1O88A

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 30mm ca2+
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 141
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o88A00
4XN3A 1DBOA 4OJ6A 4XLFA 3UW0A 1O8DA 1O8JA 4URRA 2QX3A 2UVFA 4HWVA 4EW9A 4XLHA 4W8QA 4XMYA 1OGOX 4Z05A 3GQAA 1O8MA 2VBKA 5AMVA 2NT6A 3GQ7A 1IDKA 1JTAA 1JRGA 1O8EA 2NSTA 2Z8GA 1H80A 4PMHA 4XR6A 4AVZA 1KCCA 4W8SA 2O1DA 2O0VA 3T9GA 1PLUA 3GRHA 4XLCA 1O88A 2O04A 1PXZA 1KTWA 2X3HA 2NTPA 3EQOA 3VMVA 4YZ0A 1O8GA 1OFMA 1O8LA 4U4BA 3B90A 3FY3A 1X0CA 1WMRA 4OJOA 3VSVA 4I84A 4YZQA 1EE6A 4NK8A 4OJLA 2PECA 4MR0A 4Z03A 1IDJA 4MXNA 1O8IA 1QCXA 4OJ5A 4NK6A 2EWEA 1NHCA 4Z06A 4XN0A 3ZSCA 3JURA 3KRGA 2X6YA 4XKWA 1AIRA 1PE9A 1RU4A 2X6WA 2INVA 4W8TA 4OZYA 1O8KA 1RWRA 4OJPA 2UVEA 4XM3A 1IB4A 4XL9A 2IQ7A 1O8HA 4W8RA 2VJJA 4XOPA 2QY1A 4YZXA 4XLAA 2NTBA 1GQ8A 1K5CA 3GQ8A 3LMWA 1QJVA 1O8FA 4XNFA 2PYGA 3B4NA 2BSPA 3WWGA 1HG8A 2VBEA 1BHEA 3EQNA 3VSTA 1XG2A 4XLEA 2ODLA 4XQFA 2VBMA 2O17A 2X85A 4U49A 4YEJA 1IA5A 4C2LA 4YELA 1OFLA 1VBLA 1RMGA 1CZFA 3SUCA 3GQ9A 4XOTA 1OOCA 4XKVA 4XORA 5C1CA 2INUA 2NT9A 1DBGA 3VMWA 3ZPPA 3VSUA 4OZZA 4YZAA 1OGMX 1KCDA 4XONA 5C1EA 2X6XA 2NSPA 2PYHA 2QXZA 2NTQA 3B8YA 2NZMA 1BN8A 2O0WA 2VJIA
chains in the Genus database with same CATH superfamily
4XN3A 2J8IA 1DBOA 4OJ6A 4XLFA 3AK5A 2J8KA 3UW0A 1O8DA 1O8JA 3JX8A 2QX3A 2UVFA 4HWVA 4URRA 2VFNA 4EW9A 4XLHA 4W8QA 4XMYA 2XTYA 1OGOX 2VFPA 3PSZA 3GQAA 4Z05A 1O8MA 2VBKA 5AMVA 2NT6A 3GQ7A 1IDKA 1JTAA 1JRGA 1O8EA 2NSTA 2Z8GA 4OPWA 3SYJA 1H80A 4PMHA 3NB2A 4XR6A 4AVZA 1KCCA 4W8SA 4YCQA 3TH0A 1CLWA 2O1DA 2O0VA 3T9GA 1PLUA 3GRHA 4XLCA 1O88A 2O04A 1K4ZA 1PXZA 1KTWA 1LLZA 3N90A 2X3HA 2XTWA 2B0RA 2F3LA 2NTPA 3EQOA 3VMVA 1QQ1A 4YZ0A 1O8GA 1OFMA 3N6ZA 2G0YA 1L1IA 2IOUG 1O8LA 4U4BA 1EZGA 3B90A 3FY3A 1X0CA 2O6WA 1K8FA 1TYUA 4YC5A 1WMRA 3SY2A 1TYXA 5JLVC 4OJOA 1HF2A 3VSVA 4I84A 4YZQA 1EE6A 2QYUA 4NK8A 4YDTA 3NAWA 4OJLA 2PECA 2W7ZA 1LM1A 4MR0A 4Z03A 1IDJA 4JRAC 4MXNA 1O8IA 1QCXA 4OJ5A 4NK6A 2EWEA 5JMCB 4Z06A 1NHCA 1OFEA 3SQVA 4XN0A 3ZSCA 3BH7B 3JURA 3KRGA 2X6YA 4XKWA 1AIRA 1PE9A 1RU4A 2X6WA 2YUHA 2INVA 4W8TA 4OZYA 1O8KA 1RWRA 4OJPA 2UVEA 4XM3A 1IB4A 4XL9A 2IQ7A 4OM9A 1O8HA 4W8RA 2VJJA 4XOPA 2BX6A 2QY1A 1OFDA 4YZXA 3ML3A 3DU1X 1WXRA 4XLAA 1EA0A 2NTBA 1QA1A 1GQ8A 1K5CA 3P4GA 4YFOA 3GQ8A 3LMWA 1QJVA 1O8FA 3LJYA 1QA3A 4XNFA 2VFQA 2PYGA 2XT4A 3B4NA 2BSPA 3WWGA 1TYWA 2VFOA 1HG8A 2VBEA 1BHEA 3EQNA 3VSTA 1XG2A 4XLEA 1QRBA 2ODLA 3RIQA 4XQFA 2VFMA 2VBMA 2XTXA 1QA2A 2BM6A 2O17A 2X85A 1KQ5A 4U49A 4YEJA 1QRCA 1IA5A 4C2LA 1LLWA 2V5IA 4YELA 1OFLA 1VBLA 1RMGA 1CZFA 3BH6B 2BM5A 3GQ9A 3SUCA 4XOTA 1OOCA 4XKVA 3PETA 4XORA 1TSPA 2INUA 5C1CA 2NT9A 2BM4A 4YEIA 1DBGA 3VMWA 2XC1A 2XT2A 4V02C 4KH3A 3VSUA 4OZZA 3ZPPA 1DABA 3PSSA 4YZAA 1OGMX 1KCDA 4XONA 5C1EA 2X6XA 2NSPA 2PYHA 2QXZA 2NTQA 3B8YA 2BM7A 3LYCA 5DNSA 2NZMA 1TYVA 3SZEA 1BN8A 2QZAA 2O0WA 2VJIA 3H09A
chains in the Genus database with same CATH topology
4XN3A 1DBOA 4OJ6A 4XLFA 3UW0A 1O8DA 1O8JA 4URRA 2QX3A 2UVFA 4HWVA 4EW9A 4XLHA 4W8QA 4XMYA 1OGOX 4Z05A 3GQAA 1O8MA 2VBKA 5AMVA 2NT6A 3GQ7A 1IDKA 1JTAA 1JRGA 1O8EA 2NSTA 2Z8GA 1H80A 4PMHA 4XR6A 4AVZA 1KCCA 4W8SA 2O1DA 2O0VA 3T9GA 1PLUA 3GRHA 4XLCA 1O88A 2O04A 1PXZA 1KTWA 2X3HA 2NTPA 3EQOA 3VMVA 4YZ0A 1O8GA 1OFMA 1O8LA 4U4BA 3B90A 3FY3A 1X0CA 1WMRA 4OJOA 3VSVA 4I84A 4YZQA 1EE6A 4NK8A 4OJLA 2PECA 4MR0A 4Z03A 1IDJA 4MXNA 1O8IA 1QCXA 4OJ5A 4NK6A 2EWEA 1NHCA 4Z06A 4XN0A 3ZSCA 3JURA 3KRGA 2X6YA 4XKWA 1AIRA 1PE9A 1RU4A 2X6WA 2INVA 4W8TA 4OZYA 1O8KA 1RWRA 4OJPA 2UVEA 4XM3A 1IB4A 4XL9A 2IQ7A 1O8HA 4W8RA 2VJJA 4XOPA 2QY1A 4YZXA 4XLAA 2NTBA 1GQ8A 1K5CA 3GQ8A 3LMWA 1QJVA 1O8FA 4XNFA 2PYGA 3B4NA 2BSPA 3WWGA 1HG8A 2VBEA 1BHEA 3EQNA 3VSTA 1XG2A 4XLEA 2ODLA 4XQFA 2VBMA 2O17A 2X85A 4U49A 4YEJA 1IA5A 4C2LA 4YELA 1OFLA 1VBLA 1RMGA 1CZFA 3SUCA 3GQ9A 4XOTA 1OOCA 4XKVA 4XORA 5C1CA 2INUA 2NT9A 1DBGA 3VMWA 3ZPPA 3VSUA 4OZZA 4YZAA 1OGMX 1KCDA 4XONA 5C1EA 2X6XA 2NSPA 2PYHA 2QXZA 2NTQA 3B8YA 2NZMA 1BN8A 2O0WA 2VJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XN3 A;  1DBO A;  4OJ6 A;  4XLF A;  3UW0 A;  1O8D A;  1O8J A;  4URR A;  2QX3 A;  2UVF A;  4HWV A;  4EW9 A;  4XLH A;  4W8Q A;  4XMY A;  1OGO X;  4Z05 A;  3GQA A;  1O8M A;  2VBK A;  5AMV A;  2NT6 A;  3GQ7 A;  1IDK A;  1JTA A;  1JRG A;  1O8E A;  2NST A;  2Z8G A;  1H80 A;  4PMH A;  4XR6 A;  4AVZ A;  1KCC A;  4W8S A;  2O1D A;  2O0V A;  3T9G A;  1PLU A;  3GRH A;  4XLC A;  1O88 A;  2O04 A;  1PXZ A;  1KTW A;  2X3H A;  2NTP A;  3EQO A;  3VMV A;  4YZ0 A;  1O8G A;  1OFM A;  1O8L A;  4U4B A;  3B90 A;  3FY3 A;  1X0C A;  1WMR A;  4OJO A;  3VSV A;  4I84 A;  4YZQ A;  1EE6 A;  4NK8 A;  4OJL A;  2PEC A;  4MR0 A;  4Z03 A;  1IDJ A;  4MXN A;  1O8I A;  1QCX A;  4OJ5 A;  4NK6 A;  2EWE A;  1NHC A;  4Z06 A;  4XN0 A;  3ZSC A;  3JUR A;  3KRG A;  2X6Y A;  4XKW A;  1AIR A;  1PE9 A;  1RU4 A;  2X6W A;  2INV A;  4W8T A;  4OZY A;  1O8K A;  1RWR A;  4OJP A;  2UVE A;  4XM3 A;  1IB4 A;  4XL9 A;  2IQ7 A;  1O8H A;  4W8R A;  2VJJ A;  4XOP A;  2QY1 A;  4YZX A;  4XLA A;  2NTB A;  1GQ8 A;  1K5C A;  3GQ8 A;  3LMW A;  1QJV A;  1O8F A;  4XNF A;  2PYG A;  3B4N A;  2BSP A;  3WWG A;  1HG8 A;  2VBE A;  1BHE A;  3EQN A;  3VST A;  1XG2 A;  4XLE A;  2ODL A;  4XQF A;  2VBM A;  2O17 A;  2X85 A;  4U49 A;  4YEJ A;  1IA5 A;  4C2L A;  4YEL A;  1OFL A;  1VBL A;  1RMG A;  1CZF A;  3SUC A;  3GQ9 A;  4XOT A;  1OOC A;  4XKV A;  4XOR A;  5C1C A;  2INU A;  2NT9 A;  1DBG A;  3VMW A;  3ZPP A;  3VSU A;  4OZZ A;  4YZA A;  1OGM X;  1KCD A;  4XON A;  5C1E A;  2X6X A;  2NSP A;  2PYH A;  2QXZ A;  2NTQ A;  3B8Y A;  2NZM A;  1BN8 A;  2O0W A;  2VJI A; 
#chains in the Genus database with same CATH topology
 4XN3 A;  2J8I A;  1DBO A;  4OJ6 A;  4XLF A;  3AK5 A;  2J8K A;  3UW0 A;  1O8D A;  1O8J A;  3JX8 A;  2QX3 A;  2UVF A;  4HWV A;  4URR A;  2VFN A;  4EW9 A;  4XLH A;  4W8Q A;  4XMY A;  2XTY A;  1OGO X;  2VFP A;  3PSZ A;  3GQA A;  4Z05 A;  1O8M A;  2VBK A;  5AMV A;  2NT6 A;  3GQ7 A;  1IDK A;  1JTA A;  1JRG A;  1O8E A;  2NST A;  2Z8G A;  4OPW A;  3SYJ A;  1H80 A;  4PMH A;  3NB2 A;  4XR6 A;  4AVZ A;  1KCC A;  4W8S A;  4YCQ A;  3TH0 A;  1CLW A;  2O1D A;  2O0V A;  3T9G A;  1PLU A;  3GRH A;  4XLC A;  1O88 A;  2O04 A;  1K4Z A;  1PXZ A;  1KTW A;  1LLZ A;  3N90 A;  2X3H A;  2XTW A;  2B0R A;  2F3L A;  2NTP A;  3EQO A;  3VMV A;  1QQ1 A;  4YZ0 A;  1O8G A;  1OFM A;  3N6Z A;  2G0Y A;  1L1I A;  2IOU G;  1O8L A;  4U4B A;  1EZG A;  3B90 A;  3FY3 A;  1X0C A;  2O6W A;  1K8F A;  1TYU A;  4YC5 A;  1WMR A;  3SY2 A;  1TYX A;  5JLV C;  4OJO A;  1HF2 A;  3VSV A;  4I84 A;  4YZQ A;  1EE6 A;  2QYU A;  4NK8 A;  4YDT A;  3NAW A;  4OJL A;  2PEC A;  2W7Z A;  1LM1 A;  4MR0 A;  4Z03 A;  1IDJ A;  4JRA C;  4MXN A;  1O8I A;  1QCX A;  4OJ5 A;  4NK6 A;  2EWE A;  5JMC B;  4Z06 A;  1NHC A;  1OFE A;  3SQV A;  4XN0 A;  3ZSC A;  3BH7 B;  3JUR A;  3KRG A;  2X6Y A;  4XKW A;  1AIR A;  1PE9 A;  1RU4 A;  2X6W A;  2YUH A;  2INV A;  4W8T A;  4OZY A;  1O8K A;  1RWR A;  4OJP A;  2UVE A;  4XM3 A;  1IB4 A;  4XL9 A;  2IQ7 A;  4OM9 A;  1O8H A;  4W8R A;  2VJJ A;  4XOP A;  2BX6 A;  2QY1 A;  1OFD A;  4YZX A;  3ML3 A;  3DU1 X;  1WXR A;  4XLA A;  1EA0 A;  2NTB A;  1QA1 A;  1GQ8 A;  1K5C A;  3P4G A;  4YFO A;  3GQ8 A;  3LMW A;  1QJV A;  1O8F A;  3LJY A;  1QA3 A;  4XNF A;  2VFQ A;  2PYG A;  2XT4 A;  3B4N A;  2BSP A;  3WWG A;  1TYW A;  2VFO A;  1HG8 A;  2VBE A;  1BHE A;  3EQN A;  3VST A;  1XG2 A;  4XLE A;  1QRB A;  2ODL A;  3RIQ A;  4XQF A;  2VFM A;  2VBM A;  2XTX A;  1QA2 A;  2BM6 A;  2O17 A;  2X85 A;  1KQ5 A;  4U49 A;  4YEJ A;  1QRC A;  1IA5 A;  4C2L A;  1LLW A;  2V5I A;  4YEL A;  1OFL A;  1VBL A;  1RMG A;  1CZF A;  3BH6 B;  2BM5 A;  3GQ9 A;  3SUC A;  4XOT A;  1OOC A;  4XKV A;  3PET A;  4XOR A;  1TSP A;  2INU A;  5C1C A;  2NT9 A;  2BM4 A;  4YEI A;  1DBG A;  3VMW A;  2XC1 A;  2XT2 A;  4V02 C;  4KH3 A;  3VSU A;  4OZZ A;  3ZPP A;  1DAB A;  3PSS A;  4YZA A;  1OGM X;  1KCD A;  4XON A;  5C1E A;  2X6X A;  2NSP A;  2PYH A;  2QXZ A;  2NTQ A;  3B8Y A;  2BM7 A;  3LYC A;  5DNS A;  2NZM A;  1TYV A;  3SZE A;  1BN8 A;  2QZA A;  2O0W A;  2VJI A;  3H09 A; 
#chains in the Genus database with same CATH homology
 4XN3 A;  1DBO A;  4OJ6 A;  4XLF A;  3UW0 A;  1O8D A;  1O8J A;  4URR A;  2QX3 A;  2UVF A;  4HWV A;  4EW9 A;  4XLH A;  4W8Q A;  4XMY A;  1OGO X;  4Z05 A;  3GQA A;  1O8M A;  2VBK A;  5AMV A;  2NT6 A;  3GQ7 A;  1IDK A;  1JTA A;  1JRG A;  1O8E A;  2NST A;  2Z8G A;  1H80 A;  4PMH A;  4XR6 A;  4AVZ A;  1KCC A;  4W8S A;  2O1D A;  2O0V A;  3T9G A;  1PLU A;  3GRH A;  4XLC A;  1O88 A;  2O04 A;  1PXZ A;  1KTW A;  2X3H A;  2NTP A;  3EQO A;  3VMV A;  4YZ0 A;  1O8G A;  1OFM A;  1O8L A;  4U4B A;  3B90 A;  3FY3 A;  1X0C A;  1WMR A;  4OJO A;  3VSV A;  4I84 A;  4YZQ A;  1EE6 A;  4NK8 A;  4OJL A;  2PEC A;  4MR0 A;  4Z03 A;  1IDJ A;  4MXN A;  1O8I A;  1QCX A;  4OJ5 A;  4NK6 A;  2EWE A;  1NHC A;  4Z06 A;  4XN0 A;  3ZSC A;  3JUR A;  3KRG A;  2X6Y A;  4XKW A;  1AIR A;  1PE9 A;  1RU4 A;  2X6W A;  2INV A;  4W8T A;  4OZY A;  1O8K A;  1RWR A;  4OJP A;  2UVE A;  4XM3 A;  1IB4 A;  4XL9 A;  2IQ7 A;  1O8H A;  4W8R A;  2VJJ A;  4XOP A;  2QY1 A;  4YZX A;  4XLA A;  2NTB A;  1GQ8 A;  1K5C A;  3GQ8 A;  3LMW A;  1QJV A;  1O8F A;  4XNF A;  2PYG A;  3B4N A;  2BSP A;  3WWG A;  1HG8 A;  2VBE A;  1BHE A;  3EQN A;  3VST A;  1XG2 A;  4XLE A;  2ODL A;  4XQF A;  2VBM A;  2O17 A;  2X85 A;  4U49 A;  4YEJ A;  1IA5 A;  4C2L A;  4YEL A;  1OFL A;  1VBL A;  1RMG A;  1CZF A;  3SUC A;  3GQ9 A;  4XOT A;  1OOC A;  4XKV A;  4XOR A;  5C1C A;  2INU A;  2NT9 A;  1DBG A;  3VMW A;  3ZPP A;  3VSU A;  4OZZ A;  4YZA A;  1OGM X;  1KCD A;  4XON A;  5C1E A;  2X6X A;  2NSP A;  2PYH A;  2QXZ A;  2NTQ A;  3B8Y A;  2NZM A;  1BN8 A;  2O0W A;  2VJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...