4W8RA 1O8FA 4U4BA 1EE6A 3GRHA 1KTWA 2NTPA 2O1DA 1BN8A 1HG8A 2VBKA 1PLUA 3SUCA 4AVZA 2VBMA 4YELA 5C1EA 4W8QA 1NHCA 1QCXA 1KCCA 4C2LA 1WMRA 1XG2A 1O8DA 2ODLA 4XNFA 1OGMX 1OFLA 1JTAA 1VBLA 2VJIA 3VSTA 1O8HA 3VMVA 2X6WA 3B90A 4XLCA 4XLHA 4XLAA 2UVFA 4W8SA 4XN3A 1RMGA 1O88A 4OJLA 2NSPA 5AMVA 4XL9A 4OJ6A 1QJVA 1RWRA 2Z8GA 3B4NA 4U49A 2IQ7A 3VSUA 2QXZA 2PYHA 4URRA 2NT6A 1O8KA 4EW9A 1X0CA 1OGOX 2VBEA 1O8MA 3GQ9A 1O8LA 4NK6A 1OOCA 2NTBA 3KRGA 1H80A 3LMWA 1OFMA 4XOPA 4OJOA 1IDJA 4W8TA 4XR6A
chains in the Genus database with same CATH superfamily
1BHEA 2NT9A 4YC5A 1PE9A 4XKWA 2VJJA 2X6YA 2NSTA 1OFDA 3P4GA 4OPWA 1WXRA 3N90A 1RU4A 2G0YA 1DBOA 2NTQA 3GQAA 4Z03A 2IOUG 2PECA 4NK8A 3FY3A 4XOTA 4XN0A 3ZSCA 3UW0A 2VFOA 1K4ZA 2X3HA 4OZZA 4XKVA 4YZAA 4Z05A 3SQVA 4XQFA 4OZYA 3LJYA 4HWVA 2XT2A 3ZPPA 1O8IA 2VFQA 3EQNA 4XONA 4YZ0A 1EZGA 2VFMA 1JRGA 2QY1A 1DBGA 1HF2A 4KH3A 4XLFA 1KCDA 4I84A 2O04A 2BSPA 2INUA 2QZAA 2PYGA 4OM9A 5C1CA 1CZFA 4YZQA 2B0RA 4Z06A 4XLEA 3VSVA 3GQ8A 1TYUA 2J8KA 4PMHA 4XM3A 2YUHA 2XT4A 2BM4A 2O0WA 3ML3A 5JLVC 2QYUA 1LLWA 1O8JA 2UVEA 4MXNA 3SY2A 3PSSA 4OJPA 3TH0A 4JRAC 1EA0A 1TYXA 1AIRA 3DU1X 3NAWA 4OJ5A 4MR0A 2O17A 1PXZA 2QX3A 2XTWA 2X6XA 3WWGA 1IB4A 1K5CA 2X85A 1O8EA 1QQ1A 3GQ7A 3SYJA 1OFEA 4XMYA 3JURA 1IA5A 3VMWA 1LM1A 1O8GA 2O0VA 1GQ8A 3B8YA 2EWEA 2INVA 4XORA 1IDKA 1K8FA 3T9GA 4YEJA 2NZMA 3EQOA 1QA1A 4YDTA 4YZXA 3BH7B 4W8RA 1O8FA 4U4BA 1EE6A 3PETA 2F3LA 3SZEA 2XC1A 1KTWA 1TYVA 2NTPA 1BN8A 2O1DA 1HG8A 3GRHA 4YFOA 3PSZA 2VBKA 3LYCA 1PLUA 3SUCA 1TYWA 5DNSA 3RIQA 2VBMA 4AVZA 2BM5A 4YELA 4W8QA 5C1EA 1DABA 1NHCA 1QCXA 3BH6B 1KCCA 4C2LA 1WMRA 1XG2A 1O8DA 4YEIA 2J8IA 2ODLA 3NB2A 1OGMX 4XNFA 4V02C 1OFLA 1JTAA 1VBLA 2VJIA 3VSTA 1O8HA 3VMVA 2X6WA 3B90A 4XLCA 3H09A 4XLHA 4XLAA 1L1IA 2UVFA 4W8SA 2BX6A 4XN3A 1RMGA 1O88A 3JX8A 4OJLA 2NSPA 1QA3A 1LLZA 5AMVA 4XL9A 4OJ6A 2O6WA 1CLWA 1QJVA 1RWRA 1QRBA 2VFNA 2XTXA 2Z8GA 3B4NA 2IQ7A 4U49A 3VSUA 2QXZA 2PYHA 4URRA 2NT6A 1O8KA 2V5IA 1KQ5A 1X0CA 4EW9A 1OGOX 1TSPA 2BM7A 1O8MA 2VBEA 4YCQA 3GQ9A 1O8LA 4NK6A 1OOCA 2NTBA 3KRGA 1H80A 2VFPA 3LMWA 2W7ZA 3N6ZA 1OFMA 2BM6A 2XTYA 4OJOA 4XOPA 1IDJA 3AK5A 5JMCB 1QRCA 1QA2A 4W8TA 4XR6A
chains in the Genus database with same CATH topology
1BHEA 2NT9A 1PE9A 4XKWA 2VJJA 2X6YA 2NSTA 1RU4A 1DBOA 2NTQA 3GQAA 4Z03A 2PECA 4NK8A 3FY3A 4XOTA 4XN0A 3ZSCA 3UW0A 2X3HA 4OZZA 4XKVA 4YZAA 4Z05A 4XQFA 4OZYA 4HWVA 3ZPPA 1O8IA 3EQNA 4XONA 4YZ0A 1JRGA 2QY1A 1DBGA 4XLFA 1KCDA 4I84A 2O04A 2BSPA 2INUA 2PYGA 5C1CA 1CZFA 4YZQA 4Z06A 4XLEA 3VSVA 3GQ8A 4PMHA 4XM3A 2O0WA 2UVEA 1O8JA 4MXNA 4OJPA 1AIRA 4OJ5A 4MR0A 2O17A 1PXZA 2QX3A 3WWGA 2X6XA 1IB4A 1K5CA 2X85A 1O8EA 3GQ7A 4XMYA 3JURA 1IA5A 3VMWA 1O8GA 2O0VA 1GQ8A 3B8YA 2EWEA 2INVA 4XORA 1IDKA 3T9GA 4YEJA 2NZMA 3EQOA 4YZXA 4W8RA 1O8FA 4U4BA 1EE6A 3GRHA 1KTWA 2NTPA 2O1DA 1BN8A 1HG8A 2VBKA 1PLUA 3SUCA 4AVZA 2VBMA 4YELA 5C1EA 4W8QA 1NHCA 1QCXA 1KCCA 4C2LA 1WMRA 1XG2A 1O8DA 2ODLA 4XNFA 1OGMX 1OFLA 1JTAA 1VBLA 2VJIA 3VSTA 1O8HA 3VMVA 2X6WA 3B90A 4XLCA 4XLHA 4XLAA 2UVFA 4W8SA 4XN3A 1RMGA 1O88A 4OJLA 2NSPA 5AMVA 4XL9A 4OJ6A 1QJVA 1RWRA 2Z8GA 3B4NA 4U49A 2IQ7A 3VSUA 2QXZA 2PYHA 4URRA 2NT6A 1O8KA 4EW9A 1X0CA 1OGOX 2VBEA 1O8MA 3GQ9A 1O8LA 4NK6A 1OOCA 2NTBA 3KRGA 1H80A 3LMWA 1OFMA 4XOPA 4OJOA 1IDJA 4W8TA 4XR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHE A;  2NT9 A;  1PE9 A;  4XKW A;  2VJJ A;  2X6Y A;  2NST A;  1RU4 A;  1DBO A;  2NTQ A;  3GQA A;  4Z03 A;  2PEC A;  4NK8 A;  3FY3 A;  4XOT A;  4XN0 A;  3ZSC A;  3UW0 A;  2X3H A;  4OZZ A;  4XKV A;  4YZA A;  4Z05 A;  4XQF A;  4OZY A;  4HWV A;  3ZPP A;  1O8I A;  3EQN A;  4XON A;  4YZ0 A;  1JRG A;  2QY1 A;  1DBG A;  4XLF A;  1KCD A;  4I84 A;  2O04 A;  2BSP A;  2INU A;  2PYG A;  5C1C A;  1CZF A;  4YZQ A;  4Z06 A;  4XLE A;  3VSV A;  3GQ8 A;  4PMH A;  4XM3 A;  2O0W A;  2UVE A;  1O8J A;  4MXN A;  4OJP A;  1AIR A;  4OJ5 A;  4MR0 A;  2O17 A;  1PXZ A;  2QX3 A;  3WWG A;  2X6X A;  1IB4 A;  1K5C A;  2X85 A;  1O8E A;  3GQ7 A;  4XMY A;  3JUR A;  1IA5 A;  3VMW A;  1O8G A;  2O0V A;  1GQ8 A;  3B8Y A;  2EWE A;  2INV A;  4XOR A;  1IDK A;  3T9G A;  4YEJ A;  2NZM A;  3EQO A;  4YZX A;  4W8R A;  1O8F A;  4U4B A;  1EE6 A;  3GRH A;  1KTW A;  2NTP A;  2O1D A;  1BN8 A;  1HG8 A;  2VBK A;  1PLU A;  3SUC A;  4AVZ A;  2VBM A;  4YEL A;  5C1E A;  4W8Q A;  1NHC A;  1QCX A;  1KCC A;  4C2L A;  1WMR A;  1XG2 A;  1O8D A;  2ODL A;  4XNF A;  1OGM X;  1OFL A;  1JTA A;  1VBL A;  2VJI A;  3VST A;  1O8H A;  3VMV A;  2X6W A;  3B90 A;  4XLC A;  4XLH A;  4XLA A;  2UVF A;  4W8S A;  4XN3 A;  1RMG A;  1O88 A;  4OJL A;  2NSP A;  5AMV A;  4XL9 A;  4OJ6 A;  1QJV A;  1RWR A;  2Z8G A;  3B4N A;  4U49 A;  2IQ7 A;  3VSU A;  2QXZ A;  2PYH A;  4URR A;  2NT6 A;  1O8K A;  4EW9 A;  1X0C A;  1OGO X;  2VBE A;  1O8M A;  3GQ9 A;  1O8L A;  4NK6 A;  1OOC A;  2NTB A;  3KRG A;  1H80 A;  3LMW A;  1OFM A;  4XOP A;  4OJO A;  1IDJ A;  4W8T A;  4XR6 A; 
#chains in the Genus database with same CATH topology
 1BHE A;  2NT9 A;  4YC5 A;  1PE9 A;  4XKW A;  2VJJ A;  2X6Y A;  2NST A;  1OFD A;  3P4G A;  4OPW A;  1WXR A;  3N90 A;  1RU4 A;  2G0Y A;  1DBO A;  2NTQ A;  3GQA A;  4Z03 A;  2IOU G;  2PEC A;  4NK8 A;  3FY3 A;  4XOT A;  4XN0 A;  3ZSC A;  3UW0 A;  2VFO A;  1K4Z A;  2X3H A;  4OZZ A;  4XKV A;  4YZA A;  4Z05 A;  3SQV A;  4XQF A;  4OZY A;  3LJY A;  4HWV A;  2XT2 A;  3ZPP A;  1O8I A;  2VFQ A;  3EQN A;  4XON A;  4YZ0 A;  1EZG A;  2VFM A;  1JRG A;  2QY1 A;  1DBG A;  1HF2 A;  4KH3 A;  4XLF A;  1KCD A;  4I84 A;  2O04 A;  2BSP A;  2INU A;  2QZA A;  2PYG A;  4OM9 A;  5C1C A;  1CZF A;  4YZQ A;  2B0R A;  4Z06 A;  4XLE A;  3VSV A;  3GQ8 A;  1TYU A;  2J8K A;  4PMH A;  4XM3 A;  2YUH A;  2XT4 A;  2BM4 A;  2O0W A;  3ML3 A;  5JLV C;  2QYU A;  1LLW A;  1O8J A;  2UVE A;  4MXN A;  3SY2 A;  3PSS A;  4OJP A;  3TH0 A;  4JRA C;  1EA0 A;  1TYX A;  1AIR A;  3DU1 X;  3NAW A;  4OJ5 A;  4MR0 A;  2O17 A;  1PXZ A;  2QX3 A;  2XTW A;  2X6X A;  3WWG A;  1IB4 A;  1K5C A;  2X85 A;  1O8E A;  1QQ1 A;  3GQ7 A;  3SYJ A;  1OFE A;  4XMY A;  3JUR A;  1IA5 A;  3VMW A;  1LM1 A;  1O8G A;  2O0V A;  1GQ8 A;  3B8Y A;  2EWE A;  2INV A;  4XOR A;  1IDK A;  1K8F A;  3T9G A;  4YEJ A;  2NZM A;  3EQO A;  1QA1 A;  4YDT A;  4YZX A;  3BH7 B;  4W8R A;  1O8F A;  4U4B A;  1EE6 A;  3PET A;  2F3L A;  3SZE A;  2XC1 A;  1KTW A;  1TYV A;  2NTP A;  1BN8 A;  2O1D A;  1HG8 A;  3GRH A;  4YFO A;  3PSZ A;  2VBK A;  3LYC A;  1PLU A;  3SUC A;  1TYW A;  5DNS A;  3RIQ A;  2VBM A;  4AVZ A;  2BM5 A;  4YEL A;  4W8Q A;  5C1E A;  1DAB A;  1NHC A;  1QCX A;  3BH6 B;  1KCC A;  4C2L A;  1WMR A;  1XG2 A;  1O8D A;  4YEI A;  2J8I A;  2ODL A;  3NB2 A;  1OGM X;  4XNF A;  4V02 C;  1OFL A;  1JTA A;  1VBL A;  2VJI A;  3VST A;  1O8H A;  3VMV A;  2X6W A;  3B90 A;  4XLC A;  3H09 A;  4XLH A;  4XLA A;  1L1I A;  2UVF A;  4W8S A;  2BX6 A;  4XN3 A;  1RMG A;  1O88 A;  3JX8 A;  4OJL A;  2NSP A;  1QA3 A;  1LLZ A;  5AMV A;  4XL9 A;  4OJ6 A;  2O6W A;  1CLW A;  1QJV A;  1RWR A;  1QRB A;  2VFN A;  2XTX A;  2Z8G A;  3B4N A;  2IQ7 A;  4U49 A;  3VSU A;  2QXZ A;  2PYH A;  4URR A;  2NT6 A;  1O8K A;  2V5I A;  1KQ5 A;  1X0C A;  4EW9 A;  1OGO X;  1TSP A;  2BM7 A;  1O8M A;  2VBE A;  4YCQ A;  3GQ9 A;  1O8L A;  4NK6 A;  1OOC A;  2NTB A;  3KRG A;  1H80 A;  2VFP A;  3LMW A;  2W7Z A;  3N6Z A;  1OFM A;  2BM6 A;  2XTY A;  4OJO A;  4XOP A;  1IDJ A;  3AK5 A;  5JMC B;  1QRC A;  1QA2 A;  4W8T A;  4XR6 A; 
#chains in the Genus database with same CATH homology
 1BHE A;  2NT9 A;  1PE9 A;  4XKW A;  2VJJ A;  2X6Y A;  2NST A;  1RU4 A;  1DBO A;  2NTQ A;  3GQA A;  4Z03 A;  2PEC A;  4NK8 A;  3FY3 A;  4XOT A;  4XN0 A;  3ZSC A;  3UW0 A;  2X3H A;  4OZZ A;  4XKV A;  4YZA A;  4Z05 A;  4XQF A;  4OZY A;  4HWV A;  3ZPP A;  1O8I A;  3EQN A;  4XON A;  4YZ0 A;  1JRG A;  2QY1 A;  1DBG A;  4XLF A;  1KCD A;  4I84 A;  2O04 A;  2BSP A;  2INU A;  2PYG A;  5C1C A;  1CZF A;  4YZQ A;  4Z06 A;  4XLE A;  3VSV A;  3GQ8 A;  4PMH A;  4XM3 A;  2O0W A;  2UVE A;  1O8J A;  4MXN A;  4OJP A;  1AIR A;  4OJ5 A;  4MR0 A;  2O17 A;  1PXZ A;  2QX3 A;  3WWG A;  2X6X A;  1IB4 A;  1K5C A;  2X85 A;  1O8E A;  3GQ7 A;  4XMY A;  3JUR A;  1IA5 A;  3VMW A;  1O8G A;  2O0V A;  1GQ8 A;  3B8Y A;  2EWE A;  2INV A;  4XOR A;  1IDK A;  3T9G A;  4YEJ A;  2NZM A;  3EQO A;  4YZX A;  4W8R A;  1O8F A;  4U4B A;  1EE6 A;  3GRH A;  1KTW A;  2NTP A;  2O1D A;  1BN8 A;  1HG8 A;  2VBK A;  1PLU A;  3SUC A;  4AVZ A;  2VBM A;  4YEL A;  5C1E A;  4W8Q A;  1NHC A;  1QCX A;  1KCC A;  4C2L A;  1WMR A;  1XG2 A;  1O8D A;  2ODL A;  4XNF A;  1OGM X;  1OFL A;  1JTA A;  1VBL A;  2VJI A;  3VST A;  1O8H A;  3VMV A;  2X6W A;  3B90 A;  4XLC A;  4XLH A;  4XLA A;  2UVF A;  4W8S A;  4XN3 A;  1RMG A;  1O88 A;  4OJL A;  2NSP A;  5AMV A;  4XL9 A;  4OJ6 A;  1QJV A;  1RWR A;  2Z8G A;  3B4N A;  4U49 A;  2IQ7 A;  3VSU A;  2QXZ A;  2PYH A;  4URR A;  2NT6 A;  1O8K A;  4EW9 A;  1X0C A;  1OGO X;  2VBE A;  1O8M A;  3GQ9 A;  1O8L A;  4NK6 A;  1OOC A;  2NTB A;  3KRG A;  1H80 A;  3LMW A;  1OFM A;  4XOP A;  4OJO A;  1IDJ A;  4W8T A;  4XR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...