4XOPA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 235
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xopA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xopA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xopA02
4MXNA 3ZPPA 2O1DA 4PMHA 1OGOX 2VBKA 4C2LA 3VSUA 1NHCA 3B8YA 4XKVA 1O8JA 1OOCA 1O8LA 3GQ9A 2QY1A 4U49A 2VJJA 5C1EA 4URRA 2PYHA 1O8MA 4XN3A 1IDKA 1O8EA 1KCDA 2VBEA 2INUA 4XN0A 5AMVA 4YZ0A 4OJOA 1JRGA 2X3HA 4XL9A 4HWVA 3WWGA 4OJ5A 3VMVA 1JTAA 1OFMA 2NSPA 4YZXA 4Z05A 3EQOA 1CZFA 1PLUA 3GQ7A 4XM3A 2NTQA 2O0VA 1OFLA 3B4NA 4XOTA 4XQFA 4U4BA 2NTBA 3VSVA 2O0WA 4EW9A 4OJLA 3T9GA 4XOPA 4XLAA 3FY3A 4XR6A 1PXZA 4AVZA 3GQAA 3VSTA 4NK6A 4MR0A 2BSPA 2QX3A 1KCCA 3EQNA 2ODLA 3ZSCA 2PECA 1KTWA 3SUCA 1GQ8A 2X6YA 2NTPA 1BN8A 1RMGA 1O8HA 1QJVA 2INVA 1EE6A 2QXZA 3GQ8A 4YZQA 2VJIA 1XG2A 1RWRA 1QCXA 4I84A 4Z06A 4YZAA 4YEJA 2NSTA 4OJ6A 3B90A 4W8RA 2UVFA 4NK8A 2PYGA 1DBOA 1H80A 1OGMX 1O8DA 4XLEA 4OZYA 4YELA 2X6WA 4XNFA 1O8IA 1O88A 1PE9A 4XLCA 3VMWA 1DBGA 1HG8A 4Z03A 1IA5A 1IB4A 3LMWA 1VBLA 5C1CA 4W8SA 4W8TA 1O8KA 2EWEA 3KRGA 2IQ7A 1X0CA 4XLFA 1IDJA 1BHEA 1O8FA 2X6XA 4XKWA 4XLHA 3JURA 4OZZA 2UVEA 1WMRA 4XMYA 2O04A 2O17A 4OJPA 4XORA 1K5CA 1RU4A 2NZMA 2Z8GA 1O8GA 4W8QA 2VBMA 2NT9A 3UW0A 2NT6A 3GRHA 2X85A 4XONA 1AIRA
chains in the Genus database with same CATH superfamily
1VQKI 4E7LA 4Y13A 1QGZA 4OIQF 3VSUA 3CCEB 1E3OC 3L1PA 3G6EI 1J9ZA 3CMAI 1O8JA 4A6EA 3CC4B 2D74A 2F6CA 1U6GA 2OCCH 4AWXB 4G1BA 1ONVA 4RS8A 3SZTA 3HXLA 2VC0A 2FU4A 4KN7X 4A5NA 3KEYA 4B44A 1G3WA 1R71A 1H88C 5L3CA 2ADUA 4I99C 3IWZA 1BW6A 1XB4A 2ACJA 1FOKA 1KU9A 3CDLA 4QSHA 3KLOA 1YI2B 1MNDA 3C3WA 2Y0SN 4M6XA 3ZRGA 1DQUA 1J5YA 4F52A 4B09A 1RZ4A 2UZKA 1W9XA 2IA2A 3A8IA 4RPBA 1KA8A 2GK7A 2B7CA 1VLYA 3G2BA 2ELHA 2L4AA 1JJ6C 1E79A 2IA1A 1QFZA 2P5KA 3CJRB 1J9IA 3BQJA 3GLLA 3LOCA 1GXQA 1QRYA 3R6KA 3G3ZA 3WWGA 3GSIA 4BE2A 1KQ8A 4UB8C 4RA2A 2YSRA 2JPBA 1XGSA 2IAIA 1E62A 5EGOB 3C2GA 4ZH4F 5DNSA 2JA2A 1W7PD 1QUEA 1KU2A 4D5FA 4X0CA 2DQRA 4OAYA 2F4MB 3AKZA 2ZL5A 5H5JA 3DCFA 3KEWA 1V5VA 4AD9A 4OM9A 2G7UA 4P3IA 2TCTA 3IV5A 1XGNA 3BG9A 2VQCA 4KMUX 2OF7A 1PXZA 5J6XA 1PVEA 3AG1H 3S1MJ 1FNCA 2L9RA 3CC2B 2HR3A 2XGCA 2O8XA 1J59A 3TP3A 3OS2A 2XTYA 3CO7C 3E1SA 1FNNA 1JGGA 2WJVA 2BHZA 4RB0A 5HZBA 4ZYDA 2DMUA 1USSA 1KGSA 2D1VA 4O3MA 3DU5A 3ASTA 2LC2A 1LFBA 2RGVA 2XKPA 1SFEA 3PA2A 4FE4A 2FVGA 1QRCA 2I10A 2EZIA 3BR0A 3AAFA 3PUNA 4L5IA 1GXPA 4FN5A 1ZGWA 1EH6A 2VE8A 5TJJA 2FBKA 3AVUA 2DA4A 3P5JA 2HI3A 3H3UA 4A6DA 3GTPJ 2HTJA 2GLOA 4OZYA 1IXCA 4KDPA 1QQIA 3ZN0A 4IRGA 4KKUA 4BQQA 1D8TA 3VSKA 1T98A 2DDAA 4U7BA 2JDIA 5CKTA 2BE5F 4BQOA 3UNGC 1KQSB 1VNDA 1YLFA 2DYRH 4GYGA 3RTRA 2B63J 3ONUA 2EZKA 4YAFA 3C18A 2VFPA 1Q81D 1DU0A 4I09A 2QTZA 5DUKA 3RZOJ 3HGGA 1Z9CA 1TWCJ 2LREA 1FX0A 3OFNA 3I5UA 5K5OA 2Q6OA 4XD7A 3ZQQA 1T6ZA 1KONA 2HWVA 1FBQA 3JW4A 4YFNF 4WWCA 2IRFG 2YUHA 3W2GA 1Y39A 1W7PA 2UWMA 2IGMA 5HODA 3S93A 2VBMA 1VF9A 2MYSA 1XN7A 2FOWA 1X1BA 2D1HA 5EZGA 3GRHA 4E6KG 1YIJB 2HOAA 1UFMA 2H27A 2IS1A 1JI8A 4PCQA 3MKWB 1SKYB 2F5VA 4BJ6C 2R5YA 1BJZA 3FBNB 3BR6A 4IRHA 3D0SA 3FMSA 4HZFA 5HLTA 3HOYJ 3T51B 1FYKA 2FOKA 2JVGA 4BHPA 1K78A 2FQ4A 1JHHA 2BF4A 3BR3A 3RI4A 2LR8A 4NBQA 3I54A 2AXTC 4PC2A 3JRCA 2K40A 2FE3A 4IKFA 4AIHA 3QPTA 5E18F 1Y56A 4KICA 1R5GA 3PM1A 2MABA 4XRMA 4X6AJ 4C0SA 1REPC 1BLIA 2K02A 4MYUA 4E0FA 2YS9A 1EFUA 3KL9A 2V1DA 1VLOA 3ZOBA 1JHFA 2ME6A 3SKBA 1HSTA 3HC7A 2MSYA 3H09A 2JWTA 1QHGA 2MC4A 3HGYA 3LQRA 1D1NA 2MGQA 3I59B 3COAC 1GV5A 2J7KA 3I53A 3UR3C 4ZTFA 2CFXA 1OFMA 2M45A 3Q9VA 4B3AA 2QVOA 4ENNA 2KIUA 4L9NA 1BOAA 2CV2A 4S0HB 1E3XA 2HDNB 1TTTA 1UHMA 3D5LA 3HM5A 2L7FP 3CCJI 1CLWA 1HF2A 1ZRFA 3PL8A 1BJAA 3ZIAA 4FQGA 4ON0A 1XMKA 2F4OB 4A3DJ 4EM1A 4XR6A 2EV5A 3KLNA 1WJBA 4DBQA 4KKSA 1X1PA 3S2WA 2BSPA 1JA0A 2BM6A 3ZSCA 3B82A 1HOMA 2NTPA 5EF6A 2GIVA 4IOCF 3ZZTA 1RC9A 4A69C 1OR7C 2UXXA 2W7NA 4HF1A 5DV5A 2ESHA 3OPOA 2JRTA 4PFPA 2STWA 3WHCA 5HVQC 4CYCB 1VQLI 3T8RA 2V31A 4AU7A 2GXBA 4FASD 1A36A 1N05A 2JN6A 4DQLA 5GAEJ 4Z06A 3P9KA 2K9QA 3RYPA 4P9UA 5GTIC 2VPLA 2BX6A 5EEHA 4MTEA 5J1UA 2PYGA 4RGUA 1HZEA 3LVBA 3H92A 2C4UA 3DWLE 5L46A 2GOMA 4XLCA 4E7HA 3I4MJ 1PUFA 4HX8A 3ONYA 3JAMZ 4W8SA 4EJVA 2XPUA 5F27A 3Q38A 4W8TA 1LVAA 4G9YA 4GRIA 4A3LJ 2K86A 4JYKA 2ECCA 4M3EA 4BJTA 2QLZA 1OLTA 3KP3A 5F04A 4TMVA 2IQ7A 5EZHA 3HYIA 4DYCA 1KQ0A 3M1CA 3CUOA 4XLHA 3LNQA 5IY5H 5K7ZA 5IP7J 1GR1A 2DA5A 2O3FA 2OV7A 4LG3A 2G7HA 2CW7A 4RCZA 3J81k 2O04A 1XTAA 2V7WA 2B7EA 2Z33A 2EA4A 2NZMA 2XVCA 3LSKA 4XK4A 4BXXJ 3D1NI 1RRJA 4H4KC 2Y31A 3DP7A 1JT0A 1SFOJ 1ZYRF 2RQPA 2RC6A 5HS7A 4CGZA 2OTLI 2LY2A 3LA3A 5BPDA 3GLXA 1GO2A 4XONA 2DEUA 2EIMH 1DABA 2BVNA 1S0UA 4MLOA 3HUGB 4B3GA 3K4CA 1WJFA 3CF2A 2FNPA 2R9VA 3ZMDA 1IV6A 3CCEI 1ZG3A 2L9NA 3I0TA 2LKXA 1JT6A 4DNCA 3HOWJ 2VOPA 1Z6TA 2M8GX 1NB9A 5BMZA 4X7EA 2BMWA 4ESFA 4L18B 5ICGA 3IHUA 3GFJA 1BW5A 2PMUA 4IPAA 2O03A 3FDYA 4MTDA 5GP9A 1PP8F 2AHOA 4M3GA 2KPMA 1YI2I 3BH7B 2WB1N 9ANTA 2XRLA 3OYLA 2VBEA 1W36C 1RR7A 5LRSA 3TO6A 1LEAA 4Y7CA 4Z4UA 2M7BA 5HDGA 1WWXA 4WXCA 2DERA 1UHWA 2X3HA 2PFBA 4NQWB 3EYYA 4WF2A 2KQRA 4RD3A 3ZBUA 2LF8A 1YE9A 2QSGX 3ZZ0A 1T5EA 4E70A 1CZFA 1XQBA 1PLUA 2I1LA 2LKSA 4RB1A 5H20A 1O7FA 4XQFA 4CCKA 2WAQN 1Y0YA 5F08A 2GAUA 2R7QA 3AG3H 4LGWA 1MDMA 2C77A 5TISC 2N8GA 1IZ1A 3LO8A 1P4MA 5IYNA 2OBSA 1WI9A 1A8PA 2IOUG 2CQKA 3OYEA 1U5TA 2HFHA 3LAJA 2DPDA 4RJLA 2NPFA 1S29A 2I8DA 1H9GA 1SVMA 2ZFWA 2D3NA 3CC2I 2GXGA 5H6QA 3CXCB 3ASNH 1A31A 3SDGA 3SHFA 1GQ8A 2DMNA 1BOBA 3CJNA 5CDFA 3ZPNA 2ZJPF 2DT5A 4Y52J 1QJVA 2E1MC 5H2FC 2DW4A 1TLHB 2F1MA 3GQ8A 4YZQA 5ICCA 1GHCA 1SVLA 1V5GA 2C4TA 3KP7A 1QA2A 2AS5F 2DK5A 1FYLA 2WJYA 5TGTA 1RWRA 3KYCB 1QNTA 2XKOA 4CCNA 3J80K 2EV0A 1ON2A 4BNCA 4DNTB 4C2MJ 3E6MA 1UMKA 2HGCA 3ABTA 4YEIA 3EUAA 1L1IA 1AU7A 3JRIA 5DM7F 3TEDA 1F4KA 1W2BB 3ZMZA 1O8DA 1SKQA 1L0OC 3J7YJ 2KDZA 4YIIA 3JX8A 3I3LA 4EATA 3CUQC 1TQPA 4ZYAA 1MGTA 1X58A 4D5CA 1IA5A 3VFZA 4RM3A 3NEUA 5C1CA 1TWGJ 4IEJA 3OSGA 4MYTA 3K4LA 1SVOA 4OOSA 3ZMSA 1SM4A 3FXRA 5B1BH 3A01A 2P0WA 2O61A 1MMGA 4C2UA 2ZXWH 3BG6A 2CUZA 2ETHA 1MD0A 3AG4H 3JRBA 1FNMA 1R5BA 4KH3A 2Z16A 3IWFA 3VNVA 3MZ8A 4RGSA 4UAJA 3CCQI 2HMAA 3PSIA 4PJLA 2XT2A 1S5LC 3BZ6A 2ZZQA 2BY3A 2E1MB 1WTHD 1YOVB 3UW0A 4ENKA 1YIJI 3OJWA 4AIKA 1U78A 4BBSJ 4TMZA 4R79A 4CYDA 2BY2A 5DCMB 4A0XA 2LMDA 4U0YA 1IUFA 4JOMA 4P1VA 1YHQB 2EZLA 1D1AA 2A05A 3EPZA 4CA0A 2V6EA 4ETSA 5FKOA 3O3KA 4YALA 1FOYA 2BM0A 5A88A 3NAWA 4YG2F 5DTDA 1JKPC 1QZZA 1EFCA 4PJJA 5HS9A 3NQOA 2V6CA 2KIFA 1FP2A 3GBGA 2O6GE 4A3IJ 3U6BA 2COBA 3W6JB 3FIWA 2EFOA 3O8GA 2LY1A 4IF4A 2ZMEC 2E5ZA 2OPTA 2INUA 5EG0B 4X7CA 3DBLB 2E1OA 2E34A 1ITYA 2F4NA 2Z99A 1UAAA 2QBYA 2XTWA 1SD5A 4YAOA 1DPUA 2EK5A 4BXUA 4CO8A 4BS9A 1CQXA 5ILUA 2KISA 1WZ2A 5IOZA 4HNTA 3WTXC 2A07F 4JK1X 2KVOA 1LDKB 1Q86D 2NSPA 2KHMA 3FX3A 4AIDA 2CH0A 4G6DA 1R5ID 4ZDLA 3BWGA 1O3TA 4HE5A 2XZLA 3PQKA 1OFLA 3QP5A 3MCAA 3BPXA 5CLSA 1ZRDA 3Q3SA 4QWQA 3NARA 4BEHB 1I50J 1JTYA 1MH4A 1FYMA 1G7TA 2VFMA 3PNTA 1ZUNB 3SFZA 2VODA 1XMAA 2ZSHB 3R4KA 4KT5C 1EH7A 1SAXA 1Z6RA 2XSDC 2Q6KA 1VQMI 2AQEA 3BDDA 3VB2A 4NK6A 1B4AA 3FKSA 1KMHA 4C9YA 1HSJA 3CDHA 2F43A 3AL0B 3EQNA 4AVPA 1R5OA 4P96A 2V5IA 1G4DA 1FC3A 3B6AA 2QENA 1UB9A 3QPLA 4YIFA 1COWA 1VQ7B 1DGWY 2K27A 2A6EF 4F7ZA 1NG7A 4KT6A 1TL8A 5CVRA 3C1DA 2QGGA 2CQXA 2RREA 4F55A 1J2XA 4G7HF 4ACBA 1BI1A 1RPWA 4AUXA 2M30A 2RC4A 3OS0A 3E0JB 1ETXA 4CDGA 1HKQA 3T53B 3SJZA 3CCVB 1OB2A 2R7SA 4P1WA 1S6LA 3I9V2 4PSXA 3HSEA 4HG2A 4RAZA 4Y7NJ 4EH1A 5DS9A 2AXLA 3OYAA 1W36D 1AHDP 2QDXA 3GTGJ 4Z4SA 3G4SB 2JA7J 5ED4A 2PN6A 1FJLA 3H3VK 3N90A 2PI0A 2H8RA 4HYEA 1EXMA 1YQAA 2ZNZA 3AGPA 5FKLA 4X7DA 5FROA 1YFHA 1XFOA 1SANA 4PABA 2UUZA 1YX5A 4XSZF 4XRFA 2V1UA 2F5EA 5IP9J 1YITB 4J19A 5B6IA 2KRHA 3CW2A 3WE2A 5E79C 4EGYA 2DOGA 4A3FJ 3ZQHA 2HVSA 1LB2A 3P27A 3SQVA 1EKEA 3ZUGA 1YJWB 5FJ8J 2CJJA 3A8KA 5K7HA 1DU6A 2Z8GA 1O8GA 2JUGA 3TO9A 2H09A 1YIOA 3K6GA 4P2NA 4W97A 4WCGA 3SYTA 2NT9A 2VFNA 4Q48A 2NS0A 4M2LA 2E1CA 4MHGA 1ORKA 3QYEA 3ZPPA 3L7WA 2DDBA 4ROXA 4FETA 1IDYA 2W1OA 3F8FA 3GO5A 3V8KA 4RDUA 2HEOA 1NHCA 4ZC3A 2HZDA 1S4MA 5E1ZB 2Y0SA 1OCCH 5M5YJ 1NH3A 1YJNB 3DKYA 4LIVA 3H5NA 2DOAA 4M9SA 3OIPA 3E6BA 2XSJC 4U49A 2VKEA 1H0MA 1Y0RA 5DDGA 2O8KA 4URRA 4RAGA 2VNIA 5ILSA 4H9GA 3JSOA 4ZZLA 2QMUA 1ZR4A 1UG2A 1XSVA 2CW5A 1ZELA 2EA2A 3HKZA 1J7KA 2V7FA 2JPCA 1VQPB 3F8MA 2AHQA 2CV1A 4BJ5C 3HTSB 3HAGA 1ZM3A 1K4TA 1SMTA 2IJLA 4BE1A 2COMA 3H9QA 2XAHA 1LKXA 1WGXA 1ODDA 3PUFA 3RQIA 4V2FA 5A2QK 2WZNA 2XTXA 2ZITA 2NAZA 3EQOA 4OMZA 3A35A 2F5FA 1I39A 1R00A 3VSLA 4N3NA 4M0LA 2RDPA 3HPHA 1HF0A 4FX0A 3QSYA 3OV8A 4WZEA 3FMRA 3HEFA 5J8FA 4PGGA 3E1YE 2DY1A 3G73A 1IRZA 3OOCA 4FCYA 1FY7A 3WTZA 3DV8A 2W48A 5DEQA 1NBMA 1KCCA 3PUMA 2GM4A 2JVHA 1DPRA 1T6SA 4C3HJ 5HXBA 2O0YA 2LYCA 3OYFA 1UD4A 2Y30A 3FM3A 5KHDA 3SZGA 1DARA 3WU0A 5E3NA 3L2VA 2Y48A 3P7NA 1ZM4A 2V7UA 1B8IB 2ME0A 1RKTA 4X0GA 3OYDA 4RDKA 5FO5A 3PO3J 2HNHA 1SAUA 4I84A 4HE6A 1IN8A 2IVMA 4MQVA 2A6TA 4HSTA 3VYUB 3FHZA 1M90D 1ZR2A 1V55H 2PMZN 3H94A 4RDJA 1E3HA 1FIAA 1Z7UA 1V5FA 2R7WA 3ASQA 2V7TA 3EETA 1Y1VJ 5J3LA 3DBRB 5AONA 1DP7P 4YELA 4BY1J 1GAWA 1ZM2A 1O88A 1G6NA 2VB6A 3I56I 1BQEA 3JR9A 2WBMA 1DBGA 1R1VA 2Z6BD 3H9GA 2VJ5A 1HG8A 4Z03A 1P4XA 1XS9A 3GFMA 1QA3A 5A8AA 4AYBA 5FFZA 3KRGA 1B59A 4UUTA 4BUPA 1GAQA 2CNDA 1QX4A 3GVLA 1Z0XA 3OL3A 1RQRA 3ZXSA 3S14J 1ZTRA 2VBSA 5ICEA 3WU1B 1ETOA 1T95A 3CUQA 3QODA 1FDRA 2PLFA 4LFUA 3QWLA 2KIQA 3T5XA 1V3FA 3B73A 3OR1C 2JA6J 1XMXA 1LE8B 3HRTA 4HSRA 4IHVA 1R36A 1MABA 1Q1VA 2QSHX 2EFGA 4P3YA 3JREA 2ZXHA 3QFCA 4RLFA 3OYIA 3GVAA 3JQQA 3HSFA 3LWFA 3WGIA 3BQYA 3KETA 3DEEA 4I0AA 1P2FA 2VONA 1D8JA 3FHNA 3K4JA 4LMYA 3VOEA 2M9HA 3A0HC 1OGOX 1MBKA 1Z77A 3SYJA 4ZV4A 1HW1A 1YHQI 5JVTA 1AWCA 4CHUA 1H8HA 3VO2A 3U6KA 1FT9A 2H8WA 1MBFA 3CD6I 3ASOH 3E7LA 4A0ZA 2CRVA 2KJCA 2R4GA 5J8CA 5JBQA 3BQZA 3BC9A 4II3A 2CRGA 1T6YA 1OYYA 3WNDA 3TP0A 1SMYF 3G71B 2XGEA 2AQFA 2W85A 3N4MA 3Q9SA 4YZ0A 2QA4I 4DYQA 1ETWA 3IC7A 5LGUA 1ZKGA 3BY6A 4HPQA 3Q0UA 2HOTA 2UV1A 3ELKA 1F20A 3W5UA 2PJRA 2DYSH 4Z05A 2BBYA 3FPPA 2X51A 3CJTB 2ICWG 3GQ7A 3CMEB 1NB0A 4P9SA 3BPVA 2R7FA 2M2EA 3LSIA 2LVSA 4N4NB 3FKIJ 3RSNA 2JMWA 3ZBTA 4HF2A 1MBGA 1A6QA 1P92A 4L0ZB 4G6TB 4MGRA 4KMFA 3CESA 4RD4A 1TVCA 2P4WA 3LSTA 2HQRA 3L09A 4LLGF 4XLNF 1W35A 3EUHA 5DS0A 2STTA 2KRFA 4M4SA 1XDUA 1W1WE 1ETVA 2Z3YA 3K1PA 4CXFA 5A2QZ 1MMNA 1QRBA 1VQ7I 1W0TA 4UVBA 4Y15A 1DDNA 4UNOA 5IYWA 1VQOB 2DMPA 5LLQA 1UHSA 1B6AA 2DFEA 2DJIA 1HQCA 2M8EA 4IJAA 3BCFA 4KA4A 5JHFA 1H80A 1GV2A 2LOOA 3OY9A 5DCFA 2JZYA 4E7IA 2RKHA 4C2TA 1S9HA 2K4JA 3JAMK 1AIPA 3G4SI 5JVGF 2GOXB 4OPSA 1K73D 5C3EJ 2Y9ZA 3WG7H 5FIUA 3M8FA 1N75A 2BN4A 4MEYF 1TSPA 2WWYA 3SFIA 2K85A 5BOXA 2QYOA 4BAYA 4TMXA 2K5CA 3LSHA 1YITI 4WXDA 2HXOA 4PFOA 1FMVA 4IHTA 4I76A 4EM0B 3OYGA 3AVYA 4O5VA 2J5OA 1LFUP 2WA0A 2LNBA 2O17A 1YJWI 4OIPF 4YXWA 2CW0F 3RZDJ 4Z4WA 3I64A 1PP7U 4F7DA 4NDLA 5HOOA 3V8JA 1JE8A 2NVXJ 2PLYA 1CNFA 2E2HJ 2EFNA 1FLIA 3CRZA 2BVMA 5TRDA 1NG6A 2XF5A 3G1OA 3V7CA 2VBKA 5J4YA 4BU2A 4YIRX 1T0FC 1JGSA 2XDVA 3RKWA 4YRVA 3LSPA 2L7MP 4O6JA 3E3VA 2WYRA 3V4GA 1ZRCA 1YJNI 3CCUB 1OOCA 1OHHA 1RKWA 2DOFA 5L3EA 2CYYA 1VQ5B 1NK3P 1HA3A 5BS6A 1GVJA 1CF7A 1QQ1A 1MMDA 4HIZA 3CTAA 2IP2A 3HTUA 3KEOA 3ML6A 5DD8A 5DSZA 4FWTA 4UY8I 3WYAA 5LD2C 1U5TB 1KCDA 4I2OA 1BA5A 4UZEA 2EIXA 1ZM9A 4ZCIA 2OC6A 1MW7A 2A69F 3E20A 3CCSB 1YW9A 1FIPA 1VQPI 3OEEA 3A4CA 2Q6LA 3OZVA 4QHYA 4HRIA 4P6YA 4EM2A 5FNZA 4YAWA 3WGHA 1TNSA 2ZJRF 2Z2SB 5LHGA 1LFPA 1RIOH 2BXYA 3CCLB 2DOEA 2L9SA 2X1DA 4M6YA 2QQAA 3ZR8X 1X2MA 5HNHA 3I4NJ 1GVDA 2A5WA 4B4CA 3F21A 1XB2A 4FXUA 2J8IA 1OB5A 3KPHA 4LG0A 2VNJA 2DJNA 4UB6C 4M6VA 4L9TA 5E8IA 1YW7A 1Y0UA 4I98B 3SEJA 1MSEC 3Q0WA 3N97A 2L9VA 2OBPA 5F1JA 1R1TA 2WV1A 4Z2YA 5D5UB 4ZDPA 4DZPA 2V7QA 5FA6A 3I1FA 4ASUA 5TV2A 2X6YA 2NRAC 3I55B 4KIFA 1P7JA 5D4RA 2D2WA 2BSAA 2LLKA 3QQAA 3A01B 1I5ZA 4LD5A 2GQFA 4UZFA 3HOVJ 3AK5A 1YX2A 3A3GA 4ACAA 2K7LA 2QM3A 3JTGA 2PMDA 3M3YJ 1JNYA 4UUVA 3J7AO 2F3LA 3MD2A 1BN5A 3IUOA 2M4KA 4ZYHA 2KL4A 1KTVA 2W84A 4CZCA 4RGRA 1QPMA 1T6XA 2ZL7A 2UVFA 1ZK8A 3JRDA 4ZGQB 1X19A 2GREA 2Q2EA 1VQNB 4XNFA 1O8IA 4RGXA 3BP8A 3NWSA 1LLZA 1BI0A 2QCOA 1ZGJA 2WTEA 2X1EA 2R5ZA 2IEKA 1BI3A 1BL0A 2MD5A 1JJ8C 3RKYA 5HKKA 2XB0X 1G3TA 4HLYA 3ASRA 5F6FA 1TT0A 4Z4ZA 3PETA 3OYNA 4XLFA 4QVAA 2KP6A 1VTNC 2FD5A 4TT3A 4R8HA 2HDCA 2VN2A 2HOEA 4RM0A 2UVEA 4GGGA 5D6EA 3TH0A 1P7IA 2E19A 1J0RA 3TOAA 2V7VA 4C3JJ 1RR8C 4LOCA 2OYNA 5LRRA 3ZPLA 2VT3A 1RU4A 2JN9A 1UCRA 3ZQCA 4Z6YA 3BNWA 1USTA 2W82A 4OINF 1HDDC 1B9MA 3LQEA 1WJEA 3R0JA 2E2IJ 1UG0A 1JUMA 1FP1D 1P6RA 3FXOA 2R7DA 2WAFA 2P6TA 1Y1WJ 2EQRA 4A3GJ 3QP6A 3S3OA 1RETA 1POGA 3K1NA 2XGJA 3QOPA 4UXNA 4PAAA 2F2EA 4EJTA 4LBWA 3PNYA 1IDZA 1BIAA 2ECBA 1EA3A 4FISA 2VC1A 3H0DA 1IAWA 5JMCB 2V79A 2YX4A 4GDFA 2P7VB 4I6ZA 3RY8A 1W0KA 2R92J 4OP7A 3H9NA 1YTYA 2DFHA 2QKMB 3G71I 3S17J 2VOOA 5KAIC 1IRGA 2I5UA 2WV0A 2X4HA 4JQFA 1ZQ3P 3CC7B 2XGXA 3ABLH 2FX0A 1MH3A 2DAOA 2FRHA 3IRRA 4ABZA 1T33A 1T8IA 1HCRA 3PIPF 4IQJA 3AVVA 3BR2A 2E1NA 5EGOA 3L9FA 4GYIA 2NTQA 3CMEI 2VBUA 2O0VA 5C4JJ 3CC4I 2WY7Q 5ICFA 2EZHA 3BLYA 2FMYA 4OPVA 1NTCA 4DBRA 1IGNA 3EYIA 1F9NA 2VXZA 1D0XA 2XAUA 3HOTA 1N25A 1L3LA 1DDIA 4A3EJ 1RQPA 2H6BA 3VSTA 2K4BA 4IHXA 2OQGA 5LHIA 5IYPA 1ENHA 1WH7A 2DO7A 5D4SA 1B23P 5E3MA 1MJ9A 2QWWA 3LSJA 5D8LB 5L3DA 1G7RA 4BH9A 3MN2A 4X8IA 1X4OA 1BN8A 2XZOA 3DEUA 2BGCA 5HNFA 1WORA 4NBSA 5B5EC 2H6CA 2H1LA 1VQ8B 1Z3XA 1XGMA 2NVQJ 2CG4A 2JTVA 4IXAA 4NC6A 1A35A 3TMOA 3IAS2 2LBFB 1VQOI 2PJPA 3NWTA 2E71A 2E2JJ 1SD7A 3ERMA 1R6RA 5H6RA 2ZJQF 3J7AY 4LB5A 2A6HF 3DF8A 4S04A 5FO0A 2HQNA 2OCEA 1Z1DA 5K5QA 3IAM2 1TZLA 1WP6A 3LMMA 3W6VA 4GO1A 3OP1A 2BM7A 3LA2A 4QVJA 2GWRA 2KZVA 2LD5A 1H8EA 3CMMA 4IL6C 3QPHA 3DU6A 4A0YA 2GQQA 4J00A 1H42A 4B1RA 1TWHJ 2WR8A 4V2GA 3P9CA 2XAGA 1MJBA 5CQEA 4RLZA 1PJ6A 1WQ2A 2LY9A 3N05A 1R5NA 2VZLA 4AIJA 2BY0A 4KN4X 3W2AA 1I1GA 4TKOB 1WSUA 3S2HJ 2VT2A 2O6WA 3HHHA 1FBSA 3ONQA 5FKKA 4EV0A 2XROA 2BM5A 1U8RA 2DK8A 1OMIA 2FX3A 1K5CA 2CWEA 2KKOA 4WZTA 5JLVC 4IVNA 5L3FA 3F22A 1N78A 1QU3A 3QU6A 5D8KB 2NT6A 2LK2A 2DODA 3E5XA 1F60A 3D5RC 1FX7A 4PDKA 2O1DA 3Q6QA 3GMEA 1I27A 1D5YA 3WGGA 3B78A 3FXLA 5JLXA 1LDDA 4UV9A 5IT9Z 2VL8A 2WSSA 3H0GJ 3RPUD 3DFGA 4CCOA 3CCUI 2BW3B 2KLOA 1O8LA 1KK1A 3PSSA 1VQ5I 5JHUA 4DQKA 1KU7A 1U3EM 3M4OJ 2PYHA 1O8MA 1IV8A 4M9XA 4OU0A 2QQ8A 2A3SA 4BKXA 4OMYA 2BGJA 5LMZA 4M3DA 3A1PA 1B72A 1N07A 1OCRH 3TL4X 1GLNA 3PSFA 1K6OA 4P22A 2XB5A 1WDTA 4ZYEA 2B5OA 1LVKA 4G5GA 2X0LA 3S8PA 5JLWA 3S3NA 1TYUA 2E7WA 1WI3A 3DTIA 3CCLI 4LLLA 1QGAA 1DGRM 2W24A 1QZEA 3AFHA 3VYSB 5GPCA 3GEZA 2IS2A 4KFCA 4HF0A 3AL0C 1I6HJ 4DNRB 2LDUA 2D9RA 1HA8A 2NTBA 1K9MD 1X1AA 4TSFA 4EJWA 2O0WA 4DJAA 1W0JA 4Q5SF 1PJ5A 2CQNA 4W1UA 4RB2C 1ZLKA 3Q39A 4ESJA 3QU3A 2JQ7A 2OU2A 3GQBA 4A2UA 3FXJA 4HBLA 1FOWA 1TC3C 4ZDOA 4PUSA 3F72A 6PAXA 3I55I 3V8LA 4UUSB 3SZPA 2EILH 1EP2B 4ZYGA 4KIBA 4IHYA 3M7GA 4B3FX 3OYJA 1MNMC 1SFUA 1QVTA 4XBFA 4BGDA 4AC9A 5AIPA 4R71A 3E97A 3VMFA 4HW0A 2XZPA 2K3FA 3IH3A 5KW9A 4CYCA 1X3ZB 4F3QA 3NE5B 2WADA 4P26A 4GCVA 3T1BA 1K4SA 4ZJZA 4BXFA 5BQTA 2NSTA 1FTTA 4RB3C 4L8JA 3B90A 1JUSA 3MQ0A 3RPUA 5K1YA 2DA2A 4Y17A 3MAJA 1ETKA 4NK8A 1CGPA 4MQ9F 2L2OA 3HOZJ 2MH9A 1IC8A 1BJKA 5KSWB 3J81K 3T8TA 1IF1A 4X07A 1PE9A 5E1WA 1JTXA 1T56A 2IXSA 2PX9A 1VQKB 5FRMA 2YUSA 1TNTA 3A8JA 3ESWB 4UZUA 2M1BA 3HOUJ 1AKHB 4XLPF 1DG1G 1H85A 2NNYA 2XV4S 4RBOA 4ENJA 3GTQJ 1UD2A 3CF5F 1T39A 4XICA 3CPWB 2R7XA 3K70C 2IGKA 2WZPP 2EWNA 4XMYA 3SJPA 4CUGA 3LFKA 3HOXJ 2YWHA 3OL4A 1ZREA 1OGIA 3N6ZA 2M0CA 1H89C 2L7KA 5KAFC 5HDNA 2CGPA 1OR7A 2V1NA 5DD4A 4KKTA 1FZPB 1WCMJ 4UHTA 1I18A 2ELJA 3CJQB 2ZO4A 3KFWX 3RKQA 1ULYA 4A3MJ 2HVRA 2DYIA 5IYQA 1PJRA 1WH5A 3HUGA 2G0EA 4M72A 1N0UA 2GA2A 4XKVA 4KYWA 2Z5UA 2W6IA 3ISXA 4JRAC 3CQZJ 1O7LA 2QGUA 2W6JA 3LYCA 1P9QC 3IH2A 4CICA 4OIRF 1SFKA 3OZWA 3VODA 3KYLA 1T2KA 2J8KA 4L5EA 1ZGAA 1Q1HA 5C1EA 3E5QA 3WE3A 5ILVA 4WXHA 4U0VA 1W5SA 4KJZA 3QRFF 5E17F 4D0PA 4YFKF 5CVJA 4PC3A 3Q5FA 3FM5A 3BCAA 1OYWA 2HYGD 4HEA2 1EP1B 4JMQA 4AM3A 3K2AA 1UD3A 3V76A 3W2HA 1WXRA 4IX7A 3CC7I 5IYRA 1PUEE 3JRGA 1QUFA 1WJDA 3DTEA 5JI6A 1XCVA 4Q4ZF 1BC7C 1Z3YA 4KNYA 3B6CA 1E1RA 4XM3A 2V7XA 2V9VA 4TMTA 4OWRB 3W2IA 5F0FA 1LNWA 1XSDA 5BSYA 4C2LA 1VQ6B 3LQ6A 5FGMA 3WHBA 2LFBA 3TO7A 4L5JA 4LK1F 3L2UA 2MLKA 3SEZA 2D5VA 1G7SA 1RI7A 1W4MA 1R23A 4BBRJ 5FL7A 3T9GA 4XOPA 4XLAA 5CVIA 2QN6A 4PJ0C 4RD6A 1D0YA 3BJ6A 1N0VC 2GJRA 5J3OA 1ACIA 1IN6A 4YHBA 1BPLA 1KTWA 3MKLA 2L5QA 2ZSIB 3BTCA 2PEXA 4PC1A 3HSRA 1WOOA 5C44J 5A89A 4M74A 2E60A 5GAGJ 2L7ZA 2INVA 3Q0VA 3VPRA 2K3PA 2XPWA 4ASNA 4E7ZA 4IQ4A 1EFRA 1IXSB 2VBZA 1WPKA 3IKVA 3GFIA 3QE2A 1F36A 1G8XA 1OCTC 2HPIA 4IW3B 3K4NA 1UD5A 4YEJA 2GIZA 4BQAA 3PVDA 1O3SA 4OOXA 1AA7A 1GDTA 1MBJA 3EUKL 3M9AA 1JJ2B 1OGMX 2ZCWA 3IP4B 5DUIA 4IZZA 2CQQA 1WSRA 2JJ1A 2CU7A 1VQ4B 1Y8RB 2EH3A 2MC3A 3WG9A 3VMWA 2YR2A 1JXSA 1IB4A 3EDPA 2R7VA 2NYXA 1O8KA 2LKPA 2KZGA 3WTSC 5L3GA 3WNCA 3FK6A 2CQ7A 5FRNA 4BACA 4LJZF 4ZCMA 2IBDA 2GXAA 2Q6IA 3K4KA 3OJXA 4ITVA 4Y3OA 1JUPA 2R93J 4HAMA 2F4IA 2V4JC 3R0AA 4QIWN 1W87A 1R1UA 3LSGA 1BR4A 4EVIA 3BY1A 2XGDA 4N3GA 3BR1A 1W7PB 1GVHA 2Q8KA 2OD5A 4EJOA 3R6SA 2VJ4A 2DU9A 3AVWA 2YU3A 3F0CA 3D5SC 4U0WA 4CCJA 2C6YA 1VZ0A 3OIOA 3SQNA 3OE7A 3J81Z 2R5YB 3PO2J 2X9DA 3CO6C 3B8YA 5DCMA 2CV0A 1U2WA 4V02C 4PGOA 4Z4TA 1K78B 1B1BA 3PQJA 5E6TA 1XX5A 2ZBKA 3RJPA 4E7SA 4OOIA 3GXOA 3DQVC 2C5BA 3A0BC 3GIRA 1OFCX 4BPRA 3CCJB 4LG0B 2F5CA 3FZVA 2OK7A 4B47A 3SJMA 1QFYA 2DLLA 3Q3AA 4R1HA 1XSXA 1K4ZA 4CCLA 2HYFA 4GFBA 4DK0A 5EDNA 3IL2A 4U9UA 5EG0A 4U7DA 4UV8A 1MRZA 1R4NB 4UVCA 2GBYA 3PIOF 5M3MJ 2FJ1A 1GJRA 3GTKJ 2F48A 2GJKA 1K6YA 5AIQA 2KFDA 4U88A 4OJ5A 1MMSA 5BPIA 5GADJ 1QO0D 1PJ7A 1WKMA 2FUG2 1ZARA 2M4GA 4K2EA 2HDDA 3U1KA 1F43A 3W5VA 2NNNA 4MFDA 2IS4A 4JX6A 3PSZA 3JRFA 2XASA 4BE0A 2ISYA 3W2VA 1RUNA 1MSFC 5J1RA 1OCZH 2NXNB 3TGNA 4BEHA 1IN7A 1N06A 3AVTA 1TQIA 2CW8A 2HLDA 1X1CA 2W57A 4NB5A 4XIDA 2VKVA 1BBYA 3K9TA 2GJPA 2OUMA 2V26A 3H35A 3BG3A 4M53A 1TBXA 2ODLA 3LJYA 1R4MB 3ZQGA 3BROA 2DN0A 2BY1A 5EEAA 2CMPA 4BDYA 4GQNA 4MNUA 3U1DA 4QLCU 3IKTA 1E17A 3FPKA 2E35A 4OOVA 4PJMA 4B8XA 4G7ZF 3FXUA 2CC2A 3F3XA 1JKOC 2ZMEA 3ZMTA 2UXNA 1YS6A 2VJIA 3BTLA 1EV7A 1OQYA 2IW5A 4FHTA 3DLLF 2NVTJ 1HC8A 3JU4A 1OFEA 2F5DA 1A6IA 1YRNA 3T0YA 2TRTA 1D3YA 2E5NA 4ZZDA 2CUJA 4H0EA 3QOEA 1V54H 2OTLB 3SLNA 4RD0A 3TDZC 1TP4A 2VBWA 4NUBA 3WY9A 2HKOA 2OTJB 1PUFB 2VQGA 4Z1MA 4U87A 4A3BJ 2VNKA 4RAYA 4Z4RA 2EWEA 2ZC2A 3NB2A 3VO1A 1FSHA 3RIRA 2ELKA 2L02A 4Q7JB 4G6IA 1X0CA 3MMYB 3IRQA 3ZP5A 5DYMA 4OPWA 2KIMA 5KNLA 5CJ9A 4PC7A 1PDNC 5KVRA 3HOSA 4FTHA 3WBJA 3J7ZI 3JRAA 4P5OA 3G05A 3AVXA 2MFZA 4A3KJ 3OSFA 2XHKA 1DDGA 1IRXA 3CCVI 3MMPA 1X3UA 2KT0A 4LBYA 2X3UA 4TN1A 1EA0A 2X53S 1TYVA 2VI6A 2P3MA 5D5XB 4MXNA 3U21A 1I3AA 2KRCA 1OKRA 2D3LA 3MFKA 2XNDA 2LSOA 4WZLA 1EF4A 4PMHA 1U5TC 1GT0C 2TDXA 4C43A 3HKZN 1Z7LA 3WTWC 5EJCA 5HLGA 4G1VA 2OJED 3H5AA 3L00A 3R60A 4YCQA 2DBBA 1EWYA 1Z05A 2R6HA 3WTTC 3ROUA 2VJJA 3LSRA 3ISPA 4LK0F 2EFQA 1LUJB 1UJ8A 2BXZA 2NOGA 4WQMA 1OCOH 3FF5A 4DZJA 4AF6A 5J35A 2P5VA 2G0YA 3S15J 2P6SA 3D26A 1QVGB 3A3BA 3K2ZA 4PC6A 4OJOA 2W00A 1X2NA 2XC1A 4LITA 1BM9A 3MHPA 4M71A 2L01A 4XL9A 5EEGA 4LBVA 2OBTA 3CP2A 2MW8A 2L0KA 2WB1A 3GX4X 2P81A 3ABMH 1TYWA 2BHYA 2ZXJA 3TW7A 2QEXB 3O8HA 2P5LC 2OQRA 3DDYA 1VQ6I 3MEXA 2LTPA 5M5XJ 3S1QJ 4K1XA 1MDMB 5GAHJ 2QF7A 2X6OA 3BH6B 2NVUB 2ZTGA 2FMLA 3BJOA 2E7XA 3OYBA 2BGIA 3HHGA 5IP6A 2ID3A 1FRQA 2B9SA 3CCYA 1G2HA 1FNDA 2XUBA 4MR0A 2QX3A 2RNJA 4M73A 4XSXF 2DPUA 2PECA 3SUCA 3DBHB 4WWVA 1WU8A 2FA5A 2WAQA 1OISA 2BM4A 2CUEA 1EZGA 4J0QA 1Z21A 4L9JA 3F6VA 4QPOA 3BTJA 2QSFX 1IJEA 1BMFA 1O8HA 4CH7A 1VJSA 1EE6A 2JK3A 1HVXA 1D1CA 2VBYA 1M1KD 1B8IA 2MA3A 4IOAF 3FKJA 1XG2A 3DEWA 3DPLC 1E43A 3CCQB 1QCXA 1G7CA 3ULQB 1TW3A 1NDHA 1WVRA 4GXOA 3RKXA 1E2XA 4OIOF 4AYBN 1JKRC 1K28D 3TW6A 3VYTB 3F8CA 5EYRA 1RNLA 3KP4A 3KP2A 4CZZA 5J47A 3GTJJ 2XNCA 4A12A 1VQ4I 2FSWA 4F91B 1G3SA 4P12A 1MKMA 1TQMA 1VI0A 2XAJA 1WSVA 4N9HA 2Q1ZB 3WU2C 4B3XA 3OOPA 3K4MA 3HJEA 3H3ZA 2Z1DA 3AGQA 2P7CB 1MJAA 1X4PA 1R58A 2ZJ2A 3LA7A 3V7RA 1ERDA 2BV6A 2JSCA 3CCRB 2VQHA 1QFJA 1LQ1A 4EEFG 1LJ9A 1H8AC 1IDJA 2NS8A 1W34A 2ZBVA 1O8FA 5BSXA 5CVVA 3HB9A 4DYRA 1RUOA 2NVYJ 2M3AA 2F1LA 3KZZA 2VIXA 2MLGA 3KZYA 4KISA 4PZJA 1XDSA 1F5TA 1PKVA 1MIJA 1D0ZA 4I01A 1ON1A 3RDIA 1TLLA 1UD8A 4C3IJ 1LE8A 4IRIA 2QE7A 2QTLA 4BDZA 3OEHA 3U2RA 1B72B 3L2WA 1OJLA 1ZAOA 2K9NA 2XF7A 5FKMA 4HDVA 3RPQA 1S8NA 2JSPA 5CQGA 2VUMJ 4MEXF 3RIQA 2QZ8A 2OA4A 4OPOA 1KU3A 3CLOA 1OB0A 3C7JA 3Q6RA 1TT5B 2HQAA 1ELOA 4LC0A 2JT1A 3W2FA 1TYXA 4NCNA 5LBQA 3PENA 3WODF 1QVUA 1U9OA 5B1AH 3GZNB 3PNVA 5IT9K 3W2EA 2BOLA 3RYRA 2B0LA 4BHCA 4N9IA 5FLXK 2OZUA 3LFUA 2NV4A 4YAUA 1JB9A 2HDWA 4X1EA 3VYRB 3DLAA 2KMUA 2ZTNA 2QZAA 4JP0A 2VQLA 3JSPA 1M1EB 1HXDA 4M1KA 3BG7A 4RPDA 4I02A 1VQMB 3KCCA 4D9JA 2KDOA 1HKSA 2VPRA 4I0BA 4EQQA 5IOYA 5J4VA 1QH0A 4A3CJ 2LZJA 1B2RA 2OK8A 2VNHA 2QBYB 5AMVA 4LB6B 3B8HA 1FPQA 2BV3A 2RC5A 3CZ6A 3KZIC 4QUZA 3TKYA 3CDIA 5LGNA 4DW6A 3LAPA 2JIZA 2W25A 1HLVA 3HPGA 3MCZA 1JKQC 3S3MA 1HKTA 3V7SA 5M5WJ 2CF4A 2GPJA 2ZL6A 4DK1A 3GVKA 1WRJA 3VMVA 4E4HA 4XKBA 1I1SA 1YG2A 1ZH5A 3ASPA 4FK8A 2EFPA 4UVAA 2WPDA 1IN5A 4X05A 2DMTA 5DN6A 3OW2B 4E7KA 2HU9A 5THXA 5HZAA 4CQJA 3GF2A 1LM1A 3ZC3A 1D5VA 3V42A 5B3SH 1VF7A 5FO1A 1Z91A 2YWGA 1ZG1A 1TTYA 4HQMA 3WTVC 3B02A 3CCMB 3GQAA 4AVZA 5B66C 3E6CC 3HRMA 2DETA 4PGHA 2IPQX 3RQ4A 3W2WA 2DQLA 2RNGA 3WTYC 3ABKH 3NRVA 3KE2A 2RQQA 4RMNA 1I6XA 4P55A 3I4PA 3JCUC 1K61A 3BT9A 5F4OA 1SD4A 3L2CA 2DA6A 3HBLA 1Y0NA 1Q9SA 2HCJB 4QV2A 3JQRA 2JA5J 2Y0MA 4Q47A 3HG9A 1FWZA 3E5UA 3SEQA 3ZGKA 1J09A 4P9FA 5JFRA 4D1QA 1A5JA 1KRHA 1S72B 4OJ6A 1KZLA 1TW2A 1O3RA 3WTUC 3FXKA 3FMQA 4ZTJA 3QFTA 1EH8A 2IGNA 4P6VF 5HDKA 5HS8A 2G9WA 5L3BA 3JRHA 1VHOA 2QUFA 2OTJI 3LL7A 5F4MA 3OMYA 3K1MA 3LQQA 4RAFA 4AC0A 1S7OA 2ID6A 4KIGA 1LDJA 4LIUA 1O3QA 2BYVE 1D8KA 1R9TJ 3OYMA 3M8JA 2M34A 2X6XA 4J01A 4IHWA 3ML3A 3ZQFA 2AO9A 1NJID 1WHUA 4QTRA 1HW5A 3WXMA 1NHAA 3A03A 3H1CA 5E3OA 3OAAA 4Y9UA 4OJPA 4E7JA 2EIJH 5FD5A 3GTMJ 3ECOA 1N08A 1WPCA 4YC5A 1WJAA 1YX3A 1WJ5A 1FNBA 1MBEA 2VXDA 3OYCA 3REOA 4HQEA 4CSWA 4B4DA 3O2PE 1V0FA 3VEPA 1UELB 4G12A 1YO5C 2BM1A 2XOKA 1KK3A 1XD7A 1W5TA 2ZZEA 2L3DA 3PA1A 1IN4A 3RCOA 1TWFJ 5J40A 1VQ9B 5IYDJ 3OKXA 4ESBA 1FEXA 1T08B 2X48A 2DIEA 4XN3A 3HZJA 2XNJA 1KK2A 2L4MA 1JA1A 2A68F 2FNAA 2J5PA 3GFLA 5D5VB 5F64A 3KYDB 3MWMA 1QHHD 4HV6A 5TR9A 4YFXF 1O4XA 3P4GA 1Q7YD 4XRSG 1IUYA 1IJFA 1OGJA 2W4SA 2O5RA 4YDTA 1SD6A 4HDUA 3GWZA 3ERED 3LNNA 2ZZFA 1XCBA 2VYQA 1UZCA 4N0BA 4EGZA 1B9NA 2QYUA 3OOUA 3PJRA 5FLXZ 3C2HA 2QEXI 1S3JA 4PJNA 2Z9OA 4XOTA 1IO2A 3QAHA 1K83J 2HS5A 3A02A 4WK8F 1ETYA 3FK7A 5LFAA 5EMNA 2FF4A 5LGTA 3R6JA 1FMWA 3BR5A 4OJLA 1A04A 2ZZGA 3SY2A 1U9NA 4MFEA 1T0FA 3U2QA 1CQTA 2DFIA 4ZCLA 3DKXA 4B48A 3I56B 1QZYA 3H9JA 3CCSI 2K9MA 4OAZA 2EPFA 5J1YA 2V9PA 1ZN2A 3A2KA 3FBIB 1QGYA 1QA1A 2E1RA 4AF7A 3FJOA 2PG4A 2KJBA 5F0HA 3HRSA 5IYBJ 3VWBA 2R3SA 3AG2H 2LF7A 3I59A 1XGOA 1U2RA 2FBIA 2R7RA 2EJRA 4C30A 1QVFB 3JQPA 2CUFA 1W0UA 1KD1D 3A1YA 3C2BA 1WFXA 4G7OF 1TWAJ 2DTZA 3GZ5A 3OR2C 4I7HA 3TQNA 4WX9A 1LLWA 1GUUA 2MBFA 2Q0OA 3OW7A 1K79A 4W8RA 3BC8A 2DT6A 4A5MA 4HOBA 2MD0A 3QYBA 1E3ZA 5GV8A 5LHHA 1YJ9B 3G1MA 4LLNA 1BX1A 2EIKH 2IA0A 2DT7B 3SLDA 2CFOA 2A61A 3FXQA 3ZQIA 2A5YB 1WOPA 4F92B 1XPXA 2XRNA 4LBZA 2LG4A 2V1XA 1DP3A 1IHMA 1TUIA 2H1KA 1V0EA 3ES9A 2CSOA 5IYCJ 1IJWC 4PSWA 2PMZA 3IH4A 1EJ9A 1CNEA 2JRMA 1ETQA 1OCPA 3ZMVA 1AOYA 4F93B 3W3CA 1K7AA 2ZKZA 4S05A 3CCRI 2VBVA 3WBKA 3CD6B 3S1RJ 4OZZA 3CUQB 3GUDA 4HX7A 4A93J 2HPMA 3BY2A 2RN7A 3F9KA 1YLOA 3K7AJ 1IRFA 3L2RA 3GYHX 2NOJB 1OPCA 1Y8QB 2LRDA 3GZ6A 1R5HA 2OBRA 1W5CC 4W8QA 2EFWA 4RDLA 4ANJA 4HNVA 4Z4YA 3T56B 2QA4B 3SXYA 5FLVA 2M0MA 4B43A 5GPAA 1VQNI 2B7BA 3MKZA 2IT0A 3I71A 3H5RA 3QFRA 4JBAA 2WY8Q 4IO9F 5IK2A 1AMOA 3CMYA 2O9LA 1Q82D 3G6EB 2ISZA 4HLXA 2XC7A 3CMAB 1SFXA 4G94A 2WAEA 2YPRA 4KUMA 3X2QH 3MZHA 2B0RA 3JTHA 3KP6A 2R7ZJ 3EUHC 3GQ9A 5KCMA 1F1ZA 2K9SA 2DMQA 3FXMA 4Y33A 2LH9A 1QG0A 4NC8A 4HV5A 2VASA 3K0LA 1VFCA 1G3YA 5C4XJ 2GA1A 3G1LA 4RD1A 3TBIA 3O6BB 3K69A 4TV7A 3K4BA 2QKLB 1MZBA 3NAUA 4XN0A 4D7MA 4D7NA 5GTHC 1LPQA 3GTOJ 3R61A 4DGWB 2FBHA 2C5HA 1KYWA 4DQ2A 3GCMA 4IHSA 2V4DA 1MNEA 4G7WA 3BTIA 1JRGA 2HVQA 4HWVA 2YX7A 3BOQA 4L0YB 2HOSA 5E20A 4QPQA 2PJRB 4YZXA 5K7FA 3S16J 2ZMEB 2VE9A 1IXRC 1S7EA 1E64A 1FSEA 2VFQA 2EB7A 3OZUA 2X0KA 1YRNB 2DCEA 2XIGA 4MIMA 5K5RA 5LEJA 4A3JJ 3QYFA 2V9KA 1HW2A 4RD2A 2VBTA 1D2EA 3VSVA 4RLQA 1FTZA 1I8DA 3ZMUA 1H9TA 2BPOA 3HIFA 3CCMI 1BR2A 1YW8A 2H94A 5CVUA 2MH2A 1MBHA 2ZFUA 3WNBA 3SZEA 3ASSA 2ZNYA 2ZXIA 3TOBA 4DOZA 2EINH 3V7AA 1BR1A 1P4WA 3OWTA 3HL2A 1I3QJ 3K10A 3KX2A 4P25A 1LEBA 4NQWA 3CB4A 3TDUC 1KYZA 3LSMA 4BY7J 2JJ7A 1T38A 2QXZA 4FX4A 2BEOA 2RVCA 5H59A 2Y75A 4M3FA 1ZG5A 2XAQA 2HYJA 4Y4RA 4QFMA 2LBFA 4HNUA 2HTSA 1MMAA 3J80Z 4BL0B 1S72I 1VHEA 2DTRA 2MG4A 3OYKA 2VBXA 4YZAA 1J75A 2CO5A 1QBJA 2NS7A 1X1DA 4WZKA 2E1BA 3QPSA 1DBOA 1D1BA 4HA8A 1R49A 2FXAA 4XLEA 2DXIA 1UD6A 3CPXA 4ZGNB 1QGPA 2Y2ZA 2HXIA 2FQ3A 5D5WB 1E0EA 1EP3B 3LMWA 4MO7A 5FLMJ 5D6FA 1EFTA 2VFOA 2EBIA 1O57A 4BYYA 5M3FJ 1R7JA 2HZTA 3BH4A 3VR6A 1QA6A 3GTLJ 2DFFA 3VNUA 1NRKA 3F8BA 4XRSA 1KZHA 3HRUA 1BHEA 1VQ8I 2PBIA 4XKWA 3ZZUA 3BZCA 2IS6A 5HLIA 3S2DJ 2R7UA 2W7ZA 4XORA 3P9IA 1R22A 3ZQ7A 4NNJA 1G59A 1XE1A 4NC7A 5FB2A 3E6DA 3DPTA 1BX0A 2ZBUA 2X85A 2X1CA 5LEKA 1AIRA 3PUBA 3ZCOA 5FD6A 2L54A 2VLAA 2WC2A 5AN9A 3DKWA 1X3WB 3W6KB 3KP5A 5F4JA 5IPAA 2OAZA 3S32A 1XC5A 2X8KA 2BW3A 5BNGA 5CYVA 1VQ9I 2YWFA 2QY1A 1CF7B 1U0JA 2RV8A 4M9ZA 3ABUA 3MZYA 1APLC 1NK2P 3WQZA 2PE3A 1E1QA 1IB0A 1IDKA 3FISA 1O8EA 3DU1X 3FWEA 4EJUA 2XT4A 1SEUA 1K8FA 3QFSA 1U8BA 2M7AA 3S1NJ 3M8EA 4CCMA 4N4OB 3MVPA 1KJZA 2DI3A 1ZHFA 3CP8A 1FRNA 3CLQA 1BC8C 3ZN1A 1YS7A 3OS1A 3OYHA 1QPIA 1JTAA 5F0CA 1V5EA 3H36A 2BZTA 1I7PA 4FE7A 3BCDA 1OFDA 4ENMA 3VDXA 4FT8A 1WJCA 2YU9J 3GW2A 2GZWA 3KEQA 4YFOA 2ZB9A 3I58A 5TY0A 3B4NA 1K8AD 4EMSA 4U4BA 3ECHA 5E8GA 2XEXA 1FOXA 2K9LA 5FKNA 4EW9A 5DM6F 1DUXC 5GV7A 1HDPA 1BI2A 3FY3A 1STZA 2XF6A 5HLHA 2Y9YA 1FBUA 2JJ2A 2E36A 3OIQA 3U9GA 3ZQLA 2HKXA 2JA8J 2JUCA 2CBXA 2ESNA 3UKGA 4TMWA 3F23A 1PYVA 4UUSA 5JR3A 1WOSA 2OZ6A 2R7OA 4M3BA 1P4AA 2R7TA 3M07A 2CS3A 2C2WA 1RMGA 2DA7A 1IW7F 2M87A 1N8RD 4HX4A 5KK1A 1IG7A 1BIBA 3BG5A 2VKDA 3F6OA 2HQ5A 3F8NA 3PFIA 4JX5A 4JX4A 5IT3A 4X7FA 1VQLB 4G8XA 4PK4A 2DA3A 2M5SA 3BCBA 5FFXA 2D45A 3P26A 1S7AA 3W5HA 1XG1A 3EQLF 3L2QA 4Z4VA 1OYIA 3K70D 2PIAA 2BVLA 1UMQA 2XAFA 1V4RA 3BJAA 4BQNA 2PMHA 2Q2EB 3DTKA 1YJ9I 4G6QA 1KC8D 2X6WA 3PFYA 2DCUA 2LP0A 3MKYB 2IGOA 2M5WA 2P8TA 1Z67A 3SDBA 2EV6A 2R0QC 2R5ZB 1C0WA 3HDDA 1VBLA 1KQ9A 4DIQA 4KITB 1SC7A 1N77A 5E1XA 1KK0A 4X06A 2CK3A 2YWEA 1AKHA 2QQBA 5F1RA 2RAEA 1E63A 4II2A 1HBXG 2PQ8A 2QQ9A 3BZKA 3JURA 3DXJF 4RCYA 2FEZA 3M1EA 1WMRA 1KQ5A 5CPRB 3DPUA 2DA1A 5E3LA 3GVJA 4NHJA 4G7XA 4RM2A 2Y69H 1Y6IA 4L9VA 4Y9RA 2O7OA 2C78A 2GK6A 4BHBA 4XKCA 3KIOA 1ZLJA 2XPVA 4V19K 1E3PA 1YYVA 5ERIA 2VKHA 1RESA
chains in the Genus database with same CATH topology
1OB0A 3QYEA 3ZPPA 3D5RC 2O1DA 4FETA 2HQAA 2W1OA 4E7LA 1NHCA 3VSUA 4ZC3A 2HZDA 2Y0SA 3PNVA 2BOLA 2VL8A 3RPUD 3DKYA 4LIVA 2WSSA 3H5NA 2DOAA 4CCOA 3OIPA 1O8JA 2BW3B 2F6CA 2KLOA 1O8LA 2XSJC 3LFUA 4U49A 3HXLA 3KEYA 4B44A 4URRA 2HDWA 3VYRB 2PYHA 3DLAA 1O8MA 2KMUA 2ZTNA 2VQLA 3BG7A 1ZELA 1MNDA 3HKZA 4D9JA 3ZRGA 1DQUA 2KDOA 2V7FA 4F52A 1W9XA 2LZJA 5AMVA 2GK7A 1VLYA 3G2BA 3TL4X 2CV1A 4BJ5C 1GLNA 1E79A 3CZ6A 3PSFA 3HAGA 3CJRB 4P22A 2JIZA 4BE1A 3H9QA 3HPGA 3WWGA 1LKXA 1LVKA 4BE2A 3S8PA 3S3NA 3S3MA 4DK1A 3GVKA 3DTIA 3VMVA 4E4HA 1DGRM 3EQOA 4XKBA 3C2GA 3A35A 3AFHA 2JA2A 3VSLA 3VYSB 2WPDA 2IS2A 5DN6A 3HPHA 4OAYA 4E7KA 3AL0C 2HU9A 3AKZA 4DNRB 1HA8A 3KEWA 2NTBA 1X1AA 4TSFA 2O0WA 3V42A 4DJAA 1W0JA 1VF7A 3OOCA 2VQCA 1PXZA 4AVZA 3GQAA 3GQBA 1KCCA 4ZDOA 2JVHA 3RQ4A 4PUSA 3W2WA 2RNGA 3OS2A 2LYCA 3OYFA 1UD4A 2RQQA 4RMNA 5KHDA 3E1SA 3SZGA 4B3FX 3L2VA 3OYJA 2WJVA 4BGDA 4X0GA 3OYDA 3DU5A 2XZPA 2HNHA 3NE5B 4F3QA 1SAUA 2LC2A 2WADA 4I84A 4D1QA 3HG9A 3ZGKA 3SEQA 2A6TA 4HSTA 1J09A 3VYUB 4BXFA 4ZJZA 2NSTA 4L8JA 4OJ6A 3B90A 1KZLA 3H94A 1V5FA 2R7WA 4NK8A 4ZTJA 2L2OA 2IGNA 4OZYA 4YELA 1O88A 2VB6A 1PE9A 4KKUA 4BQQA 2IXSA 2WBMA 3LL7A 5FRMA 3H9GA 2VJ5A 3OMYA 3VSKA 2Z6BD 1HG8A 4U7BA 4Z03A 2JDIA 4UZUA 5CKTA 4AYBA 4BQOA 3UNGC 3KRGA 4LIUA 4BUPA 3RTRA 1UD2A 3GVLA 3OL3A 3OYMA 3M8JA 3ZXSA 2X6XA 4J01A 2R7XA 3OFNA 1T95A 2LREA 3QODA 2IGKA 3K70C 1FX0A 2WZPP 4XMYA 4XD7A 3ZQQA 4CUGA 1KONA 3OL4A 3OR1C 4OJPA 3OAAA 1MABA 4HSRA 4E7JA 2L7KA 2UWMA 2IGMA 1WPCA 1WJAA 3S93A 4KKTA 2VBMA 1YX3A 2V1NA 2MYSA 1WJ5A 2ZXHA 4RLFA 3OYIA 1X1BA 3GRHA 2VXDA 4E6KG 3OYCA 3DEEA 2ELJA 1I18A 3CJQB 2IS1A 1JI8A 3MKWB 1SKYB 2HVRA 3FHNA 2F5VA 3K4JA 4BJ6C 1PJRA 3FBNB 4CSWA 1V0FA 1OGOX 1UELB 5HLTA 3T51B 4XKVA 2W6IA 2XOKA 2JVGA 2W6JA 2ZZEA 1P9QC 3RCOA 1H8HA 1SFKA 4IKFA 3KYLA 5C1EA 1Y56A 2DIEA 2R4GA 4XN3A 3BC9A 2MABA 4KJZA 4II3A 1BLIA 4E0FA 1QHHD 2AQFA 4YZ0A 3BCAA 4JMQA 4HEA2 1UD3A 3HC7A 4IX7A 1QHGA 2MC4A 4HPQA 2UV1A 2W4SA 2O5RA 1WJDA 3UR3C 3DTEA 4ZTFA 2PJRA 3LNNA 3FPPA 1Z3YA 2ZZFA 1OFMA 2X51A 4Z05A 1E1RA 3GQ7A 4XM3A 3OOUA 3PJRA 4OWRB 3C2HA 2CV2A 1E3XA 4PJNA 4C2LA 4XOTA 3D5LA 3LSIA 4N4NB 3RSNA 3PL8A 5LFAA 3L2UA 3SEZA 1FMWA 3ZIAA 4OJLA 2ZZGA 3T9GA 5FL7A 4XOPA 4XLAA 4XR6A 4G6TB 1D0YA 3DKXA 4KKSA 1WJBA 4B48A 4DBQA 3CESA 3H9JA 2GJRA 2K9MA 4OAZA 2BSPA 3ZSCA 3A2KA 3FBIB 1BPLA 1KTWA 2L5QA 2ZSIB 2NTPA 3VWBA 2E60A 2INVA 2R7RA 1OR7C 2K3PA 1MMNA 4C30A 2W7NA 4E7ZA 4IQ4A 3OPOA 1EFRA 3A1YA 4PFPA 1WFXA 5HVQC 3OR2C 1G8XA 2HPIA 2V31A 4AU7A 4Z06A 4FASD 3K4NA 2DJIA 4YEJA 1UD5A 3OW7A 1AA7A 4W8RA 2VPLA 3BCFA 3BC8A 2DT6A 3EUKL 2PYGA 2MD0A 3QYBA 5JHFA 3IP4B 4IZZA 1E3ZA 2LOOA 3OY9A 1HZEA 1H80A 4E7IA 2JJ1A 3DWLE 2DT7B 2GOMA 2CFOA 4XLCA 4E7HA 3VMWA 4C2TA 1S9HA 1OGMX 1IB4A 4F92B 2GOXB 4W8SA 2LG4A 1DP3A 4W8TA 2R7VA 1V0EA 1O8KA 4GRIA 4BJTA 1N75A 2PMZA 1OLTA 4PSWA 2IQ7A 4F93B 3W3CA 2K5CA 3LSHA 3M1CA 5FRNA 4PFOA 4XLHA 1FMVA 4BACA 4OZZA 3OYGA 2HPMA 2OV7A 3K4KA 3F9KA 2WA0A 4ITVA 2CW7A 4LG3A 4Y3OA 2O04A 2O17A 2F4IA 2V4JC 4YXWA 3L2RA 3LSGA 1BR4A 2NOJB 2NZMA 2LRDA 3LSKA 4W8QA 2VJ4A 4H4KC 4ANJA 3T56B 3D5SC 5HOOA 2M0MA 4B43A 2LY2A 4CCJA 1VZ0A 3OE7A 4XONA 3MKZA 4MLOA 2BVMA 3H5RA 3HUGB 3K4CA 4B3GA 1NG6A 2WY8Q 1WJFA 2XF5A 3CF2A 5IK2A 4BU2A 2VBKA 1T0FC 2R9VA 2XDVA 4YRVA 2CV0A 3B8YA 2XC7A 2L9NA 1OOCA 2WAEA 1OHHA 4E7SA 3DQVC 3EUHC 3GQ9A 5KCMA 4Y33A 2LH9A 1MMDA 4NC8A 2VASA 4B47A 4HIZA 3FDYA 5LD2C 3TBIA 1KCDA 2KPMA 4CCLA 4DK0A 2OC6A 3OYLA 1MW7A 3K4BA 2VBEA 1W36C 2QKLB 4XN0A 3OEEA 3A4CA 4DGWB 2M7BA 4HRIA 2GJKA 2V4DA 1MNEA 4G7WA 1JRGA 1K6YA 2HVQA 2Z2SB 2X3HA 4HWVA 4OJ5A 4NQWB 2KQRA 1LFPA 1YE9A 4QPQA 2PJRB 1T5EA 2FUG2 4YZXA 2L9SA 1CZFA 1PLUA 2X1DA 2M4GA 3ZR8X 5HNHA 2IS4A 2A5WA 4XQFA 4BE0A 4CCKA 2DCEA 3W2VA 4FXUA 2R7QA 3QYFA 2V9KA 4BEHA 2HLDA 2CW8A 4RLQA 3VSVA 1I8DA 3OYEA 1X0CA 1X1CA 2I8DA 1BR2A 2GJPA 2OUMA 2V26A 2ZFUA 3H35A 2D3NA 2ODLA 2ZXIA 4ZDPA 4DOZA 2V7QA 4GQNA 4ASUA 2CMPA 2X6YA 4BDYA 1BR1A 3HL2A 3OWTA 1GQ8A 1BOBA 5CDFA 3K10A 3KX2A 3ZPNA 4PJMA 1QJVA 2E1MC 2F1MA 3LSMA 2QXZA 3GQ8A 4YZQA 3A3GA 1V5GA 2VJIA 4Y4RA 2LBFA 4HNUA 3MD2A 5TGTA 2WJYA 3JU4A 1RWRA 3IUOA 2M4KA 1MMAA 4CCNA 4YZAA 4BL0B 2KL4A 4CZCA 3OYKA 2E5NA 4DNTB 2CUJA 2UVFA 1X1DA 3EUAA 2E1BA 3QOEA 1DBOA 1D1BA 1X19A 1O8DA 4XLEA 2DXIA 1UD6A 4XNFA 1O8IA 4NUBA 3NWSA 3I3LA 4EATA 4ZYAA 1E0EA 2VQGA 2X1EA 1IA5A 3LMWA 5C1CA 4RM3A 4Z1MA 4U87A 5HKKA 3K4LA 2EWEA 3BH4A 3VR6A 1TT0A 2P0WA 1NRKA 3OYNA 1MMGA 4C2UA 4XLFA 3MMYB 2KP6A 3BG6A 2CUZA 4G6IA 4TT3A 1BHEA 5KNLA 2Z16A 4XKWA 1DBGA 2UVEA 2IS6A 3HOSA 2R7UA 4P5OA 3PSIA 3G05A 4PJLA 4XORA 1RU4A 2MFZA 2ZZQA 4NNJA 1IRXA 2E1MB 2W82A 1G59A 1WTHD 4NC7A 1WJEA 3DPTA 3UW0A 1UG0A 2X53S 2X85A 2X1CA 2WAFA 1AIRA 4MXNA 3U21A 3PUBA 2KRCA 3ZCOA 2D3LA 2XNDA 4PMHA 3S3OA 4R79A 2VLAA 1Z7LA 2XGJA 4JOMA 1D1AA 3H5AA 3EPZA 3PNYA 3S32A 4CA0A 2X8KA 2BW3A 2V6EA 2QY1A 1EA3A 2VJJA 1U0JA 3H0DA 3WQZA 4PJJA 1E1QA 1IDKA 3GBGA 1O8EA 2LY1A 1W0KA 2E5ZA 2INUA 2M7AA 3A3BA 2QKMB 1UAAA 4OJOA 4CCMA 2W00A 4N4OB 4JQFA 4LITA 4BS9A 3CP8A 4XL9A 4HNTA 2KVOA 3CP2A 1LDKB 3OS1A 3OYHA 1JTAA 2NSPA 1V5EA 2KHMA 4IQJA 2CH0A 3BCDA 2WB1A 4ZDLA 3VDXA 2NTQA 2XZLA 1WJCA 2O0VA 1OFLA 2WY7Q 3B4NA 3BLYA 3DDYA 4U4BA 4DBRA 4BEHB 2K9LA 2ZTGA 2VXZA 3PNTA 4EW9A 1D0XA 2ZSHB 2XAUA 3OYBA 3HOTA 3FY3A 2XF6A 2AQEA 2JJ2A 3VSTA 4NK6A 4MR0A 2QX3A 3OIQA 3FKSA 1KMHA 4C9YA 3EQNA 2F43A 3AL0B 2PECA 3SUCA 2WAQA 1PYVA 1X4OA 1BN8A 1Z21A 2R7OA 4QPOA 2R7TA 1BMFA 5HNFA 2CS3A 2XZOA 1O8HA 1RMGA 4CH7A 1COWA 1VJSA 1EE6A 1DGWY 1HVXA 1NG7A 4KT6A 1Z3XA 1D1CA 2VKDA 3TMOA 3FKJA 3IAS2 2RREA 3DPLC 2LBFB 4F55A 1E43A 3NWTA 1QCXA 1XG2A 4PK4A 2M5SA 3BCBA 1R6RA 3J7AY 3OS0A 3E0JB 3L2QA 3T53B 3K70D 1K28D 2BVLA 2R7SA 4P1WA 3IAM2 3I9V2 1TZLA 4PSXA 3VYTB 1WP6A 3LMMA 2Q2EB 4BQNA 3DTKA 2X6WA 4HG2A 3PFYA 2KZVA 4F91B 3MKYB 1H8EA 3OYAA 2IGOA 3CMMA 1W36D 3SDBA 3DU6A 1VBLA 4KITB 2Q1ZB 4DIQA 4J00A 1N77A 4B3XA 2CK3A 3K4MA 5FROA 2Z1DA 2UUZA 5CQEA 3N05A 1X4PA 4II2A 1YX5A 1ERDA 2VQHA 1IDJA 3W2AA 1O8FA 2KRHA 4TKOB 3JURA 1WMRA 3ONQA 2M3AA 2HVSA 2VIXA 4KISA 5CPRB 3DPUA 1PKVA 3GVJA 4G7XA 1K5CA 1D0ZA 4RM2A 1UD8A 1Y6IA 2Z8GA 2QE7A 1O8GA 4BDZA 3OEHA 2GK6A 2JUGA 3L2WA 4XKCA 2XF7A 3K6GA 3SYTA 2JSPA 5CQGA 1N78A 1QU3A 2NT6A 2NT9A 1NBMA 2VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MXN A;  3ZPP A;  2O1D A;  4PMH A;  1OGO X;  2VBK A;  4C2L A;  3VSU A;  1NHC A;  3B8Y A;  4XKV A;  1O8J A;  1OOC A;  1O8L A;  3GQ9 A;  2QY1 A;  4U49 A;  2VJJ A;  5C1E A;  4URR A;  2PYH A;  1O8M A;  4XN3 A;  1IDK A;  1O8E A;  1KCD A;  2VBE A;  2INU A;  4XN0 A;  5AMV A;  4YZ0 A;  4OJO A;  1JRG A;  2X3H A;  4XL9 A;  4HWV A;  3WWG A;  4OJ5 A;  3VMV A;  1JTA A;  1OFM A;  2NSP A;  4YZX A;  4Z05 A;  3EQO A;  1CZF A;  1PLU A;  3GQ7 A;  4XM3 A;  2NTQ A;  2O0V A;  1OFL A;  3B4N A;  4XOT A;  4XQF A;  4U4B A;  2NTB A;  3VSV A;  2O0W A;  4EW9 A;  4OJL A;  3T9G A;  4XOP A;  4XLA A;  3FY3 A;  4XR6 A;  1PXZ A;  4AVZ A;  3GQA A;  3VST A;  4NK6 A;  4MR0 A;  2BSP A;  2QX3 A;  1KCC A;  3EQN A;  2ODL A;  3ZSC A;  2PEC A;  1KTW A;  3SUC A;  1GQ8 A;  2X6Y A;  2NTP A;  1BN8 A;  1RMG A;  1O8H A;  1QJV A;  2INV A;  1EE6 A;  2QXZ A;  3GQ8 A;  4YZQ A;  2VJI A;  1XG2 A;  1RWR A;  1QCX A;  4I84 A;  4Z06 A;  4YZA A;  4YEJ A;  2NST A;  4OJ6 A;  3B90 A;  4W8R A;  2UVF A;  4NK8 A;  2PYG A;  1DBO A;  1H80 A;  1OGM X;  1O8D A;  4XLE A;  4OZY A;  4YEL A;  2X6W A;  4XNF A;  1O8I A;  1O88 A;  1PE9 A;  4XLC A;  3VMW A;  1DBG A;  1HG8 A;  4Z03 A;  1IA5 A;  1IB4 A;  3LMW A;  1VBL A;  5C1C A;  4W8S A;  4W8T A;  1O8K A;  2EWE A;  3KRG A;  2IQ7 A;  1X0C A;  4XLF A;  1IDJ A;  1BHE A;  1O8F A;  2X6X A;  4XKW A;  4XLH A;  3JUR A;  4OZZ A;  2UVE A;  1WMR A;  4XMY A;  2O04 A;  2O17 A;  4OJP A;  4XOR A;  1K5C A;  1RU4 A;  2NZM A;  2Z8G A;  1O8G A;  4W8Q A;  2VBM A;  2NT9 A;  3UW0 A;  2NT6 A;  3GRH A;  2X85 A;  4XON A;  1AIR A; 
#chains in the Genus database with same CATH topology
 1VQK I;  4E7L A;  4Y13 A;  1QGZ A;  4OIQ F;  3VSU A;  3CCE B;  1E3O C;  3L1P A;  3G6E I;  1J9Z A;  3CMA I;  1O8J A;  4A6E A;  3CC4 B;  2D74 A;  2F6C A;  1U6G A;  2OCC H;  4AWX B;  4G1B A;  1ONV A;  4RS8 A;  3SZT A;  3HXL A;  2VC0 A;  2FU4 A;  4KN7 X;  4A5N A;  3KEY A;  4B44 A;  1G3W A;  1R71 A;  1H88 C;  5L3C A;  2ADU A;  4I99 C;  3IWZ A;  1BW6 A;  1XB4 A;  2ACJ A;  1FOK A;  1KU9 A;  3CDL A;  4QSH A;  3KLO A;  1YI2 B;  1MND A;  3C3W A;  2Y0S N;  4M6X A;  3ZRG A;  1DQU A;  1J5Y A;  4F52 A;  4B09 A;  1RZ4 A;  2UZK A;  1W9X A;  2IA2 A;  3A8I A;  4RPB A;  1KA8 A;  2GK7 A;  2B7C A;  1VLY A;  3G2B A;  2ELH A;  2L4A A;  1JJ6 C;  1E79 A;  2IA1 A;  1QFZ A;  2P5K A;  3CJR B;  1J9I A;  3BQJ A;  3GLL A;  3LOC A;  1GXQ A;  1QRY A;  3R6K A;  3G3Z A;  3WWG A;  3GSI A;  4BE2 A;  1KQ8 A;  4UB8 C;  4RA2 A;  2YSR A;  2JPB A;  1XGS A;  2IAI A;  1E62 A;  5EGO B;  3C2G A;  4ZH4 F;  5DNS A;  2JA2 A;  1W7P D;  1QUE A;  1KU2 A;  4D5F A;  4X0C A;  2DQR A;  4OAY A;  2F4M B;  3AKZ A;  2ZL5 A;  5H5J A;  3DCF A;  3KEW A;  1V5V A;  4AD9 A;  4OM9 A;  2G7U A;  4P3I A;  2TCT A;  3IV5 A;  1XGN A;  3BG9 A;  2VQC A;  4KMU X;  2OF7 A;  1PXZ A;  5J6X A;  1PVE A;  3AG1 H;  3S1M J;  1FNC A;  2L9R A;  3CC2 B;  2HR3 A;  2XGC A;  2O8X A;  1J59 A;  3TP3 A;  3OS2 A;  2XTY A;  3CO7 C;  3E1S A;  1FNN A;  1JGG A;  2WJV A;  2BHZ A;  4RB0 A;  5HZB A;  4ZYD A;  2DMU A;  1USS A;  1KGS A;  2D1V A;  4O3M A;  3DU5 A;  3AST A;  2LC2 A;  1LFB A;  2RGV A;  2XKP A;  1SFE A;  3PA2 A;  4FE4 A;  2FVG A;  1QRC A;  2I10 A;  2EZI A;  3BR0 A;  3AAF A;  3PUN A;  4L5I A;  1GXP A;  4FN5 A;  1ZGW A;  1EH6 A;  2VE8 A;  5TJJ A;  2FBK A;  3AVU A;  2DA4 A;  3P5J A;  2HI3 A;  3H3U A;  4A6D A;  3GTP J;  2HTJ A;  2GLO A;  4OZY A;  1IXC A;  4KDP A;  1QQI A;  3ZN0 A;  4IRG A;  4KKU A;  4BQQ A;  1D8T A;  3VSK A;  1T98 A;  2DDA A;  4U7B A;  2JDI A;  5CKT A;  2BE5 F;  4BQO A;  3UNG C;  1KQS B;  1VND A;  1YLF A;  2DYR H;  4GYG A;  3RTR A;  2B63 J;  3ONU A;  2EZK A;  4YAF A;  3C18 A;  2VFP A;  1Q81 D;  1DU0 A;  4I09 A;  2QTZ A;  5DUK A;  3RZO J;  3HGG A;  1Z9C A;  1TWC J;  2LRE A;  1FX0 A;  3OFN A;  3I5U A;  5K5O A;  2Q6O A;  4XD7 A;  3ZQQ A;  1T6Z A;  1KON A;  2HWV A;  1FBQ A;  3JW4 A;  4YFN F;  4WWC A;  2IRF G;  2YUH A;  3W2G A;  1Y39 A;  1W7P A;  2UWM A;  2IGM A;  5HOD A;  3S93 A;  2VBM A;  1VF9 A;  2MYS A;  1XN7 A;  2FOW A;  1X1B A;  2D1H A;  5EZG A;  3GRH A;  4E6K G;  1YIJ B;  2HOA A;  1UFM A;  2H27 A;  2IS1 A;  1JI8 A;  4PCQ A;  3MKW B;  1SKY B;  2F5V A;  4BJ6 C;  2R5Y A;  1BJZ A;  3FBN B;  3BR6 A;  4IRH A;  3D0S A;  3FMS A;  4HZF A;  5HLT A;  3HOY J;  3T51 B;  1FYK A;  2FOK A;  2JVG A;  4BHP A;  1K78 A;  2FQ4 A;  1JHH A;  2BF4 A;  3BR3 A;  3RI4 A;  2LR8 A;  4NBQ A;  3I54 A;  2AXT C;  4PC2 A;  3JRC A;  2K40 A;  2FE3 A;  4IKF A;  4AIH A;  3QPT A;  5E18 F;  1Y56 A;  4KIC A;  1R5G A;  3PM1 A;  2MAB A;  4XRM A;  4X6A J;  4C0S A;  1REP C;  1BLI A;  2K02 A;  4MYU A;  4E0F A;  2YS9 A;  1EFU A;  3KL9 A;  2V1D A;  1VLO A;  3ZOB A;  1JHF A;  2ME6 A;  3SKB A;  1HST A;  3HC7 A;  2MSY A;  3H09 A;  2JWT A;  1QHG A;  2MC4 A;  3HGY A;  3LQR A;  1D1N A;  2MGQ A;  3I59 B;  3COA C;  1GV5 A;  2J7K A;  3I53 A;  3UR3 C;  4ZTF A;  2CFX A;  1OFM A;  2M45 A;  3Q9V A;  4B3A A;  2QVO A;  4ENN A;  2KIU A;  4L9N A;  1BOA A;  2CV2 A;  4S0H B;  1E3X A;  2HDN B;  1TTT A;  1UHM A;  3D5L A;  3HM5 A;  2L7F P;  3CCJ I;  1CLW A;  1HF2 A;  1ZRF A;  3PL8 A;  1BJA A;  3ZIA A;  4FQG A;  4ON0 A;  1XMK A;  2F4O B;  4A3D J;  4EM1 A;  4XR6 A;  2EV5 A;  3KLN A;  1WJB A;  4DBQ A;  4KKS A;  1X1P A;  3S2W A;  2BSP A;  1JA0 A;  2BM6 A;  3ZSC A;  3B82 A;  1HOM A;  2NTP A;  5EF6 A;  2GIV A;  4IOC F;  3ZZT A;  1RC9 A;  4A69 C;  1OR7 C;  2UXX A;  2W7N A;  4HF1 A;  5DV5 A;  2ESH A;  3OPO A;  2JRT A;  4PFP A;  2STW A;  3WHC A;  5HVQ C;  4CYC B;  1VQL I;  3T8R A;  2V31 A;  4AU7 A;  2GXB A;  4FAS D;  1A36 A;  1N05 A;  2JN6 A;  4DQL A;  5GAE J;  4Z06 A;  3P9K A;  2K9Q A;  3RYP A;  4P9U A;  5GTI C;  2VPL A;  2BX6 A;  5EEH A;  4MTE A;  5J1U A;  2PYG A;  4RGU A;  1HZE A;  3LVB A;  3H92 A;  2C4U A;  3DWL E;  5L46 A;  2GOM A;  4XLC A;  4E7H A;  3I4M J;  1PUF A;  4HX8 A;  3ONY A;  3JAM Z;  4W8S A;  4EJV A;  2XPU A;  5F27 A;  3Q38 A;  4W8T A;  1LVA A;  4G9Y A;  4GRI A;  4A3L J;  2K86 A;  4JYK A;  2ECC A;  4M3E A;  4BJT A;  2QLZ A;  1OLT A;  3KP3 A;  5F04 A;  4TMV A;  2IQ7 A;  5EZH A;  3HYI A;  4DYC A;  1KQ0 A;  3M1C A;  3CUO A;  4XLH A;  3LNQ A;  5IY5 H;  5K7Z A;  5IP7 J;  1GR1 A;  2DA5 A;  2O3F A;  2OV7 A;  4LG3 A;  2G7H A;  2CW7 A;  4RCZ A;  3J81 k;  2O04 A;  1XTA A;  2V7W A;  2B7E A;  2Z33 A;  2EA4 A;  2NZM A;  2XVC A;  3LSK A;  4XK4 A;  4BXX J;  3D1N I;  1RRJ A;  4H4K C;  2Y31 A;  3DP7 A;  1JT0 A;  1SFO J;  1ZYR F;  2RQP A;  2RC6 A;  5HS7 A;  4CGZ A;  2OTL I;  2LY2 A;  3LA3 A;  5BPD A;  3GLX A;  1GO2 A;  4XON A;  2DEU A;  2EIM H;  1DAB A;  2BVN A;  1S0U A;  4MLO A;  3HUG B;  4B3G A;  3K4C A;  1WJF A;  3CF2 A;  2FNP A;  2R9V A;  3ZMD A;  1IV6 A;  3CCE I;  1ZG3 A;  2L9N A;  3I0T A;  2LKX A;  1JT6 A;  4DNC A;  3HOW J;  2VOP A;  1Z6T A;  2M8G X;  1NB9 A;  5BMZ A;  4X7E A;  2BMW A;  4ESF A;  4L18 B;  5ICG A;  3IHU A;  3GFJ A;  1BW5 A;  2PMU A;  4IPA A;  2O03 A;  3FDY A;  4MTD A;  5GP9 A;  1PP8 F;  2AHO A;  4M3G A;  2KPM A;  1YI2 I;  3BH7 B;  2WB1 N;  9ANT A;  2XRL A;  3OYL A;  2VBE A;  1W36 C;  1RR7 A;  5LRS A;  3TO6 A;  1LEA A;  4Y7C A;  4Z4U A;  2M7B A;  5HDG A;  1WWX A;  4WXC A;  2DER A;  1UHW A;  2X3H A;  2PFB A;  4NQW B;  3EYY A;  4WF2 A;  2KQR A;  4RD3 A;  3ZBU A;  2LF8 A;  1YE9 A;  2QSG X;  3ZZ0 A;  1T5E A;  4E70 A;  1CZF A;  1XQB A;  1PLU A;  2I1L A;  2LKS A;  4RB1 A;  5H20 A;  1O7F A;  4XQF A;  4CCK A;  2WAQ N;  1Y0Y A;  5F08 A;  2GAU A;  2R7Q A;  3AG3 H;  4LGW A;  1MDM A;  2C77 A;  5TIS C;  2N8G A;  1IZ1 A;  3LO8 A;  1P4M A;  5IYN A;  2OBS A;  1WI9 A;  1A8P A;  2IOU G;  2CQK A;  3OYE A;  1U5T A;  2HFH A;  3LAJ A;  2DPD A;  4RJL A;  2NPF A;  1S29 A;  2I8D A;  1H9G A;  1SVM A;  2ZFW A;  2D3N A;  3CC2 I;  2GXG A;  5H6Q A;  3CXC B;  3ASN H;  1A31 A;  3SDG A;  3SHF A;  1GQ8 A;  2DMN A;  1BOB A;  3CJN A;  5CDF A;  3ZPN A;  2ZJP F;  2DT5 A;  4Y52 J;  1QJV A;  2E1M C;  5H2F C;  2DW4 A;  1TLH B;  2F1M A;  3GQ8 A;  4YZQ A;  5ICC A;  1GHC A;  1SVL A;  1V5G A;  2C4T A;  3KP7 A;  1QA2 A;  2AS5 F;  2DK5 A;  1FYL A;  2WJY A;  5TGT A;  1RWR A;  3KYC B;  1QNT A;  2XKO A;  4CCN A;  3J80 K;  2EV0 A;  1ON2 A;  4BNC A;  4DNT B;  4C2M J;  3E6M A;  1UMK A;  2HGC A;  3ABT A;  4YEI A;  3EUA A;  1L1I A;  1AU7 A;  3JRI A;  5DM7 F;  3TED A;  1F4K A;  1W2B B;  3ZMZ A;  1O8D A;  1SKQ A;  1L0O C;  3J7Y J;  2KDZ A;  4YII A;  3JX8 A;  3I3L A;  4EAT A;  3CUQ C;  1TQP A;  4ZYA A;  1MGT A;  1X58 A;  4D5C A;  1IA5 A;  3VFZ A;  4RM3 A;  3NEU A;  5C1C A;  1TWG J;  4IEJ A;  3OSG A;  4MYT A;  3K4L A;  1SVO A;  4OOS A;  3ZMS A;  1SM4 A;  3FXR A;  5B1B H;  3A01 A;  2P0W A;  2O61 A;  1MMG A;  4C2U A;  2ZXW H;  3BG6 A;  2CUZ A;  2ETH A;  1MD0 A;  3AG4 H;  3JRB A;  1FNM A;  1R5B A;  4KH3 A;  2Z16 A;  3IWF A;  3VNV A;  3MZ8 A;  4RGS A;  4UAJ A;  3CCQ I;  2HMA A;  3PSI A;  4PJL A;  2XT2 A;  1S5L C;  3BZ6 A;  2ZZQ A;  2BY3 A;  2E1M B;  1WTH D;  1YOV B;  3UW0 A;  4ENK A;  1YIJ I;  3OJW A;  4AIK A;  1U78 A;  4BBS J;  4TMZ A;  4R79 A;  4CYD A;  2BY2 A;  5DCM B;  4A0X A;  2LMD A;  4U0Y A;  1IUF A;  4JOM A;  4P1V A;  1YHQ B;  2EZL A;  1D1A A;  2A05 A;  3EPZ A;  4CA0 A;  2V6E A;  4ETS A;  5FKO A;  3O3K A;  4YAL A;  1FOY A;  2BM0 A;  5A88 A;  3NAW A;  4YG2 F;  5DTD A;  1JKP C;  1QZZ A;  1EFC A;  4PJJ A;  5HS9 A;  3NQO A;  2V6C A;  2KIF A;  1FP2 A;  3GBG A;  2O6G E;  4A3I J;  3U6B A;  2COB A;  3W6J B;  3FIW A;  2EFO A;  3O8G A;  2LY1 A;  4IF4 A;  2ZME C;  2E5Z A;  2OPT A;  2INU A;  5EG0 B;  4X7C A;  3DBL B;  2E1O A;  2E34 A;  1ITY A;  2F4N A;  2Z99 A;  1UAA A;  2QBY A;  2XTW A;  1SD5 A;  4YAO A;  1DPU A;  2EK5 A;  4BXU A;  4CO8 A;  4BS9 A;  1CQX A;  5ILU A;  2KIS A;  1WZ2 A;  5IOZ A;  4HNT A;  3WTX C;  2A07 F;  4JK1 X;  2KVO A;  1LDK B;  1Q86 D;  2NSP A;  2KHM A;  3FX3 A;  4AID A;  2CH0 A;  4G6D A;  1R5I D;  4ZDL A;  3BWG A;  1O3T A;  4HE5 A;  2XZL A;  3PQK A;  1OFL A;  3QP5 A;  3MCA A;  3BPX A;  5CLS A;  1ZRD A;  3Q3S A;  4QWQ A;  3NAR A;  4BEH B;  1I50 J;  1JTY A;  1MH4 A;  1FYM A;  1G7T A;  2VFM A;  3PNT A;  1ZUN B;  3SFZ A;  2VOD A;  1XMA A;  2ZSH B;  3R4K A;  4KT5 C;  1EH7 A;  1SAX A;  1Z6R A;  2XSD C;  2Q6K A;  1VQM I;  2AQE A;  3BDD A;  3VB2 A;  4NK6 A;  1B4A A;  3FKS A;  1KMH A;  4C9Y A;  1HSJ A;  3CDH A;  2F43 A;  3AL0 B;  3EQN A;  4AVP A;  1R5O A;  4P96 A;  2V5I A;  1G4D A;  1FC3 A;  3B6A A;  2QEN A;  1UB9 A;  3QPL A;  4YIF A;  1COW A;  1VQ7 B;  1DGW Y;  2K27 A;  2A6E F;  4F7Z A;  1NG7 A;  4KT6 A;  1TL8 A;  5CVR A;  3C1D A;  2QGG A;  2CQX A;  2RRE A;  4F55 A;  1J2X A;  4G7H F;  4ACB A;  1BI1 A;  1RPW A;  4AUX A;  2M30 A;  2RC4 A;  3OS0 A;  3E0J B;  1ETX A;  4CDG A;  1HKQ A;  3T53 B;  3SJZ A;  3CCV B;  1OB2 A;  2R7S A;  4P1W A;  1S6L A;  3I9V 2;  4PSX A;  3HSE A;  4HG2 A;  4RAZ A;  4Y7N J;  4EH1 A;  5DS9 A;  2AXL A;  3OYA A;  1W36 D;  1AHD P;  2QDX A;  3GTG J;  4Z4S A;  3G4S B;  2JA7 J;  5ED4 A;  2PN6 A;  1FJL A;  3H3V K;  3N90 A;  2PI0 A;  2H8R A;  4HYE A;  1EXM A;  1YQA A;  2ZNZ A;  3AGP A;  5FKL A;  4X7D A;  5FRO A;  1YFH A;  1XFO A;  1SAN A;  4PAB A;  2UUZ A;  1YX5 A;  4XSZ F;  4XRF A;  2V1U A;  2F5E A;  5IP9 J;  1YIT B;  4J19 A;  5B6I A;  2KRH A;  3CW2 A;  3WE2 A;  5E79 C;  4EGY A;  2DOG A;  4A3F J;  3ZQH A;  2HVS A;  1LB2 A;  3P27 A;  3SQV A;  1EKE A;  3ZUG A;  1YJW B;  5FJ8 J;  2CJJ A;  3A8K A;  5K7H A;  1DU6 A;  2Z8G A;  1O8G A;  2JUG A;  3TO9 A;  2H09 A;  1YIO A;  3K6G A;  4P2N A;  4W97 A;  4WCG A;  3SYT A;  2NT9 A;  2VFN A;  4Q48 A;  2NS0 A;  4M2L A;  2E1C A;  4MHG A;  1ORK A;  3QYE A;  3ZPP A;  3L7W A;  2DDB A;  4ROX A;  4FET A;  1IDY A;  2W1O A;  3F8F A;  3GO5 A;  3V8K A;  4RDU A;  2HEO A;  1NHC A;  4ZC3 A;  2HZD A;  1S4M A;  5E1Z B;  2Y0S A;  1OCC H;  5M5Y J;  1NH3 A;  1YJN B;  3DKY A;  4LIV A;  3H5N A;  2DOA A;  4M9S A;  3OIP A;  3E6B A;  2XSJ C;  4U49 A;  2VKE A;  1H0M A;  1Y0R A;  5DDG A;  2O8K A;  4URR A;  4RAG A;  2VNI A;  5ILS A;  4H9G A;  3JSO A;  4ZZL A;  2QMU A;  1ZR4 A;  1UG2 A;  1XSV A;  2CW5 A;  1ZEL A;  2EA2 A;  3HKZ A;  1J7K A;  2V7F A;  2JPC A;  1VQP B;  3F8M A;  2AHQ A;  2CV1 A;  4BJ5 C;  3HTS B;  3HAG A;  1ZM3 A;  1K4T A;  1SMT A;  2IJL A;  4BE1 A;  2COM A;  3H9Q A;  2XAH A;  1LKX A;  1WGX A;  1ODD A;  3PUF A;  3RQI A;  4V2F A;  5A2Q K;  2WZN A;  2XTX A;  2ZIT A;  2NAZ A;  3EQO A;  4OMZ A;  3A35 A;  2F5F A;  1I39 A;  1R00 A;  3VSL A;  4N3N A;  4M0L A;  2RDP A;  3HPH A;  1HF0 A;  4FX0 A;  3QSY A;  3OV8 A;  4WZE A;  3FMR A;  3HEF A;  5J8F A;  4PGG A;  3E1Y E;  2DY1 A;  3G73 A;  1IRZ A;  3OOC A;  4FCY A;  1FY7 A;  3WTZ A;  3DV8 A;  2W48 A;  5DEQ A;  1NBM A;  1KCC A;  3PUM A;  2GM4 A;  2JVH A;  1DPR A;  1T6S A;  4C3H J;  5HXB A;  2O0Y A;  2LYC A;  3OYF A;  1UD4 A;  2Y30 A;  3FM3 A;  5KHD A;  3SZG A;  1DAR A;  3WU0 A;  5E3N A;  3L2V A;  2Y48 A;  3P7N A;  1ZM4 A;  2V7U A;  1B8I B;  2ME0 A;  1RKT A;  4X0G A;  3OYD A;  4RDK A;  5FO5 A;  3PO3 J;  2HNH A;  1SAU A;  4I84 A;  4HE6 A;  1IN8 A;  2IVM A;  4MQV A;  2A6T A;  4HST A;  3VYU B;  3FHZ A;  1M90 D;  1ZR2 A;  1V55 H;  2PMZ N;  3H94 A;  4RDJ A;  1E3H A;  1FIA A;  1Z7U A;  1V5F A;  2R7W A;  3ASQ A;  2V7T A;  3EET A;  1Y1V J;  5J3L A;  3DBR B;  5AON A;  1DP7 P;  4YEL A;  4BY1 J;  1GAW A;  1ZM2 A;  1O88 A;  1G6N A;  2VB6 A;  3I56 I;  1BQE A;  3JR9 A;  2WBM A;  1DBG A;  1R1V A;  2Z6B D;  3H9G A;  2VJ5 A;  1HG8 A;  4Z03 A;  1P4X A;  1XS9 A;  3GFM A;  1QA3 A;  5A8A A;  4AYB A;  5FFZ A;  3KRG A;  1B59 A;  4UUT A;  4BUP A;  1GAQ A;  2CND A;  1QX4 A;  3GVL A;  1Z0X A;  3OL3 A;  1RQR A;  3ZXS A;  3S14 J;  1ZTR A;  2VBS A;  5ICE A;  3WU1 B;  1ETO A;  1T95 A;  3CUQ A;  3QOD A;  1FDR A;  2PLF A;  4LFU A;  3QWL A;  2KIQ A;  3T5X A;  1V3F A;  3B73 A;  3OR1 C;  2JA6 J;  1XMX A;  1LE8 B;  3HRT A;  4HSR A;  4IHV A;  1R36 A;  1MAB A;  1Q1V A;  2QSH X;  2EFG A;  4P3Y A;  3JRE A;  2ZXH A;  3QFC A;  4RLF A;  3OYI A;  3GVA A;  3JQQ A;  3HSF A;  3LWF A;  3WGI A;  3BQY A;  3KET A;  3DEE A;  4I0A A;  1P2F A;  2VON A;  1D8J A;  3FHN A;  3K4J A;  4LMY A;  3VOE A;  2M9H A;  3A0H C;  1OGO X;  1MBK A;  1Z77 A;  3SYJ A;  4ZV4 A;  1HW1 A;  1YHQ I;  5JVT A;  1AWC A;  4CHU A;  1H8H A;  3VO2 A;  3U6K A;  1FT9 A;  2H8W A;  1MBF A;  3CD6 I;  3ASO H;  3E7L A;  4A0Z A;  2CRV A;  2KJC A;  2R4G A;  5J8C A;  5JBQ A;  3BQZ A;  3BC9 A;  4II3 A;  2CRG A;  1T6Y A;  1OYY A;  3WND A;  3TP0 A;  1SMY F;  3G71 B;  2XGE A;  2AQF A;  2W85 A;  3N4M A;  3Q9S A;  4YZ0 A;  2QA4 I;  4DYQ A;  1ETW A;  3IC7 A;  5LGU A;  1ZKG A;  3BY6 A;  4HPQ A;  3Q0U A;  2HOT A;  2UV1 A;  3ELK A;  1F20 A;  3W5U A;  2PJR A;  2DYS H;  4Z05 A;  2BBY A;  3FPP A;  2X51 A;  3CJT B;  2ICW G;  3GQ7 A;  3CME B;  1NB0 A;  4P9S A;  3BPV A;  2R7F A;  2M2E A;  3LSI A;  2LVS A;  4N4N B;  3FKI J;  3RSN A;  2JMW A;  3ZBT A;  4HF2 A;  1MBG A;  1A6Q A;  1P92 A;  4L0Z B;  4G6T B;  4MGR A;  4KMF A;  3CES A;  4RD4 A;  1TVC A;  2P4W A;  3LST A;  2HQR A;  3L09 A;  4LLG F;  4XLN F;  1W35 A;  3EUH A;  5DS0 A;  2STT A;  2KRF A;  4M4S A;  1XDU A;  1W1W E;  1ETV A;  2Z3Y A;  3K1P A;  4CXF A;  5A2Q Z;  1MMN A;  1QRB A;  1VQ7 I;  1W0T A;  4UVB A;  4Y15 A;  1DDN A;  4UNO A;  5IYW A;  1VQO B;  2DMP A;  5LLQ A;  1UHS A;  1B6A A;  2DFE A;  2DJI A;  1HQC A;  2M8E A;  4IJA A;  3BCF A;  4KA4 A;  5JHF A;  1H80 A;  1GV2 A;  2LOO A;  3OY9 A;  5DCF A;  2JZY A;  4E7I A;  2RKH A;  4C2T A;  1S9H A;  2K4J A;  3JAM K;  1AIP A;  3G4S I;  5JVG F;  2GOX B;  4OPS A;  1K73 D;  5C3E J;  2Y9Z A;  3WG7 H;  5FIU A;  3M8F A;  1N75 A;  2BN4 A;  4MEY F;  1TSP A;  2WWY A;  3SFI A;  2K85 A;  5BOX A;  2QYO A;  4BAY A;  4TMX A;  2K5C A;  3LSH A;  1YIT I;  4WXD A;  2HXO A;  4PFO A;  1FMV A;  4IHT A;  4I76 A;  4EM0 B;  3OYG A;  3AVY A;  4O5V A;  2J5O A;  1LFU P;  2WA0 A;  2LNB A;  2O17 A;  1YJW I;  4OIP F;  4YXW A;  2CW0 F;  3RZD J;  4Z4W A;  3I64 A;  1PP7 U;  4F7D A;  4NDL A;  5HOO A;  3V8J A;  1JE8 A;  2NVX J;  2PLY A;  1CNF A;  2E2H J;  2EFN A;  1FLI A;  3CRZ A;  2BVM A;  5TRD A;  1NG6 A;  2XF5 A;  3G1O A;  3V7C A;  2VBK A;  5J4Y A;  4BU2 A;  4YIR X;  1T0F C;  1JGS A;  2XDV A;  3RKW A;  4YRV A;  3LSP A;  2L7M P;  4O6J A;  3E3V A;  2WYR A;  3V4G A;  1ZRC A;  1YJN I;  3CCU B;  1OOC A;  1OHH A;  1RKW A;  2DOF A;  5L3E A;  2CYY A;  1VQ5 B;  1NK3 P;  1HA3 A;  5BS6 A;  1GVJ A;  1CF7 A;  1QQ1 A;  1MMD A;  4HIZ A;  3CTA A;  2IP2 A;  3HTU A;  3KEO A;  3ML6 A;  5DD8 A;  5DSZ A;  4FWT A;  4UY8 I;  3WYA A;  5LD2 C;  1U5T B;  1KCD A;  4I2O A;  1BA5 A;  4UZE A;  2EIX A;  1ZM9 A;  4ZCI A;  2OC6 A;  1MW7 A;  2A69 F;  3E20 A;  3CCS B;  1YW9 A;  1FIP A;  1VQP I;  3OEE A;  3A4C A;  2Q6L A;  3OZV A;  4QHY A;  4HRI A;  4P6Y A;  4EM2 A;  5FNZ A;  4YAW A;  3WGH A;  1TNS A;  2ZJR F;  2Z2S B;  5LHG A;  1LFP A;  1RIO H;  2BXY A;  3CCL B;  2DOE A;  2L9S A;  2X1D A;  4M6Y A;  2QQA A;  3ZR8 X;  1X2M A;  5HNH A;  3I4N J;  1GVD A;  2A5W A;  4B4C A;  3F21 A;  1XB2 A;  4FXU A;  2J8I A;  1OB5 A;  3KPH A;  4LG0 A;  2VNJ A;  2DJN A;  4UB6 C;  4M6V A;  4L9T A;  5E8I A;  1YW7 A;  1Y0U A;  4I98 B;  3SEJ A;  1MSE C;  3Q0W A;  3N97 A;  2L9V A;  2OBP A;  5F1J A;  1R1T A;  2WV1 A;  4Z2Y A;  5D5U B;  4ZDP A;  4DZP A;  2V7Q A;  5FA6 A;  3I1F A;  4ASU A;  5TV2 A;  2X6Y A;  2NRA C;  3I55 B;  4KIF A;  1P7J A;  5D4R A;  2D2W A;  2BSA A;  2LLK A;  3QQA A;  3A01 B;  1I5Z A;  4LD5 A;  2GQF A;  4UZF A;  3HOV J;  3AK5 A;  1YX2 A;  3A3G A;  4ACA A;  2K7L A;  2QM3 A;  3JTG A;  2PMD A;  3M3Y J;  1JNY A;  4UUV A;  3J7A O;  2F3L A;  3MD2 A;  1BN5 A;  3IUO A;  2M4K A;  4ZYH A;  2KL4 A;  1KTV A;  2W84 A;  4CZC A;  4RGR A;  1QPM A;  1T6X A;  2ZL7 A;  2UVF A;  1ZK8 A;  3JRD A;  4ZGQ B;  1X19 A;  2GRE A;  2Q2E A;  1VQN B;  4XNF A;  1O8I A;  4RGX A;  3BP8 A;  3NWS A;  1LLZ A;  1BI0 A;  2QCO A;  1ZGJ A;  2WTE A;  2X1E A;  2R5Z A;  2IEK A;  1BI3 A;  1BL0 A;  2MD5 A;  1JJ8 C;  3RKY A;  5HKK A;  2XB0 X;  1G3T A;  4HLY A;  3ASR A;  5F6F A;  1TT0 A;  4Z4Z A;  3PET A;  3OYN A;  4XLF A;  4QVA A;  2KP6 A;  1VTN C;  2FD5 A;  4TT3 A;  4R8H A;  2HDC A;  2VN2 A;  2HOE A;  4RM0 A;  2UVE A;  4GGG A;  5D6E A;  3TH0 A;  1P7I A;  2E19 A;  1J0R A;  3TOA A;  2V7V A;  4C3J J;  1RR8 C;  4LOC A;  2OYN A;  5LRR A;  3ZPL A;  2VT3 A;  1RU4 A;  2JN9 A;  1UCR A;  3ZQC A;  4Z6Y A;  3BNW A;  1UST A;  2W82 A;  4OIN F;  1HDD C;  1B9M A;  3LQE A;  1WJE A;  3R0J A;  2E2I J;  1UG0 A;  1JUM A;  1FP1 D;  1P6R A;  3FXO A;  2R7D A;  2WAF A;  2P6T A;  1Y1W J;  2EQR A;  4A3G J;  3QP6 A;  3S3O A;  1RET A;  1POG A;  3K1N A;  2XGJ A;  3QOP A;  4UXN A;  4PAA A;  2F2E A;  4EJT A;  4LBW A;  3PNY A;  1IDZ A;  1BIA A;  2ECB A;  1EA3 A;  4FIS A;  2VC1 A;  3H0D A;  1IAW A;  5JMC B;  2V79 A;  2YX4 A;  4GDF A;  2P7V B;  4I6Z A;  3RY8 A;  1W0K A;  2R92 J;  4OP7 A;  3H9N A;  1YTY A;  2DFH A;  2QKM B;  3G71 I;  3S17 J;  2VOO A;  5KAI C;  1IRG A;  2I5U A;  2WV0 A;  2X4H A;  4JQF A;  1ZQ3 P;  3CC7 B;  2XGX A;  3ABL H;  2FX0 A;  1MH3 A;  2DAO A;  2FRH A;  3IRR A;  4ABZ A;  1T33 A;  1T8I A;  1HCR A;  3PIP F;  4IQJ A;  3AVV A;  3BR2 A;  2E1N A;  5EGO A;  3L9F A;  4GYI A;  2NTQ A;  3CME I;  2VBU A;  2O0V A;  5C4J J;  3CC4 I;  2WY7 Q;  5ICF A;  2EZH A;  3BLY A;  2FMY A;  4OPV A;  1NTC A;  4DBR A;  1IGN A;  3EYI A;  1F9N A;  2VXZ A;  1D0X A;  2XAU A;  3HOT A;  1N25 A;  1L3L A;  1DDI A;  4A3E J;  1RQP A;  2H6B A;  3VST A;  2K4B A;  4IHX A;  2OQG A;  5LHI A;  5IYP A;  1ENH A;  1WH7 A;  2DO7 A;  5D4S A;  1B23 P;  5E3M A;  1MJ9 A;  2QWW A;  3LSJ A;  5D8L B;  5L3D A;  1G7R A;  4BH9 A;  3MN2 A;  4X8I A;  1X4O A;  1BN8 A;  2XZO A;  3DEU A;  2BGC A;  5HNF A;  1WOR A;  4NBS A;  5B5E C;  2H6C A;  2H1L A;  1VQ8 B;  1Z3X A;  1XGM A;  2NVQ J;  2CG4 A;  2JTV A;  4IXA A;  4NC6 A;  1A35 A;  3TMO A;  3IAS 2;  2LBF B;  1VQO I;  2PJP A;  3NWT A;  2E71 A;  2E2J J;  1SD7 A;  3ERM A;  1R6R A;  5H6R A;  2ZJQ F;  3J7A Y;  4LB5 A;  2A6H F;  3DF8 A;  4S04 A;  5FO0 A;  2HQN A;  2OCE A;  1Z1D A;  5K5Q A;  3IAM 2;  1TZL A;  1WP6 A;  3LMM A;  3W6V A;  4GO1 A;  3OP1 A;  2BM7 A;  3LA2 A;  4QVJ A;  2GWR A;  2KZV A;  2LD5 A;  1H8E A;  3CMM A;  4IL6 C;  3QPH A;  3DU6 A;  4A0Y A;  2GQQ A;  4J00 A;  1H42 A;  4B1R A;  1TWH J;  2WR8 A;  4V2G A;  3P9C A;  2XAG A;  1MJB A;  5CQE A;  4RLZ A;  1PJ6 A;  1WQ2 A;  2LY9 A;  3N05 A;  1R5N A;  2VZL A;  4AIJ A;  2BY0 A;  4KN4 X;  3W2A A;  1I1G A;  4TKO B;  1WSU A;  3S2H J;  2VT2 A;  2O6W A;  3HHH A;  1FBS A;  3ONQ A;  5FKK A;  4EV0 A;  2XRO A;  2BM5 A;  1U8R A;  2DK8 A;  1OMI A;  2FX3 A;  1K5C A;  2CWE A;  2KKO A;  4WZT A;  5JLV C;  4IVN A;  5L3F A;  3F22 A;  1N78 A;  1QU3 A;  3QU6 A;  5D8K B;  2NT6 A;  2LK2 A;  2DOD A;  3E5X A;  1F60 A;  3D5R C;  1FX7 A;  4PDK A;  2O1D A;  3Q6Q A;  3GME A;  1I27 A;  1D5Y A;  3WGG A;  3B78 A;  3FXL A;  5JLX A;  1LDD A;  4UV9 A;  5IT9 Z;  2VL8 A;  2WSS A;  3H0G J;  3RPU D;  3DFG A;  4CCO A;  3CCU I;  2BW3 B;  2KLO A;  1O8L A;  1KK1 A;  3PSS A;  1VQ5 I;  5JHU A;  4DQK A;  1KU7 A;  1U3E M;  3M4O J;  2PYH A;  1O8M A;  1IV8 A;  4M9X A;  4OU0 A;  2QQ8 A;  2A3S A;  4BKX A;  4OMY A;  2BGJ A;  5LMZ A;  4M3D A;  3A1P A;  1B72 A;  1N07 A;  1OCR H;  3TL4 X;  1GLN A;  3PSF A;  1K6O A;  4P22 A;  2XB5 A;  1WDT A;  4ZYE A;  2B5O A;  1LVK A;  4G5G A;  2X0L A;  3S8P A;  5JLW A;  3S3N A;  1TYU A;  2E7W A;  1WI3 A;  3DTI A;  3CCL I;  4LLL A;  1QGA A;  1DGR M;  2W24 A;  1QZE A;  3AFH A;  3VYS B;  5GPC A;  3GEZ A;  2IS2 A;  4KFC A;  4HF0 A;  3AL0 C;  1I6H J;  4DNR B;  2LDU A;  2D9R A;  1HA8 A;  2NTB A;  1K9M D;  1X1A A;  4TSF A;  4EJW A;  2O0W A;  4DJA A;  1W0J A;  4Q5S F;  1PJ5 A;  2CQN A;  4W1U A;  4RB2 C;  1ZLK A;  3Q39 A;  4ESJ A;  3QU3 A;  2JQ7 A;  2OU2 A;  3GQB A;  4A2U A;  3FXJ A;  4HBL A;  1FOW A;  1TC3 C;  4ZDO A;  4PUS A;  3F72 A;  6PAX A;  3I55 I;  3V8L A;  4UUS B;  3SZP A;  2EIL H;  1EP2 B;  4ZYG A;  4KIB A;  4IHY A;  3M7G A;  4B3F X;  3OYJ A;  1MNM C;  1SFU A;  1QVT A;  4XBF A;  4BGD A;  4AC9 A;  5AIP A;  4R71 A;  3E97 A;  3VMF A;  4HW0 A;  2XZP A;  2K3F A;  3IH3 A;  5KW9 A;  4CYC A;  1X3Z B;  4F3Q A;  3NE5 B;  2WAD A;  4P26 A;  4GCV A;  3T1B A;  1K4S A;  4ZJZ A;  4BXF A;  5BQT A;  2NST A;  1FTT A;  4RB3 C;  4L8J A;  3B90 A;  1JUS A;  3MQ0 A;  3RPU A;  5K1Y A;  2DA2 A;  4Y17 A;  3MAJ A;  1ETK A;  4NK8 A;  1CGP A;  4MQ9 F;  2L2O A;  3HOZ J;  2MH9 A;  1IC8 A;  1BJK A;  5KSW B;  3J81 K;  3T8T A;  1IF1 A;  4X07 A;  1PE9 A;  5E1W A;  1JTX A;  1T56 A;  2IXS A;  2PX9 A;  1VQK B;  5FRM A;  2YUS A;  1TNT A;  3A8J A;  3ESW B;  4UZU A;  2M1B A;  3HOU J;  1AKH B;  4XLP F;  1DG1 G;  1H85 A;  2NNY A;  2XV4 S;  4RBO A;  4ENJ A;  3GTQ J;  1UD2 A;  3CF5 F;  1T39 A;  4XIC A;  3CPW B;  2R7X A;  3K70 C;  2IGK A;  2WZP P;  2EWN A;  4XMY A;  3SJP A;  4CUG A;  3LFK A;  3HOX J;  2YWH A;  3OL4 A;  1ZRE A;  1OGI A;  3N6Z A;  2M0C A;  1H89 C;  2L7K A;  5KAF C;  5HDN A;  2CGP A;  1OR7 A;  2V1N A;  5DD4 A;  4KKT A;  1FZP B;  1WCM J;  4UHT A;  1I18 A;  2ELJ A;  3CJQ B;  2ZO4 A;  3KFW X;  3RKQ A;  1ULY A;  4A3M J;  2HVR A;  2DYI A;  5IYQ A;  1PJR A;  1WH5 A;  3HUG A;  2G0E A;  4M72 A;  1N0U A;  2GA2 A;  4XKV A;  4KYW A;  2Z5U A;  2W6I A;  3ISX A;  4JRA C;  3CQZ J;  1O7L A;  2QGU A;  2W6J A;  3LYC A;  1P9Q C;  3IH2 A;  4CIC A;  4OIR F;  1SFK A;  3OZW A;  3VOD A;  3KYL A;  1T2K A;  2J8K A;  4L5E A;  1ZGA A;  1Q1H A;  5C1E A;  3E5Q A;  3WE3 A;  5ILV A;  4WXH A;  4U0V A;  1W5S A;  4KJZ A;  3QRF F;  5E17 F;  4D0P A;  4YFK F;  5CVJ A;  4PC3 A;  3Q5F A;  3FM5 A;  3BCA A;  1OYW A;  2HYG D;  4HEA 2;  1EP1 B;  4JMQ A;  4AM3 A;  3K2A A;  1UD3 A;  3V76 A;  3W2H A;  1WXR A;  4IX7 A;  3CC7 I;  5IYR A;  1PUE E;  3JRG A;  1QUF A;  1WJD A;  3DTE A;  5JI6 A;  1XCV A;  4Q4Z F;  1BC7 C;  1Z3Y A;  4KNY A;  3B6C A;  1E1R A;  4XM3 A;  2V7X A;  2V9V A;  4TMT A;  4OWR B;  3W2I A;  5F0F A;  1LNW A;  1XSD A;  5BSY A;  4C2L A;  1VQ6 B;  3LQ6 A;  5FGM A;  3WHB A;  2LFB A;  3TO7 A;  4L5J A;  4LK1 F;  3L2U A;  2MLK A;  3SEZ A;  2D5V A;  1G7S A;  1RI7 A;  1W4M A;  1R23 A;  4BBR J;  5FL7 A;  3T9G A;  4XOP A;  4XLA A;  5CVI A;  2QN6 A;  4PJ0 C;  4RD6 A;  1D0Y A;  3BJ6 A;  1N0V C;  2GJR A;  5J3O A;  1ACI A;  1IN6 A;  4YHB A;  1BPL A;  1KTW A;  3MKL A;  2L5Q A;  2ZSI B;  3BTC A;  2PEX A;  4PC1 A;  3HSR A;  1WOO A;  5C44 J;  5A89 A;  4M74 A;  2E60 A;  5GAG J;  2L7Z A;  2INV A;  3Q0V A;  3VPR A;  2K3P A;  2XPW A;  4ASN A;  4E7Z A;  4IQ4 A;  1EFR A;  1IXS B;  2VBZ A;  1WPK A;  3IKV A;  3GFI A;  3QE2 A;  1F36 A;  1G8X A;  1OCT C;  2HPI A;  4IW3 B;  3K4N A;  1UD5 A;  4YEJ A;  2GIZ A;  4BQA A;  3PVD A;  1O3S A;  4OOX A;  1AA7 A;  1GDT A;  1MBJ A;  3EUK L;  3M9A A;  1JJ2 B;  1OGM X;  2ZCW A;  3IP4 B;  5DUI A;  4IZZ A;  2CQQ A;  1WSR A;  2JJ1 A;  2CU7 A;  1VQ4 B;  1Y8R B;  2EH3 A;  2MC3 A;  3WG9 A;  3VMW A;  2YR2 A;  1JXS A;  1IB4 A;  3EDP A;  2R7V A;  2NYX A;  1O8K A;  2LKP A;  2KZG A;  3WTS C;  5L3G A;  3WNC A;  3FK6 A;  2CQ7 A;  5FRN A;  4BAC A;  4LJZ F;  4ZCM A;  2IBD A;  2GXA A;  2Q6I A;  3K4K A;  3OJX A;  4ITV A;  4Y3O A;  1JUP A;  2R93 J;  4HAM A;  2F4I A;  2V4J C;  3R0A A;  4QIW N;  1W87 A;  1R1U A;  3LSG A;  1BR4 A;  4EVI A;  3BY1 A;  2XGD A;  4N3G A;  3BR1 A;  1W7P B;  1GVH A;  2Q8K A;  2OD5 A;  4EJO A;  3R6S A;  2VJ4 A;  2DU9 A;  3AVW A;  2YU3 A;  3F0C A;  3D5S C;  4U0W A;  4CCJ A;  2C6Y A;  1VZ0 A;  3OIO A;  3SQN A;  3OE7 A;  3J81 Z;  2R5Y B;  3PO2 J;  2X9D A;  3CO6 C;  3B8Y A;  5DCM A;  2CV0 A;  1U2W A;  4V02 C;  4PGO A;  4Z4T A;  1K78 B;  1B1B A;  3PQJ A;  5E6T A;  1XX5 A;  2ZBK A;  3RJP A;  4E7S A;  4OOI A;  3GXO A;  3DQV C;  2C5B A;  3A0B C;  3GIR A;  1OFC X;  4BPR A;  3CCJ B;  4LG0 B;  2F5C A;  3FZV A;  2OK7 A;  4B47 A;  3SJM A;  1QFY A;  2DLL A;  3Q3A A;  4R1H A;  1XSX A;  1K4Z A;  4CCL A;  2HYF A;  4GFB A;  4DK0 A;  5EDN A;  3IL2 A;  4U9U A;  5EG0 A;  4U7D A;  4UV8 A;  1MRZ A;  1R4N B;  4UVC A;  2GBY A;  3PIO F;  5M3M J;  2FJ1 A;  1GJR A;  3GTK J;  2F48 A;  2GJK A;  1K6Y A;  5AIQ A;  2KFD A;  4U88 A;  4OJ5 A;  1MMS A;  5BPI A;  5GAD J;  1QO0 D;  1PJ7 A;  1WKM A;  2FUG 2;  1ZAR A;  2M4G A;  4K2E A;  2HDD A;  3U1K A;  1F43 A;  3W5V A;  2NNN A;  4MFD A;  2IS4 A;  4JX6 A;  3PSZ A;  3JRF A;  2XAS A;  4BE0 A;  2ISY A;  3W2V A;  1RUN A;  1MSF C;  5J1R A;  1OCZ H;  2NXN B;  3TGN A;  4BEH A;  1IN7 A;  1N06 A;  3AVT A;  1TQI A;  2CW8 A;  2HLD A;  1X1C A;  2W57 A;  4NB5 A;  4XID A;  2VKV A;  1BBY A;  3K9T A;  2GJP A;  2OUM A;  2V26 A;  3H35 A;  3BG3 A;  4M53 A;  1TBX A;  2ODL A;  3LJY A;  1R4M B;  3ZQG A;  3BRO A;  2DN0 A;  2BY1 A;  5EEA A;  2CMP A;  4BDY A;  4GQN A;  4MNU A;  3U1D A;  4QLC U;  3IKT A;  1E17 A;  3FPK A;  2E35 A;  4OOV A;  4PJM A;  4B8X A;  4G7Z F;  3FXU A;  2CC2 A;  3F3X A;  1JKO C;  2ZME A;  3ZMT A;  2UXN A;  1YS6 A;  2VJI A;  3BTL A;  1EV7 A;  1OQY A;  2IW5 A;  4FHT A;  3DLL F;  2NVT J;  1HC8 A;  3JU4 A;  1OFE A;  2F5D A;  1A6I A;  1YRN A;  3T0Y A;  2TRT A;  1D3Y A;  2E5N A;  4ZZD A;  2CUJ A;  4H0E A;  3QOE A;  1V54 H;  2OTL B;  3SLN A;  4RD0 A;  3TDZ C;  1TP4 A;  2VBW A;  4NUB A;  3WY9 A;  2HKO A;  2OTJ B;  1PUF B;  2VQG A;  4Z1M A;  4U87 A;  4A3B J;  2VNK A;  4RAY A;  4Z4R A;  2EWE A;  2ZC2 A;  3NB2 A;  3VO1 A;  1FSH A;  3RIR A;  2ELK A;  2L02 A;  4Q7J B;  4G6I A;  1X0C A;  3MMY B;  3IRQ A;  3ZP5 A;  5DYM A;  4OPW A;  2KIM A;  5KNL A;  5CJ9 A;  4PC7 A;  1PDN C;  5KVR A;  3HOS A;  4FTH A;  3WBJ A;  3J7Z I;  3JRA A;  4P5O A;  3G05 A;  3AVX A;  2MFZ A;  4A3K J;  3OSF A;  2XHK A;  1DDG A;  1IRX A;  3CCV I;  3MMP A;  1X3U A;  2KT0 A;  4LBY A;  2X3U A;  4TN1 A;  1EA0 A;  2X53 S;  1TYV A;  2VI6 A;  2P3M A;  5D5X B;  4MXN A;  3U21 A;  1I3A A;  2KRC A;  1OKR A;  2D3L A;  3MFK A;  2XND A;  2LSO A;  4WZL A;  1EF4 A;  4PMH A;  1U5T C;  1GT0 C;  2TDX A;  4C43 A;  3HKZ N;  1Z7L A;  3WTW C;  5EJC A;  5HLG A;  4G1V A;  2OJE D;  3H5A A;  3L00 A;  3R60 A;  4YCQ A;  2DBB A;  1EWY A;  1Z05 A;  2R6H A;  3WTT C;  3ROU A;  2VJJ A;  3LSR A;  3ISP A;  4LK0 F;  2EFQ A;  1LUJ B;  1UJ8 A;  2BXZ A;  2NOG A;  4WQM A;  1OCO H;  3FF5 A;  4DZJ A;  4AF6 A;  5J35 A;  2P5V A;  2G0Y A;  3S15 J;  2P6S A;  3D26 A;  1QVG B;  3A3B A;  3K2Z A;  4PC6 A;  4OJO A;  2W00 A;  1X2N A;  2XC1 A;  4LIT A;  1BM9 A;  3MHP A;  4M71 A;  2L01 A;  4XL9 A;  5EEG A;  4LBV A;  2OBT A;  3CP2 A;  2MW8 A;  2L0K A;  2WB1 A;  3GX4 X;  2P81 A;  3ABM H;  1TYW A;  2BHY A;  2ZXJ A;  3TW7 A;  2QEX B;  3O8H A;  2P5L C;  2OQR A;  3DDY A;  1VQ6 I;  3MEX A;  2LTP A;  5M5X J;  3S1Q J;  4K1X A;  1MDM B;  5GAH J;  2QF7 A;  2X6O A;  3BH6 B;  2NVU B;  2ZTG A;  2FML A;  3BJO A;  2E7X A;  3OYB A;  2BGI A;  3HHG A;  5IP6 A;  2ID3 A;  1FRQ A;  2B9S A;  3CCY A;  1G2H A;  1FND A;  2XUB A;  4MR0 A;  2QX3 A;  2RNJ A;  4M73 A;  4XSX F;  2DPU A;  2PEC A;  3SUC A;  3DBH B;  4WWV A;  1WU8 A;  2FA5 A;  2WAQ A;  1OIS A;  2BM4 A;  2CUE A;  1EZG A;  4J0Q A;  1Z21 A;  4L9J A;  3F6V A;  4QPO A;  3BTJ A;  2QSF X;  1IJE A;  1BMF A;  1O8H A;  4CH7 A;  1VJS A;  1EE6 A;  2JK3 A;  1HVX A;  1D1C A;  2VBY A;  1M1K D;  1B8I A;  2MA3 A;  4IOA F;  3FKJ A;  1XG2 A;  3DEW A;  3DPL C;  1E43 A;  3CCQ B;  1QCX A;  1G7C A;  3ULQ B;  1TW3 A;  1NDH A;  1WVR A;  4GXO A;  3RKX A;  1E2X A;  4OIO F;  4AYB N;  1JKR C;  1K28 D;  3TW6 A;  3VYT B;  3F8C A;  5EYR A;  1RNL A;  3KP4 A;  3KP2 A;  4CZZ A;  5J47 A;  3GTJ J;  2XNC A;  4A12 A;  1VQ4 I;  2FSW A;  4F91 B;  1G3S A;  4P12 A;  1MKM A;  1TQM A;  1VI0 A;  2XAJ A;  1WSV A;  4N9H A;  2Q1Z B;  3WU2 C;  4B3X A;  3OOP A;  3K4M A;  3HJE A;  3H3Z A;  2Z1D A;  3AGQ A;  2P7C B;  1MJA A;  1X4P A;  1R58 A;  2ZJ2 A;  3LA7 A;  3V7R A;  1ERD A;  2BV6 A;  2JSC A;  3CCR B;  2VQH A;  1QFJ A;  1LQ1 A;  4EEF G;  1LJ9 A;  1H8A C;  1IDJ A;  2NS8 A;  1W34 A;  2ZBV A;  1O8F A;  5BSX A;  5CVV A;  3HB9 A;  4DYR A;  1RUO A;  2NVY J;  2M3A A;  2F1L A;  3KZZ A;  2VIX A;  2MLG A;  3KZY A;  4KIS A;  4PZJ A;  1XDS A;  1F5T A;  1PKV A;  1MIJ A;  1D0Z A;  4I01 A;  1ON1 A;  3RDI A;  1TLL A;  1UD8 A;  4C3I J;  1LE8 A;  4IRI A;  2QE7 A;  2QTL A;  4BDZ A;  3OEH A;  3U2R A;  1B72 B;  3L2W A;  1OJL A;  1ZAO A;  2K9N A;  2XF7 A;  5FKM A;  4HDV A;  3RPQ A;  1S8N A;  2JSP A;  5CQG A;  2VUM J;  4MEX F;  3RIQ A;  2QZ8 A;  2OA4 A;  4OPO A;  1KU3 A;  3CLO A;  1OB0 A;  3C7J A;  3Q6R A;  1TT5 B;  2HQA A;  1ELO A;  4LC0 A;  2JT1 A;  3W2F A;  1TYX A;  4NCN A;  5LBQ A;  3PEN A;  3WOD F;  1QVU A;  1U9O A;  5B1A H;  3GZN B;  3PNV A;  5IT9 K;  3W2E A;  2BOL A;  3RYR A;  2B0L A;  4BHC A;  4N9I A;  5FLX K;  2OZU A;  3LFU A;  2NV4 A;  4YAU A;  1JB9 A;  2HDW A;  4X1E A;  3VYR B;  3DLA A;  2KMU A;  2ZTN A;  2QZA A;  4JP0 A;  2VQL A;  3JSP A;  1M1E B;  1HXD A;  4M1K A;  3BG7 A;  4RPD A;  4I02 A;  1VQM B;  3KCC A;  4D9J A;  2KDO A;  1HKS A;  2VPR A;  4I0B A;  4EQQ A;  5IOY A;  5J4V A;  1QH0 A;  4A3C J;  2LZJ A;  1B2R A;  2OK8 A;  2VNH A;  2QBY B;  5AMV A;  4LB6 B;  3B8H A;  1FPQ A;  2BV3 A;  2RC5 A;  3CZ6 A;  3KZI C;  4QUZ A;  3TKY A;  3CDI A;  5LGN A;  4DW6 A;  3LAP A;  2JIZ A;  2W25 A;  1HLV A;  3HPG A;  3MCZ A;  1JKQ C;  3S3M A;  1HKT A;  3V7S A;  5M5W J;  2CF4 A;  2GPJ A;  2ZL6 A;  4DK1 A;  3GVK A;  1WRJ A;  3VMV A;  4E4H A;  4XKB A;  1I1S A;  1YG2 A;  1ZH5 A;  3ASP A;  4FK8 A;  2EFP A;  4UVA A;  2WPD A;  1IN5 A;  4X05 A;  2DMT A;  5DN6 A;  3OW2 B;  4E7K A;  2HU9 A;  5THX A;  5HZA A;  4CQJ A;  3GF2 A;  1LM1 A;  3ZC3 A;  1D5V A;  3V42 A;  5B3S H;  1VF7 A;  5FO1 A;  1Z91 A;  2YWG A;  1ZG1 A;  1TTY A;  4HQM A;  3WTV C;  3B02 A;  3CCM B;  3GQA A;  4AVZ A;  5B66 C;  3E6C C;  3HRM A;  2DET A;  4PGH A;  2IPQ X;  3RQ4 A;  3W2W A;  2DQL A;  2RNG A;  3WTY C;  3ABK H;  3NRV A;  3KE2 A;  2RQQ A;  4RMN A;  1I6X A;  4P55 A;  3I4P A;  3JCU C;  1K61 A;  3BT9 A;  5F4O A;  1SD4 A;  3L2C A;  2DA6 A;  3HBL A;  1Y0N A;  1Q9S A;  2HCJ B;  4QV2 A;  3JQR A;  2JA5 J;  2Y0M A;  4Q47 A;  3HG9 A;  1FWZ A;  3E5U A;  3SEQ A;  3ZGK A;  1J09 A;  4P9F A;  5JFR A;  4D1Q A;  1A5J A;  1KRH A;  1S72 B;  4OJ6 A;  1KZL A;  1TW2 A;  1O3R A;  3WTU C;  3FXK A;  3FMQ A;  4ZTJ A;  3QFT A;  1EH8 A;  2IGN A;  4P6V F;  5HDK A;  5HS8 A;  2G9W A;  5L3B A;  3JRH A;  1VHO A;  2QUF A;  2OTJ I;  3LL7 A;  5F4M A;  3OMY A;  3K1M A;  3LQQ A;  4RAF A;  4AC0 A;  1S7O A;  2ID6 A;  4KIG A;  1LDJ A;  4LIU A;  1O3Q A;  2BYV E;  1D8K A;  1R9T J;  3OYM A;  3M8J A;  2M34 A;  2X6X A;  4J01 A;  4IHW A;  3ML3 A;  3ZQF A;  2AO9 A;  1NJI D;  1WHU A;  4QTR A;  1HW5 A;  3WXM A;  1NHA A;  3A03 A;  3H1C A;  5E3O A;  3OAA A;  4Y9U A;  4OJP A;  4E7J A;  2EIJ H;  5FD5 A;  3GTM J;  3ECO A;  1N08 A;  1WPC A;  4YC5 A;  1WJA A;  1YX3 A;  1WJ5 A;  1FNB A;  1MBE A;  2VXD A;  3OYC A;  3REO A;  4HQE A;  4CSW A;  4B4D A;  3O2P E;  1V0F A;  3VEP A;  1UEL B;  4G12 A;  1YO5 C;  2BM1 A;  2XOK A;  1KK3 A;  1XD7 A;  1W5T A;  2ZZE A;  2L3D A;  3PA1 A;  1IN4 A;  3RCO A;  1TWF J;  5J40 A;  1VQ9 B;  5IYD J;  3OKX A;  4ESB A;  1FEX A;  1T08 B;  2X48 A;  2DIE A;  4XN3 A;  3HZJ A;  2XNJ A;  1KK2 A;  2L4M A;  1JA1 A;  2A68 F;  2FNA A;  2J5P A;  3GFL A;  5D5V B;  5F64 A;  3KYD B;  3MWM A;  1QHH D;  4HV6 A;  5TR9 A;  4YFX F;  1O4X A;  3P4G A;  1Q7Y D;  4XRS G;  1IUY A;  1IJF A;  1OGJ A;  2W4S A;  2O5R A;  4YDT A;  1SD6 A;  4HDU A;  3GWZ A;  3ERE D;  3LNN A;  2ZZF A;  1XCB A;  2VYQ A;  1UZC A;  4N0B A;  4EGZ A;  1B9N A;  2QYU A;  3OOU A;  3PJR A;  5FLX Z;  3C2H A;  2QEX I;  1S3J A;  4PJN A;  2Z9O A;  4XOT A;  1IO2 A;  3QAH A;  1K83 J;  2HS5 A;  3A02 A;  4WK8 F;  1ETY A;  3FK7 A;  5LFA A;  5EMN A;  2FF4 A;  5LGT A;  3R6J A;  1FMW A;  3BR5 A;  4OJL A;  1A04 A;  2ZZG A;  3SY2 A;  1U9N A;  4MFE A;  1T0F A;  3U2Q A;  1CQT A;  2DFI A;  4ZCL A;  3DKX A;  4B48 A;  3I56 B;  1QZY A;  3H9J A;  3CCS I;  2K9M A;  4OAZ A;  2EPF A;  5J1Y A;  2V9P A;  1ZN2 A;  3A2K A;  3FBI B;  1QGY A;  1QA1 A;  2E1R A;  4AF7 A;  3FJO A;  2PG4 A;  2KJB A;  5F0H A;  3HRS A;  5IYB J;  3VWB A;  2R3S A;  3AG2 H;  2LF7 A;  3I59 A;  1XGO A;  1U2R A;  2FBI A;  2R7R A;  2EJR A;  4C30 A;  1QVF B;  3JQP A;  2CUF A;  1W0U A;  1KD1 D;  3A1Y A;  3C2B A;  1WFX A;  4G7O F;  1TWA J;  2DTZ A;  3GZ5 A;  3OR2 C;  4I7H A;  3TQN A;  4WX9 A;  1LLW A;  1GUU A;  2MBF A;  2Q0O A;  3OW7 A;  1K79 A;  4W8R A;  3BC8 A;  2DT6 A;  4A5M A;  4HOB A;  2MD0 A;  3QYB A;  1E3Z A;  5GV8 A;  5LHH A;  1YJ9 B;  3G1M A;  4LLN A;  1BX1 A;  2EIK H;  2IA0 A;  2DT7 B;  3SLD A;  2CFO A;  2A61 A;  3FXQ A;  3ZQI A;  2A5Y B;  1WOP A;  4F92 B;  1XPX A;  2XRN A;  4LBZ A;  2LG4 A;  2V1X A;  1DP3 A;  1IHM A;  1TUI A;  2H1K A;  1V0E A;  3ES9 A;  2CSO A;  5IYC J;  1IJW C;  4PSW A;  2PMZ A;  3IH4 A;  1EJ9 A;  1CNE A;  2JRM A;  1ETQ A;  1OCP A;  3ZMV A;  1AOY A;  4F93 B;  3W3C A;  1K7A A;  2ZKZ A;  4S05 A;  3CCR I;  2VBV A;  3WBK A;  3CD6 B;  3S1R J;  4OZZ A;  3CUQ B;  3GUD A;  4HX7 A;  4A93 J;  2HPM A;  3BY2 A;  2RN7 A;  3F9K A;  1YLO A;  3K7A J;  1IRF A;  3L2R A;  3GYH X;  2NOJ B;  1OPC A;  1Y8Q B;  2LRD A;  3GZ6 A;  1R5H A;  2OBR A;  1W5C C;  4W8Q A;  2EFW A;  4RDL A;  4ANJ A;  4HNV A;  4Z4Y A;  3T56 B;  2QA4 B;  3SXY A;  5FLV A;  2M0M A;  4B43 A;  5GPA A;  1VQN I;  2B7B A;  3MKZ A;  2IT0 A;  3I71 A;  3H5R A;  3QFR A;  4JBA A;  2WY8 Q;  4IO9 F;  5IK2 A;  1AMO A;  3CMY A;  2O9L A;  1Q82 D;  3G6E B;  2ISZ A;  4HLX A;  2XC7 A;  3CMA B;  1SFX A;  4G94 A;  2WAE A;  2YPR A;  4KUM A;  3X2Q H;  3MZH A;  2B0R A;  3JTH A;  3KP6 A;  2R7Z J;  3EUH C;  3GQ9 A;  5KCM A;  1F1Z A;  2K9S A;  2DMQ A;  3FXM A;  4Y33 A;  2LH9 A;  1QG0 A;  4NC8 A;  4HV5 A;  2VAS A;  3K0L A;  1VFC A;  1G3Y A;  5C4X J;  2GA1 A;  3G1L A;  4RD1 A;  3TBI A;  3O6B B;  3K69 A;  4TV7 A;  3K4B A;  2QKL B;  1MZB A;  3NAU A;  4XN0 A;  4D7M A;  4D7N A;  5GTH C;  1LPQ A;  3GTO J;  3R61 A;  4DGW B;  2FBH A;  2C5H A;  1KYW A;  4DQ2 A;  3GCM A;  4IHS A;  2V4D A;  1MNE A;  4G7W A;  3BTI A;  1JRG A;  2HVQ A;  4HWV A;  2YX7 A;  3BOQ A;  4L0Y B;  2HOS A;  5E20 A;  4QPQ A;  2PJR B;  4YZX A;  5K7F A;  3S16 J;  2ZME B;  2VE9 A;  1IXR C;  1S7E A;  1E64 A;  1FSE A;  2VFQ A;  2EB7 A;  3OZU A;  2X0K A;  1YRN B;  2DCE A;  2XIG A;  4MIM A;  5K5R A;  5LEJ A;  4A3J J;  3QYF A;  2V9K A;  1HW2 A;  4RD2 A;  2VBT A;  1D2E A;  3VSV A;  4RLQ A;  1FTZ A;  1I8D A;  3ZMU A;  1H9T A;  2BPO A;  3HIF A;  3CCM I;  1BR2 A;  1YW8 A;  2H94 A;  5CVU A;  2MH2 A;  1MBH A;  2ZFU A;  3WNB A;  3SZE A;  3ASS A;  2ZNY A;  2ZXI A;  3TOB A;  4DOZ A;  2EIN H;  3V7A A;  1BR1 A;  1P4W A;  3OWT A;  3HL2 A;  1I3Q J;  3K10 A;  3KX2 A;  4P25 A;  1LEB A;  4NQW A;  3CB4 A;  3TDU C;  1KYZ A;  3LSM A;  4BY7 J;  2JJ7 A;  1T38 A;  2QXZ A;  4FX4 A;  2BEO A;  2RVC A;  5H59 A;  2Y75 A;  4M3F A;  1ZG5 A;  2XAQ A;  2HYJ A;  4Y4R A;  4QFM A;  2LBF A;  4HNU A;  2HTS A;  1MMA A;  3J80 Z;  4BL0 B;  1S72 I;  1VHE A;  2DTR A;  2MG4 A;  3OYK A;  2VBX A;  4YZA A;  1J75 A;  2CO5 A;  1QBJ A;  2NS7 A;  1X1D A;  4WZK A;  2E1B A;  3QPS A;  1DBO A;  1D1B A;  4HA8 A;  1R49 A;  2FXA A;  4XLE A;  2DXI A;  1UD6 A;  3CPX A;  4ZGN B;  1QGP A;  2Y2Z A;  2HXI A;  2FQ3 A;  5D5W B;  1E0E A;  1EP3 B;  3LMW A;  4MO7 A;  5FLM J;  5D6F A;  1EFT A;  2VFO A;  2EBI A;  1O57 A;  4BYY A;  5M3F J;  1R7J A;  2HZT A;  3BH4 A;  3VR6 A;  1QA6 A;  3GTL J;  2DFF A;  3VNU A;  1NRK A;  3F8B A;  4XRS A;  1KZH A;  3HRU A;  1BHE A;  1VQ8 I;  2PBI A;  4XKW A;  3ZZU A;  3BZC A;  2IS6 A;  5HLI A;  3S2D J;  2R7U A;  2W7Z A;  4XOR A;  3P9I A;  1R22 A;  3ZQ7 A;  4NNJ A;  1G59 A;  1XE1 A;  4NC7 A;  5FB2 A;  3E6D A;  3DPT A;  1BX0 A;  2ZBU A;  2X85 A;  2X1C A;  5LEK A;  1AIR A;  3PUB A;  3ZCO A;  5FD6 A;  2L54 A;  2VLA A;  2WC2 A;  5AN9 A;  3DKW A;  1X3W B;  3W6K B;  3KP5 A;  5F4J A;  5IPA A;  2OAZ A;  3S32 A;  1XC5 A;  2X8K A;  2BW3 A;  5BNG A;  5CYV A;  1VQ9 I;  2YWF A;  2QY1 A;  1CF7 B;  1U0J A;  2RV8 A;  4M9Z A;  3ABU A;  3MZY A;  1APL C;  1NK2 P;  3WQZ A;  2PE3 A;  1E1Q A;  1IB0 A;  1IDK A;  3FIS A;  1O8E A;  3DU1 X;  3FWE A;  4EJU A;  2XT4 A;  1SEU A;  1K8F A;  3QFS A;  1U8B A;  2M7A A;  3S1N J;  3M8E A;  4CCM A;  4N4O B;  3MVP A;  1KJZ A;  2DI3 A;  1ZHF A;  3CP8 A;  1FRN A;  3CLQ A;  1BC8 C;  3ZN1 A;  1YS7 A;  3OS1 A;  3OYH A;  1QPI A;  1JTA A;  5F0C A;  1V5E A;  3H36 A;  2BZT A;  1I7P A;  4FE7 A;  3BCD A;  1OFD A;  4ENM A;  3VDX A;  4FT8 A;  1WJC A;  2YU9 J;  3GW2 A;  2GZW A;  3KEQ A;  4YFO A;  2ZB9 A;  3I58 A;  5TY0 A;  3B4N A;  1K8A D;  4EMS A;  4U4B A;  3ECH A;  5E8G A;  2XEX A;  1FOX A;  2K9L A;  5FKN A;  4EW9 A;  5DM6 F;  1DUX C;  5GV7 A;  1HDP A;  1BI2 A;  3FY3 A;  1STZ A;  2XF6 A;  5HLH A;  2Y9Y A;  1FBU A;  2JJ2 A;  2E36 A;  3OIQ A;  3U9G A;  3ZQL A;  2HKX A;  2JA8 J;  2JUC A;  2CBX A;  2ESN A;  3UKG A;  4TMW A;  3F23 A;  1PYV A;  4UUS A;  5JR3 A;  1WOS A;  2OZ6 A;  2R7O A;  4M3B A;  1P4A A;  2R7T A;  3M07 A;  2CS3 A;  2C2W A;  1RMG A;  2DA7 A;  1IW7 F;  2M87 A;  1N8R D;  4HX4 A;  5KK1 A;  1IG7 A;  1BIB A;  3BG5 A;  2VKD A;  3F6O A;  2HQ5 A;  3F8N A;  3PFI A;  4JX5 A;  4JX4 A;  5IT3 A;  4X7F A;  1VQL B;  4G8X A;  4PK4 A;  2DA3 A;  2M5S A;  3BCB A;  5FFX A;  2D45 A;  3P26 A;  1S7A A;  3W5H A;  1XG1 A;  3EQL F;  3L2Q A;  4Z4V A;  1OYI A;  3K70 D;  2PIA A;  2BVL A;  1UMQ A;  2XAF A;  1V4R A;  3BJA A;  4BQN A;  2PMH A;  2Q2E B;  3DTK A;  1YJ9 I;  4G6Q A;  1KC8 D;  2X6W A;  3PFY A;  2DCU A;  2LP0 A;  3MKY B;  2IGO A;  2M5W A;  2P8T A;  1Z67 A;  3SDB A;  2EV6 A;  2R0Q C;  2R5Z B;  1C0W A;  3HDD A;  1VBL A;  1KQ9 A;  4DIQ A;  4KIT B;  1SC7 A;  1N77 A;  5E1X A;  1KK0 A;  4X06 A;  2CK3 A;  2YWE A;  1AKH A;  2QQB A;  5F1R A;  2RAE A;  1E63 A;  4II2 A;  1HBX G;  2PQ8 A;  2QQ9 A;  3BZK A;  3JUR A;  3DXJ F;  4RCY A;  2FEZ A;  3M1E A;  1WMR A;  1KQ5 A;  5CPR B;  3DPU A;  2DA1 A;  5E3L A;  3GVJ A;  4NHJ A;  4G7X A;  4RM2 A;  2Y69 H;  1Y6I A;  4L9V A;  4Y9R A;  2O7O A;  2C78 A;  2GK6 A;  4BHB A;  4XKC A;  3KIO A;  1ZLJ A;  2XPV A;  4V19 K;  1E3P A;  1YYV A;  5ERI A;  2VKH A;  1RES A; 
#chains in the Genus database with same CATH homology
 1OB0 A;  3QYE A;  3ZPP A;  3D5R C;  2O1D A;  4FET A;  2HQA A;  2W1O A;  4E7L A;  1NHC A;  3VSU A;  4ZC3 A;  2HZD A;  2Y0S A;  3PNV A;  2BOL A;  2VL8 A;  3RPU D;  3DKY A;  4LIV A;  2WSS A;  3H5N A;  2DOA A;  4CCO A;  3OIP A;  1O8J A;  2BW3 B;  2F6C A;  2KLO A;  1O8L A;  2XSJ C;  3LFU A;  4U49 A;  3HXL A;  3KEY A;  4B44 A;  4URR A;  2HDW A;  3VYR B;  2PYH A;  3DLA A;  1O8M A;  2KMU A;  2ZTN A;  2VQL A;  3BG7 A;  1ZEL A;  1MND A;  3HKZ A;  4D9J A;  3ZRG A;  1DQU A;  2KDO A;  2V7F A;  4F52 A;  1W9X A;  2LZJ A;  5AMV A;  2GK7 A;  1VLY A;  3G2B A;  3TL4 X;  2CV1 A;  4BJ5 C;  1GLN A;  1E79 A;  3CZ6 A;  3PSF A;  3HAG A;  3CJR B;  4P22 A;  2JIZ A;  4BE1 A;  3H9Q A;  3HPG A;  3WWG A;  1LKX A;  1LVK A;  4BE2 A;  3S8P A;  3S3N A;  3S3M A;  4DK1 A;  3GVK A;  3DTI A;  3VMV A;  4E4H A;  1DGR M;  3EQO A;  4XKB A;  3C2G A;  3A35 A;  3AFH A;  2JA2 A;  3VSL A;  3VYS B;  2WPD A;  2IS2 A;  5DN6 A;  3HPH A;  4OAY A;  4E7K A;  3AL0 C;  2HU9 A;  3AKZ A;  4DNR B;  1HA8 A;  3KEW A;  2NTB A;  1X1A A;  4TSF A;  2O0W A;  3V42 A;  4DJA A;  1W0J A;  1VF7 A;  3OOC A;  2VQC A;  1PXZ A;  4AVZ A;  3GQA A;  3GQB A;  1KCC A;  4ZDO A;  2JVH A;  3RQ4 A;  4PUS A;  3W2W A;  2RNG A;  3OS2 A;  2LYC A;  3OYF A;  1UD4 A;  2RQQ A;  4RMN A;  5KHD A;  3E1S A;  3SZG A;  4B3F X;  3L2V A;  3OYJ A;  2WJV A;  4BGD A;  4X0G A;  3OYD A;  3DU5 A;  2XZP A;  2HNH A;  3NE5 B;  4F3Q A;  1SAU A;  2LC2 A;  2WAD A;  4I84 A;  4D1Q A;  3HG9 A;  3ZGK A;  3SEQ A;  2A6T A;  4HST A;  1J09 A;  3VYU B;  4BXF A;  4ZJZ A;  2NST A;  4L8J A;  4OJ6 A;  3B90 A;  1KZL A;  3H94 A;  1V5F A;  2R7W A;  4NK8 A;  4ZTJ A;  2L2O A;  2IGN A;  4OZY A;  4YEL A;  1O88 A;  2VB6 A;  1PE9 A;  4KKU A;  4BQQ A;  2IXS A;  2WBM A;  3LL7 A;  5FRM A;  3H9G A;  2VJ5 A;  3OMY A;  3VSK A;  2Z6B D;  1HG8 A;  4U7B A;  4Z03 A;  2JDI A;  4UZU A;  5CKT A;  4AYB A;  4BQO A;  3UNG C;  3KRG A;  4LIU A;  4BUP A;  3RTR A;  1UD2 A;  3GVL A;  3OL3 A;  3OYM A;  3M8J A;  3ZXS A;  2X6X A;  4J01 A;  2R7X A;  3OFN A;  1T95 A;  2LRE A;  3QOD A;  2IGK A;  3K70 C;  1FX0 A;  2WZP P;  4XMY A;  4XD7 A;  3ZQQ A;  4CUG A;  1KON A;  3OL4 A;  3OR1 C;  4OJP A;  3OAA A;  1MAB A;  4HSR A;  4E7J A;  2L7K A;  2UWM A;  2IGM A;  1WPC A;  1WJA A;  3S93 A;  4KKT A;  2VBM A;  1YX3 A;  2V1N A;  2MYS A;  1WJ5 A;  2ZXH A;  4RLF A;  3OYI A;  1X1B A;  3GRH A;  2VXD A;  4E6K G;  3OYC A;  3DEE A;  2ELJ A;  1I18 A;  3CJQ B;  2IS1 A;  1JI8 A;  3MKW B;  1SKY B;  2HVR A;  3FHN A;  2F5V A;  3K4J A;  4BJ6 C;  1PJR A;  3FBN B;  4CSW A;  1V0F A;  1OGO X;  1UEL B;  5HLT A;  3T51 B;  4XKV A;  2W6I A;  2XOK A;  2JVG A;  2W6J A;  2ZZE A;  1P9Q C;  3RCO A;  1H8H A;  1SFK A;  4IKF A;  3KYL A;  5C1E A;  1Y56 A;  2DIE A;  2R4G A;  4XN3 A;  3BC9 A;  2MAB A;  4KJZ A;  4II3 A;  1BLI A;  4E0F A;  1QHH D;  2AQF A;  4YZ0 A;  3BCA A;  4JMQ A;  4HEA 2;  1UD3 A;  3HC7 A;  4IX7 A;  1QHG A;  2MC4 A;  4HPQ A;  2UV1 A;  2W4S A;  2O5R A;  1WJD A;  3UR3 C;  3DTE A;  4ZTF A;  2PJR A;  3LNN A;  3FPP A;  1Z3Y A;  2ZZF A;  1OFM A;  2X51 A;  4Z05 A;  1E1R A;  3GQ7 A;  4XM3 A;  3OOU A;  3PJR A;  4OWR B;  3C2H A;  2CV2 A;  1E3X A;  4PJN A;  4C2L A;  4XOT A;  3D5L A;  3LSI A;  4N4N B;  3RSN A;  3PL8 A;  5LFA A;  3L2U A;  3SEZ A;  1FMW A;  3ZIA A;  4OJL A;  2ZZG A;  3T9G A;  5FL7 A;  4XOP A;  4XLA A;  4XR6 A;  4G6T B;  1D0Y A;  3DKX A;  4KKS A;  1WJB A;  4B48 A;  4DBQ A;  3CES A;  3H9J A;  2GJR A;  2K9M A;  4OAZ A;  2BSP A;  3ZSC A;  3A2K A;  3FBI B;  1BPL A;  1KTW A;  2L5Q A;  2ZSI B;  2NTP A;  3VWB A;  2E60 A;  2INV A;  2R7R A;  1OR7 C;  2K3P A;  1MMN A;  4C30 A;  2W7N A;  4E7Z A;  4IQ4 A;  3OPO A;  1EFR A;  3A1Y A;  4PFP A;  1WFX A;  5HVQ C;  3OR2 C;  1G8X A;  2HPI A;  2V31 A;  4AU7 A;  4Z06 A;  4FAS D;  3K4N A;  2DJI A;  4YEJ A;  1UD5 A;  3OW7 A;  1AA7 A;  4W8R A;  2VPL A;  3BCF A;  3BC8 A;  2DT6 A;  3EUK L;  2PYG A;  2MD0 A;  3QYB A;  5JHF A;  3IP4 B;  4IZZ A;  1E3Z A;  2LOO A;  3OY9 A;  1HZE A;  1H80 A;  4E7I A;  2JJ1 A;  3DWL E;  2DT7 B;  2GOM A;  2CFO A;  4XLC A;  4E7H A;  3VMW A;  4C2T A;  1S9H A;  1OGM X;  1IB4 A;  4F92 B;  2GOX B;  4W8S A;  2LG4 A;  1DP3 A;  4W8T A;  2R7V A;  1V0E A;  1O8K A;  4GRI A;  4BJT A;  1N75 A;  2PMZ A;  1OLT A;  4PSW A;  2IQ7 A;  4F93 B;  3W3C A;  2K5C A;  3LSH A;  3M1C A;  5FRN A;  4PFO A;  4XLH A;  1FMV A;  4BAC A;  4OZZ A;  3OYG A;  2HPM A;  2OV7 A;  3K4K A;  3F9K A;  2WA0 A;  4ITV A;  2CW7 A;  4LG3 A;  4Y3O A;  2O04 A;  2O17 A;  2F4I A;  2V4J C;  4YXW A;  3L2R A;  3LSG A;  1BR4 A;  2NOJ B;  2NZM A;  2LRD A;  3LSK A;  4W8Q A;  2VJ4 A;  4H4K C;  4ANJ A;  3T56 B;  3D5S C;  5HOO A;  2M0M A;  4B43 A;  2LY2 A;  4CCJ A;  1VZ0 A;  3OE7 A;  4XON A;  3MKZ A;  4MLO A;  2BVM A;  3H5R A;  3HUG B;  3K4C A;  4B3G A;  1NG6 A;  2WY8 Q;  1WJF A;  2XF5 A;  3CF2 A;  5IK2 A;  4BU2 A;  2VBK A;  1T0F C;  2R9V A;  2XDV A;  4YRV A;  2CV0 A;  3B8Y A;  2XC7 A;  2L9N A;  1OOC A;  2WAE A;  1OHH A;  4E7S A;  3DQV C;  3EUH C;  3GQ9 A;  5KCM A;  4Y33 A;  2LH9 A;  1MMD A;  4NC8 A;  2VAS A;  4B47 A;  4HIZ A;  3FDY A;  5LD2 C;  3TBI A;  1KCD A;  2KPM A;  4CCL A;  4DK0 A;  2OC6 A;  3OYL A;  1MW7 A;  3K4B A;  2VBE A;  1W36 C;  2QKL B;  4XN0 A;  3OEE A;  3A4C A;  4DGW B;  2M7B A;  4HRI A;  2GJK A;  2V4D A;  1MNE A;  4G7W A;  1JRG A;  1K6Y A;  2HVQ A;  2Z2S B;  2X3H A;  4HWV A;  4OJ5 A;  4NQW B;  2KQR A;  1LFP A;  1YE9 A;  4QPQ A;  2PJR B;  1T5E A;  2FUG 2;  4YZX A;  2L9S A;  1CZF A;  1PLU A;  2X1D A;  2M4G A;  3ZR8 X;  5HNH A;  2IS4 A;  2A5W A;  4XQF A;  4BE0 A;  4CCK A;  2DCE A;  3W2V A;  4FXU A;  2R7Q A;  3QYF A;  2V9K A;  4BEH A;  2HLD A;  2CW8 A;  4RLQ A;  3VSV A;  1I8D A;  3OYE A;  1X0C A;  1X1C A;  2I8D A;  1BR2 A;  2GJP A;  2OUM A;  2V26 A;  2ZFU A;  3H35 A;  2D3N A;  2ODL A;  2ZXI A;  4ZDP A;  4DOZ A;  2V7Q A;  4GQN A;  4ASU A;  2CMP A;  2X6Y A;  4BDY A;  1BR1 A;  3HL2 A;  3OWT A;  1GQ8 A;  1BOB A;  5CDF A;  3K10 A;  3KX2 A;  3ZPN A;  4PJM A;  1QJV A;  2E1M C;  2F1M A;  3LSM A;  2QXZ A;  3GQ8 A;  4YZQ A;  3A3G A;  1V5G A;  2VJI A;  4Y4R A;  2LBF A;  4HNU A;  3MD2 A;  5TGT A;  2WJY A;  3JU4 A;  1RWR A;  3IUO A;  2M4K A;  1MMA A;  4CCN A;  4YZA A;  4BL0 B;  2KL4 A;  4CZC A;  3OYK A;  2E5N A;  4DNT B;  2CUJ A;  2UVF A;  1X1D A;  3EUA A;  2E1B A;  3QOE A;  1DBO A;  1D1B A;  1X19 A;  1O8D A;  4XLE A;  2DXI A;  1UD6 A;  4XNF A;  1O8I A;  4NUB A;  3NWS A;  3I3L A;  4EAT A;  4ZYA A;  1E0E A;  2VQG A;  2X1E A;  1IA5 A;  3LMW A;  5C1C A;  4RM3 A;  4Z1M A;  4U87 A;  5HKK A;  3K4L A;  2EWE A;  3BH4 A;  3VR6 A;  1TT0 A;  2P0W A;  1NRK A;  3OYN A;  1MMG A;  4C2U A;  4XLF A;  3MMY B;  2KP6 A;  3BG6 A;  2CUZ A;  4G6I A;  4TT3 A;  1BHE A;  5KNL A;  2Z16 A;  4XKW A;  1DBG A;  2UVE A;  2IS6 A;  3HOS A;  2R7U A;  4P5O A;  3PSI A;  3G05 A;  4PJL A;  4XOR A;  1RU4 A;  2MFZ A;  2ZZQ A;  4NNJ A;  1IRX A;  2E1M B;  2W82 A;  1G59 A;  1WTH D;  4NC7 A;  1WJE A;  3DPT A;  3UW0 A;  1UG0 A;  2X53 S;  2X85 A;  2X1C A;  2WAF A;  1AIR A;  4MXN A;  3U21 A;  3PUB A;  2KRC A;  3ZCO A;  2D3L A;  2XND A;  4PMH A;  3S3O A;  4R79 A;  2VLA A;  1Z7L A;  2XGJ A;  4JOM A;  1D1A A;  3H5A A;  3EPZ A;  3PNY A;  3S32 A;  4CA0 A;  2X8K A;  2BW3 A;  2V6E A;  2QY1 A;  1EA3 A;  2VJJ A;  1U0J A;  3H0D A;  3WQZ A;  4PJJ A;  1E1Q A;  1IDK A;  3GBG A;  1O8E A;  2LY1 A;  1W0K A;  2E5Z A;  2INU A;  2M7A A;  3A3B A;  2QKM B;  1UAA A;  4OJO A;  4CCM A;  2W00 A;  4N4O B;  4JQF A;  4LIT A;  4BS9 A;  3CP8 A;  4XL9 A;  4HNT A;  2KVO A;  3CP2 A;  1LDK B;  3OS1 A;  3OYH A;  1JTA A;  2NSP A;  1V5E A;  2KHM A;  4IQJ A;  2CH0 A;  3BCD A;  2WB1 A;  4ZDL A;  3VDX A;  2NTQ A;  2XZL A;  1WJC A;  2O0V A;  1OFL A;  2WY7 Q;  3B4N A;  3BLY A;  3DDY A;  4U4B A;  4DBR A;  4BEH B;  2K9L A;  2ZTG A;  2VXZ A;  3PNT A;  4EW9 A;  1D0X A;  2ZSH B;  2XAU A;  3OYB A;  3HOT A;  3FY3 A;  2XF6 A;  2AQE A;  2JJ2 A;  3VST A;  4NK6 A;  4MR0 A;  2QX3 A;  3OIQ A;  3FKS A;  1KMH A;  4C9Y A;  3EQN A;  2F43 A;  3AL0 B;  2PEC A;  3SUC A;  2WAQ A;  1PYV A;  1X4O A;  1BN8 A;  1Z21 A;  2R7O A;  4QPO A;  2R7T A;  1BMF A;  5HNF A;  2CS3 A;  2XZO A;  1O8H A;  1RMG A;  4CH7 A;  1COW A;  1VJS A;  1EE6 A;  1DGW Y;  1HVX A;  1NG7 A;  4KT6 A;  1Z3X A;  1D1C A;  2VKD A;  3TMO A;  3FKJ A;  3IAS 2;  2RRE A;  3DPL C;  2LBF B;  4F55 A;  1E43 A;  3NWT A;  1QCX A;  1XG2 A;  4PK4 A;  2M5S A;  3BCB A;  1R6R A;  3J7A Y;  3OS0 A;  3E0J B;  3L2Q A;  3T53 B;  3K70 D;  1K28 D;  2BVL A;  2R7S A;  4P1W A;  3IAM 2;  3I9V 2;  1TZL A;  4PSX A;  3VYT B;  1WP6 A;  3LMM A;  2Q2E B;  4BQN A;  3DTK A;  2X6W A;  4HG2 A;  3PFY A;  2KZV A;  4F91 B;  3MKY B;  1H8E A;  3OYA A;  2IGO A;  3CMM A;  1W36 D;  3SDB A;  3DU6 A;  1VBL A;  4KIT B;  2Q1Z B;  4DIQ A;  4J00 A;  1N77 A;  4B3X A;  2CK3 A;  3K4M A;  5FRO A;  2Z1D A;  2UUZ A;  5CQE A;  3N05 A;  1X4P A;  4II2 A;  1YX5 A;  1ERD A;  2VQH A;  1IDJ A;  3W2A A;  1O8F A;  2KRH A;  4TKO B;  3JUR A;  1WMR A;  3ONQ A;  2M3A A;  2HVS A;  2VIX A;  4KIS A;  5CPR B;  3DPU A;  1PKV A;  3GVJ A;  4G7X A;  1K5C A;  1D0Z A;  4RM2 A;  1UD8 A;  1Y6I A;  2Z8G A;  2QE7 A;  1O8G A;  4BDZ A;  3OEH A;  2GK6 A;  2JUG A;  3L2W A;  4XKC A;  2XF7 A;  3K6G A;  3SYT A;  2JSP A;  5CQG A;  1N78 A;  1QU3 A;  2NT6 A;  2NT9 A;  1NBM A;  2VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...