4XOPA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 235
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xopA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xopA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xopA02
4PMHA 4OJ6A 3VSUA 2NSPA 2UVEA 3GRHA 2X6YA 1CZFA 1H80A 1O8LA 4U49A 3GQ7A 4MR0A 3LMWA 1O8DA 4XLFA 3VMVA 1O88A 1KTWA 4OJPA 1O8GA 1BN8A 5C1EA 4I84A 2X6XA 2NSTA 2PYHA 4XNFA 2EWEA 4EW9A 4XORA 4U4BA 1OGMX 1O8FA 4YZAA 3T9GA 2QX3A 3B90A 1QCXA 2VBKA 1XG2A 4HWVA 4C2LA 2ODLA 2PECA 4W8SA 2Z8GA 4YZXA 4XKVA 1RWRA 3KRGA 2O17A 4XL9A 1IDKA 4XMYA 2INVA 2O0VA 4MXNA 3FY3A 3ZPPA 5C1CA 1OFMA 1QJVA 4Z06A 2IQ7A 3SUCA 1KCDA 1O8JA 2QXZA 3ZSCA 4NK6A 4OZYA 4XONA 1DBGA 1JRGA 1PXZA 4AVZA 4XLEA 1BHEA 2NTPA 4XLCA 4XOTA 3WWGA 1PE9A 1X0CA 4YEJA 1OOCA 2O1DA 3JURA 2UVFA 1HG8A 4YELA 4OJOA 4XM3A 4XLAA 1IA5A 1VBLA 3VMWA 4XN0A 4XOPA 2X6WA 1O8HA 1NHCA 3GQAA 2X85A 4XN3A 4Z05A 3GQ8A 2O0WA 2PYGA 4XLHA 4XR6A 3B8YA 3B4NA 4NK8A 1AIRA 3EQNA 5AMVA 1RMGA 2VJJA 2VBEA 4URRA 3UW0A 2VJIA 1PLUA 2QY1A 2NTQA 1K5CA 1OGOX 1O8IA 4XQFA 1OFLA 1O8KA 1IB4A 3VSVA 1IDJA 1O8MA 4W8TA 2VBMA 1EE6A 4W8RA 1KCCA 1O8EA 2O04A 2NTBA 2BSPA 4W8QA 4YZQA 2NT6A 3EQOA 1RU4A 1DBOA 4XKWA 3GQ9A 4OJLA 4YZ0A 2NT9A 2NZMA 1GQ8A 2INUA 4OJ5A 1WMRA 2X3HA 3VSTA 4OZZA 4Z03A 1JTAA
chains in the Genus database with same CATH superfamily
3OP1A 2R7WA 2VJ4A 5KAFC 2KDZA 1GAQA 1EWYA 4MEXF 4ZZLA 3OZVA 4NB5A 2KDOA 2N8GA 1H0MA 2V7UA 4P25A 4AIKA 1LKXA 3M1EA 2ZFWA 1WWXA 4QTRA 5DUKA 1T6ZA 2OJED 4HNVA 3BNWA 4Z4SA 5EZGA 2C5BA 2VC1A 2P6SA 2VE9A 1FOKA 2M5SA 3OYKA 1YHQI 1NHAA 5F0HA 1MBFA 3BY2A 1WU8A 4V19K 1Z0XA 3TQNA 3JR9A 3FXQA 4OOIA 1S72I 4ZGQB 3FM3A 3JRAA 3W2AA 5AONA 4PJJA 2WADA 1SD6A 3OMYA 2EPFA 3BPVA 3S93A 3QFTA 1E43A 3H36A 1FBUA 5FKNA 3VOEA 3CC2I 3F9KA 4L9VA 3JRDA 4AUXA 3SZTA 2P6TA 3HIFA 2NOGA 1BL0A 1VQ9B 1O57A 1QNTA 1Y6IA 2OTLI 2AHOA 2O8XA 2GK6A 2PECA 4AYBN 2M3AA 3HOXJ 4RD0A 4Z4TA 1JNYA 2HI3A 3H35A 1YJ9I 4I09A 5C1CA 3RCOA 4XRFA 1WJ5A 4R79A 3CDLA 1EFTA 2XTYA 1XB4A 1HSJA 4IL6C 1O8JA 3HSRA 3A35A 1W34A 1KQSB 4LC0A 1ZK8A 5BOXA 4AVPA 2BV6A 3BOQA 1VLOA 4M6YA 3CJRB 5FFXA 4HIZA 5K7ZA 2R7SA 3BG9A 2FF4A 1W35A 4BJ5C 5M5YJ 3S2DJ 5CJ9A 3IAS2 1F9NA 1OB5A 1RR8C 3PVDA 5D5VB 2WJYA 1OOCA 4AM3A 3H5NA 2XT2A 2P5VA 4RB3C 4B43A 3OSGA 3ML3A 3VEPA 3CXCB 3E5UA 4UXNA 5HOOA 1H8HA 3PNTA 3AG4H 3GTOJ 2JZYA 3WTYC 5BSYA 4XOPA 4WXHA 1UFMA 3CCRI 2MABA 2CQ7A 4QVJA 4E0FA 1HA3A 2VYQA 2IS2A 1IF1A 4CCLA 1D0XA 2G7UA 3CCSB 4PDKA 3HGYA 1O8IA 4LB6B 3BH6B 1A35A 2L02A 2R7DA 4FQGA 1BA5A 3AG2H 5CYVA 1FYKA 2KHMA 4MFEA 3N97A 5ED4A 4BQAA 1PUEE 4U0VA 3VSVA 2D74A 4BUPA 4A2UA 2HZDA 2NAZA 1N75A 1IN4A 2DA1A 2KIFA 4II2A 4LJZF 3SY2A 1BPLA 2V7VA 1FMVA 3AG3H 5L46A 2D3NA 1I3AA 2OQRA 3Q3AA 3A03A 2F4OB 1P7JA 2E36A 1RU4A 3JRFA 4Y3OA 1DABA 5KCMA 3B78A 2XPVA 4P26A 3WGGA 3IH4A 3V4GA 4ZDOA 2VQHA 1YI2B 3DBHB 1S6LA 3FHNA 2C4UA 1YW7A 4KKTA 4C2MJ 1IN8A 3HC7A 2VT2A 3DFGA 3WTXC 3L2UA 3GX4X 3GLLA 1YITI 2MC3A 1T39A 4UZEA 4U87A 1ZR2A 4U49A 2XAGA 1F43A 2IA0A 5LGUA 2DYIA 1G3WA 1O88A 2VT3A 3LVBA 2JA8J 1VQ8B 5J3LA 1LE8A 3ASPA 2R9VA 3PO2J 4HQEA 5D5XB 3DXJF 4B44A 2DQLA 2I5UA 1DU6A 3SQNA 1WJDA 2PYHA 1EA0A 1OCOH 3OL3A 4RCZA 2EWEA 4WZEA 3VO1A 1NB0A 2Q6OA 3ABTA 4C30A 1YJNI 1ZLJA 4M53A 2HEOA 2LSOA 1WP6A 4OPOA 2CWEA 2DOAA 1FIPA 4CICA 2VPLA 4P55A 2Y0SN 5DD4A 4F55A 1XPXA 1WSRA 2VUMJ 4KH3A 3HTSB 2J7KA 2IA2A 2INVA 2K9SA 1BR4A 4RAFA 2O0VA 1WJEA 3V8LA 1W7PD 2M8GX 1IHMA 2CUFA 3NARA 3IKVA 2X0LA 1XFOA 3GXOA 4F92B 2NVTJ 3OWTA 3ZGKA 1U9NA 3KP6A 3QWLA 3VSKA 2OBSA 5HXBA 2RN7A 2BHZA 2QSFX 4NQWA 3T53B 4CHUA 2VBZA 4UB8C 2W25A 2TDXA 4PSWA 5DUIA 3VMFA 5B5EC 4H4KC 5FGMA 2BY2A 1FNBA 5KHDA 3L2CA 4FK8A 2XPWA 3WTSC 4LBYA 2IW5A 4UUSA 3QYEA 4L5IA 3OS1A 2K7LA 3PO3J 1KQ8A 2K40A 4XLAA 4UVCA 2DEUA 3VMWA 4OIPF 4UUVA 4N3NA 1PP8F 1Q9SA 4EJUA 1KQ0A 2E1NA 2O0WA 4G6QA 4XR6A 4TSFA 3FMSA 3FBNB 4FN5A 3R6SA 3CCUI 5E17F 3R4KA 4LIVA 2KJCA 1B4AA 2VBEA 1FNMA 3ZPNA 2Y75A 3DTKA 2LKSA 4XQFA 4UV9A 2LKXA 2EFWA 1BR2A 4CYDA 1D3YA 1OCTC 2CS3A 5DYMA 4RDLA 3FKSA 3NAUA 4CA0A 5IT3A 3U21A 5AN9A 1X3UA 3OOPA 4XRSG 1D1NA 4B3GA 4A0XA 4V2FA 2VNJA 4PC3A 5E6TA 2ZZFA 3C3WA 3HXLA 2PX9A 1Z77A 4CUGA 4ZGNB 1GO2A 1D1BA 2O5RA 2PMDA 4FX0A 3HBLA 2HVRA 5F64A 3CMEI 1DQUA 2NZMA 3CJNA 4PUSA 3DU6A 2XSDC 2H6CA 1U3EM 3K70D 1R5BA 4KITB 1X3ZB 3OS0A 3BG3A 2NVQJ 1F1ZA 4A3BJ 4HF0A 5DEQA 2KIUA 2FQ3A 5HZBA 1V54H 2E2IJ 5KNLA 4C2TA 3CC7B 2ESNA 4HAMA 2ZB9A 1OGJA 1O8LA 2HNHA 3BR3A 3WG9A 5J47A 1QZZA 3OYMA 3ML6A 1IV8A 1O8DA 1ORKA 2ZO4A 3J7AY 5IYWA 1JJ2B 2V1XA 4HX8A 4BPRA 1IJEA 1D8JA 4NUBA 1GAWA 3CUOA 3M9AA 5GTIC 2XAUA 5J1YA 1FYLA 3MKLA 4BL0B 3L1PA 3SLNA 2E71A 1J9ZA 4DIQA 1B23P 1BI3A 1U9OA 2M45A 4ZTFA 5BNGA 2DDBA 3J7ZI 3ONQA 2X8KA 3G05A 1XDUA 4JX6A 3QPSA 1UMKA 3C18A 3DLLF 3A3BA 1LEBA 3HEFA 2DAOA 2IJLA 1R71A 1ZR4A 2O8KA 3ASRA 3IWFA 3A3GA 4OM9A 3T5XA 5AIQA 1XMXA 2F1MA 3B02A 1H88C 4YZXA 3GTLJ 3LAPA 3QAHA 3WHBA 1HKQA 2OK8A 4FASD 4ASUA 1P9QC 4NK6A 3Q6RA 5TGTA 4A6EA 4UY8I 2XNDA 4HX4A 4RMNA 3CCJB 5F08A 2V4JC 2XTXA 5IP6A 4R8HA 1RQRA 5GPCA 5L3GA 1MDMA 1DG1G 3FXLA 2NTPA 1TBXA 3BCFA 1M1EB 2NV4A 3Q38A 5J35A 4RDJA 4YIRX 3P26A 3FIWA 2JA7J 2IEKA 4YCQA 4BH9A 1BIAA 2LF8A 1OYIA 2CQKA 3HOTA 4KYWA 1H89C 1FMWA 1WORA 1FP2A 4ZYAA 2E5NA 4KFCA 4WZKA 5F4OA 3S17J 1PJRA 3VODA 3G73A 1HW5A 5DD8A 5K1YA 3LSJA 1E64A 3WG7H 3S16J 3I55B 2HOSA 3V8JA 2DA7A 1UD2A 2IOUG 5LHHA 3ZBUA 3BJ6A 3EQNA 1IXCA 2HKXA 1JT0A 2ZC2A 1K5CA 2DODA 2X9DA 1OGOX 4BEHB 2E34A 4F93B 2C2WA 4ZTJA 5ICGA 3FXKA 3FM5A 4NC7A 2DYRH 5FKOA 1HW1A 2ME6A 3SEQA 4P3YA 1GHCA 1R5GA 3CCEI 5CPRB 2VL8A 2WB1A 4M3BA 2E60A 4LBZA 4YALA 1MJBA 1U2RA 1RETA 4BXXJ 2DFIA 3X2QH 1S9HA 2UUZA 3GF2A 4HSTA 4BJTA 1F20A 2LREA 3SZEA 2FSWA 3ESWB 4G8XA 2LLKA 2MD0A 3HHGA 1FEXA 2HVSA 2RVCA 1PYVA 1QGAA 1HC8A 2CNDA 4LIUA 1KGSA 2UV1A 3OYNA 1N05A 3JTHA 3LFUA 3S14J 2VBXA 1IC8A 5DSZA 2ACJA 4II3A 5LHGA 1HW2A 4IOCF 3VSUA 2VB6A 2DA5A 2MYSA 1JGSA 9ANTA 4RA2A 1T0FC 2PG4A 4ITVA 2HDCA 4M0LA 1ON2A 5JVTA 3BR6A 3ZMVA 4XKCA 3BP8A 2L7KA 1JA0A 2HFHA 2XHKA 2HOTA 1D8TA 4TMXA 1V55H 2WTEA 4XRSA 3PUBA 4PCQA 4WZTA 1JT6A 1QA1A 1YX2A 2CRVA 1HBXG 2H8WA 2KISA 4IHSA 1U0JA 2XKPA 2LNBA 3QFCA 1Z3XA 3H92A 2ZMEA 4QWQA 1K4SA 4AD9A 3SHFA 5C4JJ 4XORA 1O8FA 2AHQA 3OW2B 3KCCA 3L2RA 4HWVA 3E5QA 4BE1A 3OS2A 3CTAA 1YJNB 3CC4B 1TLLA 2MA3A 3MAJA 4F91B 1TWGJ 4XBFA 5B6IA 1ACIA 2ICWG 4EM0B 3KP4A 3KRGA 1YJ9B 1R7JA 1MBEA 1O4XA 2P7CB 4G6IA 1K28D 2WY8Q 2GXAA 3W2GA 3HSEA 4L0YB 1W5TA 3S1QJ 4YFOA 1OQYA 4ZCLA 3QYFA 1ZARA 4NDLA 3RYPA 3ZPLA 1JHFA 3FJOA 3CP8A 3ONUA 5F4JA 5FD5A 1STZA 1YW9A 4CZCA 3BR2A 3JRGA 3T1BA 1K6OA 4ZZDA 3F8MA 1OFEA 2IGMA 3KP7A 2CV1A 1ZM4A 1TUIA 3EUHA 2ZZQA 4Y15A 2R7OA 1LDDA 2G0EA 3PM1A 3KEWA 1KU9A 3GUDA 4DJAA 3N4MA 1IN5A 1OFCX 1RRJA 2XNJA 5H2FC 1ZUNB 3JQRA 2Y2ZA 2K9NA 1IA5A 1IN7A 3A2KA 2DCEA 1K73D 1MSFC 1K8AD 2LOOA 1NHCA 3A0HC 5LRRA 3CC7I 1POGA 2QQ8A 1S7OA 1G4DA 4FXUA 3GVJA 2FBHA 5KAIC 4X07A 1WOPA 4HLYA 2GJKA 4G94A 5HDKA 3HDDA 4YDTA 1LLZA 2M0MA 4PZJA 2AQFA 2W84A 1MMDA 2KJBA 5J1UA 2GXGA 1WOSA 2QSGX 3ZMUA 2XRNA 3TKYA 4DYCA 1YYVA 2LBFB 2LY9A 1BN5A 2VOOA 1JKQC 3R61A 1HA8A 4PK4A 2FX3A 2O6WA 4YAWA 1R1VA 4WCGA 3CCSI 2KPMA 1N08A 2L5QA 2BY3A 4IJAA 4W97A 4JMQA 3KYDB 1GV5A 3M4OJ 3I71A 3OPOA 4X7DA 4C3JJ 4B1RA 3Q5FA 3ASTA 1OB2A 5A89A 4HV5A 2NT6A 1DBOA 4YZ0A 1I7PA 1SFUA 1DPUA 3RPQA 3FISA 1IO2A 2B9SA 2JJ2A 2VI6A 5LBQA 2Z33A 2E1CA 3VSTA 1WKMA 1LFBA 2A68F 2CQXA 4LLLA 3H5RA 1SVMA 3RQ4A 1OR7C 1V0EA 3W5VA 1VTNC 1U5TA 5GADJ 4KISA 3JQQA 1FX7A 2PMZN 2Q6KA 1KU7A 5HNFA 3R0AA 2PQ8A 2ISYA 5C1EA 2P5KA 2V9VA 3NQOA 3S15J 3U6BA 3BY1A 3OE7A 4G6DA 2CQNA 3CCVB 2VBSA 1LUJB 2YWHA 1B9MA 5JHUA 3OYEA 4G12A 4QHYA 2HDWA 1B59A 1QPIA 2P0WA 2DMQA 4AWXB 1WQ2A 3QPLA 2EBIA 5B1BH 2VQGA 1KZLA 4I7HA 3FPKA 1WPKA 4BHPA 5F1RA 4TMTA 3WNDA 3AGQA 1S72B 3DEEA 3TGNA 3TP3A 4XL9A 5GTHC 3OKXA 3RDIA 3FY3A 5DDGA 3HRSA 4BS9A 1Z91A 2QKLB 1MD0A 4IRIA 1FT9A 2A61A 2QVOA 4BXUA 3JRHA 2EA2A 1E3OC 5A8AA 6PAXA 4XRMA 2KL4A 2VKDA 2WV0A 3HM5A 2VOPA 3CF2A 1USTA 2NS8A 2QQ9A 1Y39A 1N06A 1I50J 1TT5B 1TWFJ 2LMDA 2XAJA 3Q9VA 2I1LA 1BW5A 1FIAA 3EDPA 5DN6A 1MNEA 1SANA 1PE9A 2QQBA 3ASQA 2Z2SB 1CQTA 1R49A 3H9NA 2KQRA 2Q2EB 1BJAA 4RLQA 2QENA 1EFRA 4X7EA 5DM7F 1X1PA 4PJ0C 4DNRB 1Q82D 2ZITA 1OYWA 1VFCA 1FJLA 1TWAJ 3EUAA 1IRFA 1T6XA 2LZJA 1P2FA 1LVAA 2GREA 2RC6A 2LY1A 3F8NA 3QFSA 1APLC 1Q1VA 3B8YA 4M72A 1MMNA 1VQLB 3F8CA 4BDZA 4EVIA 2CUZA 3G1LA 1LNWA 2QY1A 3UW0A 3CLQA 3HRMA 3WU2C 4EJTA 3Q9SA 4PJNA 5CVRA 4S05A 5FLXK 4TT3A 2DOFA 1YHQB 4ZYGA 1ERDA 2JJ7A 3DP7A 1IRGA 1KYZA 3JAMK 1FY7A 1TP4A 2FOWA 5IP9J 3W5HA 1HF2A 4A3MJ 1IRXA 2QCOA 1H8AC 2CV2A 4HE5A 3DTEA 1XCBA 5J40A 1QGZA 1XQBA 4YEIA 1V4RA 4W8QA 3AFHA 4D9JA 1WZ2A 1ETWA 1RKTA 3GW2A 4ESJA 2NXNB 4M1KA 4ZYDA 3LYCA 2YSRA 1ON1A 4CCJA 1E2XA 1D1CA 2GBYA 2XAQA 4RAGA 4Y7NJ 4OZZA 1X1AA 1ZRCA 4Z03A 1HZEA 2YX4A 2UXXA 1YE9A 1OHHA 3ZQFA 2FNPA 2IS1A 4HG2A 4I0BA 2EZLA 2C6YA 2H27A 4KN4X 3KP2A 3A8KA 3KYLA 1UG0A 3WODF 1RUNA 5GV7A 3LWFA 4OIQF 3CZ6A 4GYIA 4HPQA 1QQIA 2XKOA 3DTIA 4NQWB 5FD6A 5K5QA 3SLDA 4OPWA 5J4YA 1FP1D 1F4KA 4G1BA 4FWTA 5M3FJ 3JRCA 1I27A 3B6AA 2L2OA 3I53A 4LLGF 5DCMB 1VZ0A 3ES9A 2NS7A 3V8KA 2JSCA 1QVTA 3K0LA 4AIJA 3CCQI 4XNFA 2H6BA 3KP5A 2VNHA 1V5EA 2YWFA 3M3YJ 4OIOF 2KRHA 4S0HB 1N25A 4Z4WA 3RKQA 2ZSHB 4DYQA 4ENKA 1SKQA 3ROUA 3K6GA 5E8GA 3CMMA 1A8PA 5CQGA 2EIKH 5FKMA 1JKRC 4WWVA 1QBJA 4P6VF 1QUEA 2XV4S 4HF2A 4CCOA 4WF2A 4D7MA 3SZPA 2YUSA 3KE2A 4YG2F 4CO8A 2VKVA 1S3JA 3BR1A 3GFIA 1TYXA 3Q0VA 2DW4A 2ME0A 2QMUA 5E1ZB 2B63J 3HL2A 2FVGA 1BI0A 2V26A 4E4HA 3CMAI 2DPDA 4JRAC 1RUOA 3Q39A 1X4OA 2FNAA 3ELKA 4DQKA 3KEOA 3VYTB 3VNVA 1Z6TA 1DGWY 4BAYA 2QA4B 4P6YA 5CQEA 3ZR8X 5F4MA 3JURA 2WWYA 1G59A 3P5JA 3CDIA 1W0UA 3A8JA 1QGPA 3SQVA 2BE5F 1XD7A 5H59A 3C2BA 2F2EA 2Y0MA 2Z1DA 2ZTNA 1EA3A 2L3DA 2E1OA 3P9KA 2MSYA 5D8KB 1P4MA 1WDTA 2HMAA 4QFMA 3GQAA 4MHGA 3W6KB 2W4SA 4IOAF 1V3FA 5HDGA 3L9FA 4H9GA 1HXDA 1Z67A 3MKZA 4URRA 3OYJA 1PLUA 2M30A 2M5WA 3U2RA 3ZMDA 4A0YA 1MRZA 1TYWA 2O0YA 3HTUA 2VNKA 1O8KA 2M9HA 3V7SA 2V4DA 3TO7A 4OOXA 3A8IA 3D26A 3SKBA 1U78A 4PC6A 1K9MD 2EFQA 1IB4A 3P4GA 1ZGWA 3PSSA 1OKRA 4HQMA 3S2WA 1Z21A 3TO6A 5BQTA 2VBMA 2A3SA 2ZMEB 4MTDA 1J75A 3LNNA 3CCVI 2MLKA 3HAGA 2Z5UA 4N4OB 2IS6A 2AXTC 3I64A 3OYLA 3MQ0A 5L3DA 3K4JA 3HRUA 1W0KA 3CD6B 1EKEA 4OJLA 2AQEA 4UAJA 4U7BA 3CO7C 4YFKF 5H5JA 3ABLH 2INUA 2X3HA 3OEHA 2A69F 3LFKA 4MTEA 4OIRF 1TLHB 4CDGA 1UD3A 2ZZEA 1R23A 1TTTA 2DA4A 3VYSB 3WTWC 3K7AJ 2R5YB 2CMPA 3MMYB 4B48A 1LDJA 4ZDPA 2UVEA 1ZGJA 2X6YA 4BQOA 4GGGA 4G1VA 2QKMB 2XNCA 2L01A 3VPRA 1Y0NA 2TCTA 3GEZA 2FA5A 5JBQA 4DGWB 4OJPA 3P7NA 5ILVA 1R58A 1BN8A 4P1WA 3AVVA 4DZPA 5C3EJ 3CJQB 3ZQCA 2VFPA 1TYUA 4UZFA 1YJWI 1F5TA 3TP0A 1YLFA 4OU0A 4PGHA 2Y30A 2DERA 2NSTA 3DPTA 5LGTA 1EXMA 1TTYA 1R5OA 4RD6A 3LJYA 1XSVA 2F5VA 4V2GA 2IT0A 1OB0A 1BJKA 5HS7A 1KK3A 3JSPA 3C1DA 5IP7J 1IXSB 4OPSA 4BQNA 1A6IA 2K9MA 4ON0A 3F8FA 2JSPA 2L0KA 1D2EA 2KFDA 1UD6A 4AYBA 4D5CA 3VYRB 4QVAA 4U9UA 4I98B 2NVYJ 4XMYA 4CYCB 2W82A 4MFDA 1BI1A 2EA4A 1QFJA 2XT4A 1O7LA 4CZZA 4KMUX 3OJXA 1XSXA 3BG7A 3DBRB 4EM1A 4Q47A 2OD5A 3H94A 3KFWX 4Z1MA 2QXZA 3QODA 4GCVA 2RGVA 1XC5A 3KPHA 5GP9A 2QYUA 1KA8A 1T0FA 1SC7A 2NPFA 4GRIA 4AVZA 4ENNA 2VIXA 2ZXJA 4RAYA 3LSHA 2BMWA 2OTLB 2CUEA 3AG1H 4WQMA 1VQ5B 3WWGA 3BR5A 4M3EA 4ZCMA 1DU0A 3IKTA 1XG1A 1YRNA 3RZOJ 3BH4A 1FNCA 3FXOA 3CCLB 3EETA 2OU2A 2WBMA 1HDDC 3I4MJ 3S3NA 3CDHA 5BS6A 2QLZA 4IKFA 3LA7A 2E1MB 1YITB 3AVXA 1Y1VJ 2ELHA 2V5IA 2BEOA 3HKZN 3G4SB 1QZEA 4XSZF 1ZELA 2DFHA 3I9V2 3OYGA 1R5HA 2DA2A 3WU1B 1E17A 1E3XA 4F52A 4RD2A 2VFNA 3GQ8A 2VBWA 2CK3A 1SMYF 2CW5A 3LO8A 1KK2A 2VXDA 5F27A 4AU7A 4E6KG 4ESFA 4B09A 4YAOA 4YAFA 2HKOA 3QRFF 1JE8A 5E3LA 1GJRA 3H3UA 2OV7A 4L9JA 3CJTB 1TQIA 2JPBA 3MHPA 2Y9YA 3AAFA 1H9TA 3BTJA 5J8CA 4NCNA 3LQQA 3SYJA 3JRIA 2JK3A 1VQ7I 1VQ7B 2VPRA 5HS8A 3CW2A 3VR6A 2CW0F 2BGIA 3WNCA 4UVBA 3S32A 3DKXA 3BG5A 5FO1A 4HYEA 2RC4A 1JTYA 2XC7A 1DP3A 1JKPC 1AIPA 4LD5A 5GAEJ 3R60A 1J7KA 5KSWB 2RAEA 3AVUA 2V9KA 5K7FA 1XTAA 2ISZA 2BM6A 1PJ5A 1RIOH 2CRGA 4D7NA 4A3CJ 4C9YA 2RNJA 1R22A 2ESHA 3EUKL 3OYFA 2ZZGA 2DQRA 3BROA 1FSEA 5A2QK 3G3ZA 5HZAA 3F6OA 4JX4A 4GYGA 4OJ6A 3F23A 3F72A 3H9QA 2MFZA 2M1BA 2DLLA 2DA3A 2V6CA 3L09A 4EQQA 4J0QA 4JQFA 2COMA 2CV0A 1U5TB 1KMHA 5KVRA 4A3FJ 2YU9J 1BMFA 1A5JA 3MD2A 2OBRA 2P4WA 2HS5A 3Q6QA 1R6RA 3ZRGA 2VONA 3B6CA 3CESA 2O6GE 4I84A 5FO0A 3I54A 3DKYA 4S04A 2X6XA 2F3LA 1QRYA 3RQIA 1F60A 2C77A 3OEEA 2R7FA 1GLNA 1DP7P 2OPTA 3J81Z 5FLVA 2DN0A 2X53S 4U4BA 3PENA 3PSIA 1EP1B 1J5YA 2IGOA 2ELJA 2CFXA 2FXAA 2L9VA 3O8HA 3J80K 1P4WA 4HLXA 1EP3B 5CVIA 3BQZA 3A4CA 1QFZA 4E7SA 1E1QA 1NBMA 2VNIA 3WQZA 3C2HA 1IZ1A 4XKVA 4PABA 1WJCA 2O3FA 2VQCA 2HPMA 1VQ9I 3CCRB 2WZNA 2JWTA 1K4ZA 3LA2A 3RSNA 2R7XA 1FSHA 1D0ZA 1GXQA 1ZM3A 4Z06A 4H0EA 2FD5A 2MLGA 3CD6I 4C43A 1X1CA 4C3HJ 4D5FA 1BM9A 3KZZA 3SJZA 4Y9UA 2HYJA 2MH9A 2FMYA 4IEJA 5EEGA 2GQFA 3LOCA 2HYFA 3K4CA 2Z9OA 1MH4A 1IRZA 1LDKB 2DOGA 3PETA 3RIQA 2XASA 5JLVC 3PFYA 5EJCA 5JLXA 1GR1A 5LEKA 4JP0A 1SKYB 1OLTA 2X6OA 2BX6A 1GVJA 1Y8QB 4RD4A 3GZ5A 3I0TA 3WTTC 4EJWA 3OYAA 2OZ6A 4G7ZF 1TSPA 3VWBA 3N90A 3LSTA 3ERED 5LGNA 4Q48A 4DNTB 2IGKA 5IYPA 1QG0A 4BACA 4G6TB 2V7FA 2X85A 2L9RA 1LVKA 3MCAA 3OR1C 4Z4YA 3PNVA 4XIDA 3H1CA 3E3VA 3SJPA 2P7VB 5AMVA 4I01A 5ICCA 1VQLI 4YXWA 4U7DA 3K10A 4BY7J 3TDUC 4BKXA 3A1PA 1QRCA 3F21A 2I8DA 2FE3A 2EFGA 4XD7A 2K9QA 2Y9ZA 2W48A 3OYHA 2F43A 3OYIA 1BW6A 1UMQA 2R3SA 4MIMA 2DTRA 3E5XA 4RCYA 1R1UA 2ZJ2A 5H6QA 3RPUA 3GTMJ 3LQEA 4NC6A 4Q4ZF 1WSVA 3G71B 2R4GA 2XZPA 3VFZA 1TWHJ 3BWGA 3CO6C 2M2EA 2K27A 4KA4A 3CB4A 3FXRA 4XKWA 4ZJZA 2H1LA 4AIHA 3H0DA 3RTRA 1BJZA 4FISA 1TW2A 2NYXA 2R0QC 1EFUA 1GQ8A 2ETHA 2BM5A 1T6SA 1R1TA 2Q0OA 1MW7A 3RYRA 5ILUA 2IRFG 1I6XA 4G7HF 1SEUA 1K79A 1T6YA 3DEWA 3CCEB 5D8LB 1WVRA 3HOSA 2VODA 3C7JA 1U8BA 1O3QA 3CQZJ 2RV8A 1GVDA 2GK7A 3GRHA 3I3LA 3QU6A 4F7ZA 2QWWA 5HLIA 1GVHA 3ASSA 1RKWA 3M8JA 3A02A 4Y17A 2RQQA 3HUGB 2QA4I 1XMAA 1WOOA 4GQNA 2EH3A 2B0LA 1QA6A 4AF6A 2V1NA 4RGSA 1VQMB 5IY5H 3GSIA 4OP7A 3KEQA 4IRGA 2IS4A 2HQ5A 1R00A 2CG4A 3FF5A 2BGJA 2W6IA 2DTZA 2MG4A 3L7WA 3ERMA 1FNNA 3CMAB 1OGMX 2DI3A 5EGOA 1YS7A 1YRNB 2XB5A 3SFIA 3K4MA 3FXUA 4PGOA 4KN7X 1TC3C 2LR8A 4RM3A 3ECHA 4EEFG 1UHMA 3K4LA 1SAXA 2ODLA 1EH6A 1N0UA 3EPZA 2XGXA 3CRZA 3H5AA 2KZVA 2NOJB 1HCRA 3K2ZA 4I99C 2QQAA 3PL8A 1OPCA 5FKLA 1W5CC 3AKZA 3MZHA 4KKUA 4RPDA 2JQ7A 2KP6A 1MKMA 4KICA 3F22A 2GA2A 3ZQIA 2RC5A 4BHBA 4PC1A 2WAQN 2PBIA 3CUQC 3U6KA 2BHYA 4Z4UA 2IQ7A 1KCDA 5BPDA 2DA6A 3ZXSA 1PKVA 3PA2A 2QF7A 3CPWB 3MVPA 4DBRA 4YFXF 4ZC3A 2CFOA 2JN6A 4FTHA 4FHTA 1YLOA 3W2HA 3ZZUA 5FRMA 1MBGA 4N3GA 1FX0A 3SDBA 3OZWA 3RJPA 3IUOA 3ZMSA 4ANJA 3JSOA 3MN2A 3ZBTA 4Q7JB 5JLWA 1V5VA 5JFRA 1W87A 1HKSA 3D5LA 2XVCA 4YELA 1ZHFA 5HVQC 2BW3A 4JBAA 2R93J 3MCZA 4Z4ZA 3QP5A 2B5OA 1WJBA 2JRTA 1YOVB 1FNDA 3JX8A 2PN6A 1T2KA 3I56B 3B73A 1N77A 2LVSA 1QA3A 2BVLA 3GLXA 5IOYA 4PAAA 3LL7A 3O3KA 2P3MA 2XTWA 4BYYA 5EDNA 4U0YA 2PI0A 2JN9A 2YU3A 2NTQA 3M8EA 4AIDA 3LSIA 1NJID 5IT9K 2KT0A 3BJAA 2PE3A 3BH7B 2V1DA 2FQ4A 2DFFA 2D1HA 2NNNA 5FJ8J 4E7HA 3ZP5A 2NVUB 4G9YA 5E8IA 3PNYA 4N0BA 1O8MA 2NS0A 1CF7B 4F3QA 3LSKA 4TKOB 5THXA 4E7ZA 1U2WA 1Y8RB 2A05A 3SEZA 1IXRC 5D4SA 5FNZA 2QZ8A 1JGGA 2LRDA 1DDGA 1JA1A 3DV8A 1FRNA 3SEJA 2G9WA 5HODA 1N0VC 3VNUA 3K9TA 5J3OA 3DEUA 2ZFUA 2OBPA 5F04A 1FDRA 2H8RA 1RI7A 2C78A 2BSAA 2IBDA 3I59A 1XS9A 2CC2A 2WJVA 1UB9A 5HLHA 1KQ9A 2J5OA 3Q0UA 2LTPA 4IX7A 2L4MA 3B82A 1ITYA 1FYMA 2RKHA 2PIAA 3W2FA 3FK7A 3HOVJ 4B3FX 1KK1A 1QPMA 1S5LC 1S29A 3ONYA 2XAFA 2XZLA 4KIFA 1OMIA 2RQPA 3W3CA 2ZL6A 3LMMA 4QUZA 3RY8A 1QRBA 4LG0B 3CLOA 2W85A 3K1NA 2E2JJ 1QQ1A 4RM0A 3E6DA 2HPIA 2QBYA 4QPQA 1XB2A 3ABKH 2YX7A 3LSRA 3F6VA 3ZN0A 1G7SA 5DTDA 4ACBA 4UHTA 1K83J 1D1AA 3IP4B 1IAWA 1MMSA 4TMVA 1SM4A 3SUCA 4EW9A 3HUGA 2YWGA 3EQLF 1KJZA 3T9GA 2BYVE 4NNJA 3IH3A 2HDNB 1IJFA 1Z6RA 1VQPB 1VQPI 1XG2A 1TYVA 3L00A 1Q81D 4PC2A 1T95A 2Z8GA 2STTA 1XGOA 3T51B 3CCQB 1IDKA 4EM2A 5F0FA 2BM1A 1S8NA 2L7FP 2BM0A 3G4SI 1O3RA 1K7AA 4RGUA 1WI9A 4EJVA 3L2WA 4Y33A 1JUPA 2ZNZA 5IYBJ 3V42A 4BHCA 1YW8A 2DJNA 4XONA 3CMYA 4M73A 4RLFA 3D5SC 3FHZA 4ZYHA 3I4PA 3CF5F 3RZDJ 1O3TA 3E7LA 1FZPB 2E1MC 2PLFA 3KL9A 3CC4I 1Q1HA 4PJMA 4EGYA 1YO5C 1ZH5A 2B0RA 1MBHA 2QSHX 4A3GJ 1I1SA 2F48A 4JYKA 1IDYA 1VJSA 2EK5A 3CCJI 4P1VA 2OCEA 1MSEC 3S3MA 2F4NA 4IHVA 4M9SA 4B3AA 4P2NA 5L3CA 2HXOA 3KEYA 4N9HA 3SYTA 2CQQA 1S0UA 2D2WA 2CJJA 5M5WJ 4YC5A 1EP2B 3NWTA 2EIJH 3G6EB 4Z4VA 1X19A 4BBSJ 3LQ6A 3BG6A 2XF6A 2ZJRF 3MZ8A 2FRHA 1XX5A 2JVGA 3VO2A 2DMTA 2K86A 3A01A 4L18B 3CMEB 4YRVA 3BTLA 1KTVA 3GZ6A 3NRVA 4PGGA 2NRAC 2VFOA 2VBTA 4A12A 4Y52J 2Y0SA 1VLYA 1YIJB 1KZHA 3ZQ7A 3WTUC 4RB0A 3QP6A 1JJ8C 1IDJA 1W7PB 2ZKZA 1BX1A 3DQVC 1V0FA 3D5RC 2BSPA 2ECBA 2BW3B 1IDZA 2LY2A 2L9SA 3OL4A 4B8XA 2Y31A 4U0WA 2ZCWA 2HU9A 4EATA 3LA3A 5J8FA 1UJ8A 2EFNA 3K4NA 2XDVA 3GQ9A 1GT0C 2EQRA 4B3XA 1MZBA 3WNBA 4ABZA 2PLYA 3FZVA 3ASNH 5FO5A 3FMQA 4EMSA 1G3YA 3K4KA 3REOA 4KKSA 4PMHA 4UNOA 2M4KA 1IUFA 1JUMA 2CUJA 2Z99A 4ZH4F 3IC7A 4CSWA 3HOWJ 3M07A 1LLWA 2BN4A 3A1YA 4XLFA 3QOEA 4I0AA 5FFZA 5TISC 1G2HA 5FIUA 4IHYA 1AHDP 3W6VA 5HDNA 3JW4A 1WPCA 3WY9A 4O3MA 2GQQA 2XIGA 3C2GA 2QN6A 2C4TA 4U88A 2PEXA 4P12A 2WA0A 5DM6F 3JTGA 4LK1F 4MQVA 5L3BA 4HRIA 1UD5A 4HE6A 1T38A 3TW7A 2DDAA 4FCYA 3OZUA 1I6HJ 5EEHA 1BOBA 2HR3A 5EGOB 1H9GA 1Y0RA 1A36A 4IQ4A 1NG7A 1TT0A 1W5SA 5DS9A 5IYCJ 1BIBA 2IXSA 4XSXF 3AL0C 2DXIA 3CUQA 2DOEA 2F6CA 4M3DA 4NC8A 4XICA 3ISPA 1FOXA 2WB1N 1QO0D 5D6EA 2O17A 2DU9A 4CQJA 1YFHA 1YTYA 2XGEA 1B1BA 4RLZA 3GTQJ 4RDKA 1TNTA 1WJAA 2AO9A 2KIMA 3MMPA 4OZYA 2HXIA 3E1SA 1DBGA 3I58A 2M7AA 1W0TA 5A2QZ 3OOCA 4Q5SF 3PA1A 1PXZA 3RIRA 1P4XA 2VJ5A 4XLCA 3TO9A 2FU4A 4G7XA 3BZ6A 1PVEA 4PFOA 2Y48A 1OCCH 4JK1X 1X0CA 4YEJA 1ODDA 3NAWA 1LQ1A 1R5ID 1J59A 4X7CA 4XKBA 4DYRA 1ETYA 3ABMH 3GVLA 1BLIA 1HG8A 1SD5A 1X1BA 3K2AA 3ZZTA 4F7DA 1QFYA 1HLVA 5FB2A 2H1KA 4C3IJ 5JHFA 3JREA 4MLOA 2K4BA 4ZYEA 5F1JA 4CYCA 3EYIA 1BX0A 3HRTA 2OZUA 3W6JB 4E7LA 3M7GA 1K78B 3K1PA 1XMKA 5CVVA 2Z16A 4A93J 4DBQA 5L3FA 2XZOA 2PYGA 2A07F 1D8KA 1LEAA 1UZCA 2GIZA 3WBKA 3E97A 3HB9A 4ENJA 5BMZA 1VQKB 1YI2I 4NK8A 3RPUD 2R7QA 5EZHA 2GOXB 2HOEA 2BY0A 2VBUA 2WYRA 2XOKA 4P9FA 3SXYA 3RI4A 2LK2A 2PJRA 2EZHA 2DY1A 1YIJI 2DIEA 3GQBA 2QDXA 4IRHA 2JJ1A 3D0SA 4AC0A 1NH3A 4OAZA 1DUXC 5DNSA 2CYYA 5JR3A 1WRJA 2V7XA 2WAEA 2LD5A 4W8RA 4HSRA 4HNUA 2ZBVA 1KCCA 3GFJA 1FBQA 4WK8F 4KDPA 3DKWA 2V7WA 3LSMA 1PDNC 1DDIA 1COWA 4RD1A 2Q6LA 1N07A 1WHUA 3EQOA 4NHJA 1R9TJ 1TL8A 4A3LJ 2DK5A 1P7IA 1B2RA 3H09A 2NT9A 1VQOI 1E3ZA 3GTKJ 2FJ1A 1JKOC 2XPUA 2BY1A 4LLNA 2LYCA 1HDPA 2R5ZB 1ETOA 1H8EA 2OK7A 4GXOA 1RC9A 2K02A 4P9UA 2VXZA 1TVCA 2OAZA 3HGGA 3OYCA 2EILH 1LFUP 3A0BC 1BBYA 4BE2A 3CC2B 1LM1A 1ZTRA 2LBFA 1RESA 2BZTA 2MD5A 3GWZA 3RKYA 1R4MB 2FX0A 4G7OF 2HLDA 1EFCA 4X8IA 4R71A 1W7PA 4I76A 2M87A 5ICFA 2D9RA 2BXYA 2KVOA 1FBSA 1DPRA 5IT9Z 1G3TA 1WFXA 3T0YA 4KJZA 1LE8B 2K85A 1J9IA 1KD1D 2G0YA 2KKOA 1Y56A 4P5OA 2W7ZA 4DW6A 2E7WA 5A88A 2DCUA 2HQAA 1CF7A 1VNDA 1KK0A 2IVMA 5M5XJ 4RAZA 4L5EA 4L0ZB 2Q2EA 2EWNA 1AMOA 2H09A 2X4HA 1OGIA 4YIIA 3K70C 3PFIA 1VF7A 2VBKA 3V76A 4P9SA 1P6RA 1IW7F 1NRKA 2EFPA 2W57A 2A6EF 2WC2A 3N6ZA 3MFKA 4DK0A 2D5VA 1FOWA 3OR2C 5FKKA 1NK2P 2GA1A 4IW3B 3PUNA 3VSLA 2J8KA 1ENHA 3IL2A 5B66C 2MC4A 2GLOA 1VI0A 2F1LA 2JDIA 3OYBA 1ZG1A 1B72A 3U2QA 5FLMJ 3LSGA 1OCPA 4P96A 2OCCH 4E70A 4LBWA 2Z6BD 1B6AA 3HYIA 5DV5A 3QFRA 2WSSA 2ZXHA 2WAFA 4Y13A 2V9PA 2L7ZA 3ZQQA 2JT1A 1QA2A 1W4MA 2DT6A 1Y0YA 4YHBA 3QQAA 3DU5A 5D6FA 3EUHC 2XROA 4HDVA 1IJWC 4M3FA 1H85A 4LB5A 2ZNYA 3F3XA 4PFPA 2UVFA 2A5WA 3M1CA 4M9XA 3PSZA 1KU3A 4XM3A 2JVHA 1TW3A 1CGPA 5EG0A 2R92J 1VBLA 4MNUA 5E79C 3M8FA 5E3NA 3WXMA 2DETA 3UKGA 1TQPA 2L4AA 1NDHA 2K4JA 5IPAA 2LG4A 5C4XJ 2HQNA 1OCZH 1BC7C 3B4NA 3DBLB 1MIJA 2F5EA 5TR9A 1V5GA 5LMZA 1R36A 1Z7UA 5HLTA 1FTTA 4K1XA 5FA6A 3J7YJ 3OIPA 3FPPA 3BDDA 3N05A 3I56I 1HOMA 3OIOA 1SFKA 1QVFB 4Z4RA 5DS0A 1A04A 4LG3A 4ZV4A 5DCMA 1ZM9A 3ZIAA 2GOMA 5HNHA 1JTXA 2RDPA 4IZZA 2KZGA 4PJLA 4WXCA 4BE0A 5IOZA 3GO5A 4L9NA 1JXSA 2NTBA 2QTZA 1WXRA 2VN2A 4HBLA 3T56B 4B4DA 3PQKA 4J19A 5BPIA 2EJRA 2L7MP 5E1WA 2VE8A 3MKYB 3FXJA 1AKHA 1D5VA 1HKTA 2CH0A 2A5YB 2F5CA 2K9LA 2FBKA 2OBTA 2K3FA 3WTVC 1ONVA 3WHCA 3PQJA 2P5LC 4O5VA 2YS9A 4A3IJ 4RJLA 2FMLA 3IH2A 4B4CA 2LFBA 4BEHA 4I6ZA 4KNYA 5CDFA 1KRHA 2E35A 2GJPA 4HEA2 1BI2A 3O8GA 4OAYA 4HNTA 1ZRFA 3S2HJ 3GQ7A 4L5JA 1F36A 1O8GA 2W1OA 4OMZA 1Y0UA 2KIQA 1FRQA 3GZNB 1XN7A 2ZTGA 2XGCA 3FKIJ 4DK1A 3DLAA 5LLQA 5F0CA 3BCDA 4OOVA 3I1FA 4C0SA 1XGSA 4X6AJ 4YZAA 1A6QA 2HCJB 1MJ9A 4DOZA 2GPJA 1KONA 1S7EA 4WXDA 2Q8KA 3LAJA 2BV3A 4M2LA 3CCMI 1Q86D 3CCLI 2J8IA 4YIFA 4MGRA 2Q1ZB 3CUQB 3TOBA 4BJ6C 1IB0A 4FE4A 1OCRH 3VB2A 4Z2YA 1Y1WJ 2C5HA 1IN6A 4W8SA 1SVOA 1NTCA 4GDFA 2E7XA 1WI3A 2WPDA 5IYQA 3FKJA 2KMUA 2OF7A 3ZPPA 4M71A 4J01A 1QUFA 2M0CA 1T56A 3F0CA 1UAAA 4M4SA 4BQQA 4QIWN 5GAGJ 3ZSCA 1QH0A 3KP3A 3KLOA 2VLAA 4IHTA 3ZN1A 2CO5A 4Y4RA 1CNEA 1QX4A 1VQ4I 2CBXA 1RR7A 3U9GA 2LC2A 1XSDA 1BHEA 1G3SA 4XOTA 4A3KJ 4UZUA 4QV2A 4CCKA 3RKWA 1QVGB 1K78A 5F6FA 2R7RA 4DQ2A 4AC9A 2HYGD 2FOKA 1ZG3A 4E7IA 2D45A 2F5DA 4UV8A 2PMHA 4UVAA 4OOSA 5JMCB 3R6KA 3ZC3A 5K7HA 3LNQA 3E6BA 3ZMTA 3J80Z 1KC8D 2BBYA 3TMOA 2FEZA 4HW0A 2E5ZA 3JAMZ 2CF4A 2VBVA 3K1MA 4XN3A 4Y7CA 4Z05A 1FLIA 3G2BA 4XLHA 3SFZA 5D4RA 3J81K 4D1QA 3AVWA 3JRBA 1W1WE 5FLXZ 1AIRA 1EH8A 3T8RA 1RMGA 1YX3A 2VJJA 5FROA 4X0GA 2DMUA 2VJIA 3GVKA 3HPGA 1WCMJ 5CVJA 2E1BA 2Y69H 1S4MA 1OFLA 1KU2A 1OYYA 4QPOA 2HZTA 4L9TA 3IV5A 1ZKGA 2VASA 4MO7A 4TN1A 5CLSA 3ZUGA 5C44J 4HV6A 3TH0A 2X1DA 2LH9A 1TZLA 2DK8A 4IF4A 1ETVA 2IGNA 3ZMZA 4CCMA 1N78A 3BR0A 4W8TA 4TMZA 1O8EA 3GMEA 3F8BA 3R0JA 4D0PA 2TRTA 4BU2A 1PUFA 2O04A 4IPAA 1Z05A 3ABUA 2JUGA 3S3OA 1L0OC 1ZQ3P 4TV7A 3HZJA 3KYCB 1MNDA 4L8JA 3BT9A 1IUYA 1UCRA 1HVXA 2MBFA 2GJRA 4OJ5A 3PUMA 2KLOA 4RGRA 3W2VA 3OV8A 5E3MA 1CNFA 3LQRA 4FT8A 2XUBA 5LHIA 1HSTA 2DYSH 2QUFA 4E7JA 4A3EJ 2EIXA 4IQJA 2X51A 2NSPA 3VYUB 2V7QA 1WH7A 3I55I 5IYDJ 1I39A 2A6HF 2AS5F 4K2EA 4IO9F 4NBSA 4YAUA 3WU0A 4A0ZA 4JOMA 4M6VA 5J1RA 1B8IB 3J81k 3BQJA 4PSXA 3PIOF 3AGPA 3LMWA 3MEXA 2UZKA 5B3SH 3VMVA 4PC7A 3GFLA 1KTWA 1E79A 5D5UB 2LKPA 2ELKA 2ZSIB 2W7NA 3V7CA 2R7ZJ 1UELB 2F4MB 4BNCA 2P81A 1A31A 3QPTA 4CGZA 4M74A 3FBIB 3T8TA 1VF9A 5FL7A 1BR1A 2D3LA 2V79A 3KZIC 1QU3A 2QX3A 2V1UA 2HGCA 5KK1A 1MBKA 4GFBA 1J09A 1CLWA 1HF0A 1O7FA 1B72B 1R4NB 1ZN2A 4C2LA 4UUSB 3D1NI 1JHHA 1REPC 3NE5B 1QZYA 1YS6A 2ZJPF 2GZWA 1N8RD 4RBOA 3OJWA 1RWRA 4V02C 4KIGA 3U1DA 5B1AH 3BY6A 4IHXA 1W36D 4I02A 4W1UA 1UHSA 1OFMA 3TBIA 1JB9A 2DT5A 1L3LA 3OOUA 3HHHA 1QJVA 2BF4A 2HVQA 1SFOJ 1QGYA 4MYUA 4GO1A 2OA4A 4OPVA 1BC8C 4BDYA 3H9JA 4QSHA 1T33A 3G71I 3ZQLA 3LSPA 3A01B 4MYTA 4RPBA 2H94A 3S1RJ 4RGXA 3CP2A 4EH1A 1WGXA 3G1OA 3KZYA 1WTHD 1VHOA 4RB2C 1ETKA 1OR7A 4E7KA 1PJ6A 2QEXB 2VKHA 1ZLKA 3IAM2 1Z1DA 2O1DA 2CU7A 2L9NA 3ISXA 3OIQA 5E20A 3ZQGA 3BCBA 5KW9A 4LMYA 2B7CA 2OC6A 3BC9A 3CPXA 2M7BA 5TY0A 1I5ZA 3HJEA 1RNLA 1E63A 4OJOA 4IXAA 3EYYA 1MBJA 2E2HJ 1QHHD 4ESBA 1H42A 3CCUB 1DDNA 5E3OA 1ELOA 2X6WA 3R6JA 1SD4A 1SMTA 4A3DJ 2JTVA 3ASOH 1FOYA 1IGNA 2ECCA 2R5ZA 1Z3YA 1RZ4A 5TRDA 4I2OA 1I1GA 2W24A 1SAUA 3K69A 4BGDA 3WGIA 1IV6A 4ZDLA 2LP0A 2M34A 3OAAA 5EMNA 3B8HA 2OTJB 2EINH 4KUMA 1ZAOA 3TL4X 1U8RA 1FTZA 3ZZ0A 2J5PA 3SDGA 5HS9A 1EE6A 4EGZA 1UD8A 1BQEA 4X05A 3V7AA 4DNCA 4Z6YA 4HDUA 2QM3A 1VQMI 3OFNA 4YZQA 4KIBA 3E0JB 5IYRA 1U6GA 2GAUA 1G7TA 1YG2A 3G1MA 4ENMA 4LK0F 2OUMA 2IPQX 2X1CA 1G8XA 2X48A 3FMRA 3DDYA 1EH7A 5IYNA 2MGQA 1WMRA 2G7HA 3BTIA 2I10A 3PSFA 2Q6IA 1JTAA 1X58A 2W00A 3DWLE 1IG7A 1X2MA 2CW8A 4LBVA 4P3IA 3HSFA 3RKXA 1WH5A 4N4NB 2A6TA 4EJOA 3HG9A 3H0GJ 3GCMA 4RD3A 1B8IA 2GWRA 2GXBA 1CZFA 3IWZA 2PMZA 1HQCA 1J2XA 3COAC 2MH2A 2ZXWH 3PIPF 2QGGA 5J4VA 1NK3P 1VQ4B 4MR0A 4LG0A 1TWCJ 1AA7A 2P8TA 2YUHA 3FDYA 1Z9CA 1K61A 2COBA 1QVUA 1ULYA 2O03A 2JA5J 2UXNA 2EB7A 2R6HA 3W2WA 1ZREA 1G7CA 2VZLA 3AVYA 2WV1A 1XCVA 2HQRA 1K6YA 5LRSA 2VQLA 1C0WA 4RS8A 3W5UA 1S7AA 1YIOA 1U5TC 1W0JA 3I59B 4OWRB 3K4BA 5K5RA 2DPUA 1GXPA 2R7VA 3ZQHA 2EV6A 1YX5A 2IAIA 4MEYF 1Q7YD 3Q0WA 3WYAA 2XAHA 2XGDA 2BM7A 1RPWA 2ZJQF 5CKTA 1X4PA 1SD7A 4IVNA 1AKHB 2ZBKA 1R5NA 2OYNA 4BY1J 4DQLA 3Q3SA 4M6XA 4HF1A 2YPRA 4OINF 4G5GA 3MKWB 2UWMA 3TEDA 2VC0A 1MH3A 1OISA 4MXNA 5ICEA 1X3WB 4X1EA 1GUUA 3S1MJ 3E1YE 4LGWA 4ACAA 5HKKA 1W2BB 1ZG5A 1T08B 2DT7B 3TDZC 1RQPA 4MQ9F 2AXLA 2PMUA 2E1RA 3JU4A 1J0RA 4Y9RA 2JA6J 3FWEA 4KMFA 2EV0A 4XLEA 2QYOA 2VBYA 1LPQA 1DARA 2B7BA 1O3SA 4BBRJ 1EF4A 2DO7A 3P27A 1ZRDA 3W2EA 4HZFA 3P9CA 1USSA 2XSJC 5LEJA 3GFMA 2WZPP 4YFNF 4XLNF 3HOYJ 1M1KD 3SZGA 5HLGA 1VQ8I 3GTJJ 3CCYA 4XK4A 2JUCA 5EG0B 1AOYA 4UUTA 2JPCA 1ZYRF 2DJIA 3KLNA 5E1XA 2YR2A 5DCFA 3PUFA 1O8HA 2EZKA 3QPHA 3H3VK 3O6BB 2DMNA 3QOPA 2KRFA 1P4AA 2FBIA 1B9NA 4KT5C 1NG6A 2M8EA 4OMYA 1WJFA 3DPLC 4LOCA 3OSFA 1E3HA 5E18F 1SFXA 3FK6A 4RB1A 3ECOA 1MMGA 3ZOBA 1EZGA 3S1NJ 1PP7U 4O6JA 5L3EA 5CVUA 4A69C 3BC8A 4BXFA 1M90D 3GYHX 2GIVA 3E6MA 3VDXA 3UR3C 2BVNA 2BM4A 5H6RA 5GV8A 5JVGF 2VKEA 2LF7A 3HPHA 1D5YA 2BPOA 1V5FA 2B7EA 3ZCOA 1NB9A 1MDMB 3QSYA 2ZMEC 1PUFB 2QBYB 1E3PA 2R7UA 1T5EA 3O2PE 5GPAA 2X0KA 5IK2A 3IHUA 3L2QA 3G6EI 1I18A 2L54A 4M3GA 1KQ5A 1LFPA 4R1HA 3HOUJ 2R5YA 4A5MA 1LB2A 1MJAA 1AU7A 1SFEA 3OYDA 1ETQA 1PJ7A 1QHGA 2K5CA 1VQKI 2O7OA 2QE7A 3IRRA 3DF8A 2GM4A 4X06A 3BLYA 4M9ZA 2VFMA 5EF6A 2V31A 2YWEA 2CSOA 3V7RA 4EV0A 2E19A 4RM2A 4X0CA 3MZYA 4CXFA 1TNSA 2QEXI 3WBJA 3FXMA 1ZGAA 1K8FA 2O9LA 3PJRA 1H80A 2VFQA 3NB2A 2JA2A 2BXZA 4RDUA 3NWSA 1BOAA 2ADUA 3WGHA 3IRQA 1AWCA 1JJ6C 2HOAA 2F5FA 4AF7A 3HKZA 2PJPA 2HTJA 4CH7A 2V6EA 2DMPA 5M3MJ 1VQ5I 2FUG2 2NNYA 5FRNA 2KRCA 1DGRM 3OW7A 1XE1A 3MWMA 5H20A 3L2VA 1VQ6B 3H9GA 4G7WA 5ERIA 3QU3A 1MMAA 3GTGJ 4ROXA 2QZAA 3TOAA 1VQNI 1GDTA 3BTCA 3AK5A 2F4IA 1GV2A 4X7FA 1SVLA 3B90A 2JRMA 4UB6C 3OY9A 3GBGA 2ID3A 2ZXIA 1KYWA 2EZIA 1UHWA 3FX3A 4ASNA 2WR8A 1QCXA 2HWVA 2OQGA 1FC3A 4ETSA 4B47A 2XGJA 1X1DA 4A5NA 2RNGA 2MW8A 1VQNB 2BGCA 3HOZJ 1JI8A 3I4NJ 3JCUC 1D0YA 2O61A 1MABA 3I5UA 4QLCU 4XLPF 3CCMB 2WY7Q 1K4TA 3P9IA 3BZKA 1OJLA 5GAHJ 5LFAA 1JRGA 1G6NA 1P92A 2DBBA 3WE2A 1I3QJ 3SJMA 2XC1A 2PJRB 2BVMA 1JUSA 1YJWB 4P22A 3AVTA 3KIOA 4LFUA 5ILSA 1XGNA 2ZL5A 2PFBA 2XB0X 3QE2A 5BSXA 3QYBA 1FWZA 3BJOA 2NVXJ 3NEUA 3DU1X 4NBQA 5J6XA 2ID6A 2DFEA 4A6DA 2HDDA 2RREA 3KX2A 3AL0B 1ZM2A 5TV2A 1FPQA 2JMWA 2X1EA 5JI6A 4N9IA 2JIZA 1E0EA 1VQOB 1OFDA 2LDUA 1MGTA 4XN0A 5TJJA 3JQPA 2R7TA 2EV5A 1G7RA 3GIRA 4FE7A 5LD2C 4HA8A 4A3JJ 2IP2A 2CGPA 2V7TA 4WX9A 1T8IA 1TQMA 2CW7A 1T98A 2K3PA 4HOBA 2XF5A 4HX7A 3TW6A 1WSUA 2XEXA 3BQYA 2ZL7A 4WWCA 3GVAA 1XDSA 1VQ6I 2ZBUA 5EYRA 3E6CC 3WE3A 4JX5A 1VHEA 3S8PA 2STWA 1E1RA 2QTLA 1UG2A 2EFOA 4J00A 5EEAA 1E62A 5D5WB 3KETA 2W6JA 3J7AO 1UD4A 4LITA 1W9XA 4TMWA 3BPXA 2QGUA 1Z7LA 4WZLA 5AIPA 3WTZA 2D1VA 3H3ZA 5K5OA 4FX4A 4FETA 3DPUA 3U1KA 2OTJI 3E20A 4ZCIA 1W36C 3ULQB 1EJ9A 3DCFA 2HTSA 4KT6A 4IHWA 3W2IA 2Z3YA 1YQAA 1CQXA 3GTPJ 1EV7A 1XGMA 2WAQA 1I8DA 1L1IA 3UNGC 4C2UA 2IA1A 3BCAA 1X2NA 3BZCA 4CCNA 2XRLA 1MNMC 2X3UA 1LJ9A 2XF7A 4DZJA 2BOLA 2EIMH 1ETXA 2M4GA
chains in the Genus database with same CATH topology
2R7WA 3HOSA 2VJ4A 4BEHA 5CDFA 3RQ4A 1OR7C 2GK7A 1V0EA 3GRHA 2GJPA 4HEA2 3I3LA 2KDOA 4OAYA 4HNTA 1LKXA 3GQ7A 3M8JA 4KISA 2RQQA 3HUGB 5HNFA 4GQNA 1O8GA 2W1OA 2V1NA 5C1EA 2M5SA 3OE7A 3OYKA 2ZTGA 4DK1A 3DLAA 2IS4A 2W6IA 3BCDA 3OYEA 2HDWA 3W2AA 4PJJA 2WADA 4YZAA 2P0WA 3OMYA 1OGMX 3S93A 4DOZA 3K4MA 1E43A 1KONA 3F9KA 4RM3A 2VQGA 1KZLA 2Q1ZB 4BJ6C 3K4LA 1Y6IA 2ODLA 2GK6A 2PECA 3EPZA 4W8SA 3H5AA 2KZVA 2M3AA 2NOJB 2WPDA 3DEEA 3FKJA 2KMUA 3H35A 3PL8A 4XL9A 3AKZA 4KKUA 5C1CA 3RCOA 3FY3A 3ZPPA 2KP6A 1WJ5A 4BS9A 2QKLB 4R79A 4J01A 1UAAA 4BQQA 2IQ7A 1KCDA 1O8JA 3ZSCA 3A35A 3ZXSA 1PKVA 4DBRA 2KL4A 2VKDA 4ZC3A 2VLAA 2CFOA 3CF2A 3CJRB 4Y4RA 4HIZA 2R7SA 1BHEA 2LC2A 5FRMA 4BJ5C 4XOTA 1FX0A 4UZUA 5DN6A 3SDBA 3IAS2 3IUOA 4CCKA 4ANJA 1MNEA 2R7RA 2WJYA 1PE9A 1OOCA 3H5NA 4E7IA 2Z2SB 4B43A 3D5LA 2KQRA 4YELA 2Q2EB 5HVQC 4RLQA 1H8HA 5HOOA 2BW3A 1EFRA 3PNTA 3TMOA 4XOPA 1WJBA 2E5ZA 4DNRB 4XN3A 2MABA 4E0FA 4Z05A 3EUAA 3G2BA 1N77A 2LZJA 4XLHA 2BVLA 4D1QA 3B8YA 2LY1A 3LL7A 2IS2A 1AIRA 4CCLA 1MMNA 1RMGA 1D0XA 1YX3A 2VJJA 5FROA 4X0GA 2CUZA 2VJIA 4BDZA 3GVKA 2NTQA 3HPGA 2QY1A 3UW0A 1O8IA 2E1BA 4PJNA 1OFLA 3LSIA 4QPOA 4TT3A 2KHMA 2VASA 1ERDA 4E7HA 2X1DA 2LH9A 1TZLA 3VSVA 3PNYA 4BUPA 2IGNA 4CCMA 1O8MA 1N78A 1IRXA 4F3QA 4W8TA 2HZDA 3LSKA 2CV2A 4TKOB 1N75A 4II2A 4E7ZA 1O8EA 3DTEA 1BPLA 3OFNA 4BU2A 1FMVA 3SEZA 2O04A 4W8QA 2D3NA 2LRDA 2JUGA 3AFHA 4D9JA 3S3OA 1RU4A 2ZFUA 4Y3OA 1MNDA 4L8JA 1HVXA 5KCMA 4CCJA 2GJRA 4OJ5A 1D1CA 2KLOA 2WJVA 3W2VA 4OZZA 4Z03A 1X1AA 4IX7A 1HZEA 4ZDOA 2VQHA 4E7JA 3FHNA 4B3FX 4IQJA 2X51A 1OHHA 1YE9A 4KKTA 2NSPA 3HC7A 3VYUB 2V7QA 3L2UA 2IS1A 4HG2A 2XZLA 3W3CA 4JOMA 4U87A 3LMMA 4U49A 3KYLA 1UG0A 4PSXA 3LMWA 3CZ6A 3VMVA 4HPQA 4NQWB 3DTIA 1KTWA 2HPIA 1O88A 1E79A 4QPQA 2ZSIB 2W7NA 2R9VA 1UELB 1D1AA 2L2OA 4B44A 1VZ0A 3IP4B 3FBIB 1WJDA 5FL7A 2PYHA 4XNFA 1BR1A 2D3LA 3OL3A 1V5EA 2EWEA 4EW9A 2KRHA 1QU3A 3T9GA 4NNJA 2QX3A 4C30A 1J09A 2ZSHB 1XG2A 2DOAA 2VPLA 4C2LA 3K6GA 3CMMA 4F55A 5CQGA 3NE5B 1T95A 2Z8GA 3T51B 1RWRA 4CCOA 1IDKA 2INVA 1BR4A 1W36D 2O0VA 1WJEA 1OFMA 3TBIA 3L2WA 3OOUA 1QJVA 4Y33A 2HVQA 3V42A 4F92B 4BDYA 3OWTA 3H9JA 4XONA 3ZGKA 3VSKA 4RLFA 3D5SC 3HL2A 2E1MC 2V26A 4E4HA 3CP2A 3T53B 1WTHD 1X4OA 4PJMA 4PSWA 4E7KA 3VYTB 2VKHA 1DGWY 4H4KC 3IAM2 2O1DA 5CQEA 2L9NA 3ZR8X 3OIQA 5KHDA 3JURA 3BCBA 1G59A 3QYEA 1VJSA 2OC6A 3BC9A 2M7BA 3OS1A 4OJOA 4XLAA 3S3MA 2Z1DA 2ZTNA 1EA3A 1QHHD 3VMWA 3KEYA 2X6WA 3SYTA 3GQAA 3NWTA 2O0WA 2W4SA 4XR6A 4TSFA 1X19A 3FBNB 3BG6A 2XF6A 4LIVA 1Z3YA 2JVGA 3MKZA 2VBEA 4URRA 3OYJA 1PLUA 4YRVA 3ZPNA 3DTKA 4XQFA 1O8KA 1SAUA 4BGDA 2V4DA 4ZDLA 2Y0SA 1BR2A 3OAAA 2CS3A 1VLYA 1IB4A 3TL4X 3FKSA 1IDJA 1Z21A 4CA0A 3U21A 2VBMA 1EE6A 3LNNA 4B3GA 3DQVC 1UD8A 3HAGA 1V0FA 3D5RC 4N4OB 2IS6A 2ZZFA 2BSPA 2BW3B 3HXLA 2LY2A 4CUGA 3OYLA 2L9SA 3OL4A 3E0JB 4EATA 1D1BA 3K4JA 2HU9A 1WP6A 2O5RA 4YZQA 1W0KA 3K4NA 2XDVA 2HVRA 3GQ9A 4OJLA 2AQEA 2OUMA 1DQUA 2X1CA 1G8XA 4PUSA 4U7BA 2NZMA 4B3XA 3DU6A 3DDYA 2INUA 1WMRA 2X3HA 3OEHA 3PSFA 3K70D 4KITB 3OS0A 1JTAA 2W00A 4KKSA 3K4KA 3DWLE 4PMHA 2CW8A 1UD3A 2ZZEA 2M4KA 3VYSB 2CUJA 5KNLA 2CMPA 3MMYB 2A6TA 4N4NB 4ZDPA 3HG9A 2X6YA 4B48A 4BQOA 4C2TA 4CSWA 1CZFA 2QKMB 1O8LA 2HNHA 2PMZA 3OYMA 4MR0A 3A1YA 4XLFA 3J7AY 3QOEA 1O8DA 1AA7A 4DGWB 3FDYA 4OJPA 1BN8A 4P1WA 4NUBA 2XAUA 1WPCA 3CJQB 3W2WA 4BL0B 3C2GA 2WA0A 1K6YA 4DIQA 1UD5A 2NSTA 3DPTA 4HRIA 2VQLA 4ZTFA 1W0JA 4OWRB 2F5VA 3K4BA 2R7VA 3ONQA 1YX5A 1BOBA 2X8KA 3G05A 1OB0A 4IQ4A 1NG7A 1TT0A 3A3BA 5CKTA 1X4PA 4BQNA 2K9MA 2IXSA 3AL0C 3A3GA 2DXIA 4NC8A 2F6CA 2JSPA 2F1MA 1UD6A 4YZXA 4AYBA 3VYRB 3MKWB 2UWMA 2O17A 4XMYA 4MXNA 2W82A 5HKKA 2DT7B 3SUCA 3BG7A 4FASD 4Z1MA 1P9QC 1WJAA 3H94A 4ASUA 2QXZA 4NK6A 4OZYA 3QODA 3JU4A 3E1SA 5TGTA 2XNDA 1DBGA 4RMNA 2M7AA 2V4JC 3OOCA 1PXZA 4GRIA 4AVZA 4XLEA 2VIXA 2VJ5A 3LSHA 4XLCA 2NTPA 3BCFA 3WWGA 4G7XA 4PFOA 3BH4A 1X0CA 2XSJC 4YEJA 2WBMA 3S3NA 2WZPP 4XKBA 3SZGA 3GVLA 1BLIA 3HOTA 1HG8A 4IKFA 1X1BA 1FMWA 2E1MB 4ZYAA 2E5NA 5JHFA 4MLOA 2DJIA 1PJRA 4E7LA 1O8HA 1ZELA 3I9V2 3OYGA 2XZOA 2Z16A 1E3XA 4DBQA 4F52A 3GQ8A 2PYGA 2CK3A 1UD2A 2VXDA 1NG6A 4AU7A 4E6KG 1WJFA 3DPLC 4NK8A 3EQNA 3RPUD 2R7QA 2GOXB 1K5CA 2XOKA 1MMGA 1OGOX 4BEHB 4F93B 2PJRA 3GQBA 4ZTJA 2OV7A 2DIEA 4NC7A 3BC8A 4BXFA 3SEQA 2JJ1A 3VDXA 5CPRB 2VL8A 4OAZA 3UR3C 2WB1A 2E60A 3HPHA 2WAEA 1V5FA 3ZCOA 3VR6A 4HSRA 4HNUA 4W8RA 1KCCA 2R7UA 3S32A 1T5EA 5IK2A 3DKXA 2UVEA 3LSMA 1S9HA 2UUZA 2XC7A 4HSTA 3L2QA 1DP3A 4BJTA 1COWA 2LREA 1I18A 1LFPA 2V9KA 3EQOA 2MD0A 2NT9A 3OYDA 1E3ZA 1QHGA 2HVSA 2K5CA 1PYVA 4C9YA 2QE7A 3BLYA 3EUKL 3OYFA 2LYCA 2ZZGA 4LIUA 1H8EA 2UV1A 2V31A 3LFUA 4II3A 2VXZA 4RM2A 4OJ6A 3VSUA 2MFZA 3H9QA 2VB6A 2MYSA 4JQFA 3OYCA 2CV0A 1T0FC 3PJRA 4BE2A 4ITVA 2JA2A 2LBFA 1KMHA 1H80A 3NWSA 4XKCA 1BMFA 2L7KA 3MD2A 2HLDA 3HKZA 1R6RA 4CH7A 3ZRGA 2V6EA 3PUBA 2KVOA 3CESA 4I84A 2FUG2 1WFXA 5FRNA 3DKYA 4KJZA 2KRCA 2X6XA 1DGRM 1Y56A 4P5OA 3OW7A 3OEEA 1U0JA 3L2VA 1GLNA 2HQAA 3H9GA 1Z3XA 4G7WA 1MMAA 2X53S 4XORA 4U4BA 1O8FA 2F4IA 3PSIA 3B90A 2IGOA 3GBGA 2ZXIA 3OY9A 2ELJA 3K70C 1VF7A 3L2RA 1QCXA 2VBKA 4HWVA 4BE1A 3OS2A 4B47A 1NRKA 2XGJA 1X1DA 3A4CA 4F91B 4E7SA 2RNGA 1E1QA 1NBMA 4DK0A 3WQZA 3C2HA 4XKVA 1JI8A 1WJCA 1D0YA 3OR2C 3KRGA 2VQCA 2HPMA 1MABA 3VSLA 4G6IA 1K28D 2WY8Q 2MC4A 2WY7Q 2JDIA 3RSNA 3OYBA 2R7XA 1D0ZA 4Z06A 3QYFA 3LSGA 3CP8A 1X1CA 2Z6BD 5LFAA 1JRGA 4CZCA 3K4CA 2WSSA 2ZXHA 2BVMA 2WAFA 2PJRB 4P22A 2M4GA 2IGMA 1LDKB 2CV1A 3ZQQA 2ZZQA 2DT6A 2R7OA 3PFYA 3DU5A 3EUHC 3QYBA 1SKYB 1OLTA 4PFPA 2UVFA 2A5WA 3KEWA 4DJAA 3M1CA 2RREA 3KX2A 3AL0B 3OYAA 2X1EA 3VWBA 4XM3A 2JVHA 2JIZA 1E0EA 1IA5A 1VBLA 4DNTB 3A2KA 2DCEA 4XN0A 2IGKA 2LOOA 1NHCA 4BACA 2R7TA 4G6TB 2V7FA 2X85A 1LVKA 5LD2C 3OR1C 4FXUA 3GVJA 3PNVA 2LG4A 2GJKA 3B4NA 5AMVA 2CW7A 2K3PA 2M0MA 2XF5A 2AQFA 1V5GA 1MMDA 3K10A 4YXWA 5HLTA 3OIPA 3FPPA 2I8DA 3N05A 3S8PA 1E1RA 4XD7A 1SFKA 4J00A 2W6JA 3OYHA 2LBFB 2F43A 4LG3A 3OYIA 1HA8A 4LITA 1UD4A 4PK4A 2GOMA 1W9XA 3ZIAA 1Z7LA 5HNHA 4JMQA 2KPMA 2L5QA 4IZZA 4PJLA 4BE0A 4FETA 3DPUA 3OPOA 2NTBA 1W36C 2R4GA 2XZPA 4KT6A 2NT6A 3T56B 1DBOA 4XKWA 4YZ0A 2WAQA 3MKYB 1I8DA 4ZJZA 3H0DA 3RTRA 3UNGC 2CH0A 4C2UA 1GQ8A 2JJ2A 3BCAA 2K9LA 4CCNA 1MW7A 3VSTA 2XF7A 2BOLA 3OYNA 3H5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMH A;  4OJ6 A;  3VSU A;  2NSP A;  2UVE A;  3GRH A;  2X6Y A;  1CZF A;  1H80 A;  1O8L A;  4U49 A;  3GQ7 A;  4MR0 A;  3LMW A;  1O8D A;  4XLF A;  3VMV A;  1O88 A;  1KTW A;  4OJP A;  1O8G A;  1BN8 A;  5C1E A;  4I84 A;  2X6X A;  2NST A;  2PYH A;  4XNF A;  2EWE A;  4EW9 A;  4XOR A;  4U4B A;  1OGM X;  1O8F A;  4YZA A;  3T9G A;  2QX3 A;  3B90 A;  1QCX A;  2VBK A;  1XG2 A;  4HWV A;  4C2L A;  2ODL A;  2PEC A;  4W8S A;  2Z8G A;  4YZX A;  4XKV A;  1RWR A;  3KRG A;  2O17 A;  4XL9 A;  1IDK A;  4XMY A;  2INV A;  2O0V A;  4MXN A;  3FY3 A;  3ZPP A;  5C1C A;  1OFM A;  1QJV A;  4Z06 A;  2IQ7 A;  3SUC A;  1KCD A;  1O8J A;  2QXZ A;  3ZSC A;  4NK6 A;  4OZY A;  4XON A;  1DBG A;  1JRG A;  1PXZ A;  4AVZ A;  4XLE A;  1BHE A;  2NTP A;  4XLC A;  4XOT A;  3WWG A;  1PE9 A;  1X0C A;  4YEJ A;  1OOC A;  2O1D A;  3JUR A;  2UVF A;  1HG8 A;  4YEL A;  4OJO A;  4XM3 A;  4XLA A;  1IA5 A;  1VBL A;  3VMW A;  4XN0 A;  4XOP A;  2X6W A;  1O8H A;  1NHC A;  3GQA A;  2X85 A;  4XN3 A;  4Z05 A;  3GQ8 A;  2O0W A;  2PYG A;  4XLH A;  4XR6 A;  3B8Y A;  3B4N A;  4NK8 A;  1AIR A;  3EQN A;  5AMV A;  1RMG A;  2VJJ A;  2VBE A;  4URR A;  3UW0 A;  2VJI A;  1PLU A;  2QY1 A;  2NTQ A;  1K5C A;  1OGO X;  1O8I A;  4XQF A;  1OFL A;  1O8K A;  1IB4 A;  3VSV A;  1IDJ A;  1O8M A;  4W8T A;  2VBM A;  1EE6 A;  4W8R A;  1KCC A;  1O8E A;  2O04 A;  2NTB A;  2BSP A;  4W8Q A;  4YZQ A;  2NT6 A;  3EQO A;  1RU4 A;  1DBO A;  4XKW A;  3GQ9 A;  4OJL A;  4YZ0 A;  2NT9 A;  2NZM A;  1GQ8 A;  2INU A;  4OJ5 A;  1WMR A;  2X3H A;  3VST A;  4OZZ A;  4Z03 A;  1JTA A; 
#chains in the Genus database with same CATH topology
 3OP1 A;  2R7W A;  2VJ4 A;  5KAF C;  2KDZ A;  1GAQ A;  1EWY A;  4MEX F;  4ZZL A;  3OZV A;  4NB5 A;  2KDO A;  2N8G A;  1H0M A;  2V7U A;  4P25 A;  4AIK A;  1LKX A;  3M1E A;  2ZFW A;  1WWX A;  4QTR A;  5DUK A;  1T6Z A;  2OJE D;  4HNV A;  3BNW A;  4Z4S A;  5EZG A;  2C5B A;  2VC1 A;  2P6S A;  2VE9 A;  1FOK A;  2M5S A;  3OYK A;  1YHQ I;  1NHA A;  5F0H A;  1MBF A;  3BY2 A;  1WU8 A;  4V19 K;  1Z0X A;  3TQN A;  3JR9 A;  3FXQ A;  4OOI A;  1S72 I;  4ZGQ B;  3FM3 A;  3JRA A;  3W2A A;  5AON A;  4PJJ A;  2WAD A;  1SD6 A;  3OMY A;  2EPF A;  3BPV A;  3S93 A;  3QFT A;  1E43 A;  3H36 A;  1FBU A;  5FKN A;  3VOE A;  3CC2 I;  3F9K A;  4L9V A;  3JRD A;  4AUX A;  3SZT A;  2P6T A;  3HIF A;  2NOG A;  1BL0 A;  1VQ9 B;  1O57 A;  1QNT A;  1Y6I A;  2OTL I;  2AHO A;  2O8X A;  2GK6 A;  2PEC A;  4AYB N;  2M3A A;  3HOX J;  4RD0 A;  4Z4T A;  1JNY A;  2HI3 A;  3H35 A;  1YJ9 I;  4I09 A;  5C1C A;  3RCO A;  4XRF A;  1WJ5 A;  4R79 A;  3CDL A;  1EFT A;  2XTY A;  1XB4 A;  1HSJ A;  4IL6 C;  1O8J A;  3HSR A;  3A35 A;  1W34 A;  1KQS B;  4LC0 A;  1ZK8 A;  5BOX A;  4AVP A;  2BV6 A;  3BOQ A;  1VLO A;  4M6Y A;  3CJR B;  5FFX A;  4HIZ A;  5K7Z A;  2R7S A;  3BG9 A;  2FF4 A;  1W35 A;  4BJ5 C;  5M5Y J;  3S2D J;  5CJ9 A;  3IAS 2;  1F9N A;  1OB5 A;  1RR8 C;  3PVD A;  5D5V B;  2WJY A;  1OOC A;  4AM3 A;  3H5N A;  2XT2 A;  2P5V A;  4RB3 C;  4B43 A;  3OSG A;  3ML3 A;  3VEP A;  3CXC B;  3E5U A;  4UXN A;  5HOO A;  1H8H A;  3PNT A;  3AG4 H;  3GTO J;  2JZY A;  3WTY C;  5BSY A;  4XOP A;  4WXH A;  1UFM A;  3CCR I;  2MAB A;  2CQ7 A;  4QVJ A;  4E0F A;  1HA3 A;  2VYQ A;  2IS2 A;  1IF1 A;  4CCL A;  1D0X A;  2G7U A;  3CCS B;  4PDK A;  3HGY A;  1O8I A;  4LB6 B;  3BH6 B;  1A35 A;  2L02 A;  2R7D A;  4FQG A;  1BA5 A;  3AG2 H;  5CYV A;  1FYK A;  2KHM A;  4MFE A;  3N97 A;  5ED4 A;  4BQA A;  1PUE E;  4U0V A;  3VSV A;  2D74 A;  4BUP A;  4A2U A;  2HZD A;  2NAZ A;  1N75 A;  1IN4 A;  2DA1 A;  2KIF A;  4II2 A;  4LJZ F;  3SY2 A;  1BPL A;  2V7V A;  1FMV A;  3AG3 H;  5L46 A;  2D3N A;  1I3A A;  2OQR A;  3Q3A A;  3A03 A;  2F4O B;  1P7J A;  2E36 A;  1RU4 A;  3JRF A;  4Y3O A;  1DAB A;  5KCM A;  3B78 A;  2XPV A;  4P26 A;  3WGG A;  3IH4 A;  3V4G A;  4ZDO A;  2VQH A;  1YI2 B;  3DBH B;  1S6L A;  3FHN A;  2C4U A;  1YW7 A;  4KKT A;  4C2M J;  1IN8 A;  3HC7 A;  2VT2 A;  3DFG A;  3WTX C;  3L2U A;  3GX4 X;  3GLL A;  1YIT I;  2MC3 A;  1T39 A;  4UZE A;  4U87 A;  1ZR2 A;  4U49 A;  2XAG A;  1F43 A;  2IA0 A;  5LGU A;  2DYI A;  1G3W A;  1O88 A;  2VT3 A;  3LVB A;  2JA8 J;  1VQ8 B;  5J3L A;  1LE8 A;  3ASP A;  2R9V A;  3PO2 J;  4HQE A;  5D5X B;  3DXJ F;  4B44 A;  2DQL A;  2I5U A;  1DU6 A;  3SQN A;  1WJD A;  2PYH A;  1EA0 A;  1OCO H;  3OL3 A;  4RCZ A;  2EWE A;  4WZE A;  3VO1 A;  1NB0 A;  2Q6O A;  3ABT A;  4C30 A;  1YJN I;  1ZLJ A;  4M53 A;  2HEO A;  2LSO A;  1WP6 A;  4OPO A;  2CWE A;  2DOA A;  1FIP A;  4CIC A;  2VPL A;  4P55 A;  2Y0S N;  5DD4 A;  4F55 A;  1XPX A;  1WSR A;  2VUM J;  4KH3 A;  3HTS B;  2J7K A;  2IA2 A;  2INV A;  2K9S A;  1BR4 A;  4RAF A;  2O0V A;  1WJE A;  3V8L A;  1W7P D;  2M8G X;  1IHM A;  2CUF A;  3NAR A;  3IKV A;  2X0L A;  1XFO A;  3GXO A;  4F92 B;  2NVT J;  3OWT A;  3ZGK A;  1U9N A;  3KP6 A;  3QWL A;  3VSK A;  2OBS A;  5HXB A;  2RN7 A;  2BHZ A;  2QSF X;  4NQW A;  3T53 B;  4CHU A;  2VBZ A;  4UB8 C;  2W25 A;  2TDX A;  4PSW A;  5DUI A;  3VMF A;  5B5E C;  4H4K C;  5FGM A;  2BY2 A;  1FNB A;  5KHD A;  3L2C A;  4FK8 A;  2XPW A;  3WTS C;  4LBY A;  2IW5 A;  4UUS A;  3QYE A;  4L5I A;  3OS1 A;  2K7L A;  3PO3 J;  1KQ8 A;  2K40 A;  4XLA A;  4UVC A;  2DEU A;  3VMW A;  4OIP F;  4UUV A;  4N3N A;  1PP8 F;  1Q9S A;  4EJU A;  1KQ0 A;  2E1N A;  2O0W A;  4G6Q A;  4XR6 A;  4TSF A;  3FMS A;  3FBN B;  4FN5 A;  3R6S A;  3CCU I;  5E17 F;  3R4K A;  4LIV A;  2KJC A;  1B4A A;  2VBE A;  1FNM A;  3ZPN A;  2Y75 A;  3DTK A;  2LKS A;  4XQF A;  4UV9 A;  2LKX A;  2EFW A;  1BR2 A;  4CYD A;  1D3Y A;  1OCT C;  2CS3 A;  5DYM A;  4RDL A;  3FKS A;  3NAU A;  4CA0 A;  5IT3 A;  3U21 A;  5AN9 A;  1X3U A;  3OOP A;  4XRS G;  1D1N A;  4B3G A;  4A0X A;  4V2F A;  2VNJ A;  4PC3 A;  5E6T A;  2ZZF A;  3C3W A;  3HXL A;  2PX9 A;  1Z77 A;  4CUG A;  4ZGN B;  1GO2 A;  1D1B A;  2O5R A;  2PMD A;  4FX0 A;  3HBL A;  2HVR A;  5F64 A;  3CME I;  1DQU A;  2NZM A;  3CJN A;  4PUS A;  3DU6 A;  2XSD C;  2H6C A;  1U3E M;  3K70 D;  1R5B A;  4KIT B;  1X3Z B;  3OS0 A;  3BG3 A;  2NVQ J;  1F1Z A;  4A3B J;  4HF0 A;  5DEQ A;  2KIU A;  2FQ3 A;  5HZB A;  1V54 H;  2E2I J;  5KNL A;  4C2T A;  3CC7 B;  2ESN A;  4HAM A;  2ZB9 A;  1OGJ A;  1O8L A;  2HNH A;  3BR3 A;  3WG9 A;  5J47 A;  1QZZ A;  3OYM A;  3ML6 A;  1IV8 A;  1O8D A;  1ORK A;  2ZO4 A;  3J7A Y;  5IYW A;  1JJ2 B;  2V1X A;  4HX8 A;  4BPR A;  1IJE A;  1D8J A;  4NUB A;  1GAW A;  3CUO A;  3M9A A;  5GTI C;  2XAU A;  5J1Y A;  1FYL A;  3MKL A;  4BL0 B;  3L1P A;  3SLN A;  2E71 A;  1J9Z A;  4DIQ A;  1B23 P;  1BI3 A;  1U9O A;  2M45 A;  4ZTF A;  5BNG A;  2DDB A;  3J7Z I;  3ONQ A;  2X8K A;  3G05 A;  1XDU A;  4JX6 A;  3QPS A;  1UMK A;  3C18 A;  3DLL F;  3A3B A;  1LEB A;  3HEF A;  2DAO A;  2IJL A;  1R71 A;  1ZR4 A;  2O8K A;  3ASR A;  3IWF A;  3A3G A;  4OM9 A;  3T5X A;  5AIQ A;  1XMX A;  2F1M A;  3B02 A;  1H88 C;  4YZX A;  3GTL J;  3LAP A;  3QAH A;  3WHB A;  1HKQ A;  2OK8 A;  4FAS D;  4ASU A;  1P9Q C;  4NK6 A;  3Q6R A;  5TGT A;  4A6E A;  4UY8 I;  2XND A;  4HX4 A;  4RMN A;  3CCJ B;  5F08 A;  2V4J C;  2XTX A;  5IP6 A;  4R8H A;  1RQR A;  5GPC A;  5L3G A;  1MDM A;  1DG1 G;  3FXL A;  2NTP A;  1TBX A;  3BCF A;  1M1E B;  2NV4 A;  3Q38 A;  5J35 A;  4RDJ A;  4YIR X;  3P26 A;  3FIW A;  2JA7 J;  2IEK A;  4YCQ A;  4BH9 A;  1BIA A;  2LF8 A;  1OYI A;  2CQK A;  3HOT A;  4KYW A;  1H89 C;  1FMW A;  1WOR A;  1FP2 A;  4ZYA A;  2E5N A;  4KFC A;  4WZK A;  5F4O A;  3S17 J;  1PJR A;  3VOD A;  3G73 A;  1HW5 A;  5DD8 A;  5K1Y A;  3LSJ A;  1E64 A;  3WG7 H;  3S16 J;  3I55 B;  2HOS A;  3V8J A;  2DA7 A;  1UD2 A;  2IOU G;  5LHH A;  3ZBU A;  3BJ6 A;  3EQN A;  1IXC A;  2HKX A;  1JT0 A;  2ZC2 A;  1K5C A;  2DOD A;  2X9D A;  1OGO X;  4BEH B;  2E34 A;  4F93 B;  2C2W A;  4ZTJ A;  5ICG A;  3FXK A;  3FM5 A;  4NC7 A;  2DYR H;  5FKO A;  1HW1 A;  2ME6 A;  3SEQ A;  4P3Y A;  1GHC A;  1R5G A;  3CCE I;  5CPR B;  2VL8 A;  2WB1 A;  4M3B A;  2E60 A;  4LBZ A;  4YAL A;  1MJB A;  1U2R A;  1RET A;  4BXX J;  2DFI A;  3X2Q H;  1S9H A;  2UUZ A;  3GF2 A;  4HST A;  4BJT A;  1F20 A;  2LRE A;  3SZE A;  2FSW A;  3ESW B;  4G8X A;  2LLK A;  2MD0 A;  3HHG A;  1FEX A;  2HVS A;  2RVC A;  1PYV A;  1QGA A;  1HC8 A;  2CND A;  4LIU A;  1KGS A;  2UV1 A;  3OYN A;  1N05 A;  3JTH A;  3LFU A;  3S14 J;  2VBX A;  1IC8 A;  5DSZ A;  2ACJ A;  4II3 A;  5LHG A;  1HW2 A;  4IOC F;  3VSU A;  2VB6 A;  2DA5 A;  2MYS A;  1JGS A;  9ANT A;  4RA2 A;  1T0F C;  2PG4 A;  4ITV A;  2HDC A;  4M0L A;  1ON2 A;  5JVT A;  3BR6 A;  3ZMV A;  4XKC A;  3BP8 A;  2L7K A;  1JA0 A;  2HFH A;  2XHK A;  2HOT A;  1D8T A;  4TMX A;  1V55 H;  2WTE A;  4XRS A;  3PUB A;  4PCQ A;  4WZT A;  1JT6 A;  1QA1 A;  1YX2 A;  2CRV A;  1HBX G;  2H8W A;  2KIS A;  4IHS A;  1U0J A;  2XKP A;  2LNB A;  3QFC A;  1Z3X A;  3H92 A;  2ZME A;  4QWQ A;  1K4S A;  4AD9 A;  3SHF A;  5C4J J;  4XOR A;  1O8F A;  2AHQ A;  3OW2 B;  3KCC A;  3L2R A;  4HWV A;  3E5Q A;  4BE1 A;  3OS2 A;  3CTA A;  1YJN B;  3CC4 B;  1TLL A;  2MA3 A;  3MAJ A;  4F91 B;  1TWG J;  4XBF A;  5B6I A;  1ACI A;  2ICW G;  4EM0 B;  3KP4 A;  3KRG A;  1YJ9 B;  1R7J A;  1MBE A;  1O4X A;  2P7C B;  4G6I A;  1K28 D;  2WY8 Q;  2GXA A;  3W2G A;  3HSE A;  4L0Y B;  1W5T A;  3S1Q J;  4YFO A;  1OQY A;  4ZCL A;  3QYF A;  1ZAR A;  4NDL A;  3RYP A;  3ZPL A;  1JHF A;  3FJO A;  3CP8 A;  3ONU A;  5F4J A;  5FD5 A;  1STZ A;  1YW9 A;  4CZC A;  3BR2 A;  3JRG A;  3T1B A;  1K6O A;  4ZZD A;  3F8M A;  1OFE A;  2IGM A;  3KP7 A;  2CV1 A;  1ZM4 A;  1TUI A;  3EUH A;  2ZZQ A;  4Y15 A;  2R7O A;  1LDD A;  2G0E A;  3PM1 A;  3KEW A;  1KU9 A;  3GUD A;  4DJA A;  3N4M A;  1IN5 A;  1OFC X;  1RRJ A;  2XNJ A;  5H2F C;  1ZUN B;  3JQR A;  2Y2Z A;  2K9N A;  1IA5 A;  1IN7 A;  3A2K A;  2DCE A;  1K73 D;  1MSF C;  1K8A D;  2LOO A;  1NHC A;  3A0H C;  5LRR A;  3CC7 I;  1POG A;  2QQ8 A;  1S7O A;  1G4D A;  4FXU A;  3GVJ A;  2FBH A;  5KAI C;  4X07 A;  1WOP A;  4HLY A;  2GJK A;  4G94 A;  5HDK A;  3HDD A;  4YDT A;  1LLZ A;  2M0M A;  4PZJ A;  2AQF A;  2W84 A;  1MMD A;  2KJB A;  5J1U A;  2GXG A;  1WOS A;  2QSG X;  3ZMU A;  2XRN A;  3TKY A;  4DYC A;  1YYV A;  2LBF B;  2LY9 A;  1BN5 A;  2VOO A;  1JKQ C;  3R61 A;  1HA8 A;  4PK4 A;  2FX3 A;  2O6W A;  4YAW A;  1R1V A;  4WCG A;  3CCS I;  2KPM A;  1N08 A;  2L5Q A;  2BY3 A;  4IJA A;  4W97 A;  4JMQ A;  3KYD B;  1GV5 A;  3M4O J;  3I71 A;  3OPO A;  4X7D A;  4C3J J;  4B1R A;  3Q5F A;  3AST A;  1OB2 A;  5A89 A;  4HV5 A;  2NT6 A;  1DBO A;  4YZ0 A;  1I7P A;  1SFU A;  1DPU A;  3RPQ A;  3FIS A;  1IO2 A;  2B9S A;  2JJ2 A;  2VI6 A;  5LBQ A;  2Z33 A;  2E1C A;  3VST A;  1WKM A;  1LFB A;  2A68 F;  2CQX A;  4LLL A;  3H5R A;  1SVM A;  3RQ4 A;  1OR7 C;  1V0E A;  3W5V A;  1VTN C;  1U5T A;  5GAD J;  4KIS A;  3JQQ A;  1FX7 A;  2PMZ N;  2Q6K A;  1KU7 A;  5HNF A;  3R0A A;  2PQ8 A;  2ISY A;  5C1E A;  2P5K A;  2V9V A;  3NQO A;  3S15 J;  3U6B A;  3BY1 A;  3OE7 A;  4G6D A;  2CQN A;  3CCV B;  2VBS A;  1LUJ B;  2YWH A;  1B9M A;  5JHU A;  3OYE A;  4G12 A;  4QHY A;  2HDW A;  1B59 A;  1QPI A;  2P0W A;  2DMQ A;  4AWX B;  1WQ2 A;  3QPL A;  2EBI A;  5B1B H;  2VQG A;  1KZL A;  4I7H A;  3FPK A;  1WPK A;  4BHP A;  5F1R A;  4TMT A;  3WND A;  3AGQ A;  1S72 B;  3DEE A;  3TGN A;  3TP3 A;  4XL9 A;  5GTH C;  3OKX A;  3RDI A;  3FY3 A;  5DDG A;  3HRS A;  4BS9 A;  1Z91 A;  2QKL B;  1MD0 A;  4IRI A;  1FT9 A;  2A61 A;  2QVO A;  4BXU A;  3JRH A;  2EA2 A;  1E3O C;  5A8A A;  6PAX A;  4XRM A;  2KL4 A;  2VKD A;  2WV0 A;  3HM5 A;  2VOP A;  3CF2 A;  1UST A;  2NS8 A;  2QQ9 A;  1Y39 A;  1N06 A;  1I50 J;  1TT5 B;  1TWF J;  2LMD A;  2XAJ A;  3Q9V A;  2I1L A;  1BW5 A;  1FIA A;  3EDP A;  5DN6 A;  1MNE A;  1SAN A;  1PE9 A;  2QQB A;  3ASQ A;  2Z2S B;  1CQT A;  1R49 A;  3H9N A;  2KQR A;  2Q2E B;  1BJA A;  4RLQ A;  2QEN A;  1EFR A;  4X7E A;  5DM7 F;  1X1P A;  4PJ0 C;  4DNR B;  1Q82 D;  2ZIT A;  1OYW A;  1VFC A;  1FJL A;  1TWA J;  3EUA A;  1IRF A;  1T6X A;  2LZJ A;  1P2F A;  1LVA A;  2GRE A;  2RC6 A;  2LY1 A;  3F8N A;  3QFS A;  1APL C;  1Q1V A;  3B8Y A;  4M72 A;  1MMN A;  1VQL B;  3F8C A;  4BDZ A;  4EVI A;  2CUZ A;  3G1L A;  1LNW A;  2QY1 A;  3UW0 A;  3CLQ A;  3HRM A;  3WU2 C;  4EJT A;  3Q9S A;  4PJN A;  5CVR A;  4S05 A;  5FLX K;  4TT3 A;  2DOF A;  1YHQ B;  4ZYG A;  1ERD A;  2JJ7 A;  3DP7 A;  1IRG A;  1KYZ A;  3JAM K;  1FY7 A;  1TP4 A;  2FOW A;  5IP9 J;  3W5H A;  1HF2 A;  4A3M J;  1IRX A;  2QCO A;  1H8A C;  2CV2 A;  4HE5 A;  3DTE A;  1XCB A;  5J40 A;  1QGZ A;  1XQB A;  4YEI A;  1V4R A;  4W8Q A;  3AFH A;  4D9J A;  1WZ2 A;  1ETW A;  1RKT A;  3GW2 A;  4ESJ A;  2NXN B;  4M1K A;  4ZYD A;  3LYC A;  2YSR A;  1ON1 A;  4CCJ A;  1E2X A;  1D1C A;  2GBY A;  2XAQ A;  4RAG A;  4Y7N J;  4OZZ A;  1X1A A;  1ZRC A;  4Z03 A;  1HZE A;  2YX4 A;  2UXX A;  1YE9 A;  1OHH A;  3ZQF A;  2FNP A;  2IS1 A;  4HG2 A;  4I0B A;  2EZL A;  2C6Y A;  2H27 A;  4KN4 X;  3KP2 A;  3A8K A;  3KYL A;  1UG0 A;  3WOD F;  1RUN A;  5GV7 A;  3LWF A;  4OIQ F;  3CZ6 A;  4GYI A;  4HPQ A;  1QQI A;  2XKO A;  3DTI A;  4NQW B;  5FD6 A;  5K5Q A;  3SLD A;  4OPW A;  5J4Y A;  1FP1 D;  1F4K A;  4G1B A;  4FWT A;  5M3F J;  3JRC A;  1I27 A;  3B6A A;  2L2O A;  3I53 A;  4LLG F;  5DCM B;  1VZ0 A;  3ES9 A;  2NS7 A;  3V8K A;  2JSC A;  1QVT A;  3K0L A;  4AIJ A;  3CCQ I;  4XNF A;  2H6B A;  3KP5 A;  2VNH A;  1V5E A;  2YWF A;  3M3Y J;  4OIO F;  2KRH A;  4S0H B;  1N25 A;  4Z4W A;  3RKQ A;  2ZSH B;  4DYQ A;  4ENK A;  1SKQ A;  3ROU A;  3K6G A;  5E8G A;  3CMM A;  1A8P A;  5CQG A;  2EIK H;  5FKM A;  1JKR C;  4WWV A;  1QBJ A;  4P6V F;  1QUE A;  2XV4 S;  4HF2 A;  4CCO A;  4WF2 A;  4D7M A;  3SZP A;  2YUS A;  3KE2 A;  4YG2 F;  4CO8 A;  2VKV A;  1S3J A;  3BR1 A;  3GFI A;  1TYX A;  3Q0V A;  2DW4 A;  2ME0 A;  2QMU A;  5E1Z B;  2B63 J;  3HL2 A;  2FVG A;  1BI0 A;  2V26 A;  4E4H A;  3CMA I;  2DPD A;  4JRA C;  1RUO A;  3Q39 A;  1X4O A;  2FNA A;  3ELK A;  4DQK A;  3KEO A;  3VYT B;  3VNV A;  1Z6T A;  1DGW Y;  4BAY A;  2QA4 B;  4P6Y A;  5CQE A;  3ZR8 X;  5F4M A;  3JUR A;  2WWY A;  1G59 A;  3P5J A;  3CDI A;  1W0U A;  3A8J A;  1QGP A;  3SQV A;  2BE5 F;  1XD7 A;  5H59 A;  3C2B A;  2F2E A;  2Y0M A;  2Z1D A;  2ZTN A;  1EA3 A;  2L3D A;  2E1O A;  3P9K A;  2MSY A;  5D8K B;  1P4M A;  1WDT A;  2HMA A;  4QFM A;  3GQA A;  4MHG A;  3W6K B;  2W4S A;  4IOA F;  1V3F A;  5HDG A;  3L9F A;  4H9G A;  1HXD A;  1Z67 A;  3MKZ A;  4URR A;  3OYJ A;  1PLU A;  2M30 A;  2M5W A;  3U2R A;  3ZMD A;  4A0Y A;  1MRZ A;  1TYW A;  2O0Y A;  3HTU A;  2VNK A;  1O8K A;  2M9H A;  3V7S A;  2V4D A;  3TO7 A;  4OOX A;  3A8I A;  3D26 A;  3SKB A;  1U78 A;  4PC6 A;  1K9M D;  2EFQ A;  1IB4 A;  3P4G A;  1ZGW A;  3PSS A;  1OKR A;  4HQM A;  3S2W A;  1Z21 A;  3TO6 A;  5BQT A;  2VBM A;  2A3S A;  2ZME B;  4MTD A;  1J75 A;  3LNN A;  3CCV I;  2MLK A;  3HAG A;  2Z5U A;  4N4O B;  2IS6 A;  2AXT C;  3I64 A;  3OYL A;  3MQ0 A;  5L3D A;  3K4J A;  3HRU A;  1W0K A;  3CD6 B;  1EKE A;  4OJL A;  2AQE A;  4UAJ A;  4U7B A;  3CO7 C;  4YFK F;  5H5J A;  3ABL H;  2INU A;  2X3H A;  3OEH A;  2A69 F;  3LFK A;  4MTE A;  4OIR F;  1TLH B;  4CDG A;  1UD3 A;  2ZZE A;  1R23 A;  1TTT A;  2DA4 A;  3VYS B;  3WTW C;  3K7A J;  2R5Y B;  2CMP A;  3MMY B;  4B48 A;  1LDJ A;  4ZDP A;  2UVE A;  1ZGJ A;  2X6Y A;  4BQO A;  4GGG A;  4G1V A;  2QKM B;  2XNC A;  2L01 A;  3VPR A;  1Y0N A;  2TCT A;  3GEZ A;  2FA5 A;  5JBQ A;  4DGW B;  4OJP A;  3P7N A;  5ILV A;  1R58 A;  1BN8 A;  4P1W A;  3AVV A;  4DZP A;  5C3E J;  3CJQ B;  3ZQC A;  2VFP A;  1TYU A;  4UZF A;  1YJW I;  1F5T A;  3TP0 A;  1YLF A;  4OU0 A;  4PGH A;  2Y30 A;  2DER A;  2NST A;  3DPT A;  5LGT A;  1EXM A;  1TTY A;  1R5O A;  4RD6 A;  3LJY A;  1XSV A;  2F5V A;  4V2G A;  2IT0 A;  1OB0 A;  1BJK A;  5HS7 A;  1KK3 A;  3JSP A;  3C1D A;  5IP7 J;  1IXS B;  4OPS A;  4BQN A;  1A6I A;  2K9M A;  4ON0 A;  3F8F A;  2JSP A;  2L0K A;  1D2E A;  2KFD A;  1UD6 A;  4AYB A;  4D5C A;  3VYR B;  4QVA A;  4U9U A;  4I98 B;  2NVY J;  4XMY A;  4CYC B;  2W82 A;  4MFD A;  1BI1 A;  2EA4 A;  1QFJ A;  2XT4 A;  1O7L A;  4CZZ A;  4KMU X;  3OJX A;  1XSX A;  3BG7 A;  3DBR B;  4EM1 A;  4Q47 A;  2OD5 A;  3H94 A;  3KFW X;  4Z1M A;  2QXZ A;  3QOD A;  4GCV A;  2RGV A;  1XC5 A;  3KPH A;  5GP9 A;  2QYU A;  1KA8 A;  1T0F A;  1SC7 A;  2NPF A;  4GRI A;  4AVZ A;  4ENN A;  2VIX A;  2ZXJ A;  4RAY A;  3LSH A;  2BMW A;  2OTL B;  2CUE A;  3AG1 H;  4WQM A;  1VQ5 B;  3WWG A;  3BR5 A;  4M3E A;  4ZCM A;  1DU0 A;  3IKT A;  1XG1 A;  1YRN A;  3RZO J;  3BH4 A;  1FNC A;  3FXO A;  3CCL B;  3EET A;  2OU2 A;  2WBM A;  1HDD C;  3I4M J;  3S3N A;  3CDH A;  5BS6 A;  2QLZ A;  4IKF A;  3LA7 A;  2E1M B;  1YIT B;  3AVX A;  1Y1V J;  2ELH A;  2V5I A;  2BEO A;  3HKZ N;  3G4S B;  1QZE A;  4XSZ F;  1ZEL A;  2DFH A;  3I9V 2;  3OYG A;  1R5H A;  2DA2 A;  3WU1 B;  1E17 A;  1E3X A;  4F52 A;  4RD2 A;  2VFN A;  3GQ8 A;  2VBW A;  2CK3 A;  1SMY F;  2CW5 A;  3LO8 A;  1KK2 A;  2VXD A;  5F27 A;  4AU7 A;  4E6K G;  4ESF A;  4B09 A;  4YAO A;  4YAF A;  2HKO A;  3QRF F;  1JE8 A;  5E3L A;  1GJR A;  3H3U A;  2OV7 A;  4L9J A;  3CJT B;  1TQI A;  2JPB A;  3MHP A;  2Y9Y A;  3AAF A;  1H9T A;  3BTJ A;  5J8C A;  4NCN A;  3LQQ A;  3SYJ A;  3JRI A;  2JK3 A;  1VQ7 I;  1VQ7 B;  2VPR A;  5HS8 A;  3CW2 A;  3VR6 A;  2CW0 F;  2BGI A;  3WNC A;  4UVB A;  3S32 A;  3DKX A;  3BG5 A;  5FO1 A;  4HYE A;  2RC4 A;  1JTY A;  2XC7 A;  1DP3 A;  1JKP C;  1AIP A;  4LD5 A;  5GAE J;  3R60 A;  1J7K A;  5KSW B;  2RAE A;  3AVU A;  2V9K A;  5K7F A;  1XTA A;  2ISZ A;  2BM6 A;  1PJ5 A;  1RIO H;  2CRG A;  4D7N A;  4A3C J;  4C9Y A;  2RNJ A;  1R22 A;  2ESH A;  3EUK L;  3OYF A;  2ZZG A;  2DQR A;  3BRO A;  1FSE A;  5A2Q K;  3G3Z A;  5HZA A;  3F6O A;  4JX4 A;  4GYG A;  4OJ6 A;  3F23 A;  3F72 A;  3H9Q A;  2MFZ A;  2M1B A;  2DLL A;  2DA3 A;  2V6C A;  3L09 A;  4EQQ A;  4J0Q A;  4JQF A;  2COM A;  2CV0 A;  1U5T B;  1KMH A;  5KVR A;  4A3F J;  2YU9 J;  1BMF A;  1A5J A;  3MD2 A;  2OBR A;  2P4W A;  2HS5 A;  3Q6Q A;  1R6R A;  3ZRG A;  2VON A;  3B6C A;  3CES A;  2O6G E;  4I84 A;  5FO0 A;  3I54 A;  3DKY A;  4S04 A;  2X6X A;  2F3L A;  1QRY A;  3RQI A;  1F60 A;  2C77 A;  3OEE A;  2R7F A;  1GLN A;  1DP7 P;  2OPT A;  3J81 Z;  5FLV A;  2DN0 A;  2X53 S;  4U4B A;  3PEN A;  3PSI A;  1EP1 B;  1J5Y A;  2IGO A;  2ELJ A;  2CFX A;  2FXA A;  2L9V A;  3O8H A;  3J80 K;  1P4W A;  4HLX A;  1EP3 B;  5CVI A;  3BQZ A;  3A4C A;  1QFZ A;  4E7S A;  1E1Q A;  1NBM A;  2VNI A;  3WQZ A;  3C2H A;  1IZ1 A;  4XKV A;  4PAB A;  1WJC A;  2O3F A;  2VQC A;  2HPM A;  1VQ9 I;  3CCR B;  2WZN A;  2JWT A;  1K4Z A;  3LA2 A;  3RSN A;  2R7X A;  1FSH A;  1D0Z A;  1GXQ A;  1ZM3 A;  4Z06 A;  4H0E A;  2FD5 A;  2MLG A;  3CD6 I;  4C43 A;  1X1C A;  4C3H J;  4D5F A;  1BM9 A;  3KZZ A;  3SJZ A;  4Y9U A;  2HYJ A;  2MH9 A;  2FMY A;  4IEJ A;  5EEG A;  2GQF A;  3LOC A;  2HYF A;  3K4C A;  2Z9O A;  1MH4 A;  1IRZ A;  1LDK B;  2DOG A;  3PET A;  3RIQ A;  2XAS A;  5JLV C;  3PFY A;  5EJC A;  5JLX A;  1GR1 A;  5LEK A;  4JP0 A;  1SKY B;  1OLT A;  2X6O A;  2BX6 A;  1GVJ A;  1Y8Q B;  4RD4 A;  3GZ5 A;  3I0T A;  3WTT C;  4EJW A;  3OYA A;  2OZ6 A;  4G7Z F;  1TSP A;  3VWB A;  3N90 A;  3LST A;  3ERE D;  5LGN A;  4Q48 A;  4DNT B;  2IGK A;  5IYP A;  1QG0 A;  4BAC A;  4G6T B;  2V7F A;  2X85 A;  2L9R A;  1LVK A;  3MCA A;  3OR1 C;  4Z4Y A;  3PNV A;  4XID A;  3H1C A;  3E3V A;  3SJP A;  2P7V B;  5AMV A;  4I01 A;  5ICC A;  1VQL I;  4YXW A;  4U7D A;  3K10 A;  4BY7 J;  3TDU C;  4BKX A;  3A1P A;  1QRC A;  3F21 A;  2I8D A;  2FE3 A;  2EFG A;  4XD7 A;  2K9Q A;  2Y9Z A;  2W48 A;  3OYH A;  2F43 A;  3OYI A;  1BW6 A;  1UMQ A;  2R3S A;  4MIM A;  2DTR A;  3E5X A;  4RCY A;  1R1U A;  2ZJ2 A;  5H6Q A;  3RPU A;  3GTM J;  3LQE A;  4NC6 A;  4Q4Z F;  1WSV A;  3G71 B;  2R4G A;  2XZP A;  3VFZ A;  1TWH J;  3BWG A;  3CO6 C;  2M2E A;  2K27 A;  4KA4 A;  3CB4 A;  3FXR A;  4XKW A;  4ZJZ A;  2H1L A;  4AIH A;  3H0D A;  3RTR A;  1BJZ A;  4FIS A;  1TW2 A;  2NYX A;  2R0Q C;  1EFU A;  1GQ8 A;  2ETH A;  2BM5 A;  1T6S A;  1R1T A;  2Q0O A;  1MW7 A;  3RYR A;  5ILU A;  2IRF G;  1I6X A;  4G7H F;  1SEU A;  1K79 A;  1T6Y A;  3DEW A;  3CCE B;  5D8L B;  1WVR A;  3HOS A;  2VOD A;  3C7J A;  1U8B A;  1O3Q A;  3CQZ J;  2RV8 A;  1GVD A;  2GK7 A;  3GRH A;  3I3L A;  3QU6 A;  4F7Z A;  2QWW A;  5HLI A;  1GVH A;  3ASS A;  1RKW A;  3M8J A;  3A02 A;  4Y17 A;  2RQQ A;  3HUG B;  2QA4 I;  1XMA A;  1WOO A;  4GQN A;  2EH3 A;  2B0L A;  1QA6 A;  4AF6 A;  2V1N A;  4RGS A;  1VQM B;  5IY5 H;  3GSI A;  4OP7 A;  3KEQ A;  4IRG A;  2IS4 A;  2HQ5 A;  1R00 A;  2CG4 A;  3FF5 A;  2BGJ A;  2W6I A;  2DTZ A;  2MG4 A;  3L7W A;  3ERM A;  1FNN A;  3CMA B;  1OGM X;  2DI3 A;  5EGO A;  1YS7 A;  1YRN B;  2XB5 A;  3SFI A;  3K4M A;  3FXU A;  4PGO A;  4KN7 X;  1TC3 C;  2LR8 A;  4RM3 A;  3ECH A;  4EEF G;  1UHM A;  3K4L A;  1SAX A;  2ODL A;  1EH6 A;  1N0U A;  3EPZ A;  2XGX A;  3CRZ A;  3H5A A;  2KZV A;  2NOJ B;  1HCR A;  3K2Z A;  4I99 C;  2QQA A;  3PL8 A;  1OPC A;  5FKL A;  1W5C C;  3AKZ A;  3MZH A;  4KKU A;  4RPD A;  2JQ7 A;  2KP6 A;  1MKM A;  4KIC A;  3F22 A;  2GA2 A;  3ZQI A;  2RC5 A;  4BHB A;  4PC1 A;  2WAQ N;  2PBI A;  3CUQ C;  3U6K A;  2BHY A;  4Z4U A;  2IQ7 A;  1KCD A;  5BPD A;  2DA6 A;  3ZXS A;  1PKV A;  3PA2 A;  2QF7 A;  3CPW B;  3MVP A;  4DBR A;  4YFX F;  4ZC3 A;  2CFO A;  2JN6 A;  4FTH A;  4FHT A;  1YLO A;  3W2H A;  3ZZU A;  5FRM A;  1MBG A;  4N3G A;  1FX0 A;  3SDB A;  3OZW A;  3RJP A;  3IUO A;  3ZMS A;  4ANJ A;  3JSO A;  3MN2 A;  3ZBT A;  4Q7J B;  5JLW A;  1V5V A;  5JFR A;  1W87 A;  1HKS A;  3D5L A;  2XVC A;  4YEL A;  1ZHF A;  5HVQ C;  2BW3 A;  4JBA A;  2R93 J;  3MCZ A;  4Z4Z A;  3QP5 A;  2B5O A;  1WJB A;  2JRT A;  1YOV B;  1FND A;  3JX8 A;  2PN6 A;  1T2K A;  3I56 B;  3B73 A;  1N77 A;  2LVS A;  1QA3 A;  2BVL A;  3GLX A;  5IOY A;  4PAA A;  3LL7 A;  3O3K A;  2P3M A;  2XTW A;  4BYY A;  5EDN A;  4U0Y A;  2PI0 A;  2JN9 A;  2YU3 A;  2NTQ A;  3M8E A;  4AID A;  3LSI A;  1NJI D;  5IT9 K;  2KT0 A;  3BJA A;  2PE3 A;  3BH7 B;  2V1D A;  2FQ4 A;  2DFF A;  2D1H A;  2NNN A;  5FJ8 J;  4E7H A;  3ZP5 A;  2NVU B;  4G9Y A;  5E8I A;  3PNY A;  4N0B A;  1O8M A;  2NS0 A;  1CF7 B;  4F3Q A;  3LSK A;  4TKO B;  5THX A;  4E7Z A;  1U2W A;  1Y8R B;  2A05 A;  3SEZ A;  1IXR C;  5D4S A;  5FNZ A;  2QZ8 A;  1JGG A;  2LRD A;  1DDG A;  1JA1 A;  3DV8 A;  1FRN A;  3SEJ A;  2G9W A;  5HOD A;  1N0V C;  3VNU A;  3K9T A;  5J3O A;  3DEU A;  2ZFU A;  2OBP A;  5F04 A;  1FDR A;  2H8R A;  1RI7 A;  2C78 A;  2BSA A;  2IBD A;  3I59 A;  1XS9 A;  2CC2 A;  2WJV A;  1UB9 A;  5HLH A;  1KQ9 A;  2J5O A;  3Q0U A;  2LTP A;  4IX7 A;  2L4M A;  3B82 A;  1ITY A;  1FYM A;  2RKH A;  2PIA A;  3W2F A;  3FK7 A;  3HOV J;  4B3F X;  1KK1 A;  1QPM A;  1S5L C;  1S29 A;  3ONY A;  2XAF A;  2XZL A;  4KIF A;  1OMI A;  2RQP A;  3W3C A;  2ZL6 A;  3LMM A;  4QUZ A;  3RY8 A;  1QRB A;  4LG0 B;  3CLO A;  2W85 A;  3K1N A;  2E2J J;  1QQ1 A;  4RM0 A;  3E6D A;  2HPI A;  2QBY A;  4QPQ A;  1XB2 A;  3ABK H;  2YX7 A;  3LSR A;  3F6V A;  3ZN0 A;  1G7S A;  5DTD A;  4ACB A;  4UHT A;  1K83 J;  1D1A A;  3IP4 B;  1IAW A;  1MMS A;  4TMV A;  1SM4 A;  3SUC A;  4EW9 A;  3HUG A;  2YWG A;  3EQL F;  1KJZ A;  3T9G A;  2BYV E;  4NNJ A;  3IH3 A;  2HDN B;  1IJF A;  1Z6R A;  1VQP B;  1VQP I;  1XG2 A;  1TYV A;  3L00 A;  1Q81 D;  4PC2 A;  1T95 A;  2Z8G A;  2STT A;  1XGO A;  3T51 B;  3CCQ B;  1IDK A;  4EM2 A;  5F0F A;  2BM1 A;  1S8N A;  2L7F P;  2BM0 A;  3G4S I;  1O3R A;  1K7A A;  4RGU A;  1WI9 A;  4EJV A;  3L2W A;  4Y33 A;  1JUP A;  2ZNZ A;  5IYB J;  3V42 A;  4BHC A;  1YW8 A;  2DJN A;  4XON A;  3CMY A;  4M73 A;  4RLF A;  3D5S C;  3FHZ A;  4ZYH A;  3I4P A;  3CF5 F;  3RZD J;  1O3T A;  3E7L A;  1FZP B;  2E1M C;  2PLF A;  3KL9 A;  3CC4 I;  1Q1H A;  4PJM A;  4EGY A;  1YO5 C;  1ZH5 A;  2B0R A;  1MBH A;  2QSH X;  4A3G J;  1I1S A;  2F48 A;  4JYK A;  1IDY A;  1VJS A;  2EK5 A;  3CCJ I;  4P1V A;  2OCE A;  1MSE C;  3S3M A;  2F4N A;  4IHV A;  4M9S A;  4B3A A;  4P2N A;  5L3C A;  2HXO A;  3KEY A;  4N9H A;  3SYT A;  2CQQ A;  1S0U A;  2D2W A;  2CJJ A;  5M5W J;  4YC5 A;  1EP2 B;  3NWT A;  2EIJ H;  3G6E B;  4Z4V A;  1X19 A;  4BBS J;  3LQ6 A;  3BG6 A;  2XF6 A;  2ZJR F;  3MZ8 A;  2FRH A;  1XX5 A;  2JVG A;  3VO2 A;  2DMT A;  2K86 A;  3A01 A;  4L18 B;  3CME B;  4YRV A;  3BTL A;  1KTV A;  3GZ6 A;  3NRV A;  4PGG A;  2NRA C;  2VFO A;  2VBT A;  4A12 A;  4Y52 J;  2Y0S A;  1VLY A;  1YIJ B;  1KZH A;  3ZQ7 A;  3WTU C;  4RB0 A;  3QP6 A;  1JJ8 C;  1IDJ A;  1W7P B;  2ZKZ A;  1BX1 A;  3DQV C;  1V0F A;  3D5R C;  2BSP A;  2ECB A;  2BW3 B;  1IDZ A;  2LY2 A;  2L9S A;  3OL4 A;  4B8X A;  2Y31 A;  4U0W A;  2ZCW A;  2HU9 A;  4EAT A;  3LA3 A;  5J8F A;  1UJ8 A;  2EFN A;  3K4N A;  2XDV A;  3GQ9 A;  1GT0 C;  2EQR A;  4B3X A;  1MZB A;  3WNB A;  4ABZ A;  2PLY A;  3FZV A;  3ASN H;  5FO5 A;  3FMQ A;  4EMS A;  1G3Y A;  3K4K A;  3REO A;  4KKS A;  4PMH A;  4UNO A;  2M4K A;  1IUF A;  1JUM A;  2CUJ A;  2Z99 A;  4ZH4 F;  3IC7 A;  4CSW A;  3HOW J;  3M07 A;  1LLW A;  2BN4 A;  3A1Y A;  4XLF A;  3QOE A;  4I0A A;  5FFZ A;  5TIS C;  1G2H A;  5FIU A;  4IHY A;  1AHD P;  3W6V A;  5HDN A;  3JW4 A;  1WPC A;  3WY9 A;  4O3M A;  2GQQ A;  2XIG A;  3C2G A;  2QN6 A;  2C4T A;  4U88 A;  2PEX A;  4P12 A;  2WA0 A;  5DM6 F;  3JTG A;  4LK1 F;  4MQV A;  5L3B A;  4HRI A;  1UD5 A;  4HE6 A;  1T38 A;  3TW7 A;  2DDA A;  4FCY A;  3OZU A;  1I6H J;  5EEH A;  1BOB A;  2HR3 A;  5EGO B;  1H9G A;  1Y0R A;  1A36 A;  4IQ4 A;  1NG7 A;  1TT0 A;  1W5S A;  5DS9 A;  5IYC J;  1BIB A;  2IXS A;  4XSX F;  3AL0 C;  2DXI A;  3CUQ A;  2DOE A;  2F6C A;  4M3D A;  4NC8 A;  4XIC A;  3ISP A;  1FOX A;  2WB1 N;  1QO0 D;  5D6E A;  2O17 A;  2DU9 A;  4CQJ A;  1YFH A;  1YTY A;  2XGE A;  1B1B A;  4RLZ A;  3GTQ J;  4RDK A;  1TNT A;  1WJA A;  2AO9 A;  2KIM A;  3MMP A;  4OZY A;  2HXI A;  3E1S A;  1DBG A;  3I58 A;  2M7A A;  1W0T A;  5A2Q Z;  3OOC A;  4Q5S F;  3PA1 A;  1PXZ A;  3RIR A;  1P4X A;  2VJ5 A;  4XLC A;  3TO9 A;  2FU4 A;  4G7X A;  3BZ6 A;  1PVE A;  4PFO A;  2Y48 A;  1OCC H;  4JK1 X;  1X0C A;  4YEJ A;  1ODD A;  3NAW A;  1LQ1 A;  1R5I D;  1J59 A;  4X7C A;  4XKB A;  4DYR A;  1ETY A;  3ABM H;  3GVL A;  1BLI A;  1HG8 A;  1SD5 A;  1X1B A;  3K2A A;  3ZZT A;  4F7D A;  1QFY A;  1HLV A;  5FB2 A;  2H1K A;  4C3I J;  5JHF A;  3JRE A;  4MLO A;  2K4B A;  4ZYE A;  5F1J A;  4CYC A;  3EYI A;  1BX0 A;  3HRT A;  2OZU A;  3W6J B;  4E7L A;  3M7G A;  1K78 B;  3K1P A;  1XMK A;  5CVV A;  2Z16 A;  4A93 J;  4DBQ A;  5L3F A;  2XZO A;  2PYG A;  2A07 F;  1D8K A;  1LEA A;  1UZC A;  2GIZ A;  3WBK A;  3E97 A;  3HB9 A;  4ENJ A;  5BMZ A;  1VQK B;  1YI2 I;  4NK8 A;  3RPU D;  2R7Q A;  5EZH A;  2GOX B;  2HOE A;  2BY0 A;  2VBU A;  2WYR A;  2XOK A;  4P9F A;  3SXY A;  3RI4 A;  2LK2 A;  2PJR A;  2EZH A;  2DY1 A;  1YIJ I;  2DIE A;  3GQB A;  2QDX A;  4IRH A;  2JJ1 A;  3D0S A;  4AC0 A;  1NH3 A;  4OAZ A;  1DUX C;  5DNS A;  2CYY A;  5JR3 A;  1WRJ A;  2V7X A;  2WAE A;  2LD5 A;  4W8R A;  4HSR A;  4HNU A;  2ZBV A;  1KCC A;  3GFJ A;  1FBQ A;  4WK8 F;  4KDP A;  3DKW A;  2V7W A;  3LSM A;  1PDN C;  1DDI A;  1COW A;  4RD1 A;  2Q6L A;  1N07 A;  1WHU A;  3EQO A;  4NHJ A;  1R9T J;  1TL8 A;  4A3L J;  2DK5 A;  1P7I A;  1B2R A;  3H09 A;  2NT9 A;  1VQO I;  1E3Z A;  3GTK J;  2FJ1 A;  1JKO C;  2XPU A;  2BY1 A;  4LLN A;  2LYC A;  1HDP A;  2R5Z B;  1ETO A;  1H8E A;  2OK7 A;  4GXO A;  1RC9 A;  2K02 A;  4P9U A;  2VXZ A;  1TVC A;  2OAZ A;  3HGG A;  3OYC A;  2EIL H;  1LFU P;  3A0B C;  1BBY A;  4BE2 A;  3CC2 B;  1LM1 A;  1ZTR A;  2LBF A;  1RES A;  2BZT A;  2MD5 A;  3GWZ A;  3RKY A;  1R4M B;  2FX0 A;  4G7O F;  2HLD A;  1EFC A;  4X8I A;  4R71 A;  1W7P A;  4I76 A;  2M87 A;  5ICF A;  2D9R A;  2BXY A;  2KVO A;  1FBS A;  1DPR A;  5IT9 Z;  1G3T A;  1WFX A;  3T0Y A;  4KJZ A;  1LE8 B;  2K85 A;  1J9I A;  1KD1 D;  2G0Y A;  2KKO A;  1Y56 A;  4P5O A;  2W7Z A;  4DW6 A;  2E7W A;  5A88 A;  2DCU A;  2HQA A;  1CF7 A;  1VND A;  1KK0 A;  2IVM A;  5M5X J;  4RAZ A;  4L5E A;  4L0Z B;  2Q2E A;  2EWN A;  1AMO A;  2H09 A;  2X4H A;  1OGI A;  4YII A;  3K70 C;  3PFI A;  1VF7 A;  2VBK A;  3V76 A;  4P9S A;  1P6R A;  1IW7 F;  1NRK A;  2EFP A;  2W57 A;  2A6E F;  2WC2 A;  3N6Z A;  3MFK A;  4DK0 A;  2D5V A;  1FOW A;  3OR2 C;  5FKK A;  1NK2 P;  2GA1 A;  4IW3 B;  3PUN A;  3VSL A;  2J8K A;  1ENH A;  3IL2 A;  5B66 C;  2MC4 A;  2GLO A;  1VI0 A;  2F1L A;  2JDI A;  3OYB A;  1ZG1 A;  1B72 A;  3U2Q A;  5FLM J;  3LSG A;  1OCP A;  4P96 A;  2OCC H;  4E70 A;  4LBW A;  2Z6B D;  1B6A A;  3HYI A;  5DV5 A;  3QFR A;  2WSS A;  2ZXH A;  2WAF A;  4Y13 A;  2V9P A;  2L7Z A;  3ZQQ A;  2JT1 A;  1QA2 A;  1W4M A;  2DT6 A;  1Y0Y A;  4YHB A;  3QQA A;  3DU5 A;  5D6F A;  3EUH C;  2XRO A;  4HDV A;  1IJW C;  4M3F A;  1H85 A;  4LB5 A;  2ZNY A;  3F3X A;  4PFP A;  2UVF A;  2A5W A;  3M1C A;  4M9X A;  3PSZ A;  1KU3 A;  4XM3 A;  2JVH A;  1TW3 A;  1CGP A;  5EG0 A;  2R92 J;  1VBL A;  4MNU A;  5E79 C;  3M8F A;  5E3N A;  3WXM A;  2DET A;  3UKG A;  1TQP A;  2L4A A;  1NDH A;  2K4J A;  5IPA A;  2LG4 A;  5C4X J;  2HQN A;  1OCZ H;  1BC7 C;  3B4N A;  3DBL B;  1MIJ A;  2F5E A;  5TR9 A;  1V5G A;  5LMZ A;  1R36 A;  1Z7U A;  5HLT A;  1FTT A;  4K1X A;  5FA6 A;  3J7Y J;  3OIP A;  3FPP A;  3BDD A;  3N05 A;  3I56 I;  1HOM A;  3OIO A;  1SFK A;  1QVF B;  4Z4R A;  5DS0 A;  1A04 A;  4LG3 A;  4ZV4 A;  5DCM A;  1ZM9 A;  3ZIA A;  2GOM A;  5HNH A;  1JTX A;  2RDP A;  4IZZ A;  2KZG A;  4PJL A;  4WXC A;  4BE0 A;  5IOZ A;  3GO5 A;  4L9N A;  1JXS A;  2NTB A;  2QTZ A;  1WXR A;  2VN2 A;  4HBL A;  3T56 B;  4B4D A;  3PQK A;  4J19 A;  5BPI A;  2EJR A;  2L7M P;  5E1W A;  2VE8 A;  3MKY B;  3FXJ A;  1AKH A;  1D5V A;  1HKT A;  2CH0 A;  2A5Y B;  2F5C A;  2K9L A;  2FBK A;  2OBT A;  2K3F A;  3WTV C;  1ONV A;  3WHC A;  3PQJ A;  2P5L C;  4O5V A;  2YS9 A;  4A3I J;  4RJL A;  2FML A;  3IH2 A;  4B4C A;  2LFB A;  4BEH A;  4I6Z A;  4KNY A;  5CDF A;  1KRH A;  2E35 A;  2GJP A;  4HEA 2;  1BI2 A;  3O8G A;  4OAY A;  4HNT A;  1ZRF A;  3S2H J;  3GQ7 A;  4L5J A;  1F36 A;  1O8G A;  2W1O A;  4OMZ A;  1Y0U A;  2KIQ A;  1FRQ A;  3GZN B;  1XN7 A;  2ZTG A;  2XGC A;  3FKI J;  4DK1 A;  3DLA A;  5LLQ A;  5F0C A;  3BCD A;  4OOV A;  3I1F A;  4C0S A;  1XGS A;  4X6A J;  4YZA A;  1A6Q A;  2HCJ B;  1MJ9 A;  4DOZ A;  2GPJ A;  1KON A;  1S7E A;  4WXD A;  2Q8K A;  3LAJ A;  2BV3 A;  4M2L A;  3CCM I;  1Q86 D;  3CCL I;  2J8I A;  4YIF A;  4MGR A;  2Q1Z B;  3CUQ B;  3TOB A;  4BJ6 C;  1IB0 A;  4FE4 A;  1OCR H;  3VB2 A;  4Z2Y A;  1Y1W J;  2C5H A;  1IN6 A;  4W8S A;  1SVO A;  1NTC A;  4GDF A;  2E7X A;  1WI3 A;  2WPD A;  5IYQ A;  3FKJ A;  2KMU A;  2OF7 A;  3ZPP A;  4M71 A;  4J01 A;  1QUF A;  2M0C A;  1T56 A;  3F0C A;  1UAA A;  4M4S A;  4BQQ A;  4QIW N;  5GAG J;  3ZSC A;  1QH0 A;  3KP3 A;  3KLO A;  2VLA A;  4IHT A;  3ZN1 A;  2CO5 A;  4Y4R A;  1CNE A;  1QX4 A;  1VQ4 I;  2CBX A;  1RR7 A;  3U9G A;  2LC2 A;  1XSD A;  1BHE A;  1G3S A;  4XOT A;  4A3K J;  4UZU A;  4QV2 A;  4CCK A;  3RKW A;  1QVG B;  1K78 A;  5F6F A;  2R7R A;  4DQ2 A;  4AC9 A;  2HYG D;  2FOK A;  1ZG3 A;  4E7I A;  2D45 A;  2F5D A;  4UV8 A;  2PMH A;  4UVA A;  4OOS A;  5JMC B;  3R6K A;  3ZC3 A;  5K7H A;  3LNQ A;  3E6B A;  3ZMT A;  3J80 Z;  1KC8 D;  2BBY A;  3TMO A;  2FEZ A;  4HW0 A;  2E5Z A;  3JAM Z;  2CF4 A;  2VBV A;  3K1M A;  4XN3 A;  4Y7C A;  4Z05 A;  1FLI A;  3G2B A;  4XLH A;  3SFZ A;  5D4R A;  3J81 K;  4D1Q A;  3AVW A;  3JRB A;  1W1W E;  5FLX Z;  1AIR A;  1EH8 A;  3T8R A;  1RMG A;  1YX3 A;  2VJJ A;  5FRO A;  4X0G A;  2DMU A;  2VJI A;  3GVK A;  3HPG A;  1WCM J;  5CVJ A;  2E1B A;  2Y69 H;  1S4M A;  1OFL A;  1KU2 A;  1OYY A;  4QPO A;  2HZT A;  4L9T A;  3IV5 A;  1ZKG A;  2VAS A;  4MO7 A;  4TN1 A;  5CLS A;  3ZUG A;  5C44 J;  4HV6 A;  3TH0 A;  2X1D A;  2LH9 A;  1TZL A;  2DK8 A;  4IF4 A;  1ETV A;  2IGN A;  3ZMZ A;  4CCM A;  1N78 A;  3BR0 A;  4W8T A;  4TMZ A;  1O8E A;  3GME A;  3F8B A;  3R0J A;  4D0P A;  2TRT A;  4BU2 A;  1PUF A;  2O04 A;  4IPA A;  1Z05 A;  3ABU A;  2JUG A;  3S3O A;  1L0O C;  1ZQ3 P;  4TV7 A;  3HZJ A;  3KYC B;  1MND A;  4L8J A;  3BT9 A;  1IUY A;  1UCR A;  1HVX A;  2MBF A;  2GJR A;  4OJ5 A;  3PUM A;  2KLO A;  4RGR A;  3W2V A;  3OV8 A;  5E3M A;  1CNF A;  3LQR A;  4FT8 A;  2XUB A;  5LHI A;  1HST A;  2DYS H;  2QUF A;  4E7J A;  4A3E J;  2EIX A;  4IQJ A;  2X51 A;  2NSP A;  3VYU B;  2V7Q A;  1WH7 A;  3I55 I;  5IYD J;  1I39 A;  2A6H F;  2AS5 F;  4K2E A;  4IO9 F;  4NBS A;  4YAU A;  3WU0 A;  4A0Z A;  4JOM A;  4M6V A;  5J1R A;  1B8I B;  3J81 k;  3BQJ A;  4PSX A;  3PIO F;  3AGP A;  3LMW A;  3MEX A;  2UZK A;  5B3S H;  3VMV A;  4PC7 A;  3GFL A;  1KTW A;  1E79 A;  5D5U B;  2LKP A;  2ELK A;  2ZSI B;  2W7N A;  3V7C A;  2R7Z J;  1UEL B;  2F4M B;  4BNC A;  2P81 A;  1A31 A;  3QPT A;  4CGZ A;  4M74 A;  3FBI B;  3T8T A;  1VF9 A;  5FL7 A;  1BR1 A;  2D3L A;  2V79 A;  3KZI C;  1QU3 A;  2QX3 A;  2V1U A;  2HGC A;  5KK1 A;  1MBK A;  4GFB A;  1J09 A;  1CLW A;  1HF0 A;  1O7F A;  1B72 B;  1R4N B;  1ZN2 A;  4C2L A;  4UUS B;  3D1N I;  1JHH A;  1REP C;  3NE5 B;  1QZY A;  1YS6 A;  2ZJP F;  2GZW A;  1N8R D;  4RBO A;  3OJW A;  1RWR A;  4V02 C;  4KIG A;  3U1D A;  5B1A H;  3BY6 A;  4IHX A;  1W36 D;  4I02 A;  4W1U A;  1UHS A;  1OFM A;  3TBI A;  1JB9 A;  2DT5 A;  1L3L A;  3OOU A;  3HHH A;  1QJV A;  2BF4 A;  2HVQ A;  1SFO J;  1QGY A;  4MYU A;  4GO1 A;  2OA4 A;  4OPV A;  1BC8 C;  4BDY A;  3H9J A;  4QSH A;  1T33 A;  3G71 I;  3ZQL A;  3LSP A;  3A01 B;  4MYT A;  4RPB A;  2H94 A;  3S1R J;  4RGX A;  3CP2 A;  4EH1 A;  1WGX A;  3G1O A;  3KZY A;  1WTH D;  1VHO A;  4RB2 C;  1ETK A;  1OR7 A;  4E7K A;  1PJ6 A;  2QEX B;  2VKH A;  1ZLK A;  3IAM 2;  1Z1D A;  2O1D A;  2CU7 A;  2L9N A;  3ISX A;  3OIQ A;  5E20 A;  3ZQG A;  3BCB A;  5KW9 A;  4LMY A;  2B7C A;  2OC6 A;  3BC9 A;  3CPX A;  2M7B A;  5TY0 A;  1I5Z A;  3HJE A;  1RNL A;  1E63 A;  4OJO A;  4IXA A;  3EYY A;  1MBJ A;  2E2H J;  1QHH D;  4ESB A;  1H42 A;  3CCU B;  1DDN A;  5E3O A;  1ELO A;  2X6W A;  3R6J A;  1SD4 A;  1SMT A;  4A3D J;  2JTV A;  3ASO H;  1FOY A;  1IGN A;  2ECC A;  2R5Z A;  1Z3Y A;  1RZ4 A;  5TRD A;  4I2O A;  1I1G A;  2W24 A;  1SAU A;  3K69 A;  4BGD A;  3WGI A;  1IV6 A;  4ZDL A;  2LP0 A;  2M34 A;  3OAA A;  5EMN A;  3B8H A;  2OTJ B;  2EIN H;  4KUM A;  1ZAO A;  3TL4 X;  1U8R A;  1FTZ A;  3ZZ0 A;  2J5P A;  3SDG A;  5HS9 A;  1EE6 A;  4EGZ A;  1UD8 A;  1BQE A;  4X05 A;  3V7A A;  4DNC A;  4Z6Y A;  4HDU A;  2QM3 A;  1VQM I;  3OFN A;  4YZQ A;  4KIB A;  3E0J B;  5IYR A;  1U6G A;  2GAU A;  1G7T A;  1YG2 A;  3G1M A;  4ENM A;  4LK0 F;  2OUM A;  2IPQ X;  2X1C A;  1G8X A;  2X48 A;  3FMR A;  3DDY A;  1EH7 A;  5IYN A;  2MGQ A;  1WMR A;  2G7H A;  3BTI A;  2I10 A;  3PSF A;  2Q6I A;  1JTA A;  1X58 A;  2W00 A;  3DWL E;  1IG7 A;  1X2M A;  2CW8 A;  4LBV A;  4P3I A;  3HSF A;  3RKX A;  1WH5 A;  4N4N B;  2A6T A;  4EJO A;  3HG9 A;  3H0G J;  3GCM A;  4RD3 A;  1B8I A;  2GWR A;  2GXB A;  1CZF A;  3IWZ A;  2PMZ A;  1HQC A;  1J2X A;  3COA C;  2MH2 A;  2ZXW H;  3PIP F;  2QGG A;  5J4V A;  1NK3 P;  1VQ4 B;  4MR0 A;  4LG0 A;  1TWC J;  1AA7 A;  2P8T A;  2YUH A;  3FDY A;  1Z9C A;  1K61 A;  2COB A;  1QVU A;  1ULY A;  2O03 A;  2JA5 J;  2UXN A;  2EB7 A;  2R6H A;  3W2W A;  1ZRE A;  1G7C A;  2VZL A;  3AVY A;  2WV1 A;  1XCV A;  2HQR A;  1K6Y A;  5LRS A;  2VQL A;  1C0W A;  4RS8 A;  3W5U A;  1S7A A;  1YIO A;  1U5T C;  1W0J A;  3I59 B;  4OWR B;  3K4B A;  5K5R A;  2DPU A;  1GXP A;  2R7V A;  3ZQH A;  2EV6 A;  1YX5 A;  2IAI A;  4MEY F;  1Q7Y D;  3Q0W A;  3WYA A;  2XAH A;  2XGD A;  2BM7 A;  1RPW A;  2ZJQ F;  5CKT A;  1X4P A;  1SD7 A;  4IVN A;  1AKH B;  2ZBK A;  1R5N A;  2OYN A;  4BY1 J;  4DQL A;  3Q3S A;  4M6X A;  4HF1 A;  2YPR A;  4OIN F;  4G5G A;  3MKW B;  2UWM A;  3TED A;  2VC0 A;  1MH3 A;  1OIS A;  4MXN A;  5ICE A;  1X3W B;  4X1E A;  1GUU A;  3S1M J;  3E1Y E;  4LGW A;  4ACA A;  5HKK A;  1W2B B;  1ZG5 A;  1T08 B;  2DT7 B;  3TDZ C;  1RQP A;  4MQ9 F;  2AXL A;  2PMU A;  2E1R A;  3JU4 A;  1J0R A;  4Y9R A;  2JA6 J;  3FWE A;  4KMF A;  2EV0 A;  4XLE A;  2QYO A;  2VBY A;  1LPQ A;  1DAR A;  2B7B A;  1O3S A;  4BBR J;  1EF4 A;  2DO7 A;  3P27 A;  1ZRD A;  3W2E A;  4HZF A;  3P9C A;  1USS A;  2XSJ C;  5LEJ A;  3GFM A;  2WZP P;  4YFN F;  4XLN F;  3HOY J;  1M1K D;  3SZG A;  5HLG A;  1VQ8 I;  3GTJ J;  3CCY A;  4XK4 A;  2JUC A;  5EG0 B;  1AOY A;  4UUT A;  2JPC A;  1ZYR F;  2DJI A;  3KLN A;  5E1X A;  2YR2 A;  5DCF A;  3PUF A;  1O8H A;  2EZK A;  3QPH A;  3H3V K;  3O6B B;  2DMN A;  3QOP A;  2KRF A;  1P4A A;  2FBI A;  1B9N A;  4KT5 C;  1NG6 A;  2M8E A;  4OMY A;  1WJF A;  3DPL C;  4LOC A;  3OSF A;  1E3H A;  5E18 F;  1SFX A;  3FK6 A;  4RB1 A;  3ECO A;  1MMG A;  3ZOB A;  1EZG A;  3S1N J;  1PP7 U;  4O6J A;  5L3E A;  5CVU A;  4A69 C;  3BC8 A;  4BXF A;  1M90 D;  3GYH X;  2GIV A;  3E6M A;  3VDX A;  3UR3 C;  2BVN A;  2BM4 A;  5H6R A;  5GV8 A;  5JVG F;  2VKE A;  2LF7 A;  3HPH A;  1D5Y A;  2BPO A;  1V5F A;  2B7E A;  3ZCO A;  1NB9 A;  1MDM B;  3QSY A;  2ZME C;  1PUF B;  2QBY B;  1E3P A;  2R7U A;  1T5E A;  3O2P E;  5GPA A;  2X0K A;  5IK2 A;  3IHU A;  3L2Q A;  3G6E I;  1I18 A;  2L54 A;  4M3G A;  1KQ5 A;  1LFP A;  4R1H A;  3HOU J;  2R5Y A;  4A5M A;  1LB2 A;  1MJA A;  1AU7 A;  1SFE A;  3OYD A;  1ETQ A;  1PJ7 A;  1QHG A;  2K5C A;  1VQK I;  2O7O A;  2QE7 A;  3IRR A;  3DF8 A;  2GM4 A;  4X06 A;  3BLY A;  4M9Z A;  2VFM A;  5EF6 A;  2V31 A;  2YWE A;  2CSO A;  3V7R A;  4EV0 A;  2E19 A;  4RM2 A;  4X0C A;  3MZY A;  4CXF A;  1TNS A;  2QEX I;  3WBJ A;  3FXM A;  1ZGA A;  1K8F A;  2O9L A;  3PJR A;  1H80 A;  2VFQ A;  3NB2 A;  2JA2 A;  2BXZ A;  4RDU A;  3NWS A;  1BOA A;  2ADU A;  3WGH A;  3IRQ A;  1AWC A;  1JJ6 C;  2HOA A;  2F5F A;  4AF7 A;  3HKZ A;  2PJP A;  2HTJ A;  4CH7 A;  2V6E A;  2DMP A;  5M3M J;  1VQ5 I;  2FUG 2;  2NNY A;  5FRN A;  2KRC A;  1DGR M;  3OW7 A;  1XE1 A;  3MWM A;  5H20 A;  3L2V A;  1VQ6 B;  3H9G A;  4G7W A;  5ERI A;  3QU3 A;  1MMA A;  3GTG J;  4ROX A;  2QZA A;  3TOA A;  1VQN I;  1GDT A;  3BTC A;  3AK5 A;  2F4I A;  1GV2 A;  4X7F A;  1SVL A;  3B90 A;  2JRM A;  4UB6 C;  3OY9 A;  3GBG A;  2ID3 A;  2ZXI A;  1KYW A;  2EZI A;  1UHW A;  3FX3 A;  4ASN A;  2WR8 A;  1QCX A;  2HWV A;  2OQG A;  1FC3 A;  4ETS A;  4B47 A;  2XGJ A;  1X1D A;  4A5N A;  2RNG A;  2MW8 A;  1VQN B;  2BGC A;  3HOZ J;  1JI8 A;  3I4N J;  3JCU C;  1D0Y A;  2O61 A;  1MAB A;  3I5U A;  4QLC U;  4XLP F;  3CCM B;  2WY7 Q;  1K4T A;  3P9I A;  3BZK A;  1OJL A;  5GAH J;  5LFA A;  1JRG A;  1G6N A;  1P92 A;  2DBB A;  3WE2 A;  1I3Q J;  3SJM A;  2XC1 A;  2PJR B;  2BVM A;  1JUS A;  1YJW B;  4P22 A;  3AVT A;  3KIO A;  4LFU A;  5ILS A;  1XGN A;  2ZL5 A;  2PFB A;  2XB0 X;  3QE2 A;  5BSX A;  3QYB A;  1FWZ A;  3BJO A;  2NVX J;  3NEU A;  3DU1 X;  4NBQ A;  5J6X A;  2ID6 A;  2DFE A;  4A6D A;  2HDD A;  2RRE A;  3KX2 A;  3AL0 B;  1ZM2 A;  5TV2 A;  1FPQ A;  2JMW A;  2X1E A;  5JI6 A;  4N9I A;  2JIZ A;  1E0E A;  1VQO B;  1OFD A;  2LDU A;  1MGT A;  4XN0 A;  5TJJ A;  3JQP A;  2R7T A;  2EV5 A;  1G7R A;  3GIR A;  4FE7 A;  5LD2 C;  4HA8 A;  4A3J J;  2IP2 A;  2CGP A;  2V7T A;  4WX9 A;  1T8I A;  1TQM A;  2CW7 A;  1T98 A;  2K3P A;  4HOB A;  2XF5 A;  4HX7 A;  3TW6 A;  1WSU A;  2XEX A;  3BQY A;  2ZL7 A;  4WWC A;  3GVA A;  1XDS A;  1VQ6 I;  2ZBU A;  5EYR A;  3E6C C;  3WE3 A;  4JX5 A;  1VHE A;  3S8P A;  2STW A;  1E1R A;  2QTL A;  1UG2 A;  2EFO A;  4J00 A;  5EEA A;  1E62 A;  5D5W B;  3KET A;  2W6J A;  3J7A O;  1UD4 A;  4LIT A;  1W9X A;  4TMW A;  3BPX A;  2QGU A;  1Z7L A;  4WZL A;  5AIP A;  3WTZ A;  2D1V A;  3H3Z A;  5K5O A;  4FX4 A;  4FET A;  3DPU A;  3U1K A;  2OTJ I;  3E20 A;  4ZCI A;  1W36 C;  3ULQ B;  1EJ9 A;  3DCF A;  2HTS A;  4KT6 A;  4IHW A;  3W2I A;  2Z3Y A;  1YQA A;  1CQX A;  3GTP J;  1EV7 A;  1XGM A;  2WAQ A;  1I8D A;  1L1I A;  3UNG C;  4C2U A;  2IA1 A;  3BCA A;  1X2N A;  3BZC A;  4CCN A;  2XRL A;  1MNM C;  2X3U A;  1LJ9 A;  2XF7 A;  4DZJ A;  2BOL A;  2EIM H;  1ETX A;  2M4G A; 
#chains in the Genus database with same CATH homology
 2R7W A;  3HOS A;  2VJ4 A;  4BEH A;  5CDF A;  3RQ4 A;  1OR7 C;  2GK7 A;  1V0E A;  3GRH A;  2GJP A;  4HEA 2;  3I3L A;  2KDO A;  4OAY A;  4HNT A;  1LKX A;  3GQ7 A;  3M8J A;  4KIS A;  2RQQ A;  3HUG B;  5HNF A;  4GQN A;  1O8G A;  2W1O A;  2V1N A;  5C1E A;  2M5S A;  3OE7 A;  3OYK A;  2ZTG A;  4DK1 A;  3DLA A;  2IS4 A;  2W6I A;  3BCD A;  3OYE A;  2HDW A;  3W2A A;  4PJJ A;  2WAD A;  4YZA A;  2P0W A;  3OMY A;  1OGM X;  3S93 A;  4DOZ A;  3K4M A;  1E43 A;  1KON A;  3F9K A;  4RM3 A;  2VQG A;  1KZL A;  2Q1Z B;  4BJ6 C;  3K4L A;  1Y6I A;  2ODL A;  2GK6 A;  2PEC A;  3EPZ A;  4W8S A;  3H5A A;  2KZV A;  2M3A A;  2NOJ B;  2WPD A;  3DEE A;  3FKJ A;  2KMU A;  3H35 A;  3PL8 A;  4XL9 A;  3AKZ A;  4KKU A;  5C1C A;  3RCO A;  3FY3 A;  3ZPP A;  2KP6 A;  1WJ5 A;  4BS9 A;  2QKL B;  4R79 A;  4J01 A;  1UAA A;  4BQQ A;  2IQ7 A;  1KCD A;  1O8J A;  3ZSC A;  3A35 A;  3ZXS A;  1PKV A;  4DBR A;  2KL4 A;  2VKD A;  4ZC3 A;  2VLA A;  2CFO A;  3CF2 A;  3CJR B;  4Y4R A;  4HIZ A;  2R7S A;  1BHE A;  2LC2 A;  5FRM A;  4BJ5 C;  4XOT A;  1FX0 A;  4UZU A;  5DN6 A;  3SDB A;  3IAS 2;  3IUO A;  4CCK A;  4ANJ A;  1MNE A;  2R7R A;  2WJY A;  1PE9 A;  1OOC A;  3H5N A;  4E7I A;  2Z2S B;  4B43 A;  3D5L A;  2KQR A;  4YEL A;  2Q2E B;  5HVQ C;  4RLQ A;  1H8H A;  5HOO A;  2BW3 A;  1EFR A;  3PNT A;  3TMO A;  4XOP A;  1WJB A;  2E5Z A;  4DNR B;  4XN3 A;  2MAB A;  4E0F A;  4Z05 A;  3EUA A;  3G2B A;  1N77 A;  2LZJ A;  4XLH A;  2BVL A;  4D1Q A;  3B8Y A;  2LY1 A;  3LL7 A;  2IS2 A;  1AIR A;  4CCL A;  1MMN A;  1RMG A;  1D0X A;  1YX3 A;  2VJJ A;  5FRO A;  4X0G A;  2CUZ A;  2VJI A;  4BDZ A;  3GVK A;  2NTQ A;  3HPG A;  2QY1 A;  3UW0 A;  1O8I A;  2E1B A;  4PJN A;  1OFL A;  3LSI A;  4QPO A;  4TT3 A;  2KHM A;  2VAS A;  1ERD A;  4E7H A;  2X1D A;  2LH9 A;  1TZL A;  3VSV A;  3PNY A;  4BUP A;  2IGN A;  4CCM A;  1O8M A;  1N78 A;  1IRX A;  4F3Q A;  4W8T A;  2HZD A;  3LSK A;  2CV2 A;  4TKO B;  1N75 A;  4II2 A;  4E7Z A;  1O8E A;  3DTE A;  1BPL A;  3OFN A;  4BU2 A;  1FMV A;  3SEZ A;  2O04 A;  4W8Q A;  2D3N A;  2LRD A;  2JUG A;  3AFH A;  4D9J A;  3S3O A;  1RU4 A;  2ZFU A;  4Y3O A;  1MND A;  4L8J A;  1HVX A;  5KCM A;  4CCJ A;  2GJR A;  4OJ5 A;  1D1C A;  2KLO A;  2WJV A;  3W2V A;  4OZZ A;  4Z03 A;  1X1A A;  4IX7 A;  1HZE A;  4ZDO A;  2VQH A;  4E7J A;  3FHN A;  4B3F X;  4IQJ A;  2X51 A;  1OHH A;  1YE9 A;  4KKT A;  2NSP A;  3HC7 A;  3VYU B;  2V7Q A;  3L2U A;  2IS1 A;  4HG2 A;  2XZL A;  3W3C A;  4JOM A;  4U87 A;  3LMM A;  4U49 A;  3KYL A;  1UG0 A;  4PSX A;  3LMW A;  3CZ6 A;  3VMV A;  4HPQ A;  4NQW B;  3DTI A;  1KTW A;  2HPI A;  1O88 A;  1E79 A;  4QPQ A;  2ZSI B;  2W7N A;  2R9V A;  1UEL B;  1D1A A;  2L2O A;  4B44 A;  1VZ0 A;  3IP4 B;  3FBI B;  1WJD A;  5FL7 A;  2PYH A;  4XNF A;  1BR1 A;  2D3L A;  3OL3 A;  1V5E A;  2EWE A;  4EW9 A;  2KRH A;  1QU3 A;  3T9G A;  4NNJ A;  2QX3 A;  4C30 A;  1J09 A;  2ZSH B;  1XG2 A;  2DOA A;  2VPL A;  4C2L A;  3K6G A;  3CMM A;  4F55 A;  5CQG A;  3NE5 B;  1T95 A;  2Z8G A;  3T51 B;  1RWR A;  4CCO A;  1IDK A;  2INV A;  1BR4 A;  1W36 D;  2O0V A;  1WJE A;  1OFM A;  3TBI A;  3L2W A;  3OOU A;  1QJV A;  4Y33 A;  2HVQ A;  3V42 A;  4F92 B;  4BDY A;  3OWT A;  3H9J A;  4XON A;  3ZGK A;  3VSK A;  4RLF A;  3D5S C;  3HL2 A;  2E1M C;  2V26 A;  4E4H A;  3CP2 A;  3T53 B;  1WTH D;  1X4O A;  4PJM A;  4PSW A;  4E7K A;  3VYT B;  2VKH A;  1DGW Y;  4H4K C;  3IAM 2;  2O1D A;  5CQE A;  2L9N A;  3ZR8 X;  3OIQ A;  5KHD A;  3JUR A;  3BCB A;  1G59 A;  3QYE A;  1VJS A;  2OC6 A;  3BC9 A;  2M7B A;  3OS1 A;  4OJO A;  4XLA A;  3S3M A;  2Z1D A;  2ZTN A;  1EA3 A;  1QHH D;  3VMW A;  3KEY A;  2X6W A;  3SYT A;  3GQA A;  3NWT A;  2O0W A;  2W4S A;  4XR6 A;  4TSF A;  1X19 A;  3FBN B;  3BG6 A;  2XF6 A;  4LIV A;  1Z3Y A;  2JVG A;  3MKZ A;  2VBE A;  4URR A;  3OYJ A;  1PLU A;  4YRV A;  3ZPN A;  3DTK A;  4XQF A;  1O8K A;  1SAU A;  4BGD A;  2V4D A;  4ZDL A;  2Y0S A;  1BR2 A;  3OAA A;  2CS3 A;  1VLY A;  1IB4 A;  3TL4 X;  3FKS A;  1IDJ A;  1Z21 A;  4CA0 A;  3U21 A;  2VBM A;  1EE6 A;  3LNN A;  4B3G A;  3DQV C;  1UD8 A;  3HAG A;  1V0F A;  3D5R C;  4N4O B;  2IS6 A;  2ZZF A;  2BSP A;  2BW3 B;  3HXL A;  2LY2 A;  4CUG A;  3OYL A;  2L9S A;  3OL4 A;  3E0J B;  4EAT A;  1D1B A;  3K4J A;  2HU9 A;  1WP6 A;  2O5R A;  4YZQ A;  1W0K A;  3K4N A;  2XDV A;  2HVR A;  3GQ9 A;  4OJL A;  2AQE A;  2OUM A;  1DQU A;  2X1C A;  1G8X A;  4PUS A;  4U7B A;  2NZM A;  4B3X A;  3DU6 A;  3DDY A;  2INU A;  1WMR A;  2X3H A;  3OEH A;  3PSF A;  3K70 D;  4KIT B;  3OS0 A;  1JTA A;  2W00 A;  4KKS A;  3K4K A;  3DWL E;  4PMH A;  2CW8 A;  1UD3 A;  2ZZE A;  2M4K A;  3VYS B;  2CUJ A;  5KNL A;  2CMP A;  3MMY B;  2A6T A;  4N4N B;  4ZDP A;  3HG9 A;  2X6Y A;  4B48 A;  4BQO A;  4C2T A;  4CSW A;  1CZF A;  2QKM B;  1O8L A;  2HNH A;  2PMZ A;  3OYM A;  4MR0 A;  3A1Y A;  4XLF A;  3J7A Y;  3QOE A;  1O8D A;  1AA7 A;  4DGW B;  3FDY A;  4OJP A;  1BN8 A;  4P1W A;  4NUB A;  2XAU A;  1WPC A;  3CJQ B;  3W2W A;  4BL0 B;  3C2G A;  2WA0 A;  1K6Y A;  4DIQ A;  1UD5 A;  2NST A;  3DPT A;  4HRI A;  2VQL A;  4ZTF A;  1W0J A;  4OWR B;  2F5V A;  3K4B A;  2R7V A;  3ONQ A;  1YX5 A;  1BOB A;  2X8K A;  3G05 A;  1OB0 A;  4IQ4 A;  1NG7 A;  1TT0 A;  3A3B A;  5CKT A;  1X4P A;  4BQN A;  2K9M A;  2IXS A;  3AL0 C;  3A3G A;  2DXI A;  4NC8 A;  2F6C A;  2JSP A;  2F1M A;  1UD6 A;  4YZX A;  4AYB A;  3VYR B;  3MKW B;  2UWM A;  2O17 A;  4XMY A;  4MXN A;  2W82 A;  5HKK A;  2DT7 B;  3SUC A;  3BG7 A;  4FAS D;  4Z1M A;  1P9Q C;  1WJA A;  3H94 A;  4ASU A;  2QXZ A;  4NK6 A;  4OZY A;  3QOD A;  3JU4 A;  3E1S A;  5TGT A;  2XND A;  1DBG A;  4RMN A;  2M7A A;  2V4J C;  3OOC A;  1PXZ A;  4GRI A;  4AVZ A;  4XLE A;  2VIX A;  2VJ5 A;  3LSH A;  4XLC A;  2NTP A;  3BCF A;  3WWG A;  4G7X A;  4PFO A;  3BH4 A;  1X0C A;  2XSJ C;  4YEJ A;  2WBM A;  3S3N A;  2WZP P;  4XKB A;  3SZG A;  3GVL A;  1BLI A;  3HOT A;  1HG8 A;  4IKF A;  1X1B A;  1FMW A;  2E1M B;  4ZYA A;  2E5N A;  5JHF A;  4MLO A;  2DJI A;  1PJR A;  4E7L A;  1O8H A;  1ZEL A;  3I9V 2;  3OYG A;  2XZO A;  2Z16 A;  1E3X A;  4DBQ A;  4F52 A;  3GQ8 A;  2PYG A;  2CK3 A;  1UD2 A;  2VXD A;  1NG6 A;  4AU7 A;  4E6K G;  1WJF A;  3DPL C;  4NK8 A;  3EQN A;  3RPU D;  2R7Q A;  2GOX B;  1K5C A;  2XOK A;  1MMG A;  1OGO X;  4BEH B;  4F93 B;  2PJR A;  3GQB A;  4ZTJ A;  2OV7 A;  2DIE A;  4NC7 A;  3BC8 A;  4BXF A;  3SEQ A;  2JJ1 A;  3VDX A;  5CPR B;  2VL8 A;  4OAZ A;  3UR3 C;  2WB1 A;  2E60 A;  3HPH A;  2WAE A;  1V5F A;  3ZCO A;  3VR6 A;  4HSR A;  4HNU A;  4W8R A;  1KCC A;  2R7U A;  3S32 A;  1T5E A;  5IK2 A;  3DKX A;  2UVE A;  3LSM A;  1S9H A;  2UUZ A;  2XC7 A;  4HST A;  3L2Q A;  1DP3 A;  4BJT A;  1COW A;  2LRE A;  1I18 A;  1LFP A;  2V9K A;  3EQO A;  2MD0 A;  2NT9 A;  3OYD A;  1E3Z A;  1QHG A;  2HVS A;  2K5C A;  1PYV A;  4C9Y A;  2QE7 A;  3BLY A;  3EUK L;  3OYF A;  2LYC A;  2ZZG A;  4LIU A;  1H8E A;  2UV1 A;  2V31 A;  3LFU A;  4II3 A;  2VXZ A;  4RM2 A;  4OJ6 A;  3VSU A;  2MFZ A;  3H9Q A;  2VB6 A;  2MYS A;  4JQF A;  3OYC A;  2CV0 A;  1T0F C;  3PJR A;  4BE2 A;  4ITV A;  2JA2 A;  2LBF A;  1KMH A;  1H80 A;  3NWS A;  4XKC A;  1BMF A;  2L7K A;  3MD2 A;  2HLD A;  3HKZ A;  1R6R A;  4CH7 A;  3ZRG A;  2V6E A;  3PUB A;  2KVO A;  3CES A;  4I84 A;  2FUG 2;  1WFX A;  5FRN A;  3DKY A;  4KJZ A;  2KRC A;  2X6X A;  1DGR M;  1Y56 A;  4P5O A;  3OW7 A;  3OEE A;  1U0J A;  3L2V A;  1GLN A;  2HQA A;  3H9G A;  1Z3X A;  4G7W A;  1MMA A;  2X53 S;  4XOR A;  4U4B A;  1O8F A;  2F4I A;  3PSI A;  3B90 A;  2IGO A;  3GBG A;  2ZXI A;  3OY9 A;  2ELJ A;  3K70 C;  1VF7 A;  3L2R A;  1QCX A;  2VBK A;  4HWV A;  4BE1 A;  3OS2 A;  4B47 A;  1NRK A;  2XGJ A;  1X1D A;  3A4C A;  4F91 B;  4E7S A;  2RNG A;  1E1Q A;  1NBM A;  4DK0 A;  3WQZ A;  3C2H A;  4XKV A;  1JI8 A;  1WJC A;  1D0Y A;  3OR2 C;  3KRG A;  2VQC A;  2HPM A;  1MAB A;  3VSL A;  4G6I A;  1K28 D;  2WY8 Q;  2MC4 A;  2WY7 Q;  2JDI A;  3RSN A;  3OYB A;  2R7X A;  1D0Z A;  4Z06 A;  3QYF A;  3LSG A;  3CP8 A;  1X1C A;  2Z6B D;  5LFA A;  1JRG A;  4CZC A;  3K4C A;  2WSS A;  2ZXH A;  2BVM A;  2WAF A;  2PJR B;  4P22 A;  2M4G A;  2IGM A;  1LDK B;  2CV1 A;  3ZQQ A;  2ZZQ A;  2DT6 A;  2R7O A;  3PFY A;  3DU5 A;  3EUH C;  3QYB A;  1SKY B;  1OLT A;  4PFP A;  2UVF A;  2A5W A;  3KEW A;  4DJA A;  3M1C A;  2RRE A;  3KX2 A;  3AL0 B;  3OYA A;  2X1E A;  3VWB A;  4XM3 A;  2JVH A;  2JIZ A;  1E0E A;  1IA5 A;  1VBL A;  4DNT B;  3A2K A;  2DCE A;  4XN0 A;  2IGK A;  2LOO A;  1NHC A;  4BAC A;  2R7T A;  4G6T B;  2V7F A;  2X85 A;  1LVK A;  5LD2 C;  3OR1 C;  4FXU A;  3GVJ A;  3PNV A;  2LG4 A;  2GJK A;  3B4N A;  5AMV A;  2CW7 A;  2K3P A;  2M0M A;  2XF5 A;  2AQF A;  1V5G A;  1MMD A;  3K10 A;  4YXW A;  5HLT A;  3OIP A;  3FPP A;  2I8D A;  3N05 A;  3S8P A;  1E1R A;  4XD7 A;  1SFK A;  4J00 A;  2W6J A;  3OYH A;  2LBF B;  2F43 A;  4LG3 A;  3OYI A;  1HA8 A;  4LIT A;  1UD4 A;  4PK4 A;  2GOM A;  1W9X A;  3ZIA A;  1Z7L A;  5HNH A;  4JMQ A;  2KPM A;  2L5Q A;  4IZZ A;  4PJL A;  4BE0 A;  4FET A;  3DPU A;  3OPO A;  2NTB A;  1W36 C;  2R4G A;  2XZP A;  4KT6 A;  2NT6 A;  3T56 B;  1DBO A;  4XKW A;  4YZ0 A;  2WAQ A;  3MKY B;  1I8D A;  4ZJZ A;  3H0D A;  3RTR A;  3UNG C;  2CH0 A;  4C2U A;  1GQ8 A;  2JJ2 A;  3BCA A;  2K9L A;  4CCN A;  1MW7 A;  3VST A;  2XF7 A;  2BOL A;  3OYN A;  3H5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...