4XOPA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 235
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xopA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xopA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xopA02
1IDKA 2NSTA 2X6YA 2NTQA 4OZYA 4W8RA 4EW9A 4XMYA 4XLHA 4YZQA 4XKVA 3VMWA 3LMWA 4OJ5A 2PYHA 2NTPA 4OJ6A 1PXZA 3VSVA 1KCCA 1JRGA 3FY3A 3B90A 2NSPA 2QY1A 1BN8A 4XQFA 1KCDA 4YZAA 4XNFA 1O8LA 2X85A 1OOCA 4XLCA 4AVZA 2IQ7A 4XLAA 2X6XA 1O8KA 3ZPPA 4XORA 1OGMX 1RMGA 4PMHA 4XOPA 1AIRA 2INUA 2NTBA 5AMVA 3B8YA 1XG2A 4W8SA 4Z03A 2BSPA 1QJVA 1O8GA 4NK8A 3VSUA 1OFMA 4C2LA 2X3HA 2PYGA 1GQ8A 1O8EA 2QXZA 4OJPA 4YZXA 2O04A 1BHEA 2NT9A 1CZFA 4Z05A 3UW0A 2Z8GA 4XN0A 1RU4A 4W8TA 3VSTA 1O8DA 2INVA 4I84A 1IB4A 1H80A 1PLUA 1K5CA 4URRA 3WWGA 2O17A 3EQOA 5C1EA 1O8MA 4OJOA 3B4NA 4XN3A 1X0CA 4YZ0A 3KRGA 4W8QA 4XONA 3GQAA 4XL9A 2VBKA 1QCXA 2NZMA 4XLEA 2O0VA 4OJLA 4XR6A 1IDJA 1RWRA 1O8JA 2X6WA 3GQ8A 1PE9A 3JURA 1WMRA 3GQ7A 3GQ9A 4XM3A 4MXNA 2NT6A 3GRHA 2PECA 3T9GA 3ZSCA 4YELA 4U4BA 4Z06A 1OGOX 1O8FA 1NHCA 1DBGA 1OFLA 4HWVA 2O0WA 1IA5A 1O88A 2O1DA 4XKWA 4NK6A 1EE6A 1O8HA 1KTWA 5C1CA 1O8IA 2VJIA 4YEJA 1DBOA 2UVEA 4U49A 4OZZA 3VMVA 1JTAA 2EWEA 4XOTA 2QX3A 2VJJA 2VBEA 2UVFA 1VBLA 2ODLA 3SUCA 2VBMA 4XLFA 1HG8A 4MR0A 3EQNA
chains in the Genus database with same CATH superfamily
1FYMA 4XLHA 1NBMA 2E71A 2HQRA 2XAGA 2I5UA 2M2EA 3IWZA 3RIRA 3RPQA 2KZVA 4WX9A 2GM4A 4HZFA 1L1IA 2CMPA 1KK3A 2VFMA 3UKGA 2M5WA 3LMWA 3VMWA 4I2OA 3CCUB 3CJQB 4OJ6A 2A5WA 2VB6A 1T5EA 1W9XA 1ZM2A 1QVFB 1TL8A 3ZRGA 4U0YA 3LSPA 4X7DA 1AKHA 1PJ5A 3I3LA 1WHUA 5F0CA 3CC4I 4NQWA 3CCRI 3WQZA 1XGOA 4XLCA 2ZNYA 2VFPA 3B02A 1WH5A 1J75A 2BXYA 3A8JA 1IO2A 3FMQA 1NTCA 4EM1A 5J1RA 2F5CA 1AIRA 4OINF 4CCOA 2NTBA 3GX4X 4XK4A 2DW4A 3FHNA 1IXCA 5DCMA 4IRHA 3CB4A 2A6EF 4W8SA 4QPQA 3M07A 2C5BA 1WWXA 4FQGA 2QKLB 3B8HA 2GA1A 4U9UA 2UV1A 5DTDA 3V8JA 1I18A 3NEUA 4G6IA 3VNVA 1YITB 4I7HA 2OF7A 2FBHA 4RD1A 3S15J 4Z05A 3CD6I 3HSFA 3L1PA 2QGUA 1TWGJ 3ERED 3CD6B 3FKJA 2LRDA 5GP9A 2Q6KA 2OD5A 2D1VA 4HF2A 2R7TA 1YOVB 2LG4A 2ZC2A 2E1MB 4BDZA 1Z7LA 1U9OA 2HVRA 1P4AA 4CUGA 1S5LC 3ZP5A 1VQ8I 1G3TA 1S8NA 2OQRA 4G1BA 3F0CA 3HG9A 1SEUA 4H9GA 5EG0A 1U2WA 2FOWA 3E97A 5CLSA 3FX3A 4PJ0C 5KCMA 3OYLA 2JIZA 5FO0A 1BI0A 3KL9A 3Q6QA 3JSOA 1MIJA 1X2MA 3KRGA 1O57A 2CUFA 4HDVA 2FU4A 2PQ8A 2LTPA 5E1XA 1YHQB 1H85A 2VBKA 3ML6A 2HCJB 2QKMB 4OJLA 4HX8A 5KVRA 2KP6A 1JHFA 1SFEA 3FIWA 3V7SA 1DDIA 3BQJA 3OIOA 1T0FA 4WXHA 2GQFA 4M2LA 3LQQA 5F6FA 1K4TA 4F92B 4WCGA 1TW2A 1VQLB 2Q2EB 2DA5A 3ZQCA 4M3DA 4K2EA 2QDXA 3C3WA 2GK7A 3W2FA 4UZUA 1XTAA 3HTUA 4CA0A 2ICWG 1KONA 3I59A 1N08A 1R00A 2GOXB 1RNLA 3TMOA 2HDNB 4Z06A 1OGOX 2H09A 2OU2A 3QPTA 4ZTJA 5IYQA 1Y0UA 4IJAA 1UELB 1TWHJ 1ZTRA 1I3AA 3HRSA 4ZZDA 2NS7A 2F1LA 3H09A 2E2HJ 3FXRA 3PSZA 1GXQA 2XGEA 4F52A 1OCTC 1POGA 2FE3A 2OCCH 2R7VA 4RPBA 3ZQFA 3O3KA 2X48A 3OOUA 3N4MA 1T39A 2HOTA 2ZL6A 1X2NA 1REPC 5IP9J 2IA1A 1QGPA 3F8CA 3Q5FA 3JQQA 5CQEA 1TYWA 3I4PA 1Y39A 3FXOA 1X1CA 1B9NA 4DZJA 4I01A 1SMYF 4BHBA 1JT0A 5D6FA 4XLFA 4EV0A 1VQOB 2OUMA 3GCMA 5EZHA 3K4CA 2K9SA 5GPAA 1W0JA 1WOPA 3ONYA 1V5EA 3A8KA 5B6IA 1EF4A 1HKSA 2W7ZA 4BDYA 1P4XA 3HOTA 1LVAA 1O3RA 3K2ZA 1E2XA 4A3FJ 4XBFA 2CSOA 1HLVA 4G9YA 3J7ZI 4MEXF 3SLNA 4I0BA 1NJID 3A3GA 4PK4A 1HBXG 1RKTA 1TLHB 5M5WJ 4OOSA 1ZK8A 4M3GA 5HS8A 1ZGWA 2VBVA 2ZITA 2IXSA 3PUMA 5LEKA 3PJRA 2W1OA 3CCQB 1VZ0A 2MBFA 3S93A 1OOCA 4FHTA 1OCPA 1HSJA 3LA7A 3GVKA 4JMQA 3KETA 4KH3A 4LG3A 2V7VA 1BC8C 4P2NA 1XS9A 1MMDA 5AMVA 1IN6A 1CF7A 5TY0A 1BR4A 2G0YA 3DBHB 3DQVC 2KMUA 2ZJRF 2R92J 1OKRA 1XFOA 4I99C 4N3NA 2DERA 3Q0WA 1ZGAA 4P9UA 3BOQA 4B47A 4N0BA 1RUNA 5F27A 2W6IA 2ACJA 1BBYA 1U78A 2CQXA 2H1LA 1MSFC 1ORKA 2MFZA 2DFFA 1RU4A 5GV7A 2P6SA 4KUMA 2BW3B 3RKYA 3LSKA 2DA6A 1VQ9I 1WOSA 2F2EA 2KRFA 4RBOA 1W36C 3CCRB 5GV8A 4RDKA 5J47A 2HDCA 2QBYB 3CRZA 3OYHA 1Q86D 5LHIA 1U5TB 5IK2A 4FX4A 3ZMUA 2EZKA 3V7AA 1PJRA 2VKHA 4AD9A 3AAFA 1H88C 4G7ZF 1KD1D 1FBSA 4XN3A 4YAFA 2M1BA 3C7JA 2NVTJ 1LDDA 1WORA 4KMFA 4HLXA 1S7EA 2QEXI 1AOYA 3W6VA 2XGDA 2F4NA 1E3XA 1VF9A 2FXAA 5HNFA 1SFKA 1XMXA 2BV6A 2W6JA 4X6AJ 4XSZF 4LIVA 4P26A 2JA2A 2ESNA 1B8IB 2DODA 4I98B 3JSPA 4F91B 1AU7A 1EFRA 2ZJ2A 1O8JA 5LRSA 3C2HA 1EH7A 4RGRA 3C2BA 2LY2A 3BG3A 1FRQA 2WY7Q 4FETA 3F8BA 4IXAA 4IW3B 3WBKA 3IAS2 2QSHX 4YHBA 3ZCOA 3T9GA 4YELA 3CMEB 5E8GA 4TSFA 1EA3A 1VQNI 1OFLA 2HEOA 2CW0F 1B6AA 4RB2C 4P12A 5BMZA 4P6VF 4L5EA 3HKZA 4FE4A 2HTJA 1XC5A 1SD4A 2HXOA 1DGWY 4XKWA 3SDGA 5HXBA 1XCVA 5J8FA 3ZZUA 3TEDA 2DJIA 3OEEA 1FOXA 2LZJA 4YEJA 5BS6A 2OTJB 1S6LA 1R7JA 4BJ5C 4AF7A 4QV2A 1OLTA 2OTJI 3WU1B 1E3HA 4CO8A 3E5UA 2J5PA 3VO2A 2QX3A 1HQCA 1MBJA 2VJJA 1TZLA 2DAOA 2A68F 3WU2C 5FLMJ 2PIAA 2DOEA 2WPDA 3Q6RA 4F93B 4LC0A 1KQ5A 2JN9A 3ZQQA 3EQNA 2V7TA 4PJJA 1UB9A 3ZQ7A 2XPVA 5KSWB 3CW2A 3DEWA 5ERIA 2W85A 4D7MA 3IL2A 1H42A 1W0KA 4TMZA 4HG2A 1LUJB 4H0EA 1WJDA 4F7ZA 2KL4A 4GXOA 5F4MA 3AL0C 3CCUI 1LEBA 1I6XA 4Q5SF 2DYSH 1ON1A 1ETWA 3IRQA 4BXFA 3AGQA 3KZZA 4UXNA 4P9FA 2M5SA 1S9HA 1B23P 2QTLA 3JREA 1D3YA 1W5TA 2K7LA 3M8JA 3IUOA 1RI7A 5CJ9A 4XKBA 3GO5A 2R7WA 1LEAA 2DT6A 3GVAA 2XGXA 3R0JA 1FOKA 4YCQA 4L8JA 4IHXA 4Y52J 3V4GA 3PUNA 1O8GA 2HWVA 3ISPA 1GV2A 2BHYA 2KPMA 4KKTA 1VQ7B 1B9MA 1A6IA 3BG7A 3T0YA 4OJPA 1MMNA 2ZZFA 4B48A 5HODA 2B0LA 3ABMH 3AGPA 5DS0A 3L09A 2VIXA 1IRGA 1QHGA 4AIJA 3PL8A 1P6RA 2GPJA 3B82A 4M72A 2YUHA 1H80A 2AHOA 4Z4UA 5K5RA 1SMTA 5ED4A 2WC2A 2CV2A 4UVCA 1JKRC 4KJZA 2OBSA 2WV0A 1U6GA 3HOZJ 3G3ZA 3F8NA 4G6TB 2V9VA 2V1XA 3IKVA 3OOCA 1ZRFA 2LDUA 5DD8A 3H9NA 5FA6A 3I71A 2KIMA 1GDTA 3VOEA 1WSUA 1FBQA 1X3ZB 3U2RA 1GJRA 2MD0A 2CU7A 5GAGJ 5ICGA 2HKXA 5IY5H 1OQYA 4RB1A 3COAC 4BE0A 3TP0A 3REOA 1SC7A 1B72B 3A03A 3T1BA 4P6YA 3W6KB 3W2AA 3ECHA 3DKWA 3FXJA 3ABLH 1ZKGA 2VNJA 5F04A 4GQNA 1QFZA 1W5CC 4CCLA 3P5JA 4CYDA 2V1NA 4D5FA 2A69F 2JMWA 4Q4ZF 3GQ8A 1YIOA 2EJRA 2XHKA 4LG0A 3OW7A 3ZN1A 5FKKA 1S7AA 1MMSA 3RY8A 2YWEA 3QSYA 3I55B 3LFUA 1MRZA 3CCEB 2P0WA 4U4BA 2DI3A 3ZQHA 1O8FA 5EGOB 1K6OA 1FY7A 2O0WA 4ZGQB 3Q0UA 2ZJQF 4FWTA 1ENHA 3LA2A 2HPMA 2Y31A 4NK6A 4IX7A 2JVGA 5ICEA 4NUBA 3GFIA 4BNCA 1IW7F 2DO7A 4FISA 1KK0A 2R6HA 5FIUA 5F1RA 1KTWA 1MJBA 4Y13A 1E3OC 2Y0SN 3L2UA 4I0AA 4DNCA 3LJYA 4EGYA 3F23A 3PFIA 4O3MA 5F1JA 4LITA 4UUVA 2EFQA 1VNDA 1BJZA 2LBFA 3ASPA 2Z2SB 2WAQA 2RQPA 3AKZA 4BACA 1LQ1A 3HOWJ 4EW9A 3IH4A 2WADA 3KP4A 4U87A 4RGXA 1HW1A 3FMRA 3O8GA 2E7WA 2XAQA 2CV1A 2E1MC 2V6EA 3FF5A 3L2WA 4E6KG 3WNDA 1V54H 2DJNA 2ME6A 5DM7F 1R58A 1PXZA 4TMWA 5HS9A 1UFMA 2I10A 4MHGA 2DOFA 3FPPA 3W5VA 4YC5A 3MZ8A 1R5ID 4ETSA 2NYXA 2BM1A 1BOAA 2QVOA 4EATA 1UD4A 3GFLA 1OR7C 1S72I 4TMTA 1DP7P 2JA7J 1LLZA 1XMKA 2HU9A 1O3QA 4NCNA 2X6XA 4EEFG 2BE5F 2XF6A 3ES9A 3HSRA 4LK0F 3VSLA 2R0QC 3OYBA 1QO0D 2DPUA 5F64A 2V9PA 3VYSB 4D9JA 3L2RA 2OBPA 2PFBA 4I09A 1W7PA 4ZYAA 1TQPA 1BR2A 3D5LA 2O04A 2FD5A 1MKMA 1CZFA 1QVGB 4R79A 2TRTA 5FO1A 1WJAA 4U0VA 4LD5A 4ZYDA 4YALA 5JVGF 4BL0B 4QPOA 3G4SI 1Q7YD 3P9KA 1ONVA 2GBYA 3Q3SA 2VODA 3J7AO 3ZBTA 3CMAB 2GIZA 1YRNB 1J5YA 4RS8A 3SQVA 1ZRDA 2P5LC 3S8PA 2Q8KA 1E3PA 1Z0XA 2DFHA 4YFKF 5B3SH 2HVSA 2VQHA 3ROUA 1WPKA 2MW8A 2CV0A 4BGDA 1QQ1A 1QVUA 3HM5A 4BBRJ 2CW5A 3BY1A 2HYFA 3Q3AA 3W2HA 3KE2A 1LVKA 2QLZA 1E63A 3W2GA 4GRIA 2LYCA 4ACBA 2L02A 5E8IA 3OS0A 4V2GA 1MBFA 2IS1A 2QMUA 1LJ9A 1Q1VA 3RI4A 4ACAA 3IV5A 1I1SA 1I8DA 1E1QA 4HA8A 3F22A 2JUCA 2FX0A 2AS5F 5JBQA 1JXSA 3ECOA 1TNSA 4LJZF 3RCOA 1M1KD 5JHUA 3B78A 3CPWB 1R6RA 3C18A 1G7SA 3M4OJ 1LB2A 3ZMVA 1JKQC 3VYRB 3TBIA 3Q38A 3W5UA 4RM0A 3BR2A 2L0KA 4LLLA 3RDIA 4A6DA 1P2FA 4BAYA 1NHCA 3EDPA 2V7QA 1T08B 3FXKA 4NC6A 1JUSA 4Q48A 1UMQA 5GTHC 3ZOBA 4RD0A 1A35A 5LBQA 4X0GA 1LLWA 4J01A 2K27A 4LK1F 3R6JA 1ZG3A 2STWA 3ONUA 3B6CA 1R71A 1KYZA 2EV0A 4NHJA 3M3YJ 2WZPP 2LY1A 1DBOA 1WKMA 3KLNA 2QYUA 3PFYA 1FYLA 3Q9VA 5B1AH 2QENA 3GEZA 2XOKA 3LNNA 4RAYA 1OB0A 4C43A 2XKOA 4G8XA 5C44J 1K83J 3SEZA 2PJPA 1Z05A 3P7NA 4QWQA 1IXRC 1FMVA 2C78A 3ZXSA 4W8RA 1HA8A 2HOEA 4M9SA 2NNNA 2YX4A 1MH4A 3H5AA 2GOMA 5FKOA 4ZZLA 1ZUNB 3AVTA 3M8FA 5HS7A 3BCAA 1A04A 2KJCA 1NG6A 2VOPA 2M8GX 3BH7B 4BUPA 1QFJA 1HA3A 4C9YA 1SM4A 2M0MA 4A0XA 2H8WA 1JA1A 1J0RA 3NWTA 1USSA 2F4OB 5FD5A 2JTVA 1B72A 3DU5A 5FGMA 1NG7A 4KYWA 2KHMA 3I5UA 3DKXA 3TW6A 5E1WA 2VE8A 4JP0A 4A3CJ 5IT3A 4X7FA 2FMLA 4U0WA 1QJVA 3VSUA 3JRBA 3RKXA 3CCSI 1ZR4A 3H0DA 4BHPA 1W36D 1KA8A 4G7OF 3A01B 3R0AA 3VDXA 5KAFC 2GZWA 5IP6A 3BY2A 5FKLA 5FL7A 3LSJA 4L0ZB 2QQAA 4CCKA 3DPTA 5DSZA 2KFDA 2E1BA 1BHEA 3SZEA 1KU3A 3WODF 3LA3A 5IYDJ 3UW0A 3BJ6A 2VXDA 2Z8GA 2VJ5A 2VXZA 2F3LA 2P8TA 2F43A 2DMTA 2XKPA 3PSFA 4JX4A 3W2WA 1JB9A 4ZGNB 3L2VA 2PMHA 1OCCH 3PA2A 3GRHA 2BPOA 1RETA 2DT7B 1QA1A 2NVUB 4DBRA 2KIFA 1K28D 1WP6A 2XDVA 3SYTA 2XNCA 4BS9A 1IAWA 1WQ2A 3V42A 2ZL5A 4YAWA 4OIOF 1D8JA 3FISA 1WDTA 1ZM4A 4QVAA 3K0LA 2FQ4A 3OYDA 2CC2A 3OYCA 5BSXA 3B73A 3KEYA 2O8XA 2JJ1A 1I7PA 4XR6A 4BKXA 1KQ9A 2W24A 2OYNA 2GXGA 1R4MB 1UG2A 4OOXA 3FK7A 1HKTA 4YIIA 2GJRA 5AONA 4EVIA 1PUFB 1V5GA 1MBGA 2E1CA 3RTRA 1D0XA 4L0YB 1YLFA 4CQJA 3QQAA 3GTOJ 1D2EA 3KPHA 4N4OB 4CICA 2RNGA 2RDPA 3PUFA 1YS7A 4UVAA 2GXAA 2CJJA 2XAFA 3WGHA 3P4GA 3HZJA 2MC3A 4X07A 2FVGA 4CDGA 2DQLA 1E64A 5CVIA 4YXWA 1QUEA 2XNDA 1IA5A 1FTZA 1YG2A 3E1SA 4AU7A 1O7FA 2ETHA 4RB3C 4EMSA 2D45A 4KNYA 4OMYA 1QGZA 1F9NA 5HLTA 1ZELA 1PJ7A 2OK8A 2QZAA 1Q9SA 3KZIC 3MKYB 3S16J 3OPOA 5IYCJ 4CZZA 1K61A 1UAAA 5DCMB 2Y2ZA 4B09A 3FBIB 3PETA 2EQRA 3I58A 4XOTA 1UD2A 4NC7A 1AA7A 1P7JA 2FBIA 1EZGA 1F5TA 3KIOA 1FRNA 1EH8A 3AFHA 2Y9ZA 1O7LA 4AF6A 1HDDC 4OM9A 1X58A 5E3NA 3BPVA 5H5JA 3SDBA 4DQ2A 4N4NB 2K9LA 2CNDA 1GXPA 4HLYA 1SFOJ 1U9NA 5DV5A 2HZDA 3F21A 1Y6IA 2LH9A 2V26A 5DM6F 3J81K 2VBYA 4RAFA 1E1RA 1W35A 1IF1A 3BCBA 1JUPA 1V5VA 4BQNA 3B90A 5HDGA 2BM7A 2DMPA 2YWGA 2NSPA 1R5HA 4YZAA 4Y33A 1JGGA 1O8LA 2VL8A 3L7WA 3MEXA 2M0CA 1JKOC 2IA2A 4MQ9F 2FJ1A 2P7VB 4JOMA 5BOXA 1A31A 5IYRA 3CLQA 2M8EA 4NK8A 4RD3A 4GYGA 1RESA 4O5VA 3JRIA 3DEUA 3LSMA 5M3FJ 3CJTB 3RZDJ 3K4MA 4L9JA 3LO8A 4A93J 4OPOA 4LB6B 1OYYA 3QFSA 1X4OA 2HQNA 3PSIA 3CCLB 4I02A 4BE2A 4Q47A 1FP1D 3MCZA 4KMUX 3OV8A 3TL4X 2R5YB 1E62A 3LQEA 3OFNA 1RZ4A 2MYSA 1J59A 1S4MA 3BCDA 3IAM2 3KX2A 2DIEA 2FSWA 4OPSA 2DA1A 3S3OA 1T8IA 3S32A 2WJVA 3HSEA 4PFOA 2C6YA 4OOVA 4JRAC 4AIDA 1EP1B 2O3FA 3HGYA 3ZQLA 3J7YJ 1VTNC 4A3IJ 1L3LA 4Y7CA 1FC3A 4UUSB 1R5NA 1TC3C 3GVJA 4Z4SA 3N90A 1A6QA 4S0HB 1QZEA 3HGGA 3VYUB 2ADUA 2VBXA 2LR8A 3VMFA 1MGTA 1F43A 3TO7A 1BC7C 1QHHD 1WJEA 4L5JA 5K5OA 3L9FA 1GR1A 4XM3A 4E7LA 3FM3A 5K7ZA 3OYMA 3U1KA 4IHYA 3JQPA 4Y9UA 3FXUA 2PG4A 3TQNA 1OCRH 2DN0A 4OIRF 3ZN0A 3OYIA 3DU1X 4NBQA 1WRJA 3QYBA 4LOCA 3ASRA 3K6GA 5DN6A 3JRAA 4A2UA 2H27A 4IHSA 4P5OA 5HZBA 1T0FC 4M3FA 2PX9A 4P22A 2EFOA 4ZCMA 2QQ9A 4HX4A 3GWZA 4HQMA 3QP5A 4IHTA 2MABA 4OZZA 2DMUA 4XRFA 3NARA 4QTRA 1Q82D 1W7PB 1UD6A 4L18B 1SD6A 2I8DA 4CCNA 1DARA 2A3SA 2M3AA 3O8HA 4BE1A 2VKVA 4E7IA 5K7HA 3VSKA 3ASQA 5K1YA 1RC9A 2Q6OA 4XD7A 1T2KA 3OL4A 1UG0A 1OFCX 3KEOA 4M9XA 1K4ZA 3R4KA 2NTQA 2D3LA 2GAUA 3PQKA 4AIHA 3CUQB 1W5SA 2R7UA 2KRCA 5AIPA 2OQGA 3BR0A 3ZMDA 2VNIA 3A1PA 4CXFA 2KT0A 2LLKA 2BBYA 1QQIA 4ESJA 3HRMA 2O7OA 5EG0B 2XNJA 1R1VA 2QA4B 2F4IA 4BPRA 5LMZA 2DYIA 3GQ7A 2DT5A 2MH2A 4HE5A 5EEAA 4B4DA 1B4AA 2YSRA 3WTZA 3WBJA 5JLVC 5DYMA 3PENA 4F3QA 3RZOJ 4DGWB 1PP8F 4XORA 2WB1A 4XOPA 3RPUD 3SYJA 1IZ1A 1Y56A 3H36A 3WXMA 1D5YA 2XTYA 2RC5A 3HTSB 2FMYA 5TR9A 3CCSB 2EBIA 1BW6A 2OBRA 3ONQA 2ZFWA 3GTPJ 1T33A 3LFKA 3HHGA 3HJEA 2XB5A 4J0QA 2DOAA 4A3LJ 2XAUA 4ASNA 5C3EJ 2FNAA 1EKEA 4DOZA 5A2QZ 4XN0A 3FPKA 4DNTB 2W82A 2IP2A 3H1CA 1IUFA 3AVWA 3I53A 1F1ZA 4RA2A 1YS6A 1FOWA 1XDUA 4V19K 4MTDA 2VASA 1FMWA 2R3SA 5D5XB 4GFBA 2DU9A 4G94A 2MLGA 3KZYA 4KT6A 3F8FA 3A0HC 4HNVA 3JX8A 4CCJA 1IDYA 3BJAA 3ERMA 1Z9CA 1OCOH 3JRGA 2LBFB 4C0SA 3IHUA 2O0VA 2BVNA 5LEJA 1UMKA 2XV4S 3F9KA 1WJCA 2QTZA 3VODA 3PNVA 4KT5C 4Z6YA 3BG9A 1B1BA 4B43A 3BR3A 4LLNA 5AIQA 3MKLA 5KK1A 5GAEJ 1YQAA 3UNGC 1FDRA 1F4KA 5F0FA 4PAAA 3W5HA 4X7EA 2ELKA 1QH0A 4TMXA 3GQ9A 2WB1N 2NT6A 3SEJA 4MFDA 3P9IA 3TGNA 3AG3H 3K7AJ 4RPDA 3ZBUA 2CG4A 2IPQX 3CTAA 4JYKA 3BLYA 4LBYA 3ZSCA 2BM6A 4QSHA 5LFAA 1DBGA 2JRTA 1N0VC 1WI9A 4U88A 1W2BB 3BZ6A 1OFDA 3EETA 3MZYA 4C30A 1T95A 1Z6RA 2IGOA 1U8BA 4MYUA 3J81Z 2BVMA 2QA4I 3VMVA 3W2VA 3DLLF 4II2A 2B7CA 2Z99A 5DD4A 4HPQA 2RC6A 1G3SA 2BY0A 4M4SA 1LDKB 1X4PA 1R4NB 2VI6A 5IT9K 1A8PA 1KQSB 3ZPNA 1JUMA 3P9CA 3HOSA 2O8KA 1G2HA 2FQ3A 3H9QA 3T56B 1IHMA 4RDUA 4M74A 2N8GA 1QFYA 4A3GJ 2XEXA 5THXA 2VOOA 3S1MJ 3VYTB 1G59A 4C3HJ 3LAPA 3MZHA 4CZCA 4JK1X 4ZH4F 1JRGA 1BM9A 3VSVA 1U5TC 1XX5A 2ELHA 3QE2A 2JWTA 2YX7A 4E7KA 5LHHA 1BN8A 2XZPA 4P96A 2DY1A 1X1BA 3CCYA 3CZ6A 5TISC 3PQJA 2OZUA 3QYFA 2LC2A 2MLKA 1WH7A 2J8IA 2E1NA 5K5QA 1WGXA 3OYNA 1O8KA 1RMGA 2DETA 4N3GA 2W4SA 3BZCA 2YWHA 3I56I 4MTEA 1J7KA 1M1EB 2M7AA 3HRUA 4PGGA 2QN6A 2WA0A 4Z03A 3ASSA 1X1AA 4EJVA 3IP4B 3SKBA 1Z91A 2X3HA 3OZVA 4LBWA 3RIQA 2DCEA 4WZEA 2OV7A 2F6CA 5KNLA 2W48A 1O8EA 2O5RA 2Y69H 4OMZA 3H5RA 3BG5A 1FZPB 3WTWC 5JVTA 2YPRA 1JTYA 1P4WA 3HAGA 4RLFA 1XGSA 4CYCB 3OJWA 3N05A 4KIBA 2JJ2A 3C2GA 5F08A 3I4NJ 2CBXA 4LMYA 2RQQA 1BQEA 3TKYA 3D26A 4XLPF 4E7ZA 2XB0X 3MAJA 1SANA 3CESA 4G7HF 4L5IA 1QPIA 3KYLA 1JGSA 1KK1A 1PUEE 2H94A 2MH9A 1R1TA 1Z7UA 3JRFA 4ENKA 1SFUA 2FX3A 4Z4TA 3D1NI 4F7DA 3JCUC 4YIRX 4Y15A 2GWRA 3HDDA 1VQ9B 3TP3A 1TVCA 1ETYA 3SHFA 5BSYA 2LNBA 3GQAA 1IN5A 3K4NA 4IOAF 2DA7A 1HW2A 4QUZA 2M45A 2K86A 4HRIA 4R8HA 1FNNA 4ESFA 4F55A 5HLHA 2KKOA 2Q1ZB 3EQLF 4D7NA 3G1OA 2DLLA 1GLNA 2JRMA 3OWTA 1OGIA 4FT8A 5IOYA 3GTQJ 4HF1A 1DG1G 1YJ9B 1O3TA 2QUFA 5J4YA 3A2KA 2BOLA 2RV8A 1WMRA 1ZG5A 2A5YB 4EJOA 1R22A 2R5ZA 4AWXB 3ABTA 1NHAA 2DMQA 3DF8A 5D4SA 2CF4A 1MBKA 5GTIC 1W7PD 1SVMA 3D0SA 2E5ZA 3GW2A 2ME0A 1V5FA 1IG7A 1GHCA 1YFHA 1ODDA 1HXDA 4A0YA 3R6SA 1MSEC 4XRMA 2EFGA 1WCMJ 4P1WA 4K1XA 3J7AY 1JE8A 3Q9SA 2VJIA 3U6KA 1QA3A 3TOBA 4JX6A 2HS5A 2NOGA 4BXXJ 3FKSA 2FOKA 3GZNB 3J81k 2ZBKA 3JR9A 3CF5F 1O3SA 1JTAA 2O6WA 3S1RJ 1QZZA 3VB2A 1IRFA 4IPAA 1UHSA 2L9RA 4FTHA 1YTYA 1RUOA 1X3WB 1XPXA 1ZQ3P 2ESHA 4WZLA 2LY9A 3WE2A 1MD0A 1SVOA 4CCMA 1H8HA 1QRCA 2RN7A 2RNJA 3DXJF 2H8RA 2FBKA 3KEQA 4N9IA 3OS2A 1KMHA 4B3XA 4WXCA 3GF2A 2EA2A 1I5ZA 3P27A 3C1DA 3BG6A 2F5FA 4OJ5A 2XGCA 4KKUA 3WU0A 1KCCA 4C3JJ 3KFWX 5E18F 3TW7A 5JI6A 4AIKA 2PLFA 1K73D 1DPRA 2AQFA 2CWEA 1JNYA 2CQQA 3LSGA 1SAUA 2ZO4A 3FK6A 2BX6A 1OFEA 1VQ5B 2HOAA 4NC8A 1BX0A 1F20A 1F60A 2B7EA 1R9TJ 1BIBA 5TJJA 3H35A 3B8YA 1YIJB 2BSPA 2BGCA 5HVQC 3PUBA 1BI3A 2P7CB 5EMNA 1IJWC 4IKFA 1EP2B 4C2LA 1VQLI 1ULYA 2M87A 2X1EA 1R36A 2ZXHA 3LNQA 2A6HF 5EF6A 2Z5UA 1R23A 4Y3OA 2F5DA 3TOAA 1LM1A 4YDTA 2ECCA 1IRZA 3GVLA 4N9HA 1OR7A 1GT0C 3SQNA 2ZNZA 5E20A 2KIUA 3VSTA 3CC2I 1EXMA 1ZLJA 1D8KA 3A35A 4RM3A 1UD3A 3KLOA 1VQ6B 1IB4A 4P9SA 4KITB 4ZYEA 1IV8A 3OP1A 2HI3A 3T8TA 3OYFA 4KA4A 2CUZA 2VT3A 1O8MA 3CO7C 1YJNB 1BIAA 3QU3A 2Q6IA 1ON2A 3PSSA 3HUGB 1LKXA 3FHZA 1W87A 2AQEA 3K10A 1XGMA 5CVVA 2K3PA 2XGJA 3GQBA 1ZM9A 2M9HA 5E17F 1VLYA 4LBZA 4NQWB 1ETQA 3MFKA 4KFCA 4BEHB 5B66C 2V7FA 3OE7A 3T5XA 4IOCF 5J40A 3ZMTA 2G7HA 4A3EJ 2HMAA 1OB2A 3NAWA 4Y4RA 5JMCB 4C2TA 2CQNA 1R49A 1XB4A 1I6HJ 4IEJA 2E19A 3CCMB 3QPSA 4LIUA 1N25A 4UY8I 1VQMI 1TWCJ 3H3UA 4AYBA 2LF8A 1OMIA 1GAWA 2BSAA 2PECA 2FRHA 1TYUA 1OB5A 4E0FA 1T56A 2H6BA 4ZYHA 3M7GA 2WYRA 4O6JA 3GXOA 3UR3C 2K9NA 1HSTA 2JK3A 2IRFG 3PNTA 2XUBA 4P55A 5JR3A 4M3EA 1BMFA 4HOBA 5H20A 4A3KJ 3PIPF 4ASUA 1O4XA 1BLIA 2FEZA 2LMDA 4L9TA 3VPRA 3ZGKA 3GLLA 4HQEA 2VBTA 1GV5A 3A4CA 3U21A 3E6BA 2LKXA 3OZUA 2K4BA 4EH1A 1V0EA 2GJKA 1FPQA 5J35A 5HKKA 3ABKH 2Y75A 3SUCA 1U8RA 3G05A 4II3A 1FWZA 1N06A 1W34A 1VQOI 1YW9A 1TW3A 2OK7A 4M71A 5KW9A 1ITYA 4LLGF 5FLXK 4KKSA 2Z9OA 4YZQA 3CUOA 5F4OA 3E6MA 4FX0A 1MZBA 1V4RA 2V7WA 2K40A 2CUJA 3FXQA 1OYIA 2LREA 2ZXIA 2FF4A 1Y1VJ 3RYPA 1WFXA 3QODA 1GVJA 1LE8B 2JZYA 1UCRA 3G6EI 4XQFA 2AO9A 2X6OA 4BQOA 1H9TA 1E3ZA 4OPVA 3RQ4A 2X85A 4ZJZA 5L3DA 1JI8A 3X2QH 1HF2A 2M4KA 3CDLA 5TV2A 3LSTA 2DA3A 1IGNA 3OEHA 4PMHA 1WPCA 5J4VA 3SLDA 3OYJA 1ZHFA 2BYVE 1RRJA 3EYIA 4CGZA 1ELOA 1NK2P 4NDLA 2KLOA 3OMYA 2QSGX 2X8KA 4XRSG 4GCVA 3K2AA 4KIGA 1IN7A 4WF2A 1ZLKA 1HVXA 2PN6A 2FNPA 2L4AA 3DTKA 3R60A 2DOGA 1YX2A 5FB2A 2IOUG 3V7CA 4W8TA 2ISYA 1DDGA 3ZQIA 1PLUA 4S04A 3IH3A 1G7TA 1EJ9A 1TWAJ 2VNKA 1T6XA 1QU3A 1DPUA 3VR6A 1S29A 2GIVA 3A01A 2O17A 2VFQA 4MNUA 1OYWA 3A0BC 3MWMA 2O9LA 4GGGA 2HLDA 3QFRA 1D1AA 1VQMB 5C1EA 2WWYA 1KZHA 1IV6A 3LSHA 3H9GA 4DYQA 1ZREA 4V02C 1TQIA 4TV7A 3AG2H 4XONA 3OIPA 1G4DA 3LQRA 4ZCIA 2J5OA 4WWCA 1N78A 4AC0A 3OR1C 5A2QK 3G73A 1GO2A 1MJ9A 3W6JB 1SD7A 4A0ZA 1G3WA 1WXRA 4ZC3A 4AUXA 5HNHA 2LSOA 2IGKA 2W57A 3RKQA 1VQ4B 1LNWA 2EWNA 2KIQA 5ICFA 1LPQA 4TT3A 3QU6A 3MKWB 4Y7NJ 4YIFA 1H8EA 2XC7A 1J9ZA 3HOUJ 2K4JA 1TSPA 3FBNB 4XSXF 3CCLI 5IYPA 2WAQN 4V2FA 2BEOA 2VNHA 1AHDP 1FJLA 5IYWA 3BQYA 3QPHA 2V5IA 5IP7J 2Z1DA 3AVXA 1X1DA 1G8XA 4L9VA 2V1UA 3KYCB 5H6RA 2O1DA 1WZ2A 2H6CA 2X3UA 2CK3A 4PJLA 5L3CA 2RVCA 5K7FA 1EE6A 1IDZA 2F5VA 3KP7A 2QZ8A 1Z21A 2Y0SA 1YJWI 2EV5A 2NNYA 3JQRA 1G7CA 3JRHA 3K4KA 4ZV4A 4PZJA 2L7ZA 2EZLA 2R7RA 1K9MD 5D5WB 1YO5C 2BY3A 1N05A 1FNBA 2ECBA 1D1NA 2P3MA 2VBEA 3E0JB 4RCZA 4EQQA 4ZYGA 4CHUA 2H1KA 2YWFA 3V7RA 4UVBA 2PJRB 1P9QC 4KISA 4FXUA 4TMVA 4HV5A 2EPFA 5L3FA 3I64A 4C2UA 2EZIA 2VN2A 2VBWA 4XKVA 1BI1A 3JTHA 5DUKA 2WR8A 5E3OA 4DQLA 2L7MP 1JJ8C 3QAHA 3MVPA 4A12A 2PYHA 4Z4YA 3S3NA 2X51A 2VQCA 3VO1A 2O6GE 3W3CA 2WAFA 2JVHA 1U5TA 4H4KC 4J00A 2QY1A 1CGPA 3DBRB 2ISZA 5HOOA 4UUSA 2A07F 4EM2A 3VNUA 4CH7A 3CJRB 3G2BA 3IH2A 2K5CA 3AVYA 2Y30A 4ZDLA 3WGGA 1OGMX 1WJBA 1D1BA 3K4JA 4C2MJ 2MGQA 3P26A 2XT4A 1JT6A 4M6XA 1DP3A 3FWEA 1GUUA 3IRRA 3FXMA 3BROA 3PM1A 4LFUA 1H0MA 1QA2A 1VQ8B 5KAIC 3DV8A 4UHTA 1BI2A 2A61A 4G6DA 3OY9A 4X05A 2Y48A 3MD2A 1MW7A 2STTA 3BY6A 3EUAA 4G12A 2YS9A 2R7QA 3F3XA 1S72B 3OOPA 2VPLA 4URRA 2ZMEC 3I1FA 1TBXA 4PC6A 3S3MA 5H59A 2E35A 3BH4A 2GREA 2Z16A 4RJLA 4MQVA 3OKXA 1N8RD 3LQ6A 3BH6B 4M6YA 3U2QA 4HF0A 3I54A 4B3FX 3I9V2 4IO9F 4MFEA 3B4NA 1U3EM 2D3NA 3H0GJ 1E17A 5LGUA 1UHMA 2VQLA 1U0JA 3CF2A 2A6TA 2M7BA 1TTTA 5AN9A 1Z3XA 2R7FA 2B0RA 3IC7A 1ETXA 2CFXA 1VHEA 3BT9A 1BX1A 3QPLA 3OS1A 2D74A 1FX7A 5HLIA 1S7OA 3DPLC 2Y9YA 5JHFA 4QFMA 2HKOA 2ZZQA 1K78A 1D5VA 2VC1A 1V55H 4BQQA 2DBBA 3TO6A 3CUQA 2JJ7A 1YLOA 2PMDA 1WVRA 1TTYA 4AVPA 5J1UA 1YI2I 3KP3A 3HPHA 4KN4X 3RYRA 3AG1H 5J6XA 5E79C 3L2CA 4A3MJ 2V4DA 2UWMA 1RQPA 2ZZEA 1KU9A 4ON0A 2P5KA 2JPCA 2VQGA 5EEGA 3KEWA 3I0TA 2OA4A 3S14J 4PABA 3O2PE 2HFHA 2L01A 5EDNA 2L2OA 3GZ6A 3CXCB 3K1PA 5BPDA 1KJZA 2NV4A 5C1CA 4HSTA 2XZLA 2LFBA 2D1HA 1WSVA 1FYKA 3ASOH 3A8IA 2XRNA 5A88A 2VBUA 3OR2C 4ZCLA 2VFOA 2YR2A 4DYCA 1ETOA 1UHWA 3GMEA 4ENNA 1MH3A 5CKTA 1BN5A 1OGJA 4FK8A 2DDAA 1ZYRF 3HPGA 2IJLA 2IVMA 4J19A 1K79A 3I4MJ 3H3ZA 2QF7A 4DJAA 2OTLI 2OZ6A 1ETVA 1FIAA 2FUG2 3RKWA 4I6ZA 2VKEA 3S2DJ 1BW5A 2ZTNA 1OCZH 4JBAA 3E6CC 3BR1A 4RLQA 4E4HA 1EFCA 4HYEA 2DTRA 2V9KA 3BR6A 4IF4A 4CSWA 3HL2A 3N6ZA 1X1PA 3LMMA 3I59B 2OC6A 2DA4A 4G1VA 5FFXA 3K4BA 2MD5A 3SJPA 1Y8RB 2RKHA 2HVQA 2QM3A 2VYQA 3ZPLA 2PBIA 4RB0A 1MBEA 5LRRA 4WZTA 2JQ7A 4PC2A 4Y9RA 4AVZA 4RLZA 5FJ8J 2IA0A 4YFOA 3ZPPA 3M1CA 2GJPA 4NNJA 4YAUA 1KU2A 3TDUC 5JLWA 4M9ZA 2XT2A 5FROA 2QQ8A 2KVOA 1FT9A 1XG1A 3ZQGA 4BY7J 3LAJA 2ZKZA 1Y0YA 3BNWA 5ILSA 1T98A 4JX5A 1NK3P 3NRVA 1RQRA 2DXIA 4TN1A 3W2IA 4U7DA 3BTLA 5JLXA 1VQ7I 4YZXA 2NT9A 1G7RA 2F48A 2XVCA 2UUZA 4OWRB 3EQOA 1M90D 1Z77A 1SFXA 5DNSA 1X19A 1T38A 5TRDA 2CW8A 3JAMK 3M8EA 3PO2J 4HX7A 5M5XJ 3QOPA 2OBTA 2JDIA 1LFUP 3S17J 3CCJB 4Z4RA 4XIDA 5CVRA 1YI2B 3HYIA 1DU0A 1QGYA 2KQRA 5E3LA 3WTUC 4OIQF 3CPXA 5ICCA 1EA0A 2V6CA 3AVVA 1R1UA 4ABZA 3QFTA 4AM3A 1YIJI 1YJ9I 1Y1WJ 3FMSA 4PC3A 4YFXF 2W84A 3CDIA 2GQQA 4AC9A 4W8QA 2NS8A 3O6BB 1CNEA 2DCUA 1QCXA 2NZMA 2EIMH 5CPRB 4A5NA 1P7IA 2EIKH 3DEEA 4OPWA 1IDJA 1UZCA 4EJUA 2CGPA 2CW7A 5HDNA 2PJRA 1E79A 1MNMC 3PA1A 5EZGA 1MMGA 3CUQC 3TO9A 3J80K 2B5OA 1B59A 1FTTA 3GTGJ 1AIPA 3GZ5A 2BM4A 4GO1A 2VE9A 1N0UA 1I50J 3ZMZA 2E2JJ 5IOZA 1VF7A 3ZMSA 4YAOA 3G4SB 5H6QA 4E7SA 3T53B 2IAIA 4WK8F 4RD2A 2K02A 2XASA 1LFPA 1IRXA 1D0ZA 2Y0MA 5LLQA 1NDHA 1COWA 3HXLA 1BJKA 2ZXJA 3G1MA 3BZKA 3DBLB 5FKMA 4R1HA 2DQRA 3V8LA 3N97A 1YITI 2XZOA 1SKYB 4A3DJ 1MJAA 3HEFA 2VUMJ 1O8IA 3LWFA 5FRMA 2GK6A 3A3BA 4M73A 1K8AD 2XSJC 2X1DA 4ZTFA 1S0UA 3GFMA 1KTVA 1WSRA 2J7KA 1FX0A 5J3LA 4ANJA 1VQKI 4X06A 2VBZA 1JKPC 1EH6A 3OYKA 4DYRA 5ILUA 1RPWA 2E34A 3LOCA 3GTKJ 5FNZA 3OJXA 1R5BA 6PAXA 1WU8A 3CMMA 5GADJ 2ZSHB 2AXTC 4BQAA 1FSEA 1KYWA 4IZZA 2C77A 3S2WA 1VQPB 1ETKA 4WQMA 1JJ2B 2K3FA 1B8IA 1FNMA 2RAEA 1PYVA 4UUTA 5JFRA 2V31A 1Z3YA 2ZCWA 1EFUA 3JAMZ 2L5QA 3JU4A 1V3FA 2VONA 2IBDA 2F5EA 1QRYA 2P6TA 3MMPA 1W0TA 2JA6J 2XSDC 3PNYA 1QA6A 1PJ6A 3GYHX 3FY3A 3WHBA 1KC8D 3F8MA 2D9RA 1AMOA 2BVLA 3ZZ0A 1TNTA 2V4JC 3DWLE 4BU2A 1QX4A 1JJ6C 3SJZA 3WTYC 2BY1A 4HNUA 3VFZA 3WTSC 5DS9A 1Z67A 1IC8A 3WTVC 4MIMA 2YU9J 3U6BA 1HCRA 1XG2A 4RM2A 1R5OA 4Y17A 4I76A 2QBYA 2A05A 2PYGA 2DTZA 2LKPA 2X4HA 1CQTA 1USTA 1I1GA 4RAGA 1DUXC 2ZTGA 2O0YA 3QFCA 4S05A 3EUKL 2HDDA 4A3JJ 3PIOF 1XMAA 2QYOA 1TT0A 3SEQA 4IRIA 4IRGA 1YJWB 3QWLA 2PE3A 1O8DA 3CCQI 2INVA 1TWFJ 4XICA 1QVTA 1IB0A 2EA4A 5LD2C 1ZRCA 2VPRA 2WAEA 2R9VA 2F1MA 4M53A 4P1VA 1NB9A 3EUHC 1ZR2A 5F4JA 3ZZTA 2V7UA 4QHYA 1NH3A 1K4SA 5D6EA 1I3QJ 2MG4A 3SY2A 2F4MB 1G6NA 3I56B 2YU3A 3ZR8X 4DZPA 2X0LA 5CVUA 3KP6A 2DK8A 4G6QA 1CNFA 1UJ8A 2QWWA 1APLC 1GAQA 1AKHB 2C4TA 1FOYA 4YZ0A 2ZB9A 3DU6A 1JA0A 5EEHA 2VT2A 4XL9A 5FFZA 5L3GA 4EGZA 1I39A 5D8LB 3SZPA 3GTJJ 1HKQA 3DKYA 4PSXA 3DDYA 4FASD 4XLNF 1R5GA 1RWRA 1QBJA 2P4WA 4FCYA 4NB5A 2CYYA 1JTXA 3HOVJ 2L7KA 2XAHA 2ZZGA 4RMNA 4HSRA 2AXLA 2IGNA 3BQZA 2LOOA 2RREA 3CP8A 1N75A 1LE8A 1N07A 2XRLA 3T8RA 2KDZA 4HV6A 1AWCA 1MNDA 2EILH 2DYRH 2YUSA 3CP2A 4GYIA 4HIZA 3QYEA 1PKVA 3OYAA 1MDMA 2XPUA 3SZTA 2KDOA 4IHVA 2O61A 2VZLA 2LK2A 1ZH5A 3A02A 5LHGA 5HLGA 3V8KA 1VFCA 2IS6A 1O8HA 1K7AA 1TYVA 1HOMA 3WE3A 2CQ7A 4BHCA 3GIRA 2IW5A 5HZAA 5EYRA 2KISA 1TYXA 1OISA 3GBGA 4OAYA 4UZFA 2W25A 3BTCA 1VI0A 2VFNA 3K69A 4UNOA 1KU7A 3WYAA 2TDXA 2X0KA 2OPTA 1B2RA 1A5JA 1FNCA 2COMA 1YHQI 1BA5A 1WOOA 3M9AA 5F0HA 2JPBA 2L9VA 2NSTA 5L3EA 4XMYA 2JT1A 4OP7A 1VQKB 2QEXB 1PVEA 1XQBA 1IN4A 3GFJA 2BHZA 2R7ZJ 1ERDA 4LG0B 4IQ4A 4B1RA 3L2QA 1Y0NA 4Z1MA 2Q2EA 4FN5A 3ZC3A 2NTPA 2P5VA 3HUGA 1RIOH 2DA2A 2M30A 3AVUA 3W2EA 4RAZA 1TT5B 3DCFA 3CMYA 3K70D 5BPIA 4OU0A 4EJTA 3RPUA 4RGSA 3OAAA 4B44A 5GAHJ 4RGUA 3LL7A 2EV6A 3H94A 1ZN2A 3BP8A 4B3AA 1TLLA 2HR3A 4IL6C 2MSYA 2B7BA 2HYGD 2OJED 4BEHA 2BY2A 5C4JJ 3HOXJ 2R5YA 3E1YE 4W1UA 1VQPI 1T6ZA 3D5SC 3HOYJ 4G5GA 5CDFA 2WV1A 2AHQA 4BY1J 2R7DA 2UZKA 3BDDA 4HEA2 4A3BJ 3IWFA 3CJNA 2R7SA 1HZEA 4MEYF 3AK5A 3G71B 3AG4H 2CUEA 3GTLJ 2XF5A 1BL0A 5BNGA 4M3BA 1EV7A 3ASTA 2DPDA 2R5ZB 4ROXA 1VQNB 4LBVA 1DQUA 2RC4A 3JRDA 4I84A 4NBSA 3CC4B 3BC8A 5L3BA 3WHCA 1CQXA 2XIGA 4G7XA 4IHWA 3WWGA 5LGTA 3EUHA 3NAUA 2QE7A 1XN7A 1YE9A 2IGMA 4BH9A 2CRGA 3OSFA 4PGOA 3ZIAA 1U2RA 1IUYA 5TGTA 5J1YA 3NQOA 4X8IA 1XB2A 1C0WA 1X0CA 2VC0A 3DTIA 1ZM3A 2V1DA 1F36A 3GSIA 4U7BA 4E7JA 1ACIA 3CCMI 1QZYA 3MN2A 2HDWA 4XLEA 2O03A 2HQ5A 4RD6A 1N77A 2VKDA 2XF7A 5E1ZB 4X0CA 3S1NJ 3G6EB 4UV9A 2J8KA 2HZTA 2BZTA 4LB5A 3E7LA 4EJWA 3F6OA 2HXIA 4PUSA 1PE9A 2XTXA 3MKZA 2D5VA 2NS0A 1RKWA 5FD6A 3MQ0A 4A5MA 4DW6A 1W1WE 4B8XA 2E60A 2OCEA 2BM0A 3H3VK 2KJBA 1YJNI 2L54A 2WTEA 5DDGA 2WBMA 3OW2B 2ZL7A 4UZEA 4HWVA 2CO5A 2C5HA 1HDPA 1QGAA 1PP7U 4M6VA 5DEQA 1O88A 2EK5A 2BW3A 4P25A 4RDJA 2K9MA 2ZJPF 2B9SA 4P3IA 1J09A 3CCVB 4YFNF 4IQJA 2GXBA 3JW4A 5E6TA 3FZVA 4OOIA 4UV8A 2NXNB 2TCTA 2G0EA 4M1KA 2VLAA 1YYVA 3HBLA 1H9GA 4FE7A 4BYYA 5ILVA 3CC7I 2DFEA 5FLVA 2LP0A 3G1LA 1MDMB 3WY9A 2XROA 1VBLA 2NVXJ 3OZWA 3OL3A 2HQAA 5E3MA 4ZDPA 4MYTA 4ENJA 2BGJA 4G7WA 1HG8A 1IDKA 3PVDA 3WTXC 3E3VA 2ELJA 3SFZA 2PMZN 1WTHD 3L00A 1KQ0A 2R7XA 1NRKA 1WJ5A 2ZSIB 1VQ5I 2P81A 2Q6LA 4HAMA 4GDFA 2M4GA 1GVHA 2X53S 2E1RA 5DUIA 3H92A 4QLCU 1MABA 4PGHA 2KZGA 2NRAC 2Z3YA 4QVJA 1T6SA 2GA2A 3Q0VA 4PJNA 3ESWB 1UD5A 2VBSA 1XSDA 2XPWA 3RJPA 3DTEA 5L46A 3RSNA 3CMAI 5B1BH 2DEUA 2FA5A 5IYBJ 5M3MJ 3OIQA 5J3OA 3R61A 1KZLA 4D0PA 3BCFA 1K8FA 1FIPA 5D4RA 2INUA 3FXLA 4MO7A 3VWBA 2D2WA 1UD8A 3OYGA 1YRNA 5CYVA 3J80Z 3E5QA 3DPUA 1MBHA 3CMEI 4YEIA 2EB7A 2QQBA 1EP3B 1OFMA 2EH3A 3WNCA 4BJ6C 3ELKA 3H9JA 4M0LA 3E6DA 1V0FA 1Y0RA 1GQ8A 1XCBA 5IT9Z 2BN4A 3DFGA 2EIJH 3Q39A 3T51B 2M34A 3MCAA 3K1MA 1ZG1A 4WZKA 3QOEA 3GUDA 2VJ4A 1D0YA 4X1EA 4B3GA 4JQFA 1SAXA 1VQ6I 2HPIA 4PC7A 4RDLA 3H5NA 3PO3J 4E70A 1P4MA 4XKCA 4X7CA 3CC2B 1K5CA 3BTJA 1FEXA 3QP6A 2BGIA 3NB2A 2IT0A 3E5XA 2JA5J 4BBSJ 4A6EA 1XDSA 1JHHA 3SZGA 1BPLA 1BJAA 2HOSA 3AL0B 2NOJB 1Y8QB 3TDZC 1WI3A 1KCDA 5BQTA 2E5NA 5D5UB 1Q81D 3OYEA 2ZMEB 1PDNC 4B4CA 4Z2YA 2LF7A 2EIXA 3R6KA 1D1CA 3EPZA 4WWVA 2NPFA 1CLWA 2XC1A 2E1OA 5EGOA 3QRFF 3E20A 1Z6TA 2LKSA 2HNHA 1YW7A 1TP4A 1SKQA 2X6WA 2K9QA 3MMYB 3A1YA 4EM0B 2BMWA 2IS4A 1E0EA 2BV3A 1QNTA 2L9NA 4C3IJ 2LVSA 2ZBVA 2UXNA 3WG9A 3SJMA 4ITVA 4MXNA 1HF0A 1NB0A 1I27A 3JTGA 1S3JA 4PDKA 3CO6C 3S1QJ 4CYCA 3JRCA 1VQ4I 2BM5A 4A69C 3WTTC 3BTIA 5FKNA 4Q7JB 1IJEA 3CQZJ 1OJLA 4YG2F 2W7NA 4UB6C 3WG7H 3FKIJ 3LVBA 5H2FC 3HC7A 2QCOA 3GLXA 3WGIA 3TH0A 1GVDA 5IYNA 3LSIA 3I55I 4U49A 4IVNA 4XRSA 4PSWA 3CCEI 4DK1A 2EZHA 1OPCA 4DIQA 2G7UA 2ZBUA 4P3YA 2QGGA 5DCFA 3CLOA 4MR0A 1ZGJA 5GPCA 2Z33A 3VEPA 1OHHA 1XSXA 3ML3A 2MC4A 2CS3A 2UVFA 3F6VA 1EFTA 2ID6A 1KQ8A 1H89C 2VBMA 2OTLB 4UAJA 3ISXA 2BXZA 2JSPA 1MMAA 2IS2A 1K6YA 2C2WA 2X6YA 4OZYA 1QUFA 2CRVA 2DDBA 3FM5A 1FSHA 2PMZA 3CC7B 1VLOA 4HNTA 2R93J 1Z1DA 2L3DA 4MGRA 2QSFX 5KHDA 4ENMA 3U1DA 4PC1A 1IXSB 1TQMA 3CCJI 2BF4A 3BPXA 5CQGA 3CCVI 2JA8J 1E43A 5M5YJ 4DBQA 2EFNA 1IN8A 2MA3A 2ZFUA 5CVJA 4Z4WA 4WXDA 4XNFA 2DK5A 2R7OA 3NWSA 2UXXA 4HW0A 4DNRB 2E2IJ 1KGSA 3FDYA 2IQ7A 4XLAA 2E7XA 3M1EA 1KRHA 4BJTA 1YW8A 4PFPA 4E7HA 1Q1HA 2WZNA 5FLXZ 1MNEA 5HDKA 4PJMA 4TKOB 1W4MA 1IJFA 3K9TA 3S2HJ 1XSVA 4UB8C 2Z6BD 2C4UA 2X1CA 4Z4ZA 3HKZN 2CFOA 1QG0A 1SVLA 4HE6A 3DLAA 2PLYA 1J9IA 4OAZA 2DMNA 4KICA 5FRNA 2HGCA 1X3UA 2QXZA 5D8KB 2RGVA 1VJSA 2IEKA 4MLOA 5B5EC 3HIFA 1KK2A 2V7XA 1XGNA 2EINH 4ZDOA 2W00A 1RR7A 3ABUA 3MHPA 1TUIA 3LYCA 1DU6A 2PI0A 1DABA 1FP2A 3IKTA 1QPMA 4RD4A 1A36A 1LDJA 4LGWA 1HW5A 1G3YA 4DK0A 4KIFA 4KN7X 1VHOA 1DGRM 1PUFA 5A89A 4OJOA 2JUGA 5IPAA 4PCQA 2ID3A 3BJOA 3D5RC 1ZAOA 2PMUA 2V79A 1STZA 1DDNA 2L4MA 4YRVA 3ASNH 1HC8A 1QRBA 3HHHA 2G9WA 2ZXWH 3SFIA 3F72A 3K70C 5EJCA 2X9DA 2NVQJ 3BR5A 2LD5A 2K85A 3CDHA 1FNDA 2L7FP 3GTMJ 2JSCA 2XTWA 4D1QA 3B6AA 4OIPF 2WJYA 4AYBN 1W0UA 1XD7A 9ANTA 2DFIA 2XAJA 3KP2A 1D8TA 1L0OC 2E36A 1T6YA 4L9NA 5J8CA 2I1LA 1EWYA 4D5CA 3G71I 3RQIA 4Z4VA 4DQKA 2L9SA 2HTSA 5A8AA 3FJOA 3KP5A 3KCCA 4KDPA 2COBA 3ZUGA 3JURA 5FO5A 4ESBA 2EFPA 2ZMEA 3K4LA 2PEXA 2CH0A 3LSRA 2KRHA 4HBLA 2WY8Q 1P92A 2NVYJ 2GLOA 3K1NA 2HYJA 3DP7A 4W97A 5D5VB 3BWGA 1WJFA 1FBUA 2WSSA 4BXUA 1LFBA 2CQKA 3HRTA 3EYYA 3OSGA 5C4XJ 3WNBA 1BOBA 1K78B 3SXYA 2R4GA 3NE5B 5LGNA 3U9GA 2EFWA 4HDUA 2UVEA 1ZARA 1CF7B 1YX5A 1YX3A 2NAZA 2OAZA 3ULQB 1BR1A 2EWEA 1H8AC 4RCYA 1SD5A 2B63J 3V76A 4QIWN 3HB9A 1FLIA 3BC9A 1J2XA 2ODLA 2JN6A 1RR8C 2Q0OA 1XE1A 4R71A 3KYDB
chains in the Genus database with same CATH topology
1FMVA 3ZXSA 4W8RA 1HA8A 4XLHA 1NBMA 1PYVA 1KMHA 3OS2A 2V31A 2KZVA 4B3XA 1Z3YA 3H5AA 2CMPA 2GOMA 2L5QA 3JU4A 3VMWA 3LMWA 3BG6A 4OJ5A 4KKUA 3CJQB 4OJ6A 2A5WA 2VB6A 1T5EA 1W9XA 1KCCA 3ZRGA 3BCAA 3PNYA 3FY3A 1NG6A 2BVLA 2AQFA 3I3LA 4BUPA 2V4JC 3DWLE 4BU2A 4C9YA 3WQZA 2M0MA 3LSGA 4XLCA 1SAUA 4HNUA 3NWTA 4NC8A 3DU5A 1NG7A 2KHMA 1AIRA 4CCOA 3DKXA 2NTBA 3H35A 3B8YA 3FHNA 1XG2A 4W8SA 2BSPA 4RM2A 5HVQC 1QJVA 3PUBA 3VSUA 4C2LA 4QPQA 4IKFA 3H0DA 1W36D 2QKLB 2PYGA 2X1EA 2ZXHA 3VDXA 2UV1A 5FL7A 1I18A 4G6IA 2ZTGA 4CCKA 3DPTA 4Y3OA 2E1BA 3EUKL 1BHEA 3GVLA 1TT0A 3SEQA 4Z05A 3UW0A 2VXDA 2Z8GA 3VSTA 1O8DA 3FKJA 2VJ5A 2VXZA 2LRDA 4RM3A 1UD3A 3A35A 2R9VA 2F43A 2INVA 1IB4A 2R7TA 5LD2C 2LG4A 2WAEA 2E1MB 3PSFA 4KITB 1Z7LA 4BDZA 2F1MA 3W2WA 3EUHC 2HVRA 3L2VA 4CUGA 3OYFA 3EQOA 1O8MA 2CUZA 3HG9A 2DT7B 3ZR8X 4DBRA 1WP6A 1K28D 3HUGB 2XDVA 1LKXA 3SYTA 4BS9A 3V42A 2JIZA 2AQEA 3K10A 5KCMA 3OYLA 2K3PA 3KRGA 2XGJA 4YZ0A 3DU6A 3GQBA 4XL9A 1VLYA 4NQWB 2VBKA 3OYDA 3OYCA 3DKYA 4PSXA 3KEYA 4BEHB 2QKMB 4FASD 2JJ1A 2V7FA 4XR6A 3DDYA 2KP6A 3OE7A 1RWRA 4OJLA 2GJRA 4Y4RA 4F92B 1V5GA 4C2TA 2L7KA 2Q2EB 1D0XA 3RTRA 2ZZGA 4RMNA 4HSRA 2IGNA 2GK7A 2LOOA 2RREA 3CP8A 1N75A 4LIUA 4UZUA 4N4OB 4AYBA 2RNGA 4CA0A 1KONA 2PECA 3TMOA 1MNDA 2GOXB 3CP2A 4HIZA 4E0FA 4Z06A 1OGOX 3QYEA 1PKVA 3OYAA 3UR3C 4YXWA 4ZTJA 2XNDA 2KDOA 1UELB 3PNTA 1IA5A 1BMFA 3E1SA 4AU7A 4ASUA 1O8HA 2IS6A 4F52A 1BLIA 5HLTA 1ZELA 3ZGKA 2R7VA 3OOUA 3MKYB 3A4CA 3OPOA 3U21A 3GBGA 4OAYA 1UAAA 3FBIB 4XOTA 5CQEA 1UD2A 4NC7A 1AA7A 1V0EA 1X1CA 2GJKA 3AFHA 5HKKA 3SUCA 4XLFA 3G05A 2OUMA 4II3A 3K4CA 1W0JA 3SDBA 1V5EA 4N4NB 2NSTA 4KKSA 4XMYA 2K9LA 4BDYA 4YZQA 3HOTA 2HZDA 2CUJA 1Y6IA 2LREA 2ZXIA 2LH9A 2V26A 4IQ4A 3L2QA 1WFXA 1ERDA 4Z1MA 2NTPA 3QODA 1E1RA 3BCBA 3A3GA 4PK4A 4BQNA 3B90A 2NSPA 4XQFA 4BQOA 1KCDA 2IXSA 4Y33A 3K70D 1E3ZA 3RQ4A 2X85A 4ZJZA 2VL8A 2W1OA 3PJRA 1VZ0A 2M4KA 3S93A 4B44A 3OAAA 3LL7A 3H94A 3GVKA 4JMQA 3OEHA 4LG3A 4PMHA 4JOMA 1WPCA 4BEHA 1MMDA 5AMVA 3OYJA 3D5SC 5CDFA 4NK8A 1BR4A 2KLOA 3LSMA 3OMYA 2X8KA 4HEA2 2R7SA 3DQVC 1HZEA 2KMUA 3K4MA 1HVXA 4B47A 2XF5A 2W6IA 3DTKA 1X4OA 2MFZA 1DQUA 3PSIA 1RU4A 4W8TA 4BE2A 2BW3B 3TL4X 3LSKA 1PLUA 4I84A 3BC8A 3OFNA 2MYSA 1W36C 3WWGA 4G7XA 3BCDA 3IAM2 3KX2A 1QU3A 3VR6A 1O8LA 2DIEA 3S3OA 2QE7A 2O17A 3S32A 3OYHA 1YE9A 2IGMA 2WJVA 4PFOA 2HLDA 5IK2A 5C1EA 1D1AA 3ZIAA 1PJRA 2VKHA 5TGTA 3LSHA 4XN3A 3H9GA 1X0CA 3DTIA 4XONA 3OIPA 4U7BA 4E7JA 1E3XA 1N78A 5HNFA 3OR1C 1SFKA 4XLEA 2HDWA 2W6JA 4LIVA 2JA2A 3GVJA 1EFRA 1O8JA 1N77A 2VKDA 4ZC3A 4F91B 2XF7A 5HNHA 2IGKA 3VYUB 4TT3A 3C2HA 3MKWB 1PE9A 1QHHD 1WJEA 2LY2A 4PUSA 3MKZA 1H8EA 2WY7Q 4XM3A 4FETA 2XC7A 3OYMA 4E7LA 3GQ7A 3IAS2 3ZCOA 3FBNB 3T9GA 2E60A 3OYIA 4YELA 4TSFA 2WBMA 1EA3A 1OFLA 4HWVA 3QYBA 3K6GA 2Z1DA 5DN6A 1X1DA 1G8XA 3HKZA 1O88A 2O1DA 2BW3A 2CK3A 4XKWA 1DGWY 4P5OA 1T0FC 4PJLA 1EE6A 2K9MA 4P22A 3OEEA 2DJIA 1J09A 2F5VA 2LZJA 4IQJA 1Z21A 2Y0SA 4YEJA 4BJ5C 1OLTA 3K4KA 2MABA 4OZZA 2R7RA 2VLAA 1UD6A 2QX3A 4CCNA 1TZLA 2I8DA 2VJJA 2WPDA 2M3AA 4BE1A 4E7IA 2VBEA 3E0JB 3VSKA 4F93B 1VBLA 3ZQQA 4XD7A 3OL3A 4PJJA 2HQAA 3OL4A 1UG0A 4ZDPA 2PJRB 1P9QC 4KISA 4FXUA 4G7WA 1HG8A 1IDKA 2NTQA 2ELJA 1W0KA 2D3LA 4HG2A 1WTHD 4C2UA 4XKVA 2R7XA 1WJDA 1WJ5A 2ZSIB 2R7UA 1NRKA 2KRCA 2KL4A 1JI8A 2M4GA 3AL0C 2X53S 2PYHA 3S3NA 2X51A 2VQCA 3W3CA 2WAFA 1MABA 2JVHA 2F4IA 4H4KC 4J00A 2QY1A 4PJNA 4BXFA 1UD5A 2M5SA 1S9HA 3DTEA 5HOOA 3RSNA 4F3QA 3M8JA 3IUOA 4DGWB 4CH7A 3OIQA 4XKBA 3CJRB 3G2BA 2K5CA 4XORA 2R7WA 4ZDLA 1KZLA 1OGMX 2DT6A 2WB1A 1WJBA 1D1BA 3K4JA 4XOPA 3RPUD 3VWBA 1UD8A 3BCFA 2INUA 4L8JA 3OYGA 1Y56A 3DPUA 1O8GA 1OFMA 4BJ6C 1DP3A 3H9JA 2KPMA 3ONQA 1V0FA 4KKTA 1GQ8A 3BG7A 3T51B 4OJPA 1MMNA 2DOAA 2XAUA 4B48A 2ZZFA 3QOEA 2VJ4A 1D0YA 2VIXA 4B3GA 1QHGA 4DOZA 3OY9A 4JQFA 4XN0A 3MD2A 1MW7A 2HPIA 3EUAA 3H5NA 3PL8A 2W82A 2R7QA 4XKCA 4DNTB 1H80A 2VPLA 4URRA 1K5CA 2CV2A 4KJZA 3S3MA 3BH4A 2VASA 1FMWA 2Z16A 4G6TB 3OOCA 3SZGA 1BPLA 4KT6A 3AL0B 2NOJB 4CCJA 4B3FX 3I9V2 3B4NA 2D3NA 2E5NA 2MD0A 4BE0A 3OYEA 2VQLA 1U0JA 2LBFB 3CF2A 1D1CA 3EPZA 2A6TA 3W2AA 4GQNA 2M7BA 2O0VA 1Z3XA 2HNHA 1WJCA 3F9KA 2V1NA 4CCLA 3PNVA 3OS1A 2X6WA 4B43A 3MMYB 3A1YA 3DPLC 5JHFA 2ZZQA 2IS4A 3GQ8A 1E0EA 3UNGC 2L9NA 4BQQA 3OW7A 3GQ9A 4ITVA 4MXNA 2NT6A 3LFUA 3ZSCA 3HPHA 2V4DA 3BLYA 3T56B 2ZZEA 2P0WA 4U4BA 2UWMA 1O8FA 5LFAA 1DBGA 3KEWA 2VQGA 2O0WA 2W7NA 2HPMA 3HC7A 2L2OA 4IX7A 2JVGA 4NK6A 4NUBA 4C30A 1KTWA 5C1CA 1T95A 4HSTA 2XZLA 2IGOA 3LSIA 4U49A 3L2UA 4PSWA 2BVMA 4DK1A 3VMVA 3W2VA 3OR2C 4YZAA 4DIQA 4II2A 5CKTA 1OHHA 4HPQA 2MC4A 2CS3A 2UVFA 4LITA 1LDKB 1X4PA 2VBMA 3HPGA 2LBFA 2Z2SB 2WAQA 3AKZA 3ZPNA 2JSPA 1MMAA 4DJAA 3HOSA 1K6YA 4BACA 2IS2A 2FUG2 3H9QA 2X6YA 4OZYA 4EW9A 2WADA 4U87A 2ZTNA 2PMZA 4RLQA 4E4HA 4HNTA 2CV1A 2E1MC 2V6EA 4CSWA 2V9KA 3VYTB 4E6KG 5KHDA 3L2WA 3HL2A 1G59A 3LMMA 1PXZA 3VSVA 2OC6A 4CZCA 1JRGA 3K4BA 5CQGA 1E43A 3FPPA 4E7KA 2HVQA 4DBQA 1BN8A 2ZFUA 2XZPA 1X1BA 4EATA 4XNFA 1UD4A 1OR7C 2R7OA 3CZ6A 3NWSA 4AVZA 4DNRB 3FDYA 3QYFA 2HU9A 2LC2A 4XLAA 2IQ7A 4BJTA 2X6XA 4PFPA 4E7HA 3OYNA 1O8KA 3M1CA 2GJPA 2XF6A 4NNJA 1RMGA 3ZPPA 1MNEA 2W4SA 4PJMA 4TKOB 5FROA 3VSLA 2KVOA 3OYBA 2M7AA 2Z6BD 4Z03A 2WA0A 3VYSB 2X1CA 4D9JA 3L2RA 1X1AA 2CFOA 3IP4B 2X3HA 2DXIA 3DLAA 4ZYAA 2DCEA 4OAZA 1BR2A 5FRNA 2OV7A 2F6CA 5KNLA 1O8EA 3D5LA 2QXZA 2O5RA 1VJSA 4YZXA 3H5RA 4MLOA 2NT9A 2O04A 1CZFA 2UUZA 4OWRB 4R79A 1WJAA 4ZDOA 3HAGA 4RLFA 2W00A 1X19A 4BL0B 4QPOA 3N05A 2CW8A 2JJ2A 3C2GA 2RQQA 2JDIA 4E7ZA 3S8PA 3CESA 4DK0A 2HVSA 1DGRM 2VQHA 3KYLA 4OJOA 2JUGA 2KQRA 3D5RC 2CV0A 4BGDA 4YRVA 3K70C 1LVKA 4W8QA 3GQAA 3K4NA 4GRIA 2LYCA 3OS0A 1QCXA 2NZMA 2IS1A 5CPRB 4D1QA 4HRIA 2WJYA 3DEEA 1IDJA 4F55A 2Q1ZB 1I8DA 1E1QA 2CW7A 1E79A 2PJRA 3OWTA 1GLNA 3RCOA 1MMGA 2L9SA 3A2KA 2BOLA 3JURA 1WMRA 1R6RA 3K4LA 1VF7A 3GRHA 2CH0A 3VYRB 3TBIA 4E7SA 2KRHA 3T53B 2WY8Q 2E5ZA 1NHCA 1LFPA 1IRXA 1D0ZA 1V5FA 2V7QA 1COWA 3HXLA 1WJFA 2WSSA 4X0GA 2XZOA 4J01A 1BOBA 4P1WA 1SKYB 1OOCA 2R4GA 3NE5B 3J7AY 1O8IA 2VJIA 2WZPP 5FRMA 2GK6A 2LY1A 3A3BA 1DBOA 2UVEA 3FKSA 1YX5A 1YX3A 2XSJC 2X1DA 4ZTFA 1JTAA 1FX0A 1BR1A 3PFYA 2EWEA 4ANJA 3OYKA 2XOKA 3BC9A 3LNNA 1OB0A 2ODLA 3CMMA 2ZSHB 3SEZA 4IZZA 4MR0A 4CCMA 3EQNA 1H8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDK A;  2NST A;  2X6Y A;  2NTQ A;  4OZY A;  4W8R A;  4EW9 A;  4XMY A;  4XLH A;  4YZQ A;  4XKV A;  3VMW A;  3LMW A;  4OJ5 A;  2PYH A;  2NTP A;  4OJ6 A;  1PXZ A;  3VSV A;  1KCC A;  1JRG A;  3FY3 A;  3B90 A;  2NSP A;  2QY1 A;  1BN8 A;  4XQF A;  1KCD A;  4YZA A;  4XNF A;  1O8L A;  2X85 A;  1OOC A;  4XLC A;  4AVZ A;  2IQ7 A;  4XLA A;  2X6X A;  1O8K A;  3ZPP A;  4XOR A;  1OGM X;  1RMG A;  4PMH A;  4XOP A;  1AIR A;  2INU A;  2NTB A;  5AMV A;  3B8Y A;  1XG2 A;  4W8S A;  4Z03 A;  2BSP A;  1QJV A;  1O8G A;  4NK8 A;  3VSU A;  1OFM A;  4C2L A;  2X3H A;  2PYG A;  1GQ8 A;  1O8E A;  2QXZ A;  4OJP A;  4YZX A;  2O04 A;  1BHE A;  2NT9 A;  1CZF A;  4Z05 A;  3UW0 A;  2Z8G A;  4XN0 A;  1RU4 A;  4W8T A;  3VST A;  1O8D A;  2INV A;  4I84 A;  1IB4 A;  1H80 A;  1PLU A;  1K5C A;  4URR A;  3WWG A;  2O17 A;  3EQO A;  5C1E A;  1O8M A;  4OJO A;  3B4N A;  4XN3 A;  1X0C A;  4YZ0 A;  3KRG A;  4W8Q A;  4XON A;  3GQA A;  4XL9 A;  2VBK A;  1QCX A;  2NZM A;  4XLE A;  2O0V A;  4OJL A;  4XR6 A;  1IDJ A;  1RWR A;  1O8J A;  2X6W A;  3GQ8 A;  1PE9 A;  3JUR A;  1WMR A;  3GQ7 A;  3GQ9 A;  4XM3 A;  4MXN A;  2NT6 A;  3GRH A;  2PEC A;  3T9G A;  3ZSC A;  4YEL A;  4U4B A;  4Z06 A;  1OGO X;  1O8F A;  1NHC A;  1DBG A;  1OFL A;  4HWV A;  2O0W A;  1IA5 A;  1O88 A;  2O1D A;  4XKW A;  4NK6 A;  1EE6 A;  1O8H A;  1KTW A;  5C1C A;  1O8I A;  2VJI A;  4YEJ A;  1DBO A;  2UVE A;  4U49 A;  4OZZ A;  3VMV A;  1JTA A;  2EWE A;  4XOT A;  2QX3 A;  2VJJ A;  2VBE A;  2UVF A;  1VBL A;  2ODL A;  3SUC A;  2VBM A;  4XLF A;  1HG8 A;  4MR0 A;  3EQN A; 
#chains in the Genus database with same CATH topology
 1FYM A;  4XLH A;  1NBM A;  2E71 A;  2HQR A;  2XAG A;  2I5U A;  2M2E A;  3IWZ A;  3RIR A;  3RPQ A;  2KZV A;  4WX9 A;  2GM4 A;  4HZF A;  1L1I A;  2CMP A;  1KK3 A;  2VFM A;  3UKG A;  2M5W A;  3LMW A;  3VMW A;  4I2O A;  3CCU B;  3CJQ B;  4OJ6 A;  2A5W A;  2VB6 A;  1T5E A;  1W9X A;  1ZM2 A;  1QVF B;  1TL8 A;  3ZRG A;  4U0Y A;  3LSP A;  4X7D A;  1AKH A;  1PJ5 A;  3I3L A;  1WHU A;  5F0C A;  3CC4 I;  4NQW A;  3CCR I;  3WQZ A;  1XGO A;  4XLC A;  2ZNY A;  2VFP A;  3B02 A;  1WH5 A;  1J75 A;  2BXY A;  3A8J A;  1IO2 A;  3FMQ A;  1NTC A;  4EM1 A;  5J1R A;  2F5C A;  1AIR A;  4OIN F;  4CCO A;  2NTB A;  3GX4 X;  4XK4 A;  2DW4 A;  3FHN A;  1IXC A;  5DCM A;  4IRH A;  3CB4 A;  2A6E F;  4W8S A;  4QPQ A;  3M07 A;  2C5B A;  1WWX A;  4FQG A;  2QKL B;  3B8H A;  2GA1 A;  4U9U A;  2UV1 A;  5DTD A;  3V8J A;  1I18 A;  3NEU A;  4G6I A;  3VNV A;  1YIT B;  4I7H A;  2OF7 A;  2FBH A;  4RD1 A;  3S15 J;  4Z05 A;  3CD6 I;  3HSF A;  3L1P A;  2QGU A;  1TWG J;  3ERE D;  3CD6 B;  3FKJ A;  2LRD A;  5GP9 A;  2Q6K A;  2OD5 A;  2D1V A;  4HF2 A;  2R7T A;  1YOV B;  2LG4 A;  2ZC2 A;  2E1M B;  4BDZ A;  1Z7L A;  1U9O A;  2HVR A;  1P4A A;  4CUG A;  1S5L C;  3ZP5 A;  1VQ8 I;  1G3T A;  1S8N A;  2OQR A;  4G1B A;  3F0C A;  3HG9 A;  1SEU A;  4H9G A;  5EG0 A;  1U2W A;  2FOW A;  3E97 A;  5CLS A;  3FX3 A;  4PJ0 C;  5KCM A;  3OYL A;  2JIZ A;  5FO0 A;  1BI0 A;  3KL9 A;  3Q6Q A;  3JSO A;  1MIJ A;  1X2M A;  3KRG A;  1O57 A;  2CUF A;  4HDV A;  2FU4 A;  2PQ8 A;  2LTP A;  5E1X A;  1YHQ B;  1H85 A;  2VBK A;  3ML6 A;  2HCJ B;  2QKM B;  4OJL A;  4HX8 A;  5KVR A;  2KP6 A;  1JHF A;  1SFE A;  3FIW A;  3V7S A;  1DDI A;  3BQJ A;  3OIO A;  1T0F A;  4WXH A;  2GQF A;  4M2L A;  3LQQ A;  5F6F A;  1K4T A;  4F92 B;  4WCG A;  1TW2 A;  1VQL B;  2Q2E B;  2DA5 A;  3ZQC A;  4M3D A;  4K2E A;  2QDX A;  3C3W A;  2GK7 A;  3W2F A;  4UZU A;  1XTA A;  3HTU A;  4CA0 A;  2ICW G;  1KON A;  3I59 A;  1N08 A;  1R00 A;  2GOX B;  1RNL A;  3TMO A;  2HDN B;  4Z06 A;  1OGO X;  2H09 A;  2OU2 A;  3QPT A;  4ZTJ A;  5IYQ A;  1Y0U A;  4IJA A;  1UEL B;  1TWH J;  1ZTR A;  1I3A A;  3HRS A;  4ZZD A;  2NS7 A;  2F1L A;  3H09 A;  2E2H J;  3FXR A;  3PSZ A;  1GXQ A;  2XGE A;  4F52 A;  1OCT C;  1POG A;  2FE3 A;  2OCC H;  2R7V A;  4RPB A;  3ZQF A;  3O3K A;  2X48 A;  3OOU A;  3N4M A;  1T39 A;  2HOT A;  2ZL6 A;  1X2N A;  1REP C;  5IP9 J;  2IA1 A;  1QGP A;  3F8C A;  3Q5F A;  3JQQ A;  5CQE A;  1TYW A;  3I4P A;  1Y39 A;  3FXO A;  1X1C A;  1B9N A;  4DZJ A;  4I01 A;  1SMY F;  4BHB A;  1JT0 A;  5D6F A;  4XLF A;  4EV0 A;  1VQO B;  2OUM A;  3GCM A;  5EZH A;  3K4C A;  2K9S A;  5GPA A;  1W0J A;  1WOP A;  3ONY A;  1V5E A;  3A8K A;  5B6I A;  1EF4 A;  1HKS A;  2W7Z A;  4BDY A;  1P4X A;  3HOT A;  1LVA A;  1O3R A;  3K2Z A;  1E2X A;  4A3F J;  4XBF A;  2CSO A;  1HLV A;  4G9Y A;  3J7Z I;  4MEX F;  3SLN A;  4I0B A;  1NJI D;  3A3G A;  4PK4 A;  1HBX G;  1RKT A;  1TLH B;  5M5W J;  4OOS A;  1ZK8 A;  4M3G A;  5HS8 A;  1ZGW A;  2VBV A;  2ZIT A;  2IXS A;  3PUM A;  5LEK A;  3PJR A;  2W1O A;  3CCQ B;  1VZ0 A;  2MBF A;  3S93 A;  1OOC A;  4FHT A;  1OCP A;  1HSJ A;  3LA7 A;  3GVK A;  4JMQ A;  3KET A;  4KH3 A;  4LG3 A;  2V7V A;  1BC8 C;  4P2N A;  1XS9 A;  1MMD A;  5AMV A;  1IN6 A;  1CF7 A;  5TY0 A;  1BR4 A;  2G0Y A;  3DBH B;  3DQV C;  2KMU A;  2ZJR F;  2R92 J;  1OKR A;  1XFO A;  4I99 C;  4N3N A;  2DER A;  3Q0W A;  1ZGA A;  4P9U A;  3BOQ A;  4B47 A;  4N0B A;  1RUN A;  5F27 A;  2W6I A;  2ACJ A;  1BBY A;  1U78 A;  2CQX A;  2H1L A;  1MSF C;  1ORK A;  2MFZ A;  2DFF A;  1RU4 A;  5GV7 A;  2P6S A;  4KUM A;  2BW3 B;  3RKY A;  3LSK A;  2DA6 A;  1VQ9 I;  1WOS A;  2F2E A;  2KRF A;  4RBO A;  1W36 C;  3CCR B;  5GV8 A;  4RDK A;  5J47 A;  2HDC A;  2QBY B;  3CRZ A;  3OYH A;  1Q86 D;  5LHI A;  1U5T B;  5IK2 A;  4FX4 A;  3ZMU A;  2EZK A;  3V7A A;  1PJR A;  2VKH A;  4AD9 A;  3AAF A;  1H88 C;  4G7Z F;  1KD1 D;  1FBS A;  4XN3 A;  4YAF A;  2M1B A;  3C7J A;  2NVT J;  1LDD A;  1WOR A;  4KMF A;  4HLX A;  1S7E A;  2QEX I;  1AOY A;  3W6V A;  2XGD A;  2F4N A;  1E3X A;  1VF9 A;  2FXA A;  5HNF A;  1SFK A;  1XMX A;  2BV6 A;  2W6J A;  4X6A J;  4XSZ F;  4LIV A;  4P26 A;  2JA2 A;  2ESN A;  1B8I B;  2DOD A;  4I98 B;  3JSP A;  4F91 B;  1AU7 A;  1EFR A;  2ZJ2 A;  1O8J A;  5LRS A;  3C2H A;  1EH7 A;  4RGR A;  3C2B A;  2LY2 A;  3BG3 A;  1FRQ A;  2WY7 Q;  4FET A;  3F8B A;  4IXA A;  4IW3 B;  3WBK A;  3IAS 2;  2QSH X;  4YHB A;  3ZCO A;  3T9G A;  4YEL A;  3CME B;  5E8G A;  4TSF A;  1EA3 A;  1VQN I;  1OFL A;  2HEO A;  2CW0 F;  1B6A A;  4RB2 C;  4P12 A;  5BMZ A;  4P6V F;  4L5E A;  3HKZ A;  4FE4 A;  2HTJ A;  1XC5 A;  1SD4 A;  2HXO A;  1DGW Y;  4XKW A;  3SDG A;  5HXB A;  1XCV A;  5J8F A;  3ZZU A;  3TED A;  2DJI A;  3OEE A;  1FOX A;  2LZJ A;  4YEJ A;  5BS6 A;  2OTJ B;  1S6L A;  1R7J A;  4BJ5 C;  4AF7 A;  4QV2 A;  1OLT A;  2OTJ I;  3WU1 B;  1E3H A;  4CO8 A;  3E5U A;  2J5P A;  3VO2 A;  2QX3 A;  1HQC A;  1MBJ A;  2VJJ A;  1TZL A;  2DAO A;  2A68 F;  3WU2 C;  5FLM J;  2PIA A;  2DOE A;  2WPD A;  3Q6R A;  4F93 B;  4LC0 A;  1KQ5 A;  2JN9 A;  3ZQQ A;  3EQN A;  2V7T A;  4PJJ A;  1UB9 A;  3ZQ7 A;  2XPV A;  5KSW B;  3CW2 A;  3DEW A;  5ERI A;  2W85 A;  4D7M A;  3IL2 A;  1H42 A;  1W0K A;  4TMZ A;  4HG2 A;  1LUJ B;  4H0E A;  1WJD A;  4F7Z A;  2KL4 A;  4GXO A;  5F4M A;  3AL0 C;  3CCU I;  1LEB A;  1I6X A;  4Q5S F;  2DYS H;  1ON1 A;  1ETW A;  3IRQ A;  4BXF A;  3AGQ A;  3KZZ A;  4UXN A;  4P9F A;  2M5S A;  1S9H A;  1B23 P;  2QTL A;  3JRE A;  1D3Y A;  1W5T A;  2K7L A;  3M8J A;  3IUO A;  1RI7 A;  5CJ9 A;  4XKB A;  3GO5 A;  2R7W A;  1LEA A;  2DT6 A;  3GVA A;  2XGX A;  3R0J A;  1FOK A;  4YCQ A;  4L8J A;  4IHX A;  4Y52 J;  3V4G A;  3PUN A;  1O8G A;  2HWV A;  3ISP A;  1GV2 A;  2BHY A;  2KPM A;  4KKT A;  1VQ7 B;  1B9M A;  1A6I A;  3BG7 A;  3T0Y A;  4OJP A;  1MMN A;  2ZZF A;  4B48 A;  5HOD A;  2B0L A;  3ABM H;  3AGP A;  5DS0 A;  3L09 A;  2VIX A;  1IRG A;  1QHG A;  4AIJ A;  3PL8 A;  1P6R A;  2GPJ A;  3B82 A;  4M72 A;  2YUH A;  1H80 A;  2AHO A;  4Z4U A;  5K5R A;  1SMT A;  5ED4 A;  2WC2 A;  2CV2 A;  4UVC A;  1JKR C;  4KJZ A;  2OBS A;  2WV0 A;  1U6G A;  3HOZ J;  3G3Z A;  3F8N A;  4G6T B;  2V9V A;  2V1X A;  3IKV A;  3OOC A;  1ZRF A;  2LDU A;  5DD8 A;  3H9N A;  5FA6 A;  3I71 A;  2KIM A;  1GDT A;  3VOE A;  1WSU A;  1FBQ A;  1X3Z B;  3U2R A;  1GJR A;  2MD0 A;  2CU7 A;  5GAG J;  5ICG A;  2HKX A;  5IY5 H;  1OQY A;  4RB1 A;  3COA C;  4BE0 A;  3TP0 A;  3REO A;  1SC7 A;  1B72 B;  3A03 A;  3T1B A;  4P6Y A;  3W6K B;  3W2A A;  3ECH A;  3DKW A;  3FXJ A;  3ABL H;  1ZKG A;  2VNJ A;  5F04 A;  4GQN A;  1QFZ A;  1W5C C;  4CCL A;  3P5J A;  4CYD A;  2V1N A;  4D5F A;  2A69 F;  2JMW A;  4Q4Z F;  3GQ8 A;  1YIO A;  2EJR A;  2XHK A;  4LG0 A;  3OW7 A;  3ZN1 A;  5FKK A;  1S7A A;  1MMS A;  3RY8 A;  2YWE A;  3QSY A;  3I55 B;  3LFU A;  1MRZ A;  3CCE B;  2P0W A;  4U4B A;  2DI3 A;  3ZQH A;  1O8F A;  5EGO B;  1K6O A;  1FY7 A;  2O0W A;  4ZGQ B;  3Q0U A;  2ZJQ F;  4FWT A;  1ENH A;  3LA2 A;  2HPM A;  2Y31 A;  4NK6 A;  4IX7 A;  2JVG A;  5ICE A;  4NUB A;  3GFI A;  4BNC A;  1IW7 F;  2DO7 A;  4FIS A;  1KK0 A;  2R6H A;  5FIU A;  5F1R A;  1KTW A;  1MJB A;  4Y13 A;  1E3O C;  2Y0S N;  3L2U A;  4I0A A;  4DNC A;  3LJY A;  4EGY A;  3F23 A;  3PFI A;  4O3M A;  5F1J A;  4LIT A;  4UUV A;  2EFQ A;  1VND A;  1BJZ A;  2LBF A;  3ASP A;  2Z2S B;  2WAQ A;  2RQP A;  3AKZ A;  4BAC A;  1LQ1 A;  3HOW J;  4EW9 A;  3IH4 A;  2WAD A;  3KP4 A;  4U87 A;  4RGX A;  1HW1 A;  3FMR A;  3O8G A;  2E7W A;  2XAQ A;  2CV1 A;  2E1M C;  2V6E A;  3FF5 A;  3L2W A;  4E6K G;  3WND A;  1V54 H;  2DJN A;  2ME6 A;  5DM7 F;  1R58 A;  1PXZ A;  4TMW A;  5HS9 A;  1UFM A;  2I10 A;  4MHG A;  2DOF A;  3FPP A;  3W5V A;  4YC5 A;  3MZ8 A;  1R5I D;  4ETS A;  2NYX A;  2BM1 A;  1BOA A;  2QVO A;  4EAT A;  1UD4 A;  3GFL A;  1OR7 C;  1S72 I;  4TMT A;  1DP7 P;  2JA7 J;  1LLZ A;  1XMK A;  2HU9 A;  1O3Q A;  4NCN A;  2X6X A;  4EEF G;  2BE5 F;  2XF6 A;  3ES9 A;  3HSR A;  4LK0 F;  3VSL A;  2R0Q C;  3OYB A;  1QO0 D;  2DPU A;  5F64 A;  2V9P A;  3VYS B;  4D9J A;  3L2R A;  2OBP A;  2PFB A;  4I09 A;  1W7P A;  4ZYA A;  1TQP A;  1BR2 A;  3D5L A;  2O04 A;  2FD5 A;  1MKM A;  1CZF A;  1QVG B;  4R79 A;  2TRT A;  5FO1 A;  1WJA A;  4U0V A;  4LD5 A;  4ZYD A;  4YAL A;  5JVG F;  4BL0 B;  4QPO A;  3G4S I;  1Q7Y D;  3P9K A;  1ONV A;  2GBY A;  3Q3S A;  2VOD A;  3J7A O;  3ZBT A;  3CMA B;  2GIZ A;  1YRN B;  1J5Y A;  4RS8 A;  3SQV A;  1ZRD A;  2P5L C;  3S8P A;  2Q8K A;  1E3P A;  1Z0X A;  2DFH A;  4YFK F;  5B3S H;  2HVS A;  2VQH A;  3ROU A;  1WPK A;  2MW8 A;  2CV0 A;  4BGD A;  1QQ1 A;  1QVU A;  3HM5 A;  4BBR J;  2CW5 A;  3BY1 A;  2HYF A;  3Q3A A;  3W2H A;  3KE2 A;  1LVK A;  2QLZ A;  1E63 A;  3W2G A;  4GRI A;  2LYC A;  4ACB A;  2L02 A;  5E8I A;  3OS0 A;  4V2G A;  1MBF A;  2IS1 A;  2QMU A;  1LJ9 A;  1Q1V A;  3RI4 A;  4ACA A;  3IV5 A;  1I1S A;  1I8D A;  1E1Q A;  4HA8 A;  3F22 A;  2JUC A;  2FX0 A;  2AS5 F;  5JBQ A;  1JXS A;  3ECO A;  1TNS A;  4LJZ F;  3RCO A;  1M1K D;  5JHU A;  3B78 A;  3CPW B;  1R6R A;  3C18 A;  1G7S A;  3M4O J;  1LB2 A;  3ZMV A;  1JKQ C;  3VYR B;  3TBI A;  3Q38 A;  3W5U A;  4RM0 A;  3BR2 A;  2L0K A;  4LLL A;  3RDI A;  4A6D A;  1P2F A;  4BAY A;  1NHC A;  3EDP A;  2V7Q A;  1T08 B;  3FXK A;  4NC6 A;  1JUS A;  4Q48 A;  1UMQ A;  5GTH C;  3ZOB A;  4RD0 A;  1A35 A;  5LBQ A;  4X0G A;  1LLW A;  4J01 A;  2K27 A;  4LK1 F;  3R6J A;  1ZG3 A;  2STW A;  3ONU A;  3B6C A;  1R71 A;  1KYZ A;  2EV0 A;  4NHJ A;  3M3Y J;  2WZP P;  2LY1 A;  1DBO A;  1WKM A;  3KLN A;  2QYU A;  3PFY A;  1FYL A;  3Q9V A;  5B1A H;  2QEN A;  3GEZ A;  2XOK A;  3LNN A;  4RAY A;  1OB0 A;  4C43 A;  2XKO A;  4G8X A;  5C44 J;  1K83 J;  3SEZ A;  2PJP A;  1Z05 A;  3P7N A;  4QWQ A;  1IXR C;  1FMV A;  2C78 A;  3ZXS A;  4W8R A;  1HA8 A;  2HOE A;  4M9S A;  2NNN A;  2YX4 A;  1MH4 A;  3H5A A;  2GOM A;  5FKO A;  4ZZL A;  1ZUN B;  3AVT A;  3M8F A;  5HS7 A;  3BCA A;  1A04 A;  2KJC A;  1NG6 A;  2VOP A;  2M8G X;  3BH7 B;  4BUP A;  1QFJ A;  1HA3 A;  4C9Y A;  1SM4 A;  2M0M A;  4A0X A;  2H8W A;  1JA1 A;  1J0R A;  3NWT A;  1USS A;  2F4O B;  5FD5 A;  2JTV A;  1B72 A;  3DU5 A;  5FGM A;  1NG7 A;  4KYW A;  2KHM A;  3I5U A;  3DKX A;  3TW6 A;  5E1W A;  2VE8 A;  4JP0 A;  4A3C J;  5IT3 A;  4X7F A;  2FML A;  4U0W A;  1QJV A;  3VSU A;  3JRB A;  3RKX A;  3CCS I;  1ZR4 A;  3H0D A;  4BHP A;  1W36 D;  1KA8 A;  4G7O F;  3A01 B;  3R0A A;  3VDX A;  5KAF C;  2GZW A;  5IP6 A;  3BY2 A;  5FKL A;  5FL7 A;  3LSJ A;  4L0Z B;  2QQA A;  4CCK A;  3DPT A;  5DSZ A;  2KFD A;  2E1B A;  1BHE A;  3SZE A;  1KU3 A;  3WOD F;  3LA3 A;  5IYD J;  3UW0 A;  3BJ6 A;  2VXD A;  2Z8G A;  2VJ5 A;  2VXZ A;  2F3L A;  2P8T A;  2F43 A;  2DMT A;  2XKP A;  3PSF A;  4JX4 A;  3W2W A;  1JB9 A;  4ZGN B;  3L2V A;  2PMH A;  1OCC H;  3PA2 A;  3GRH A;  2BPO A;  1RET A;  2DT7 B;  1QA1 A;  2NVU B;  4DBR A;  2KIF A;  1K28 D;  1WP6 A;  2XDV A;  3SYT A;  2XNC A;  4BS9 A;  1IAW A;  1WQ2 A;  3V42 A;  2ZL5 A;  4YAW A;  4OIO F;  1D8J A;  3FIS A;  1WDT A;  1ZM4 A;  4QVA A;  3K0L A;  2FQ4 A;  3OYD A;  2CC2 A;  3OYC A;  5BSX A;  3B73 A;  3KEY A;  2O8X A;  2JJ1 A;  1I7P A;  4XR6 A;  4BKX A;  1KQ9 A;  2W24 A;  2OYN A;  2GXG A;  1R4M B;  1UG2 A;  4OOX A;  3FK7 A;  1HKT A;  4YII A;  2GJR A;  5AON A;  4EVI A;  1PUF B;  1V5G A;  1MBG A;  2E1C A;  3RTR A;  1D0X A;  4L0Y B;  1YLF A;  4CQJ A;  3QQA A;  3GTO J;  1D2E A;  3KPH A;  4N4O B;  4CIC A;  2RNG A;  2RDP A;  3PUF A;  1YS7 A;  4UVA A;  2GXA A;  2CJJ A;  2XAF A;  3WGH A;  3P4G A;  3HZJ A;  2MC3 A;  4X07 A;  2FVG A;  4CDG A;  2DQL A;  1E64 A;  5CVI A;  4YXW A;  1QUE A;  2XND A;  1IA5 A;  1FTZ A;  1YG2 A;  3E1S A;  4AU7 A;  1O7F A;  2ETH A;  4RB3 C;  4EMS A;  2D45 A;  4KNY A;  4OMY A;  1QGZ A;  1F9N A;  5HLT A;  1ZEL A;  1PJ7 A;  2OK8 A;  2QZA A;  1Q9S A;  3KZI C;  3MKY B;  3S16 J;  3OPO A;  5IYC J;  4CZZ A;  1K61 A;  1UAA A;  5DCM B;  2Y2Z A;  4B09 A;  3FBI B;  3PET A;  2EQR A;  3I58 A;  4XOT A;  1UD2 A;  4NC7 A;  1AA7 A;  1P7J A;  2FBI A;  1EZG A;  1F5T A;  3KIO A;  1FRN A;  1EH8 A;  3AFH A;  2Y9Z A;  1O7L A;  4AF6 A;  1HDD C;  4OM9 A;  1X58 A;  5E3N A;  3BPV A;  5H5J A;  3SDB A;  4DQ2 A;  4N4N B;  2K9L A;  2CND A;  1GXP A;  4HLY A;  1SFO J;  1U9N A;  5DV5 A;  2HZD A;  3F21 A;  1Y6I A;  2LH9 A;  2V26 A;  5DM6 F;  3J81 K;  2VBY A;  4RAF A;  1E1R A;  1W35 A;  1IF1 A;  3BCB A;  1JUP A;  1V5V A;  4BQN A;  3B90 A;  5HDG A;  2BM7 A;  2DMP A;  2YWG A;  2NSP A;  1R5H A;  4YZA A;  4Y33 A;  1JGG A;  1O8L A;  2VL8 A;  3L7W A;  3MEX A;  2M0C A;  1JKO C;  2IA2 A;  4MQ9 F;  2FJ1 A;  2P7V B;  4JOM A;  5BOX A;  1A31 A;  5IYR A;  3CLQ A;  2M8E A;  4NK8 A;  4RD3 A;  4GYG A;  1RES A;  4O5V A;  3JRI A;  3DEU A;  3LSM A;  5M3F J;  3CJT B;  3RZD J;  3K4M A;  4L9J A;  3LO8 A;  4A93 J;  4OPO A;  4LB6 B;  1OYY A;  3QFS A;  1X4O A;  2HQN A;  3PSI A;  3CCL B;  4I02 A;  4BE2 A;  4Q47 A;  1FP1 D;  3MCZ A;  4KMU X;  3OV8 A;  3TL4 X;  2R5Y B;  1E62 A;  3LQE A;  3OFN A;  1RZ4 A;  2MYS A;  1J59 A;  1S4M A;  3BCD A;  3IAM 2;  3KX2 A;  2DIE A;  2FSW A;  4OPS A;  2DA1 A;  3S3O A;  1T8I A;  3S32 A;  2WJV A;  3HSE A;  4PFO A;  2C6Y A;  4OOV A;  4JRA C;  4AID A;  1EP1 B;  2O3F A;  3HGY A;  3ZQL A;  3J7Y J;  1VTN C;  4A3I J;  1L3L A;  4Y7C A;  1FC3 A;  4UUS B;  1R5N A;  1TC3 C;  3GVJ A;  4Z4S A;  3N90 A;  1A6Q A;  4S0H B;  1QZE A;  3HGG A;  3VYU B;  2ADU A;  2VBX A;  2LR8 A;  3VMF A;  1MGT A;  1F43 A;  3TO7 A;  1BC7 C;  1QHH D;  1WJE A;  4L5J A;  5K5O A;  3L9F A;  1GR1 A;  4XM3 A;  4E7L A;  3FM3 A;  5K7Z A;  3OYM A;  3U1K A;  4IHY A;  3JQP A;  4Y9U A;  3FXU A;  2PG4 A;  3TQN A;  1OCR H;  2DN0 A;  4OIR F;  3ZN0 A;  3OYI A;  3DU1 X;  4NBQ A;  1WRJ A;  3QYB A;  4LOC A;  3ASR A;  3K6G A;  5DN6 A;  3JRA A;  4A2U A;  2H27 A;  4IHS A;  4P5O A;  5HZB A;  1T0F C;  4M3F A;  2PX9 A;  4P22 A;  2EFO A;  4ZCM A;  2QQ9 A;  4HX4 A;  3GWZ A;  4HQM A;  3QP5 A;  4IHT A;  2MAB A;  4OZZ A;  2DMU A;  4XRF A;  3NAR A;  4QTR A;  1Q82 D;  1W7P B;  1UD6 A;  4L18 B;  1SD6 A;  2I8D A;  4CCN A;  1DAR A;  2A3S A;  2M3A A;  3O8H A;  4BE1 A;  2VKV A;  4E7I A;  5K7H A;  3VSK A;  3ASQ A;  5K1Y A;  1RC9 A;  2Q6O A;  4XD7 A;  1T2K A;  3OL4 A;  1UG0 A;  1OFC X;  3KEO A;  4M9X A;  1K4Z A;  3R4K A;  2NTQ A;  2D3L A;  2GAU A;  3PQK A;  4AIH A;  3CUQ B;  1W5S A;  2R7U A;  2KRC A;  5AIP A;  2OQG A;  3BR0 A;  3ZMD A;  2VNI A;  3A1P A;  4CXF A;  2KT0 A;  2LLK A;  2BBY A;  1QQI A;  4ESJ A;  3HRM A;  2O7O A;  5EG0 B;  2XNJ A;  1R1V A;  2QA4 B;  2F4I A;  4BPR A;  5LMZ A;  2DYI A;  3GQ7 A;  2DT5 A;  2MH2 A;  4HE5 A;  5EEA A;  4B4D A;  1B4A A;  2YSR A;  3WTZ A;  3WBJ A;  5JLV C;  5DYM A;  3PEN A;  4F3Q A;  3RZO J;  4DGW B;  1PP8 F;  4XOR A;  2WB1 A;  4XOP A;  3RPU D;  3SYJ A;  1IZ1 A;  1Y56 A;  3H36 A;  3WXM A;  1D5Y A;  2XTY A;  2RC5 A;  3HTS B;  2FMY A;  5TR9 A;  3CCS B;  2EBI A;  1BW6 A;  2OBR A;  3ONQ A;  2ZFW A;  3GTP J;  1T33 A;  3LFK A;  3HHG A;  3HJE A;  2XB5 A;  4J0Q A;  2DOA A;  4A3L J;  2XAU A;  4ASN A;  5C3E J;  2FNA A;  1EKE A;  4DOZ A;  5A2Q Z;  4XN0 A;  3FPK A;  4DNT B;  2W82 A;  2IP2 A;  3H1C A;  1IUF A;  3AVW A;  3I53 A;  1F1Z A;  4RA2 A;  1YS6 A;  1FOW A;  1XDU A;  4V19 K;  4MTD A;  2VAS A;  1FMW A;  2R3S A;  5D5X B;  4GFB A;  2DU9 A;  4G94 A;  2MLG A;  3KZY A;  4KT6 A;  3F8F A;  3A0H C;  4HNV A;  3JX8 A;  4CCJ A;  1IDY A;  3BJA A;  3ERM A;  1Z9C A;  1OCO H;  3JRG A;  2LBF B;  4C0S A;  3IHU A;  2O0V A;  2BVN A;  5LEJ A;  1UMK A;  2XV4 S;  3F9K A;  1WJC A;  2QTZ A;  3VOD A;  3PNV A;  4KT5 C;  4Z6Y A;  3BG9 A;  1B1B A;  4B43 A;  3BR3 A;  4LLN A;  5AIQ A;  3MKL A;  5KK1 A;  5GAE J;  1YQA A;  3UNG C;  1FDR A;  1F4K A;  5F0F A;  4PAA A;  3W5H A;  4X7E A;  2ELK A;  1QH0 A;  4TMX A;  3GQ9 A;  2WB1 N;  2NT6 A;  3SEJ A;  4MFD A;  3P9I A;  3TGN A;  3AG3 H;  3K7A J;  4RPD A;  3ZBU A;  2CG4 A;  2IPQ X;  3CTA A;  4JYK A;  3BLY A;  4LBY A;  3ZSC A;  2BM6 A;  4QSH A;  5LFA A;  1DBG A;  2JRT A;  1N0V C;  1WI9 A;  4U88 A;  1W2B B;  3BZ6 A;  1OFD A;  3EET A;  3MZY A;  4C30 A;  1T95 A;  1Z6R A;  2IGO A;  1U8B A;  4MYU A;  3J81 Z;  2BVM A;  2QA4 I;  3VMV A;  3W2V A;  3DLL F;  4II2 A;  2B7C A;  2Z99 A;  5DD4 A;  4HPQ A;  2RC6 A;  1G3S A;  2BY0 A;  4M4S A;  1LDK B;  1X4P A;  1R4N B;  2VI6 A;  5IT9 K;  1A8P A;  1KQS B;  3ZPN A;  1JUM A;  3P9C A;  3HOS A;  2O8K A;  1G2H A;  2FQ3 A;  3H9Q A;  3T56 B;  1IHM A;  4RDU A;  4M74 A;  2N8G A;  1QFY A;  4A3G J;  2XEX A;  5THX A;  2VOO A;  3S1M J;  3VYT B;  1G59 A;  4C3H J;  3LAP A;  3MZH A;  4CZC A;  4JK1 X;  4ZH4 F;  1JRG A;  1BM9 A;  3VSV A;  1U5T C;  1XX5 A;  2ELH A;  3QE2 A;  2JWT A;  2YX7 A;  4E7K A;  5LHH A;  1BN8 A;  2XZP A;  4P96 A;  2DY1 A;  1X1B A;  3CCY A;  3CZ6 A;  5TIS C;  3PQJ A;  2OZU A;  3QYF A;  2LC2 A;  2MLK A;  1WH7 A;  2J8I A;  2E1N A;  5K5Q A;  1WGX A;  3OYN A;  1O8K A;  1RMG A;  2DET A;  4N3G A;  2W4S A;  3BZC A;  2YWH A;  3I56 I;  4MTE A;  1J7K A;  1M1E B;  2M7A A;  3HRU A;  4PGG A;  2QN6 A;  2WA0 A;  4Z03 A;  3ASS A;  1X1A A;  4EJV A;  3IP4 B;  3SKB A;  1Z91 A;  2X3H A;  3OZV A;  4LBW A;  3RIQ A;  2DCE A;  4WZE A;  2OV7 A;  2F6C A;  5KNL A;  2W48 A;  1O8E A;  2O5R A;  2Y69 H;  4OMZ A;  3H5R A;  3BG5 A;  1FZP B;  3WTW C;  5JVT A;  2YPR A;  1JTY A;  1P4W A;  3HAG A;  4RLF A;  1XGS A;  4CYC B;  3OJW A;  3N05 A;  4KIB A;  2JJ2 A;  3C2G A;  5F08 A;  3I4N J;  2CBX A;  4LMY A;  2RQQ A;  1BQE A;  3TKY A;  3D26 A;  4XLP F;  4E7Z A;  2XB0 X;  3MAJ A;  1SAN A;  3CES A;  4G7H F;  4L5I A;  1QPI A;  3KYL A;  1JGS A;  1KK1 A;  1PUE E;  2H94 A;  2MH9 A;  1R1T A;  1Z7U A;  3JRF A;  4ENK A;  1SFU A;  2FX3 A;  4Z4T A;  3D1N I;  4F7D A;  3JCU C;  4YIR X;  4Y15 A;  2GWR A;  3HDD A;  1VQ9 B;  3TP3 A;  1TVC A;  1ETY A;  3SHF A;  5BSY A;  2LNB A;  3GQA A;  1IN5 A;  3K4N A;  4IOA F;  2DA7 A;  1HW2 A;  4QUZ A;  2M45 A;  2K86 A;  4HRI A;  4R8H A;  1FNN A;  4ESF A;  4F55 A;  5HLH A;  2KKO A;  2Q1Z B;  3EQL F;  4D7N A;  3G1O A;  2DLL A;  1GLN A;  2JRM A;  3OWT A;  1OGI A;  4FT8 A;  5IOY A;  3GTQ J;  4HF1 A;  1DG1 G;  1YJ9 B;  1O3T A;  2QUF A;  5J4Y A;  3A2K A;  2BOL A;  2RV8 A;  1WMR A;  1ZG5 A;  2A5Y B;  4EJO A;  1R22 A;  2R5Z A;  4AWX B;  3ABT A;  1NHA A;  2DMQ A;  3DF8 A;  5D4S A;  2CF4 A;  1MBK A;  5GTI C;  1W7P D;  1SVM A;  3D0S A;  2E5Z A;  3GW2 A;  2ME0 A;  1V5F A;  1IG7 A;  1GHC A;  1YFH A;  1ODD A;  1HXD A;  4A0Y A;  3R6S A;  1MSE C;  4XRM A;  2EFG A;  1WCM J;  4P1W A;  4K1X A;  3J7A Y;  1JE8 A;  3Q9S A;  2VJI A;  3U6K A;  1QA3 A;  3TOB A;  4JX6 A;  2HS5 A;  2NOG A;  4BXX J;  3FKS A;  2FOK A;  3GZN B;  3J81 k;  2ZBK A;  3JR9 A;  3CF5 F;  1O3S A;  1JTA A;  2O6W A;  3S1R J;  1QZZ A;  3VB2 A;  1IRF A;  4IPA A;  1UHS A;  2L9R A;  4FTH A;  1YTY A;  1RUO A;  1X3W B;  1XPX A;  1ZQ3 P;  2ESH A;  4WZL A;  2LY9 A;  3WE2 A;  1MD0 A;  1SVO A;  4CCM A;  1H8H A;  1QRC A;  2RN7 A;  2RNJ A;  3DXJ F;  2H8R A;  2FBK A;  3KEQ A;  4N9I A;  3OS2 A;  1KMH A;  4B3X A;  4WXC A;  3GF2 A;  2EA2 A;  1I5Z A;  3P27 A;  3C1D A;  3BG6 A;  2F5F A;  4OJ5 A;  2XGC A;  4KKU A;  3WU0 A;  1KCC A;  4C3J J;  3KFW X;  5E18 F;  3TW7 A;  5JI6 A;  4AIK A;  2PLF A;  1K73 D;  1DPR A;  2AQF A;  2CWE A;  1JNY A;  2CQQ A;  3LSG A;  1SAU A;  2ZO4 A;  3FK6 A;  2BX6 A;  1OFE A;  1VQ5 B;  2HOA A;  4NC8 A;  1BX0 A;  1F20 A;  1F60 A;  2B7E A;  1R9T J;  1BIB A;  5TJJ A;  3H35 A;  3B8Y A;  1YIJ B;  2BSP A;  2BGC A;  5HVQ C;  3PUB A;  1BI3 A;  2P7C B;  5EMN A;  1IJW C;  4IKF A;  1EP2 B;  4C2L A;  1VQL I;  1ULY A;  2M87 A;  2X1E A;  1R36 A;  2ZXH A;  3LNQ A;  2A6H F;  5EF6 A;  2Z5U A;  1R23 A;  4Y3O A;  2F5D A;  3TOA A;  1LM1 A;  4YDT A;  2ECC A;  1IRZ A;  3GVL A;  4N9H A;  1OR7 A;  1GT0 C;  3SQN A;  2ZNZ A;  5E20 A;  2KIU A;  3VST A;  3CC2 I;  1EXM A;  1ZLJ A;  1D8K A;  3A35 A;  4RM3 A;  1UD3 A;  3KLO A;  1VQ6 B;  1IB4 A;  4P9S A;  4KIT B;  4ZYE A;  1IV8 A;  3OP1 A;  2HI3 A;  3T8T A;  3OYF A;  4KA4 A;  2CUZ A;  2VT3 A;  1O8M A;  3CO7 C;  1YJN B;  1BIA A;  3QU3 A;  2Q6I A;  1ON2 A;  3PSS A;  3HUG B;  1LKX A;  3FHZ A;  1W87 A;  2AQE A;  3K10 A;  1XGM A;  5CVV A;  2K3P A;  2XGJ A;  3GQB A;  1ZM9 A;  2M9H A;  5E17 F;  1VLY A;  4LBZ A;  4NQW B;  1ETQ A;  3MFK A;  4KFC A;  4BEH B;  5B66 C;  2V7F A;  3OE7 A;  3T5X A;  4IOC F;  5J40 A;  3ZMT A;  2G7H A;  4A3E J;  2HMA A;  1OB2 A;  3NAW A;  4Y4R A;  5JMC B;  4C2T A;  2CQN A;  1R49 A;  1XB4 A;  1I6H J;  4IEJ A;  2E19 A;  3CCM B;  3QPS A;  4LIU A;  1N25 A;  4UY8 I;  1VQM I;  1TWC J;  3H3U A;  4AYB A;  2LF8 A;  1OMI A;  1GAW A;  2BSA A;  2PEC A;  2FRH A;  1TYU A;  1OB5 A;  4E0F A;  1T56 A;  2H6B A;  4ZYH A;  3M7G A;  2WYR A;  4O6J A;  3GXO A;  3UR3 C;  2K9N A;  1HST A;  2JK3 A;  2IRF G;  3PNT A;  2XUB A;  4P55 A;  5JR3 A;  4M3E A;  1BMF A;  4HOB A;  5H20 A;  4A3K J;  3PIP F;  4ASU A;  1O4X A;  1BLI A;  2FEZ A;  2LMD A;  4L9T A;  3VPR A;  3ZGK A;  3GLL A;  4HQE A;  2VBT A;  1GV5 A;  3A4C A;  3U21 A;  3E6B A;  2LKX A;  3OZU A;  2K4B A;  4EH1 A;  1V0E A;  2GJK A;  1FPQ A;  5J35 A;  5HKK A;  3ABK H;  2Y75 A;  3SUC A;  1U8R A;  3G05 A;  4II3 A;  1FWZ A;  1N06 A;  1W34 A;  1VQO I;  1YW9 A;  1TW3 A;  2OK7 A;  4M71 A;  5KW9 A;  1ITY A;  4LLG F;  5FLX K;  4KKS A;  2Z9O A;  4YZQ A;  3CUO A;  5F4O A;  3E6M A;  4FX0 A;  1MZB A;  1V4R A;  2V7W A;  2K40 A;  2CUJ A;  3FXQ A;  1OYI A;  2LRE A;  2ZXI A;  2FF4 A;  1Y1V J;  3RYP A;  1WFX A;  3QOD A;  1GVJ A;  1LE8 B;  2JZY A;  1UCR A;  3G6E I;  4XQF A;  2AO9 A;  2X6O A;  4BQO A;  1H9T A;  1E3Z A;  4OPV A;  3RQ4 A;  2X85 A;  4ZJZ A;  5L3D A;  1JI8 A;  3X2Q H;  1HF2 A;  2M4K A;  3CDL A;  5TV2 A;  3LST A;  2DA3 A;  1IGN A;  3OEH A;  4PMH A;  1WPC A;  5J4V A;  3SLD A;  3OYJ A;  1ZHF A;  2BYV E;  1RRJ A;  3EYI A;  4CGZ A;  1ELO A;  1NK2 P;  4NDL A;  2KLO A;  3OMY A;  2QSG X;  2X8K A;  4XRS G;  4GCV A;  3K2A A;  4KIG A;  1IN7 A;  4WF2 A;  1ZLK A;  1HVX A;  2PN6 A;  2FNP A;  2L4A A;  3DTK A;  3R60 A;  2DOG A;  1YX2 A;  5FB2 A;  2IOU G;  3V7C A;  4W8T A;  2ISY A;  1DDG A;  3ZQI A;  1PLU A;  4S04 A;  3IH3 A;  1G7T A;  1EJ9 A;  1TWA J;  2VNK A;  1T6X A;  1QU3 A;  1DPU A;  3VR6 A;  1S29 A;  2GIV A;  3A01 A;  2O17 A;  2VFQ A;  4MNU A;  1OYW A;  3A0B C;  3MWM A;  2O9L A;  4GGG A;  2HLD A;  3QFR A;  1D1A A;  1VQM B;  5C1E A;  2WWY A;  1KZH A;  1IV6 A;  3LSH A;  3H9G A;  4DYQ A;  1ZRE A;  4V02 C;  1TQI A;  4TV7 A;  3AG2 H;  4XON A;  3OIP A;  1G4D A;  3LQR A;  4ZCI A;  2J5O A;  4WWC A;  1N78 A;  4AC0 A;  3OR1 C;  5A2Q K;  3G73 A;  1GO2 A;  1MJ9 A;  3W6J B;  1SD7 A;  4A0Z A;  1G3W A;  1WXR A;  4ZC3 A;  4AUX A;  5HNH A;  2LSO A;  2IGK A;  2W57 A;  3RKQ A;  1VQ4 B;  1LNW A;  2EWN A;  2KIQ A;  5ICF A;  1LPQ A;  4TT3 A;  3QU6 A;  3MKW B;  4Y7N J;  4YIF A;  1H8E A;  2XC7 A;  1J9Z A;  3HOU J;  2K4J A;  1TSP A;  3FBN B;  4XSX F;  3CCL I;  5IYP A;  2WAQ N;  4V2F A;  2BEO A;  2VNH A;  1AHD P;  1FJL A;  5IYW A;  3BQY A;  3QPH A;  2V5I A;  5IP7 J;  2Z1D A;  3AVX A;  1X1D A;  1G8X A;  4L9V A;  2V1U A;  3KYC B;  5H6R A;  2O1D A;  1WZ2 A;  2H6C A;  2X3U A;  2CK3 A;  4PJL A;  5L3C A;  2RVC A;  5K7F A;  1EE6 A;  1IDZ A;  2F5V A;  3KP7 A;  2QZ8 A;  1Z21 A;  2Y0S A;  1YJW I;  2EV5 A;  2NNY A;  3JQR A;  1G7C A;  3JRH A;  3K4K A;  4ZV4 A;  4PZJ A;  2L7Z A;  2EZL A;  2R7R A;  1K9M D;  5D5W B;  1YO5 C;  2BY3 A;  1N05 A;  1FNB A;  2ECB A;  1D1N A;  2P3M A;  2VBE A;  3E0J B;  4RCZ A;  4EQQ A;  4ZYG A;  4CHU A;  2H1K A;  2YWF A;  3V7R A;  4UVB A;  2PJR B;  1P9Q C;  4KIS A;  4FXU A;  4TMV A;  4HV5 A;  2EPF A;  5L3F A;  3I64 A;  4C2U A;  2EZI A;  2VN2 A;  2VBW A;  4XKV A;  1BI1 A;  3JTH A;  5DUK A;  2WR8 A;  5E3O A;  4DQL A;  2L7M P;  1JJ8 C;  3QAH A;  3MVP A;  4A12 A;  2PYH A;  4Z4Y A;  3S3N A;  2X51 A;  2VQC A;  3VO1 A;  2O6G E;  3W3C A;  2WAF A;  2JVH A;  1U5T A;  4H4K C;  4J00 A;  2QY1 A;  1CGP A;  3DBR B;  2ISZ A;  5HOO A;  4UUS A;  2A07 F;  4EM2 A;  3VNU A;  4CH7 A;  3CJR B;  3G2B A;  3IH2 A;  2K5C A;  3AVY A;  2Y30 A;  4ZDL A;  3WGG A;  1OGM X;  1WJB A;  1D1B A;  3K4J A;  4C2M J;  2MGQ A;  3P26 A;  2XT4 A;  1JT6 A;  4M6X A;  1DP3 A;  3FWE A;  1GUU A;  3IRR A;  3FXM A;  3BRO A;  3PM1 A;  4LFU A;  1H0M A;  1QA2 A;  1VQ8 B;  5KAI C;  3DV8 A;  4UHT A;  1BI2 A;  2A61 A;  4G6D A;  3OY9 A;  4X05 A;  2Y48 A;  3MD2 A;  1MW7 A;  2STT A;  3BY6 A;  3EUA A;  4G12 A;  2YS9 A;  2R7Q A;  3F3X A;  1S72 B;  3OOP A;  2VPL A;  4URR A;  2ZME C;  3I1F A;  1TBX A;  4PC6 A;  3S3M A;  5H59 A;  2E35 A;  3BH4 A;  2GRE A;  2Z16 A;  4RJL A;  4MQV A;  3OKX A;  1N8R D;  3LQ6 A;  3BH6 B;  4M6Y A;  3U2Q A;  4HF0 A;  3I54 A;  4B3F X;  3I9V 2;  4IO9 F;  4MFE A;  3B4N A;  1U3E M;  2D3N A;  3H0G J;  1E17 A;  5LGU A;  1UHM A;  2VQL A;  1U0J A;  3CF2 A;  2A6T A;  2M7B A;  1TTT A;  5AN9 A;  1Z3X A;  2R7F A;  2B0R A;  3IC7 A;  1ETX A;  2CFX A;  1VHE A;  3BT9 A;  1BX1 A;  3QPL A;  3OS1 A;  2D74 A;  1FX7 A;  5HLI A;  1S7O A;  3DPL C;  2Y9Y A;  5JHF A;  4QFM A;  2HKO A;  2ZZQ A;  1K78 A;  1D5V A;  2VC1 A;  1V55 H;  4BQQ A;  2DBB A;  3TO6 A;  3CUQ A;  2JJ7 A;  1YLO A;  2PMD A;  1WVR A;  1TTY A;  4AVP A;  5J1U A;  1YI2 I;  3KP3 A;  3HPH A;  4KN4 X;  3RYR A;  3AG1 H;  5J6X A;  5E79 C;  3L2C A;  4A3M J;  2V4D A;  2UWM A;  1RQP A;  2ZZE A;  1KU9 A;  4ON0 A;  2P5K A;  2JPC A;  2VQG A;  5EEG A;  3KEW A;  3I0T A;  2OA4 A;  3S14 J;  4PAB A;  3O2P E;  2HFH A;  2L01 A;  5EDN A;  2L2O A;  3GZ6 A;  3CXC B;  3K1P A;  5BPD A;  1KJZ A;  2NV4 A;  5C1C A;  4HST A;  2XZL A;  2LFB A;  2D1H A;  1WSV A;  1FYK A;  3ASO H;  3A8I A;  2XRN A;  5A88 A;  2VBU A;  3OR2 C;  4ZCL A;  2VFO A;  2YR2 A;  4DYC A;  1ETO A;  1UHW A;  3GME A;  4ENN A;  1MH3 A;  5CKT A;  1BN5 A;  1OGJ A;  4FK8 A;  2DDA A;  1ZYR F;  3HPG A;  2IJL A;  2IVM A;  4J19 A;  1K79 A;  3I4M J;  3H3Z A;  2QF7 A;  4DJA A;  2OTL I;  2OZ6 A;  1ETV A;  1FIA A;  2FUG 2;  3RKW A;  4I6Z A;  2VKE A;  3S2D J;  1BW5 A;  2ZTN A;  1OCZ H;  4JBA A;  3E6C C;  3BR1 A;  4RLQ A;  4E4H A;  1EFC A;  4HYE A;  2DTR A;  2V9K A;  3BR6 A;  4IF4 A;  4CSW A;  3HL2 A;  3N6Z A;  1X1P A;  3LMM A;  3I59 B;  2OC6 A;  2DA4 A;  4G1V A;  5FFX A;  3K4B A;  2MD5 A;  3SJP A;  1Y8R B;  2RKH A;  2HVQ A;  2QM3 A;  2VYQ A;  3ZPL A;  2PBI A;  4RB0 A;  1MBE A;  5LRR A;  4WZT A;  2JQ7 A;  4PC2 A;  4Y9R A;  4AVZ A;  4RLZ A;  5FJ8 J;  2IA0 A;  4YFO A;  3ZPP A;  3M1C A;  2GJP A;  4NNJ A;  4YAU A;  1KU2 A;  3TDU C;  5JLW A;  4M9Z A;  2XT2 A;  5FRO A;  2QQ8 A;  2KVO A;  1FT9 A;  1XG1 A;  3ZQG A;  4BY7 J;  3LAJ A;  2ZKZ A;  1Y0Y A;  3BNW A;  5ILS A;  1T98 A;  4JX5 A;  1NK3 P;  3NRV A;  1RQR A;  2DXI A;  4TN1 A;  3W2I A;  4U7D A;  3BTL A;  5JLX A;  1VQ7 I;  4YZX A;  2NT9 A;  1G7R A;  2F48 A;  2XVC A;  2UUZ A;  4OWR B;  3EQO A;  1M90 D;  1Z77 A;  1SFX A;  5DNS A;  1X19 A;  1T38 A;  5TRD A;  2CW8 A;  3JAM K;  3M8E A;  3PO2 J;  4HX7 A;  5M5X J;  3QOP A;  2OBT A;  2JDI A;  1LFU P;  3S17 J;  3CCJ B;  4Z4R A;  4XID A;  5CVR A;  1YI2 B;  3HYI A;  1DU0 A;  1QGY A;  2KQR A;  5E3L A;  3WTU C;  4OIQ F;  3CPX A;  5ICC A;  1EA0 A;  2V6C A;  3AVV A;  1R1U A;  4ABZ A;  3QFT A;  4AM3 A;  1YIJ I;  1YJ9 I;  1Y1W J;  3FMS A;  4PC3 A;  4YFX F;  2W84 A;  3CDI A;  2GQQ A;  4AC9 A;  4W8Q A;  2NS8 A;  3O6B B;  1CNE A;  2DCU A;  1QCX A;  2NZM A;  2EIM H;  5CPR B;  4A5N A;  1P7I A;  2EIK H;  3DEE A;  4OPW A;  1IDJ A;  1UZC A;  4EJU A;  2CGP A;  2CW7 A;  5HDN A;  2PJR A;  1E79 A;  1MNM C;  3PA1 A;  5EZG A;  1MMG A;  3CUQ C;  3TO9 A;  3J80 K;  2B5O A;  1B59 A;  1FTT A;  3GTG J;  1AIP A;  3GZ5 A;  2BM4 A;  4GO1 A;  2VE9 A;  1N0U A;  1I50 J;  3ZMZ A;  2E2J J;  5IOZ A;  1VF7 A;  3ZMS A;  4YAO A;  3G4S B;  5H6Q A;  4E7S A;  3T53 B;  2IAI A;  4WK8 F;  4RD2 A;  2K02 A;  2XAS A;  1LFP A;  1IRX A;  1D0Z A;  2Y0M A;  5LLQ A;  1NDH A;  1COW A;  3HXL A;  1BJK A;  2ZXJ A;  3G1M A;  3BZK A;  3DBL B;  5FKM A;  4R1H A;  2DQR A;  3V8L A;  3N97 A;  1YIT I;  2XZO A;  1SKY B;  4A3D J;  1MJA A;  3HEF A;  2VUM J;  1O8I A;  3LWF A;  5FRM A;  2GK6 A;  3A3B A;  4M73 A;  1K8A D;  2XSJ C;  2X1D A;  4ZTF A;  1S0U A;  3GFM A;  1KTV A;  1WSR A;  2J7K A;  1FX0 A;  5J3L A;  4ANJ A;  1VQK I;  4X06 A;  2VBZ A;  1JKP C;  1EH6 A;  3OYK A;  4DYR A;  5ILU A;  1RPW A;  2E34 A;  3LOC A;  3GTK J;  5FNZ A;  3OJX A;  1R5B A;  6PAX A;  1WU8 A;  3CMM A;  5GAD J;  2ZSH B;  2AXT C;  4BQA A;  1FSE A;  1KYW A;  4IZZ A;  2C77 A;  3S2W A;  1VQP B;  1ETK A;  4WQM A;  1JJ2 B;  2K3F A;  1B8I A;  1FNM A;  2RAE A;  1PYV A;  4UUT A;  5JFR A;  2V31 A;  1Z3Y A;  2ZCW A;  1EFU A;  3JAM Z;  2L5Q A;  3JU4 A;  1V3F A;  2VON A;  2IBD A;  2F5E A;  1QRY A;  2P6T A;  3MMP A;  1W0T A;  2JA6 J;  2XSD C;  3PNY A;  1QA6 A;  1PJ6 A;  3GYH X;  3FY3 A;  3WHB A;  1KC8 D;  3F8M A;  2D9R A;  1AMO A;  2BVL A;  3ZZ0 A;  1TNT A;  2V4J C;  3DWL E;  4BU2 A;  1QX4 A;  1JJ6 C;  3SJZ A;  3WTY C;  2BY1 A;  4HNU A;  3VFZ A;  3WTS C;  5DS9 A;  1Z67 A;  1IC8 A;  3WTV C;  4MIM A;  2YU9 J;  3U6B A;  1HCR A;  1XG2 A;  4RM2 A;  1R5O A;  4Y17 A;  4I76 A;  2QBY A;  2A05 A;  2PYG A;  2DTZ A;  2LKP A;  2X4H A;  1CQT A;  1UST A;  1I1G A;  4RAG A;  1DUX C;  2ZTG A;  2O0Y A;  3QFC A;  4S05 A;  3EUK L;  2HDD A;  4A3J J;  3PIO F;  1XMA A;  2QYO A;  1TT0 A;  3SEQ A;  4IRI A;  4IRG A;  1YJW B;  3QWL A;  2PE3 A;  1O8D A;  3CCQ I;  2INV A;  1TWF J;  4XIC A;  1QVT A;  1IB0 A;  2EA4 A;  5LD2 C;  1ZRC A;  2VPR A;  2WAE A;  2R9V A;  2F1M A;  4M53 A;  4P1V A;  1NB9 A;  3EUH C;  1ZR2 A;  5F4J A;  3ZZT A;  2V7U A;  4QHY A;  1NH3 A;  1K4S A;  5D6E A;  1I3Q J;  2MG4 A;  3SY2 A;  2F4M B;  1G6N A;  3I56 B;  2YU3 A;  3ZR8 X;  4DZP A;  2X0L A;  5CVU A;  3KP6 A;  2DK8 A;  4G6Q A;  1CNF A;  1UJ8 A;  2QWW A;  1APL C;  1GAQ A;  1AKH B;  2C4T A;  1FOY A;  4YZ0 A;  2ZB9 A;  3DU6 A;  1JA0 A;  5EEH A;  2VT2 A;  4XL9 A;  5FFZ A;  5L3G A;  4EGZ A;  1I39 A;  5D8L B;  3SZP A;  3GTJ J;  1HKQ A;  3DKY A;  4PSX A;  3DDY A;  4FAS D;  4XLN F;  1R5G A;  1RWR A;  1QBJ A;  2P4W A;  4FCY A;  4NB5 A;  2CYY A;  1JTX A;  3HOV J;  2L7K A;  2XAH A;  2ZZG A;  4RMN A;  4HSR A;  2AXL A;  2IGN A;  3BQZ A;  2LOO A;  2RRE A;  3CP8 A;  1N75 A;  1LE8 A;  1N07 A;  2XRL A;  3T8R A;  2KDZ A;  4HV6 A;  1AWC A;  1MND A;  2EIL H;  2DYR H;  2YUS A;  3CP2 A;  4GYI A;  4HIZ A;  3QYE A;  1PKV A;  3OYA A;  1MDM A;  2XPU A;  3SZT A;  2KDO A;  4IHV A;  2O61 A;  2VZL A;  2LK2 A;  1ZH5 A;  3A02 A;  5LHG A;  5HLG A;  3V8K A;  1VFC A;  2IS6 A;  1O8H A;  1K7A A;  1TYV A;  1HOM A;  3WE3 A;  2CQ7 A;  4BHC A;  3GIR A;  2IW5 A;  5HZA A;  5EYR A;  2KIS A;  1TYX A;  1OIS A;  3GBG A;  4OAY A;  4UZF A;  2W25 A;  3BTC A;  1VI0 A;  2VFN A;  3K69 A;  4UNO A;  1KU7 A;  3WYA A;  2TDX A;  2X0K A;  2OPT A;  1B2R A;  1A5J A;  1FNC A;  2COM A;  1YHQ I;  1BA5 A;  1WOO A;  3M9A A;  5F0H A;  2JPB A;  2L9V A;  2NST A;  5L3E A;  4XMY A;  2JT1 A;  4OP7 A;  1VQK B;  2QEX B;  1PVE A;  1XQB A;  1IN4 A;  3GFJ A;  2BHZ A;  2R7Z J;  1ERD A;  4LG0 B;  4IQ4 A;  4B1R A;  3L2Q A;  1Y0N A;  4Z1M A;  2Q2E A;  4FN5 A;  3ZC3 A;  2NTP A;  2P5V A;  3HUG A;  1RIO H;  2DA2 A;  2M30 A;  3AVU A;  3W2E A;  4RAZ A;  1TT5 B;  3DCF A;  3CMY A;  3K70 D;  5BPI A;  4OU0 A;  4EJT A;  3RPU A;  4RGS A;  3OAA A;  4B44 A;  5GAH J;  4RGU A;  3LL7 A;  2EV6 A;  3H94 A;  1ZN2 A;  3BP8 A;  4B3A A;  1TLL A;  2HR3 A;  4IL6 C;  2MSY A;  2B7B A;  2HYG D;  2OJE D;  4BEH A;  2BY2 A;  5C4J J;  3HOX J;  2R5Y A;  3E1Y E;  4W1U A;  1VQP I;  1T6Z A;  3D5S C;  3HOY J;  4G5G A;  5CDF A;  2WV1 A;  2AHQ A;  4BY1 J;  2R7D A;  2UZK A;  3BDD A;  4HEA 2;  4A3B J;  3IWF A;  3CJN A;  2R7S A;  1HZE A;  4MEY F;  3AK5 A;  3G71 B;  3AG4 H;  2CUE A;  3GTL J;  2XF5 A;  1BL0 A;  5BNG A;  4M3B A;  1EV7 A;  3AST A;  2DPD A;  2R5Z B;  4ROX A;  1VQN B;  4LBV A;  1DQU A;  2RC4 A;  3JRD A;  4I84 A;  4NBS A;  3CC4 B;  3BC8 A;  5L3B A;  3WHC A;  1CQX A;  2XIG A;  4G7X A;  4IHW A;  3WWG A;  5LGT A;  3EUH A;  3NAU A;  2QE7 A;  1XN7 A;  1YE9 A;  2IGM A;  4BH9 A;  2CRG A;  3OSF A;  4PGO A;  3ZIA A;  1U2R A;  1IUY A;  5TGT A;  5J1Y A;  3NQO A;  4X8I A;  1XB2 A;  1C0W A;  1X0C A;  2VC0 A;  3DTI A;  1ZM3 A;  2V1D A;  1F36 A;  3GSI A;  4U7B A;  4E7J A;  1ACI A;  3CCM I;  1QZY A;  3MN2 A;  2HDW A;  4XLE A;  2O03 A;  2HQ5 A;  4RD6 A;  1N77 A;  2VKD A;  2XF7 A;  5E1Z B;  4X0C A;  3S1N J;  3G6E B;  4UV9 A;  2J8K A;  2HZT A;  2BZT A;  4LB5 A;  3E7L A;  4EJW A;  3F6O A;  2HXI A;  4PUS A;  1PE9 A;  2XTX A;  3MKZ A;  2D5V A;  2NS0 A;  1RKW A;  5FD6 A;  3MQ0 A;  4A5M A;  4DW6 A;  1W1W E;  4B8X A;  2E60 A;  2OCE A;  2BM0 A;  3H3V K;  2KJB A;  1YJN I;  2L54 A;  2WTE A;  5DDG A;  2WBM A;  3OW2 B;  2ZL7 A;  4UZE A;  4HWV A;  2CO5 A;  2C5H A;  1HDP A;  1QGA A;  1PP7 U;  4M6V A;  5DEQ A;  1O88 A;  2EK5 A;  2BW3 A;  4P25 A;  4RDJ A;  2K9M A;  2ZJP F;  2B9S A;  4P3I A;  1J09 A;  3CCV B;  4YFN F;  4IQJ A;  2GXB A;  3JW4 A;  5E6T A;  3FZV A;  4OOI A;  4UV8 A;  2NXN B;  2TCT A;  2G0E A;  4M1K A;  2VLA A;  1YYV A;  3HBL A;  1H9G A;  4FE7 A;  4BYY A;  5ILV A;  3CC7 I;  2DFE A;  5FLV A;  2LP0 A;  3G1L A;  1MDM B;  3WY9 A;  2XRO A;  1VBL A;  2NVX J;  3OZW A;  3OL3 A;  2HQA A;  5E3M A;  4ZDP A;  4MYT A;  4ENJ A;  2BGJ A;  4G7W A;  1HG8 A;  1IDK A;  3PVD A;  3WTX C;  3E3V A;  2ELJ A;  3SFZ A;  2PMZ N;  1WTH D;  3L00 A;  1KQ0 A;  2R7X A;  1NRK A;  1WJ5 A;  2ZSI B;  1VQ5 I;  2P81 A;  2Q6L A;  4HAM A;  4GDF A;  2M4G A;  1GVH A;  2X53 S;  2E1R A;  5DUI A;  3H92 A;  4QLC U;  1MAB A;  4PGH A;  2KZG A;  2NRA C;  2Z3Y A;  4QVJ A;  1T6S A;  2GA2 A;  3Q0V A;  4PJN A;  3ESW B;  1UD5 A;  2VBS A;  1XSD A;  2XPW A;  3RJP A;  3DTE A;  5L46 A;  3RSN A;  3CMA I;  5B1B H;  2DEU A;  2FA5 A;  5IYB J;  5M3M J;  3OIQ A;  5J3O A;  3R61 A;  1KZL A;  4D0P A;  3BCF A;  1K8F A;  1FIP A;  5D4R A;  2INU A;  3FXL A;  4MO7 A;  3VWB A;  2D2W A;  1UD8 A;  3OYG A;  1YRN A;  5CYV A;  3J80 Z;  3E5Q A;  3DPU A;  1MBH A;  3CME I;  4YEI A;  2EB7 A;  2QQB A;  1EP3 B;  1OFM A;  2EH3 A;  3WNC A;  4BJ6 C;  3ELK A;  3H9J A;  4M0L A;  3E6D A;  1V0F A;  1Y0R A;  1GQ8 A;  1XCB A;  5IT9 Z;  2BN4 A;  3DFG A;  2EIJ H;  3Q39 A;  3T51 B;  2M34 A;  3MCA A;  3K1M A;  1ZG1 A;  4WZK A;  3QOE A;  3GUD A;  2VJ4 A;  1D0Y A;  4X1E A;  4B3G A;  4JQF A;  1SAX A;  1VQ6 I;  2HPI A;  4PC7 A;  4RDL A;  3H5N A;  3PO3 J;  4E70 A;  1P4M A;  4XKC A;  4X7C A;  3CC2 B;  1K5C A;  3BTJ A;  1FEX A;  3QP6 A;  2BGI A;  3NB2 A;  2IT0 A;  3E5X A;  2JA5 J;  4BBS J;  4A6E A;  1XDS A;  1JHH A;  3SZG A;  1BPL A;  1BJA A;  2HOS A;  3AL0 B;  2NOJ B;  1Y8Q B;  3TDZ C;  1WI3 A;  1KCD A;  5BQT A;  2E5N A;  5D5U B;  1Q81 D;  3OYE A;  2ZME B;  1PDN C;  4B4C A;  4Z2Y A;  2LF7 A;  2EIX A;  3R6K A;  1D1C A;  3EPZ A;  4WWV A;  2NPF A;  1CLW A;  2XC1 A;  2E1O A;  5EGO A;  3QRF F;  3E20 A;  1Z6T A;  2LKS A;  2HNH A;  1YW7 A;  1TP4 A;  1SKQ A;  2X6W A;  2K9Q A;  3MMY B;  3A1Y A;  4EM0 B;  2BMW A;  2IS4 A;  1E0E A;  2BV3 A;  1QNT A;  2L9N A;  4C3I J;  2LVS A;  2ZBV A;  2UXN A;  3WG9 A;  3SJM A;  4ITV A;  4MXN A;  1HF0 A;  1NB0 A;  1I27 A;  3JTG A;  1S3J A;  4PDK A;  3CO6 C;  3S1Q J;  4CYC A;  3JRC A;  1VQ4 I;  2BM5 A;  4A69 C;  3WTT C;  3BTI A;  5FKN A;  4Q7J B;  1IJE A;  3CQZ J;  1OJL A;  4YG2 F;  2W7N A;  4UB6 C;  3WG7 H;  3FKI J;  3LVB A;  5H2F C;  3HC7 A;  2QCO A;  3GLX A;  3WGI A;  3TH0 A;  1GVD A;  5IYN A;  3LSI A;  3I55 I;  4U49 A;  4IVN A;  4XRS A;  4PSW A;  3CCE I;  4DK1 A;  2EZH A;  1OPC A;  4DIQ A;  2G7U A;  2ZBU A;  4P3Y A;  2QGG A;  5DCF A;  3CLO A;  4MR0 A;  1ZGJ A;  5GPC A;  2Z33 A;  3VEP A;  1OHH A;  1XSX A;  3ML3 A;  2MC4 A;  2CS3 A;  2UVF A;  3F6V A;  1EFT A;  2ID6 A;  1KQ8 A;  1H89 C;  2VBM A;  2OTL B;  4UAJ A;  3ISX A;  2BXZ A;  2JSP A;  1MMA A;  2IS2 A;  1K6Y A;  2C2W A;  2X6Y A;  4OZY A;  1QUF A;  2CRV A;  2DDB A;  3FM5 A;  1FSH A;  2PMZ A;  3CC7 B;  1VLO A;  4HNT A;  2R93 J;  1Z1D A;  2L3D A;  4MGR A;  2QSF X;  5KHD A;  4ENM A;  3U1D A;  4PC1 A;  1IXS B;  1TQM A;  3CCJ I;  2BF4 A;  3BPX A;  5CQG A;  3CCV I;  2JA8 J;  1E43 A;  5M5Y J;  4DBQ A;  2EFN A;  1IN8 A;  2MA3 A;  2ZFU A;  5CVJ A;  4Z4W A;  4WXD A;  4XNF A;  2DK5 A;  2R7O A;  3NWS A;  2UXX A;  4HW0 A;  4DNR B;  2E2I J;  1KGS A;  3FDY A;  2IQ7 A;  4XLA A;  2E7X A;  3M1E A;  1KRH A;  4BJT A;  1YW8 A;  4PFP A;  4E7H A;  1Q1H A;  2WZN A;  5FLX Z;  1MNE A;  5HDK A;  4PJM A;  4TKO B;  1W4M A;  1IJF A;  3K9T A;  3S2H J;  1XSV A;  4UB8 C;  2Z6B D;  2C4U A;  2X1C A;  4Z4Z A;  3HKZ N;  2CFO A;  1QG0 A;  1SVL A;  4HE6 A;  3DLA A;  2PLY A;  1J9I A;  4OAZ A;  2DMN A;  4KIC A;  5FRN A;  2HGC A;  1X3U A;  2QXZ A;  5D8K B;  2RGV A;  1VJS A;  2IEK A;  4MLO A;  5B5E C;  3HIF A;  1KK2 A;  2V7X A;  1XGN A;  2EIN H;  4ZDO A;  2W00 A;  1RR7 A;  3ABU A;  3MHP A;  1TUI A;  3LYC A;  1DU6 A;  2PI0 A;  1DAB A;  1FP2 A;  3IKT A;  1QPM A;  4RD4 A;  1A36 A;  1LDJ A;  4LGW A;  1HW5 A;  1G3Y A;  4DK0 A;  4KIF A;  4KN7 X;  1VHO A;  1DGR M;  1PUF A;  5A89 A;  4OJO A;  2JUG A;  5IPA A;  4PCQ A;  2ID3 A;  3BJO A;  3D5R C;  1ZAO A;  2PMU A;  2V79 A;  1STZ A;  1DDN A;  2L4M A;  4YRV A;  3ASN H;  1HC8 A;  1QRB A;  3HHH A;  2G9W A;  2ZXW H;  3SFI A;  3F72 A;  3K70 C;  5EJC A;  2X9D A;  2NVQ J;  3BR5 A;  2LD5 A;  2K85 A;  3CDH A;  1FND A;  2L7F P;  3GTM J;  2JSC A;  2XTW A;  4D1Q A;  3B6A A;  4OIP F;  2WJY A;  4AYB N;  1W0U A;  1XD7 A;  9ANT A;  2DFI A;  2XAJ A;  3KP2 A;  1D8T A;  1L0O C;  2E36 A;  1T6Y A;  4L9N A;  5J8C A;  2I1L A;  1EWY A;  4D5C A;  3G71 I;  3RQI A;  4Z4V A;  4DQK A;  2L9S A;  2HTS A;  5A8A A;  3FJO A;  3KP5 A;  3KCC A;  4KDP A;  2COB A;  3ZUG A;  3JUR A;  5FO5 A;  4ESB A;  2EFP A;  2ZME A;  3K4L A;  2PEX A;  2CH0 A;  3LSR A;  2KRH A;  4HBL A;  2WY8 Q;  1P92 A;  2NVY J;  2GLO A;  3K1N A;  2HYJ A;  3DP7 A;  4W97 A;  5D5V B;  3BWG A;  1WJF A;  1FBU A;  2WSS A;  4BXU A;  1LFB A;  2CQK A;  3HRT A;  3EYY A;  3OSG A;  5C4X J;  3WNB A;  1BOB A;  1K78 B;  3SXY A;  2R4G A;  3NE5 B;  5LGN A;  3U9G A;  2EFW A;  4HDU A;  2UVE A;  1ZAR A;  1CF7 B;  1YX5 A;  1YX3 A;  2NAZ A;  2OAZ A;  3ULQ B;  1BR1 A;  2EWE A;  1H8A C;  4RCY A;  1SD5 A;  2B63 J;  3V76 A;  4QIW N;  3HB9 A;  1FLI A;  3BC9 A;  1J2X A;  2ODL A;  2JN6 A;  1RR8 C;  2Q0O A;  1XE1 A;  4R71 A;  3KYD B; 
#chains in the Genus database with same CATH homology
 1FMV A;  3ZXS A;  4W8R A;  1HA8 A;  4XLH A;  1NBM A;  1PYV A;  1KMH A;  3OS2 A;  2V31 A;  2KZV A;  4B3X A;  1Z3Y A;  3H5A A;  2CMP A;  2GOM A;  2L5Q A;  3JU4 A;  3VMW A;  3LMW A;  3BG6 A;  4OJ5 A;  4KKU A;  3CJQ B;  4OJ6 A;  2A5W A;  2VB6 A;  1T5E A;  1W9X A;  1KCC A;  3ZRG A;  3BCA A;  3PNY A;  3FY3 A;  1NG6 A;  2BVL A;  2AQF A;  3I3L A;  4BUP A;  2V4J C;  3DWL E;  4BU2 A;  4C9Y A;  3WQZ A;  2M0M A;  3LSG A;  4XLC A;  1SAU A;  4HNU A;  3NWT A;  4NC8 A;  3DU5 A;  1NG7 A;  2KHM A;  1AIR A;  4CCO A;  3DKX A;  2NTB A;  3H35 A;  3B8Y A;  3FHN A;  1XG2 A;  4W8S A;  2BSP A;  4RM2 A;  5HVQ C;  1QJV A;  3PUB A;  3VSU A;  4C2L A;  4QPQ A;  4IKF A;  3H0D A;  1W36 D;  2QKL B;  2PYG A;  2X1E A;  2ZXH A;  3VDX A;  2UV1 A;  5FL7 A;  1I18 A;  4G6I A;  2ZTG A;  4CCK A;  3DPT A;  4Y3O A;  2E1B A;  3EUK L;  1BHE A;  3GVL A;  1TT0 A;  3SEQ A;  4Z05 A;  3UW0 A;  2VXD A;  2Z8G A;  3VST A;  1O8D A;  3FKJ A;  2VJ5 A;  2VXZ A;  2LRD A;  4RM3 A;  1UD3 A;  3A35 A;  2R9V A;  2F43 A;  2INV A;  1IB4 A;  2R7T A;  5LD2 C;  2LG4 A;  2WAE A;  2E1M B;  3PSF A;  4KIT B;  1Z7L A;  4BDZ A;  2F1M A;  3W2W A;  3EUH C;  2HVR A;  3L2V A;  4CUG A;  3OYF A;  3EQO A;  1O8M A;  2CUZ A;  3HG9 A;  2DT7 B;  3ZR8 X;  4DBR A;  1WP6 A;  1K28 D;  3HUG B;  2XDV A;  1LKX A;  3SYT A;  4BS9 A;  3V42 A;  2JIZ A;  2AQE A;  3K10 A;  5KCM A;  3OYL A;  2K3P A;  3KRG A;  2XGJ A;  4YZ0 A;  3DU6 A;  3GQB A;  4XL9 A;  1VLY A;  4NQW B;  2VBK A;  3OYD A;  3OYC A;  3DKY A;  4PSX A;  3KEY A;  4BEH B;  2QKM B;  4FAS D;  2JJ1 A;  2V7F A;  4XR6 A;  3DDY A;  2KP6 A;  3OE7 A;  1RWR A;  4OJL A;  2GJR A;  4Y4R A;  4F92 B;  1V5G A;  4C2T A;  2L7K A;  2Q2E B;  1D0X A;  3RTR A;  2ZZG A;  4RMN A;  4HSR A;  2IGN A;  2GK7 A;  2LOO A;  2RRE A;  3CP8 A;  1N75 A;  4LIU A;  4UZU A;  4N4O B;  4AYB A;  2RNG A;  4CA0 A;  1KON A;  2PEC A;  3TMO A;  1MND A;  2GOX B;  3CP2 A;  4HIZ A;  4E0F A;  4Z06 A;  1OGO X;  3QYE A;  1PKV A;  3OYA A;  3UR3 C;  4YXW A;  4ZTJ A;  2XND A;  2KDO A;  1UEL B;  3PNT A;  1IA5 A;  1BMF A;  3E1S A;  4AU7 A;  4ASU A;  1O8H A;  2IS6 A;  4F52 A;  1BLI A;  5HLT A;  1ZEL A;  3ZGK A;  2R7V A;  3OOU A;  3MKY B;  3A4C A;  3OPO A;  3U21 A;  3GBG A;  4OAY A;  1UAA A;  3FBI B;  4XOT A;  5CQE A;  1UD2 A;  4NC7 A;  1AA7 A;  1V0E A;  1X1C A;  2GJK A;  3AFH A;  5HKK A;  3SUC A;  4XLF A;  3G05 A;  2OUM A;  4II3 A;  3K4C A;  1W0J A;  3SDB A;  1V5E A;  4N4N B;  2NST A;  4KKS A;  4XMY A;  2K9L A;  4BDY A;  4YZQ A;  3HOT A;  2HZD A;  2CUJ A;  1Y6I A;  2LRE A;  2ZXI A;  2LH9 A;  2V26 A;  4IQ4 A;  3L2Q A;  1WFX A;  1ERD A;  4Z1M A;  2NTP A;  3QOD A;  1E1R A;  3BCB A;  3A3G A;  4PK4 A;  4BQN A;  3B90 A;  2NSP A;  4XQF A;  4BQO A;  1KCD A;  2IXS A;  4Y33 A;  3K70 D;  1E3Z A;  3RQ4 A;  2X85 A;  4ZJZ A;  2VL8 A;  2W1O A;  3PJR A;  1VZ0 A;  2M4K A;  3S93 A;  4B44 A;  3OAA A;  3LL7 A;  3H94 A;  3GVK A;  4JMQ A;  3OEH A;  4LG3 A;  4PMH A;  4JOM A;  1WPC A;  4BEH A;  1MMD A;  5AMV A;  3OYJ A;  3D5S C;  5CDF A;  4NK8 A;  1BR4 A;  2KLO A;  3LSM A;  3OMY A;  2X8K A;  4HEA 2;  2R7S A;  3DQV C;  1HZE A;  2KMU A;  3K4M A;  1HVX A;  4B47 A;  2XF5 A;  2W6I A;  3DTK A;  1X4O A;  2MFZ A;  1DQU A;  3PSI A;  1RU4 A;  4W8T A;  4BE2 A;  2BW3 B;  3TL4 X;  3LSK A;  1PLU A;  4I84 A;  3BC8 A;  3OFN A;  2MYS A;  1W36 C;  3WWG A;  4G7X A;  3BCD A;  3IAM 2;  3KX2 A;  1QU3 A;  3VR6 A;  1O8L A;  2DIE A;  3S3O A;  2QE7 A;  2O17 A;  3S32 A;  3OYH A;  1YE9 A;  2IGM A;  2WJV A;  4PFO A;  2HLD A;  5IK2 A;  5C1E A;  1D1A A;  3ZIA A;  1PJR A;  2VKH A;  5TGT A;  3LSH A;  4XN3 A;  3H9G A;  1X0C A;  3DTI A;  4XON A;  3OIP A;  4U7B A;  4E7J A;  1E3X A;  1N78 A;  5HNF A;  3OR1 C;  1SFK A;  4XLE A;  2HDW A;  2W6J A;  4LIV A;  2JA2 A;  3GVJ A;  1EFR A;  1O8J A;  1N77 A;  2VKD A;  4ZC3 A;  4F91 B;  2XF7 A;  5HNH A;  2IGK A;  3VYU B;  4TT3 A;  3C2H A;  3MKW B;  1PE9 A;  1QHH D;  1WJE A;  2LY2 A;  4PUS A;  3MKZ A;  1H8E A;  2WY7 Q;  4XM3 A;  4FET A;  2XC7 A;  3OYM A;  4E7L A;  3GQ7 A;  3IAS 2;  3ZCO A;  3FBN B;  3T9G A;  2E60 A;  3OYI A;  4YEL A;  4TSF A;  2WBM A;  1EA3 A;  1OFL A;  4HWV A;  3QYB A;  3K6G A;  2Z1D A;  5DN6 A;  1X1D A;  1G8X A;  3HKZ A;  1O88 A;  2O1D A;  2BW3 A;  2CK3 A;  4XKW A;  1DGW Y;  4P5O A;  1T0F C;  4PJL A;  1EE6 A;  2K9M A;  4P22 A;  3OEE A;  2DJI A;  1J09 A;  2F5V A;  2LZJ A;  4IQJ A;  1Z21 A;  2Y0S A;  4YEJ A;  4BJ5 C;  1OLT A;  3K4K A;  2MAB A;  4OZZ A;  2R7R A;  2VLA A;  1UD6 A;  2QX3 A;  4CCN A;  1TZL A;  2I8D A;  2VJJ A;  2WPD A;  2M3A A;  4BE1 A;  4E7I A;  2VBE A;  3E0J B;  3VSK A;  4F93 B;  1VBL A;  3ZQQ A;  4XD7 A;  3OL3 A;  4PJJ A;  2HQA A;  3OL4 A;  1UG0 A;  4ZDP A;  2PJR B;  1P9Q C;  4KIS A;  4FXU A;  4G7W A;  1HG8 A;  1IDK A;  2NTQ A;  2ELJ A;  1W0K A;  2D3L A;  4HG2 A;  1WTH D;  4C2U A;  4XKV A;  2R7X A;  1WJD A;  1WJ5 A;  2ZSI B;  2R7U A;  1NRK A;  2KRC A;  2KL4 A;  1JI8 A;  2M4G A;  3AL0 C;  2X53 S;  2PYH A;  3S3N A;  2X51 A;  2VQC A;  3W3C A;  2WAF A;  1MAB A;  2JVH A;  2F4I A;  4H4K C;  4J00 A;  2QY1 A;  4PJN A;  4BXF A;  1UD5 A;  2M5S A;  1S9H A;  3DTE A;  5HOO A;  3RSN A;  4F3Q A;  3M8J A;  3IUO A;  4DGW B;  4CH7 A;  3OIQ A;  4XKB A;  3CJR B;  3G2B A;  2K5C A;  4XOR A;  2R7W A;  4ZDL A;  1KZL A;  1OGM X;  2DT6 A;  2WB1 A;  1WJB A;  1D1B A;  3K4J A;  4XOP A;  3RPU D;  3VWB A;  1UD8 A;  3BCF A;  2INU A;  4L8J A;  3OYG A;  1Y56 A;  3DPU A;  1O8G A;  1OFM A;  4BJ6 C;  1DP3 A;  3H9J A;  2KPM A;  3ONQ A;  1V0F A;  4KKT A;  1GQ8 A;  3BG7 A;  3T51 B;  4OJP A;  1MMN A;  2DOA A;  2XAU A;  4B48 A;  2ZZF A;  3QOE A;  2VJ4 A;  1D0Y A;  2VIX A;  4B3G A;  1QHG A;  4DOZ A;  3OY9 A;  4JQF A;  4XN0 A;  3MD2 A;  1MW7 A;  2HPI A;  3EUA A;  3H5N A;  3PL8 A;  2W82 A;  2R7Q A;  4XKC A;  4DNT B;  1H80 A;  2VPL A;  4URR A;  1K5C A;  2CV2 A;  4KJZ A;  3S3M A;  3BH4 A;  2VAS A;  1FMW A;  2Z16 A;  4G6T B;  3OOC A;  3SZG A;  1BPL A;  4KT6 A;  3AL0 B;  2NOJ B;  4CCJ A;  4B3F X;  3I9V 2;  3B4N A;  2D3N A;  2E5N A;  2MD0 A;  4BE0 A;  3OYE A;  2VQL A;  1U0J A;  2LBF B;  3CF2 A;  1D1C A;  3EPZ A;  2A6T A;  3W2A A;  4GQN A;  2M7B A;  2O0V A;  1Z3X A;  2HNH A;  1WJC A;  3F9K A;  2V1N A;  4CCL A;  3PNV A;  3OS1 A;  2X6W A;  4B43 A;  3MMY B;  3A1Y A;  3DPL C;  5JHF A;  2ZZQ A;  2IS4 A;  3GQ8 A;  1E0E A;  3UNG C;  2L9N A;  4BQQ A;  3OW7 A;  3GQ9 A;  4ITV A;  4MXN A;  2NT6 A;  3LFU A;  3ZSC A;  3HPH A;  2V4D A;  3BLY A;  3T56 B;  2ZZE A;  2P0W A;  4U4B A;  2UWM A;  1O8F A;  5LFA A;  1DBG A;  3KEW A;  2VQG A;  2O0W A;  2W7N A;  2HPM A;  3HC7 A;  2L2O A;  4IX7 A;  2JVG A;  4NK6 A;  4NUB A;  4C30 A;  1KTW A;  5C1C A;  1T95 A;  4HST A;  2XZL A;  2IGO A;  3LSI A;  4U49 A;  3L2U A;  4PSW A;  2BVM A;  4DK1 A;  3VMV A;  3W2V A;  3OR2 C;  4YZA A;  4DIQ A;  4II2 A;  5CKT A;  1OHH A;  4HPQ A;  2MC4 A;  2CS3 A;  2UVF A;  4LIT A;  1LDK B;  1X4P A;  2VBM A;  3HPG A;  2LBF A;  2Z2S B;  2WAQ A;  3AKZ A;  3ZPN A;  2JSP A;  1MMA A;  4DJA A;  3HOS A;  1K6Y A;  4BAC A;  2IS2 A;  2FUG 2;  3H9Q A;  2X6Y A;  4OZY A;  4EW9 A;  2WAD A;  4U87 A;  2ZTN A;  2PMZ A;  4RLQ A;  4E4H A;  4HNT A;  2CV1 A;  2E1M C;  2V6E A;  4CSW A;  2V9K A;  3VYT B;  4E6K G;  5KHD A;  3L2W A;  3HL2 A;  1G59 A;  3LMM A;  1PXZ A;  3VSV A;  2OC6 A;  4CZC A;  1JRG A;  3K4B A;  5CQG A;  1E43 A;  3FPP A;  4E7K A;  2HVQ A;  4DBQ A;  1BN8 A;  2ZFU A;  2XZP A;  1X1B A;  4EAT A;  4XNF A;  1UD4 A;  1OR7 C;  2R7O A;  3CZ6 A;  3NWS A;  4AVZ A;  4DNR B;  3FDY A;  3QYF A;  2HU9 A;  2LC2 A;  4XLA A;  2IQ7 A;  4BJT A;  2X6X A;  4PFP A;  4E7H A;  3OYN A;  1O8K A;  3M1C A;  2GJP A;  2XF6 A;  4NNJ A;  1RMG A;  3ZPP A;  1MNE A;  2W4S A;  4PJM A;  4TKO B;  5FRO A;  3VSL A;  2KVO A;  3OYB A;  2M7A A;  2Z6B D;  4Z03 A;  2WA0 A;  3VYS B;  2X1C A;  4D9J A;  3L2R A;  1X1A A;  2CFO A;  3IP4 B;  2X3H A;  2DXI A;  3DLA A;  4ZYA A;  2DCE A;  4OAZ A;  1BR2 A;  5FRN A;  2OV7 A;  2F6C A;  5KNL A;  1O8E A;  3D5L A;  2QXZ A;  2O5R A;  1VJS A;  4YZX A;  3H5R A;  4MLO A;  2NT9 A;  2O04 A;  1CZF A;  2UUZ A;  4OWR B;  4R79 A;  1WJA A;  4ZDO A;  3HAG A;  4RLF A;  2W00 A;  1X19 A;  4BL0 B;  4QPO A;  3N05 A;  2CW8 A;  2JJ2 A;  3C2G A;  2RQQ A;  2JDI A;  4E7Z A;  3S8P A;  3CES A;  4DK0 A;  2HVS A;  1DGR M;  2VQH A;  3KYL A;  4OJO A;  2JUG A;  2KQR A;  3D5R C;  2CV0 A;  4BGD A;  4YRV A;  3K70 C;  1LVK A;  4W8Q A;  3GQA A;  3K4N A;  4GRI A;  2LYC A;  3OS0 A;  1QCX A;  2NZM A;  2IS1 A;  5CPR B;  4D1Q A;  4HRI A;  2WJY A;  3DEE A;  1IDJ A;  4F55 A;  2Q1Z B;  1I8D A;  1E1Q A;  2CW7 A;  1E79 A;  2PJR A;  3OWT A;  1GLN A;  3RCO A;  1MMG A;  2L9S A;  3A2K A;  2BOL A;  3JUR A;  1WMR A;  1R6R A;  3K4L A;  1VF7 A;  3GRH A;  2CH0 A;  3VYR B;  3TBI A;  4E7S A;  2KRH A;  3T53 B;  2WY8 Q;  2E5Z A;  1NHC A;  1LFP A;  1IRX A;  1D0Z A;  1V5F A;  2V7Q A;  1COW A;  3HXL A;  1WJF A;  2WSS A;  4X0G A;  2XZO A;  4J01 A;  1BOB A;  4P1W A;  1SKY B;  1OOC A;  2R4G A;  3NE5 B;  3J7A Y;  1O8I A;  2VJI A;  2WZP P;  5FRM A;  2GK6 A;  2LY1 A;  3A3B A;  1DBO A;  2UVE A;  3FKS A;  1YX5 A;  1YX3 A;  2XSJ C;  2X1D A;  4ZTF A;  1JTA A;  1FX0 A;  1BR1 A;  3PFY A;  2EWE A;  4ANJ A;  3OYK A;  2XOK A;  3BC9 A;  3LNN A;  1OB0 A;  2ODL A;  3CMM A;  2ZSH B;  3SEZ A;  4IZZ A;  4MR0 A;  4CCM A;  3EQN A;  1H8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...