4XOPA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
596
structure length
596
Chain Sequence
b'FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 235
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xopA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xopA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xopA02
4XQFA 4MXNA 2VBEA 4XN3A 1XG2A 2PYHA 1OOCA 1O88A 1PXZA 1O8LA 2X6YA 2O04A 2VJJA 3VSTA 4YEJA 1AIRA 4W8QA 1PE9A 2IQ7A 1RWRA 1RMGA 1JRGA 4XL9A 2X3HA 3ZPPA 1OFLA 2VJIA 4W8SA 4EW9A 1O8IA 4OJPA 4URRA 2PYGA 3B4NA 3ZSCA 3JURA 3GQ7A 2INUA 4C2LA 3VMVA 3EQOA 4OJ6A 4XOTA 4XLAA 4Z05A 1O8KA 1O8HA 4Z03A 4YZQA 4XLFA 5C1CA 4YZAA 2VBKA 2NZMA 2X6XA 1K5CA 4XONA 2INVA 4XKWA 1X0CA 2UVEA 3GQAA 4OJOA 1KCDA 1O8JA 3GRHA 3SUCA 5AMVA 2QY1A 4XNFA 3EQNA 1OGOX 4YELA 1RU4A 4Z06A 4W8TA 2EWEA 1O8FA 2O0WA 2O0VA 3GQ9A 1IDJA 2O17A 1HG8A 1KTWA 4XM3A 2NTQA 5C1EA 4XORA 4U4BA 4PMHA 4U49A 4W8RA 4NK8A 4XN0A 4HWVA 2NTPA 2NTBA 1IDKA 1IB4A 3VMWA 3KRGA 1QCXA 2VBMA 1CZFA 4OJLA 2X6WA 4AVZA 3LMWA 2NT6A 4OZZA 2PECA 1H80A 3B8YA 2X85A 4XLCA 4MR0A 3UW0A 1JTAA 4XLHA 1PLUA 4I84A 2QXZA 2Z8GA 3WWGA 2NT9A 4XKVA 4OJ5A 1WMRA 2BSPA 1O8MA 3FY3A 3B90A 1BHEA 1NHCA 1IA5A 1KCCA 3VSVA 2QX3A 4XMYA 2ODLA 1O8GA 4XR6A 1OFMA 1O8DA 1OGMX 3VSUA 3GQ8A 1EE6A 4YZ0A 1O8EA 1VBLA 4OZYA 2UVFA 4XOPA 2NSPA 2O1DA 4YZXA 1GQ8A 1QJVA 1BN8A 4XLEA 4NK6A 3T9GA 1DBOA 2NSTA 1DBGA
chains in the Genus database with same CATH superfamily
5FKLA 3FM3A 2WZNA 1QRBA 3T8RA 3PUFA 1F9NA 1SFXA 3PO2J 4DJAA 1VF7A 3OZVA 3KLNA 1FNNA 1TWGJ 3BG6A 2VFOA 2IP2A 2V9PA 3I53A 1FNDA 2ZITA 5ICEA 3QP5A 4PK4A 4S04A 4LITA 1H9GA 1MABA 1YS6A 2EZKA 1MZBA 3D5SC 3R60A 4BHCA 1XDSA 3J7YJ 1B4AA 2G0EA 2GXBA 3TW7A 4W8SA 4A69C 5C4JJ 4PGHA 3AL0B 2K9LA 4CCKA 2OCCH 5LEJA 4HX8A 1QA1A 4BKXA 4QTRA 2FOKA 1ELOA 2W4SA 1GLNA 1Y8RB 1ZR2A 3EQLF 3W2GA 2Y48A 4RMNA 1MBGA 3E5XA 1FEXA 4CUGA 1T5EA 3WQZA 5C1CA 1VNDA 3WXMA 4OIOF 1R1VA 3M8FA 5FRNA 2YX7A 3BG3A 2EV5A 5JVGF 2BM4A 4XONA 2OBPA 5LHGA 2E1MC 5J35A 3D5RC 1KONA 2V7XA 2WBMA 5FKMA 1KTVA 2NAZA 2COBA 2XAJA 5JHUA 2CFXA 4GGGA 2IS6A 2VOPA 1A5JA 3ZMVA 4PJNA 1E64A 2PE3A 1R36A 2V6CA 1IXSB 2UV1A 1HA8A 3A35A 3BQYA 4BJTA 3CP2A 1F1ZA 1HW1A 5GTIC 5DD8A 1IGNA 4ZGQB 1OYWA 3DWLE 1ZLJA 4WXCA 2O0VA 1ZARA 4PGGA 3CJRB 3NQOA 2VBWA 1XX5A 1KTWA 1TWCJ 3JTGA 2VFPA 1BC7C 3OEEA 1VQPB 3KP4A 2BW3A 1BI0A 1XGSA 2EPFA 1SMTA 2IVMA 4O6JA 4W8RA 1FY7A 1MNEA 2DJIA 3ZGKA 3L9FA 2A61A 3B73A 3JRHA 1LE8A 3RTRA 5D8KB 3GX4X 1U5TC 2IA0A 1NK2P 4B3XA 4HF1A 2ZZFA 3KRGA 1IB4A 1W7PD 2DAOA 4LK1F 1X1DA 3RY8A 2HKXA 3Q9SA 1IDZA 2CV1A 4I09A 4UHTA 1SANA 4IRGA 2ID3A 3TMOA 3G6EB 2COMA 2VODA 4G7WA 3GZ6A 2QGUA 4FHTA 1ZR4A 1JHFA 2BYVE 4Y4RA 4A3FJ 2M0MA 3CMEI 1FRNA 3BCAA 3CDHA 3KEOA 2H6CA 3JQQA 5IYBJ 2OTJI 4MFDA 4XK4A 1EP3B 4C9YA 2QX3A 2NOJB 3GTLJ 1KQ0A 4H9GA 3VMFA 4DK0A 3OYAA 2L4MA 3HDDA 2XC1A 2CQQA 4P55A 4C2MJ 2NSPA 1IUYA 2LBFB 2KKOA 1KU3A 3QPLA 3JRFA 2YU9J 4WK8F 1RNLA 4BACA 2DCUA 3GFMA 3KEWA 1OCOH 4JX5A 3TQNA 4KIBA 4BBRJ 2Y9ZA 4PGOA 1XMXA 3JSOA 2JPBA 4A2UA 2J7KA 3ZBTA 1UD6A 4XN3A 4U88A 5M5XJ 2CW5A 1IN5A 1G4DA 4I99C 1VTNC 3I5UA 2YWFA 3E5QA 2LD5A 2BZTA 3EPZA 2ZZQA 3CW2A 3CC7I 4WWVA 3U6BA 1AIRA 3U1KA 3E6CC 1QFJA 3VYRB 1RWRA 1WQ2A 2WJVA 4UVAA 2ID6A 1EFTA 4ZYHA 2CS3A 3PIOF 5FNZA 3DBRB 2MD5A 4DYCA 1MBFA 2DFIA 1ETOA 3KP3A 3QPSA 1H89C 3JURA 1SD5A 2WAFA 4BDZA 5J47A 4WWCA 3QYEA 1KQ9A 1QPIA 2ZL6A 4NB5A 2XPVA 4GDFA 2Q6IA 4DBQA 2O9LA 3AK5A 3OOPA 1OPCA 3HXLA 4M6YA 2FBHA 2PJPA 1ZGJA 3HJEA 1X1AA 5B3SH 3HTUA 3FXLA 4ENNA 4OAZA 3ZCOA 3F22A 4QFMA 4MTDA 1QVTA 3CPXA 3JAMZ 1TLHB 3KCCA 3OYNA 3EYIA 3MEXA 3SLNA 4U87A 2ZJRF 2JUGA 3F9KA 5F27A 2KT0A 5HDGA 1KMHA 3OAAA 2OK7A 3GQBA 2OPTA 4RB2C 1E3OC 3GRHA 1YLOA 1W36D 5KW9A 3P9CA 1KJZA 2V7TA 3OY9A 3K1NA 3OJXA 4P2NA 1YIJB 5M3FJ 3SDBA 4IZZA 2NXNB 1M1EB 4M74A 2CV2A 4L18B 1ACIA 3CC2B 5JHFA 2IXSA 1IB0A 5EEHA 2R5ZB 2JVGA 1PUEE 2EWEA 1O8FA 3C7JA 1HA3A 5GAGJ 4D7MA 2HLDA 2AXTC 3H9JA 4IHTA 4IRHA 3ZQLA 1P4XA 2PMUA 3BTLA 4LBYA 1YX2A 3KYCB 4BNCA 2MYSA 1CF7A 4X7EA 1AMOA 5J1YA 2NS8A 1MMAA 2DMNA 2XAQA 3HUGB 5J4VA 1KQ8A 3AVUA 2IS1A 4A3CJ 4DNRB 3LNQA 2GA1A 1XCVA 3COAC 4WZEA 2A6TA 1T56A 1GDTA 2QTLA 2X51A 4WF2A 4N4NB 5DD4A 2STWA 1BJKA 3VMWA 3PIPF 2V9VA 3K4MA 2I10A 1FLIA 3LMWA 5EMNA 1UD2A 1ZM9A 3M8JA 4IF4A 3CUOA 2FVGA 2X3UA 4I98B 3WHCA 1IRFA 2PN6A 4KISA 1DGRM 1VQ4I 2VN2A 3OYGA 4I84A 3CDLA 3WWGA 1A04A 4OJ5A 3ZMZA 2BSPA 3E5UA 2GLOA 3S2DJ 1STZA 3BJOA 2ZB9A 4E7JA 3IL2A 2CGPA 2F5FA 1NHCA 3S16J 2P7CB 4UUVA 4L8JA 2L9VA 4RBOA 2KIQA 3VDXA 4G12A 1TWHJ 3WY9A 1APLC 1FNMA 2G7UA 1ZG1A 3I59B 4HQEA 2KISA 1IJWC 2R7VA 1TYWA 3BWGA 5GTHC 1FWZA 4PJLA 3ZIAA 2D5VA 3BQZA 1WXRA 1IZ1A 1D8TA 2QKLB 1Z7UA 4IQ4A 4ENKA 2DFFA 1GUUA 1N78A 4EM2A 1R5OA 1MMDA 3K0LA 2VBUA 4G7ZF 3NB2A 3BC8A 2NSTA 5A8AA 1W35A 4EJUA 2PI0A 4Z2YA 2Z5UA 4JK1X 1OOCA 1OLTA 4QUZA 2XF7A 5JLWA 4HLXA 4A3KJ 2KPMA 1DP3A 5FJ8J 3Q5FA 2JDIA 2HKOA 3QQAA 3VYSB 3WTZA 2QMUA 1H9TA 4CA0A 3BY1A 1TP4A 5ED4A 2CUFA 1OFLA 4AC0A 2XGCA 2Z3YA 3Q0UA 2XT4A 2MA3A 4BU2A 2LRDA 1PDNC 3FXJA 5DCFA 4YG2F 1HKQA 2VQHA 3RSNA 5CVIA 3CCRI 2V1UA 4UY8I 4DQLA 5E8GA 1TYUA 3HHHA 1MJAA 2DA3A 1I1SA 2V26A 4B1RA 4G7OF 3CMEB 3EQOA 1RRJA 2V31A 4YZQA 4BDYA 1I8DA 1OB2A 1VQMI 2DXIA 2OTJB 3PSSA 2B9SA 1P4AA 4U0WA 5E79C 4G6QA 3QU3A 5FLXZ 1BOAA 5TGTA 4ABZA 1P2FA 3BJ6A 4AU7A 4IHWA 3BROA 2MC3A 1FSEA 1AHDP 3CJTB 2BX6A 5DCMB 3PSFA 3CCEI 4II3A 4HNVA 3B8HA 1R4MB 2EFQA 1WFXA 3HRUA 2W24A 1R22A 1WOSA 2CK3A 4MO7A 4CYCB 1BQEA 2DOFA 1MMSA 1YS7A 4JBAA 2MABA 2D1VA 2MH2A 4KDPA 1JA0A 4YFXF 3OYJA 3P9IA 4A5MA 2O0WA 3GUDA 4N9IA 1SD4A 2R7QA 4EVIA 4XKCA 5A2QZ 2TCTA 4V19K 4BXXJ 3SY2A 2DT6A 4W1UA 1F36A 4R79A 5C1EA 3KE2A 4M2LA 1FBQA 3GTKJ 1TSPA 3H5AA 3H9NA 3HOSA 2IAIA 4M9SA 5FO5A 5FLMJ 4FE4A 2JVHA 1W9XA 2KRHA 3ONUA 3O6BB 4IX7A 4P12A 2IGMA 3GTOJ 2DFHA 1IDKA 5L3DA 1EKEA 2CRGA 5D6FA 1WI3A 1VQ6I 2RN7A 4AC9A 1GT0C 1ZREA 4FCYA 4GYIA 1OCZH 4AVZA 1QPMA 2DCEA 4B3GA 1H80A 1Z1DA 2PMZA 5DN6A 4UV8A 1VI0A 4QVAA 3H0GJ 3LSIA 4AWXB 3CCSI 2XKPA 4KJZA 3DU5A 3DPTA 1R49A 1YW7A 1T0FA 2B5OA 5DNSA 4OIRF 3C18A 2NT9A 4PMHA 2WSSA 3Q38A 3NWTA 4TKOB 4BE0A 1NH3A 3KFWX 1FZPB 4MIMA 3BC9A 3FPPA 2HPMA 3H3VK 3FHNA 1ULYA 4BQNA 4UUSB 4TMZA 4PC6A 2DTRA 4TT3A 3CO7C 1OFMA 1ZRCA 2BM6A 1U78A 4KN4X 5EZGA 1YIOA 2CUJA 1S4MA 3H5NA 3I64A 3QPHA 2HS5A 1LE8B 4NUBA 2XASA 4XRMA 3OOCA 3ASOH 2A05A 2VQGA 4B4DA 3CP8A 3OW7A 2DT7B 5F08A 3T9GA 2LKSA 2VNHA 3JQRA 3OWTA 4MEYF 1Z67A 4HLYA 2GBYA 4XQFA 1ZELA 3PL8A 3ML3A 2G9WA 4HOBA 3OYCA 4JP0A 2UXNA 2O8KA 3BG5A 4AM3A 1K9MD 3PSZA 3CO6C 1YX3A 2E60A 2H1LA 3LSTA 4BY7J 1K78A 5DUIA 3QU6A 4XL9A 1SM4A 2DQLA 4JYKA 5IP7J 2PMHA 2WAQN 2ZJQF 1EFUA 4YALA 4EW9A 2ECCA 1VQ4B 4M71A 4OM9A 2ZC2A 3BPXA 2O6GE 1XC5A 1Q86D 2ADUA 1I18A 2X48A 2ZXIA 1HSJA 2YUHA 2A5YB 2ZFWA 3E3VA 4F52A 4L9VA 1B9MA 1I5ZA 2M8EA 1WOOA 3BY6A 3S1QJ 4A3BJ 1OISA 3KYDB 2EFWA 4N3GA 2K5CA 5E18F 1ZHFA 4KFCA 2IGOA 3HOUJ 2Z16A 4N0BA 1QHGA 3CESA 3K4BA 4M3GA 1BA5A 3R0JA 3R6KA 1R1TA 5HXBA 1O8JA 4E7SA 2O0YA 3W2VA 4RJLA 2W85A 1RUOA 2QGGA 2R4GA 4HRIA 3WE2A 4DZPA 3DBLB 2YWGA 1NJID 3GCMA 4Y52J 3MZ8A 4KH3A 2TDXA 2JRTA 3PJRA 3GVAA 4Q47A 1P6RA 4JX4A 1JKRC 1G6NA 1D1BA 1TVCA 2NS0A 3KP2A 2K9MA 3GXOA 5J1RA 2DN0A 1T98A 3W2WA 3GQ9A 1ODDA 4ZDLA 3M8EA 4BL0B 1OYYA 4Y13A 4B43A 4GQNA 2H09A 4C3JJ 2BEOA 1LJ9A 2D3LA 1QA6A 2E7XA 3L2QA 3MKWB 3Q3SA 3MQ0A 3CCRB 3WGGA 3CUQA 3PNVA 1P4MA 4OPWA 2DYSH 3S1MJ 4OJLA 1CZFA 2MH9A 5TV2A 1LM1A 2X6WA 4YEIA 1G3YA 1FIPA 5IYNA 1VQMB 4Q5SF 2QQ8A 2BPOA 2VKHA 2EA2A 5BS6A 3VSLA 3LSKA 2PJRA 4EMSA 2JJ2A 2BXZA 1PLUA 3E0JB 1R5ID 2EB7A 3HKZA 2XF6A 1FOYA 1ONVA 1LVKA 1Z6RA 3DEEA 2AO9A 3WTTC 2ZTGA 3F0CA 2NS7A 1H42A 1O7FA 1WPKA 1TLLA 2Y30A 4RGSA 4BAYA 1JXSA 2VNKA 2NVXJ 2W57A 1FMWA 2AHOA 3QE2A 4Z1MA 3ZP5A 1LKXA 1CF7B 2K9SA 3ZN0A 1EE6A 2CJJA 4XSXF 3PENA 2EFPA 2I8DA 2C2WA 1YFHA 2VL8A 3ZBUA 2CFOA 3F6VA 2O1DA 1IV6A 2CQ7A 1QJVA 3EDPA 1D5VA 2MLKA 2LLKA 2OCEA 4EEFG 2OA4A 1BN8A 3E1YE 5JBQA 3IWZA 3AVTA 4KMFA 3RPUA 3D1NI 3TGNA 5EGOA 1YRNA 1QQIA 3CXCB 1G3TA 1W4MA 2CC2A 1O88A 3A3BA 4RGRA 3ROUA 1HF0A 2JN6A 2NVUB 2V7VA 1B2RA 1NG7A 2ZXJA 5LD2C 1R5GA 2HI3A 3IRQA 4NBSA 2WAEA 1E0EA 3GFJA 4U7BA 1EA0A 2JJ1A 1K4ZA 4I76A 1RMGA 3BNWA 1UAAA 3CCSB 4FTHA 2W25A 2R5YB 3HZJA 2J5PA 3OL4A 3SKBA 3MKLA 2V4JC 4ASUA 4PC2A 4LG0B 1FTZA 5J6XA 3S14J 2XZOA 1ZTRA 2JSCA 1E1QA 1JT0A 2INUA 3R4KA 4CYDA 2E35A 4XOTA 4X0GA 1XTAA 3K4CA 4TN1A 2JA2A 4BY1J 3KYLA 4Z4SA 3JRCA 4UZEA 1PJ6A 4QWQA 1LVAA 4IEJA 3NRVA 3HOWJ 4RCYA 2KP6A 1WORA 1HCRA 3BCFA 2ICWG 1K6YA 3H3ZA 3C2GA 3H36A 2INVA 1GV2A 4RA2A 4UB6C 1AA7A 2ZNYA 2P5VA 1X0CA 4C3IJ 3A0BC 2W6JA 4IHYA 1HKTA 2WB1N 3HSFA 5KVRA 2M9HA 1RI7A 1EXMA 1XB2A 3T8TA 1NBMA 2DA2A 3SUCA 4XRSA 4ZGNB 3AG1H 4IRIA 1ZK8A 5FIUA 2XDVA 3E6DA 2XAUA 3ZQQA 3UKGA 3JTHA 3I4MJ 4Z06A 3A03A 1YJ9I 2KDZA 2CBXA 5D5WB 1B6AA 1T0FC 1HF2A 1FYKA 4NBQA 4J00A 1HG8A 1IN4A 1Z77A 3BTCA 2ZZEA 2NTQA 4P26A 3KP6A 2FD5A 2ELKA 1PUFA 1QVGB 3ZXSA 2MLGA 4YIRX 2FU4A 2RVCA 3DXJF 2HNHA 5FB2A 4XN0A 3WHBA 2FA5A 2STTA 2XUBA 5CVVA 2KLOA 3CCUI 4G1BA 2GK7A 1KQ5A 5F0FA 3VPRA 3A02A 2FMYA 2ZMEA 1G59A 4A3EJ 2DA5A 4PC1A 1PP7U 3LQRA 3W2FA 3OYDA 4MR0A 2A69F 1F5TA 2JA6J 3IKTA 3H35A 5DS9A 1PKVA 1W0UA 2V1XA 1UHWA 4MFEA 5DUKA 3K70C 1YO5C 2WV0A 4IW3B 1N8RD 5L3EA 3JSPA 4C43A 1BI1A 1ZM3A 2HVQA 2LSOA 1VQ7I 3RKXA 1VQ5I 1I39A 1OGJA 2VPLA 1BHEA 3ASSA 4A0YA 2JIZA 4KKSA 2K85A 2WC2A 4BBSJ 5M5YJ 3CZ6A 4KT5C 2CQXA 3WGIA 3FBIB 2UZKA 2PIAA 2GAUA 3CDIA 2M30A 4BYYA 1J5YA 4PJMA 4UVBA 3IH2A 3ASPA 1VBLA 2R93J 1T38A 5HDKA 2FMLA 2GOXB 2WJYA 4HAMA 2X1CA 1I27A 2Y0SA 3H9GA 3OR1C 3QFSA 2HMAA 2XROA 1QZEA 3FKJA 2VLAA 1NTCA 2L9SA 3ASNH 2F5CA 3CF2A 3PNTA 4TMVA 4BGDA 4U9UA 5F4MA 1X19A 4F3QA 1YOVB 1SD6A 3RIRA 2DA7A 1VHEA 2FX0A 3QFCA 3R6JA 4Z4ZA 2PBIA 1BW6A 1UHSA 5EEAA 5CVUA 1GXPA 1HC8A 2GZWA 2CH0A 5CVJA 4E7LA 3RCOA 1W2BB 4KT6A 1GAWA 1ORKA 3ZQHA 3TDZC 3FX3A 1ZH5A 3GMEA 2F43A 3ESWB 3VODA 3CPWB 2CNDA 5F0CA 5KHDA 3ZSCA 4AYBA 3W2EA 4D0PA 1Q82D 3D26A 2VFNA 3QPTA 2F1LA 4OPVA 2XB0X 2Q6LA 3QODA 4Z03A 4JMQA 3TO7A 2O61A 1PJ7A 4QSHA 3RIQA 2K86A 5JVTA 1WJ5A 1TNTA 1BJAA 2R0QC 2EWNA 3CC2I 1F43A 3IC7A 1K5CA 1OCRH 3W2AA 1EP2B 3LQQA 4RM2A 4RD6A 3CUQC 4IOCF 4NQWA 5L3BA 3BQJA 3HOYJ 1QG0A 5DDGA 4OMZA 3KIOA 1SFUA 2DBBA 4XBFA 1JUSA 3T53B 3VNUA 1RU4A 1K78B 5KK1A 2GJKA 3BTIA 2QBYA 4A3LJ 3AGQA 3BR0A 5EG0A 4HQMA 3DEUA 2EQRA 2NVYJ 4IO9F 3H92A 3W2IA 2R7WA 1VQKI 2Q6KA 3PFIA 1BPLA 5IPAA 1EFRA 3A8KA 1YE9A 1QNTA 2H27A 2LZJA 5E6TA 3BTJA 3J81K 2ZFUA 3JQPA 4J19A 4RDKA 3TOAA 2F6CA 1Y1WJ 2GIVA 4XD7A 1T2KA 3G73A 2FJ1A 1R6RA 3C2BA 2VOOA 4PC7A 4OMYA 5J8CA 2BMWA 1K8AD 4PZJA 3U2QA 3LO8A 3I54A 1MMGA 4MTEA 3PQJA 2K9NA 2XAGA 2HQNA 2R3SA 1Y0RA 2YSRA 1I6HJ 2VQCA 4Z4UA 3B8YA 1X3UA 1KU7A 1K79A 3UW0A 2M8GX 2DERA 1DPRA 4CDGA 4F93B 1UCRA 1B9NA 1DQUA 1ZGWA 4Y17A 1ETQA 1ITYA 2CQKA 2OV7A 3O8GA 1WJAA 3GLXA 2F48A 1U8RA 4V02C 4A3IJ 4CXFA 1FX0A 3WTVC 5EDNA 3T51B 3B90A 3FY3A 1SKQA 5M3MJ 1KCCA 1L1IA 1J09A 3O3KA 3WG7H 3VSVA 5FKOA 5F6FA 4QV2A 2D9RA 1M1KD 2AQEA 2ECBA 1YJ9B 1J9ZA 3Q0VA 1QUFA 1D0YA 3VSKA 5HKKA 3CB4A 2VT2A 3HOXJ 1S3JA 1UB9A 2DMPA 2R7RA 3H94A 3CUQB 2WY7Q 2Z9OA 1FBUA 2A5WA 3FKSA 4AIDA 2GREA 2D2WA 3NARA 1OQYA 1E3ZA 4OP7A 3D0SA 2M45A 2E34A 2KQRA 3WTXC 3MN2A 2X1DA 4CGZA 3TDUC 5HS9A 2DOEA 4ITVA 6PAXA 2F5DA 3CCUB 2PJRB 5IT9Z 3A3GA 3I9V2 4PJ0C 1RQRA 2KHMA 3M1EA 2XNDA 4R8HA 3SEZA 2LKXA 1NHAA 5K5OA 1N07A 2BOLA 3ELKA 3Q0WA 2IQ7A 2AHQA 4I6ZA 3LQEA 1R9TJ 1T33A 1IN6A 1SC7A 3T0YA 4ASNA 3QRFF 1AIPA 4AF6A 3BCDA 3LA2A 1FYLA 5E3NA 1QUEA 4RD4A 2PYGA 3B4NA 2XTYA 2E1MB 5IYDJ 2XAFA 4NCNA 3GFLA 2F2EA 3FKIJ 5H59A 1T6YA 3WGHA 2UUZA 1OB5A 1VQ5B 1VQ7B 1LEAA 2Y31A 3GVKA 1TZLA 4XLAA 2DT5A 2ME0A 1IG7A 1V5EA 4A93J 2DOGA 2DETA 1ZRDA 3GTGJ 2M7BA 5GV7A 3F21A 2XEXA 3AGPA 1DG1G 3SEJA 4DQ2A 3ZZ0A 3HGGA 1DU6A 2WADA 2PFBA 1XB4A 2B0LA 2QDXA 3DPUA 5EGOB 3KLOA 5TJJA 1WSUA 1YRNB 2PG4A 1EA3A 5CYVA 4H0EA 1Z0XA 4P5OA 3HBLA 2RV8A 2Z1DA 2ZMEC 1A35A 2ESHA 5LLQA 3GTPJ 4B48A 1SEUA 2FQ3A 2N8GA 4MLOA 1XDUA 1LLZA 2YS9A 2KDOA 2DU9A 1FBSA 4A12A 2XF5A 4WZKA 2IGNA 5KAIC 3SZGA 1NDHA 2GJRA 3Q3AA 2OZ6A 1U5TB 3C1DA 4LIUA 4EJOA 1XFOA 2V7QA 2XNCA 4YAFA 2WTEA 2KFDA 3HEFA 5GPCA 3OL3A 3V42A 2MD0A 3HRSA 4JQFA 3S32A 1WJCA 1K4TA 1KU2A 4ZC3A 4V2FA 1I3QJ 2LY2A 1XN7A 3FXRA 2BSAA 4KKTA 1BOBA 4PC3A 4Z4YA 2ESNA 1HW2A 1KK2A 5HNHA 3ZPLA 3F8MA 1DP7P 3A01A 4P6YA 1L0OC 1YQAA 3ZQIA 5DYMA 3FDYA 1GO2A 4F91B 2BGJA 3HYIA 4HE5A 4P3IA 2ISYA 4CO8A 4I7HA 2QEXI 1FJLA 5K7FA 1W0TA 1HOMA 2IEKA 3I3LA 4GCVA 4PDKA 3WTYC 1ZM2A 2QXZA 4XKVA 5J3LA 3DLLF 1W5TA 2HCJB 2VI6A 4OAYA 3MCAA 2M5WA 1D0ZA 2R7UA 2Z2SB 3CCYA 3K7AJ 1O3TA 3K2ZA 3FISA 3HSEA 1JKPC 4P22A 3IHUA 2ZJPF 1OGMX 2V5IA 3MZYA 3WNBA 4IHVA 4AIJA 3O2PE 4A0XA 1IRGA 1L3LA 2DDAA 1HZEA 2VXDA 1VQKB 3J80K 4YZXA 4UVCA 3K69A 2O5RA 3N97A 5A88A 1G3WA 1X1PA 2LTPA 1MDMA 4NK6A 3GO5A 1QFYA 1VQLI 1LDKB 5ICFA 5FRMA 3L7WA 2V7FA 2BM5A 1W0KA 2FEZA 1VQ9I 3W6KB 3JRAA 2GXGA 2NVTJ 5J1UA 3E6BA 4CCMA 3KETA 4KNYA 2K40A 3GF2A 4M73A 4LBWA 2RDPA 2HXIA 3GLLA 3VNVA 1K8FA 5E1XA 1Z21A 3JRBA 2EIMH 2BM0A 5L3GA 3L2CA 2V1NA 4X8IA 2X1EA 1WSRA 2GM4A 1S6LA 1VF9A 1K7AA 1J9IA 3F6OA 4C3HJ 2H8RA 4Y7CA 2A68F 3HOTA 2ZJ2A 3KPHA 4OJ6A 2O3FA 1E2XA 1A36A 2JK3A 2L9RA 5CJ9A 1I7PA 2P6TA 2DEUA 2F5VA 3ASRA 4Q7JB 4MYUA 3ZUGA 1QZYA 3ISXA 5C3EJ 3TO6A 3QAHA 2FF4A 4BHBA 1T39A 4YXWA 3ZOBA 1H8EA 5IY5H 3SYTA 1SAUA 1B1BA 1OYIA 3LFKA 1GAQA 1R7JA 2E36A 3U9GA 3S15J 3DBHB 3N6ZA 2BGCA 1KK1A 1ZG3A 3FXUA 1MGTA 1DDIA 5LRRA 1N0UA 2XHKA 4RS8A 2Y75A 3GWZA 1B59A 2L5QA 1YITI 1T6XA 5BQTA 1GHCA 3BR1A 3I55I 4TMWA 4MEXF 4BJ6C 1QRYA 5FKNA 1VQ8I 2VBZA 3GTMJ 2PMZN 4YAOA 1J59A 3DTKA 5H20A 4I0BA 1W0JA 1Z3XA 2C5HA 2WZPP 3G71I 4UV9A 5K5QA 4BQAA 1TYXA 1S9HA 1QO0D 4HWVA 2CW8A 5AONA 4X0CA 4YCQA 1GVDA 1FYMA 4IQJA 4B4CA 5IK2A 4CCNA 1MBEA 5HVQC 1IHMA 3SQVA 1YG2A 2QQ9A 3F8NA 3RYPA 2BHZA 1NB0A 4BXUA 4OZZA 2CUZA 5EZHA 2X85A 4XLCA 2RNJA 4RAYA 3RKWA 3T5XA 2RKHA 3EUAA 1FMVA 4P3YA 2DYIA 2J8IA 3P5JA 4KITB 1QVUA 2Z8GA 4UNOA 2HXOA 4AUXA 1TUIA 4A5NA 1Z6TA 1PP8F 1J7KA 4Y9UA 2EIKH 1R23A 4EGYA 2QBYB 5F4JA 5E3OA 1B72A 1Q1VA 1BX0A 2PMDA 2HYJA 4I0AA 2KIMA 3MHPA 5IT3A 4CICA 3L2VA 1Z9CA 3K4LA 2EZHA 1MIJA 2VKEA 1GXQA 2HPIA 3BZCA 4G8XA 5FL7A 3SHFA 1D1NA 4YZ0A 1W7PA 4N4OB 3M4OJ 1P9QC 1O3QA 1T95A 2R7DA 3I71A 3T56B 2X53S 1USSA 2L9NA 1YI2I 4WXHA 5KCMA 4XLEA 3V8JA 3GVLA 2IW5A 1TT5B 1KZHA 4M3DA 2C6YA 1V0EA 3RDIA 2ZSIB 4R1HA 3GTJJ 5FROA 2ZSHB 5D6EA 4FX4A 1Z3YA 3ZR8X 1IXCA 1YJNI 2X6OA 3DU6A 1QHHD 2GQFA 3LYCA 2HOTA 2OD5A 1D8JA 2K3FA 4RD1A 4M1KA 3S3NA 2D74A 4RPBA 3JU4A 5HOOA 5D5UB 3ZPPA 3MMYB 4G94A 5DEQA 1UD4A 2IBDA 2LMDA 4AIKA 2BW3B 3DKYA 2KMUA 1X1BA 3DF8A 2NNYA 1FSHA 3IH4A 2QZ8A 2RQPA 2CSOA 4RD0A 3M7GA 4Q48A 3MFKA 4LBVA 2HTJA 1EWYA 1U3EM 5HNFA 3OYMA 1ON2A 4PJJA 3DEWA 5ICCA 1U9OA 3HOVJ 2KVOA 3GQ7A 1HVXA 2C5BA 4BXFA 1TW3A 1QA2A 1TQIA 2X0LA 1S7EA 1Y0UA 3K4JA 4CZCA 1IV8A 2NYXA 4ESBA 2QSGX 2DY1A 1K83J 4LMYA 2J5OA 3L1PA 2MW8A 5D4SA 1E3PA 5FO1A 2X6XA 5ILUA 5L3CA 5CVRA 5IP9J 4G6IA 1H85A 2DW4A 3BCBA 4OOIA 4TV7A 3ZC3A 1Q1HA 2EA4A 1A6QA 2FSWA 2NOGA 4PFOA 5B1BH 2GPJA 1KCDA 4Z4VA 3OYHA 3N90A 4YDTA 4HYEA 2Q2EA 4YFKF 1RC9A 3P26A 2OUMA 3KP5A 5BOXA 2DDBA 1VQLB 4QPQA 5F4OA 3W2HA 1QGPA 5IYQA 5DM7F 1YX5A 3DQVC 5BNGA 3I56I 1WDTA 2VFMA 1VQ9B 3E1SA 1GV5A 2EK5A 2FX3A 1H8AC 2W84A 3CD6I 4WCGA 2K4BA 4O5VA 1BX1A 2EFGA 3QOPA 2LVSA 4A0ZA 4M72A 3AG2H 3AVXA 1OJLA 5HDNA 5THXA 4D5CA 3F8FA 3LSHA 2Z33A 4GO1A 4XSZF 1H88C 5HLGA 2HWVA 3HKZN 3ABUA 4IHXA 4BQOA 4XRFA 3TKYA 4OOSA 3ULQB 2VBMA 4FN5A 3SJPA 3N05A 5JLXA 3MKZA 3BR2A 3JCUC 3GIRA 1EH6A 3Q6QA 4MHGA 2MFZA 3SFIA 3MAJA 4XLHA 1R58A 5IOYA 1SFOJ 1IRZA 2JN9A 2X4HA 2KIFA 2M3AA 1Z05A 1WMRA 2XB5A 1F4KA 2VB6A 1OCTC 1TTYA 2E71A 1V5VA 5FA6A 2M1BA 4OPSA 2XTXA 3J7AO 4AF7A 1DPUA 3CCLI 1YITB 1GVJA 1O8GA 2CQNA 2ODLA 4H4KC 4HDUA 2JSPA 4OIPF 1MBHA 1GR1A 3BZ6A 5K1YA 3OSFA 1WSVA 3V7AA 3I55B 5GPAA 3F8CA 4V2GA 4Y7NJ 3PO3J 4XOPA 2L3DA 4G7XA 4M6VA 1VQ8B 5LHIA 4U7DA 4ROXA 1BIAA 4DYQA 1TNSA 2EZIA 3V76A 4P1WA 3G71B 4RD2A 2R7FA 1Q7YD 3CMAI 1XGOA 2M87A 3M07A 1ETWA 1XG1A 1FNCA 1JNYA 1Q9SA 1IC8A 2QA4I 1QVFB 3VSTA 5LBQA 1PE9A 3WBKA 4OINF 1F20A 1RR7A 1ZRFA 4C30A 3KL9A 1JTXA 1OFDA 1NG6A 2HGCA 3V8KA 4WQMA 1KK3A 1ERDA 2G0YA 3W3CA 3J80Z 2ZKZA 3IKVA 1SVOA 3DP7A 4WXDA 3MCZA 4HA8A 4E70A 1VLOA 1N75A 4E0FA 3HM5A 1SAXA 3OFNA 5D5XB 4NDLA 3SJMA 2BE5F 4IHSA 4CCOA 4RCZA 2FUG2 4IVNA 1I1GA 3HRTA 3I58A 3CCJI 4CHUA 1CNEA 3GVJA 3J81k 2LBFA 4RAGA 1RPWA 2D45A 3FM5A 2EILH 2R7OA 3BY2A 1YI2B 3TEDA 3P9KA 4LK0F 3K6GA 9ANTA 1LFBA 4J0QA 3HAGA 1HW5A 1U0JA 1WVRA 3TBIA 1KA8A 4OPOA 3E6MA 3OS2A 2XRNA 2K4JA 4AIHA 4OOVA 1YJNB 1E3HA 4QVJA 2DLLA 1BL0A 3VO1A 1E1RA 4EGZA 1DDNA 3DKXA 4ENJA 2IT0A 2VFQA 3CRZA 5B66C 1P4WA 1S7AA 4QIWN 1IDYA 4ENMA 3LNNA 4DW6A 3QP6A 3CC4I 2NTBA 1HKSA 1JJ8C 4FK8A 1MJBA 3V4GA 4KIGA 1MNDA 2IRFG 2IGKA 4EV0A 1NRKA 4QHYA 3P7NA 4B8XA 3GFIA 1O57A 1Z91A 4BH9A 4EJWA 1YW8A 4HDVA 3C3WA 4YAUA 4LOCA 2ZO4A 4I02A 4XIDA 2R6HA 2E5NA 1TTTA 3ZRGA 1UZCA 4CSWA 4P9SA 3B02A 2DPUA 5KSWB 4LLNA 3RI4A 2OF7A 3U1DA 3TO9A 1AWCA 2HDCA 1O8MA 3AVWA 4DIQA 2Y0SN 2R7TA 2Z99A 3ZQFA 3JAMK 1XCBA 3H0DA 1BM9A 2XGJA 4PSXA 4LG3A 1E17A 1E3XA 5B6IA 5E8IA 3RQ4A 5AN9A 5CKTA 2JMWA 1QQ1A 2NNNA 2XNJA 3WODF 3I56B 2EINH 4JX6A 4RM3A 2Q0OA 3CD6B 1E43A 2OBRA 2EJRA 1MD0A 2QM3A 4RLFA 1U2RA 2OQGA 5F1RA 1N08A 2CUEA 4A3DJ 1Y56A 2M4GA 1T6ZA 1ON1A 3HUGA 3L09A 3MZHA 4NC7A 4Y9RA 1BN5A 2VE9A 4HEA2 2GOMA 4B3AA 2K9QA 3HGYA 3DCFA 3A8IA 3IUOA 2L02A 4FETA 4AYBN 1D5YA 1WOPA 2X6YA 4HG2A 2W48A 4DQKA 4LLGF 1P7JA 1Q81D 1ZM4A 1RZ4A 4ZJZA 4E7KA 2HVSA 4IL6C 2QF7A 3VB2A 5HLIA 1BLIA 4W8QA 5LHHA 5FFXA 4IKFA 1B72B 4O3MA 2X8KA 2X3HA 4YIIA 1FX7A 2VJIA 3WU0A 4M3BA 4OJPA 1KYWA 1TWAJ 4KICA 2CWEA 3CLOA 3VR6A 3LA7A 3MD2A 4P6VF 1UMKA 5D4RA 3JR9A 1V5FA 2KIUA 1O8LA 4Z05A 1QX4A 1WJBA 1WU8A 3CCLB 4HF0A 4F7ZA 1VFCA 1SKYB 3OJWA 3LVBA 2B0RA 2XZLA 1OR7A 4ZTJA 3I59A 1MSFC 3SLDA 1BR1A 4ACAA 2LOOA 3F3XA 5D5VB 2PX9A 3AL0C 4M6XA 5EEGA 4HV6A 4IPAA 1X4PA 1Y0NA 1BIBA 1JTYA 1EV7A 1W36C 1ZLKA 4IOAF 1DABA 2W7NA 3OS1A 5M5WJ 1DGWY 2EV6A 3W6JB 4HPQA 1OGOX 3AAFA 4J01A 4ANJA 1DDGA 3CMAB 1R5NA 4YC5A 1S5LC 1EP1B 2VNIA 3U2RA 2HQ5A 2G7HA 2JUCA 4GRIA 2QA4B 4BE1A 2DMQA 2XTWA 2OBSA 5H2FC 1WJFA 3AG4H 1BI3A 3PVDA 1UD5A 4XM3A 4L5IA 1VZ0A 3ZZUA 2L01A 3K9TA 2I5UA 3G1LA 4RB0A 2LYCA 3LFUA 1TL8A 4HF2A 4U49A 2HR3A 3BR5A 4XKBA 2NTPA 1JA1A 1VLYA 1VJSA 1IO2A 2GXAA 1KYZA 1X3ZB 1K28D 5CPRB 1JJ2B 1QCXA 1WH7A 2MC4A 3DTEA 2YPRA 3L2WA 1KQSB 1DARA 2NT6A 2W7ZA 5BPIA 3GYHX 4KUMA 3PA2A 2P0WA 5CLSA 2M5SA 3OIQA 2QUFA 4KIFA 3WNDA 2E2HJ 3CLQA 1H8HA 2OJED 3SJZA 3CCJB 4DNTB 2VBTA 2JWTA 2DTZA 3CTAA 2Y2ZA 3WU2C 2VBSA 5DCMA 3FXMA 3ASTA 5FLXK 1IXRC 2Y0MA 4M0LA 2YUSA 3BLYA 4CZZA 2CMPA 1LFPA 4B09A 3OOUA 4BHPA 1IA5A 4CYCA 3NEUA 3U21A 1XPXA 3IH3A 1MMNA 1G8XA 4OWRB 4Y33A 1BMFA 5H5JA 3SXYA 5BSYA 3H09A 2OZUA 5J40A 1HDDC 1WGXA 4C2UA 2B63J 3VSUA 3ONYA 1IN8A 1CQXA 3PUMA 4K1XA 5FD5A 4OZYA 1Y6IA 5LFAA 3LAJA 3I1FA 1HDPA 3OMYA 2GIZA 1UJ8A 1ZQ3P 2E1OA 4A6EA 3JREA 2QVOA 1EFCA 2DI3A 1TWFJ 1G3SA 1S7OA 5DM6F 5IYCJ 3G05A 1QFZA 3B6CA 5A2QK 1DBGA 2XPUA 4Q4ZF 1MH3A 1ZYRF 3J7AY 4D9JA 4HZFA 3CC4B 2D3NA 4TMTA 1XG2A 2EZLA 1MW7A 2VQLA 3OSGA 2OYNA 2O04A 3S2WA 2OC6A 4G6DA 3A8JA 4C0SA 1D3YA 2V7WA 2QN6A 1IUFA 2XVCA 3PETA 2GQQA 1XSXA 1ZKGA 2DO7A 3FIWA 1E62A 2OTLI 4XICA 2FNAA 1W87A 3AG3H 4RM0A 4M4SA 3E97A 2HEOA 3NWSA 3R6SA 4ESJA 3K10A 1REPC 3ZZTA 1LLWA 3FMRA 2P8TA 3LSJA 1OGIA 4X07A 4PCQA 5E3MA 2AXLA 1D1CA 1JI8A 2A6HF 2E2JJ 2E1RA 4MQVA 4RD3A 1AKHA 1S29A 1O8HA 4UUSA 4ZDPA 2OK8A 1RR8C 3BG9A 3DTIA 3EYYA 4DZJA 2NZMA 4YFOA 3CCQI 1W34A 1JT6A 3IV5A 1Y1VJ 4XKWA 3L2UA 4ZDOA 3ASQA 5ILSA 3ABMH 2LR8A 1QGYA 3WE3A 2PEXA 1Z7LA 2M4KA 3I4NJ 1XE1A 2EFOA 1N25A 1FP2A 1SD7A 5JLVC 4KA4A 1K4SA 2L7MP 3EQNA 4G5GA 4ACBA 3DLAA 3T1BA 1MRZA 1WP6A 2OQRA 2BF4A 4UUTA 1PJ5A 1Y8QB 4PSWA 3WG9A 4DGWB 2LP0A 3NAWA 2QE7A 1XSVA 4AVPA 3FHZA 2CF4A 3BDDA 4MQ9F 2CRVA 1S8NA 2X9DA 5HLTA 4E6KG 4RLQA 3SYJA 1R1UA 1W1WE 5IOZA 4D7NA 4A6DA 3VWBA 4PFPA 1TBXA 4X1EA 2ZL7A 4ESFA 3MMPA 3N4MA 5DTDA 2X0KA 2BXYA 2F5EA 3LSPA 1VQOB 1QRCA 1JE8A 2ACJA 4DOZA 2FE3A 3VEPA 3BR3A 4FWTA 1K6OA 5J4YA 1VQNI 4M9ZA 2VBXA 2R92J 2F1MA 2LG4A 2OAZA 3IWFA 5FKKA 2W1OA 3GSIA 4ZCMA 2IS4A 3BP8A 2PECA 1ZG5A 1LDJA 4RAFA 1COWA 1KRHA 2QENA 4LC0A 1RETA 1LUJB 1QA3A 2RAEA 2P5LC 4LB6B 1XGMA 3CCVI 2FNPA 2JA7J 2XGEA 4Z6YA 3K70D 3ERED 3RYRA 3VO2A 3LAPA 4C2TA 1OHHA 4Y3OA 4HBLA 3A4CA 1ZGAA 1ZUNB 3KEQA 3HOZJ 4LIVA 1KD1D 5F64A 5HS7A 3RZOJ 3VFZA 3GQ8A 3TW6A 4UZUA 1YJWI 4P9FA 2DA1A 2HYFA 1IN7A 3OYEA 1G7RA 3TH0A 2KJBA 4G6TB 2XSDC 2ETHA 1R5BA 4MYTA 3EUKL 5HLHA 4ON0A 3F8BA 2AQFA 1X3WB 2DMUA 2L7ZA 3FXKA 3ISPA 3SEQA 1USTA 5AIPA 3OYIA 1XMKA 4LD5A 2HZTA 1KZLA 2E1BA 1DBOA 3WBJA 2JJ7A 4L5JA 1IW7F 1ETVA 1UFMA 2LY1A 4W97A 5KAFC 1OR7C 5F0HA 3CF5F 2PYHA 4EM0B 4II2A 4HX7A 1U6GA 1X2MA 2F4MB 4ZZLA 2K02A 3W5UA 2KJCA 2J8KA 2F4NA 2VJJA 1OFCX 3HIFA 4LFUA 4Y15A 1AU7A 3JX8A 3FJOA 2VBVA 5ERIA 2DK5A 4HSTA 1PUFB 4DK1A 2V79A 2PLYA 3UNGC 4DBRA 2WV1A 3FZVA 3HPGA 2TRTA 4RB1A 2BVNA 3OKXA 5HZAA 1X58A 1FDRA 2VKDA 3HL2A 1ETKA 1FPQA 5CQGA 5E17F 4L5EA 2E1NA 2V4DA 1DU0A 3ES9A 5FD6A 2E5ZA 3ZQCA 1EH8A 2ZXHA 2ZMEB 4NC6A 3ZQGA 4GFBA 4OIQF 4BUPA 5C4XJ 5GV8A 4FQGA 5JI6A 2JA8J 1CQTA 2C77A 4ZCLA 3WU1B 3G4SI 4L0YB 3SZPA 3CMMA 5E20A 2XAHA 4U0VA 5EYRA 2I1LA 2RQQA 3CQZJ 2LY9A 3A0HC 3ZMDA 5EJCA 2B7CA 1B8IA 4A3GJ 1I6XA 2BHYA 3R0AA 3DKWA 1FNBA 1POGA 4HW0A 2R7XA 3EUHA 5E1WA 1R4NB 2HU9A 3BG7A 2RC4A 4WX9A 5J8FA 2JA5J 3RJPA 2P5KA 1WI9A 2XKOA 2VJ4A 4BQQA 2UXXA 2JQ7A 2LDUA 1LPQA 2W82A 1X2NA 2XGXA 2VC0A 1IDJA 2LREA 2FBIA 3ONQA 3CJQB 3BH4A 2OTLB 3H5RA 2VZLA 2EFNA 1A31A 4RDLA 2LF8A 2R5YA 2CYYA 2EIJH 1EZGA 1T08B 5JR3A 2VKVA 4QPOA 2C78A 1O3SA 3K4KA 4LG0A 3MVPA 3S93A 2BGIA 1WWXA 2XT2A 3ML6A 2DODA 2JTVA 4I2OA 2V1DA 2QCOA 3V7CA 3PUNA 3FXOA 4ZYEA 4BJ5C 2C4TA 2L7FP 1FRQA 1V0FA 3OZUA 4ZTFA 3AVYA 2F4IA 2QKMB 1V54H 2WY8Q 4QLCU 1YYVA 1QH0A 3QYFA 3CCQB 1LDDA 1UELB 3GZNB 5GAHJ 1O4XA 2BBYA 3RPUD 3LSGA 1OKRA 3EETA 4HSRA 2BV3A 4Z4WA 1K73D 2Y9YA 2ELJA 4MNUA 3JRDA 1FOXA 2AS5F 2HFHA 2V9KA 1OCPA 4EJVA 3REOA 3TL4X 2R7SA 2VT3A 5HZBA 1WZ2A 4XRSG 1I50J 1EH7A 3DFGA 5CQEA 1GJRA 2K3PA 2KZGA 1T6SA 2KZVA 3G1MA 2HVRA 3JRIA 4KKUA 2ISZA 3QFRA 2DJNA 3TOBA 2IA1A 3FK6A 3L00A 3B82A 4NQWB 3TP0A 2HZDA 3PA1A 4RLZA 5B1AH 1TW2A 5B5EC 4TSFA 1BR4A 2BY2A 4NNJA 1OB0A 2EBIA 2HDNB 2O6WA 2A07F 2M34A 4AD9A 4HNUA 1N06A 3K2AA 2QWWA 2L2OA 4EQQA 2HOSA 2B7EA 2CW0F 1VQNB 1FC3A 1N77A 4KYWA 1XGNA 3KZYA 2DFEA 5EG0B 3J81Z 2XZPA 1BBYA 5LGUA 3VYTB 4E7IA 1HLVA 4CQJA 3FK7A 1MBJA 2KRCA 5K7HA 2DA6A 2R9VA 5A89A 3Q39A 4G1VA 1G7CA 5H6QA 1O3RA 4UAJA 1OFEA 1X1CA 3AFHA 2LKPA 4RGXA 3CCVB 3PUBA 1BR2A 4UZFA 4LB5A 2LC2A 3IRRA 2Q8KA 2VC1A 3U6KA 4KMUX 3TP3A 4OOXA 2IA2A 3VMVA 3I4PA 1WTHD 3CC7B 5C44J 3BH7B 4YFNF 3SQNA 1OCCH 3HHGA 3K1MA 5LGNA 2E2IJ 2KRFA 4XLFA 2WWYA 2K27A 1SMYF 3FF5A 1CGPA 1U8BA 1WPCA 2QZAA 2ZNZA 1SFKA 5HS8A 3WTUC 1JKQC 1YJWB 4I01A 4ZV4A 4XLNF 5LGTA 3W6VA 2BM1A 5TISC 4R71A 2NRAC 5DS0A 3LJYA 3GQAA 3D5LA 4M3EA 3VYUB 3PNYA 3BT9A 3ECOA 4RDUA 3HB9A 4CH7A 1MSEC 5FO0A 4XNFA 1F60A 3PQKA 2FQ4A 2HTSA 3QFTA 3KEYA 4D1QA 2H8WA 2V7UA 2DOAA 1WH5A 3R61A 4Z4TA 4RDJA 2WR8A 4W8TA 2VXZA 4X6AJ 1FTTA 3Q6RA 1RKTA 3LSMA 1XMAA 3V8LA 4BEHA 3F23A 1V4RA 1XS9A 4DNCA 3PSIA 2Q1ZB 1IJEA 5JFRA 1QGAA 4YIFA 4XORA 2O03A 2IOUG 4M3FA 2JT1A 1AKHB 2XC7A 3KZZA 2EH3A 1WHUA 4FISA 4G9YA 2MGQA 5AIQA 2P3MA 3ABTA 3W5HA 5F04A 3DPLC 3ECHA 2R7ZJ 5JMCB 1ENHA 3V7SA 5DSZA 1ZAOA 3G4SB 2BVLA 3AVVA 4IJAA 1S72I 3OYKA 1LB2A 1JTAA 3H9QA 3I0TA 3JW4A 1TQPA 3G2BA 3QYBA 3K1PA 1X4OA 2F4OB 2QQBA 2ZCWA 1JGSA 2VASA 1RQPA 3BOQA 3LL7A 1U2WA 2FOWA 1S0UA 3QOEA 3SZTA 4GXOA 1E79A 1A6IA 3DU1X 1MBKA 2BY3A 5IP6A 1UD8A 3B6AA 3E20A 4XMYA 1Y0YA 1M90D 3LMMA 4S05A 1P7IA 2M7AA 4RGUA 1PJRA 4E7ZA 1MH4A 3KZIC 2RGVA 1W5SA 2QSFX 2YX4A 1XSDA 2ME6A 3FWEA 1BC8C 2ZBVA 1JUPA 4ZYGA 4LGWA 2L54A 4L9TA 3GTQJ 3HG9A 2XGDA 3M1CA 1C0WA 5BSXA 1XQBA 1LQ1A 5FGMA 3BR6A 2WA0A 3PM1A 2GJPA 4X06A 4PUSA 4KN7X 4DYRA 4XLPF 3AKZA 1T8IA 2NV4A 4MXNA 2EV0A 3OYFA 1TYVA 1PXZA 3O8HA 2Y69H 5IYRA 1CNFA 4X7DA 5GP9A 4ZH4F 2GK6A 3PFYA 1QU3A 3WTSC 4YEJA 3SZEA 1G2HA 3FXQA 2LK2A 1SVMA 1H0MA 5GAEJ 1JRGA 4NHJA 3WYAA 4PABA 2NPFA 4ZCIA 3EUHC 1YHQI 5TR9A 3GEZA 4YRVA 1UD3A 3GZ5A 4URRA 4LBZA 3K4NA 3W5VA 2H6BA 1YLFA 4L9JA 1IAWA 3OEHA 1LFUP 3S3OA 5IYWA 2XOKA 2E19A 2K7LA 1N0VC 3A01B 1BW5A 2XSJC 1JGGA 2WPDA 1O8KA 2DPDA 3FMSA 5L3FA 2OU2A 2QYOA 3OR2C 1WJEA 2WAQA 4UB8C 3S2HJ 3P4GA 5IYPA 3B78A 4FXUA 2CO5A 1G7SA 4CCLA 1BI2A 1U9NA 4HV5A 1MJ9A 3G3ZA 4RAZA 1LNWA 4B47A 5EF6A 5HODA 1I3AA 2UWMA 4BPRA 2L7KA 5F1JA 4D5FA 2PQ8A 4OJOA 1TC3C 1JUMA 2HQRA 3BJAA 2DQRA 1R5HA 1WJDA 5AMVA 1V55H 2HYGD 2C4UA 1TQMA 5ILVA 4L0ZB 3ABLH 3Q9VA 1V3FA 2VJ5A 5LRSA 5LEKA 4PAAA 4MGRA 4ZZDA 2O8XA 3BH6B 1R71A 4Z4RA 2QLZA 4X05A 4B3FX 1SVLA 2BN4A 4F7DA 3C2HA 2DK8A 1FIAA 2LFBA 4LLLA 2VIXA 3V7RA 2OBTA 3S1NJ 2BVMA 4N3NA 2O17A 5IT9K 3ZN1A 3CCMI 2RREA 4BE2A 3CCEB 3CJNA 4L9NA 3ZMTA 3HTSB 1MDMB 1UHMA 1GVHA 5K5RA 2HOEA 4A3MJ 3RZDJ 4GYGA 4NK8A 1KGSA 1D8KA 2CG4A 4YHBA 1BJZA 3ABKH 1HQCA 3LOCA 4E4HA 4F92B 2NVQJ 1KK0A 2E1CA 4YAWA 2VONA 3FMQA 3A1PA 1G7TA 1WCMJ 2HQAA 2LF7A 2CU7A 1HSTA 3OV8A 2VBYA 1B8IB 3ZPNA 2DA4A 5E3LA 5FFZA 2CV0A 2MSYA 3HRMA 4M9XA 5GADJ 3S1RJ 4EJTA 3MWMA 4X7FA 3OE7A 4S0HB 4HE6A 4CCJA 1IJFA 4EATA 3A2KA 5J3OA 1VQ6B 1XD7A 3RPQA 4BS9A 4P96A 4HX4A 3FPKA 3CMYA 2HOAA 2XIGA 3G1OA 1JJ6C 1HBXG 3S17J 3LA3A 3GBGA 1VHOA 1U5TA 2Q6OA 4ZYAA 2E7WA 5TRDA 3GW2A 3IAM2 3X2QH 2UVFA 2HDWA 2IPQX 1EJ9A 1P92A 4FASD 2JPCA 4WZLA 2CW7A 1TT0A 2FXAA 1D2EA 3OYLA 2H94A 1MKMA 2YU3A 1YTYA 5BMZA 3NE5B 2MG4A 1FP1D 1IRXA 2P81A 2VBEA 5TY0A 2WYRA 2ZBKA 3S8PA 4E7HA 2BY0A 2RC6A 3DV8A 3HSRA 2VNJA 2DYRH 3ZMSA 3NAUA 2VYQA 2R5ZA 1VQPI 3OP1A 1RIOH 1S72B 4EM1A 2MBFA 1O8IA 3QWLA 2ZTNA 3BPVA 3ZQ7A 3LQ6A 3OZWA 3QSYA 1SFEA 3L2RA 2ZZGA 2P4WA 2BV6A 1RESA 3F72A 3H3UA 3IP4B 4P9UA 2HDDA 4U0YA 4C2LA 4TMXA 4RPDA 4G7HF 1B23P 2XPWA 1W5CC 1JKOC 1FOKA 2LNBA 5FLVA 4YZAA 3UR3C 2VBKA 2VPRA 1O7LA 4FX0A 5DV5A 1WKMA 3LWFA 5LMZA 5H6RA 2RC5A 2QQAA 1N05A 2DMTA 3G6EI 1RUNA 1V5GA 2DIEA 2EIXA 3J7ZI 2BY1A 3ERMA 3OIOA 2UVEA 2FBKA 1WRJA 3OPOA 1QZZA 4ZYDA 2YR2A 1RKWA 1D0XA 2ZBUA 2QY1A 3A1YA 3S3MA 2ZL5A 3VOEA 3OS0A 2VUMJ 5CDFA 4YELA 1VQOI 1PVEA 1YW9A 1FT9A 1UMQA 2IJLA 4P25A 4JRAC 3WNCA 2B7BA 1FOWA 3M9AA 3M3YJ 1AOYA 1W7PB 2VE8A 3RKQA 2FRHA 4RB3C 2WB1A 3IAS2 3P27A 2M2EA 1ETYA 4OU0A 4U4BA 1EF4A 1KU9A 2A6EF 4UXNA 4A3JJ 1Y39A 1J75A 3RKYA 4ETSA 2V6EA 4WZTA 1J2XA 1OMIA 3OW2B 1YHQB 1NK3P 1QGZA 3FBNB 4N9HA 2ELHA 2P6SA 2O7OA 4FE7A 3HC7A 2QTZA 3OIPA 2XV4S 4HNTA 5KNLA 2IS2A 2PLFA 3HPHA 4K2EA 4B44A 3MKYB 2YWEA 2XRLA 1R00A 4IXAA 2Z6BD 3BZKA 4HIZA 1E63A 5ICGA 3KX2A 4FT8A 4LJZF 4P1VA 4F55A 1HXDA 2YWHA 2QYUA 1ZN2A 2L0KA 2ZXWH 2GWRA 1K61A 5BPDA 1MNMC 4M53A 1QBJA 1KC8D 2P7VB 5L46A 5K7ZA 4BEHB 1ETXA 4NC8A 1JB9A 3H1CA 2LH9A 3LSRA 3JRGA 2JZYA 3RQIA 1IF1A 1JHHA 3SFZA 3OYBA 4XR6A 1O8DA 3WTWC 4JOMA 2QSHX 1A8PA 1O8EA 2W6IA 2L4AA 1LEBA 1J0RA 3DDYA 3KP7A 3ZMUA 2A3SA 1UG0A 4X7CA 2QEXB 1D1AA 3CCMB 1GQ8A 3SDGA 2RNGA 2M0CA 2D1HA 2KL4A 1UG2A 3E7LA 5E1ZB 5D8LB 1DUXC 2H1KA 4EH1A 1CLWA 2Q2EB 1NB9A 1YIJI 2BM7A 1PYVA 2W00A 2F3LA 2GA2A 2JRMA
chains in the Genus database with same CATH topology
2LY1A 5FROA 1OR7C 2ZSHB 1VF7A 4DJAA 1Z3YA 3ZR8X 1O88A 3A3BA 4II2A 2PYHA 3BG6A 1NG7A 3DU6A 5LD2C 1QHHD 2VJJA 2WAEA 4PK4A 1E0EA 4U7BA 4LITA 1MABA 3S3NA 2JJ1A 3D5SC 1RMGA 3JU4A 5HOOA 3ZPPA 4HSTA 3MMYB 1UAAA 1UD4A 4DK1A 2BW3B 3DKYA 2KMUA 1X1BA 3HPGA 3OL4A 3UNGC 4DBRA 4W8SA 2V4JC 4ASUA 2VKDA 3AL0B 3HL2A 2K9LA 2XZOA 5CQGA 4CCKA 5HNFA 3OYMA 4PJJA 2V4DA 3GQ7A 2KVOA 1E1QA 1HVXA 2INUA 4BXFA 2E5ZA 2ZXHA 2W4SA 3K4JA 4XOTA 3K4CA 4CZCA 1GLNA 4X0GA 4BUPA 2JA2A 4RMNA 1T5EA 3KYLA 3WQZA 4CUGA 5C1CA 2X6XA 5FRNA 3CMMA 4G6IA 2KP6A 3BCFA 3BCBA 1K6YA 4XONA 3C2GA 2INVA 2E1MC 2RQQA 1KONA 3D5RC 1AA7A 2WBMA 1X0CA 2W6JA 4PFOA 2IS6A 1KCDA 3OYHA 4PJNA 1NBMA 3SUCA 1HA8A 2OUMA 2UV1A 2R7XA 3A35A 4QPQA 2XDVA 2XAUA 3ZQQA 4BJTA 3CP2A 2HU9A 1YX5A 3BG7A 3DQVC 4Z06A 1T0FC 3E1SA 2VJ4A 4BQQA 3DWLE 2O0VA 2W82A 3CJRB 4J00A 1IDJA 1HG8A 2LREA 2ZZEA 1KTWA 2NTQA 3ONQA 3CJQB 3BH4A 3H5RA 3ZXSA 3OEEA 2BW3A 3LSHA 2HNHA 4W8RA 4QPOA 2DJIA 1MNEA 3K4KA 4XN0A 3ZGKA 3S93A 2KLOA 3RTRA 2GK7A 4BQOA 2ZZFA 4B3XA 1IB4A 3KRGA 4BJ5C 1G59A 1X1DA 2VBMA 3N05A 1V0FA 3MKZA 4ZTFA 2F4IA 2QKMB 2CV1A 2WY8Q 3OYDA 4MR0A 2MFZA 3QYFA 1UELB 4XLHA 3H35A 3TMOA 1PKVA 3RPUD 3LSGA 4HSRA 3K70C 4G7WA 2M3AA 1WMRA 2ELJA 2HVQA 2VB6A 4Y4RA 2M0MA 2VPLA 1BHEA 3BCAA 2V9KA 2JIZA 4KKSA 2QX3A 3CZ6A 3TL4X 4C9YA 2NOJB 2ODLA 2R7SA 3FBIB 1O8GA 4H4KC 5CQEA 2JSPA 4DK0A 3OYAA 2K3PA 4PJMA 2KZVA 4KKUA 1VBLA 2HVRA 1UD5A 2GOXB 4XOPA 2WJYA 2NSPA 4G7XA 2LBFB 2X1CA 2Y0SA 3H9GA 4NQWB 3OR1C 2HZDA 4BACA 3KEWA 4TSFA 1BR4A 4NNJA 1OB0A 3FKJA 2VLAA 2L9SA 4HNUA 3CF2A 3PNTA 4BGDA 1UD6A 2L2OA 1X19A 4XN3A 4F3QA 1O8LA 1N77A 3EPZA 2ZZQA 3VSTA 2CH0A 4E7LA 2XZPA 3RCOA 1AIRA 3VYTB 4E7IA 4KT6A 3VYRB 1PE9A 1RWRA 2KRCA 2WJVA 2R9VA 2CS3A 4C30A 2F43A 1NG6A 1X1CA 5KHDA 3AFHA 1ERDA 3ZSCA 3W3CA 3PUBA 1BR2A 4AYBA 3JURA 2LC2A 2WAFA 4BDZA 3QYEA 3VMVA 1WTHD 4DBQA 3QODA 1N75A 4Z03A 3HXLA 4JMQA 4E0FA 3OFNA 4XLFA 1WJ5A 1X1AA 1WPCA 4CCOA 1SFKA 4OAZA 2FUG2 3ZCOA 1K5CA 3W2AA 3OYNA 4RM2A 3GVJA 2LBFA 4U87A 1KMHA 2JUGA 3F9KA 3GQAA 3D5LA 3VYUB 3OAAA 2R7OA 3GQBA 3PNYA 3GRHA 1W36D 4CH7A 3K6GA 4XNFA 3OY9A 3HAGA 1U0JA 3TBIA 4IZZA 3SDBA 3T53B 1RU4A 2CV2A 2GJKA 3KEYA 4D1QA 5JHFA 4W8TA 2DOAA 2IXSA 3OS2A 2JVGA 2EWEA 2VXZA 1O8FA 2HLDA 3LSMA 4BEHA 3H9JA 3PSIA 2Q1ZB 2R7WA 1BPLA 1E1RA 2MYSA 4XORA 3DKXA 1EFRA 1MMAA 1YE9A 3HUGB 2LZJA 2IS1A 4DNRB 2XC7A 2ZFUA 2F6CA 3LNNA 2A6TA 4XD7A 1R6RA 2X51A 2NTBA 4N4NB 1MNDA 3VMWA 2IGKA 1MMGA 1NRKA 3K4MA 3DPLC 3LMWA 1UD2A 2VQCA 3M8JA 3B8YA 3UW0A 2BVLA 4F93B 3OYKA 2E5NA 4KISA 1DQUA 3H9QA 3ZRGA 1DGRM 1JTAA 4I84A 3QYBA 4CSWA 3G2BA 2OV7A 3OYGA 3WWGA 1X4OA 1WJAA 4OJ5A 2BSPA 2VASA 1O8MA 1FX0A 3LL7A 3T51B 4DIQA 2R7TA 3B90A 4E7JA 3FY3A 3QOEA 1NHCA 1E79A 1KCCA 1J09A 3H0DA 2XGJA 4PSXA 4LG3A 3VSVA 1E3XA 4L8JA 1UD8A 3RQ4A 4XMYA 5CKTA 3VDXA 3LMMA 2AQEA 2M7AA 1PJRA 1D0YA 4E7ZA 3VSKA 5HKKA 2R7VA 4RM3A 1E43A 4PJLA 3H94A 2R7RA 3ZIAA 4RLFA 2WY7Q 2QKLB 2A5WA 3FKSA 1Y56A 2M4GA 3HG9A 4IQ4A 3M1CA 1N78A 4NC7A 1MMDA 1E3ZA 3BC8A 2NSTA 2WA0A 2KQRA 2GJPA 2X1DA 4HEA2 4PUSA 2GOMA 3AKZA 4ITVA 4MXNA 2PJRB 3A3GA 3IUOA 3I9V2 4FETA 3OYFA 1OLTA 2KHMA 2XF7A 2X6YA 2XNDA 1OOCA 1PXZA 2KPMA 4HG2A 3SEZA 1DP3A 2GK6A 3PFYA 1QU3A 2JDIA 4E7KA 2BOLA 4ZJZA 3VYSB 4YEJA 2HVSA 1BLIA 4W8QA 4CA0A 2IQ7A 4IKFA 2X3HA 1JRGA 2X8KA 1OFLA 2VJIA 3EUHC 4BU2A 3BCDA 2LRDA 4OJPA 4YRVA 1UD3A 4URRA 2PYGA 3B4NA 2E1MB 2VQHA 3K4NA 3RSNA 3VR6A 3MD2A 3OEHA 2UUZA 3S3OA 2V26A 2XOKA 3GVKA 1TZLA 1V5FA 3EQOA 2XSJC 4XLAA 2WPDA 1O8KA 4Z05A 1V5EA 1WJBA 2V31A 4BDYA 2M7BA 1I8DA 2DXIA 4YZQA 3OR2C 1WJEA 2WAQA 1SKYB 2XZLA 4ZTJA 4FXUA 1BR1A 2LOOA 2WADA 5TGTA 4CCLA 4AU7A 3AL0C 3DPUA 4B47A 1EA3A 2UWMA 1X4PA 2L7KA 4P5OA 3PSFA 4II3A 1W36C 2Z1DA 4OJOA 2W7NA 3OS1A 1WFXA 4B48A 1DGWY 1WJDA 5AMVA 4MLOA 2CK3A 4HPQA 1OGOX 4J01A 2KDOA 4ANJA 2MABA 2XF5A 2IGNA 2VJ5A 3SZGA 3OYJA 2GJRA 2O0WA 4B3FX 4LIUA 2V7QA 4GRIA 3C2HA 4BE1A 2R7QA 2VIXA 1WJFA 4XKCA 2BVMA 2O17A 3OL3A 3V42A 2DT6A 2MD0A 2RREA 4XM3A 1VZ0A 4JQFA 3S32A 4R79A 4BE2A 1WJCA 5C1EA 3H5AA 4ZC3A 3HOSA 2LYCA 2LY2A 3LFUA 4U49A 2JVHA 1W9XA 4KKTA 1BOBA 2KRHA 4XKBA 1VJSA 1VLYA 2NTPA 4NK8A 4IX7A 2IGMA 4F92B 4E4HA 5HNHA 1IDKA 1K28D 5CPRB 1QCXA 2MC4A 3DTEA 3L2WA 2HQAA 4AVZA 2DCEA 2NT6A 4B3GA 1H80A 2PMZA 3FDYA 4F91B 5DN6A 3ZPNA 2CV0A 3LSIA 2P0WA 2M5SA 3OIQA 4KJZA 3DU5A 3DPTA 1H8HA 3I3LA 2QXZA 4DNTB 2NT9A 3OE7A 4XKVA 2WSSA 4CCJA 3NWTA 4TKOB 4EATA 4BE0A 3A2KA 4OAYA 3BLYA 4BS9A 2CMPA 1D0ZA 1LFPA 3OOUA 2R7UA 3BC9A 3FPPA 1IA5A 2Z2SB 2HPMA 3U21A 3FHNA 4OWRB 1MMNA 1G8XA 4Y33A 4BQNA 1BMFA 4TT3A 1OGMX 4P22A 1OFMA 4C2UA 3VSUA 3GBGA 2CUJA 4ZYAA 3H5NA 4OZYA 1Y6IA 3IAM2 2UVFA 5LFAA 2HDWA 4NUBA 3OMYA 4FASD 2VXDA 1HZEA 3OOCA 4YZXA 2CW7A 1TT0A 2O5RA 2VQGA 3CP8A 3OW7A 2DT7B 3OYLA 3G05A 4NK6A 3T9GA 3NE5B 1LDKB 3OWTA 1DBGA 5FRMA 3J7AY 2V7FA 1W0KA 1IRXA 4D9JA 4XQFA 1ZELA 2D3NA 2VBEA 1XG2A 3PL8A 1MW7A 2VQLA 3OYCA 2O04A 2OC6A 3S8PA 4CCMA 4E7HA 1YX3A 2E60A 4XL9A 1Z21A 4EW9A 1O8IA 2V1NA 2X1EA 2ZTNA 3NWSA 1I18A 3K10A 3L2RA 2ZZGA 2ZXIA 4C2LA 3IP4B 1D1CA 3HOTA 1JI8A 4OJ6A 4F52A 1O8HA 4ZDPA 2F5VA 3UR3C 2VBKA 4YZAA 3DTIA 2NZMA 2DIEA 1V5GA 2K5CA 4ZDOA 4XKWA 3L2UA 1H8EA 4YXWA 2IGOA 2Z16A 3SYTA 1SAUA 1QHGA 3CESA 3K4BA 2UVEA 1Z7LA 2M4KA 3OPOA 1O8JA 1D0XA 4E7SA 3W2VA 2QY1A 3A1YA 3S3MA 5CDFA 3EQNA 2R4GA 3OS0A 4HRIA 3DLAA 4YELA 1WP6A 2L5QA 4PSWA 4DGWB 3PJRA 2QE7A 1D1BA 2K9MA 4BJ6C 5HLTA 4E6KG 4RLQA 3W2WA 3GQ9A 2WB1A 3IAS2 4ZDLA 4BL0B 4U4BA 4B43A 3VWBA 3DTKA 4PFPA 2V6EA 4GQNA 4PMHA 1W0JA 1Z3XA 2WZPP 2D3LA 3L2QA 1S9HA 3MKWB 4HWVA 2CW8A 3FBNB 4DOZA 4IQJA 3HC7A 3OIPA 3PNVA 4HNTA 5IK2A 4CCNA 5KNLA 5HVQC 2IS2A 2F1MA 2LG4A 4OJLA 1CZFA 3HPHA 4B44A 2X6WA 3MKYB 2W1OA 4OZZA 2IS4A 2CUZA 2PECA 2VKHA 2X85A 4XLCA 1COWA 2Z6BD 4HIZA 3VSLA 3LSKA 3EUAA 2PJRA 3KX2A 2JJ2A 1PLUA 1FMVA 3E0JB 4F55A 3HKZA 4KITB 2XF6A 2Z8GA 1LVKA 3DEEA 3K70D 2ZTGA 4BEHB 4NC8A 4C2TA 1OHHA 4Y3OA 2LH9A 1FMWA 3A4CA 3L2VA 4Z1MA 4LIVA 1LKXA 3K4LA 4XR6A 3OYBA 1O8DA 2HPIA 1EE6A 4UZUA 4JOMA 5FL7A 3GQ8A 4YZ0A 3OYEA 1O8EA 2I8DA 4N4OB 4G6TB 1P9QC 2W6IA 1T95A 2VL8A 3T56B 3DDYA 3EUKL 2CFOA 2X53S 1UG0A 2O1DA 1D1AA 2AQFA 1GQ8A 2L9NA 2RNGA 3SEQA 1QJVA 2KL4A 3OYIA 2W00A 1BN8A 5KCMA 4XLEA 2Q2EB 1KZLA 2E1BA 3GVLA 1DBOA 1V0EA 1PYVA 2ZSIB 4P1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQF A;  4MXN A;  2VBE A;  4XN3 A;  1XG2 A;  2PYH A;  1OOC A;  1O88 A;  1PXZ A;  1O8L A;  2X6Y A;  2O04 A;  2VJJ A;  3VST A;  4YEJ A;  1AIR A;  4W8Q A;  1PE9 A;  2IQ7 A;  1RWR A;  1RMG A;  1JRG A;  4XL9 A;  2X3H A;  3ZPP A;  1OFL A;  2VJI A;  4W8S A;  4EW9 A;  1O8I A;  4OJP A;  4URR A;  2PYG A;  3B4N A;  3ZSC A;  3JUR A;  3GQ7 A;  2INU A;  4C2L A;  3VMV A;  3EQO A;  4OJ6 A;  4XOT A;  4XLA A;  4Z05 A;  1O8K A;  1O8H A;  4Z03 A;  4YZQ A;  4XLF A;  5C1C A;  4YZA A;  2VBK A;  2NZM A;  2X6X A;  1K5C A;  4XON A;  2INV A;  4XKW A;  1X0C A;  2UVE A;  3GQA A;  4OJO A;  1KCD A;  1O8J A;  3GRH A;  3SUC A;  5AMV A;  2QY1 A;  4XNF A;  3EQN A;  1OGO X;  4YEL A;  1RU4 A;  4Z06 A;  4W8T A;  2EWE A;  1O8F A;  2O0W A;  2O0V A;  3GQ9 A;  1IDJ A;  2O17 A;  1HG8 A;  1KTW A;  4XM3 A;  2NTQ A;  5C1E A;  4XOR A;  4U4B A;  4PMH A;  4U49 A;  4W8R A;  4NK8 A;  4XN0 A;  4HWV A;  2NTP A;  2NTB A;  1IDK A;  1IB4 A;  3VMW A;  3KRG A;  1QCX A;  2VBM A;  1CZF A;  4OJL A;  2X6W A;  4AVZ A;  3LMW A;  2NT6 A;  4OZZ A;  2PEC A;  1H80 A;  3B8Y A;  2X85 A;  4XLC A;  4MR0 A;  3UW0 A;  1JTA A;  4XLH A;  1PLU A;  4I84 A;  2QXZ A;  2Z8G A;  3WWG A;  2NT9 A;  4XKV A;  4OJ5 A;  1WMR A;  2BSP A;  1O8M A;  3FY3 A;  3B90 A;  1BHE A;  1NHC A;  1IA5 A;  1KCC A;  3VSV A;  2QX3 A;  4XMY A;  2ODL A;  1O8G A;  4XR6 A;  1OFM A;  1O8D A;  1OGM X;  3VSU A;  3GQ8 A;  1EE6 A;  4YZ0 A;  1O8E A;  1VBL A;  4OZY A;  2UVF A;  4XOP A;  2NSP A;  2O1D A;  4YZX A;  1GQ8 A;  1QJV A;  1BN8 A;  4XLE A;  4NK6 A;  3T9G A;  1DBO A;  2NST A;  1DBG A; 
#chains in the Genus database with same CATH topology
 5FKL A;  3FM3 A;  2WZN A;  1QRB A;  3T8R A;  3PUF A;  1F9N A;  1SFX A;  3PO2 J;  4DJA A;  1VF7 A;  3OZV A;  3KLN A;  1FNN A;  1TWG J;  3BG6 A;  2VFO A;  2IP2 A;  2V9P A;  3I53 A;  1FND A;  2ZIT A;  5ICE A;  3QP5 A;  4PK4 A;  4S04 A;  4LIT A;  1H9G A;  1MAB A;  1YS6 A;  2EZK A;  1MZB A;  3D5S C;  3R60 A;  4BHC A;  1XDS A;  3J7Y J;  1B4A A;  2G0E A;  2GXB A;  3TW7 A;  4W8S A;  4A69 C;  5C4J J;  4PGH A;  3AL0 B;  2K9L A;  4CCK A;  2OCC H;  5LEJ A;  4HX8 A;  1QA1 A;  4BKX A;  4QTR A;  2FOK A;  1ELO A;  2W4S A;  1GLN A;  1Y8R B;  1ZR2 A;  3EQL F;  3W2G A;  2Y48 A;  4RMN A;  1MBG A;  3E5X A;  1FEX A;  4CUG A;  1T5E A;  3WQZ A;  5C1C A;  1VND A;  3WXM A;  4OIO F;  1R1V A;  3M8F A;  5FRN A;  2YX7 A;  3BG3 A;  2EV5 A;  5JVG F;  2BM4 A;  4XON A;  2OBP A;  5LHG A;  2E1M C;  5J35 A;  3D5R C;  1KON A;  2V7X A;  2WBM A;  5FKM A;  1KTV A;  2NAZ A;  2COB A;  2XAJ A;  5JHU A;  2CFX A;  4GGG A;  2IS6 A;  2VOP A;  1A5J A;  3ZMV A;  4PJN A;  1E64 A;  2PE3 A;  1R36 A;  2V6C A;  1IXS B;  2UV1 A;  1HA8 A;  3A35 A;  3BQY A;  4BJT A;  3CP2 A;  1F1Z A;  1HW1 A;  5GTI C;  5DD8 A;  1IGN A;  4ZGQ B;  1OYW A;  3DWL E;  1ZLJ A;  4WXC A;  2O0V A;  1ZAR A;  4PGG A;  3CJR B;  3NQO A;  2VBW A;  1XX5 A;  1KTW A;  1TWC J;  3JTG A;  2VFP A;  1BC7 C;  3OEE A;  1VQP B;  3KP4 A;  2BW3 A;  1BI0 A;  1XGS A;  2EPF A;  1SMT A;  2IVM A;  4O6J A;  4W8R A;  1FY7 A;  1MNE A;  2DJI A;  3ZGK A;  3L9F A;  2A61 A;  3B73 A;  3JRH A;  1LE8 A;  3RTR A;  5D8K B;  3GX4 X;  1U5T C;  2IA0 A;  1NK2 P;  4B3X A;  4HF1 A;  2ZZF A;  3KRG A;  1IB4 A;  1W7P D;  2DAO A;  4LK1 F;  1X1D A;  3RY8 A;  2HKX A;  3Q9S A;  1IDZ A;  2CV1 A;  4I09 A;  4UHT A;  1SAN A;  4IRG A;  2ID3 A;  3TMO A;  3G6E B;  2COM A;  2VOD A;  4G7W A;  3GZ6 A;  2QGU A;  4FHT A;  1ZR4 A;  1JHF A;  2BYV E;  4Y4R A;  4A3F J;  2M0M A;  3CME I;  1FRN A;  3BCA A;  3CDH A;  3KEO A;  2H6C A;  3JQQ A;  5IYB J;  2OTJ I;  4MFD A;  4XK4 A;  1EP3 B;  4C9Y A;  2QX3 A;  2NOJ B;  3GTL J;  1KQ0 A;  4H9G A;  3VMF A;  4DK0 A;  3OYA A;  2L4M A;  3HDD A;  2XC1 A;  2CQQ A;  4P55 A;  4C2M J;  2NSP A;  1IUY A;  2LBF B;  2KKO A;  1KU3 A;  3QPL A;  3JRF A;  2YU9 J;  4WK8 F;  1RNL A;  4BAC A;  2DCU A;  3GFM A;  3KEW A;  1OCO H;  4JX5 A;  3TQN A;  4KIB A;  4BBR J;  2Y9Z A;  4PGO A;  1XMX A;  3JSO A;  2JPB A;  4A2U A;  2J7K A;  3ZBT A;  1UD6 A;  4XN3 A;  4U88 A;  5M5X J;  2CW5 A;  1IN5 A;  1G4D A;  4I99 C;  1VTN C;  3I5U A;  2YWF A;  3E5Q A;  2LD5 A;  2BZT A;  3EPZ A;  2ZZQ A;  3CW2 A;  3CC7 I;  4WWV A;  3U6B A;  1AIR A;  3U1K A;  3E6C C;  1QFJ A;  3VYR B;  1RWR A;  1WQ2 A;  2WJV A;  4UVA A;  2ID6 A;  1EFT A;  4ZYH A;  2CS3 A;  3PIO F;  5FNZ A;  3DBR B;  2MD5 A;  4DYC A;  1MBF A;  2DFI A;  1ETO A;  3KP3 A;  3QPS A;  1H89 C;  3JUR A;  1SD5 A;  2WAF A;  4BDZ A;  5J47 A;  4WWC A;  3QYE A;  1KQ9 A;  1QPI A;  2ZL6 A;  4NB5 A;  2XPV A;  4GDF A;  2Q6I A;  4DBQ A;  2O9L A;  3AK5 A;  3OOP A;  1OPC A;  3HXL A;  4M6Y A;  2FBH A;  2PJP A;  1ZGJ A;  3HJE A;  1X1A A;  5B3S H;  3HTU A;  3FXL A;  4ENN A;  4OAZ A;  3ZCO A;  3F22 A;  4QFM A;  4MTD A;  1QVT A;  3CPX A;  3JAM Z;  1TLH B;  3KCC A;  3OYN A;  3EYI A;  3MEX A;  3SLN A;  4U87 A;  2ZJR F;  2JUG A;  3F9K A;  5F27 A;  2KT0 A;  5HDG A;  1KMH A;  3OAA A;  2OK7 A;  3GQB A;  2OPT A;  4RB2 C;  1E3O C;  3GRH A;  1YLO A;  1W36 D;  5KW9 A;  3P9C A;  1KJZ A;  2V7T A;  3OY9 A;  3K1N A;  3OJX A;  4P2N A;  1YIJ B;  5M3F J;  3SDB A;  4IZZ A;  2NXN B;  1M1E B;  4M74 A;  2CV2 A;  4L18 B;  1ACI A;  3CC2 B;  5JHF A;  2IXS A;  1IB0 A;  5EEH A;  2R5Z B;  2JVG A;  1PUE E;  2EWE A;  1O8F A;  3C7J A;  1HA3 A;  5GAG J;  4D7M A;  2HLD A;  2AXT C;  3H9J A;  4IHT A;  4IRH A;  3ZQL A;  1P4X A;  2PMU A;  3BTL A;  4LBY A;  1YX2 A;  3KYC B;  4BNC A;  2MYS A;  1CF7 A;  4X7E A;  1AMO A;  5J1Y A;  2NS8 A;  1MMA A;  2DMN A;  2XAQ A;  3HUG B;  5J4V A;  1KQ8 A;  3AVU A;  2IS1 A;  4A3C J;  4DNR B;  3LNQ A;  2GA1 A;  1XCV A;  3COA C;  4WZE A;  2A6T A;  1T56 A;  1GDT A;  2QTL A;  2X51 A;  4WF2 A;  4N4N B;  5DD4 A;  2STW A;  1BJK A;  3VMW A;  3PIP F;  2V9V A;  3K4M A;  2I10 A;  1FLI A;  3LMW A;  5EMN A;  1UD2 A;  1ZM9 A;  3M8J A;  4IF4 A;  3CUO A;  2FVG A;  2X3U A;  4I98 B;  3WHC A;  1IRF A;  2PN6 A;  4KIS A;  1DGR M;  1VQ4 I;  2VN2 A;  3OYG A;  4I84 A;  3CDL A;  3WWG A;  1A04 A;  4OJ5 A;  3ZMZ A;  2BSP A;  3E5U A;  2GLO A;  3S2D J;  1STZ A;  3BJO A;  2ZB9 A;  4E7J A;  3IL2 A;  2CGP A;  2F5F A;  1NHC A;  3S16 J;  2P7C B;  4UUV A;  4L8J A;  2L9V A;  4RBO A;  2KIQ A;  3VDX A;  4G12 A;  1TWH J;  3WY9 A;  1APL C;  1FNM A;  2G7U A;  1ZG1 A;  3I59 B;  4HQE A;  2KIS A;  1IJW C;  2R7V A;  1TYW A;  3BWG A;  5GTH C;  1FWZ A;  4PJL A;  3ZIA A;  2D5V A;  3BQZ A;  1WXR A;  1IZ1 A;  1D8T A;  2QKL B;  1Z7U A;  4IQ4 A;  4ENK A;  2DFF A;  1GUU A;  1N78 A;  4EM2 A;  1R5O A;  1MMD A;  3K0L A;  2VBU A;  4G7Z F;  3NB2 A;  3BC8 A;  2NST A;  5A8A A;  1W35 A;  4EJU A;  2PI0 A;  4Z2Y A;  2Z5U A;  4JK1 X;  1OOC A;  1OLT A;  4QUZ A;  2XF7 A;  5JLW A;  4HLX A;  4A3K J;  2KPM A;  1DP3 A;  5FJ8 J;  3Q5F A;  2JDI A;  2HKO A;  3QQA A;  3VYS B;  3WTZ A;  2QMU A;  1H9T A;  4CA0 A;  3BY1 A;  1TP4 A;  5ED4 A;  2CUF A;  1OFL A;  4AC0 A;  2XGC A;  2Z3Y A;  3Q0U A;  2XT4 A;  2MA3 A;  4BU2 A;  2LRD A;  1PDN C;  3FXJ A;  5DCF A;  4YG2 F;  1HKQ A;  2VQH A;  3RSN A;  5CVI A;  3CCR I;  2V1U A;  4UY8 I;  4DQL A;  5E8G A;  1TYU A;  3HHH A;  1MJA A;  2DA3 A;  1I1S A;  2V26 A;  4B1R A;  4G7O F;  3CME B;  3EQO A;  1RRJ A;  2V31 A;  4YZQ A;  4BDY A;  1I8D A;  1OB2 A;  1VQM I;  2DXI A;  2OTJ B;  3PSS A;  2B9S A;  1P4A A;  4U0W A;  5E79 C;  4G6Q A;  3QU3 A;  5FLX Z;  1BOA A;  5TGT A;  4ABZ A;  1P2F A;  3BJ6 A;  4AU7 A;  4IHW A;  3BRO A;  2MC3 A;  1FSE A;  1AHD P;  3CJT B;  2BX6 A;  5DCM B;  3PSF A;  3CCE I;  4II3 A;  4HNV A;  3B8H A;  1R4M B;  2EFQ A;  1WFX A;  3HRU A;  2W24 A;  1R22 A;  1WOS A;  2CK3 A;  4MO7 A;  4CYC B;  1BQE A;  2DOF A;  1MMS A;  1YS7 A;  4JBA A;  2MAB A;  2D1V A;  2MH2 A;  4KDP A;  1JA0 A;  4YFX F;  3OYJ A;  3P9I A;  4A5M A;  2O0W A;  3GUD A;  4N9I A;  1SD4 A;  2R7Q A;  4EVI A;  4XKC A;  5A2Q Z;  2TCT A;  4V19 K;  4BXX J;  3SY2 A;  2DT6 A;  4W1U A;  1F36 A;  4R79 A;  5C1E A;  3KE2 A;  4M2L A;  1FBQ A;  3GTK J;  1TSP A;  3H5A A;  3H9N A;  3HOS A;  2IAI A;  4M9S A;  5FO5 A;  5FLM J;  4FE4 A;  2JVH A;  1W9X A;  2KRH A;  3ONU A;  3O6B B;  4IX7 A;  4P12 A;  2IGM A;  3GTO J;  2DFH A;  1IDK A;  5L3D A;  1EKE A;  2CRG A;  5D6F A;  1WI3 A;  1VQ6 I;  2RN7 A;  4AC9 A;  1GT0 C;  1ZRE A;  4FCY A;  4GYI A;  1OCZ H;  4AVZ A;  1QPM A;  2DCE A;  4B3G A;  1H80 A;  1Z1D A;  2PMZ A;  5DN6 A;  4UV8 A;  1VI0 A;  4QVA A;  3H0G J;  3LSI A;  4AWX B;  3CCS I;  2XKP A;  4KJZ A;  3DU5 A;  3DPT A;  1R49 A;  1YW7 A;  1T0F A;  2B5O A;  5DNS A;  4OIR F;  3C18 A;  2NT9 A;  4PMH A;  2WSS A;  3Q38 A;  3NWT A;  4TKO B;  4BE0 A;  1NH3 A;  3KFW X;  1FZP B;  4MIM A;  3BC9 A;  3FPP A;  2HPM A;  3H3V K;  3FHN A;  1ULY A;  4BQN A;  4UUS B;  4TMZ A;  4PC6 A;  2DTR A;  4TT3 A;  3CO7 C;  1OFM A;  1ZRC A;  2BM6 A;  1U78 A;  4KN4 X;  5EZG A;  1YIO A;  2CUJ A;  1S4M A;  3H5N A;  3I64 A;  3QPH A;  2HS5 A;  1LE8 B;  4NUB A;  2XAS A;  4XRM A;  3OOC A;  3ASO H;  2A05 A;  2VQG A;  4B4D A;  3CP8 A;  3OW7 A;  2DT7 B;  5F08 A;  3T9G A;  2LKS A;  2VNH A;  3JQR A;  3OWT A;  4MEY F;  1Z67 A;  4HLY A;  2GBY A;  4XQF A;  1ZEL A;  3PL8 A;  3ML3 A;  2G9W A;  4HOB A;  3OYC A;  4JP0 A;  2UXN A;  2O8K A;  3BG5 A;  4AM3 A;  1K9M D;  3PSZ A;  3CO6 C;  1YX3 A;  2E60 A;  2H1L A;  3LST A;  4BY7 J;  1K78 A;  5DUI A;  3QU6 A;  4XL9 A;  1SM4 A;  2DQL A;  4JYK A;  5IP7 J;  2PMH A;  2WAQ N;  2ZJQ F;  1EFU A;  4YAL A;  4EW9 A;  2ECC A;  1VQ4 B;  4M71 A;  4OM9 A;  2ZC2 A;  3BPX A;  2O6G E;  1XC5 A;  1Q86 D;  2ADU A;  1I18 A;  2X48 A;  2ZXI A;  1HSJ A;  2YUH A;  2A5Y B;  2ZFW A;  3E3V A;  4F52 A;  4L9V A;  1B9M A;  1I5Z A;  2M8E A;  1WOO A;  3BY6 A;  3S1Q J;  4A3B J;  1OIS A;  3KYD B;  2EFW A;  4N3G A;  2K5C A;  5E18 F;  1ZHF A;  4KFC A;  2IGO A;  3HOU J;  2Z16 A;  4N0B A;  1QHG A;  3CES A;  3K4B A;  4M3G A;  1BA5 A;  3R0J A;  3R6K A;  1R1T A;  5HXB A;  1O8J A;  4E7S A;  2O0Y A;  3W2V A;  4RJL A;  2W85 A;  1RUO A;  2QGG A;  2R4G A;  4HRI A;  3WE2 A;  4DZP A;  3DBL B;  2YWG A;  1NJI D;  3GCM A;  4Y52 J;  3MZ8 A;  4KH3 A;  2TDX A;  2JRT A;  3PJR A;  3GVA A;  4Q47 A;  1P6R A;  4JX4 A;  1JKR C;  1G6N A;  1D1B A;  1TVC A;  2NS0 A;  3KP2 A;  2K9M A;  3GXO A;  5J1R A;  2DN0 A;  1T98 A;  3W2W A;  3GQ9 A;  1ODD A;  4ZDL A;  3M8E A;  4BL0 B;  1OYY A;  4Y13 A;  4B43 A;  4GQN A;  2H09 A;  4C3J J;  2BEO A;  1LJ9 A;  2D3L A;  1QA6 A;  2E7X A;  3L2Q A;  3MKW B;  3Q3S A;  3MQ0 A;  3CCR B;  3WGG A;  3CUQ A;  3PNV A;  1P4M A;  4OPW A;  2DYS H;  3S1M J;  4OJL A;  1CZF A;  2MH9 A;  5TV2 A;  1LM1 A;  2X6W A;  4YEI A;  1G3Y A;  1FIP A;  5IYN A;  1VQM B;  4Q5S F;  2QQ8 A;  2BPO A;  2VKH A;  2EA2 A;  5BS6 A;  3VSL A;  3LSK A;  2PJR A;  4EMS A;  2JJ2 A;  2BXZ A;  1PLU A;  3E0J B;  1R5I D;  2EB7 A;  3HKZ A;  2XF6 A;  1FOY A;  1ONV A;  1LVK A;  1Z6R A;  3DEE A;  2AO9 A;  3WTT C;  2ZTG A;  3F0C A;  2NS7 A;  1H42 A;  1O7F A;  1WPK A;  1TLL A;  2Y30 A;  4RGS A;  4BAY A;  1JXS A;  2VNK A;  2NVX J;  2W57 A;  1FMW A;  2AHO A;  3QE2 A;  4Z1M A;  3ZP5 A;  1LKX A;  1CF7 B;  2K9S A;  3ZN0 A;  1EE6 A;  2CJJ A;  4XSX F;  3PEN A;  2EFP A;  2I8D A;  2C2W A;  1YFH A;  2VL8 A;  3ZBU A;  2CFO A;  3F6V A;  2O1D A;  1IV6 A;  2CQ7 A;  1QJV A;  3EDP A;  1D5V A;  2MLK A;  2LLK A;  2OCE A;  4EEF G;  2OA4 A;  1BN8 A;  3E1Y E;  5JBQ A;  3IWZ A;  3AVT A;  4KMF A;  3RPU A;  3D1N I;  3TGN A;  5EGO A;  1YRN A;  1QQI A;  3CXC B;  1G3T A;  1W4M A;  2CC2 A;  1O88 A;  3A3B A;  4RGR A;  3ROU A;  1HF0 A;  2JN6 A;  2NVU B;  2V7V A;  1B2R A;  1NG7 A;  2ZXJ A;  5LD2 C;  1R5G A;  2HI3 A;  3IRQ A;  4NBS A;  2WAE A;  1E0E A;  3GFJ A;  4U7B A;  1EA0 A;  2JJ1 A;  1K4Z A;  4I76 A;  1RMG A;  3BNW A;  1UAA A;  3CCS B;  4FTH A;  2W25 A;  2R5Y B;  3HZJ A;  2J5P A;  3OL4 A;  3SKB A;  3MKL A;  2V4J C;  4ASU A;  4PC2 A;  4LG0 B;  1FTZ A;  5J6X A;  3S14 J;  2XZO A;  1ZTR A;  2JSC A;  1E1Q A;  1JT0 A;  2INU A;  3R4K A;  4CYD A;  2E35 A;  4XOT A;  4X0G A;  1XTA A;  3K4C A;  4TN1 A;  2JA2 A;  4BY1 J;  3KYL A;  4Z4S A;  3JRC A;  4UZE A;  1PJ6 A;  4QWQ A;  1LVA A;  4IEJ A;  3NRV A;  3HOW J;  4RCY A;  2KP6 A;  1WOR A;  1HCR A;  3BCF A;  2ICW G;  1K6Y A;  3H3Z A;  3C2G A;  3H36 A;  2INV A;  1GV2 A;  4RA2 A;  4UB6 C;  1AA7 A;  2ZNY A;  2P5V A;  1X0C A;  4C3I J;  3A0B C;  2W6J A;  4IHY A;  1HKT A;  2WB1 N;  3HSF A;  5KVR A;  2M9H A;  1RI7 A;  1EXM A;  1XB2 A;  3T8T A;  1NBM A;  2DA2 A;  3SUC A;  4XRS A;  4ZGN B;  3AG1 H;  4IRI A;  1ZK8 A;  5FIU A;  2XDV A;  3E6D A;  2XAU A;  3ZQQ A;  3UKG A;  3JTH A;  3I4M J;  4Z06 A;  3A03 A;  1YJ9 I;  2KDZ A;  2CBX A;  5D5W B;  1B6A A;  1T0F C;  1HF2 A;  1FYK A;  4NBQ A;  4J00 A;  1HG8 A;  1IN4 A;  1Z77 A;  3BTC A;  2ZZE A;  2NTQ A;  4P26 A;  3KP6 A;  2FD5 A;  2ELK A;  1PUF A;  1QVG B;  3ZXS A;  2MLG A;  4YIR X;  2FU4 A;  2RVC A;  3DXJ F;  2HNH A;  5FB2 A;  4XN0 A;  3WHB A;  2FA5 A;  2STT A;  2XUB A;  5CVV A;  2KLO A;  3CCU I;  4G1B A;  2GK7 A;  1KQ5 A;  5F0F A;  3VPR A;  3A02 A;  2FMY A;  2ZME A;  1G59 A;  4A3E J;  2DA5 A;  4PC1 A;  1PP7 U;  3LQR A;  3W2F A;  3OYD A;  4MR0 A;  2A69 F;  1F5T A;  2JA6 J;  3IKT A;  3H35 A;  5DS9 A;  1PKV A;  1W0U A;  2V1X A;  1UHW A;  4MFE A;  5DUK A;  3K70 C;  1YO5 C;  2WV0 A;  4IW3 B;  1N8R D;  5L3E A;  3JSP A;  4C43 A;  1BI1 A;  1ZM3 A;  2HVQ A;  2LSO A;  1VQ7 I;  3RKX A;  1VQ5 I;  1I39 A;  1OGJ A;  2VPL A;  1BHE A;  3ASS A;  4A0Y A;  2JIZ A;  4KKS A;  2K85 A;  2WC2 A;  4BBS J;  5M5Y J;  3CZ6 A;  4KT5 C;  2CQX A;  3WGI A;  3FBI B;  2UZK A;  2PIA A;  2GAU A;  3CDI A;  2M30 A;  4BYY A;  1J5Y A;  4PJM A;  4UVB A;  3IH2 A;  3ASP A;  1VBL A;  2R93 J;  1T38 A;  5HDK A;  2FML A;  2GOX B;  2WJY A;  4HAM A;  2X1C A;  1I27 A;  2Y0S A;  3H9G A;  3OR1 C;  3QFS A;  2HMA A;  2XRO A;  1QZE A;  3FKJ A;  2VLA A;  1NTC A;  2L9S A;  3ASN H;  2F5C A;  3CF2 A;  3PNT A;  4TMV A;  4BGD A;  4U9U A;  5F4M A;  1X19 A;  4F3Q A;  1YOV B;  1SD6 A;  3RIR A;  2DA7 A;  1VHE A;  2FX0 A;  3QFC A;  3R6J A;  4Z4Z A;  2PBI A;  1BW6 A;  1UHS A;  5EEA A;  5CVU A;  1GXP A;  1HC8 A;  2GZW A;  2CH0 A;  5CVJ A;  4E7L A;  3RCO A;  1W2B B;  4KT6 A;  1GAW A;  1ORK A;  3ZQH A;  3TDZ C;  3FX3 A;  1ZH5 A;  3GME A;  2F43 A;  3ESW B;  3VOD A;  3CPW B;  2CND A;  5F0C A;  5KHD A;  3ZSC A;  4AYB A;  3W2E A;  4D0P A;  1Q82 D;  3D26 A;  2VFN A;  3QPT A;  2F1L A;  4OPV A;  2XB0 X;  2Q6L A;  3QOD A;  4Z03 A;  4JMQ A;  3TO7 A;  2O61 A;  1PJ7 A;  4QSH A;  3RIQ A;  2K86 A;  5JVT A;  1WJ5 A;  1TNT A;  1BJA A;  2R0Q C;  2EWN A;  3CC2 I;  1F43 A;  3IC7 A;  1K5C A;  1OCR H;  3W2A A;  1EP2 B;  3LQQ A;  4RM2 A;  4RD6 A;  3CUQ C;  4IOC F;  4NQW A;  5L3B A;  3BQJ A;  3HOY J;  1QG0 A;  5DDG A;  4OMZ A;  3KIO A;  1SFU A;  2DBB A;  4XBF A;  1JUS A;  3T53 B;  3VNU A;  1RU4 A;  1K78 B;  5KK1 A;  2GJK A;  3BTI A;  2QBY A;  4A3L J;  3AGQ A;  3BR0 A;  5EG0 A;  4HQM A;  3DEU A;  2EQR A;  2NVY J;  4IO9 F;  3H92 A;  3W2I A;  2R7W A;  1VQK I;  2Q6K A;  3PFI A;  1BPL A;  5IPA A;  1EFR A;  3A8K A;  1YE9 A;  1QNT A;  2H27 A;  2LZJ A;  5E6T A;  3BTJ A;  3J81 K;  2ZFU A;  3JQP A;  4J19 A;  4RDK A;  3TOA A;  2F6C A;  1Y1W J;  2GIV A;  4XD7 A;  1T2K A;  3G73 A;  2FJ1 A;  1R6R A;  3C2B A;  2VOO A;  4PC7 A;  4OMY A;  5J8C A;  2BMW A;  1K8A D;  4PZJ A;  3U2Q A;  3LO8 A;  3I54 A;  1MMG A;  4MTE A;  3PQJ A;  2K9N A;  2XAG A;  2HQN A;  2R3S A;  1Y0R A;  2YSR A;  1I6H J;  2VQC A;  4Z4U A;  3B8Y A;  1X3U A;  1KU7 A;  1K79 A;  3UW0 A;  2M8G X;  2DER A;  1DPR A;  4CDG A;  4F93 B;  1UCR A;  1B9N A;  1DQU A;  1ZGW A;  4Y17 A;  1ETQ A;  1ITY A;  2CQK A;  2OV7 A;  3O8G A;  1WJA A;  3GLX A;  2F48 A;  1U8R A;  4V02 C;  4A3I J;  4CXF A;  1FX0 A;  3WTV C;  5EDN A;  3T51 B;  3B90 A;  3FY3 A;  1SKQ A;  5M3M J;  1KCC A;  1L1I A;  1J09 A;  3O3K A;  3WG7 H;  3VSV A;  5FKO A;  5F6F A;  4QV2 A;  2D9R A;  1M1K D;  2AQE A;  2ECB A;  1YJ9 B;  1J9Z A;  3Q0V A;  1QUF A;  1D0Y A;  3VSK A;  5HKK A;  3CB4 A;  2VT2 A;  3HOX J;  1S3J A;  1UB9 A;  2DMP A;  2R7R A;  3H94 A;  3CUQ B;  2WY7 Q;  2Z9O A;  1FBU A;  2A5W A;  3FKS A;  4AID A;  2GRE A;  2D2W A;  3NAR A;  1OQY A;  1E3Z A;  4OP7 A;  3D0S A;  2M45 A;  2E34 A;  2KQR A;  3WTX C;  3MN2 A;  2X1D A;  4CGZ A;  3TDU C;  5HS9 A;  2DOE A;  4ITV A;  6PAX A;  2F5D A;  3CCU B;  2PJR B;  5IT9 Z;  3A3G A;  3I9V 2;  4PJ0 C;  1RQR A;  2KHM A;  3M1E A;  2XND A;  4R8H A;  3SEZ A;  2LKX A;  1NHA A;  5K5O A;  1N07 A;  2BOL A;  3ELK A;  3Q0W A;  2IQ7 A;  2AHQ A;  4I6Z A;  3LQE A;  1R9T J;  1T33 A;  1IN6 A;  1SC7 A;  3T0Y A;  4ASN A;  3QRF F;  1AIP A;  4AF6 A;  3BCD A;  3LA2 A;  1FYL A;  5E3N A;  1QUE A;  4RD4 A;  2PYG A;  3B4N A;  2XTY A;  2E1M B;  5IYD J;  2XAF A;  4NCN A;  3GFL A;  2F2E A;  3FKI J;  5H59 A;  1T6Y A;  3WGH A;  2UUZ A;  1OB5 A;  1VQ5 B;  1VQ7 B;  1LEA A;  2Y31 A;  3GVK A;  1TZL A;  4XLA A;  2DT5 A;  2ME0 A;  1IG7 A;  1V5E A;  4A93 J;  2DOG A;  2DET A;  1ZRD A;  3GTG J;  2M7B A;  5GV7 A;  3F21 A;  2XEX A;  3AGP A;  1DG1 G;  3SEJ A;  4DQ2 A;  3ZZ0 A;  3HGG A;  1DU6 A;  2WAD A;  2PFB A;  1XB4 A;  2B0L A;  2QDX A;  3DPU A;  5EGO B;  3KLO A;  5TJJ A;  1WSU A;  1YRN B;  2PG4 A;  1EA3 A;  5CYV A;  4H0E A;  1Z0X A;  4P5O A;  3HBL A;  2RV8 A;  2Z1D A;  2ZME C;  1A35 A;  2ESH A;  5LLQ A;  3GTP J;  4B48 A;  1SEU A;  2FQ3 A;  2N8G A;  4MLO A;  1XDU A;  1LLZ A;  2YS9 A;  2KDO A;  2DU9 A;  1FBS A;  4A12 A;  2XF5 A;  4WZK A;  2IGN A;  5KAI C;  3SZG A;  1NDH A;  2GJR A;  3Q3A A;  2OZ6 A;  1U5T B;  3C1D A;  4LIU A;  4EJO A;  1XFO A;  2V7Q A;  2XNC A;  4YAF A;  2WTE A;  2KFD A;  3HEF A;  5GPC A;  3OL3 A;  3V42 A;  2MD0 A;  3HRS A;  4JQF A;  3S32 A;  1WJC A;  1K4T A;  1KU2 A;  4ZC3 A;  4V2F A;  1I3Q J;  2LY2 A;  1XN7 A;  3FXR A;  2BSA A;  4KKT A;  1BOB A;  4PC3 A;  4Z4Y A;  2ESN A;  1HW2 A;  1KK2 A;  5HNH A;  3ZPL A;  3F8M A;  1DP7 P;  3A01 A;  4P6Y A;  1L0O C;  1YQA A;  3ZQI A;  5DYM A;  3FDY A;  1GO2 A;  4F91 B;  2BGJ A;  3HYI A;  4HE5 A;  4P3I A;  2ISY A;  4CO8 A;  4I7H A;  2QEX I;  1FJL A;  5K7F A;  1W0T A;  1HOM A;  2IEK A;  3I3L A;  4GCV A;  4PDK A;  3WTY C;  1ZM2 A;  2QXZ A;  4XKV A;  5J3L A;  3DLL F;  1W5T A;  2HCJ B;  2VI6 A;  4OAY A;  3MCA A;  2M5W A;  1D0Z A;  2R7U A;  2Z2S B;  3CCY A;  3K7A J;  1O3T A;  3K2Z A;  3FIS A;  3HSE A;  1JKP C;  4P22 A;  3IHU A;  2ZJP F;  1OGM X;  2V5I A;  3MZY A;  3WNB A;  4IHV A;  4AIJ A;  3O2P E;  4A0X A;  1IRG A;  1L3L A;  2DDA A;  1HZE A;  2VXD A;  1VQK B;  3J80 K;  4YZX A;  4UVC A;  3K69 A;  2O5R A;  3N97 A;  5A88 A;  1G3W A;  1X1P A;  2LTP A;  1MDM A;  4NK6 A;  3GO5 A;  1QFY A;  1VQL I;  1LDK B;  5ICF A;  5FRM A;  3L7W A;  2V7F A;  2BM5 A;  1W0K A;  2FEZ A;  1VQ9 I;  3W6K B;  3JRA A;  2GXG A;  2NVT J;  5J1U A;  3E6B A;  4CCM A;  3KET A;  4KNY A;  2K40 A;  3GF2 A;  4M73 A;  4LBW A;  2RDP A;  2HXI A;  3GLL A;  3VNV A;  1K8F A;  5E1X A;  1Z21 A;  3JRB A;  2EIM H;  2BM0 A;  5L3G A;  3L2C A;  2V1N A;  4X8I A;  2X1E A;  1WSR A;  2GM4 A;  1S6L A;  1VF9 A;  1K7A A;  1J9I A;  3F6O A;  4C3H J;  2H8R A;  4Y7C A;  2A68 F;  3HOT A;  2ZJ2 A;  3KPH A;  4OJ6 A;  2O3F A;  1E2X A;  1A36 A;  2JK3 A;  2L9R A;  5CJ9 A;  1I7P A;  2P6T A;  2DEU A;  2F5V A;  3ASR A;  4Q7J B;  4MYU A;  3ZUG A;  1QZY A;  3ISX A;  5C3E J;  3TO6 A;  3QAH A;  2FF4 A;  4BHB A;  1T39 A;  4YXW A;  3ZOB A;  1H8E A;  5IY5 H;  3SYT A;  1SAU A;  1B1B A;  1OYI A;  3LFK A;  1GAQ A;  1R7J A;  2E36 A;  3U9G A;  3S15 J;  3DBH B;  3N6Z A;  2BGC A;  1KK1 A;  1ZG3 A;  3FXU A;  1MGT A;  1DDI A;  5LRR A;  1N0U A;  2XHK A;  4RS8 A;  2Y75 A;  3GWZ A;  1B59 A;  2L5Q A;  1YIT I;  1T6X A;  5BQT A;  1GHC A;  3BR1 A;  3I55 I;  4TMW A;  4MEX F;  4BJ6 C;  1QRY A;  5FKN A;  1VQ8 I;  2VBZ A;  3GTM J;  2PMZ N;  4YAO A;  1J59 A;  3DTK A;  5H20 A;  4I0B A;  1W0J A;  1Z3X A;  2C5H A;  2WZP P;  3G71 I;  4UV9 A;  5K5Q A;  4BQA A;  1TYX A;  1S9H A;  1QO0 D;  4HWV A;  2CW8 A;  5AON A;  4X0C A;  4YCQ A;  1GVD A;  1FYM A;  4IQJ A;  4B4C A;  5IK2 A;  4CCN A;  1MBE A;  5HVQ C;  1IHM A;  3SQV A;  1YG2 A;  2QQ9 A;  3F8N A;  3RYP A;  2BHZ A;  1NB0 A;  4BXU A;  4OZZ A;  2CUZ A;  5EZH A;  2X85 A;  4XLC A;  2RNJ A;  4RAY A;  3RKW A;  3T5X A;  2RKH A;  3EUA A;  1FMV A;  4P3Y A;  2DYI A;  2J8I A;  3P5J A;  4KIT B;  1QVU A;  2Z8G A;  4UNO A;  2HXO A;  4AUX A;  1TUI A;  4A5N A;  1Z6T A;  1PP8 F;  1J7K A;  4Y9U A;  2EIK H;  1R23 A;  4EGY A;  2QBY B;  5F4J A;  5E3O A;  1B72 A;  1Q1V A;  1BX0 A;  2PMD A;  2HYJ A;  4I0A A;  2KIM A;  3MHP A;  5IT3 A;  4CIC A;  3L2V A;  1Z9C A;  3K4L A;  2EZH A;  1MIJ A;  2VKE A;  1GXQ A;  2HPI A;  3BZC A;  4G8X A;  5FL7 A;  3SHF A;  1D1N A;  4YZ0 A;  1W7P A;  4N4O B;  3M4O J;  1P9Q C;  1O3Q A;  1T95 A;  2R7D A;  3I71 A;  3T56 B;  2X53 S;  1USS A;  2L9N A;  1YI2 I;  4WXH A;  5KCM A;  4XLE A;  3V8J A;  3GVL A;  2IW5 A;  1TT5 B;  1KZH A;  4M3D A;  2C6Y A;  1V0E A;  3RDI A;  2ZSI B;  4R1H A;  3GTJ J;  5FRO A;  2ZSH B;  5D6E A;  4FX4 A;  1Z3Y A;  3ZR8 X;  1IXC A;  1YJN I;  2X6O A;  3DU6 A;  1QHH D;  2GQF A;  3LYC A;  2HOT A;  2OD5 A;  1D8J A;  2K3F A;  4RD1 A;  4M1K A;  3S3N A;  2D74 A;  4RPB A;  3JU4 A;  5HOO A;  5D5U B;  3ZPP A;  3MMY B;  4G94 A;  5DEQ A;  1UD4 A;  2IBD A;  2LMD A;  4AIK A;  2BW3 B;  3DKY A;  2KMU A;  1X1B A;  3DF8 A;  2NNY A;  1FSH A;  3IH4 A;  2QZ8 A;  2RQP A;  2CSO A;  4RD0 A;  3M7G A;  4Q48 A;  3MFK A;  4LBV A;  2HTJ A;  1EWY A;  1U3E M;  5HNF A;  3OYM A;  1ON2 A;  4PJJ A;  3DEW A;  5ICC A;  1U9O A;  3HOV J;  2KVO A;  3GQ7 A;  1HVX A;  2C5B A;  4BXF A;  1TW3 A;  1QA2 A;  1TQI A;  2X0L A;  1S7E A;  1Y0U A;  3K4J A;  4CZC A;  1IV8 A;  2NYX A;  4ESB A;  2QSG X;  2DY1 A;  1K83 J;  4LMY A;  2J5O A;  3L1P A;  2MW8 A;  5D4S A;  1E3P A;  5FO1 A;  2X6X A;  5ILU A;  5L3C A;  5CVR A;  5IP9 J;  4G6I A;  1H85 A;  2DW4 A;  3BCB A;  4OOI A;  4TV7 A;  3ZC3 A;  1Q1H A;  2EA4 A;  1A6Q A;  2FSW A;  2NOG A;  4PFO A;  5B1B H;  2GPJ A;  1KCD A;  4Z4V A;  3OYH A;  3N90 A;  4YDT A;  4HYE A;  2Q2E A;  4YFK F;  1RC9 A;  3P26 A;  2OUM A;  3KP5 A;  5BOX A;  2DDB A;  1VQL B;  4QPQ A;  5F4O A;  3W2H A;  1QGP A;  5IYQ A;  5DM7 F;  1YX5 A;  3DQV C;  5BNG A;  3I56 I;  1WDT A;  2VFM A;  1VQ9 B;  3E1S A;  1GV5 A;  2EK5 A;  2FX3 A;  1H8A C;  2W84 A;  3CD6 I;  4WCG A;  2K4B A;  4O5V A;  1BX1 A;  2EFG A;  3QOP A;  2LVS A;  4A0Z A;  4M72 A;  3AG2 H;  3AVX A;  1OJL A;  5HDN A;  5THX A;  4D5C A;  3F8F A;  3LSH A;  2Z33 A;  4GO1 A;  4XSZ F;  1H88 C;  5HLG A;  2HWV A;  3HKZ N;  3ABU A;  4IHX A;  4BQO A;  4XRF A;  3TKY A;  4OOS A;  3ULQ B;  2VBM A;  4FN5 A;  3SJP A;  3N05 A;  5JLX A;  3MKZ A;  3BR2 A;  3JCU C;  3GIR A;  1EH6 A;  3Q6Q A;  4MHG A;  2MFZ A;  3SFI A;  3MAJ A;  4XLH A;  1R58 A;  5IOY A;  1SFO J;  1IRZ A;  2JN9 A;  2X4H A;  2KIF A;  2M3A A;  1Z05 A;  1WMR A;  2XB5 A;  1F4K A;  2VB6 A;  1OCT C;  1TTY A;  2E71 A;  1V5V A;  5FA6 A;  2M1B A;  4OPS A;  2XTX A;  3J7A O;  4AF7 A;  1DPU A;  3CCL I;  1YIT B;  1GVJ A;  1O8G A;  2CQN A;  2ODL A;  4H4K C;  4HDU A;  2JSP A;  4OIP F;  1MBH A;  1GR1 A;  3BZ6 A;  5K1Y A;  3OSF A;  1WSV A;  3V7A A;  3I55 B;  5GPA A;  3F8C A;  4V2G A;  4Y7N J;  3PO3 J;  4XOP A;  2L3D A;  4G7X A;  4M6V A;  1VQ8 B;  5LHI A;  4U7D A;  4ROX A;  1BIA A;  4DYQ A;  1TNS A;  2EZI A;  3V76 A;  4P1W A;  3G71 B;  4RD2 A;  2R7F A;  1Q7Y D;  3CMA I;  1XGO A;  2M87 A;  3M07 A;  1ETW A;  1XG1 A;  1FNC A;  1JNY A;  1Q9S A;  1IC8 A;  2QA4 I;  1QVF B;  3VST A;  5LBQ A;  1PE9 A;  3WBK A;  4OIN F;  1F20 A;  1RR7 A;  1ZRF A;  4C30 A;  3KL9 A;  1JTX A;  1OFD A;  1NG6 A;  2HGC A;  3V8K A;  4WQM A;  1KK3 A;  1ERD A;  2G0Y A;  3W3C A;  3J80 Z;  2ZKZ A;  3IKV A;  1SVO A;  3DP7 A;  4WXD A;  3MCZ A;  4HA8 A;  4E70 A;  1VLO A;  1N75 A;  4E0F A;  3HM5 A;  1SAX A;  3OFN A;  5D5X B;  4NDL A;  3SJM A;  2BE5 F;  4IHS A;  4CCO A;  4RCZ A;  2FUG 2;  4IVN A;  1I1G A;  3HRT A;  3I58 A;  3CCJ I;  4CHU A;  1CNE A;  3GVJ A;  3J81 k;  2LBF A;  4RAG A;  1RPW A;  2D45 A;  3FM5 A;  2EIL H;  2R7O A;  3BY2 A;  1YI2 B;  3TED A;  3P9K A;  4LK0 F;  3K6G A;  9ANT A;  1LFB A;  4J0Q A;  3HAG A;  1HW5 A;  1U0J A;  1WVR A;  3TBI A;  1KA8 A;  4OPO A;  3E6M A;  3OS2 A;  2XRN A;  2K4J A;  4AIH A;  4OOV A;  1YJN B;  1E3H A;  4QVJ A;  2DLL A;  1BL0 A;  3VO1 A;  1E1R A;  4EGZ A;  1DDN A;  3DKX A;  4ENJ A;  2IT0 A;  2VFQ A;  3CRZ A;  5B66 C;  1P4W A;  1S7A A;  4QIW N;  1IDY A;  4ENM A;  3LNN A;  4DW6 A;  3QP6 A;  3CC4 I;  2NTB A;  1HKS A;  1JJ8 C;  4FK8 A;  1MJB A;  3V4G A;  4KIG A;  1MND A;  2IRF G;  2IGK A;  4EV0 A;  1NRK A;  4QHY A;  3P7N A;  4B8X A;  3GFI A;  1O57 A;  1Z91 A;  4BH9 A;  4EJW A;  1YW8 A;  4HDV A;  3C3W A;  4YAU A;  4LOC A;  2ZO4 A;  4I02 A;  4XID A;  2R6H A;  2E5N A;  1TTT A;  3ZRG A;  1UZC A;  4CSW A;  4P9S A;  3B02 A;  2DPU A;  5KSW B;  4LLN A;  3RI4 A;  2OF7 A;  3U1D A;  3TO9 A;  1AWC A;  2HDC A;  1O8M A;  3AVW A;  4DIQ A;  2Y0S N;  2R7T A;  2Z99 A;  3ZQF A;  3JAM K;  1XCB A;  3H0D A;  1BM9 A;  2XGJ A;  4PSX A;  4LG3 A;  1E17 A;  1E3X A;  5B6I A;  5E8I A;  3RQ4 A;  5AN9 A;  5CKT A;  2JMW A;  1QQ1 A;  2NNN A;  2XNJ A;  3WOD F;  3I56 B;  2EIN H;  4JX6 A;  4RM3 A;  2Q0O A;  3CD6 B;  1E43 A;  2OBR A;  2EJR A;  1MD0 A;  2QM3 A;  4RLF A;  1U2R A;  2OQG A;  5F1R A;  1N08 A;  2CUE A;  4A3D J;  1Y56 A;  2M4G A;  1T6Z A;  1ON1 A;  3HUG A;  3L09 A;  3MZH A;  4NC7 A;  4Y9R A;  1BN5 A;  2VE9 A;  4HEA 2;  2GOM A;  4B3A A;  2K9Q A;  3HGY A;  3DCF A;  3A8I A;  3IUO A;  2L02 A;  4FET A;  4AYB N;  1D5Y A;  1WOP A;  2X6Y A;  4HG2 A;  2W48 A;  4DQK A;  4LLG F;  1P7J A;  1Q81 D;  1ZM4 A;  1RZ4 A;  4ZJZ A;  4E7K A;  2HVS A;  4IL6 C;  2QF7 A;  3VB2 A;  5HLI A;  1BLI A;  4W8Q A;  5LHH A;  5FFX A;  4IKF A;  1B72 B;  4O3M A;  2X8K A;  2X3H A;  4YII A;  1FX7 A;  2VJI A;  3WU0 A;  4M3B A;  4OJP A;  1KYW A;  1TWA J;  4KIC A;  2CWE A;  3CLO A;  3VR6 A;  3LA7 A;  3MD2 A;  4P6V F;  1UMK A;  5D4R A;  3JR9 A;  1V5F A;  2KIU A;  1O8L A;  4Z05 A;  1QX4 A;  1WJB A;  1WU8 A;  3CCL B;  4HF0 A;  4F7Z A;  1VFC A;  1SKY B;  3OJW A;  3LVB A;  2B0R A;  2XZL A;  1OR7 A;  4ZTJ A;  3I59 A;  1MSF C;  3SLD A;  1BR1 A;  4ACA A;  2LOO A;  3F3X A;  5D5V B;  2PX9 A;  3AL0 C;  4M6X A;  5EEG A;  4HV6 A;  4IPA A;  1X4P A;  1Y0N A;  1BIB A;  1JTY A;  1EV7 A;  1W36 C;  1ZLK A;  4IOA F;  1DAB A;  2W7N A;  3OS1 A;  5M5W J;  1DGW Y;  2EV6 A;  3W6J B;  4HPQ A;  1OGO X;  3AAF A;  4J01 A;  4ANJ A;  1DDG A;  3CMA B;  1R5N A;  4YC5 A;  1S5L C;  1EP1 B;  2VNI A;  3U2R A;  2HQ5 A;  2G7H A;  2JUC A;  4GRI A;  2QA4 B;  4BE1 A;  2DMQ A;  2XTW A;  2OBS A;  5H2F C;  1WJF A;  3AG4 H;  1BI3 A;  3PVD A;  1UD5 A;  4XM3 A;  4L5I A;  1VZ0 A;  3ZZU A;  2L01 A;  3K9T A;  2I5U A;  3G1L A;  4RB0 A;  2LYC A;  3LFU A;  1TL8 A;  4HF2 A;  4U49 A;  2HR3 A;  3BR5 A;  4XKB A;  2NTP A;  1JA1 A;  1VLY A;  1VJS A;  1IO2 A;  2GXA A;  1KYZ A;  1X3Z B;  1K28 D;  5CPR B;  1JJ2 B;  1QCX A;  1WH7 A;  2MC4 A;  3DTE A;  2YPR A;  3L2W A;  1KQS B;  1DAR A;  2NT6 A;  2W7Z A;  5BPI A;  3GYH X;  4KUM A;  3PA2 A;  2P0W A;  5CLS A;  2M5S A;  3OIQ A;  2QUF A;  4KIF A;  3WND A;  2E2H J;  3CLQ A;  1H8H A;  2OJE D;  3SJZ A;  3CCJ B;  4DNT B;  2VBT A;  2JWT A;  2DTZ A;  3CTA A;  2Y2Z A;  3WU2 C;  2VBS A;  5DCM A;  3FXM A;  3AST A;  5FLX K;  1IXR C;  2Y0M A;  4M0L A;  2YUS A;  3BLY A;  4CZZ A;  2CMP A;  1LFP A;  4B09 A;  3OOU A;  4BHP A;  1IA5 A;  4CYC A;  3NEU A;  3U21 A;  1XPX A;  3IH3 A;  1MMN A;  1G8X A;  4OWR B;  4Y33 A;  1BMF A;  5H5J A;  3SXY A;  5BSY A;  3H09 A;  2OZU A;  5J40 A;  1HDD C;  1WGX A;  4C2U A;  2B63 J;  3VSU A;  3ONY A;  1IN8 A;  1CQX A;  3PUM A;  4K1X A;  5FD5 A;  4OZY A;  1Y6I A;  5LFA A;  3LAJ A;  3I1F A;  1HDP A;  3OMY A;  2GIZ A;  1UJ8 A;  1ZQ3 P;  2E1O A;  4A6E A;  3JRE A;  2QVO A;  1EFC A;  2DI3 A;  1TWF J;  1G3S A;  1S7O A;  5DM6 F;  5IYC J;  3G05 A;  1QFZ A;  3B6C A;  5A2Q K;  1DBG A;  2XPU A;  4Q4Z F;  1MH3 A;  1ZYR F;  3J7A Y;  4D9J A;  4HZF A;  3CC4 B;  2D3N A;  4TMT A;  1XG2 A;  2EZL A;  1MW7 A;  2VQL A;  3OSG A;  2OYN A;  2O04 A;  3S2W A;  2OC6 A;  4G6D A;  3A8J A;  4C0S A;  1D3Y A;  2V7W A;  2QN6 A;  1IUF A;  2XVC A;  3PET A;  2GQQ A;  1XSX A;  1ZKG A;  2DO7 A;  3FIW A;  1E62 A;  2OTL I;  4XIC A;  2FNA A;  1W87 A;  3AG3 H;  4RM0 A;  4M4S A;  3E97 A;  2HEO A;  3NWS A;  3R6S A;  4ESJ A;  3K10 A;  1REP C;  3ZZT A;  1LLW A;  3FMR A;  2P8T A;  3LSJ A;  1OGI A;  4X07 A;  4PCQ A;  5E3M A;  2AXL A;  1D1C A;  1JI8 A;  2A6H F;  2E2J J;  2E1R A;  4MQV A;  4RD3 A;  1AKH A;  1S29 A;  1O8H A;  4UUS A;  4ZDP A;  2OK8 A;  1RR8 C;  3BG9 A;  3DTI A;  3EYY A;  4DZJ A;  2NZM A;  4YFO A;  3CCQ I;  1W34 A;  1JT6 A;  3IV5 A;  1Y1V J;  4XKW A;  3L2U A;  4ZDO A;  3ASQ A;  5ILS A;  3ABM H;  2LR8 A;  1QGY A;  3WE3 A;  2PEX A;  1Z7L A;  2M4K A;  3I4N J;  1XE1 A;  2EFO A;  1N25 A;  1FP2 A;  1SD7 A;  5JLV C;  4KA4 A;  1K4S A;  2L7M P;  3EQN A;  4G5G A;  4ACB A;  3DLA A;  3T1B A;  1MRZ A;  1WP6 A;  2OQR A;  2BF4 A;  4UUT A;  1PJ5 A;  1Y8Q B;  4PSW A;  3WG9 A;  4DGW B;  2LP0 A;  3NAW A;  2QE7 A;  1XSV A;  4AVP A;  3FHZ A;  2CF4 A;  3BDD A;  4MQ9 F;  2CRV A;  1S8N A;  2X9D A;  5HLT A;  4E6K G;  4RLQ A;  3SYJ A;  1R1U A;  1W1W E;  5IOZ A;  4D7N A;  4A6D A;  3VWB A;  4PFP A;  1TBX A;  4X1E A;  2ZL7 A;  4ESF A;  3MMP A;  3N4M A;  5DTD A;  2X0K A;  2BXY A;  2F5E A;  3LSP A;  1VQO B;  1QRC A;  1JE8 A;  2ACJ A;  4DOZ A;  2FE3 A;  3VEP A;  3BR3 A;  4FWT A;  1K6O A;  5J4Y A;  1VQN I;  4M9Z A;  2VBX A;  2R92 J;  2F1M A;  2LG4 A;  2OAZ A;  3IWF A;  5FKK A;  2W1O A;  3GSI A;  4ZCM A;  2IS4 A;  3BP8 A;  2PEC A;  1ZG5 A;  1LDJ A;  4RAF A;  1COW A;  1KRH A;  2QEN A;  4LC0 A;  1RET A;  1LUJ B;  1QA3 A;  2RAE A;  2P5L C;  4LB6 B;  1XGM A;  3CCV I;  2FNP A;  2JA7 J;  2XGE A;  4Z6Y A;  3K70 D;  3ERE D;  3RYR A;  3VO2 A;  3LAP A;  4C2T A;  1OHH A;  4Y3O A;  4HBL A;  3A4C A;  1ZGA A;  1ZUN B;  3KEQ A;  3HOZ J;  4LIV A;  1KD1 D;  5F64 A;  5HS7 A;  3RZO J;  3VFZ A;  3GQ8 A;  3TW6 A;  4UZU A;  1YJW I;  4P9F A;  2DA1 A;  2HYF A;  1IN7 A;  3OYE A;  1G7R A;  3TH0 A;  2KJB A;  4G6T B;  2XSD C;  2ETH A;  1R5B A;  4MYT A;  3EUK L;  5HLH A;  4ON0 A;  3F8B A;  2AQF A;  1X3W B;  2DMU A;  2L7Z A;  3FXK A;  3ISP A;  3SEQ A;  1UST A;  5AIP A;  3OYI A;  1XMK A;  4LD5 A;  2HZT A;  1KZL A;  2E1B A;  1DBO A;  3WBJ A;  2JJ7 A;  4L5J A;  1IW7 F;  1ETV A;  1UFM A;  2LY1 A;  4W97 A;  5KAF C;  1OR7 C;  5F0H A;  3CF5 F;  2PYH A;  4EM0 B;  4II2 A;  4HX7 A;  1U6G A;  1X2M A;  2F4M B;  4ZZL A;  2K02 A;  3W5U A;  2KJC A;  2J8K A;  2F4N A;  2VJJ A;  1OFC X;  3HIF A;  4LFU A;  4Y15 A;  1AU7 A;  3JX8 A;  3FJO A;  2VBV A;  5ERI A;  2DK5 A;  4HST A;  1PUF B;  4DK1 A;  2V79 A;  2PLY A;  3UNG C;  4DBR A;  2WV1 A;  3FZV A;  3HPG A;  2TRT A;  4RB1 A;  2BVN A;  3OKX A;  5HZA A;  1X58 A;  1FDR A;  2VKD A;  3HL2 A;  1ETK A;  1FPQ A;  5CQG A;  5E17 F;  4L5E A;  2E1N A;  2V4D A;  1DU0 A;  3ES9 A;  5FD6 A;  2E5Z A;  3ZQC A;  1EH8 A;  2ZXH A;  2ZME B;  4NC6 A;  3ZQG A;  4GFB A;  4OIQ F;  4BUP A;  5C4X J;  5GV8 A;  4FQG A;  5JI6 A;  2JA8 J;  1CQT A;  2C77 A;  4ZCL A;  3WU1 B;  3G4S I;  4L0Y B;  3SZP A;  3CMM A;  5E20 A;  2XAH A;  4U0V A;  5EYR A;  2I1L A;  2RQQ A;  3CQZ J;  2LY9 A;  3A0H C;  3ZMD A;  5EJC A;  2B7C A;  1B8I A;  4A3G J;  1I6X A;  2BHY A;  3R0A A;  3DKW A;  1FNB A;  1POG A;  4HW0 A;  2R7X A;  3EUH A;  5E1W A;  1R4N B;  2HU9 A;  3BG7 A;  2RC4 A;  4WX9 A;  5J8F A;  2JA5 J;  3RJP A;  2P5K A;  1WI9 A;  2XKO A;  2VJ4 A;  4BQQ A;  2UXX A;  2JQ7 A;  2LDU A;  1LPQ A;  2W82 A;  1X2N A;  2XGX A;  2VC0 A;  1IDJ A;  2LRE A;  2FBI A;  3ONQ A;  3CJQ B;  3BH4 A;  2OTL B;  3H5R A;  2VZL A;  2EFN A;  1A31 A;  4RDL A;  2LF8 A;  2R5Y A;  2CYY A;  2EIJ H;  1EZG A;  1T08 B;  5JR3 A;  2VKV A;  4QPO A;  2C78 A;  1O3S A;  3K4K A;  4LG0 A;  3MVP A;  3S93 A;  2BGI A;  1WWX A;  2XT2 A;  3ML6 A;  2DOD A;  2JTV A;  4I2O A;  2V1D A;  2QCO A;  3V7C A;  3PUN A;  3FXO A;  4ZYE A;  4BJ5 C;  2C4T A;  2L7F P;  1FRQ A;  1V0F A;  3OZU A;  4ZTF A;  3AVY A;  2F4I A;  2QKM B;  1V54 H;  2WY8 Q;  4QLC U;  1YYV A;  1QH0 A;  3QYF A;  3CCQ B;  1LDD A;  1UEL B;  3GZN B;  5GAH J;  1O4X A;  2BBY A;  3RPU D;  3LSG A;  1OKR A;  3EET A;  4HSR A;  2BV3 A;  4Z4W A;  1K73 D;  2Y9Y A;  2ELJ A;  4MNU A;  3JRD A;  1FOX A;  2AS5 F;  2HFH A;  2V9K A;  1OCP A;  4EJV A;  3REO A;  3TL4 X;  2R7S A;  2VT3 A;  5HZB A;  1WZ2 A;  4XRS G;  1I50 J;  1EH7 A;  3DFG A;  5CQE A;  1GJR A;  2K3P A;  2KZG A;  1T6S A;  2KZV A;  3G1M A;  2HVR A;  3JRI A;  4KKU A;  2ISZ A;  3QFR A;  2DJN A;  3TOB A;  2IA1 A;  3FK6 A;  3L00 A;  3B82 A;  4NQW B;  3TP0 A;  2HZD A;  3PA1 A;  4RLZ A;  5B1A H;  1TW2 A;  5B5E C;  4TSF A;  1BR4 A;  2BY2 A;  4NNJ A;  1OB0 A;  2EBI A;  2HDN B;  2O6W A;  2A07 F;  2M34 A;  4AD9 A;  4HNU A;  1N06 A;  3K2A A;  2QWW A;  2L2O A;  4EQQ A;  2HOS A;  2B7E A;  2CW0 F;  1VQN B;  1FC3 A;  1N77 A;  4KYW A;  1XGN A;  3KZY A;  2DFE A;  5EG0 B;  3J81 Z;  2XZP A;  1BBY A;  5LGU A;  3VYT B;  4E7I A;  1HLV A;  4CQJ A;  3FK7 A;  1MBJ A;  2KRC A;  5K7H A;  2DA6 A;  2R9V A;  5A89 A;  3Q39 A;  4G1V A;  1G7C A;  5H6Q A;  1O3R A;  4UAJ A;  1OFE A;  1X1C A;  3AFH A;  2LKP A;  4RGX A;  3CCV B;  3PUB A;  1BR2 A;  4UZF A;  4LB5 A;  2LC2 A;  3IRR A;  2Q8K A;  2VC1 A;  3U6K A;  4KMU X;  3TP3 A;  4OOX A;  2IA2 A;  3VMV A;  3I4P A;  1WTH D;  3CC7 B;  5C44 J;  3BH7 B;  4YFN F;  3SQN A;  1OCC H;  3HHG A;  3K1M A;  5LGN A;  2E2I J;  2KRF A;  4XLF A;  2WWY A;  2K27 A;  1SMY F;  3FF5 A;  1CGP A;  1U8B A;  1WPC A;  2QZA A;  2ZNZ A;  1SFK A;  5HS8 A;  3WTU C;  1JKQ C;  1YJW B;  4I01 A;  4ZV4 A;  4XLN F;  5LGT A;  3W6V A;  2BM1 A;  5TIS C;  4R71 A;  2NRA C;  5DS0 A;  3LJY A;  3GQA A;  3D5L A;  4M3E A;  3VYU B;  3PNY A;  3BT9 A;  3ECO A;  4RDU A;  3HB9 A;  4CH7 A;  1MSE C;  5FO0 A;  4XNF A;  1F60 A;  3PQK A;  2FQ4 A;  2HTS A;  3QFT A;  3KEY A;  4D1Q A;  2H8W A;  2V7U A;  2DOA A;  1WH5 A;  3R61 A;  4Z4T A;  4RDJ A;  2WR8 A;  4W8T A;  2VXZ A;  4X6A J;  1FTT A;  3Q6R A;  1RKT A;  3LSM A;  1XMA A;  3V8L A;  4BEH A;  3F23 A;  1V4R A;  1XS9 A;  4DNC A;  3PSI A;  2Q1Z B;  1IJE A;  5JFR A;  1QGA A;  4YIF A;  4XOR A;  2O03 A;  2IOU G;  4M3F A;  2JT1 A;  1AKH B;  2XC7 A;  3KZZ A;  2EH3 A;  1WHU A;  4FIS A;  4G9Y A;  2MGQ A;  5AIQ A;  2P3M A;  3ABT A;  3W5H A;  5F04 A;  3DPL C;  3ECH A;  2R7Z J;  5JMC B;  1ENH A;  3V7S A;  5DSZ A;  1ZAO A;  3G4S B;  2BVL A;  3AVV A;  4IJA A;  1S72 I;  3OYK A;  1LB2 A;  1JTA A;  3H9Q A;  3I0T A;  3JW4 A;  1TQP A;  3G2B A;  3QYB A;  3K1P A;  1X4O A;  2F4O B;  2QQB A;  2ZCW A;  1JGS A;  2VAS A;  1RQP A;  3BOQ A;  3LL7 A;  1U2W A;  2FOW A;  1S0U A;  3QOE A;  3SZT A;  4GXO A;  1E79 A;  1A6I A;  3DU1 X;  1MBK A;  2BY3 A;  5IP6 A;  1UD8 A;  3B6A A;  3E20 A;  4XMY A;  1Y0Y A;  1M90 D;  3LMM A;  4S05 A;  1P7I A;  2M7A A;  4RGU A;  1PJR A;  4E7Z A;  1MH4 A;  3KZI C;  2RGV A;  1W5S A;  2QSF X;  2YX4 A;  1XSD A;  2ME6 A;  3FWE A;  1BC8 C;  2ZBV A;  1JUP A;  4ZYG A;  4LGW A;  2L54 A;  4L9T A;  3GTQ J;  3HG9 A;  2XGD A;  3M1C A;  1C0W A;  5BSX A;  1XQB A;  1LQ1 A;  5FGM A;  3BR6 A;  2WA0 A;  3PM1 A;  2GJP A;  4X06 A;  4PUS A;  4KN7 X;  4DYR A;  4XLP F;  3AKZ A;  1T8I A;  2NV4 A;  4MXN A;  2EV0 A;  3OYF A;  1TYV A;  1PXZ A;  3O8H A;  2Y69 H;  5IYR A;  1CNF A;  4X7D A;  5GP9 A;  4ZH4 F;  2GK6 A;  3PFY A;  1QU3 A;  3WTS C;  4YEJ A;  3SZE A;  1G2H A;  3FXQ A;  2LK2 A;  1SVM A;  1H0M A;  5GAE J;  1JRG A;  4NHJ A;  3WYA A;  4PAB A;  2NPF A;  4ZCI A;  3EUH C;  1YHQ I;  5TR9 A;  3GEZ A;  4YRV A;  1UD3 A;  3GZ5 A;  4URR A;  4LBZ A;  3K4N A;  3W5V A;  2H6B A;  1YLF A;  4L9J A;  1IAW A;  3OEH A;  1LFU P;  3S3O A;  5IYW A;  2XOK A;  2E19 A;  2K7L A;  1N0V C;  3A01 B;  1BW5 A;  2XSJ C;  1JGG A;  2WPD A;  1O8K A;  2DPD A;  3FMS A;  5L3F A;  2OU2 A;  2QYO A;  3OR2 C;  1WJE A;  2WAQ A;  4UB8 C;  3S2H J;  3P4G A;  5IYP A;  3B78 A;  4FXU A;  2CO5 A;  1G7S A;  4CCL A;  1BI2 A;  1U9N A;  4HV5 A;  1MJ9 A;  3G3Z A;  4RAZ A;  1LNW A;  4B47 A;  5EF6 A;  5HOD A;  1I3A A;  2UWM A;  4BPR A;  2L7K A;  5F1J A;  4D5F A;  2PQ8 A;  4OJO A;  1TC3 C;  1JUM A;  2HQR A;  3BJA A;  2DQR A;  1R5H A;  1WJD A;  5AMV A;  1V55 H;  2HYG D;  2C4U A;  1TQM A;  5ILV A;  4L0Z B;  3ABL H;  3Q9V A;  1V3F A;  2VJ5 A;  5LRS A;  5LEK A;  4PAA A;  4MGR A;  4ZZD A;  2O8X A;  3BH6 B;  1R71 A;  4Z4R A;  2QLZ A;  4X05 A;  4B3F X;  1SVL A;  2BN4 A;  4F7D A;  3C2H A;  2DK8 A;  1FIA A;  2LFB A;  4LLL A;  2VIX A;  3V7R A;  2OBT A;  3S1N J;  2BVM A;  4N3N A;  2O17 A;  5IT9 K;  3ZN1 A;  3CCM I;  2RRE A;  4BE2 A;  3CCE B;  3CJN A;  4L9N A;  3ZMT A;  3HTS B;  1MDM B;  1UHM A;  1GVH A;  5K5R A;  2HOE A;  4A3M J;  3RZD J;  4GYG A;  4NK8 A;  1KGS A;  1D8K A;  2CG4 A;  4YHB A;  1BJZ A;  3ABK H;  1HQC A;  3LOC A;  4E4H A;  4F92 B;  2NVQ J;  1KK0 A;  2E1C A;  4YAW A;  2VON A;  3FMQ A;  3A1P A;  1G7T A;  1WCM J;  2HQA A;  2LF7 A;  2CU7 A;  1HST A;  3OV8 A;  2VBY A;  1B8I B;  3ZPN A;  2DA4 A;  5E3L A;  5FFZ A;  2CV0 A;  2MSY A;  3HRM A;  4M9X A;  5GAD J;  3S1R J;  4EJT A;  3MWM A;  4X7F A;  3OE7 A;  4S0H B;  4HE6 A;  4CCJ A;  1IJF A;  4EAT A;  3A2K A;  5J3O A;  1VQ6 B;  1XD7 A;  3RPQ A;  4BS9 A;  4P96 A;  4HX4 A;  3FPK A;  3CMY A;  2HOA A;  2XIG A;  3G1O A;  1JJ6 C;  1HBX G;  3S17 J;  3LA3 A;  3GBG A;  1VHO A;  1U5T A;  2Q6O A;  4ZYA A;  2E7W A;  5TRD A;  3GW2 A;  3IAM 2;  3X2Q H;  2UVF A;  2HDW A;  2IPQ X;  1EJ9 A;  1P92 A;  4FAS D;  2JPC A;  4WZL A;  2CW7 A;  1TT0 A;  2FXA A;  1D2E A;  3OYL A;  2H94 A;  1MKM A;  2YU3 A;  1YTY A;  5BMZ A;  3NE5 B;  2MG4 A;  1FP1 D;  1IRX A;  2P81 A;  2VBE A;  5TY0 A;  2WYR A;  2ZBK A;  3S8P A;  4E7H A;  2BY0 A;  2RC6 A;  3DV8 A;  3HSR A;  2VNJ A;  2DYR H;  3ZMS A;  3NAU A;  2VYQ A;  2R5Z A;  1VQP I;  3OP1 A;  1RIO H;  1S72 B;  4EM1 A;  2MBF A;  1O8I A;  3QWL A;  2ZTN A;  3BPV A;  3ZQ7 A;  3LQ6 A;  3OZW A;  3QSY A;  1SFE A;  3L2R A;  2ZZG A;  2P4W A;  2BV6 A;  1RES A;  3F72 A;  3H3U A;  3IP4 B;  4P9U A;  2HDD A;  4U0Y A;  4C2L A;  4TMX A;  4RPD A;  4G7H F;  1B23 P;  2XPW A;  1W5C C;  1JKO C;  1FOK A;  2LNB A;  5FLV A;  4YZA A;  3UR3 C;  2VBK A;  2VPR A;  1O7L A;  4FX0 A;  5DV5 A;  1WKM A;  3LWF A;  5LMZ A;  5H6R A;  2RC5 A;  2QQA A;  1N05 A;  2DMT A;  3G6E I;  1RUN A;  1V5G A;  2DIE A;  2EIX A;  3J7Z I;  2BY1 A;  3ERM A;  3OIO A;  2UVE A;  2FBK A;  1WRJ A;  3OPO A;  1QZZ A;  4ZYD A;  2YR2 A;  1RKW A;  1D0X A;  2ZBU A;  2QY1 A;  3A1Y A;  3S3M A;  2ZL5 A;  3VOE A;  3OS0 A;  2VUM J;  5CDF A;  4YEL A;  1VQO I;  1PVE A;  1YW9 A;  1FT9 A;  1UMQ A;  2IJL A;  4P25 A;  4JRA C;  3WNC A;  2B7B A;  1FOW A;  3M9A A;  3M3Y J;  1AOY A;  1W7P B;  2VE8 A;  3RKQ A;  2FRH A;  4RB3 C;  2WB1 A;  3IAS 2;  3P27 A;  2M2E A;  1ETY A;  4OU0 A;  4U4B A;  1EF4 A;  1KU9 A;  2A6E F;  4UXN A;  4A3J J;  1Y39 A;  1J75 A;  3RKY A;  4ETS A;  2V6E A;  4WZT A;  1J2X A;  1OMI A;  3OW2 B;  1YHQ B;  1NK3 P;  1QGZ A;  3FBN B;  4N9H A;  2ELH A;  2P6S A;  2O7O A;  4FE7 A;  3HC7 A;  2QTZ A;  3OIP A;  2XV4 S;  4HNT A;  5KNL A;  2IS2 A;  2PLF A;  3HPH A;  4K2E A;  4B44 A;  3MKY B;  2YWE A;  2XRL A;  1R00 A;  4IXA A;  2Z6B D;  3BZK A;  4HIZ A;  1E63 A;  5ICG A;  3KX2 A;  4FT8 A;  4LJZ F;  4P1V A;  4F55 A;  1HXD A;  2YWH A;  2QYU A;  1ZN2 A;  2L0K A;  2ZXW H;  2GWR A;  1K61 A;  5BPD A;  1MNM C;  4M53 A;  1QBJ A;  1KC8 D;  2P7V B;  5L46 A;  5K7Z A;  4BEH B;  1ETX A;  4NC8 A;  1JB9 A;  3H1C A;  2LH9 A;  3LSR A;  3JRG A;  2JZY A;  3RQI A;  1IF1 A;  1JHH A;  3SFZ A;  3OYB A;  4XR6 A;  1O8D A;  3WTW C;  4JOM A;  2QSH X;  1A8P A;  1O8E A;  2W6I A;  2L4A A;  1LEB A;  1J0R A;  3DDY A;  3KP7 A;  3ZMU A;  2A3S A;  1UG0 A;  4X7C A;  2QEX B;  1D1A A;  3CCM B;  1GQ8 A;  3SDG A;  2RNG A;  2M0C A;  2D1H A;  2KL4 A;  1UG2 A;  3E7L A;  5E1Z B;  5D8L B;  1DUX C;  2H1K A;  4EH1 A;  1CLW A;  2Q2E B;  1NB9 A;  1YIJ I;  2BM7 A;  1PYV A;  2W00 A;  2F3L A;  2GA2 A;  2JRM A; 
#chains in the Genus database with same CATH homology
 2LY1 A;  5FRO A;  1OR7 C;  2ZSH B;  1VF7 A;  4DJA A;  1Z3Y A;  3ZR8 X;  1O88 A;  3A3B A;  4II2 A;  2PYH A;  3BG6 A;  1NG7 A;  3DU6 A;  5LD2 C;  1QHH D;  2VJJ A;  2WAE A;  4PK4 A;  1E0E A;  4U7B A;  4LIT A;  1MAB A;  3S3N A;  2JJ1 A;  3D5S C;  1RMG A;  3JU4 A;  5HOO A;  3ZPP A;  4HST A;  3MMY B;  1UAA A;  1UD4 A;  4DK1 A;  2BW3 B;  3DKY A;  2KMU A;  1X1B A;  3HPG A;  3OL4 A;  3UNG C;  4DBR A;  4W8S A;  2V4J C;  4ASU A;  2VKD A;  3AL0 B;  3HL2 A;  2K9L A;  2XZO A;  5CQG A;  4CCK A;  5HNF A;  3OYM A;  4PJJ A;  2V4D A;  3GQ7 A;  2KVO A;  1E1Q A;  1HVX A;  2INU A;  4BXF A;  2E5Z A;  2ZXH A;  2W4S A;  3K4J A;  4XOT A;  3K4C A;  4CZC A;  1GLN A;  4X0G A;  4BUP A;  2JA2 A;  4RMN A;  1T5E A;  3KYL A;  3WQZ A;  4CUG A;  5C1C A;  2X6X A;  5FRN A;  3CMM A;  4G6I A;  2KP6 A;  3BCF A;  3BCB A;  1K6Y A;  4XON A;  3C2G A;  2INV A;  2E1M C;  2RQQ A;  1KON A;  3D5R C;  1AA7 A;  2WBM A;  1X0C A;  2W6J A;  4PFO A;  2IS6 A;  1KCD A;  3OYH A;  4PJN A;  1NBM A;  3SUC A;  1HA8 A;  2OUM A;  2UV1 A;  2R7X A;  3A35 A;  4QPQ A;  2XDV A;  2XAU A;  3ZQQ A;  4BJT A;  3CP2 A;  2HU9 A;  1YX5 A;  3BG7 A;  3DQV C;  4Z06 A;  1T0F C;  3E1S A;  2VJ4 A;  4BQQ A;  3DWL E;  2O0V A;  2W82 A;  3CJR B;  4J00 A;  1IDJ A;  1HG8 A;  2LRE A;  2ZZE A;  1KTW A;  2NTQ A;  3ONQ A;  3CJQ B;  3BH4 A;  3H5R A;  3ZXS A;  3OEE A;  2BW3 A;  3LSH A;  2HNH A;  4W8R A;  4QPO A;  2DJI A;  1MNE A;  3K4K A;  4XN0 A;  3ZGK A;  3S93 A;  2KLO A;  3RTR A;  2GK7 A;  4BQO A;  2ZZF A;  4B3X A;  1IB4 A;  3KRG A;  4BJ5 C;  1G59 A;  1X1D A;  2VBM A;  3N05 A;  1V0F A;  3MKZ A;  4ZTF A;  2F4I A;  2QKM B;  2CV1 A;  2WY8 Q;  3OYD A;  4MR0 A;  2MFZ A;  3QYF A;  1UEL B;  4XLH A;  3H35 A;  3TMO A;  1PKV A;  3RPU D;  3LSG A;  4HSR A;  3K70 C;  4G7W A;  2M3A A;  1WMR A;  2ELJ A;  2HVQ A;  2VB6 A;  4Y4R A;  2M0M A;  2VPL A;  1BHE A;  3BCA A;  2V9K A;  2JIZ A;  4KKS A;  2QX3 A;  3CZ6 A;  3TL4 X;  4C9Y A;  2NOJ B;  2ODL A;  2R7S A;  3FBI B;  1O8G A;  4H4K C;  5CQE A;  2JSP A;  4DK0 A;  3OYA A;  2K3P A;  4PJM A;  2KZV A;  4KKU A;  1VBL A;  2HVR A;  1UD5 A;  2GOX B;  4XOP A;  2WJY A;  2NSP A;  4G7X A;  2LBF B;  2X1C A;  2Y0S A;  3H9G A;  4NQW B;  3OR1 C;  2HZD A;  4BAC A;  3KEW A;  4TSF A;  1BR4 A;  4NNJ A;  1OB0 A;  3FKJ A;  2VLA A;  2L9S A;  4HNU A;  3CF2 A;  3PNT A;  4BGD A;  1UD6 A;  2L2O A;  1X19 A;  4XN3 A;  4F3Q A;  1O8L A;  1N77 A;  3EPZ A;  2ZZQ A;  3VST A;  2CH0 A;  4E7L A;  2XZP A;  3RCO A;  1AIR A;  3VYT B;  4E7I A;  4KT6 A;  3VYR B;  1PE9 A;  1RWR A;  2KRC A;  2WJV A;  2R9V A;  2CS3 A;  4C30 A;  2F43 A;  1NG6 A;  1X1C A;  5KHD A;  3AFH A;  1ERD A;  3ZSC A;  3W3C A;  3PUB A;  1BR2 A;  4AYB A;  3JUR A;  2LC2 A;  2WAF A;  4BDZ A;  3QYE A;  3VMV A;  1WTH D;  4DBQ A;  3QOD A;  1N75 A;  4Z03 A;  3HXL A;  4JMQ A;  4E0F A;  3OFN A;  4XLF A;  1WJ5 A;  1X1A A;  1WPC A;  4CCO A;  1SFK A;  4OAZ A;  2FUG 2;  3ZCO A;  1K5C A;  3W2A A;  3OYN A;  4RM2 A;  3GVJ A;  2LBF A;  4U87 A;  1KMH A;  2JUG A;  3F9K A;  3GQA A;  3D5L A;  3VYU B;  3OAA A;  2R7O A;  3GQB A;  3PNY A;  3GRH A;  1W36 D;  4CH7 A;  3K6G A;  4XNF A;  3OY9 A;  3HAG A;  1U0J A;  3TBI A;  4IZZ A;  3SDB A;  3T53 B;  1RU4 A;  2CV2 A;  2GJK A;  3KEY A;  4D1Q A;  5JHF A;  4W8T A;  2DOA A;  2IXS A;  3OS2 A;  2JVG A;  2EWE A;  2VXZ A;  1O8F A;  2HLD A;  3LSM A;  4BEH A;  3H9J A;  3PSI A;  2Q1Z B;  2R7W A;  1BPL A;  1E1R A;  2MYS A;  4XOR A;  3DKX A;  1EFR A;  1MMA A;  1YE9 A;  3HUG B;  2LZJ A;  2IS1 A;  4DNR B;  2XC7 A;  2ZFU A;  2F6C A;  3LNN A;  2A6T A;  4XD7 A;  1R6R A;  2X51 A;  2NTB A;  4N4N B;  1MND A;  3VMW A;  2IGK A;  1MMG A;  1NRK A;  3K4M A;  3DPL C;  3LMW A;  1UD2 A;  2VQC A;  3M8J A;  3B8Y A;  3UW0 A;  2BVL A;  4F93 B;  3OYK A;  2E5N A;  4KIS A;  1DQU A;  3H9Q A;  3ZRG A;  1DGR M;  1JTA A;  4I84 A;  3QYB A;  4CSW A;  3G2B A;  2OV7 A;  3OYG A;  3WWG A;  1X4O A;  1WJA A;  4OJ5 A;  2BSP A;  2VAS A;  1O8M A;  1FX0 A;  3LL7 A;  3T51 B;  4DIQ A;  2R7T A;  3B90 A;  4E7J A;  3FY3 A;  3QOE A;  1NHC A;  1E79 A;  1KCC A;  1J09 A;  3H0D A;  2XGJ A;  4PSX A;  4LG3 A;  3VSV A;  1E3X A;  4L8J A;  1UD8 A;  3RQ4 A;  4XMY A;  5CKT A;  3VDX A;  3LMM A;  2AQE A;  2M7A A;  1PJR A;  1D0Y A;  4E7Z A;  3VSK A;  5HKK A;  2R7V A;  4RM3 A;  1E43 A;  4PJL A;  3H94 A;  2R7R A;  3ZIA A;  4RLF A;  2WY7 Q;  2QKL B;  2A5W A;  3FKS A;  1Y56 A;  2M4G A;  3HG9 A;  4IQ4 A;  3M1C A;  1N78 A;  4NC7 A;  1MMD A;  1E3Z A;  3BC8 A;  2NST A;  2WA0 A;  2KQR A;  2GJP A;  2X1D A;  4HEA 2;  4PUS A;  2GOM A;  3AKZ A;  4ITV A;  4MXN A;  2PJR B;  3A3G A;  3IUO A;  3I9V 2;  4FET A;  3OYF A;  1OLT A;  2KHM A;  2XF7 A;  2X6Y A;  2XND A;  1OOC A;  1PXZ A;  2KPM A;  4HG2 A;  3SEZ A;  1DP3 A;  2GK6 A;  3PFY A;  1QU3 A;  2JDI A;  4E7K A;  2BOL A;  4ZJZ A;  3VYS B;  4YEJ A;  2HVS A;  1BLI A;  4W8Q A;  4CA0 A;  2IQ7 A;  4IKF A;  2X3H A;  1JRG A;  2X8K A;  1OFL A;  2VJI A;  3EUH C;  4BU2 A;  3BCD A;  2LRD A;  4OJP A;  4YRV A;  1UD3 A;  4URR A;  2PYG A;  3B4N A;  2E1M B;  2VQH A;  3K4N A;  3RSN A;  3VR6 A;  3MD2 A;  3OEH A;  2UUZ A;  3S3O A;  2V26 A;  2XOK A;  3GVK A;  1TZL A;  1V5F A;  3EQO A;  2XSJ C;  4XLA A;  2WPD A;  1O8K A;  4Z05 A;  1V5E A;  1WJB A;  2V31 A;  4BDY A;  2M7B A;  1I8D A;  2DXI A;  4YZQ A;  3OR2 C;  1WJE A;  2WAQ A;  1SKY B;  2XZL A;  4ZTJ A;  4FXU A;  1BR1 A;  2LOO A;  2WAD A;  5TGT A;  4CCL A;  4AU7 A;  3AL0 C;  3DPU A;  4B47 A;  1EA3 A;  2UWM A;  1X4P A;  2L7K A;  4P5O A;  3PSF A;  4II3 A;  1W36 C;  2Z1D A;  4OJO A;  2W7N A;  3OS1 A;  1WFX A;  4B48 A;  1DGW Y;  1WJD A;  5AMV A;  4MLO A;  2CK3 A;  4HPQ A;  1OGO X;  4J01 A;  2KDO A;  4ANJ A;  2MAB A;  2XF5 A;  2IGN A;  2VJ5 A;  3SZG A;  3OYJ A;  2GJR A;  2O0W A;  4B3F X;  4LIU A;  2V7Q A;  4GRI A;  3C2H A;  4BE1 A;  2R7Q A;  2VIX A;  1WJF A;  4XKC A;  2BVM A;  2O17 A;  3OL3 A;  3V42 A;  2DT6 A;  2MD0 A;  2RRE A;  4XM3 A;  1VZ0 A;  4JQF A;  3S32 A;  4R79 A;  4BE2 A;  1WJC A;  5C1E A;  3H5A A;  4ZC3 A;  3HOS A;  2LYC A;  2LY2 A;  3LFU A;  4U49 A;  2JVH A;  1W9X A;  4KKT A;  1BOB A;  2KRH A;  4XKB A;  1VJS A;  1VLY A;  2NTP A;  4NK8 A;  4IX7 A;  2IGM A;  4F92 B;  4E4H A;  5HNH A;  1IDK A;  1K28 D;  5CPR B;  1QCX A;  2MC4 A;  3DTE A;  3L2W A;  2HQA A;  4AVZ A;  2DCE A;  2NT6 A;  4B3G A;  1H80 A;  2PMZ A;  3FDY A;  4F91 B;  5DN6 A;  3ZPN A;  2CV0 A;  3LSI A;  2P0W A;  2M5S A;  3OIQ A;  4KJZ A;  3DU5 A;  3DPT A;  1H8H A;  3I3L A;  2QXZ A;  4DNT B;  2NT9 A;  3OE7 A;  4XKV A;  2WSS A;  4CCJ A;  3NWT A;  4TKO B;  4EAT A;  4BE0 A;  3A2K A;  4OAY A;  3BLY A;  4BS9 A;  2CMP A;  1D0Z A;  1LFP A;  3OOU A;  2R7U A;  3BC9 A;  3FPP A;  1IA5 A;  2Z2S B;  2HPM A;  3U21 A;  3FHN A;  4OWR B;  1MMN A;  1G8X A;  4Y33 A;  4BQN A;  1BMF A;  4TT3 A;  1OGM X;  4P22 A;  1OFM A;  4C2U A;  3VSU A;  3GBG A;  2CUJ A;  4ZYA A;  3H5N A;  4OZY A;  1Y6I A;  3IAM 2;  2UVF A;  5LFA A;  2HDW A;  4NUB A;  3OMY A;  4FAS D;  2VXD A;  1HZE A;  3OOC A;  4YZX A;  2CW7 A;  1TT0 A;  2O5R A;  2VQG A;  3CP8 A;  3OW7 A;  2DT7 B;  3OYL A;  3G05 A;  4NK6 A;  3T9G A;  3NE5 B;  1LDK B;  3OWT A;  1DBG A;  5FRM A;  3J7A Y;  2V7F A;  1W0K A;  1IRX A;  4D9J A;  4XQF A;  1ZEL A;  2D3N A;  2VBE A;  1XG2 A;  3PL8 A;  1MW7 A;  2VQL A;  3OYC A;  2O04 A;  2OC6 A;  3S8P A;  4CCM A;  4E7H A;  1YX3 A;  2E60 A;  4XL9 A;  1Z21 A;  4EW9 A;  1O8I A;  2V1N A;  2X1E A;  2ZTN A;  3NWS A;  1I18 A;  3K10 A;  3L2R A;  2ZZG A;  2ZXI A;  4C2L A;  3IP4 B;  1D1C A;  3HOT A;  1JI8 A;  4OJ6 A;  4F52 A;  1O8H A;  4ZDP A;  2F5V A;  3UR3 C;  2VBK A;  4YZA A;  3DTI A;  2NZM A;  2DIE A;  1V5G A;  2K5C A;  4ZDO A;  4XKW A;  3L2U A;  1H8E A;  4YXW A;  2IGO A;  2Z16 A;  3SYT A;  1SAU A;  1QHG A;  3CES A;  3K4B A;  2UVE A;  1Z7L A;  2M4K A;  3OPO A;  1O8J A;  1D0X A;  4E7S A;  3W2V A;  2QY1 A;  3A1Y A;  3S3M A;  5CDF A;  3EQN A;  2R4G A;  3OS0 A;  4HRI A;  3DLA A;  4YEL A;  1WP6 A;  2L5Q A;  4PSW A;  4DGW B;  3PJR A;  2QE7 A;  1D1B A;  2K9M A;  4BJ6 C;  5HLT A;  4E6K G;  4RLQ A;  3W2W A;  3GQ9 A;  2WB1 A;  3IAS 2;  4ZDL A;  4BL0 B;  4U4B A;  4B43 A;  3VWB A;  3DTK A;  4PFP A;  2V6E A;  4GQN A;  4PMH A;  1W0J A;  1Z3X A;  2WZP P;  2D3L A;  3L2Q A;  1S9H A;  3MKW B;  4HWV A;  2CW8 A;  3FBN B;  4DOZ A;  4IQJ A;  3HC7 A;  3OIP A;  3PNV A;  4HNT A;  5IK2 A;  4CCN A;  5KNL A;  5HVQ C;  2IS2 A;  2F1M A;  2LG4 A;  4OJL A;  1CZF A;  3HPH A;  4B44 A;  2X6W A;  3MKY B;  2W1O A;  4OZZ A;  2IS4 A;  2CUZ A;  2PEC A;  2VKH A;  2X85 A;  4XLC A;  1COW A;  2Z6B D;  4HIZ A;  3VSL A;  3LSK A;  3EUA A;  2PJR A;  3KX2 A;  2JJ2 A;  1PLU A;  1FMV A;  3E0J B;  4F55 A;  3HKZ A;  4KIT B;  2XF6 A;  2Z8G A;  1LVK A;  3DEE A;  3K70 D;  2ZTG A;  4BEH B;  4NC8 A;  4C2T A;  1OHH A;  4Y3O A;  2LH9 A;  1FMW A;  3A4C A;  3L2V A;  4Z1M A;  4LIV A;  1LKX A;  3K4L A;  4XR6 A;  3OYB A;  1O8D A;  2HPI A;  1EE6 A;  4UZU A;  4JOM A;  5FL7 A;  3GQ8 A;  4YZ0 A;  3OYE A;  1O8E A;  2I8D A;  4N4O B;  4G6T B;  1P9Q C;  2W6I A;  1T95 A;  2VL8 A;  3T56 B;  3DDY A;  3EUK L;  2CFO A;  2X53 S;  1UG0 A;  2O1D A;  1D1A A;  2AQF A;  1GQ8 A;  2L9N A;  2RNG A;  3SEQ A;  1QJV A;  2KL4 A;  3OYI A;  2W00 A;  1BN8 A;  5KCM A;  4XLE A;  2Q2E B;  1KZL A;  2E1B A;  3GVL A;  1DBO A;  1V0E A;  1PYV A;  2ZSI B;  4P1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...