4XOPA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 235
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xopA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xopA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xopA02
2VJIA 3GQ7A 4OJOA 4NK8A 3VSUA 3GQ9A 4C2LA 2QX3A 2VBMA 2X3HA 2NTBA 2NT9A 4XLAA 2O0VA 4XOTA 4XLHA 1IA5A 1O8IA 3EQOA 1K5CA 1O8LA 1IB4A 1JRGA 4OJPA 4XN3A 3GQAA 1RU4A 4YEJA 4I84A 4XN0A 3ZPPA 4XKWA 4YZ0A 2INVA 1OFLA 1O8GA 1WMRA 4XLEA 4XR6A 2NSTA 1CZFA 5AMVA 1O8KA 2PYGA 1PXZA 2QXZA 1BN8A 3VMVA 1O8EA 1PLUA 1H80A 2NSPA 3B90A 2PECA 4AVZA 4U4BA 4W8SA 4Z06A 4XQFA 1RWRA 3GQ8A 3KRGA 3T9GA 1O8HA 2BSPA 4YELA 4XONA 1IDJA 4PMHA 1XG2A 4MR0A 1NHCA 3B4NA 4OJ6A 4W8TA 4Z05A 4Z03A 4XMYA 1GQ8A 3UW0A 1VBLA 3WWGA 2O17A 2VJJA 1O8FA 2X85A 2IQ7A 4XKVA 2Z8GA 4XL9A 4XLCA 2UVFA 1PE9A 4XOPA 4HWVA 3GRHA 4XM3A 4OJ5A 4MXNA 1KCDA 2X6WA 1QJVA 2UVEA 4YZXA 1DBOA 2NTPA 4OZYA 2O0WA 4YZQA 1OOCA 1O8DA 4U49A 3VSVA 2VBKA 2O1DA 4EW9A 3EQNA 1O88A 4OZZA 1JTAA 1AIRA 1KTWA 2NT6A 3JURA 4URRA 1QCXA 2NTQA 3VSTA 1BHEA 3SUCA 1EE6A 4XLFA 1IDKA 4W8RA 5C1CA 2PYHA 1X0CA 2QY1A 4XORA 3LMWA 1OGOX 1OGMX 2O04A 4NK6A 1DBGA 3ZSCA 4OJLA 3VMWA 4W8QA 4XNFA 2VBEA 3B8YA 3FY3A 2X6XA 2NZMA 2X6YA 5C1EA 1HG8A 1O8MA 1OFMA 4YZAA 1O8JA 2INUA 1KCCA 2EWEA 2ODLA 1RMGA
chains in the Genus database with same CATH superfamily
4GDFA 4ITVA 4YAOA 4NK8A 1E62A 2E5NA 3COAC 3WNDA 2F6CA 2Q2EA 3DEUA 1DPUA 1DABA 2XDVA 1WOPA 1RC9A 4OPSA 1YHQB 2HGCA 2EZKA 3CO6C 5FD5A 2QTLA 3S3OA 4IQJA 4L9NA 4E7SA 4A93J 2R0QC 3TGNA 1FOKA 1P4AA 1S0UA 4I0AA 3WG7H 3H36A 3FDYA 5CQGA 4YG2F 3GTKJ 5HOOA 1BI1A 3CMEI 3A03A 1L0OC 4OJPA 1ULYA 4YEJA 1QFYA 4TKOB 3L2UA 1EF4A 3CD6I 5B1AH 4ASNA 2XAFA 2QYOA 1FC3A 4CHUA 3ZZUA 1YYVA 1LDJA 1I3QJ 2GA2A 3A0HC 3RIQA 5KCMA 3CMYA 3OPOA 3A1YA 3CLOA 2VNKA 5DNSA 1TWAJ 4HX4A 2WY8Q 1U6GA 3WTWC 2ZTNA 3FKSA 4U9UA 1GXQA 1B6AA 2OBRA 1HSTA 1Z3YA 2IGOA 4E7ZA 2WR8A 4IOAF 4M9ZA 4LLGF 4ZDLA 2KPMA 4PJLA 3SJMA 2DCUA 1YHQI 4X7FA 2JPCA 1ERDA 4BBRJ 3KP5A 1JUMA 3PQJA 4IXAA 2E1CA 5K1YA 4E0FA 2D1HA 3PETA 4PUSA 1VF9A 3V8LA 4DBQA 2ME6A 2C4UA 1P2FA 2F1LA 1HA3A 4FX0A 1Q82D 3E20A 1RETA 4PJMA 1KQ0A 4PSWA 3AGQA 3SYJA 4BBSJ 3BR5A 2AQFA 4NCNA 2DMTA 2L9VA 2Q6IA 2FNAA 3J80K 1LNWA 5LMZA 2VOOA 1EP2B 4ETSA 1K6OA 4OMZA 3ASTA 1O7LA 3R4KA 1IN6A 1W0TA 2AHOA 1ETKA 3BQJA 4RD4A 3L2VA 4RCZA 2V7QA 4XM3A 1U2RA 2DT6A 1Y56A 4FT8A 1WH5A 2FD5A 4AIJA 1B8IA 1MABA 2GK7A 2P3MA 2ID6A 3O6BB 5LHIA 4U7DA 4L0ZB 3D0SA 1SD5A 3FHZA 2X4HA 1B72B 4TT3A 4L5JA 1DU6A 1USTA 1KK0A 4M73A 2VNJA 4ZCMA 1MNDA 1QZEA 1SM4A 4PJNA 1PDNC 1YG2A 1ZHFA 5LGTA 3AKZA 4UHTA 1V55H 3K70C 3NE5B 4NQWA 1YW9A 4JQFA 4BE2A 4EGYA 3IAM2 3OE7A 2O0YA 3HOYJ 3JURA 4G7XA 1FSEA 1Q86D 4YRVA 2ZXJA 2AHQA 3QQAA 3TDUC 4R8HA 2DTZA 2L7KA 3SUCA 1JB9A 5D5XB 3TBIA 1QBJA 5E18F 2C5BA 3OEHA 3CTAA 4CA0A 3C2GA 4Q4ZF 4KKTA 4YXWA 3FM5A 1X19A 1X2MA 5GTIC 4DNCA 5HNHA 4OJLA 4B3XA 3ABMH 2VJ5A 2E36A 4EEFG 1EJ9A 4LG0B 1VF7A 1RRJA 1I18A 2NZMA 5BS6A 1K78A 2F43A 3RYPA 4HRIA 3CCRB 2JTVA 2QBYA 3QODA 5EEHA 4UXNA 2VFNA 2IEKA 1HLVA 1J0RA 1OR7A 1T95A 3SY2A 3UKGA 4FE4A 4I98B 2R7VA 2VZLA 2ZTGA 4NB5A 5BSXA 3AVUA 3H9QA 4XLAA 4D0PA 2O03A 3Q9VA 3GZNB 1P7JA 2CUZA 1X3ZB 5DCMA 3JSOA 1JA0A 5D6EA 3K0LA 1R1TA 5FLVA 3G6EB 3AVTA 5JLXA 4O3MA 2F1MA 5EZHA 1V4RA 4KN4X 5CVRA 2JUCA 1QZYA 2WZNA 2VKVA 2HYFA 1ONVA 2XB5A 2A07F 3W2WA 1X2NA 3IC7A 1K4ZA 1E64A 3ECOA 1NRKA 1BR4A 4UY8I 2DDBA 1W7PA 2DI3A 1JTXA 3TOAA 3E0JB 1R5ID 2DQRA 1T6ZA 1IN5A 3TMOA 4B1RA 4DYCA 5E3MA 4UZFA 2Q2EB 5DDGA 2IS6A 2XZOA 4IHWA 1G3YA 3CCRI 3OL4A 3A0BC 1OCCH 2LD5A 3BH4A 4DNRB 2VXZA 3DTIA 2V26A 3G1OA 3ZMTA 3FHNA 1TSPA 2KKOA 4MHGA 5D5WB 3VR6A 2O6GE 4C0SA 2ZSIB 3M8EA 4HDUA 1FNNA 1BW5A 1JKPC 4LC0A 4CH7A 2P5LC 1G3SA 3BTCA 3HGYA 5J3LA 4D7NA 5D8LB 3Q3SA 2YSRA 4BDYA 1DDGA 4RGUA 3R6JA 2MFZA 5F0FA 1N78A 2ECBA 2ZJQF 3MCAA 2QQ9A 3G6EI 2PEXA 1LPQA 5HODA 1UD6A 1PJRA 1VLYA 1K9MD 5C4JJ 2K3FA 5FROA 5EG0A 3SEJA 1RZ4A 4M0LA 2VONA 2XKOA 5TISC 5FGMA 5HLTA 3HOZJ 4EMSA 3H9JA 1VQ6B 1T56A 1WPKA 4Z4WA 1IRXA 4DK0A 5DN6A 4NBQA 4M53A 4TMZA 3WWGA 2V5IA 2H09A 4GQNA 4J00A 1MIJA 3S8PA 4EJOA 3PIPF 1ZLKA 4V19K 3ZN0A 2DOAA 4ZTFA 2R7TA 2H1LA 4YFNF 3E5UA 3SLDA 3ZBTA 4WXDA 1TYWA 1Z67A 2WBMA 1H0MA 2BY0A 1WJBA 3WBJA 2KFDA 1EH7A 4LIUA 3HAGA 2Y2ZA 5BNGA 1W0JA 1FNDA 1S7AA 4L9VA 5HLIA 1E3ZA 2LNBA 4A3GJ 4ACBA 5AIQA 1KC8D 4CCJA 2ESHA 3E97A 3MZ8A 4YAFA 4RGXA 1TQMA 5K5OA 5L3BA 3KCCA 3TKYA 4U0YA 1FRNA 2G0EA 9ANTA 4A69C 3IUOA 3FK6A 4P5OA 1VQ6I 5EYRA 3SHFA 3ASPA 5J3OA 5K7HA 1UHSA 3DU6A 4IO9F 2O6WA 2XTWA 2HOTA 5BPIA 4OPVA 2ZFWA 2V6CA 1YX2A 2Q0OA 2GZWA 2KJCA 3QYEA 2WAFA 4E6KG 4LD5A 4O5VA 5ILUA 2CGPA 3SFZA 1OGOX 3WODF 2MC4A 3PUFA 4BH9A 4AC9A 4JK1X 2ZXWH 1V3FA 1UD4A 5IYWA 2A61A 2AXTC 1K8FA 3MMPA 2EBIA 3BNWA 1A36A 3W5UA 3OYCA 1QA3A 2WV1A 2TCTA 3B73A 4NQWB 1KK2A 3OFNA 4RD0A 2IT0A 3BR2A 2OTLB 2VKDA 1T39A 2BM1A 2DFEA 4KMFA 4ENKA 4LFUA 1QHGA 4EH1A 4WWVA 2VFOA 3NARA 1T6SA 2YPRA 4ZTJA 2M9HA 1R5OA 1GHCA 4OIPF 2VBMA 4F52A 4MO7A 5M3MJ 2Q6LA 1ZR4A 1IA5A 3R6KA 1SFUA 2OZUA 1FEXA 2LOOA 4OOVA 2G0YA 2BW3A 2CRGA 5JHUA 4M74A 2OJED 2KL4A 4G6TB 3TEDA 3FMRA 1T08B 2DFIA 1WZ2A 1K78B 2EH3A 1IB4A 1YLFA 3S1MJ 1MSEC 3R6SA 3OYIA 2QBYB 1H42A 3OYEA 5HLGA 2YWFA 4BQNA 5DD4A 2DERA 2DU9A 3F22A 2OTJB 1KZLA 3RPQA 3DQVC 1EZGA 1KD1D 3R0JA 2ZBKA 2GA1A 4WZLA 1QU3A 4Z1MA 2YUSA 2XASA 4WXHA 5DCMB 1O8EA 3L7WA 2OTLI 3AG4H 4F91B 2VNIA 5ICCA 2ZKZA 1FP1D 2M30A 2BZTA 1VQMB 3B90A 3OKXA 4L5EA 4XQFA 4PABA 1E1RA 5L46A 2BPOA 3P9CA 5ERIA 1G6NA 3GQ8A 3OYJA 4ROXA 3F6OA 4G6QA 4UVBA 5E79C 2JSPA 1SANA 1W7PB 1XMKA 2L5QA 2WC2A 3OYDA 3OSFA 4C2TA 1W35A 2QYUA 1IXRC 1XMXA 4Q7JB 2O61A 1YX3A 3OYMA 2X51A 3Q3AA 4G7OF 4XD7A 1R5BA 3MAJA 3BY6A 3K1MA 3HUGA 3OEEA 3L2WA 1QGPA 3ASOH 3E6BA 1R1UA 3H35A 3I3LA 4WK8F 3VODA 2OTJI 2BM5A 1ON2A 1YS7A 2CO5A 4RLQA 1TT5B 1ITYA 1U2WA 5CVUA 1UHMA 3ABTA 4Y13A 2JK3A 5FO0A 1PE9A 2J8KA 5L3EA 1DDIA 4P9SA 4ZYAA 2JDIA 4IQ4A 5CDFA 1F1ZA 2AS5F 1VQMI 3I4PA 4PDKA 3RIRA 4YIRX 3H3ZA 5EG0B 4RB3C 1S72B 3J7AO 4ESJA 4KNYA 3U2QA 1XE1A 1Z7LA 3NWSA 2VKEA 3KP2A 2B5OA 4X8IA 2AO9A 4JX5A 2VQHA 3P5JA 3T8TA 4RJLA 2R9VA 5J1YA 4OMYA 2EFOA 2YU3A 3V42A 3HHGA 1LB2A 1XCVA 1IXSB 1J5YA 3BLYA 3A02A 4X6AJ 1T0FA 5C44J 4A3KJ 3LMWA 2V1XA 3JCUC 2VN2A 1E3PA 1Z3XA 3E6MA 3F21A 2D9RA 1LVKA 4A5MA 4B3AA 4DBRA 4QTRA 1SAXA 3HOWJ 3AVVA 5GPAA 3A01A 3VMWA 3F72A 3TO6A 2BBYA 2LC2A 1ZRCA 2INUA 3B8HA 1UMQA 1ZR2A 1S72I 2E5ZA 3TQNA 5LHGA 2HKOA 2HCJB 3RSNA 2M5SA 3AL0B 1TLHB 3BPVA 4M3FA 2ZBUA 1W9XA 4CQJA 3GWZA 2XPUA 1WJDA 1AHDP 2COMA 5E17F 3LAJA 3WNBA 4LK0F 4LMYA 1XG1A 2NTBA 2X3HA 1FDRA 3GX4X 1VQ4B 5FFZA 1Y0YA 2CH0A 2DQLA 4LITA 1IDYA 5ILVA 1B4AA 5FL7A 2W1OA 4UVAA 4OIRF 1A6IA 1LLWA 4RS8A 3WTXC 3H3UA 3VYRB 3BZCA 2VBXA 3NEUA 3BY2A 1LEAA 2NOJB 3ZMZA 1F60A 4YZ0A 2C5HA 4XRSG 3BCFA 2E1RA 3B82A 3CPWB 2XGCA 3L9FA 1WMRA 2L7ZA 2BN4A 1VZ0A 3AAFA 3N05A 3PSIA 2A69F 3CQZJ 4HLXA 3IKVA 3KP4A 3VMVA 1KQ8A 1FP2A 4KUMA 4BNCA 2BV3A 5JLWA 2E1OA 2XF5A 1W5SA 3G3ZA 3CCUB 1R6RA 2MYSA 1WJAA 3BR6A 3BTJA 1GAQA 2QZAA 2BW3B 1TBXA 4BQQA 3GO5A 1KYZA 2D3LA 1N25A 1FWZA 4C2UA 1JA1A 1VQ4I 2L7FP 3HXLA 3GIRA 4X7EA 1TQPA 3EPZA 4DYQA 2BSPA 2LZJA 1F36A 4EM0B 5IOZA 4BXFA 4J01A 1DU0A 2E1BA 1R5NA 3CCVB 5FIUA 5EGOA 5ICEA 2YR2A 2V79A 1QVUA 3DU1X 3WU1B 1LDDA 4RLZA 4HLYA 1MBFA 4C3JJ 2AQEA 1U5TA 2E7WA 1GVDA 3TO7A 4LOCA 3ABUA 2XEXA 3BR1A 1XGSA 1HCRA 4X0CA 3CCUI 3BPXA 4X06A 1BR1A 1FOXA 4MXNA 3ZMVA 3H0DA 2W6IA 5IP6A 4GFBA 1I6HJ 2WA0A 4AIHA 1ZG1A 1K61A 1IF1A 4M9SA 1BC7C 1M90D 3WNCA 2EV6A 3ONQA 4M2LA 4V2FA 1OOCA 4RAGA 2ZB9A 3KE2A 4N0BA 2VBKA 3KX2A 2QN6A 2K40A 2IJLA 1O88A 3F8NA 2QGGA 4XSXF 4ZYHA 5FKLA 3S1NJ 1QRYA 3CW2A 4BPRA 5LRRA 4L9JA 1Y1WJ 1D5YA 1TC3C 1PKVA 3VSTA 4IHVA 3LL7A 1AU7A 4J0QA 3CCVI 3F0CA 3ZGKA 3DTEA 4XLFA 3KLOA 2FBHA 1K7AA 4BU2A 1ZGWA 3QP5A 5D4SA 4C2MJ 3ZRGA 1IB0A 4I02A 2G7HA 5GAGJ 3EDPA 2DY1A 3OZVA 1RNLA 2R7WA 1Y8QB 2HDNB 5C1EA 1OFMA 2IVMA 4M3GA 2HXIA 4V02C 5IYPA 3CCQB 4OIOF 2D74A 2DPUA 3HIFA 3N4MA 2L9RA 2DA4A 2DA7A 2O5RA 1XSVA 4NDLA 2J8IA 5ICGA 2X1CA 1ZRFA 5TR9A 1J09A 4HSTA 5IPAA 1E3XA 3GQ9A 4BKXA 4LB5A 1DP7P 5E8GA 3QPSA 2OV7A 2HQNA 3E5QA 2DOEA 1YTYA 2ZXHA 1RKTA 5GTHC 3S17J 1STZA 2XV4S 4AYBA 3A01B 3CPXA 3IWFA 4ZJZA 1R7JA 4CXFA 1EA3A 2RQQA 3H5NA 4OU0A 3TL4X 2TRTA 3W5HA 3HOSA 1XTAA 4ZDPA 4BL0B 3KYLA 4MEXF 2DT7B 1MNEA 2XF7A 2KRCA 3K70D 2Z33A 4A3LJ 3HB9A 2KZGA 3CUQC 2BGCA 3RZOJ 1SEUA 4U88A 4ASUA 2Y48A 1AIPA 4OAZA 3CCQI 1I6XA 3P27A 1VQ7B 3NQOA 2XGXA 1RPWA 1LFPA 2LH9A 5FFXA 2JMWA 5CVIA 3U9GA 2EV5A 5F64A 2KISA 1O3TA 1WKMA 2UZKA 4A3FJ 3G1LA 3TO9A 3LJYA 1I5ZA 4EATA 2ZL6A 3T9GA 2OCCH 4G12A 2DA6A 3GSIA 3W3CA 2DA5A 5BMZA 5HS9A 1EFRA 1MMSA 3DV8A 1E63A 3S2WA 3F23A 4HZFA 1MZBA 4R1HA 2ZCWA 4MYTA 3CF2A 3OYBA 4CCMA 4MEYF 3CJQB 3A8JA 1UJ8A 2H6BA 2YS9A 2RDPA 4C3IJ 3QFTA 3A2KA 1BI3A 2L02A 1VQ7I 4V2GA 4K1XA 2CW5A 3OV8A 4HWVA 2FXAA 1ZGJA 3EUAA 4X1EA 2W6JA 3I4NJ 1IRFA 2D5VA 2EFQA 1SMTA 3X2QH 3FJOA 1EFCA 3QYFA 3VNVA 2GM4A 3LA3A 4XBFA 2XAQA 4ENNA 1M1KD 3GLXA 4OZYA 4R79A 1QUEA 5ED4A 2K5CA 3ECHA 5E3LA 4X05A 2EINH 1Z7UA 5EGOB 1BX1A 1MMDA 1KRHA 3NB2A 3HBLA 2O1DA 4PSXA 3I64A 2QEXB 4Y9UA 3L09A 3PM1A 4P55A 1QCXA 2DJNA 3J81k 1U5TB 3JRAA 2QM3A 4IRGA 3TP3A 1BC8C 4MQ9F 2K9QA 2VKHA 3Q9SA 2P7CB 4CSWA 3PSFA 3HKZN 1ZAOA 3GUDA 3RDIA 1BIAA 1IHMA 4HIZA 2ELHA 2FSWA 2HZDA 3HGGA 1Y39A 2VT2A 2L54A 2CFOA 3OIOA 1LFUP 2A6EF 5IT9Z 2ELJA 2C2WA 4PCQA 2WB1N 2OA4A 2F5EA 4HG2A 4TN1A 3EYYA 1WJEA 2E71A 2WTEA 3WTVC 3OYFA 2F3LA 3GBGA 4DIQA 1X1PA 1MDMA 3PO2J 2QEXI 2O3FA 2DAOA 1EH6A 3VOEA 2XC7A 4ZYGA 3DPUA 2A68F 1N08A 5E8IA 3MQ0A 1KQ9A 1T6YA 1MJAA 3J7ZI 1WSRA 4OM9A 4KIGA 5GPCA 5A2QZ 2W7ZA 1IZ1A 4XN3A 3V7CA 1VFCA 4L18B 3PUBA 1HKSA 2EA4A 4KDPA 4XN0A 3DPLC 3EQLF 1OFLA 1OYYA 1WGXA 4BDZA 1P92A 4H0EA 2MLGA 4A3MJ 4N9IA 4JP0A 2GQQA 2HOAA 5FKOA 2HTJA 4LBWA 1D0YA 1ZM9A 2DYIA 1PLUA 2F5DA 2XNDA 4HF1A 4RPDA 1BJAA 1YJNB 3QU6A 4DQ2A 3FXRA 3OR2C 3IL2A 3VO1A 3HTSB 2BXYA 2L9SA 4U4BA 3BT9A 4Z06A 1YQAA 3F6VA 1W5CC 3HG9A 1I50J 3SEQA 4I0BA 2JN6A 3OYNA 3ONYA 4IHXA 2R92J 2R4GA 2IXSA 3I9V2 4N4NB 2XNCA 3GFLA 2BY2A 5J8CA 3CCLB 5HDNA 1SFXA 1XCBA 4NNJA 1NHCA 5M5XJ 4AVPA 1U78A 4MTEA 1WJFA 2DA1A 4OJ6A 2RAEA 1SKQA 3H9NA 3JRIA 3CC7B 2O17A 1OGJA 3PSZA 3NAUA 3K4LA 1FSHA 4Z4TA 1WPCA 1WTHD 4FASD 1W2BB 2E34A 4IF4A 1KU2A 2ZJPF 4WXCA 3AFHA 2CUEA 3F3XA 2Z8GA 4KMUX 3MKWB 2MG4A 3D5LA 2DFHA 2VFPA 4PGHA 2OPTA 4FN5A 4I6ZA 1WOSA 3V7RA 4P25A 2ADUA 5JMCB 1ETYA 1YJNI 1ZM4A 3ZQGA 3HEFA 4LLLA 4AWXB 2X0KA 3SYTA 3ABKH 3CJRB 3ASRA 3QSYA 2UVEA 2V4DA 5J1RA 2NVYJ 4ESBA 2JA8J 2XTXA 2R7ZJ 5L3FA 1J9ZA 1ZM2A 3ZMDA 4D7MA 3OYLA 1KU7A 4EM2A 3HPGA 2GXBA 3DWLE 4UUSA 3ASNH 3CCLI 3FKIJ 2UV1A 1JGGA 2Q1ZB 4EM1A 1JJ2B 4OZZA 1HF2A 4A3BJ 2B9SA 1JHFA 5LD2C 2ACJA 2O9LA 1H9GA 2B0RA 2ZZEA 1MJ9A 3ELKA 4M6VA 3CC7I 3J81Z 4B3GA 5CLSA 3NAWA 4RD3A 1UD8A 4IHYA 3MKYB 1FPQA 2KRFA 4B44A 2EIJH 1SVOA 1SD6A 4CCNA 2GREA 2HQRA 1D0ZA 3PIOF 2QMUA 2JQ7A 2VBUA 3K1PA 1BR2A 5THXA 3SLNA 3ZBUA 1BMFA 1HC8A 1O8MA 1O8JA 4ZCLA 2DK5A 5FLXZ 4XRMA 2V9VA 4KITB 3M3YJ 3HOTA 2QSGX 3FX3A 3DBRB 3C2HA 2CW8A 5H6RA 3CMAI 2QKLB 3RCOA 4YFKF 1DUXC 2VFQA 1OFCX 4QSHA 3LFUA 1W34A 2K7LA 4R71A 1KTVA 2XSDC 4XRFA 5F1JA 1IJFA 2XROA 3JQPA 3VB2A 5KHDA 2BX6A 1LJ9A 2CJJA 4I2OA 1K28D 3OOCA 2TDXA 3OIQA 4EGZA 5IP7J 3WE2A 1TWFJ 5IYBJ 2VBYA 3OS0A 4CGZA 4P22A 2A6TA 1UG2A 1P7IA 4QVAA 1S9HA 3I0TA 2P81A 4TV7A 4XKWA 3LOCA 3VSLA 5FA6A 4HX7A 4DNTB 5AONA 3W2FA 3LSGA 4AIKA 2EZIA 2A3SA 4G94A 5LLQA 2HVQA 4PFOA 2CK3A 4PC7A 2MD5A 4HF0A 1X3UA 1FZPB 2B7CA 2EZHA 4BY7J 2NXNB 4G7HF 3GQ7A 2EFNA 1XS9A 1MDMB 3AVXA 5IT3A 2XOKA 1TP4A 2M7BA 4P2NA 3P4GA 2WPDA 2VYQA 2PMZA 2NSPA 1FNBA 3K4JA 1H89C 2V7TA 2DYRH 1MH4A 4B09A 2IS1A 1VHEA 4WZKA 3BH7B 4QPOA 1Z1DA 3ZMSA 4G1BA 5TRDA 1BJKA 3KRGA 1HKTA 4G9YA 1P4XA 2W4SA 3GVAA 3E1SA 4RGSA 3JRHA 4FWTA 4XONA 5M5YJ 1POGA 1YE9A 3ZIAA 1ZUNB 3LSPA 3CO7C 1VQOB 3TDZC 2DFFA 3HM5A 4GCVA 1ZGAA 3OP1A 4RM0A 3ERMA 3ZQHA 2R5ZA 3TP0A 5TGTA 1T5EA 1J9IA 4MFDA 4EJWA 3VYUB 1VLOA 2VJJA 5FNZA 1O8FA 2HPIA 2RV8A 4BE1A 4DK1A 3T5XA 2J5PA 2Y0SN 2XT4A 3ZMUA 3F8CA 4OIQF 3DEWA 4ZCIA 3OSGA 4KIBA 3ZCOA 4NC8A 2BHYA 2LRDA 2WAQN 2JJ2A 1QVGB 2CV2A 3LSMA 3EUHC 4MLOA 3DLLF 1LLZA 2DOFA 1OLTA 4CYDA 3IV5A 4QLCU 3A4CA 3L00A 4S0HB 3T51B 2XGDA 1V0FA 4YFOA 3ZQFA 4G7ZF 5BOXA 2O0WA 2ZMEC 5E1WA 1MW7A 5LEJA 4II2A 3QFCA 1RKWA 4FCYA 4A3EJ 4G6IA 2OD5A 4NBSA 1B23P 2E2HJ 3Q38A 1NBMA 5DS0A 3I53A 3BROA 1IJEA 2ZL7A 1HW1A 1CF7A 2ZMEA 3PL8A 2LR8A 5D8KB 3T56B 3JX8A 1VQOI 1I7PA 1FBSA 2QGUA 3DP7A 2VJ4A 2HOEA 4JRAC 1FNCA 5KAFC 1QX4A 3MEXA 1IDKA 1ORKA 2QY1A 4RD6A 3OJXA 1U9NA 4PFPA 2WADA 3QOPA 2BEOA 3HTUA 1H8EA 2XRLA 2XGEA 5HVQC 1K4SA 4P3YA 5J40A 1R23A 3U6KA 4ESFA 3CJTB 4UVCA 2IA0A 4RGRA 4BACA 1W0UA 3O3KA 3GZ6A 1N07A 1D1BA 4JYKA 1OISA 2PQ8A 1ZELA 4A6EA 4UUSB 1UD5A 1B59A 4IRHA 3SXYA 5DS9A 3M8JA 4GGGA 4P1VA 4Y52J 3I56B 2OK7A 3S2HJ 1QQ1A 1HBXG 3PUMA 3VO2A 3M4OJ 3FF5A 1KZHA 1ZN2A 3LMMA 5DCFA 4YIFA 2KIUA 4Q47A 4F92B 1RIOH 2CBXA 3QFSA 4P6YA 4TMVA 1JKQC 5DSZA 5K7ZA 3LSJA 3KP6A 5KK1A 2HU9A 5CJ9A 2MD0A 4A0YA 2Z9OA 2CNDA 2LFBA 4HBLA 4OINF 3ZQQA 4XLHA 3SZGA 1NTCA 2I5UA 2M4KA 4U7BA 4Q5SF 2UWMA 4O6JA 2W24A 1TYUA 1G7SA 1B8IB 3ZC3A 1T8IA 1ETWA 4WZTA 1FY7A 3W6JB 3AL0C 1E1QA 5KW9A 1NJID 1IW7F 2FE3A 1UD3A 1XDSA 3GXOA 1WH7A 4WX9A 4IZZA 2FVGA 1BJZA 3RJPA 3JRBA 1SVMA 2HTSA 4NUBA 2HQAA 4NC6A 1I1SA 2XPWA 2GPJA 3G71B 2UXNA 3H5RA 4A2UA 1QA1A 3I56I 1BN8A 3EUKL 3FXKA 2GOXB 2NAZA 3ZQ7A 5ICFA 1EWYA 5GAHJ 4G6DA 2P5VA 3FXMA 5D6FA 2BVNA 3WGGA 2W85A 2PECA 1R58A 5M3FJ 2HOSA 3G4SB 1YI2B 2WJVA 3W2EA 1GO2A 1YLOA 3K4KA 5IY5H 3K4CA 4CYCA 4OPWA 3IP4B 1RI7A 3BZ6A 4UB6C 4Y7NJ 3BQZA 3WGHA 1DDNA 1WOOA 2YU9J 3HRSA 1IUFA 2IOUG 4MR0A 4C43A 1WU8A 3D5SC 3S15J 1R00A 4DQLA 2RNGA 5KAIC 3BG6A 4B48A 4AF7A 2QKMB 1KMHA 1Z21A 1E2XA 3RY8A 2EV0A 1K6YA 4D1QA 3O8HA 3PNYA 4BQAA 3G71I 4XLCA 4RB0A 2OU2A 2PLFA 2B7BA 3WTTC 4B8XA 4E7HA 2Y0MA 3K4BA 3AGPA 4AUXA 1ETOA 4UV8A 4A3CJ 2HWVA 2DN0A 4XICA 4TMXA 3BTIA 1KCDA 4AIDA 4Y3OA 3L2QA 2I10A 3MZYA 1MNMC 4L9TA 2NRAC 3G4SI 1JI8A 4HE5A 1BOBA 1YI2I 2H8WA 1PP8F 4X7DA 3H09A 2OQRA 2FMLA 2KJBA 1QUFA 1PUFA 3U6BA 1ETVA 1ZLJA 2ESNA 3DU5A 4XSZF 1H8AC 4U49A 3HRUA 5GP9A 2NVTJ 4ZGNB 2DDAA 2MSYA 2JA6J 5IYNA 3C2BA 4F7DA 3DLAA 4QVJA 2LTPA 2R7DA 3BCAA 2PMHA 4IL6C 3RYRA 1EH8A 4F3QA 1BA5A 1IDZA 2CFXA 1MBJA 2COBA 3MKLA 4A0XA 4A3DJ 4B3FX 2OQGA 1HA8A 3S14J 3R0AA 3H94A 2VLAA 2BM6A 4FK8A 4RPBA 2KT0A 2Z99A 2KMUA 3GTQJ 1XFOA 3ML6A 1MJBA 4CZCA 1YITB 5EEAA 3SDGA 2V9PA 2EIKH 3VYTB 5C4XJ 1FTZA 4M71A 2H8RA 3EYIA 3KEWA 4UB8C 2ICWG 2ODLA 1WI9A 3KP7A 2DTRA 2ECCA 2HQ5A 1IXCA 1XGMA 3K4MA 2P7VB 1BLIA 1MMNA 3G05A 3HHHA 2QX3A 1OMIA 2BVLA 5J4YA 5E6TA 3B02A 3M1CA 1V5VA 3P26A 1TW3A 4E7KA 3CDHA 1N0UA 2XVCA 2OC6A 1O8IA 3K6GA 1EV7A 4WQMA 2JZYA 1Q1VA 1S29A 1EKEA 2FX0A 2K4JA 3EQOA 2W82A 2QVOA 2V7VA 2RC5A 3CP8A 2WYRA 4N3GA 2FX3A 3K9TA 4ZZLA 1BOAA 2JN9A 3CDIA 4M6YA 1Z0XA 3BCDA 3DBLB 3W6VA 4Y4RA 4Y33A 1YO5C 2OAZA 1N75A 1TTTA 2V1NA 4A3JJ 1N06A 4YEIA 1V5GA 2CW7A 4KICA 1YITI 1J7KA 4KISA 1ON1A 4G5GA 4MNUA 1OCZH 2OK8A 1XDUA 2GAUA 5FLMJ 1IJWC 1XSXA 1O8KA 3OL3A 3LFKA 1ZQ3P 4PC2A 4S04A 2BGJA 4XLNF 1XGOA 2F5FA 4ENMA 1WWXA 4KYWA 3M1EA 1E43A 5J4VA 5DTDA 3DF8A 2ZFUA 4AD9A 1Y0UA 2D2WA 1D1NA 3BC8A 3RKYA 4JBAA 1XQBA 3NWTA 4M1KA 3C18A 1IDJA 1HF0A 2X8KA 1HKQA 1GR1A 3AG1H 1KA8A 3A35A 4YIIA 1N77A 1O57A 4XMYA 1GQ8A 2IPQX 3LA2A 2XAJA 5HS7A 1G59A 2XAHA 4PC3A 3KEQA 4CZZA 2BM4A 4XKVA 2JJ1A 4XL9A 1ENHA 3BR0A 1ELOA 2C4TA 4PK4A 2ZZFA 2H6CA 3LQQA 5FJ8J 1YRNA 2XT2A 1ZARA 3FMQA 2IRFG 2DA3A 3CCSB 4OJ5A 2JUGA 2KQRA 2M1BA 3BJOA 3R61A 3SJZA 5DUKA 2BF4A 2XZLA 5H5JA 1ETXA 4DYRA 2PI0A 4IX7A 1D8TA 2JRTA 1DQUA 3VYSB 2OUMA 2YWHA 1OCRH 2X3UA 1UG0A 1XMAA 1YOVB 4I99C 4PC6A 5HXBA 5JLVC 2GLOA 3GZ5A 1GVHA 2E19A 4BHCA 2M2EA 2M4GA 1EFTA 5FO1A 3U1DA 2QSFX 5GAEJ 5TJJA 5HDGA 3KZZA 1W36C 6PAXA 1E0EA 2EK5A 3OOPA 4PGGA 2NVQJ 1UCRA 1S4MA 3FM3A 3PFYA 3P7NA 5H2FC 1UFMA 3ZN1A 3RI4A 3IWZA 2PX9A 2P4WA 3WGIA 1QRBA 3H3VK 4C30A 3CCSI 1PUFB 1QFZA 1BW6A 3SZEA 2EWEA 4YCQA 2VB6A 2LLKA 3BDDA 3FXQA 2JJ7A 1IN7A 2XAUA 3HUGB 5J47A 1T38A 3S1QJ 2FU4A 3AG2H 2R93J 3ES9A 1Z05A 3E3VA 2M0MA 2V9KA 3L2RA 4XLPF 1W4MA 2E1MC 4RAYA 2KDZA 1MMAA 1OYIA 2Z5UA 4P12A 1B1BA 3K2ZA 3HZJA 5F4OA 2DMNA 1FMVA 3ESWB 2X0LA 1EFUA 3TW7A 1YFHA 3ASQA 1OGIA 1L1IA 3OZUA 1HDPA 5HZBA 2FA5A 2XKPA 1I8DA 3BQYA 1PVEA 5JHFA 3BZKA 1KU3A 5FRMA 5A89A 3LYCA 1OJLA 2OBPA 3RKQA 2I1LA 1P6RA 5JI6A 3ZPPA 2FF4A 3FBIB 2INVA 2MH9A 2VNHA 2STTA 5CYVA 4IHTA 2IGKA 3ROUA 4HV6A 4XR6A 3OS2A 2QQAA 3DKYA 5AMVA 4WCGA 5HS8A 5BPDA 3PJRA 1FIAA 1I1GA 5F4MA 3E6DA 3QP6A 1QRCA 1TWCJ 2KLOA 3H9GA 4KA4A 3JQQA 2DXIA 4KT5C 1SVLA 1C0WA 2ZC2A 1GAWA 1O8HA 4MGRA 2NS0A 3LNNA 4A0ZA 3WXMA 2HR3A 2EZLA 3OMYA 1BI2A 1F4KA 4Y9RA 3VNUA 1R5HA 2I8DA 2D3NA 2IS2A 3CUQA 4ENJA 1K4TA 4XOPA 2EIMH 4Z4RA 2GIZA 5FRNA 1S6LA 1V5FA 3FPPA 2KVOA 4RM3A 2VXDA 3N6ZA 4DQKA 4CICA 2BY1A 1RQRA 1QJVA 1LDKB 2HDWA 2RKHA 3GTLJ 4N3NA 1DBOA 3HSFA 3G2BA 4BHBA 3FIWA 1XB2A 3VFZA 4FXUA 5AN9A 3H5AA 5LBQA 5FKNA 5F6FA 4DJAA 2YWGA 4DGWB 3HKZA 3FKJA 4LIVA 3VDXA 3OW2B 1VQ5B 3S32A 1AIRA 1Z6TA 3M7GA 2NTQA 4XRSA 2V4JC 3JAMZ 1CQXA 2KHMA 1VNDA 3IRQA 1YRNB 2RNJA 3A3GA 1Q1HA 5KSWB 2JRMA 4MQVA 4EQQA 2VBVA 3UR3C 1WORA 4BHPA 4CCOA 1OGMX 2WB1A 2FMYA 4HEA2 1Y8RB 2MW8A 4HYEA 3GLLA 2GK6A 3A8IA 4ANJA 2K85A 2KDOA 3GTGJ 1IUYA 2IBDA 4YALA 2M45A 1QGAA 1TVCA 5BQTA 5FO5A 2EJRA 2BXZA 2NS7A 3HRTA 2CRVA 2OYNA 3B78A 1NK3P 5H59A 2VJIA 4HDVA 1BI0A 1PP7U 5A88A 1TZLA 2W48A 2R7XA 2WV0A 3S93A 2BM7A 2DO7A 3SZTA 2QQ8A 4BGDA 3SKBA 1O3QA 1JT6A 2DK8A 4NK6A 3CZ6A 4LLNA 2G9WA 2X1EA 2L9NA 3Q6QA 1VQ5I 3GYHX 2PFBA 1K5CA 2Y30A 1XB4A 3BOQA 1O8LA 2LBFA 3ZZ0A 4FX4A 2STWA 3GTMJ 1RU4A 1TW2A 2FNPA 5ILSA 4M3BA 1TWHJ 5LFAA 4XLEA 3OYGA 1QA6A 4IRIA 2Y9YA 1W87A 3A8KA 2EILH 1GT0C 2Q6OA 1CZFA 2P8TA 1X1BA 2GOMA 3D5RC 1I39A 1W5TA 3LSIA 4Q48A 4BQOA 3MZHA 1A35A 1FLIA 3GMEA 2GWRA 3WQZA 3LSRA 4IOCF 4BEHA 3OYAA 5L3GA 4LGWA 3QE2A 1R1VA 2EFGA 2F5VA 3H0GJ 3K10A 4RAZA 2JVHA 2XHKA 2M87A 2HLDA 2VFMA 1WQ2A 4OPOA 1R5GA 2EQRA 2GIVA 3C1DA 2D45A 2E2IJ 3V8JA 3W2AA 3OJWA 3PA1A 1WXRA 5IOYA 2F2EA 5HDKA 1USSA 2ID3A 4M9XA 3M07A 3KEOA 3G73A 1B9NA 2L3DA 2NOGA 5DUIA 2E2JJ 2CQXA 4DZJA 1I3AA 5GADJ 5EEGA 1LUJB 4UUVA 1OFEA 1S7OA 1XG2A 5IYCJ 2CQNA 1KQSB 3KIOA 3LAPA 3B4NA 4IVNA 4W8TA 4Z05A 2LP0A 3P9KA 4QIWN 2XUBA 3I58A 1KK1A 2ZSHB 1QQIA 3MFKA 1S7EA 2KIQA 1JHHA 1IRGA 2L2OA 3K1NA 2X85A 3QU3A 3OS1A 1D8JA 3FMSA 1VJSA 4BS9A 2O7OA 1XPXA 2P0WA 4BUPA 3V76A 3I1FA 1T98A 3KEYA 5H6QA 1IO2A 2CYYA 4UAJA 3GRHA 2LVSA 1JKRC 1P4MA 5DV5A 5F27A 3ERED 1YS6A 3KFWX 4KN7X 5TY0A 4MYUA 1FT9A 3P9IA 3S3NA 4BXUA 2NTPA 4XK4A 1MSFC 1R71A 3DXJF 1LE8A 2F4NA 3J80Z 1VHOA 1VQPB 2XGJA 1FYMA 3OWTA 3ZP5A 1LQ1A 4EW9A 4RB2C 2ELKA 3MMYB 5LRSA 2EFWA 3ZPLA 2VQCA 4D9JA 3CUQB 1FBQA 5L3CA 5IT9K 1D5VA 2Y75A 3BCBA 4AC0A 1D2EA 3V7AA 2GQFA 1GV2A 1OCOH 3HSRA 1SC7A 4W8RA 5C1CA 3RKWA 3MWMA 1AMOA 2MGQA 1OCTC 5CQEA 3HPHA 2LKSA 1QPIA 2O04A 1DBGA 2V7XA 1CNEA 1OHHA 2BY3A 4FISA 1D1AA 4CO8A 1MBEA 3LNQA 5GV7A 1U9OA 3ASSA 3E5XA 4KH3A 1TYXA 2FUG2 3CMAB 5A2QK 4PGOA 4NC7A 2WSSA 4B4DA 1KYWA 1Q7YD 3C7JA 4W97A 1VQPI 3CDLA 1APLC 2GXAA 2V1DA 2PMUA 2AXLA 5K5RA 3JQRA 4OAYA 1X3WB 1YW8A 2K9MA 4LJZF 2LMDA 2GJPA 4L5IA 2CV0A 3GTJJ 3WHCA 3IH3A 3U2RA 4HE6A 1XC5A 1P4WA 2M5WA 5LGNA 2FQ3A 4UZEA 3I54A 1WJ5A 2C77A 1TNTA 4E7JA 3GQAA 4I84A 1A8PA 4BJ6C 2HZTA 2VQLA 5DD8A 3LQRA 1HSJA 1AOYA 4M3DA 4I76A 4ZZDA 2LKXA 1BN5A 2IAIA 2Z3YA 1GXPA 1WSVA 3GVLA 1DGRM 1EA0A 5J1UA 2K9SA 4PJ0C 3DDYA 2CSOA 3N90A 2CU7A 3BG3A 1UMKA 2DYSH 3RZDJ 2QXZA 3WTSC 4RM2A 3GW2A 2PJPA 2R7SA 5F08A 5JFRA 1RUOA 1GVJA 3WTUC 1RESA 4IW3B 3V7SA 1N05A 2W25A 1TQIA 4AVZA 4W8SA 4MTDA 4RCYA 2X48A 3MVPA 2LF8A 2LBFB 4IHSA 1P9QC 2W7NA 1G3WA 1A04A 2K86A 4EJTA 1X1CA 2V6EA 3ZR8X 1JNYA 2XF6A 5JR3A 4UV9A 1JUPA 2HS5A 2PBIA 2XNJA 3BY1A 4RLFA 1R22A 5TV2A 3W2HA 1ZYRF 4QHYA 2Y0SA 4KIFA 3JW4A 3MN2A 2YX7A 4ON0A 1FOYA 1VI0A 4HNVA 4P9UA 2JSCA 2B7EA 1IAWA 2LY9A 5H20A 1XGNA 2HXOA 2WAQA 3FK7A 4LK1F 4BEHB 2HPMA 1QPMA 4X7CA 5IYRA 5F0CA 2G7UA 2BOLA 3Q39A 2CG4A 2QWWA 3HJEA 1OFDA 3H92A 4JX4A 4U0WA 4E4HA 1A5JA 1KK3A 3ZXSA 3GQBA 1ZM3A 1GLNA 3PNVA 2EB7A 2UUZA 3RPUD 3J81K 2NNNA 2OBTA 2KRHA 2H27A 3V8KA 2YUHA 2P5KA 3FPKA 1OR7C 3L1PA 3KL9A 5AIPA 2JPBA 3I4MJ 3ULQB 1G7RA 2KP6A 1O8DA 1JUSA 2L7MP 1G8XA 4HSRA 3B6AA 2LKPA 1TYVA 3ZQIA 1VQ9B 4DOZA 2NT6A 1CLWA 5FLXK 2CW0F 1UB9A 5CPRB 1L3LA 2HFHA 3DCFA 2VE9A 1R9TJ 4UNOA 1EE6A 3GCMA 5LEKA 2ZO4A 4HPQA 1X0CA 3S16J 4XORA 1MBHA 2MC3A 1RR8C 3GVKA 2XSJC 3S1RJ 3FXUA 1QHHD 5C3EJ 1LE8B 3ML3A 2VBWA 4P1WA 2X6YA 3DPTA 2K3PA 3K7AJ 2QSHX 2O8KA 1SD4A 3D26A 4JMQA 3EUHA 2BHZA 3FBNB 5FKMA 4FETA 1F43A 2YWEA 2Z16A 1WRJA 1WFXA 1TUIA 2RGVA 1IG7A 4QPQA 3SQNA 3L2CA 1YJWB 4C2LA 1PUEE 2XC1A 3HOVJ 4P96A 1XSDA 1DG1G 5DM7F 3CB4A 4QV2A 2IGNA 1JXSA 3LO8A 5JVTA 4AM3A 1HQCA 2XTYA 1XD7A 1VQ9I 2CQ7A 1YJ9B 2DODA 5E1XA 2LSOA 2JA5J 2DMQA 4H4KC 2EA2A 4XKCA 4Y15A 5F04A 3JTHA 3SDBA 5CKTA 4ACAA 4PJJA 3QYBA 3IKTA 2FEZA 2PMZN 2ISZA 2QCOA 3DEEA 3T8RA 2X53S 3PA2A 3M9AA 4RMNA 5DYMA 4C3HJ 2R6HA 4HNTA 3ZPNA 1J59A 3W2GA 2BSAA 2XRNA 3U21A 4G1VA 3OYKA 3C3WA 2VI6A 2WWYA 4W1UA 4IKFA 2BE5F 1WVRA 4Z4VA 1ACIA 2ZNYA 2VIXA 2LDUA 4HQMA 3GTPJ 2M0CA 3AG3H 2R7FA 3ONUA 3OW7A 4HX8A 1W36D 4OP7A 2DPDA 1H8HA 4LB6B 1YJWI 4RA2A 2MBFA 3KZYA 3Q6RA 4RDJA 2J7KA 2VPLA 2MA3A 2WY7Q 2L0KA 2Q8KA 4IPAA 2K9LA 4CDGA 4LBVA 4Z4UA 1FX7A 4K2EA 5D5UB 1YJ9I 3CUOA 3T1BA 2A5YB 1F5TA 3FZVA 3MD2A 4YELA 3BH6B 2KIMA 4PMHA 1PJ6A 1BL0A 4H9GA 1FOWA 3WG9A 4A12A 3CCJB 3QOEA 1MGTA 4WWCA 1X58A 3HC7A 4E70A 3UW0A 3F8MA 1Z91A 1YW7A 1YIOA 3ZQLA 1QNTA 4I7HA 2QZ8A 2CS3A 2JWTA 3KPHA 1NH3A 3Q0UA 2V7FA 2HDDA 3MHPA 2NV4A 1U3EM 3ABLH 2QUFA 2ZZQA 4Z4YA 1VQKB 4PZJA 2DCEA 3SZPA 2OCEA 1BIBA 1Z9CA 2HDCA 2F48A 3S2DJ 1SFOJ 3ISXA 4M3EA 2XAGA 2E60A 4YZXA 4D5FA 1KJZA 3CXCB 3PUNA 2VE8A 1TWGJ 5CVJA 2V1UA 2ZBVA 3WBKA 4F55A 1FTTA 1JT0A 2JA2A 2VQGA 5L3DA 1ZH5A 4U87A 4URRA 4JX6A 2QENA 2OZ6A 1UZCA 2LF7A 2VL8A 3CCJI 2QQBA 4UZUA 4XKBA 1TT0A 4TMTA 1Z77A 2FQ4A 4KT6A 2R3SA 1KONA 1YIJB 1IRZA 2LK2A 2QF7A 2W57A 3SFIA 3FXLA 1ZKGA 4CCLA 3JREA 1Y0RA 2M34A 3F8BA 3VMFA 2FBIA 1QH0A 3I55B 4YFXF 5FB2A 1V54H 3VSKA 4ZYEA 3WE3A 2B63J 3JSPA 1VQKI 4XNFA 3J7AY 4Z4SA 4W8QA 3M8FA 1Q81D 2HVRA 3RTRA 1QG0A 2XZPA 1E17A 2R5ZB 1XN7A 3N97A 3F8FA 3AVYA 3I59A 3VSUA 1EP3B 3GFJA 1LM1A 5CVVA 3KLNA 1WJCA 5M5WJ 3DTKA 1NB9A 1KU9A 4GXOA 3HSEA 1OB2A 2O0VA 4G8XA 4XOTA 3ZQCA 3BTLA 4EVIA 2GBYA 4FHTA 3OAAA 3QPHA 3O8GA 4HOBA 4BY1J 3BJAA 3LQ6A 1TNSA 3T0YA 5B66C 1OB0A 3LQEA 2KZVA 1YIJI 1WI3A 4FTHA 2L4MA 4RDKA 2Y69H 3DKWA 3JU4A 3I55I 5K7FA 3CC2B 1O8GA 4A3IJ 4LBYA 1O4XA 4F93B 1I27A 4HW0A 1UHWA 1CF7B 3V4GA 2ZMEB 2NSTA 2O8XA 1G4DA 1FYLA 1GJRA 1Q9SA 4N9HA 3EETA 2BM0A 2R7QA 3FWEA 4DZPA 2PMDA 3D1NI 3PVDA 1NK2P 1OB5A 4ZV4A 3K69A 2BGIA 3KYDB 2Y31A 1LVAA 4QFMA 1H80A 1QGYA 2H1KA 1ETQA 1VQ8B 2JIZA 1FRQA 3KZIC 2BMWA 4E7LA 4YC5A 1B9MA 3BR3A 3DKXA 3Q0WA 1MD0A 2OBSA 1RWRA 4GRIA 4N4OB 3AK5A 3W2IA 2EWNA 2Q6KA 2K9NA 2V7WA 3ZOBA 1ODDA 1JJ8C 3OZWA 2ZZGA 3LVBA 2BV6A 5EZGA 1YX5A 1BQEA 1QZZA 1F9NA 2BVMA 2R7RA 3QAHA 3QPTA 5E20A 2DIEA 1AKHA 5E3OA 3RPUA 1E79A 1GUUA 1PJ7A 2V31A 3NRVA 3KP3A 2P6SA 4CUGA 2VT3A 3Q5FA 5IYDJ 1T0FC 3CC2I 1UAAA 2C6YA 1BX0A 2ZJRF 4P6VF 5B1BH 1OYWA 2ZL5A 1DPRA 4BXXJ 2R5YA 5F4JA 1R4MB 3HYIA 1FYKA 4AF6A 2UVFA 2CUFA 2P6TA 4RDLA 3WYAA 2LG4A 2E35A 4D5CA 3QRFF 3G1MA 4AU7A 5A8AA 2EFPA 2WJYA 2M3AA 2QE7A 1V5EA 3PFIA 1DP3A 1VQ8I 1WSUA 2HEOA 1D3YA 4KJZA 4Z2YA 5KVRA 1G2HA 2GXGA 1X1AA 1U0JA 2XIGA 2ZXIA 2IS4A 1CNFA 1NDHA 3PSSA 1OCPA 3CJNA 3SQVA 1EP1B 1ZTRA 3A1PA 1N8RD 1WCMJ 5IK2A 4YZQA 3E1YE 3GVJA 2JT1A 4DW6A 1WHUA 2IA2A 2DETA 3GFIA 1GV5A 2NVXJ 3QFRA 1B2RA 4PC1A 4M4SA 2PG4A 2CQQA 4I01A 4B47A 4B43A 1JTAA 5E3NA 1HOMA 1K83J 2VBZA 1WP6A 5J8FA 5EDNA 1BHEA 1MMGA 2VC1A 4M6XA 3HOUJ 5E1ZB 1AWCA 3CMMA 3J7YJ 1O3SA 1M1EB 2DOGA 3OY9A 1QA2A 5DM6F 2CF4A 2MLKA 3VWBA 3E6CC 4HF2A 2M7AA 4QUZA 1T2KA 1RQPA 1TTYA 3HL2A 2PN6A 4CYCB 3CF5F 5BSYA 1QVFB 1JKOC 2X6XA 4UUTA 1QO0D 5EJCA 1IGNA 1JJ6C 4NHJA 5B6IA 3RQIA 1PYVA 1K79A 2A05A 2N8GA 3O2PE 3Q0VA 4EJUA 1RMGA 2Z2SB 4IEJA 4U0VA 1FJLA 4OJOA 4Z4ZA 4RB1A 4II3A 3KYCB 4X07A 3T53B 2F4IA 3LSTA 3CCYA 2PE3A 4HV5A 4YHBA 2NT9A 4A5NA 2W00A 3FXJA 5J6XA 1EXMA 2FOWA 4HQEA 2KIFA 4RD1A 3FXOA 4EV0A 4P3IA 5LHHA 1NG6A 1FMWA 1ZRDA 1J2XA 2E7XA 2IGMA 3ISPA 2NS8A 4IJAA 2MH2A 3AVWA 4BJTA 2QLZA 4YAWA 1JTYA 1HW5A 1UELB 3I59B 1MBGA 3DFGA 4OWRB 1FX0A 1DARA 2ZNZA 2A6HF 1U5TC 1IN4A 3R60A 2HYGD 4ABZA 4ZYDA 2CUJA 2RC6A 4PAAA 1D8KA 1DGWY 1N0VC 5EF6A 3BP8A 2LY1A 1RUNA 1D1CA 3SEZA 3PQKA 2VBSA 3IHUA 4GO1A 1CQTA 2HYJA 1HXDA 4OOXA 3MCZA 4Z6YA 1F20A 3CESA 4RD2A 4Y7CA 2VC0A 3K4NA 4HNUA 5F0HA 4MFEA 2DMPA 2X9DA 3OR1C 2PJRA 3ZZTA 3UNGC 2VUMJ 2HNHA 4YDTA 3OIPA 1T6XA 4JOMA 1SD7A 4KKUA 1LEBA 3BG7A 3RKXA 4FQGA 1IV6A 2NNYA 2DMUA 1RR7A 1PJ5A 5B5EC 2QDXA 3BC9A 4Z03A 2RREA 2LYCA 3LSHA 2ISYA 2DT5A 2CQKA 1R36A 1SKYB 1G3TA 1FIPA 1J75A 5GV8A 4CCKA 3IH4A 2HKXA 4GYIA 2IQ7A 4F7ZA 2RQPA 3JTGA 3LWFA 3LSKA 1R4NB 2L01A 1Y6IA 4M72A 2LREA 3JRFA 2F4OB 2DW4A 1TLLA 4FE7A 2PIAA 2UXXA 2QA4B 1QGZA 3QWLA 3GEZA 2GJKA 1HVXA 1AKHB 5J35A 2D1VA 1MBKA 2B0LA 5JBQA 3TOBA 5IP9J 3W5VA 3GFMA 4E7IA 3JRDA 2CV1A 1G7CA 1NB0A 4RAFA 3VSVA 3CC4B 3EQNA 1COWA 1FNMA 2F5CA 3JR9A 1JE8A 3MKZA 2RN7A 3WU2C 1K73D 2R5YB 4MIMA 1D0XA 1ZG5A 3PNTA 4XIDA 1S3JA 1LFBA 3IAS2 4GYGA 1IN8A 1JGSA 2FRHA 2K02A 4WF2A 4Y17A 4BJ5C 1BBYA 3CCEB 2PYHA 3PO3J 3CRZA 4P26A 2VASA 2JA7J 2X1DA 1H9TA 1GDTA 1HW2A 2VBTA 5F1RA 5HKKA 3ZUGA 5HZAA 4G7WA 3CCMB 3ZSCA 4HAMA 2M8GX 2NYXA 3F9KA 4BE0A 1AA7A 1A6QA 2WAEA 3B8YA 1SMYF 2E1NA 3RQ4A 3HDDA 4YZAA 4LG3A 2XB0X 4B4CA 1TL8A 4WZEA 3WTYC 4QWQA 2QA4I 4TSFA 2ETHA 2VPRA 2IW5A 4ZGQB 4ZC3A 3VEPA 1ZREA 1VQLB 2EIXA 3OYHA 2HMAA 1SFKA 1U8RA 1WDTA 3W6KB 2M8EA 1H88C 4HA8A 3CC4I 4P9FA 5D5VB 2OF7A 2IA1A 2A5WA 1W1WE 3JRCA 2RVCA 3E7LA 4I09A 1KGSA 1S5LC 1A31A 2J5OA 3CCEI 3BG9A 1JRGA 1VTNC 5EMNA 1IV8A 3REOA 2Y9ZA 1Z6RA 1ZG3A 1QVTA 2K27A 5DEQA 4X0GA 3CCMI 4AYBN 2F4MB 1VQNB 1W0KA 4KFCA 3B6CA 1G7TA 1T33A 1IC8A 3CP2A 2ZJ2A 4L8JA 2HVSA 2VODA 5KNLA 3HOXJ 2PYGA 1U8BA 3GTOJ 1PXZA 2DBBA 1R49A 4RDUA 1QFJA 1VQLI 3WU0A 3GF2A 1V0EA 3TW6A 2FOKA 2GJRA 2CMPA 2C78A 2FJ1A 5FD6A 2WZPP 1UD2A 1K8AD 1LKXA 2ME0A 4EJVA 1W7PD 1Y0NA 1OKRA 4TMWA 1BM9A 3K2AA 2PLYA 2EPFA 2DLLA 4BAYA 2JVGA 2Z1DA 1X4PA 2CC2A 1MRZA 3U1KA 2R7UA 1B72A 5HNFA 4YAUA 1REPC 1HZEA 2V7UA 3DBHB 3BJ6A 4A6DA 2BYVE 5JVGF 4S05A 1X4OA 4OOSA 1VBLA 1SAUA 3OOUA 2IP2A 4L0YB 1VQNI 3WY9A 1Y1VJ 4BYYA 1FBUA 2ZITA 3KETA 3I71A 4OOIA 1NHAA 3H1CA 2E1MB 1MH3A 3HRMA 3FISA 2X6OA 3A3BA 5LGUA 3I5UA 2PJRB 4J19A 2R7OA 3JRGA 3JAMK 2LY2A 1O3RA 5IYQA 3BWGA 1ZK8A 2FBKA 2X6WA 3SJPA 2RC4A 4LG0A 2W84A 1MKMA 1CGPA 5B3SH 3WHBA 5HLHA 2YX4A 1HDDC 1S8NA 2Z6BD 3IH2A 4C9YA 3VPRA 3TH0A 1OPCA 1BPLA 4ZH4F 5D4RA 2VOPA 1KTWA 3IRRA 1E3OC 3S3MA 4KKSA 2L4AA 2HI3A 2MABA 3LA7A 1SFEA 1KQ5A 2NVUB 2K4BA 2QTZA 1XX5A 3PENA 2CWEA 3WTZA 3CMEB 3QPLA 5FKKA 1H85A 2H94A 3CLQA 4RBOA 4LBZA 3CD6B 2XPVA 2DEUA 5K5QA 1O7FA 1X1DA 4ZDOA 2VBEA 2DJIA 3FY3A 2DA2A 1HG8A 1KCCA 2NPFA 3W2VA 1NG7A 3BG5A 1OQYA 1E3HA
chains in the Genus database with same CATH topology
4ITVA 1WFXA 2O5RA 4NK8A 2E5NA 3K4MA 4QPQA 2F6CA 2X1CA 1BLIA 1J09A 4HSTA 1MMNA 1E3XA 3G05A 3GQ9A 4C2LA 2XDVA 2QX3A 2IGNA 2BVLA 3M1CA 4E7KA 2OV7A 2OC6A 2ZXHA 3S3OA 4IQJA 4E7SA 4AYBA 4H4KC 3K6GA 1O8IA 4XKCA 3EQOA 3SDBA 4ZJZA 5CKTA 1EA3A 2RQQA 2W82A 3H5NA 3QYBA 3CP8A 3FDYA 4PJJA 5CQGA 3TL4X 5HOOA 3HOSA 4OJPA 3DEEA 2X53S 4YEJA 4RMNA 4TKOB 4ZDPA 4BL0B 4HNTA 3KYLA 3L2UA 3BCDA 4Y4RA 2DT7B 4Y33A 3ZPNA 1N75A 2V1NA 3U21A 1MNEA 2XF7A 1V5GA 2KRCA 2CW7A 3OYKA 3K70D 4KISA 4IKFA 4ASUA 5KCMA 3OPOA 4OAZA 1O8KA 3A1YA 2VIXA 3OL3A 2ZTNA 2WY8Q 3FKSA 3OW7A 1W36D 1Z3YA 2IGOA 1LFPA 2LH9A 4E7ZA 1H8HA 4ZDLA 1E43A 2KPMA 4PJLA 2VPLA 2WY7Q 2ZFUA 2K9LA 3BC8A 1ERDA 4EATA 4E0FA 3NWTA 3T9GA 4PUSA 4DBQA 4YELA 3MD2A 3W3CA 1IDJA 1EFRA 4PMHA 2X8KA 4PJMA 4PSWA 3A35A 3QOEA 1N77A 3HC7A 4XMYA 2AQFA 1GQ8A 3UW0A 3CF2A 3OYBA 4CCMA 3CJQB 1G59A 2CS3A 4XKVA 2V7FA 2JJ1A 4XL9A 3A2KA 4PK4A 2ZZFA 4HWVA 3EUAA 2ZZQA 3L2VA 2W6JA 2V7QA 4XM3A 2DCEA 4OJ5A 2DT6A 1Y56A 2JUGA 2KQRA 2WPDA 1MABA 2GK7A 2XZLA 3QYFA 4YZXA 2E60A 4IX7A 4TT3A 4OZYA 1DQUA 4R79A 3VYSB 2K5CA 2OUMA 1MNDA 4PJNA 1UG0A 4F55A 1MMDA 3AKZA 3K70C 3NE5B 2O1DA 2JA2A 4JQFA 4PSXA 4BE2A 2VQGA 3IAM2 3OE7A 3JURA 4U87A 4G7XA 1QCXA 2M4GA 4URRA 4YRVA 2VL8A 4UZUA 4XKBA 1TT0A 2L7KA 3SUCA 1W36C 1E0EA 3TBIA 4KT6A 2VKHA 1KONA 3OEHA 4CA0A 3C2GA 4KKTA 4YXWA 4CSWA 3PFYA 1X19A 3PSFA 4CCLA 5HNHA 4OJLA 4HIZA 4B3XA 2VJ5A 2HZDA 3VSKA 1VF7A 4W8QA 4XNFA 3J7AY 4C30A 1I18A 2NZMA 2F43A 2CFOA 4HRIA 2HVRA 3RTRA 2EWEA 3QODA 2XZPA 2VB6A 2ELJA 3GQ7A 2XAUA 3HUGB 4HG2A 1T95A 2M0MA 3VSUA 2V9KA 3L2RA 1WJEA 2R7VA 2E1MC 2ZTGA 3OYFA 3GBGA 1WJCA 4DIQA 1MMAA 3DTKA 3H9QA 4XLAA 2O0VA 4XOTA 2CUZA 2XC7A 1FMVA 3OAAA 3DPUA 2F1MA 1OB0A 1I8DA 2KZVA 5JHFA 4XN3A 5FRMA 3W2WA 3PUBA 4XN0A 1NRKA 3ZPPA 1BR4A 3DPLC 3FBIB 2INVA 3JU4A 1OFLA 1O8GA 3E0JB 4BDZA 2IGKA 4F93B 4XR6A 3TMOA 2NSTA 2Q2EB 2IS6A 2XZOA 3OS2A 3BH4A 3DKYA 5AMVA 3OL4A 4DNRB 2R7QA 2VXZA 3DTIA 2V26A 3FHNA 3PJRA 1D0YA 3VR6A 1PLUA 2ZSIB 2XNDA 1H80A 3OR2C 2JIZA 4CH7A 2L9SA 4U4BA 4Z06A 4E7LA 4BDYA 2KLOA 3DKXA 3H9GA 3HG9A 3SEQA 3OYNA 4GRIA 4N4OB 2MFZA 2DXIA 1N78A 1RWRA 2R4GA 2IXSA 3I9V2 4N4NB 1O8HA 1UD6A 1VLYA 1PJRA 2ZZGA 3LNNA 1YX5A 5FROA 4NNJA 2BVMA 2R7RA 2DIEA 1NHCA 5HLTA 1WJFA 1E79A 3H9JA 2V31A 4OJ6A 3OMYA 1IRXA 4DK0A 5DN6A 4CUGA 3WWGA 2O17A 2I8DA 1T0FC 2D3NA 3K4LA 1UAAA 4GQNA 4J00A 3S8PA 2IS2A 2R7TA 4FASD 1WTHD 1WPCA 2DOAA 4ZTFA 3AFHA 2Z8GA 2UVFA 4XOPA 3MKWB 3D5LA 2WBMA 2LG4A 5FRNA 1V5FA 1WJBA 4AU7A 2WJYA 2M3AA 2QE7A 3FPPA 1V5EA 4LIUA 2KVOA 4RM3A 2VXDA 1DP3A 3HAGA 1W0JA 1E3ZA 4KJZA 1QJVA 1LDKB 1X1AA 1U0JA 2ZXIA 3CJRB 3SYTA 2HDWA 2IS4A 2UVEA 2V4DA 4CCJA 1DBOA 3G2BA 3OYLA 4YZQA 5IK2A 4FXUA 3HPGA 3GVJA 1AIRA 3DWLE 3H5AA 2UV1A 2Q1ZB 4DJAA 4OZZA 1JTAA 3IUOA 3HKZA 3FKJA 4LIVA 3VDXA 4B47A 4B43A 3S32A 4DGWB 4P5OA 5LD2C 2NTQA 1WP6A 2V4JC 3DU6A 1BHEA 2ZZEA 1MMGA 4B3GA 2KHMA 3A3GA 3CMMA 4E6KG 3QYEA 1UD8A 2WAFA 3UR3C 3OY9A 3MKYB 4B44A 4CCOA 1OGOX 3VWBA 2MC4A 4CCNA 1OGMX 2WB1A 4HEA2 2M7AA 1D0ZA 3HL2A 1UD4A 2GK6A 4ANJA 1BR2A 2KDOA 2X6XA 1BMFA 1O8MA 1O8JA 3OYCA 1PYVA 4NQWB 4KITB 3OFNA 1RMGA 3HOTA 2VJIA 2Z2SB 4OJOA 2VKDA 1TZLA 3C2HA 2R7XA 2CW8A 3S93A 2QKLB 4II3A 1QHGA 3RCOA 3T53B 2F4IA 4BGDA 4ZTJA 3LFUA 2VBMA 3CZ6A 4F52A 2NT9A 2X1EA 2W00A 5KHDA 1IA5A 2L9NA 2LOOA 1K28D 3OOCA 2BW3A 1NG6A 3OIQA 1K5CA 1FMWA 2KL4A 4G6TB 1O8LA 1IB4A 2IGMA 2LBFA 3OS0A 4P22A 2A6TA 3OYIA 1RU4A 3OYEA 1S9HA 4XKWA 4BJTA 3VSLA 4DNTB 4BQNA 1UELB 3LSGA 2CK3A 5LFAA 4OWRB 2HVQA 4PFOA 4XLEA 3OYGA 1FX0A 1KZLA 3DQVC 1CZFA 1X1BA 3D5RC 2GOMA 2CUJA 3LSIA 4BQOA 1DGWY 1QU3A 4Z1MA 2XOKA 3WQZA 2LY1A 1O8EA 1D1CA 2M7BA 3SEZA 4BEHA 3OYAA 2PMZA 4F91B 2NSPA 2F5VA 3B90A 3K10A 3K4JA 2JVHA 3CESA 4XQFA 2IS1A 2HLDA 3K4NA 4HNUA 4QPOA 1E1RA 3W2AA 3GQ8A 3OYJA 3OR1C 3KRGA 2PJRA 3UNGC 2W4SA 2JSPA 2HNHA 3E1SA 3OIPA 2L5QA 4JOMA 3OYDA 4KKUA 4XONA 4C2TA 3BG7A 3ZIAA 1YE9A 1XG2A 1YX3A 3OYMA 2X51A 3B4NA 4W8TA 4XD7A 4Z05A 3BC9A 4Z03A 2RREA 2LYCA 3LSHA 3L2WA 3OEEA 2ZSHB 5TGTA 1T5EA 3I3LA 3H35A 1SKYB 3VYUB 2VJJA 2L2OA 3OS1A 2HPIA 2X85A 4CCKA 1O8FA 2IQ7A 1VJSA 4BE1A 4DK1A 4BS9A 2P0WA 4RLQA 4BUPA 1PE9A 3LSKA 3KEYA 1Y6IA 3GRHA 2LREA 3ZCOA 4NC8A 2LRDA 4ZYAA 4IQ4A 2JDIA 2JJ2A 5CDFA 2CV2A 3LSMA 3EUHC 4MLOA 1OLTA 3A4CA 3T51B 3S3NA 2GJKA 1V0FA 1HVXA 2NTPA 2O0WA 4G6IA 1MW7A 1Z7LA 4II2A 3NWSA 2XGJA 4E7IA 2CV1A 1NBMA 3VSVA 2VQHA 3OWTA 4EW9A 3EQNA 1COWA 2R9VA 3MMYB 3PL8A 3MKZA 3T56B 2VQCA 3V42A 4D9JA 1D0XA 3PNTA 3BCBA 2VJ4A 3IAS2 3BLYA 4BJ5C 1IDKA 4W8RA 2PYHA 2QY1A 5C1CA 4PFPA 2VASA 2X1DA 2WADA 5CQEA 3LMWA 3HPHA 5HKKA 1Z3XA 1H8EA 4G7WA 2O04A 1LVKA 4DBRA 5HVQC 1DBGA 4NK6A 1OHHA 3ZSCA 3F9KA 3VMWA 4BE0A 1D1AA 1AA7A 2WAEA 3B8YA 2LC2A 3RQ4A 4BACA 4YZAA 1D1BA 2INUA 4LG3A 1ZELA 1UD5A 2FUG2 2E5ZA 4TSFA 3M8JA 3RSNA 2M5SA 4NC7A 4ZC3A 3AL0B 2WSSA 3OYHA 1SFKA 3LMMA 4F92B 1W9XA 1WJDA 2X3HA 4OAYA 2HU9A 2NTBA 2MD0A 2A5WA 2K9MA 3ZQQA 2GJPA 4XLHA 2CV0A 2CH0A 4LITA 3SZGA 2M4KA 4U7BA 2UWMA 5FL7A 2W1OA 1JRGA 3VYRB 1WJ5A 4E7JA 3GQAA 4I84A 4BJ6C 2NOJB 2VQLA 3AL0C 1E1QA 4X0GA 4YZ0A 1UD3A 3BCFA 3GVLA 4IZZA 1DGRM 1W0KA 1WMRA 1VZ0A 3DDYA 3CP2A 4NUBA 2HQAA 3N05A 4L8JA 2HVSA 3H5RA 3PSIA 5KNLA 2PYGA 1PXZA 2QXZA 1BN8A 3EUKL 3VMVA 4RM2A 2R7SA 2GOXB 2XF5A 1V0EA 1R6RA 2MYSA 1WJAA 2GJRA 2CMPA 2BW3B 2WZPP 2PECA 4AVZA 4BQQA 1UD2A 4W8SA 2D3LA 1LKXA 2LBFB 4C2UA 1P9QC 2W7NA 3HXLA 1X1CA 2V6EA 3ZR8X 2WJVA 2XF6A 3K4KA 3EPZA 3K4CA 2BSPA 2LZJA 2JVGA 3IP4B 2Z1DA 1X4PA 4RLFA 4BXFA 4J01A 2E1BA 2R7UA 4MR0A 5HNFA 2Y0SA 3D5SC 1HZEA 2RNGA 3BG6A 1X4OA 4B48A 2WAQA 1VBLA 1SAUA 3OOUA 2QKMB 1KMHA 1Z21A 4BEHB 2HPMA 1K6YA 4D1QA 3PNYA 4XLCA 2E1MB 2AQEA 2BOLA 4E4HA 4E7HA 3K4BA 3A3BA 3ZXSA 3GQBA 1GLNA 3PNVA 2PJRB 2R7OA 2UUZA 1BR1A 2LY2A 3RPUD 4MXNA 2W6IA 3H0DA 1KCDA 4Y3OA 2X6WA 3L2QA 2KRHA 2WA0A 1OR7C 1JI8A 1BOBA 3ONQA 1OOCA 2Z6BD 2KP6A 1O8DA 3DU5A 4U49A 4C9YA 3KX2A 2VBKA 1G8XA 4HSRA 1O88A 1BPLA 4DOZA 1KTWA 3S3MA 2NT6A 4KKSA 1PKVA 3VSTA 3DLAA 5CPRB 2MABA 3BCAA 3LL7A 3ZGKA 4F3QA 3DTEA 4XLFA 1EE6A 4B3FX 1X0CA 4HPQA 1HA8A 4BU2A 4XORA 3H94A 2VLAA 3GVKA 2XSJC 3ZRGA 2KMUA 1QHHD 1X1DA 4CZCA 4ZDOA 2DJIA 2R7WA 2VBEA 4P1WA 3FY3A 2X6YA 3DPTA 2K3PA 3VYTB 1HG8A 1OFMA 5C1EA 1KCCA 4JMQA 3KEWA 3W2VA 2ODLA 3FBNB 1NG7A 4FETA 2Z16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJI A;  3GQ7 A;  4OJO A;  4NK8 A;  3VSU A;  3GQ9 A;  4C2L A;  2QX3 A;  2VBM A;  2X3H A;  2NTB A;  2NT9 A;  4XLA A;  2O0V A;  4XOT A;  4XLH A;  1IA5 A;  1O8I A;  3EQO A;  1K5C A;  1O8L A;  1IB4 A;  1JRG A;  4OJP A;  4XN3 A;  3GQA A;  1RU4 A;  4YEJ A;  4I84 A;  4XN0 A;  3ZPP A;  4XKW A;  4YZ0 A;  2INV A;  1OFL A;  1O8G A;  1WMR A;  4XLE A;  4XR6 A;  2NST A;  1CZF A;  5AMV A;  1O8K A;  2PYG A;  1PXZ A;  2QXZ A;  1BN8 A;  3VMV A;  1O8E A;  1PLU A;  1H80 A;  2NSP A;  3B90 A;  2PEC A;  4AVZ A;  4U4B A;  4W8S A;  4Z06 A;  4XQF A;  1RWR A;  3GQ8 A;  3KRG A;  3T9G A;  1O8H A;  2BSP A;  4YEL A;  4XON A;  1IDJ A;  4PMH A;  1XG2 A;  4MR0 A;  1NHC A;  3B4N A;  4OJ6 A;  4W8T A;  4Z05 A;  4Z03 A;  4XMY A;  1GQ8 A;  3UW0 A;  1VBL A;  3WWG A;  2O17 A;  2VJJ A;  1O8F A;  2X85 A;  2IQ7 A;  4XKV A;  2Z8G A;  4XL9 A;  4XLC A;  2UVF A;  1PE9 A;  4XOP A;  4HWV A;  3GRH A;  4XM3 A;  4OJ5 A;  4MXN A;  1KCD A;  2X6W A;  1QJV A;  2UVE A;  4YZX A;  1DBO A;  2NTP A;  4OZY A;  2O0W A;  4YZQ A;  1OOC A;  1O8D A;  4U49 A;  3VSV A;  2VBK A;  2O1D A;  4EW9 A;  3EQN A;  1O88 A;  4OZZ A;  1JTA A;  1AIR A;  1KTW A;  2NT6 A;  3JUR A;  4URR A;  1QCX A;  2NTQ A;  3VST A;  1BHE A;  3SUC A;  1EE6 A;  4XLF A;  1IDK A;  4W8R A;  5C1C A;  2PYH A;  1X0C A;  2QY1 A;  4XOR A;  3LMW A;  1OGO X;  1OGM X;  2O04 A;  4NK6 A;  1DBG A;  3ZSC A;  4OJL A;  3VMW A;  4W8Q A;  4XNF A;  2VBE A;  3B8Y A;  3FY3 A;  2X6X A;  2NZM A;  2X6Y A;  5C1E A;  1HG8 A;  1O8M A;  1OFM A;  4YZA A;  1O8J A;  2INU A;  1KCC A;  2EWE A;  2ODL A;  1RMG A; 
#chains in the Genus database with same CATH topology
 4GDF A;  4ITV A;  4YAO A;  4NK8 A;  1E62 A;  2E5N A;  3COA C;  3WND A;  2F6C A;  2Q2E A;  3DEU A;  1DPU A;  1DAB A;  2XDV A;  1WOP A;  1RC9 A;  4OPS A;  1YHQ B;  2HGC A;  2EZK A;  3CO6 C;  5FD5 A;  2QTL A;  3S3O A;  4IQJ A;  4L9N A;  4E7S A;  4A93 J;  2R0Q C;  3TGN A;  1FOK A;  1P4A A;  1S0U A;  4I0A A;  3WG7 H;  3H36 A;  3FDY A;  5CQG A;  4YG2 F;  3GTK J;  5HOO A;  1BI1 A;  3CME I;  3A03 A;  1L0O C;  4OJP A;  1ULY A;  4YEJ A;  1QFY A;  4TKO B;  3L2U A;  1EF4 A;  3CD6 I;  5B1A H;  4ASN A;  2XAF A;  2QYO A;  1FC3 A;  4CHU A;  3ZZU A;  1YYV A;  1LDJ A;  1I3Q J;  2GA2 A;  3A0H C;  3RIQ A;  5KCM A;  3CMY A;  3OPO A;  3A1Y A;  3CLO A;  2VNK A;  5DNS A;  1TWA J;  4HX4 A;  2WY8 Q;  1U6G A;  3WTW C;  2ZTN A;  3FKS A;  4U9U A;  1GXQ A;  1B6A A;  2OBR A;  1HST A;  1Z3Y A;  2IGO A;  4E7Z A;  2WR8 A;  4IOA F;  4M9Z A;  4LLG F;  4ZDL A;  2KPM A;  4PJL A;  3SJM A;  2DCU A;  1YHQ I;  4X7F A;  2JPC A;  1ERD A;  4BBR J;  3KP5 A;  1JUM A;  3PQJ A;  4IXA A;  2E1C A;  5K1Y A;  4E0F A;  2D1H A;  3PET A;  4PUS A;  1VF9 A;  3V8L A;  4DBQ A;  2ME6 A;  2C4U A;  1P2F A;  2F1L A;  1HA3 A;  4FX0 A;  1Q82 D;  3E20 A;  1RET A;  4PJM A;  1KQ0 A;  4PSW A;  3AGQ A;  3SYJ A;  4BBS J;  3BR5 A;  2AQF A;  4NCN A;  2DMT A;  2L9V A;  2Q6I A;  2FNA A;  3J80 K;  1LNW A;  5LMZ A;  2VOO A;  1EP2 B;  4ETS A;  1K6O A;  4OMZ A;  3AST A;  1O7L A;  3R4K A;  1IN6 A;  1W0T A;  2AHO A;  1ETK A;  3BQJ A;  4RD4 A;  3L2V A;  4RCZ A;  2V7Q A;  4XM3 A;  1U2R A;  2DT6 A;  1Y56 A;  4FT8 A;  1WH5 A;  2FD5 A;  4AIJ A;  1B8I A;  1MAB A;  2GK7 A;  2P3M A;  2ID6 A;  3O6B B;  5LHI A;  4U7D A;  4L0Z B;  3D0S A;  1SD5 A;  3FHZ A;  2X4H A;  1B72 B;  4TT3 A;  4L5J A;  1DU6 A;  1UST A;  1KK0 A;  4M73 A;  2VNJ A;  4ZCM A;  1MND A;  1QZE A;  1SM4 A;  4PJN A;  1PDN C;  1YG2 A;  1ZHF A;  5LGT A;  3AKZ A;  4UHT A;  1V55 H;  3K70 C;  3NE5 B;  4NQW A;  1YW9 A;  4JQF A;  4BE2 A;  4EGY A;  3IAM 2;  3OE7 A;  2O0Y A;  3HOY J;  3JUR A;  4G7X A;  1FSE A;  1Q86 D;  4YRV A;  2ZXJ A;  2AHQ A;  3QQA A;  3TDU C;  4R8H A;  2DTZ A;  2L7K A;  3SUC A;  1JB9 A;  5D5X B;  3TBI A;  1QBJ A;  5E18 F;  2C5B A;  3OEH A;  3CTA A;  4CA0 A;  3C2G A;  4Q4Z F;  4KKT A;  4YXW A;  3FM5 A;  1X19 A;  1X2M A;  5GTI C;  4DNC A;  5HNH A;  4OJL A;  4B3X A;  3ABM H;  2VJ5 A;  2E36 A;  4EEF G;  1EJ9 A;  4LG0 B;  1VF7 A;  1RRJ A;  1I18 A;  2NZM A;  5BS6 A;  1K78 A;  2F43 A;  3RYP A;  4HRI A;  3CCR B;  2JTV A;  2QBY A;  3QOD A;  5EEH A;  4UXN A;  2VFN A;  2IEK A;  1HLV A;  1J0R A;  1OR7 A;  1T95 A;  3SY2 A;  3UKG A;  4FE4 A;  4I98 B;  2R7V A;  2VZL A;  2ZTG A;  4NB5 A;  5BSX A;  3AVU A;  3H9Q A;  4XLA A;  4D0P A;  2O03 A;  3Q9V A;  3GZN B;  1P7J A;  2CUZ A;  1X3Z B;  5DCM A;  3JSO A;  1JA0 A;  5D6E A;  3K0L A;  1R1T A;  5FLV A;  3G6E B;  3AVT A;  5JLX A;  4O3M A;  2F1M A;  5EZH A;  1V4R A;  4KN4 X;  5CVR A;  2JUC A;  1QZY A;  2WZN A;  2VKV A;  2HYF A;  1ONV A;  2XB5 A;  2A07 F;  3W2W A;  1X2N A;  3IC7 A;  1K4Z A;  1E64 A;  3ECO A;  1NRK A;  1BR4 A;  4UY8 I;  2DDB A;  1W7P A;  2DI3 A;  1JTX A;  3TOA A;  3E0J B;  1R5I D;  2DQR A;  1T6Z A;  1IN5 A;  3TMO A;  4B1R A;  4DYC A;  5E3M A;  4UZF A;  2Q2E B;  5DDG A;  2IS6 A;  2XZO A;  4IHW A;  1G3Y A;  3CCR I;  3OL4 A;  3A0B C;  1OCC H;  2LD5 A;  3BH4 A;  4DNR B;  2VXZ A;  3DTI A;  2V26 A;  3G1O A;  3ZMT A;  3FHN A;  1TSP A;  2KKO A;  4MHG A;  5D5W B;  3VR6 A;  2O6G E;  4C0S A;  2ZSI B;  3M8E A;  4HDU A;  1FNN A;  1BW5 A;  1JKP C;  4LC0 A;  4CH7 A;  2P5L C;  1G3S A;  3BTC A;  3HGY A;  5J3L A;  4D7N A;  5D8L B;  3Q3S A;  2YSR A;  4BDY A;  1DDG A;  4RGU A;  3R6J A;  2MFZ A;  5F0F A;  1N78 A;  2ECB A;  2ZJQ F;  3MCA A;  2QQ9 A;  3G6E I;  2PEX A;  1LPQ A;  5HOD A;  1UD6 A;  1PJR A;  1VLY A;  1K9M D;  5C4J J;  2K3F A;  5FRO A;  5EG0 A;  3SEJ A;  1RZ4 A;  4M0L A;  2VON A;  2XKO A;  5TIS C;  5FGM A;  5HLT A;  3HOZ J;  4EMS A;  3H9J A;  1VQ6 B;  1T56 A;  1WPK A;  4Z4W A;  1IRX A;  4DK0 A;  5DN6 A;  4NBQ A;  4M53 A;  4TMZ A;  3WWG A;  2V5I A;  2H09 A;  4GQN A;  4J00 A;  1MIJ A;  3S8P A;  4EJO A;  3PIP F;  1ZLK A;  4V19 K;  3ZN0 A;  2DOA A;  4ZTF A;  2R7T A;  2H1L A;  4YFN F;  3E5U A;  3SLD A;  3ZBT A;  4WXD A;  1TYW A;  1Z67 A;  2WBM A;  1H0M A;  2BY0 A;  1WJB A;  3WBJ A;  2KFD A;  1EH7 A;  4LIU A;  3HAG A;  2Y2Z A;  5BNG A;  1W0J A;  1FND A;  1S7A A;  4L9V A;  5HLI A;  1E3Z A;  2LNB A;  4A3G J;  4ACB A;  5AIQ A;  1KC8 D;  4CCJ A;  2ESH A;  3E97 A;  3MZ8 A;  4YAF A;  4RGX A;  1TQM A;  5K5O A;  5L3B A;  3KCC A;  3TKY A;  4U0Y A;  1FRN A;  2G0E A;  9ANT A;  4A69 C;  3IUO A;  3FK6 A;  4P5O A;  1VQ6 I;  5EYR A;  3SHF A;  3ASP A;  5J3O A;  5K7H A;  1UHS A;  3DU6 A;  4IO9 F;  2O6W A;  2XTW A;  2HOT A;  5BPI A;  4OPV A;  2ZFW A;  2V6C A;  1YX2 A;  2Q0O A;  2GZW A;  2KJC A;  3QYE A;  2WAF A;  4E6K G;  4LD5 A;  4O5V A;  5ILU A;  2CGP A;  3SFZ A;  1OGO X;  3WOD F;  2MC4 A;  3PUF A;  4BH9 A;  4AC9 A;  4JK1 X;  2ZXW H;  1V3F A;  1UD4 A;  5IYW A;  2A61 A;  2AXT C;  1K8F A;  3MMP A;  2EBI A;  3BNW A;  1A36 A;  3W5U A;  3OYC A;  1QA3 A;  2WV1 A;  2TCT A;  3B73 A;  4NQW B;  1KK2 A;  3OFN A;  4RD0 A;  2IT0 A;  3BR2 A;  2OTL B;  2VKD A;  1T39 A;  2BM1 A;  2DFE A;  4KMF A;  4ENK A;  4LFU A;  1QHG A;  4EH1 A;  4WWV A;  2VFO A;  3NAR A;  1T6S A;  2YPR A;  4ZTJ A;  2M9H A;  1R5O A;  1GHC A;  4OIP F;  2VBM A;  4F52 A;  4MO7 A;  5M3M J;  2Q6L A;  1ZR4 A;  1IA5 A;  3R6K A;  1SFU A;  2OZU A;  1FEX A;  2LOO A;  4OOV A;  2G0Y A;  2BW3 A;  2CRG A;  5JHU A;  4M74 A;  2OJE D;  2KL4 A;  4G6T B;  3TED A;  3FMR A;  1T08 B;  2DFI A;  1WZ2 A;  1K78 B;  2EH3 A;  1IB4 A;  1YLF A;  3S1M J;  1MSE C;  3R6S A;  3OYI A;  2QBY B;  1H42 A;  3OYE A;  5HLG A;  2YWF A;  4BQN A;  5DD4 A;  2DER A;  2DU9 A;  3F22 A;  2OTJ B;  1KZL A;  3RPQ A;  3DQV C;  1EZG A;  1KD1 D;  3R0J A;  2ZBK A;  2GA1 A;  4WZL A;  1QU3 A;  4Z1M A;  2YUS A;  2XAS A;  4WXH A;  5DCM B;  1O8E A;  3L7W A;  2OTL I;  3AG4 H;  4F91 B;  2VNI A;  5ICC A;  2ZKZ A;  1FP1 D;  2M30 A;  2BZT A;  1VQM B;  3B90 A;  3OKX A;  4L5E A;  4XQF A;  4PAB A;  1E1R A;  5L46 A;  2BPO A;  3P9C A;  5ERI A;  1G6N A;  3GQ8 A;  3OYJ A;  4ROX A;  3F6O A;  4G6Q A;  4UVB A;  5E79 C;  2JSP A;  1SAN A;  1W7P B;  1XMK A;  2L5Q A;  2WC2 A;  3OYD A;  3OSF A;  4C2T A;  1W35 A;  2QYU A;  1IXR C;  1XMX A;  4Q7J B;  2O61 A;  1YX3 A;  3OYM A;  2X51 A;  3Q3A A;  4G7O F;  4XD7 A;  1R5B A;  3MAJ A;  3BY6 A;  3K1M A;  3HUG A;  3OEE A;  3L2W A;  1QGP A;  3ASO H;  3E6B A;  1R1U A;  3H35 A;  3I3L A;  4WK8 F;  3VOD A;  2OTJ I;  2BM5 A;  1ON2 A;  1YS7 A;  2CO5 A;  4RLQ A;  1TT5 B;  1ITY A;  1U2W A;  5CVU A;  1UHM A;  3ABT A;  4Y13 A;  2JK3 A;  5FO0 A;  1PE9 A;  2J8K A;  5L3E A;  1DDI A;  4P9S A;  4ZYA A;  2JDI A;  4IQ4 A;  5CDF A;  1F1Z A;  2AS5 F;  1VQM I;  3I4P A;  4PDK A;  3RIR A;  4YIR X;  3H3Z A;  5EG0 B;  4RB3 C;  1S72 B;  3J7A O;  4ESJ A;  4KNY A;  3U2Q A;  1XE1 A;  1Z7L A;  3NWS A;  2VKE A;  3KP2 A;  2B5O A;  4X8I A;  2AO9 A;  4JX5 A;  2VQH A;  3P5J A;  3T8T A;  4RJL A;  2R9V A;  5J1Y A;  4OMY A;  2EFO A;  2YU3 A;  3V42 A;  3HHG A;  1LB2 A;  1XCV A;  1IXS B;  1J5Y A;  3BLY A;  3A02 A;  4X6A J;  1T0F A;  5C44 J;  4A3K J;  3LMW A;  2V1X A;  3JCU C;  2VN2 A;  1E3P A;  1Z3X A;  3E6M A;  3F21 A;  2D9R A;  1LVK A;  4A5M A;  4B3A A;  4DBR A;  4QTR A;  1SAX A;  3HOW J;  3AVV A;  5GPA A;  3A01 A;  3VMW A;  3F72 A;  3TO6 A;  2BBY A;  2LC2 A;  1ZRC A;  2INU A;  3B8H A;  1UMQ A;  1ZR2 A;  1S72 I;  2E5Z A;  3TQN A;  5LHG A;  2HKO A;  2HCJ B;  3RSN A;  2M5S A;  3AL0 B;  1TLH B;  3BPV A;  4M3F A;  2ZBU A;  1W9X A;  4CQJ A;  3GWZ A;  2XPU A;  1WJD A;  1AHD P;  2COM A;  5E17 F;  3LAJ A;  3WNB A;  4LK0 F;  4LMY A;  1XG1 A;  2NTB A;  2X3H A;  1FDR A;  3GX4 X;  1VQ4 B;  5FFZ A;  1Y0Y A;  2CH0 A;  2DQL A;  4LIT A;  1IDY A;  5ILV A;  1B4A A;  5FL7 A;  2W1O A;  4UVA A;  4OIR F;  1A6I A;  1LLW A;  4RS8 A;  3WTX C;  3H3U A;  3VYR B;  3BZC A;  2VBX A;  3NEU A;  3BY2 A;  1LEA A;  2NOJ B;  3ZMZ A;  1F60 A;  4YZ0 A;  2C5H A;  4XRS G;  3BCF A;  2E1R A;  3B82 A;  3CPW B;  2XGC A;  3L9F A;  1WMR A;  2L7Z A;  2BN4 A;  1VZ0 A;  3AAF A;  3N05 A;  3PSI A;  2A69 F;  3CQZ J;  4HLX A;  3IKV A;  3KP4 A;  3VMV A;  1KQ8 A;  1FP2 A;  4KUM A;  4BNC A;  2BV3 A;  5JLW A;  2E1O A;  2XF5 A;  1W5S A;  3G3Z A;  3CCU B;  1R6R A;  2MYS A;  1WJA A;  3BR6 A;  3BTJ A;  1GAQ A;  2QZA A;  2BW3 B;  1TBX A;  4BQQ A;  3GO5 A;  1KYZ A;  2D3L A;  1N25 A;  1FWZ A;  4C2U A;  1JA1 A;  1VQ4 I;  2L7F P;  3HXL A;  3GIR A;  4X7E A;  1TQP A;  3EPZ A;  4DYQ A;  2BSP A;  2LZJ A;  1F36 A;  4EM0 B;  5IOZ A;  4BXF A;  4J01 A;  1DU0 A;  2E1B A;  1R5N A;  3CCV B;  5FIU A;  5EGO A;  5ICE A;  2YR2 A;  2V79 A;  1QVU A;  3DU1 X;  3WU1 B;  1LDD A;  4RLZ A;  4HLY A;  1MBF A;  4C3J J;  2AQE A;  1U5T A;  2E7W A;  1GVD A;  3TO7 A;  4LOC A;  3ABU A;  2XEX A;  3BR1 A;  1XGS A;  1HCR A;  4X0C A;  3CCU I;  3BPX A;  4X06 A;  1BR1 A;  1FOX A;  4MXN A;  3ZMV A;  3H0D A;  2W6I A;  5IP6 A;  4GFB A;  1I6H J;  2WA0 A;  4AIH A;  1ZG1 A;  1K61 A;  1IF1 A;  4M9S A;  1BC7 C;  1M90 D;  3WNC A;  2EV6 A;  3ONQ A;  4M2L A;  4V2F A;  1OOC A;  4RAG A;  2ZB9 A;  3KE2 A;  4N0B A;  2VBK A;  3KX2 A;  2QN6 A;  2K40 A;  2IJL A;  1O88 A;  3F8N A;  2QGG A;  4XSX F;  4ZYH A;  5FKL A;  3S1N J;  1QRY A;  3CW2 A;  4BPR A;  5LRR A;  4L9J A;  1Y1W J;  1D5Y A;  1TC3 C;  1PKV A;  3VST A;  4IHV A;  3LL7 A;  1AU7 A;  4J0Q A;  3CCV I;  3F0C A;  3ZGK A;  3DTE A;  4XLF A;  3KLO A;  2FBH A;  1K7A A;  4BU2 A;  1ZGW A;  3QP5 A;  5D4S A;  4C2M J;  3ZRG A;  1IB0 A;  4I02 A;  2G7H A;  5GAG J;  3EDP A;  2DY1 A;  3OZV A;  1RNL A;  2R7W A;  1Y8Q B;  2HDN B;  5C1E A;  1OFM A;  2IVM A;  4M3G A;  2HXI A;  4V02 C;  5IYP A;  3CCQ B;  4OIO F;  2D74 A;  2DPU A;  3HIF A;  3N4M A;  2L9R A;  2DA4 A;  2DA7 A;  2O5R A;  1XSV A;  4NDL A;  2J8I A;  5ICG A;  2X1C A;  1ZRF A;  5TR9 A;  1J09 A;  4HST A;  5IPA A;  1E3X A;  3GQ9 A;  4BKX A;  4LB5 A;  1DP7 P;  5E8G A;  3QPS A;  2OV7 A;  2HQN A;  3E5Q A;  2DOE A;  1YTY A;  2ZXH A;  1RKT A;  5GTH C;  3S17 J;  1STZ A;  2XV4 S;  4AYB A;  3A01 B;  3CPX A;  3IWF A;  4ZJZ A;  1R7J A;  4CXF A;  1EA3 A;  2RQQ A;  3H5N A;  4OU0 A;  3TL4 X;  2TRT A;  3W5H A;  3HOS A;  1XTA A;  4ZDP A;  4BL0 B;  3KYL A;  4MEX F;  2DT7 B;  1MNE A;  2XF7 A;  2KRC A;  3K70 D;  2Z33 A;  4A3L J;  3HB9 A;  2KZG A;  3CUQ C;  2BGC A;  3RZO J;  1SEU A;  4U88 A;  4ASU A;  2Y48 A;  1AIP A;  4OAZ A;  3CCQ I;  1I6X A;  3P27 A;  1VQ7 B;  3NQO A;  2XGX A;  1RPW A;  1LFP A;  2LH9 A;  5FFX A;  2JMW A;  5CVI A;  3U9G A;  2EV5 A;  5F64 A;  2KIS A;  1O3T A;  1WKM A;  2UZK A;  4A3F J;  3G1L A;  3TO9 A;  3LJY A;  1I5Z A;  4EAT A;  2ZL6 A;  3T9G A;  2OCC H;  4G12 A;  2DA6 A;  3GSI A;  3W3C A;  2DA5 A;  5BMZ A;  5HS9 A;  1EFR A;  1MMS A;  3DV8 A;  1E63 A;  3S2W A;  3F23 A;  4HZF A;  1MZB A;  4R1H A;  2ZCW A;  4MYT A;  3CF2 A;  3OYB A;  4CCM A;  4MEY F;  3CJQ B;  3A8J A;  1UJ8 A;  2H6B A;  2YS9 A;  2RDP A;  4C3I J;  3QFT A;  3A2K A;  1BI3 A;  2L02 A;  1VQ7 I;  4V2G A;  4K1X A;  2CW5 A;  3OV8 A;  4HWV A;  2FXA A;  1ZGJ A;  3EUA A;  4X1E A;  2W6J A;  3I4N J;  1IRF A;  2D5V A;  2EFQ A;  1SMT A;  3X2Q H;  3FJO A;  1EFC A;  3QYF A;  3VNV A;  2GM4 A;  3LA3 A;  4XBF A;  2XAQ A;  4ENN A;  1M1K D;  3GLX A;  4OZY A;  4R79 A;  1QUE A;  5ED4 A;  2K5C A;  3ECH A;  5E3L A;  4X05 A;  2EIN H;  1Z7U A;  5EGO B;  1BX1 A;  1MMD A;  1KRH A;  3NB2 A;  3HBL A;  2O1D A;  4PSX A;  3I64 A;  2QEX B;  4Y9U A;  3L09 A;  3PM1 A;  4P55 A;  1QCX A;  2DJN A;  3J81 k;  1U5T B;  3JRA A;  2QM3 A;  4IRG A;  3TP3 A;  1BC8 C;  4MQ9 F;  2K9Q A;  2VKH A;  3Q9S A;  2P7C B;  4CSW A;  3PSF A;  3HKZ N;  1ZAO A;  3GUD A;  3RDI A;  1BIA A;  1IHM A;  4HIZ A;  2ELH A;  2FSW A;  2HZD A;  3HGG A;  1Y39 A;  2VT2 A;  2L54 A;  2CFO A;  3OIO A;  1LFU P;  2A6E F;  5IT9 Z;  2ELJ A;  2C2W A;  4PCQ A;  2WB1 N;  2OA4 A;  2F5E A;  4HG2 A;  4TN1 A;  3EYY A;  1WJE A;  2E71 A;  2WTE A;  3WTV C;  3OYF A;  2F3L A;  3GBG A;  4DIQ A;  1X1P A;  1MDM A;  3PO2 J;  2QEX I;  2O3F A;  2DAO A;  1EH6 A;  3VOE A;  2XC7 A;  4ZYG A;  3DPU A;  2A68 F;  1N08 A;  5E8I A;  3MQ0 A;  1KQ9 A;  1T6Y A;  1MJA A;  3J7Z I;  1WSR A;  4OM9 A;  4KIG A;  5GPC A;  5A2Q Z;  2W7Z A;  1IZ1 A;  4XN3 A;  3V7C A;  1VFC A;  4L18 B;  3PUB A;  1HKS A;  2EA4 A;  4KDP A;  4XN0 A;  3DPL C;  3EQL F;  1OFL A;  1OYY A;  1WGX A;  4BDZ A;  1P92 A;  4H0E A;  2MLG A;  4A3M J;  4N9I A;  4JP0 A;  2GQQ A;  2HOA A;  5FKO A;  2HTJ A;  4LBW A;  1D0Y A;  1ZM9 A;  2DYI A;  1PLU A;  2F5D A;  2XND A;  4HF1 A;  4RPD A;  1BJA A;  1YJN B;  3QU6 A;  4DQ2 A;  3FXR A;  3OR2 C;  3IL2 A;  3VO1 A;  3HTS B;  2BXY A;  2L9S A;  4U4B A;  3BT9 A;  4Z06 A;  1YQA A;  3F6V A;  1W5C C;  3HG9 A;  1I50 J;  3SEQ A;  4I0B A;  2JN6 A;  3OYN A;  3ONY A;  4IHX A;  2R92 J;  2R4G A;  2IXS A;  3I9V 2;  4N4N B;  2XNC A;  3GFL A;  2BY2 A;  5J8C A;  3CCL B;  5HDN A;  1SFX A;  1XCB A;  4NNJ A;  1NHC A;  5M5X J;  4AVP A;  1U78 A;  4MTE A;  1WJF A;  2DA1 A;  4OJ6 A;  2RAE A;  1SKQ A;  3H9N A;  3JRI A;  3CC7 B;  2O17 A;  1OGJ A;  3PSZ A;  3NAU A;  3K4L A;  1FSH A;  4Z4T A;  1WPC A;  1WTH D;  4FAS D;  1W2B B;  2E34 A;  4IF4 A;  1KU2 A;  2ZJP F;  4WXC A;  3AFH A;  2CUE A;  3F3X A;  2Z8G A;  4KMU X;  3MKW B;  2MG4 A;  3D5L A;  2DFH A;  2VFP A;  4PGH A;  2OPT A;  4FN5 A;  4I6Z A;  1WOS A;  3V7R A;  4P25 A;  2ADU A;  5JMC B;  1ETY A;  1YJN I;  1ZM4 A;  3ZQG A;  3HEF A;  4LLL A;  4AWX B;  2X0K A;  3SYT A;  3ABK H;  3CJR B;  3ASR A;  3QSY A;  2UVE A;  2V4D A;  5J1R A;  2NVY J;  4ESB A;  2JA8 J;  2XTX A;  2R7Z J;  5L3F A;  1J9Z A;  1ZM2 A;  3ZMD A;  4D7M A;  3OYL A;  1KU7 A;  4EM2 A;  3HPG A;  2GXB A;  3DWL E;  4UUS A;  3ASN H;  3CCL I;  3FKI J;  2UV1 A;  1JGG A;  2Q1Z B;  4EM1 A;  1JJ2 B;  4OZZ A;  1HF2 A;  4A3B J;  2B9S A;  1JHF A;  5LD2 C;  2ACJ A;  2O9L A;  1H9G A;  2B0R A;  2ZZE A;  1MJ9 A;  3ELK A;  4M6V A;  3CC7 I;  3J81 Z;  4B3G A;  5CLS A;  3NAW A;  4RD3 A;  1UD8 A;  4IHY A;  3MKY B;  1FPQ A;  2KRF A;  4B44 A;  2EIJ H;  1SVO A;  1SD6 A;  4CCN A;  2GRE A;  2HQR A;  1D0Z A;  3PIO F;  2QMU A;  2JQ7 A;  2VBU A;  3K1P A;  1BR2 A;  5THX A;  3SLN A;  3ZBU A;  1BMF A;  1HC8 A;  1O8M A;  1O8J A;  4ZCL A;  2DK5 A;  5FLX Z;  4XRM A;  2V9V A;  4KIT B;  3M3Y J;  3HOT A;  2QSG X;  3FX3 A;  3DBR B;  3C2H A;  2CW8 A;  5H6R A;  3CMA I;  2QKL B;  3RCO A;  4YFK F;  1DUX C;  2VFQ A;  1OFC X;  4QSH A;  3LFU A;  1W34 A;  2K7L A;  4R71 A;  1KTV A;  2XSD C;  4XRF A;  5F1J A;  1IJF A;  2XRO A;  3JQP A;  3VB2 A;  5KHD A;  2BX6 A;  1LJ9 A;  2CJJ A;  4I2O A;  1K28 D;  3OOC A;  2TDX A;  3OIQ A;  4EGZ A;  5IP7 J;  3WE2 A;  1TWF J;  5IYB J;  2VBY A;  3OS0 A;  4CGZ A;  4P22 A;  2A6T A;  1UG2 A;  1P7I A;  4QVA A;  1S9H A;  3I0T A;  2P81 A;  4TV7 A;  4XKW A;  3LOC A;  3VSL A;  5FA6 A;  4HX7 A;  4DNT B;  5AON A;  3W2F A;  3LSG A;  4AIK A;  2EZI A;  2A3S A;  4G94 A;  5LLQ A;  2HVQ A;  4PFO A;  2CK3 A;  4PC7 A;  2MD5 A;  4HF0 A;  1X3U A;  1FZP B;  2B7C A;  2EZH A;  4BY7 J;  2NXN B;  4G7H F;  3GQ7 A;  2EFN A;  1XS9 A;  1MDM B;  3AVX A;  5IT3 A;  2XOK A;  1TP4 A;  2M7B A;  4P2N A;  3P4G A;  2WPD A;  2VYQ A;  2PMZ A;  2NSP A;  1FNB A;  3K4J A;  1H89 C;  2V7T A;  2DYR H;  1MH4 A;  4B09 A;  2IS1 A;  1VHE A;  4WZK A;  3BH7 B;  4QPO A;  1Z1D A;  3ZMS A;  4G1B A;  5TRD A;  1BJK A;  3KRG A;  1HKT A;  4G9Y A;  1P4X A;  2W4S A;  3GVA A;  3E1S A;  4RGS A;  3JRH A;  4FWT A;  4XON A;  5M5Y J;  1POG A;  1YE9 A;  3ZIA A;  1ZUN B;  3LSP A;  3CO7 C;  1VQO B;  3TDZ C;  2DFF A;  3HM5 A;  4GCV A;  1ZGA A;  3OP1 A;  4RM0 A;  3ERM A;  3ZQH A;  2R5Z A;  3TP0 A;  5TGT A;  1T5E A;  1J9I A;  4MFD A;  4EJW A;  3VYU B;  1VLO A;  2VJJ A;  5FNZ A;  1O8F A;  2HPI A;  2RV8 A;  4BE1 A;  4DK1 A;  3T5X A;  2J5P A;  2Y0S N;  2XT4 A;  3ZMU A;  3F8C A;  4OIQ F;  3DEW A;  4ZCI A;  3OSG A;  4KIB A;  3ZCO A;  4NC8 A;  2BHY A;  2LRD A;  2WAQ N;  2JJ2 A;  1QVG B;  2CV2 A;  3LSM A;  3EUH C;  4MLO A;  3DLL F;  1LLZ A;  2DOF A;  1OLT A;  4CYD A;  3IV5 A;  4QLC U;  3A4C A;  3L00 A;  4S0H B;  3T51 B;  2XGD A;  1V0F A;  4YFO A;  3ZQF A;  4G7Z F;  5BOX A;  2O0W A;  2ZME C;  5E1W A;  1MW7 A;  5LEJ A;  4II2 A;  3QFC A;  1RKW A;  4FCY A;  4A3E J;  4G6I A;  2OD5 A;  4NBS A;  1B23 P;  2E2H J;  3Q38 A;  1NBM A;  5DS0 A;  3I53 A;  3BRO A;  1IJE A;  2ZL7 A;  1HW1 A;  1CF7 A;  2ZME A;  3PL8 A;  2LR8 A;  5D8K B;  3T56 B;  3JX8 A;  1VQO I;  1I7P A;  1FBS A;  2QGU A;  3DP7 A;  2VJ4 A;  2HOE A;  4JRA C;  1FNC A;  5KAF C;  1QX4 A;  3MEX A;  1IDK A;  1ORK A;  2QY1 A;  4RD6 A;  3OJX A;  1U9N A;  4PFP A;  2WAD A;  3QOP A;  2BEO A;  3HTU A;  1H8E A;  2XRL A;  2XGE A;  5HVQ C;  1K4S A;  4P3Y A;  5J40 A;  1R23 A;  3U6K A;  4ESF A;  3CJT B;  4UVC A;  2IA0 A;  4RGR A;  4BAC A;  1W0U A;  3O3K A;  3GZ6 A;  1N07 A;  1D1B A;  4JYK A;  1OIS A;  2PQ8 A;  1ZEL A;  4A6E A;  4UUS B;  1UD5 A;  1B59 A;  4IRH A;  3SXY A;  5DS9 A;  3M8J A;  4GGG A;  4P1V A;  4Y52 J;  3I56 B;  2OK7 A;  3S2H J;  1QQ1 A;  1HBX G;  3PUM A;  3VO2 A;  3M4O J;  3FF5 A;  1KZH A;  1ZN2 A;  3LMM A;  5DCF A;  4YIF A;  2KIU A;  4Q47 A;  4F92 B;  1RIO H;  2CBX A;  3QFS A;  4P6Y A;  4TMV A;  1JKQ C;  5DSZ A;  5K7Z A;  3LSJ A;  3KP6 A;  5KK1 A;  2HU9 A;  5CJ9 A;  2MD0 A;  4A0Y A;  2Z9O A;  2CND A;  2LFB A;  4HBL A;  4OIN F;  3ZQQ A;  4XLH A;  3SZG A;  1NTC A;  2I5U A;  2M4K A;  4U7B A;  4Q5S F;  2UWM A;  4O6J A;  2W24 A;  1TYU A;  1G7S A;  1B8I B;  3ZC3 A;  1T8I A;  1ETW A;  4WZT A;  1FY7 A;  3W6J B;  3AL0 C;  1E1Q A;  5KW9 A;  1NJI D;  1IW7 F;  2FE3 A;  1UD3 A;  1XDS A;  3GXO A;  1WH7 A;  4WX9 A;  4IZZ A;  2FVG A;  1BJZ A;  3RJP A;  3JRB A;  1SVM A;  2HTS A;  4NUB A;  2HQA A;  4NC6 A;  1I1S A;  2XPW A;  2GPJ A;  3G71 B;  2UXN A;  3H5R A;  4A2U A;  1QA1 A;  3I56 I;  1BN8 A;  3EUK L;  3FXK A;  2GOX B;  2NAZ A;  3ZQ7 A;  5ICF A;  1EWY A;  5GAH J;  4G6D A;  2P5V A;  3FXM A;  5D6F A;  2BVN A;  3WGG A;  2W85 A;  2PEC A;  1R58 A;  5M3F J;  2HOS A;  3G4S B;  1YI2 B;  2WJV A;  3W2E A;  1GO2 A;  1YLO A;  3K4K A;  5IY5 H;  3K4C A;  4CYC A;  4OPW A;  3IP4 B;  1RI7 A;  3BZ6 A;  4UB6 C;  4Y7N J;  3BQZ A;  3WGH A;  1DDN A;  1WOO A;  2YU9 J;  3HRS A;  1IUF A;  2IOU G;  4MR0 A;  4C43 A;  1WU8 A;  3D5S C;  3S15 J;  1R00 A;  4DQL A;  2RNG A;  5KAI C;  3BG6 A;  4B48 A;  4AF7 A;  2QKM B;  1KMH A;  1Z21 A;  1E2X A;  3RY8 A;  2EV0 A;  1K6Y A;  4D1Q A;  3O8H A;  3PNY A;  4BQA A;  3G71 I;  4XLC A;  4RB0 A;  2OU2 A;  2PLF A;  2B7B A;  3WTT C;  4B8X A;  4E7H A;  2Y0M A;  3K4B A;  3AGP A;  4AUX A;  1ETO A;  4UV8 A;  4A3C J;  2HWV A;  2DN0 A;  4XIC A;  4TMX A;  3BTI A;  1KCD A;  4AID A;  4Y3O A;  3L2Q A;  2I10 A;  3MZY A;  1MNM C;  4L9T A;  2NRA C;  3G4S I;  1JI8 A;  4HE5 A;  1BOB A;  1YI2 I;  2H8W A;  1PP8 F;  4X7D A;  3H09 A;  2OQR A;  2FML A;  2KJB A;  1QUF A;  1PUF A;  3U6B A;  1ETV A;  1ZLJ A;  2ESN A;  3DU5 A;  4XSZ F;  1H8A C;  4U49 A;  3HRU A;  5GP9 A;  2NVT J;  4ZGN B;  2DDA A;  2MSY A;  2JA6 J;  5IYN A;  3C2B A;  4F7D A;  3DLA A;  4QVJ A;  2LTP A;  2R7D A;  3BCA A;  2PMH A;  4IL6 C;  3RYR A;  1EH8 A;  4F3Q A;  1BA5 A;  1IDZ A;  2CFX A;  1MBJ A;  2COB A;  3MKL A;  4A0X A;  4A3D J;  4B3F X;  2OQG A;  1HA8 A;  3S14 J;  3R0A A;  3H94 A;  2VLA A;  2BM6 A;  4FK8 A;  4RPB A;  2KT0 A;  2Z99 A;  2KMU A;  3GTQ J;  1XFO A;  3ML6 A;  1MJB A;  4CZC A;  1YIT B;  5EEA A;  3SDG A;  2V9P A;  2EIK H;  3VYT B;  5C4X J;  1FTZ A;  4M71 A;  2H8R A;  3EYI A;  3KEW A;  4UB8 C;  2ICW G;  2ODL A;  1WI9 A;  3KP7 A;  2DTR A;  2ECC A;  2HQ5 A;  1IXC A;  1XGM A;  3K4M A;  2P7V B;  1BLI A;  1MMN A;  3G05 A;  3HHH A;  2QX3 A;  1OMI A;  2BVL A;  5J4Y A;  5E6T A;  3B02 A;  3M1C A;  1V5V A;  3P26 A;  1TW3 A;  4E7K A;  3CDH A;  1N0U A;  2XVC A;  2OC6 A;  1O8I A;  3K6G A;  1EV7 A;  4WQM A;  2JZY A;  1Q1V A;  1S29 A;  1EKE A;  2FX0 A;  2K4J A;  3EQO A;  2W82 A;  2QVO A;  2V7V A;  2RC5 A;  3CP8 A;  2WYR A;  4N3G A;  2FX3 A;  3K9T A;  4ZZL A;  1BOA A;  2JN9 A;  3CDI A;  4M6Y A;  1Z0X A;  3BCD A;  3DBL B;  3W6V A;  4Y4R A;  4Y33 A;  1YO5 C;  2OAZ A;  1N75 A;  1TTT A;  2V1N A;  4A3J J;  1N06 A;  4YEI A;  1V5G A;  2CW7 A;  4KIC A;  1YIT I;  1J7K A;  4KIS A;  1ON1 A;  4G5G A;  4MNU A;  1OCZ H;  2OK8 A;  1XDU A;  2GAU A;  5FLM J;  1IJW C;  1XSX A;  1O8K A;  3OL3 A;  3LFK A;  1ZQ3 P;  4PC2 A;  4S04 A;  2BGJ A;  4XLN F;  1XGO A;  2F5F A;  4ENM A;  1WWX A;  4KYW A;  3M1E A;  1E43 A;  5J4V A;  5DTD A;  3DF8 A;  2ZFU A;  4AD9 A;  1Y0U A;  2D2W A;  1D1N A;  3BC8 A;  3RKY A;  4JBA A;  1XQB A;  3NWT A;  4M1K A;  3C18 A;  1IDJ A;  1HF0 A;  2X8K A;  1HKQ A;  1GR1 A;  3AG1 H;  1KA8 A;  3A35 A;  4YII A;  1N77 A;  1O57 A;  4XMY A;  1GQ8 A;  2IPQ X;  3LA2 A;  2XAJ A;  5HS7 A;  1G59 A;  2XAH A;  4PC3 A;  3KEQ A;  4CZZ A;  2BM4 A;  4XKV A;  2JJ1 A;  4XL9 A;  1ENH A;  3BR0 A;  1ELO A;  2C4T A;  4PK4 A;  2ZZF A;  2H6C A;  3LQQ A;  5FJ8 J;  1YRN A;  2XT2 A;  1ZAR A;  3FMQ A;  2IRF G;  2DA3 A;  3CCS B;  4OJ5 A;  2JUG A;  2KQR A;  2M1B A;  3BJO A;  3R61 A;  3SJZ A;  5DUK A;  2BF4 A;  2XZL A;  5H5J A;  1ETX A;  4DYR A;  2PI0 A;  4IX7 A;  1D8T A;  2JRT A;  1DQU A;  3VYS B;  2OUM A;  2YWH A;  1OCR H;  2X3U A;  1UG0 A;  1XMA A;  1YOV B;  4I99 C;  4PC6 A;  5HXB A;  5JLV C;  2GLO A;  3GZ5 A;  1GVH A;  2E19 A;  4BHC A;  2M2E A;  2M4G A;  1EFT A;  5FO1 A;  3U1D A;  2QSF X;  5GAE J;  5TJJ A;  5HDG A;  3KZZ A;  1W36 C;  6PAX A;  1E0E A;  2EK5 A;  3OOP A;  4PGG A;  2NVQ J;  1UCR A;  1S4M A;  3FM3 A;  3PFY A;  3P7N A;  5H2F C;  1UFM A;  3ZN1 A;  3RI4 A;  3IWZ A;  2PX9 A;  2P4W A;  3WGI A;  1QRB A;  3H3V K;  4C30 A;  3CCS I;  1PUF B;  1QFZ A;  1BW6 A;  3SZE A;  2EWE A;  4YCQ A;  2VB6 A;  2LLK A;  3BDD A;  3FXQ A;  2JJ7 A;  1IN7 A;  2XAU A;  3HUG B;  5J47 A;  1T38 A;  3S1Q J;  2FU4 A;  3AG2 H;  2R93 J;  3ES9 A;  1Z05 A;  3E3V A;  2M0M A;  2V9K A;  3L2R A;  4XLP F;  1W4M A;  2E1M C;  4RAY A;  2KDZ A;  1MMA A;  1OYI A;  2Z5U A;  4P12 A;  1B1B A;  3K2Z A;  3HZJ A;  5F4O A;  2DMN A;  1FMV A;  3ESW B;  2X0L A;  1EFU A;  3TW7 A;  1YFH A;  3ASQ A;  1OGI A;  1L1I A;  3OZU A;  1HDP A;  5HZB A;  2FA5 A;  2XKP A;  1I8D A;  3BQY A;  1PVE A;  5JHF A;  3BZK A;  1KU3 A;  5FRM A;  5A89 A;  3LYC A;  1OJL A;  2OBP A;  3RKQ A;  2I1L A;  1P6R A;  5JI6 A;  3ZPP A;  2FF4 A;  3FBI B;  2INV A;  2MH9 A;  2VNH A;  2STT A;  5CYV A;  4IHT A;  2IGK A;  3ROU A;  4HV6 A;  4XR6 A;  3OS2 A;  2QQA A;  3DKY A;  5AMV A;  4WCG A;  5HS8 A;  5BPD A;  3PJR A;  1FIA A;  1I1G A;  5F4M A;  3E6D A;  3QP6 A;  1QRC A;  1TWC J;  2KLO A;  3H9G A;  4KA4 A;  3JQQ A;  2DXI A;  4KT5 C;  1SVL A;  1C0W A;  2ZC2 A;  1GAW A;  1O8H A;  4MGR A;  2NS0 A;  3LNN A;  4A0Z A;  3WXM A;  2HR3 A;  2EZL A;  3OMY A;  1BI2 A;  1F4K A;  4Y9R A;  3VNU A;  1R5H A;  2I8D A;  2D3N A;  2IS2 A;  3CUQ A;  4ENJ A;  1K4T A;  4XOP A;  2EIM H;  4Z4R A;  2GIZ A;  5FRN A;  1S6L A;  1V5F A;  3FPP A;  2KVO A;  4RM3 A;  2VXD A;  3N6Z A;  4DQK A;  4CIC A;  2BY1 A;  1RQR A;  1QJV A;  1LDK B;  2HDW A;  2RKH A;  3GTL J;  4N3N A;  1DBO A;  3HSF A;  3G2B A;  4BHB A;  3FIW A;  1XB2 A;  3VFZ A;  4FXU A;  5AN9 A;  3H5A A;  5LBQ A;  5FKN A;  5F6F A;  4DJA A;  2YWG A;  4DGW B;  3HKZ A;  3FKJ A;  4LIV A;  3VDX A;  3OW2 B;  1VQ5 B;  3S32 A;  1AIR A;  1Z6T A;  3M7G A;  2NTQ A;  4XRS A;  2V4J C;  3JAM Z;  1CQX A;  2KHM A;  1VND A;  3IRQ A;  1YRN B;  2RNJ A;  3A3G A;  1Q1H A;  5KSW B;  2JRM A;  4MQV A;  4EQQ A;  2VBV A;  3UR3 C;  1WOR A;  4BHP A;  4CCO A;  1OGM X;  2WB1 A;  2FMY A;  4HEA 2;  1Y8R B;  2MW8 A;  4HYE A;  3GLL A;  2GK6 A;  3A8I A;  4ANJ A;  2K85 A;  2KDO A;  3GTG J;  1IUY A;  2IBD A;  4YAL A;  2M45 A;  1QGA A;  1TVC A;  5BQT A;  5FO5 A;  2EJR A;  2BXZ A;  2NS7 A;  3HRT A;  2CRV A;  2OYN A;  3B78 A;  1NK3 P;  5H59 A;  2VJI A;  4HDV A;  1BI0 A;  1PP7 U;  5A88 A;  1TZL A;  2W48 A;  2R7X A;  2WV0 A;  3S93 A;  2BM7 A;  2DO7 A;  3SZT A;  2QQ8 A;  4BGD A;  3SKB A;  1O3Q A;  1JT6 A;  2DK8 A;  4NK6 A;  3CZ6 A;  4LLN A;  2G9W A;  2X1E A;  2L9N A;  3Q6Q A;  1VQ5 I;  3GYH X;  2PFB A;  1K5C A;  2Y30 A;  1XB4 A;  3BOQ A;  1O8L A;  2LBF A;  3ZZ0 A;  4FX4 A;  2STW A;  3GTM J;  1RU4 A;  1TW2 A;  2FNP A;  5ILS A;  4M3B A;  1TWH J;  5LFA A;  4XLE A;  3OYG A;  1QA6 A;  4IRI A;  2Y9Y A;  1W87 A;  3A8K A;  2EIL H;  1GT0 C;  2Q6O A;  1CZF A;  2P8T A;  1X1B A;  2GOM A;  3D5R C;  1I39 A;  1W5T A;  3LSI A;  4Q48 A;  4BQO A;  3MZH A;  1A35 A;  1FLI A;  3GME A;  2GWR A;  3WQZ A;  3LSR A;  4IOC F;  4BEH A;  3OYA A;  5L3G A;  4LGW A;  3QE2 A;  1R1V A;  2EFG A;  2F5V A;  3H0G J;  3K10 A;  4RAZ A;  2JVH A;  2XHK A;  2M87 A;  2HLD A;  2VFM A;  1WQ2 A;  4OPO A;  1R5G A;  2EQR A;  2GIV A;  3C1D A;  2D45 A;  2E2I J;  3V8J A;  3W2A A;  3OJW A;  3PA1 A;  1WXR A;  5IOY A;  2F2E A;  5HDK A;  1USS A;  2ID3 A;  4M9X A;  3M07 A;  3KEO A;  3G73 A;  1B9N A;  2L3D A;  2NOG A;  5DUI A;  2E2J J;  2CQX A;  4DZJ A;  1I3A A;  5GAD J;  5EEG A;  1LUJ B;  4UUV A;  1OFE A;  1S7O A;  1XG2 A;  5IYC J;  2CQN A;  1KQS B;  3KIO A;  3LAP A;  3B4N A;  4IVN A;  4W8T A;  4Z05 A;  2LP0 A;  3P9K A;  4QIW N;  2XUB A;  3I58 A;  1KK1 A;  2ZSH B;  1QQI A;  3MFK A;  1S7E A;  2KIQ A;  1JHH A;  1IRG A;  2L2O A;  3K1N A;  2X85 A;  3QU3 A;  3OS1 A;  1D8J A;  3FMS A;  1VJS A;  4BS9 A;  2O7O A;  1XPX A;  2P0W A;  4BUP A;  3V76 A;  3I1F A;  1T98 A;  3KEY A;  5H6Q A;  1IO2 A;  2CYY A;  4UAJ A;  3GRH A;  2LVS A;  1JKR C;  1P4M A;  5DV5 A;  5F27 A;  3ERE D;  1YS6 A;  3KFW X;  4KN7 X;  5TY0 A;  4MYU A;  1FT9 A;  3P9I A;  3S3N A;  4BXU A;  2NTP A;  4XK4 A;  1MSF C;  1R71 A;  3DXJ F;  1LE8 A;  2F4N A;  3J80 Z;  1VHO A;  1VQP B;  2XGJ A;  1FYM A;  3OWT A;  3ZP5 A;  1LQ1 A;  4EW9 A;  4RB2 C;  2ELK A;  3MMY B;  5LRS A;  2EFW A;  3ZPL A;  2VQC A;  4D9J A;  3CUQ B;  1FBQ A;  5L3C A;  5IT9 K;  1D5V A;  2Y75 A;  3BCB A;  4AC0 A;  1D2E A;  3V7A A;  2GQF A;  1GV2 A;  1OCO H;  3HSR A;  1SC7 A;  4W8R A;  5C1C A;  3RKW A;  3MWM A;  1AMO A;  2MGQ A;  1OCT C;  5CQE A;  3HPH A;  2LKS A;  1QPI A;  2O04 A;  1DBG A;  2V7X A;  1CNE A;  1OHH A;  2BY3 A;  4FIS A;  1D1A A;  4CO8 A;  1MBE A;  3LNQ A;  5GV7 A;  1U9O A;  3ASS A;  3E5X A;  4KH3 A;  1TYX A;  2FUG 2;  3CMA B;  5A2Q K;  4PGO A;  4NC7 A;  2WSS A;  4B4D A;  1KYW A;  1Q7Y D;  3C7J A;  4W97 A;  1VQP I;  3CDL A;  1APL C;  2GXA A;  2V1D A;  2PMU A;  2AXL A;  5K5R A;  3JQR A;  4OAY A;  1X3W B;  1YW8 A;  2K9M A;  4LJZ F;  2LMD A;  2GJP A;  4L5I A;  2CV0 A;  3GTJ J;  3WHC A;  3IH3 A;  3U2R A;  4HE6 A;  1XC5 A;  1P4W A;  2M5W A;  5LGN A;  2FQ3 A;  4UZE A;  3I54 A;  1WJ5 A;  2C77 A;  1TNT A;  4E7J A;  3GQA A;  4I84 A;  1A8P A;  4BJ6 C;  2HZT A;  2VQL A;  5DD8 A;  3LQR A;  1HSJ A;  1AOY A;  4M3D A;  4I76 A;  4ZZD A;  2LKX A;  1BN5 A;  2IAI A;  2Z3Y A;  1GXP A;  1WSV A;  3GVL A;  1DGR M;  1EA0 A;  5J1U A;  2K9S A;  4PJ0 C;  3DDY A;  2CSO A;  3N90 A;  2CU7 A;  3BG3 A;  1UMK A;  2DYS H;  3RZD J;  2QXZ A;  3WTS C;  4RM2 A;  3GW2 A;  2PJP A;  2R7S A;  5F08 A;  5JFR A;  1RUO A;  1GVJ A;  3WTU C;  1RES A;  4IW3 B;  3V7S A;  1N05 A;  2W25 A;  1TQI A;  4AVZ A;  4W8S A;  4MTD A;  4RCY A;  2X48 A;  3MVP A;  2LF8 A;  2LBF B;  4IHS A;  1P9Q C;  2W7N A;  1G3W A;  1A04 A;  2K86 A;  4EJT A;  1X1C A;  2V6E A;  3ZR8 X;  1JNY A;  2XF6 A;  5JR3 A;  4UV9 A;  1JUP A;  2HS5 A;  2PBI A;  2XNJ A;  3BY1 A;  4RLF A;  1R22 A;  5TV2 A;  3W2H A;  1ZYR F;  4QHY A;  2Y0S A;  4KIF A;  3JW4 A;  3MN2 A;  2YX7 A;  4ON0 A;  1FOY A;  1VI0 A;  4HNV A;  4P9U A;  2JSC A;  2B7E A;  1IAW A;  2LY9 A;  5H20 A;  1XGN A;  2HXO A;  2WAQ A;  3FK7 A;  4LK1 F;  4BEH B;  2HPM A;  1QPM A;  4X7C A;  5IYR A;  5F0C A;  2G7U A;  2BOL A;  3Q39 A;  2CG4 A;  2QWW A;  3HJE A;  1OFD A;  3H92 A;  4JX4 A;  4U0W A;  4E4H A;  1A5J A;  1KK3 A;  3ZXS A;  3GQB A;  1ZM3 A;  1GLN A;  3PNV A;  2EB7 A;  2UUZ A;  3RPU D;  3J81 K;  2NNN A;  2OBT A;  2KRH A;  2H27 A;  3V8K A;  2YUH A;  2P5K A;  3FPK A;  1OR7 C;  3L1P A;  3KL9 A;  5AIP A;  2JPB A;  3I4M J;  3ULQ B;  1G7R A;  2KP6 A;  1O8D A;  1JUS A;  2L7M P;  1G8X A;  4HSR A;  3B6A A;  2LKP A;  1TYV A;  3ZQI A;  1VQ9 B;  4DOZ A;  2NT6 A;  1CLW A;  5FLX K;  2CW0 F;  1UB9 A;  5CPR B;  1L3L A;  2HFH A;  3DCF A;  2VE9 A;  1R9T J;  4UNO A;  1EE6 A;  3GCM A;  5LEK A;  2ZO4 A;  4HPQ A;  1X0C A;  3S16 J;  4XOR A;  1MBH A;  2MC3 A;  1RR8 C;  3GVK A;  2XSJ C;  3S1R J;  3FXU A;  1QHH D;  5C3E J;  1LE8 B;  3ML3 A;  2VBW A;  4P1W A;  2X6Y A;  3DPT A;  2K3P A;  3K7A J;  2QSH X;  2O8K A;  1SD4 A;  3D26 A;  4JMQ A;  3EUH A;  2BHZ A;  3FBN B;  5FKM A;  4FET A;  1F43 A;  2YWE A;  2Z16 A;  1WRJ A;  1WFX A;  1TUI A;  2RGV A;  1IG7 A;  4QPQ A;  3SQN A;  3L2C A;  1YJW B;  4C2L A;  1PUE E;  2XC1 A;  3HOV J;  4P96 A;  1XSD A;  1DG1 G;  5DM7 F;  3CB4 A;  4QV2 A;  2IGN A;  1JXS A;  3LO8 A;  5JVT A;  4AM3 A;  1HQC A;  2XTY A;  1XD7 A;  1VQ9 I;  2CQ7 A;  1YJ9 B;  2DOD A;  5E1X A;  2LSO A;  2JA5 J;  2DMQ A;  4H4K C;  2EA2 A;  4XKC A;  4Y15 A;  5F04 A;  3JTH A;  3SDB A;  5CKT A;  4ACA A;  4PJJ A;  3QYB A;  3IKT A;  2FEZ A;  2PMZ N;  2ISZ A;  2QCO A;  3DEE A;  3T8R A;  2X53 S;  3PA2 A;  3M9A A;  4RMN A;  5DYM A;  4C3H J;  2R6H A;  4HNT A;  3ZPN A;  1J59 A;  3W2G A;  2BSA A;  2XRN A;  3U21 A;  4G1V A;  3OYK A;  3C3W A;  2VI6 A;  2WWY A;  4W1U A;  4IKF A;  2BE5 F;  1WVR A;  4Z4V A;  1ACI A;  2ZNY A;  2VIX A;  2LDU A;  4HQM A;  3GTP J;  2M0C A;  3AG3 H;  2R7F A;  3ONU A;  3OW7 A;  4HX8 A;  1W36 D;  4OP7 A;  2DPD A;  1H8H A;  4LB6 B;  1YJW I;  4RA2 A;  2MBF A;  3KZY A;  3Q6R A;  4RDJ A;  2J7K A;  2VPL A;  2MA3 A;  2WY7 Q;  2L0K A;  2Q8K A;  4IPA A;  2K9L A;  4CDG A;  4LBV A;  4Z4U A;  1FX7 A;  4K2E A;  5D5U B;  1YJ9 I;  3CUO A;  3T1B A;  2A5Y B;  1F5T A;  3FZV A;  3MD2 A;  4YEL A;  3BH6 B;  2KIM A;  4PMH A;  1PJ6 A;  1BL0 A;  4H9G A;  1FOW A;  3WG9 A;  4A12 A;  3CCJ B;  3QOE A;  1MGT A;  4WWC A;  1X58 A;  3HC7 A;  4E70 A;  3UW0 A;  3F8M A;  1Z91 A;  1YW7 A;  1YIO A;  3ZQL A;  1QNT A;  4I7H A;  2QZ8 A;  2CS3 A;  2JWT A;  3KPH A;  1NH3 A;  3Q0U A;  2V7F A;  2HDD A;  3MHP A;  2NV4 A;  1U3E M;  3ABL H;  2QUF A;  2ZZQ A;  4Z4Y A;  1VQK B;  4PZJ A;  2DCE A;  3SZP A;  2OCE A;  1BIB A;  1Z9C A;  2HDC A;  2F48 A;  3S2D J;  1SFO J;  3ISX A;  4M3E A;  2XAG A;  2E60 A;  4YZX A;  4D5F A;  1KJZ A;  3CXC B;  3PUN A;  2VE8 A;  1TWG J;  5CVJ A;  2V1U A;  2ZBV A;  3WBK A;  4F55 A;  1FTT A;  1JT0 A;  2JA2 A;  2VQG A;  5L3D A;  1ZH5 A;  4U87 A;  4URR A;  4JX6 A;  2QEN A;  2OZ6 A;  1UZC A;  2LF7 A;  2VL8 A;  3CCJ I;  2QQB A;  4UZU A;  4XKB A;  1TT0 A;  4TMT A;  1Z77 A;  2FQ4 A;  4KT6 A;  2R3S A;  1KON A;  1YIJ B;  1IRZ A;  2LK2 A;  2QF7 A;  2W57 A;  3SFI A;  3FXL A;  1ZKG A;  4CCL A;  3JRE A;  1Y0R A;  2M34 A;  3F8B A;  3VMF A;  2FBI A;  1QH0 A;  3I55 B;  4YFX F;  5FB2 A;  1V54 H;  3VSK A;  4ZYE A;  3WE3 A;  2B63 J;  3JSP A;  1VQK I;  4XNF A;  3J7A Y;  4Z4S A;  4W8Q A;  3M8F A;  1Q81 D;  2HVR A;  3RTR A;  1QG0 A;  2XZP A;  1E17 A;  2R5Z B;  1XN7 A;  3N97 A;  3F8F A;  3AVY A;  3I59 A;  3VSU A;  1EP3 B;  3GFJ A;  1LM1 A;  5CVV A;  3KLN A;  1WJC A;  5M5W J;  3DTK A;  1NB9 A;  1KU9 A;  4GXO A;  3HSE A;  1OB2 A;  2O0V A;  4G8X A;  4XOT A;  3ZQC A;  3BTL A;  4EVI A;  2GBY A;  4FHT A;  3OAA A;  3QPH A;  3O8G A;  4HOB A;  4BY1 J;  3BJA A;  3LQ6 A;  1TNS A;  3T0Y A;  5B66 C;  1OB0 A;  3LQE A;  2KZV A;  1YIJ I;  1WI3 A;  4FTH A;  2L4M A;  4RDK A;  2Y69 H;  3DKW A;  3JU4 A;  3I55 I;  5K7F A;  3CC2 B;  1O8G A;  4A3I J;  4LBY A;  1O4X A;  4F93 B;  1I27 A;  4HW0 A;  1UHW A;  1CF7 B;  3V4G A;  2ZME B;  2NST A;  2O8X A;  1G4D A;  1FYL A;  1GJR A;  1Q9S A;  4N9H A;  3EET A;  2BM0 A;  2R7Q A;  3FWE A;  4DZP A;  2PMD A;  3D1N I;  3PVD A;  1NK2 P;  1OB5 A;  4ZV4 A;  3K69 A;  2BGI A;  3KYD B;  2Y31 A;  1LVA A;  4QFM A;  1H80 A;  1QGY A;  2H1K A;  1ETQ A;  1VQ8 B;  2JIZ A;  1FRQ A;  3KZI C;  2BMW A;  4E7L A;  4YC5 A;  1B9M A;  3BR3 A;  3DKX A;  3Q0W A;  1MD0 A;  2OBS A;  1RWR A;  4GRI A;  4N4O B;  3AK5 A;  3W2I A;  2EWN A;  2Q6K A;  2K9N A;  2V7W A;  3ZOB A;  1ODD A;  1JJ8 C;  3OZW A;  2ZZG A;  3LVB A;  2BV6 A;  5EZG A;  1YX5 A;  1BQE A;  1QZZ A;  1F9N A;  2BVM A;  2R7R A;  3QAH A;  3QPT A;  5E20 A;  2DIE A;  1AKH A;  5E3O A;  3RPU A;  1E79 A;  1GUU A;  1PJ7 A;  2V31 A;  3NRV A;  3KP3 A;  2P6S A;  4CUG A;  2VT3 A;  3Q5F A;  5IYD J;  1T0F C;  3CC2 I;  1UAA A;  2C6Y A;  1BX0 A;  2ZJR F;  4P6V F;  5B1B H;  1OYW A;  2ZL5 A;  1DPR A;  4BXX J;  2R5Y A;  5F4J A;  1R4M B;  3HYI A;  1FYK A;  4AF6 A;  2UVF A;  2CUF A;  2P6T A;  4RDL A;  3WYA A;  2LG4 A;  2E35 A;  4D5C A;  3QRF F;  3G1M A;  4AU7 A;  5A8A A;  2EFP A;  2WJY A;  2M3A A;  2QE7 A;  1V5E A;  3PFI A;  1DP3 A;  1VQ8 I;  1WSU A;  2HEO A;  1D3Y A;  4KJZ A;  4Z2Y A;  5KVR A;  1G2H A;  2GXG A;  1X1A A;  1U0J A;  2XIG A;  2ZXI A;  2IS4 A;  1CNF A;  1NDH A;  3PSS A;  1OCP A;  3CJN A;  3SQV A;  1EP1 B;  1ZTR A;  3A1P A;  1N8R D;  1WCM J;  5IK2 A;  4YZQ A;  3E1Y E;  3GVJ A;  2JT1 A;  4DW6 A;  1WHU A;  2IA2 A;  2DET A;  3GFI A;  1GV5 A;  2NVX J;  3QFR A;  1B2R A;  4PC1 A;  4M4S A;  2PG4 A;  2CQQ A;  4I01 A;  4B47 A;  4B43 A;  1JTA A;  5E3N A;  1HOM A;  1K83 J;  2VBZ A;  1WP6 A;  5J8F A;  5EDN A;  1BHE A;  1MMG A;  2VC1 A;  4M6X A;  3HOU J;  5E1Z B;  1AWC A;  3CMM A;  3J7Y J;  1O3S A;  1M1E B;  2DOG A;  3OY9 A;  1QA2 A;  5DM6 F;  2CF4 A;  2MLK A;  3VWB A;  3E6C C;  4HF2 A;  2M7A A;  4QUZ A;  1T2K A;  1RQP A;  1TTY A;  3HL2 A;  2PN6 A;  4CYC B;  3CF5 F;  5BSY A;  1QVF B;  1JKO C;  2X6X A;  4UUT A;  1QO0 D;  5EJC A;  1IGN A;  1JJ6 C;  4NHJ A;  5B6I A;  3RQI A;  1PYV A;  1K79 A;  2A05 A;  2N8G A;  3O2P E;  3Q0V A;  4EJU A;  1RMG A;  2Z2S B;  4IEJ A;  4U0V A;  1FJL A;  4OJO A;  4Z4Z A;  4RB1 A;  4II3 A;  3KYC B;  4X07 A;  3T53 B;  2F4I A;  3LST A;  3CCY A;  2PE3 A;  4HV5 A;  4YHB A;  2NT9 A;  4A5N A;  2W00 A;  3FXJ A;  5J6X A;  1EXM A;  2FOW A;  4HQE A;  2KIF A;  4RD1 A;  3FXO A;  4EV0 A;  4P3I A;  5LHH A;  1NG6 A;  1FMW A;  1ZRD A;  1J2X A;  2E7X A;  2IGM A;  3ISP A;  2NS8 A;  4IJA A;  2MH2 A;  3AVW A;  4BJT A;  2QLZ A;  4YAW A;  1JTY A;  1HW5 A;  1UEL B;  3I59 B;  1MBG A;  3DFG A;  4OWR B;  1FX0 A;  1DAR A;  2ZNZ A;  2A6H F;  1U5T C;  1IN4 A;  3R60 A;  2HYG D;  4ABZ A;  4ZYD A;  2CUJ A;  2RC6 A;  4PAA A;  1D8K A;  1DGW Y;  1N0V C;  5EF6 A;  3BP8 A;  2LY1 A;  1RUN A;  1D1C A;  3SEZ A;  3PQK A;  2VBS A;  3IHU A;  4GO1 A;  1CQT A;  2HYJ A;  1HXD A;  4OOX A;  3MCZ A;  4Z6Y A;  1F20 A;  3CES A;  4RD2 A;  4Y7C A;  2VC0 A;  3K4N A;  4HNU A;  5F0H A;  4MFE A;  2DMP A;  2X9D A;  3OR1 C;  2PJR A;  3ZZT A;  3UNG C;  2VUM J;  2HNH A;  4YDT A;  3OIP A;  1T6X A;  4JOM A;  1SD7 A;  4KKU A;  1LEB A;  3BG7 A;  3RKX A;  4FQG A;  1IV6 A;  2NNY A;  2DMU A;  1RR7 A;  1PJ5 A;  5B5E C;  2QDX A;  3BC9 A;  4Z03 A;  2RRE A;  2LYC A;  3LSH A;  2ISY A;  2DT5 A;  2CQK A;  1R36 A;  1SKY B;  1G3T A;  1FIP A;  1J75 A;  5GV8 A;  4CCK A;  3IH4 A;  2HKX A;  4GYI A;  2IQ7 A;  4F7Z A;  2RQP A;  3JTG A;  3LWF A;  3LSK A;  1R4N B;  2L01 A;  1Y6I A;  4M72 A;  2LRE A;  3JRF A;  2F4O B;  2DW4 A;  1TLL A;  4FE7 A;  2PIA A;  2UXX A;  2QA4 B;  1QGZ A;  3QWL A;  3GEZ A;  2GJK A;  1HVX A;  1AKH B;  5J35 A;  2D1V A;  1MBK A;  2B0L A;  5JBQ A;  3TOB A;  5IP9 J;  3W5V A;  3GFM A;  4E7I A;  3JRD A;  2CV1 A;  1G7C A;  1NB0 A;  4RAF A;  3VSV A;  3CC4 B;  3EQN A;  1COW A;  1FNM A;  2F5C A;  3JR9 A;  1JE8 A;  3MKZ A;  2RN7 A;  3WU2 C;  1K73 D;  2R5Y B;  4MIM A;  1D0X A;  1ZG5 A;  3PNT A;  4XID A;  1S3J A;  1LFB A;  3IAS 2;  4GYG A;  1IN8 A;  1JGS A;  2FRH A;  2K02 A;  4WF2 A;  4Y17 A;  4BJ5 C;  1BBY A;  3CCE B;  2PYH A;  3PO3 J;  3CRZ A;  4P26 A;  2VAS A;  2JA7 J;  2X1D A;  1H9T A;  1GDT A;  1HW2 A;  2VBT A;  5F1R A;  5HKK A;  3ZUG A;  5HZA A;  4G7W A;  3CCM B;  3ZSC A;  4HAM A;  2M8G X;  2NYX A;  3F9K A;  4BE0 A;  1AA7 A;  1A6Q A;  2WAE A;  3B8Y A;  1SMY F;  2E1N A;  3RQ4 A;  3HDD A;  4YZA A;  4LG3 A;  2XB0 X;  4B4C A;  1TL8 A;  4WZE A;  3WTY C;  4QWQ A;  2QA4 I;  4TSF A;  2ETH A;  2VPR A;  2IW5 A;  4ZGQ B;  4ZC3 A;  3VEP A;  1ZRE A;  1VQL B;  2EIX A;  3OYH A;  2HMA A;  1SFK A;  1U8R A;  1WDT A;  3W6K B;  2M8E A;  1H88 C;  4HA8 A;  3CC4 I;  4P9F A;  5D5V B;  2OF7 A;  2IA1 A;  2A5W A;  1W1W E;  3JRC A;  2RVC A;  3E7L A;  4I09 A;  1KGS A;  1S5L C;  1A31 A;  2J5O A;  3CCE I;  3BG9 A;  1JRG A;  1VTN C;  5EMN A;  1IV8 A;  3REO A;  2Y9Z A;  1Z6R A;  1ZG3 A;  1QVT A;  2K27 A;  5DEQ A;  4X0G A;  3CCM I;  4AYB N;  2F4M B;  1VQN B;  1W0K A;  4KFC A;  3B6C A;  1G7T A;  1T33 A;  1IC8 A;  3CP2 A;  2ZJ2 A;  4L8J A;  2HVS A;  2VOD A;  5KNL A;  3HOX J;  2PYG A;  1U8B A;  3GTO J;  1PXZ A;  2DBB A;  1R49 A;  4RDU A;  1QFJ A;  1VQL I;  3WU0 A;  3GF2 A;  1V0E A;  3TW6 A;  2FOK A;  2GJR A;  2CMP A;  2C78 A;  2FJ1 A;  5FD6 A;  2WZP P;  1UD2 A;  1K8A D;  1LKX A;  2ME0 A;  4EJV A;  1W7P D;  1Y0N A;  1OKR A;  4TMW A;  1BM9 A;  3K2A A;  2PLY A;  2EPF A;  2DLL A;  4BAY A;  2JVG A;  2Z1D A;  1X4P A;  2CC2 A;  1MRZ A;  3U1K A;  2R7U A;  1B72 A;  5HNF A;  4YAU A;  1REP C;  1HZE A;  2V7U A;  3DBH B;  3BJ6 A;  4A6D A;  2BYV E;  5JVG F;  4S05 A;  1X4O A;  4OOS A;  1VBL A;  1SAU A;  3OOU A;  2IP2 A;  4L0Y B;  1VQN I;  3WY9 A;  1Y1V J;  4BYY A;  1FBU A;  2ZIT A;  3KET A;  3I71 A;  4OOI A;  1NHA A;  3H1C A;  2E1M B;  1MH3 A;  3HRM A;  3FIS A;  2X6O A;  3A3B A;  5LGU A;  3I5U A;  2PJR B;  4J19 A;  2R7O A;  3JRG A;  3JAM K;  2LY2 A;  1O3R A;  5IYQ A;  3BWG A;  1ZK8 A;  2FBK A;  2X6W A;  3SJP A;  2RC4 A;  4LG0 A;  2W84 A;  1MKM A;  1CGP A;  5B3S H;  3WHB A;  5HLH A;  2YX4 A;  1HDD C;  1S8N A;  2Z6B D;  3IH2 A;  4C9Y A;  3VPR A;  3TH0 A;  1OPC A;  1BPL A;  4ZH4 F;  5D4R A;  2VOP A;  1KTW A;  3IRR A;  1E3O C;  3S3M A;  4KKS A;  2L4A A;  2HI3 A;  2MAB A;  3LA7 A;  1SFE A;  1KQ5 A;  2NVU B;  2K4B A;  2QTZ A;  1XX5 A;  3PEN A;  2CWE A;  3WTZ A;  3CME B;  3QPL A;  5FKK A;  1H85 A;  2H94 A;  3CLQ A;  4RBO A;  4LBZ A;  3CD6 B;  2XPV A;  2DEU A;  5K5Q A;  1O7F A;  1X1D A;  4ZDO A;  2VBE A;  2DJI A;  3FY3 A;  2DA2 A;  1HG8 A;  1KCC A;  2NPF A;  3W2V A;  1NG7 A;  3BG5 A;  1OQY A;  1E3H A; 
#chains in the Genus database with same CATH homology
 4ITV A;  1WFX A;  2O5R A;  4NK8 A;  2E5N A;  3K4M A;  4QPQ A;  2F6C A;  2X1C A;  1BLI A;  1J09 A;  4HST A;  1MMN A;  1E3X A;  3G05 A;  3GQ9 A;  4C2L A;  2XDV A;  2QX3 A;  2IGN A;  2BVL A;  3M1C A;  4E7K A;  2OV7 A;  2OC6 A;  2ZXH A;  3S3O A;  4IQJ A;  4E7S A;  4AYB A;  4H4K C;  3K6G A;  1O8I A;  4XKC A;  3EQO A;  3SDB A;  4ZJZ A;  5CKT A;  1EA3 A;  2RQQ A;  2W82 A;  3H5N A;  3QYB A;  3CP8 A;  3FDY A;  4PJJ A;  5CQG A;  3TL4 X;  5HOO A;  3HOS A;  4OJP A;  3DEE A;  2X53 S;  4YEJ A;  4RMN A;  4TKO B;  4ZDP A;  4BL0 B;  4HNT A;  3KYL A;  3L2U A;  3BCD A;  4Y4R A;  2DT7 B;  4Y33 A;  3ZPN A;  1N75 A;  2V1N A;  3U21 A;  1MNE A;  2XF7 A;  1V5G A;  2KRC A;  2CW7 A;  3OYK A;  3K70 D;  4KIS A;  4IKF A;  4ASU A;  5KCM A;  3OPO A;  4OAZ A;  1O8K A;  3A1Y A;  2VIX A;  3OL3 A;  2ZTN A;  2WY8 Q;  3FKS A;  3OW7 A;  1W36 D;  1Z3Y A;  2IGO A;  1LFP A;  2LH9 A;  4E7Z A;  1H8H A;  4ZDL A;  1E43 A;  2KPM A;  4PJL A;  2VPL A;  2WY7 Q;  2ZFU A;  2K9L A;  3BC8 A;  1ERD A;  4EAT A;  4E0F A;  3NWT A;  3T9G A;  4PUS A;  4DBQ A;  4YEL A;  3MD2 A;  3W3C A;  1IDJ A;  1EFR A;  4PMH A;  2X8K A;  4PJM A;  4PSW A;  3A35 A;  3QOE A;  1N77 A;  3HC7 A;  4XMY A;  2AQF A;  1GQ8 A;  3UW0 A;  3CF2 A;  3OYB A;  4CCM A;  3CJQ B;  1G59 A;  2CS3 A;  4XKV A;  2V7F A;  2JJ1 A;  4XL9 A;  3A2K A;  4PK4 A;  2ZZF A;  4HWV A;  3EUA A;  2ZZQ A;  3L2V A;  2W6J A;  2V7Q A;  4XM3 A;  2DCE A;  4OJ5 A;  2DT6 A;  1Y56 A;  2JUG A;  2KQR A;  2WPD A;  1MAB A;  2GK7 A;  2XZL A;  3QYF A;  4YZX A;  2E60 A;  4IX7 A;  4TT3 A;  4OZY A;  1DQU A;  4R79 A;  3VYS B;  2K5C A;  2OUM A;  1MND A;  4PJN A;  1UG0 A;  4F55 A;  1MMD A;  3AKZ A;  3K70 C;  3NE5 B;  2O1D A;  2JA2 A;  4JQF A;  4PSX A;  4BE2 A;  2VQG A;  3IAM 2;  3OE7 A;  3JUR A;  4U87 A;  4G7X A;  1QCX A;  2M4G A;  4URR A;  4YRV A;  2VL8 A;  4UZU A;  4XKB A;  1TT0 A;  2L7K A;  3SUC A;  1W36 C;  1E0E A;  3TBI A;  4KT6 A;  2VKH A;  1KON A;  3OEH A;  4CA0 A;  3C2G A;  4KKT A;  4YXW A;  4CSW A;  3PFY A;  1X19 A;  3PSF A;  4CCL A;  5HNH A;  4OJL A;  4HIZ A;  4B3X A;  2VJ5 A;  2HZD A;  3VSK A;  1VF7 A;  4W8Q A;  4XNF A;  3J7A Y;  4C30 A;  1I18 A;  2NZM A;  2F43 A;  2CFO A;  4HRI A;  2HVR A;  3RTR A;  2EWE A;  3QOD A;  2XZP A;  2VB6 A;  2ELJ A;  3GQ7 A;  2XAU A;  3HUG B;  4HG2 A;  1T95 A;  2M0M A;  3VSU A;  2V9K A;  3L2R A;  1WJE A;  2R7V A;  2E1M C;  2ZTG A;  3OYF A;  3GBG A;  1WJC A;  4DIQ A;  1MMA A;  3DTK A;  3H9Q A;  4XLA A;  2O0V A;  4XOT A;  2CUZ A;  2XC7 A;  1FMV A;  3OAA A;  3DPU A;  2F1M A;  1OB0 A;  1I8D A;  2KZV A;  5JHF A;  4XN3 A;  5FRM A;  3W2W A;  3PUB A;  4XN0 A;  1NRK A;  3ZPP A;  1BR4 A;  3DPL C;  3FBI B;  2INV A;  3JU4 A;  1OFL A;  1O8G A;  3E0J B;  4BDZ A;  2IGK A;  4F93 B;  4XR6 A;  3TMO A;  2NST A;  2Q2E B;  2IS6 A;  2XZO A;  3OS2 A;  3BH4 A;  3DKY A;  5AMV A;  3OL4 A;  4DNR B;  2R7Q A;  2VXZ A;  3DTI A;  2V26 A;  3FHN A;  3PJR A;  1D0Y A;  3VR6 A;  1PLU A;  2ZSI B;  2XND A;  1H80 A;  3OR2 C;  2JIZ A;  4CH7 A;  2L9S A;  4U4B A;  4Z06 A;  4E7L A;  4BDY A;  2KLO A;  3DKX A;  3H9G A;  3HG9 A;  3SEQ A;  3OYN A;  4GRI A;  4N4O B;  2MFZ A;  2DXI A;  1N78 A;  1RWR A;  2R4G A;  2IXS A;  3I9V 2;  4N4N B;  1O8H A;  1UD6 A;  1VLY A;  1PJR A;  2ZZG A;  3LNN A;  1YX5 A;  5FRO A;  4NNJ A;  2BVM A;  2R7R A;  2DIE A;  1NHC A;  5HLT A;  1WJF A;  1E79 A;  3H9J A;  2V31 A;  4OJ6 A;  3OMY A;  1IRX A;  4DK0 A;  5DN6 A;  4CUG A;  3WWG A;  2O17 A;  2I8D A;  1T0F C;  2D3N A;  3K4L A;  1UAA A;  4GQN A;  4J00 A;  3S8P A;  2IS2 A;  2R7T A;  4FAS D;  1WTH D;  1WPC A;  2DOA A;  4ZTF A;  3AFH A;  2Z8G A;  2UVF A;  4XOP A;  3MKW B;  3D5L A;  2WBM A;  2LG4 A;  5FRN A;  1V5F A;  1WJB A;  4AU7 A;  2WJY A;  2M3A A;  2QE7 A;  3FPP A;  1V5E A;  4LIU A;  2KVO A;  4RM3 A;  2VXD A;  1DP3 A;  3HAG A;  1W0J A;  1E3Z A;  4KJZ A;  1QJV A;  1LDK B;  1X1A A;  1U0J A;  2ZXI A;  3CJR B;  3SYT A;  2HDW A;  2IS4 A;  2UVE A;  2V4D A;  4CCJ A;  1DBO A;  3G2B A;  3OYL A;  4YZQ A;  5IK2 A;  4FXU A;  3HPG A;  3GVJ A;  1AIR A;  3DWL E;  3H5A A;  2UV1 A;  2Q1Z B;  4DJA A;  4OZZ A;  1JTA A;  3IUO A;  3HKZ A;  3FKJ A;  4LIV A;  3VDX A;  4B47 A;  4B43 A;  3S32 A;  4DGW B;  4P5O A;  5LD2 C;  2NTQ A;  1WP6 A;  2V4J C;  3DU6 A;  1BHE A;  2ZZE A;  1MMG A;  4B3G A;  2KHM A;  3A3G A;  3CMM A;  4E6K G;  3QYE A;  1UD8 A;  2WAF A;  3UR3 C;  3OY9 A;  3MKY B;  4B44 A;  4CCO A;  1OGO X;  3VWB A;  2MC4 A;  4CCN A;  1OGM X;  2WB1 A;  4HEA 2;  2M7A A;  1D0Z A;  3HL2 A;  1UD4 A;  2GK6 A;  4ANJ A;  1BR2 A;  2KDO A;  2X6X A;  1BMF A;  1O8M A;  1O8J A;  3OYC A;  1PYV A;  4NQW B;  4KIT B;  3OFN A;  1RMG A;  3HOT A;  2VJI A;  2Z2S B;  4OJO A;  2VKD A;  1TZL A;  3C2H A;  2R7X A;  2CW8 A;  3S93 A;  2QKL B;  4II3 A;  1QHG A;  3RCO A;  3T53 B;  2F4I A;  4BGD A;  4ZTJ A;  3LFU A;  2VBM A;  3CZ6 A;  4F52 A;  2NT9 A;  2X1E A;  2W00 A;  5KHD A;  1IA5 A;  2L9N A;  2LOO A;  1K28 D;  3OOC A;  2BW3 A;  1NG6 A;  3OIQ A;  1K5C A;  1FMW A;  2KL4 A;  4G6T B;  1O8L A;  1IB4 A;  2IGM A;  2LBF A;  3OS0 A;  4P22 A;  2A6T A;  3OYI A;  1RU4 A;  3OYE A;  1S9H A;  4XKW A;  4BJT A;  3VSL A;  4DNT B;  4BQN A;  1UEL B;  3LSG A;  2CK3 A;  5LFA A;  4OWR B;  2HVQ A;  4PFO A;  4XLE A;  3OYG A;  1FX0 A;  1KZL A;  3DQV C;  1CZF A;  1X1B A;  3D5R C;  2GOM A;  2CUJ A;  3LSI A;  4BQO A;  1DGW Y;  1QU3 A;  4Z1M A;  2XOK A;  3WQZ A;  2LY1 A;  1O8E A;  1D1C A;  2M7B A;  3SEZ A;  4BEH A;  3OYA A;  2PMZ A;  4F91 B;  2NSP A;  2F5V A;  3B90 A;  3K10 A;  3K4J A;  2JVH A;  3CES A;  4XQF A;  2IS1 A;  2HLD A;  3K4N A;  4HNU A;  4QPO A;  1E1R A;  3W2A A;  3GQ8 A;  3OYJ A;  3OR1 C;  3KRG A;  2PJR A;  3UNG C;  2W4S A;  2JSP A;  2HNH A;  3E1S A;  3OIP A;  2L5Q A;  4JOM A;  3OYD A;  4KKU A;  4XON A;  4C2T A;  3BG7 A;  3ZIA A;  1YE9 A;  1XG2 A;  1YX3 A;  3OYM A;  2X51 A;  3B4N A;  4W8T A;  4XD7 A;  4Z05 A;  3BC9 A;  4Z03 A;  2RRE A;  2LYC A;  3LSH A;  3L2W A;  3OEE A;  2ZSH B;  5TGT A;  1T5E A;  3I3L A;  3H35 A;  1SKY B;  3VYU B;  2VJJ A;  2L2O A;  3OS1 A;  2HPI A;  2X85 A;  4CCK A;  1O8F A;  2IQ7 A;  1VJS A;  4BE1 A;  4DK1 A;  4BS9 A;  2P0W A;  4RLQ A;  4BUP A;  1PE9 A;  3LSK A;  3KEY A;  1Y6I A;  3GRH A;  2LRE A;  3ZCO A;  4NC8 A;  2LRD A;  4ZYA A;  4IQ4 A;  2JDI A;  2JJ2 A;  5CDF A;  2CV2 A;  3LSM A;  3EUH C;  4MLO A;  1OLT A;  3A4C A;  3T51 B;  3S3N A;  2GJK A;  1V0F A;  1HVX A;  2NTP A;  2O0W A;  4G6I A;  1MW7 A;  1Z7L A;  4II2 A;  3NWS A;  2XGJ A;  4E7I A;  2CV1 A;  1NBM A;  3VSV A;  2VQH A;  3OWT A;  4EW9 A;  3EQN A;  1COW A;  2R9V A;  3MMY B;  3PL8 A;  3MKZ A;  3T56 B;  2VQC A;  3V42 A;  4D9J A;  1D0X A;  3PNT A;  3BCB A;  2VJ4 A;  3IAS 2;  3BLY A;  4BJ5 C;  1IDK A;  4W8R A;  2PYH A;  2QY1 A;  5C1C A;  4PFP A;  2VAS A;  2X1D A;  2WAD A;  5CQE A;  3LMW A;  3HPH A;  5HKK A;  1Z3X A;  1H8E A;  4G7W A;  2O04 A;  1LVK A;  4DBR A;  5HVQ C;  1DBG A;  4NK6 A;  1OHH A;  3ZSC A;  3F9K A;  3VMW A;  4BE0 A;  1D1A A;  1AA7 A;  2WAE A;  3B8Y A;  2LC2 A;  3RQ4 A;  4BAC A;  4YZA A;  1D1B A;  2INU A;  4LG3 A;  1ZEL A;  1UD5 A;  2FUG 2;  2E5Z A;  4TSF A;  3M8J A;  3RSN A;  2M5S A;  4NC7 A;  4ZC3 A;  3AL0 B;  2WSS A;  3OYH A;  1SFK A;  3LMM A;  4F92 B;  1W9X A;  1WJD A;  2X3H A;  4OAY A;  2HU9 A;  2NTB A;  2MD0 A;  2A5W A;  2K9M A;  3ZQQ A;  2GJP A;  4XLH A;  2CV0 A;  2CH0 A;  4LIT A;  3SZG A;  2M4K A;  4U7B A;  2UWM A;  5FL7 A;  2W1O A;  1JRG A;  3VYR B;  1WJ5 A;  4E7J A;  3GQA A;  4I84 A;  4BJ6 C;  2NOJ B;  2VQL A;  3AL0 C;  1E1Q A;  4X0G A;  4YZ0 A;  1UD3 A;  3BCF A;  3GVL A;  4IZZ A;  1DGR M;  1W0K A;  1WMR A;  1VZ0 A;  3DDY A;  3CP2 A;  4NUB A;  2HQA A;  3N05 A;  4L8J A;  2HVS A;  3H5R A;  3PSI A;  5KNL A;  2PYG A;  1PXZ A;  2QXZ A;  1BN8 A;  3EUK L;  3VMV A;  4RM2 A;  2R7S A;  2GOX B;  2XF5 A;  1V0E A;  1R6R A;  2MYS A;  1WJA A;  2GJR A;  2CMP A;  2BW3 B;  2WZP P;  2PEC A;  4AVZ A;  4BQQ A;  1UD2 A;  4W8S A;  2D3L A;  1LKX A;  2LBF B;  4C2U A;  1P9Q C;  2W7N A;  3HXL A;  1X1C A;  2V6E A;  3ZR8 X;  2WJV A;  2XF6 A;  3K4K A;  3EPZ A;  3K4C A;  2BSP A;  2LZJ A;  2JVG A;  3IP4 B;  2Z1D A;  1X4P A;  4RLF A;  4BXF A;  4J01 A;  2E1B A;  2R7U A;  4MR0 A;  5HNF A;  2Y0S A;  3D5S C;  1HZE A;  2RNG A;  3BG6 A;  1X4O A;  4B48 A;  2WAQ A;  1VBL A;  1SAU A;  3OOU A;  2QKM B;  1KMH A;  1Z21 A;  4BEH B;  2HPM A;  1K6Y A;  4D1Q A;  3PNY A;  4XLC A;  2E1M B;  2AQE A;  2BOL A;  4E4H A;  4E7H A;  3K4B A;  3A3B A;  3ZXS A;  3GQB A;  1GLN A;  3PNV A;  2PJR B;  2R7O A;  2UUZ A;  1BR1 A;  2LY2 A;  3RPU D;  4MXN A;  2W6I A;  3H0D A;  1KCD A;  4Y3O A;  2X6W A;  3L2Q A;  2KRH A;  2WA0 A;  1OR7 C;  1JI8 A;  1BOB A;  3ONQ A;  1OOC A;  2Z6B D;  2KP6 A;  1O8D A;  3DU5 A;  4U49 A;  4C9Y A;  3KX2 A;  2VBK A;  1G8X A;  4HSR A;  1O88 A;  1BPL A;  4DOZ A;  1KTW A;  3S3M A;  2NT6 A;  4KKS A;  1PKV A;  3VST A;  3DLA A;  5CPR B;  2MAB A;  3BCA A;  3LL7 A;  3ZGK A;  4F3Q A;  3DTE A;  4XLF A;  1EE6 A;  4B3F X;  1X0C A;  4HPQ A;  1HA8 A;  4BU2 A;  4XOR A;  3H94 A;  2VLA A;  3GVK A;  2XSJ C;  3ZRG A;  2KMU A;  1QHH D;  1X1D A;  4CZC A;  4ZDO A;  2DJI A;  2R7W A;  2VBE A;  4P1W A;  3FY3 A;  2X6Y A;  3DPT A;  2K3P A;  3VYT B;  1HG8 A;  1OFM A;  5C1E A;  1KCC A;  4JMQ A;  3KEW A;  3W2V A;  2ODL A;  3FBN B;  1NG7 A;  4FET A;  2Z16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...