1O88A

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 30mm ca2+
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 141
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o88A00
4XN3A 1HG8A 4XKWA 4MXNA 1JTAA 4XMYA 4Z05A 1O8JA 1IDJA 3UW0A 4U49A 2PECA 4OJ5A 2NSTA 1DBGA 3B90A 1PE9A 4XR6A 4YEJA 1IB4A 1QCXA 2X3HA 1O88A 1KCDA 1IA5A 2VBKA 3LMWA 3FY3A 1OGMX 2NTQA 2PYHA 1JRGA 2NT6A 1K5CA 2PYGA 4W8RA 1O8KA 4Z03A 4YZQA 4YZ0A 2IQ7A 2X6WA 2Z8GA 1BN8A 4OJOA 4C2LA 4XLFA 1O8GA 2O17A 2X85A 3GQ7A 4OZZA 4NK8A 1BHEA 4YELA 1O8DA 1RMGA 4OJ6A 4W8QA 4W8SA 4MR0A 1CZFA 1OFMA 3GQAA 1AIRA 3VSTA 4URRA 2INVA 1QJVA 2NZMA 1PLUA 2INUA 4XLCA 4EW9A 2VBEA 2ODLA 3B8YA 1PXZA 2NSPA 1O8FA 3GRHA 4YZAA 5C1EA 2VJIA 2VJJA 2X6XA 4XNFA 4OJLA 3SUCA 4XQFA 3WWGA 1KCCA 5C1CA 3VMWA 3GQ9A 1O8HA 4HWVA 3KRGA 4XL9A 2BSPA 1WMRA 1O8EA 4I84A 4XONA 2EWEA 4YZXA 1RWRA 4XLHA 4PMHA 1O8IA 3JURA 4OJPA 4XOPA 2UVEA 3EQOA 4NK6A 2O0VA 1NHCA 4XM3A 4W8TA 2X6YA 4XORA 2O04A 4XLEA 4OZYA 1DBOA 4XN0A 5AMVA 4XKVA 2NTPA 2O1DA 3ZSCA 3B4NA 1GQ8A 3EQNA 3VSVA 2VBMA 4XOTA 1RU4A 2QY1A 3VMVA 2UVFA 1OGOX 4XLAA 2QXZA 4Z06A 1EE6A 1VBLA 1XG2A 4AVZA 1OFLA 2NT9A 1X0CA 1H80A 2QX3A 1IDKA 1O8MA 1O8LA 3VSUA 2O0WA 4U4BA 3T9GA 3GQ8A 1OOCA 1KTWA 3ZPPA 2NTBA
chains in the Genus database with same CATH superfamily
4XN3A 2XT4A 1HG8A 3ML3A 4XKWA 4MXNA 1JTAA 4XMYA 4Z05A 1O8JA 1LLZA 1IDJA 3UW0A 4U49A 3PSZA 3RIQA 2PECA 4OJ5A 2NSTA 4V02C 1DBGA 1TYUA 1PE9A 2VFPA 3B90A 4XR6A 4YEJA 5JLVC 1IB4A 1QCXA 2X3HA 1O88A 1KCDA 3LYCA 2VBKA 1IA5A 3LMWA 3FY3A 1OGMX 2NTQA 2PYHA 1JRGA 2NT6A 1K5CA 2XTWA 3PSSA 1HF2A 2F3LA 2PYGA 4W8RA 1O8KA 4JRAC 1TYWA 4Z03A 1K8FA 4YZQA 3PETA 4YZ0A 2IQ7A 1KQ5A 2W7ZA 2VFOA 2X6WA 1BN8A 2Z8GA 4KH3A 4OJOA 4C2LA 4XLFA 2XTYA 1O8GA 2IOUG 2O17A 1QRCA 2X85A 3GQ7A 4OZZA 4NK8A 1BHEA 3NAWA 4YELA 1O8DA 1RMGA 3NB2A 4OJ6A 4W8QA 4W8SA 1QA3A 2VFQA 2QYUA 4YC5A 4MR0A 1EA0A 1CZFA 1OFMA 3GQAA 1AIRA 3VSTA 1LLWA 1WXRA 4URRA 2INVA 1QJVA 2NZMA 1PLUA 2INUA 4XLCA 4EW9A 2VBEA 2ODLA 2QZAA 3P4GA 1QA2A 3B8YA 1PXZA 2B0RA 2NSPA 3H09A 1O8FA 1QRBA 3GRHA 4YZAA 5C1EA 3BH6B 2VJIA 2VJJA 2X6XA 4XNFA 4OJLA 3SUCA 4XQFA 1QQ1A 3WWGA 1KCCA 5DNSA 5C1CA 4YDTA 3DU1X 3VMWA 2BM7A 3GQ9A 4OPWA 1O8HA 4HWVA 2BM4A 3KRGA 3SZEA 1TSPA 4XL9A 1DABA 2V5IA 2BSPA 3TH0A 1WMRA 1O8EA 2XT2A 1CLWA 4I84A 4YFOA 4XONA 2EWEA 4YCQA 4YZXA 1RWRA 4XLHA 1TYVA 1O8IA 4PMHA 2YUHA 3JURA 4OJPA 1QA1A 4XOPA 2O6WA 2UVEA 3EQOA 4NK6A 2O0VA 1NHCA 4XM3A 4W8TA 3SYJA 5JMCB 2BM6A 2X6YA 1K4ZA 3BH7B 2O04A 4XLEA 4OZYA 1DBOA 4XN0A 4XORA 4XKVA 2NTPA 2O1DA 5AMVA 3ZSCA 3LJYA 1L1IA 3B4NA 2VFNA 1GQ8A 3EQNA 3VSVA 2J8IA 2VBMA 4XOTA 2BX6A 1RU4A 2QY1A 4OM9A 3N6ZA 2VFMA 3SY2A 3VMVA 2UVFA 1OGOX 4XLAA 2QXZA 4Z06A 1EE6A 1VBLA 3AK5A 2XTXA 2BM5A 1XG2A 4AVZA 1OFEA 1OFLA 2NT9A 1X0CA 1H80A 2QX3A 1EZGA 3JX8A 1IDKA 3N90A 1O8MA 4YEIA 2J8KA 1O8LA 1OFDA 3VSUA 2O0WA 1TYXA 4U4BA 3T9GA 3GQ8A 1OOCA 1KTWA 3ZPPA 2NTBA 2G0YA 3SQVA 2XC1A 1LM1A
chains in the Genus database with same CATH topology
4XN3A 1HG8A 4XKWA 4MXNA 1JTAA 4XMYA 4Z05A 1O8JA 1IDJA 3UW0A 4U49A 2PECA 4OJ5A 2NSTA 1DBGA 3B90A 1PE9A 4XR6A 4YEJA 1IB4A 1QCXA 2X3HA 1O88A 1KCDA 1IA5A 2VBKA 3LMWA 3FY3A 1OGMX 2NTQA 2PYHA 1JRGA 2NT6A 1K5CA 2PYGA 4W8RA 1O8KA 4Z03A 4YZQA 4YZ0A 2IQ7A 2X6WA 2Z8GA 1BN8A 4OJOA 4C2LA 4XLFA 1O8GA 2O17A 2X85A 3GQ7A 4OZZA 4NK8A 1BHEA 4YELA 1O8DA 1RMGA 4OJ6A 4W8QA 4W8SA 4MR0A 1CZFA 1OFMA 3GQAA 1AIRA 3VSTA 4URRA 2INVA 1QJVA 2NZMA 1PLUA 2INUA 4XLCA 4EW9A 2VBEA 2ODLA 3B8YA 1PXZA 2NSPA 1O8FA 3GRHA 4YZAA 5C1EA 2VJIA 2VJJA 2X6XA 4XNFA 4OJLA 3SUCA 4XQFA 3WWGA 1KCCA 5C1CA 3VMWA 3GQ9A 1O8HA 4HWVA 3KRGA 4XL9A 2BSPA 1WMRA 1O8EA 4I84A 4XONA 2EWEA 4YZXA 1RWRA 4XLHA 4PMHA 1O8IA 3JURA 4OJPA 4XOPA 2UVEA 3EQOA 4NK6A 2O0VA 1NHCA 4XM3A 4W8TA 2X6YA 4XORA 2O04A 4XLEA 4OZYA 1DBOA 4XN0A 5AMVA 4XKVA 2NTPA 2O1DA 3ZSCA 3B4NA 1GQ8A 3EQNA 3VSVA 2VBMA 4XOTA 1RU4A 2QY1A 3VMVA 2UVFA 1OGOX 4XLAA 2QXZA 4Z06A 1EE6A 1VBLA 1XG2A 4AVZA 1OFLA 2NT9A 1X0CA 1H80A 2QX3A 1IDKA 1O8MA 1O8LA 3VSUA 2O0WA 4U4BA 3T9GA 3GQ8A 1OOCA 1KTWA 3ZPPA 2NTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XN3 A;  1HG8 A;  4XKW A;  4MXN A;  1JTA A;  4XMY A;  4Z05 A;  1O8J A;  1IDJ A;  3UW0 A;  4U49 A;  2PEC A;  4OJ5 A;  2NST A;  1DBG A;  3B90 A;  1PE9 A;  4XR6 A;  4YEJ A;  1IB4 A;  1QCX A;  2X3H A;  1O88 A;  1KCD A;  1IA5 A;  2VBK A;  3LMW A;  3FY3 A;  1OGM X;  2NTQ A;  2PYH A;  1JRG A;  2NT6 A;  1K5C A;  2PYG A;  4W8R A;  1O8K A;  4Z03 A;  4YZQ A;  4YZ0 A;  2IQ7 A;  2X6W A;  2Z8G A;  1BN8 A;  4OJO A;  4C2L A;  4XLF A;  1O8G A;  2O17 A;  2X85 A;  3GQ7 A;  4OZZ A;  4NK8 A;  1BHE A;  4YEL A;  1O8D A;  1RMG A;  4OJ6 A;  4W8Q A;  4W8S A;  4MR0 A;  1CZF A;  1OFM A;  3GQA A;  1AIR A;  3VST A;  4URR A;  2INV A;  1QJV A;  2NZM A;  1PLU A;  2INU A;  4XLC A;  4EW9 A;  2VBE A;  2ODL A;  3B8Y A;  1PXZ A;  2NSP A;  1O8F A;  3GRH A;  4YZA A;  5C1E A;  2VJI A;  2VJJ A;  2X6X A;  4XNF A;  4OJL A;  3SUC A;  4XQF A;  3WWG A;  1KCC A;  5C1C A;  3VMW A;  3GQ9 A;  1O8H A;  4HWV A;  3KRG A;  4XL9 A;  2BSP A;  1WMR A;  1O8E A;  4I84 A;  4XON A;  2EWE A;  4YZX A;  1RWR A;  4XLH A;  4PMH A;  1O8I A;  3JUR A;  4OJP A;  4XOP A;  2UVE A;  3EQO A;  4NK6 A;  2O0V A;  1NHC A;  4XM3 A;  4W8T A;  2X6Y A;  4XOR A;  2O04 A;  4XLE A;  4OZY A;  1DBO A;  4XN0 A;  5AMV A;  4XKV A;  2NTP A;  2O1D A;  3ZSC A;  3B4N A;  1GQ8 A;  3EQN A;  3VSV A;  2VBM A;  4XOT A;  1RU4 A;  2QY1 A;  3VMV A;  2UVF A;  1OGO X;  4XLA A;  2QXZ A;  4Z06 A;  1EE6 A;  1VBL A;  1XG2 A;  4AVZ A;  1OFL A;  2NT9 A;  1X0C A;  1H80 A;  2QX3 A;  1IDK A;  1O8M A;  1O8L A;  3VSU A;  2O0W A;  4U4B A;  3T9G A;  3GQ8 A;  1OOC A;  1KTW A;  3ZPP A;  2NTB A; 
#chains in the Genus database with same CATH topology
 4XN3 A;  2XT4 A;  1HG8 A;  3ML3 A;  4XKW A;  4MXN A;  1JTA A;  4XMY A;  4Z05 A;  1O8J A;  1LLZ A;  1IDJ A;  3UW0 A;  4U49 A;  3PSZ A;  3RIQ A;  2PEC A;  4OJ5 A;  2NST A;  4V02 C;  1DBG A;  1TYU A;  1PE9 A;  2VFP A;  3B90 A;  4XR6 A;  4YEJ A;  5JLV C;  1IB4 A;  1QCX A;  2X3H A;  1O88 A;  1KCD A;  3LYC A;  2VBK A;  1IA5 A;  3LMW A;  3FY3 A;  1OGM X;  2NTQ A;  2PYH A;  1JRG A;  2NT6 A;  1K5C A;  2XTW A;  3PSS A;  1HF2 A;  2F3L A;  2PYG A;  4W8R A;  1O8K A;  4JRA C;  1TYW A;  4Z03 A;  1K8F A;  4YZQ A;  3PET A;  4YZ0 A;  2IQ7 A;  1KQ5 A;  2W7Z A;  2VFO A;  2X6W A;  1BN8 A;  2Z8G A;  4KH3 A;  4OJO A;  4C2L A;  4XLF A;  2XTY A;  1O8G A;  2IOU G;  2O17 A;  1QRC A;  2X85 A;  3GQ7 A;  4OZZ A;  4NK8 A;  1BHE A;  3NAW A;  4YEL A;  1O8D A;  1RMG A;  3NB2 A;  4OJ6 A;  4W8Q A;  4W8S A;  1QA3 A;  2VFQ A;  2QYU A;  4YC5 A;  4MR0 A;  1EA0 A;  1CZF A;  1OFM A;  3GQA A;  1AIR A;  3VST A;  1LLW A;  1WXR A;  4URR A;  2INV A;  1QJV A;  2NZM A;  1PLU A;  2INU A;  4XLC A;  4EW9 A;  2VBE A;  2ODL A;  2QZA A;  3P4G A;  1QA2 A;  3B8Y A;  1PXZ A;  2B0R A;  2NSP A;  3H09 A;  1O8F A;  1QRB A;  3GRH A;  4YZA A;  5C1E A;  3BH6 B;  2VJI A;  2VJJ A;  2X6X A;  4XNF A;  4OJL A;  3SUC A;  4XQF A;  1QQ1 A;  3WWG A;  1KCC A;  5DNS A;  5C1C A;  4YDT A;  3DU1 X;  3VMW A;  2BM7 A;  3GQ9 A;  4OPW A;  1O8H A;  4HWV A;  2BM4 A;  3KRG A;  3SZE A;  1TSP A;  4XL9 A;  1DAB A;  2V5I A;  2BSP A;  3TH0 A;  1WMR A;  1O8E A;  2XT2 A;  1CLW A;  4I84 A;  4YFO A;  4XON A;  2EWE A;  4YCQ A;  4YZX A;  1RWR A;  4XLH A;  1TYV A;  1O8I A;  4PMH A;  2YUH A;  3JUR A;  4OJP A;  1QA1 A;  4XOP A;  2O6W A;  2UVE A;  3EQO A;  4NK6 A;  2O0V A;  1NHC A;  4XM3 A;  4W8T A;  3SYJ A;  5JMC B;  2BM6 A;  2X6Y A;  1K4Z A;  3BH7 B;  2O04 A;  4XLE A;  4OZY A;  1DBO A;  4XN0 A;  4XOR A;  4XKV A;  2NTP A;  2O1D A;  5AMV A;  3ZSC A;  3LJY A;  1L1I A;  3B4N A;  2VFN A;  1GQ8 A;  3EQN A;  3VSV A;  2J8I A;  2VBM A;  4XOT A;  2BX6 A;  1RU4 A;  2QY1 A;  4OM9 A;  3N6Z A;  2VFM A;  3SY2 A;  3VMV A;  2UVF A;  1OGO X;  4XLA A;  2QXZ A;  4Z06 A;  1EE6 A;  1VBL A;  3AK5 A;  2XTX A;  2BM5 A;  1XG2 A;  4AVZ A;  1OFE A;  1OFL A;  2NT9 A;  1X0C A;  1H80 A;  2QX3 A;  1EZG A;  3JX8 A;  1IDK A;  3N90 A;  1O8M A;  4YEI A;  2J8K A;  1O8L A;  1OFD A;  3VSU A;  2O0W A;  1TYX A;  4U4B A;  3T9G A;  3GQ8 A;  1OOC A;  1KTW A;  3ZPP A;  2NTB A;  2G0Y A;  3SQV A;  2XC1 A;  1LM1 A; 
#chains in the Genus database with same CATH homology
 4XN3 A;  1HG8 A;  4XKW A;  4MXN A;  1JTA A;  4XMY A;  4Z05 A;  1O8J A;  1IDJ A;  3UW0 A;  4U49 A;  2PEC A;  4OJ5 A;  2NST A;  1DBG A;  3B90 A;  1PE9 A;  4XR6 A;  4YEJ A;  1IB4 A;  1QCX A;  2X3H A;  1O88 A;  1KCD A;  1IA5 A;  2VBK A;  3LMW A;  3FY3 A;  1OGM X;  2NTQ A;  2PYH A;  1JRG A;  2NT6 A;  1K5C A;  2PYG A;  4W8R A;  1O8K A;  4Z03 A;  4YZQ A;  4YZ0 A;  2IQ7 A;  2X6W A;  2Z8G A;  1BN8 A;  4OJO A;  4C2L A;  4XLF A;  1O8G A;  2O17 A;  2X85 A;  3GQ7 A;  4OZZ A;  4NK8 A;  1BHE A;  4YEL A;  1O8D A;  1RMG A;  4OJ6 A;  4W8Q A;  4W8S A;  4MR0 A;  1CZF A;  1OFM A;  3GQA A;  1AIR A;  3VST A;  4URR A;  2INV A;  1QJV A;  2NZM A;  1PLU A;  2INU A;  4XLC A;  4EW9 A;  2VBE A;  2ODL A;  3B8Y A;  1PXZ A;  2NSP A;  1O8F A;  3GRH A;  4YZA A;  5C1E A;  2VJI A;  2VJJ A;  2X6X A;  4XNF A;  4OJL A;  3SUC A;  4XQF A;  3WWG A;  1KCC A;  5C1C A;  3VMW A;  3GQ9 A;  1O8H A;  4HWV A;  3KRG A;  4XL9 A;  2BSP A;  1WMR A;  1O8E A;  4I84 A;  4XON A;  2EWE A;  4YZX A;  1RWR A;  4XLH A;  4PMH A;  1O8I A;  3JUR A;  4OJP A;  4XOP A;  2UVE A;  3EQO A;  4NK6 A;  2O0V A;  1NHC A;  4XM3 A;  4W8T A;  2X6Y A;  4XOR A;  2O04 A;  4XLE A;  4OZY A;  1DBO A;  4XN0 A;  5AMV A;  4XKV A;  2NTP A;  2O1D A;  3ZSC A;  3B4N A;  1GQ8 A;  3EQN A;  3VSV A;  2VBM A;  4XOT A;  1RU4 A;  2QY1 A;  3VMV A;  2UVF A;  1OGO X;  4XLA A;  2QXZ A;  4Z06 A;  1EE6 A;  1VBL A;  1XG2 A;  4AVZ A;  1OFL A;  2NT9 A;  1X0C A;  1H80 A;  2QX3 A;  1IDK A;  1O8M A;  1O8L A;  3VSU A;  2O0W A;  4U4B A;  3T9G A;  3GQ8 A;  1OOC A;  1KTW A;  3ZPP A;  2NTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...