4XOPA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 235
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xopA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xopA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xopA02
2O17A 3GQ9A 1VBLA 2PECA 3T9GA 4OJPA 4YZQA 2VBKA 4XLAA 4W8QA 1DBGA 4NK8A 2Z8GA 4U4BA 2NSTA 1BN8A 5C1CA 1RU4A 2ODLA 3SUCA 4C2LA 3FY3A 1KCDA 3GQ7A 4NK6A 2VJJA 2PYHA 1X0CA 4Z06A 4XQFA 4MR0A 4OZZA 2VBEA 1O8HA 2NTBA 2X6YA 2NZMA 4XKVA 1OGMX 1DBOA 3B8YA 1RMGA 2X6WA 2IQ7A 3UW0A 4XN3A 4I84A 2NTQA 3JURA 3VSTA 4AVZA 1O88A 2UVEA 1QJVA 4W8RA 3VMWA 4YELA 1IDJA 1O8IA 1IB4A 1JTAA 1O8JA 1O8GA 4XLEA 4XLHA 2X6XA 4XM3A 1QCXA 4XMYA 1O8KA 1O8EA 1OFLA 1RWRA 4EW9A 4YEJA 2O1DA 2PYGA 2O0WA 5C1EA 2QXZA 2QX3A 2INVA 1IDKA 4URRA 3WWGA 2X85A 1CZFA 2VJIA 2NT6A 1PE9A 1O8FA 3ZSCA 4OJOA 2NT9A 4HWVA 4Z05A 4OJ5A 4OJ6A 1WMRA 3ZPPA 2NSPA 4XOTA 1K5CA 3GQAA 4YZXA 2INUA 4U49A 4OJLA 1O8LA 1OGOX 2X3HA 4OZYA 4XR6A 3KRGA 3EQOA 3LMWA 3VSVA 2O0VA 4XN0A 4W8SA 1H80A 2QY1A 3GQ8A 4XORA 2O04A 3EQNA 4XL9A 1IA5A 1NHCA 1HG8A 4XKWA 2VBMA 1KTWA 1EE6A 4XLCA 5AMVA 3GRHA 1PXZA 2UVFA 1OFMA 1KCCA 1BHEA 4YZ0A 1O8MA 4W8TA 2EWEA 4Z03A 4XNFA 1XG2A 1OOCA 1JRGA 4XOPA 4YZAA 3VMVA 1GQ8A 1AIRA 4MXNA 4XONA 2NTPA 1PLUA 4PMHA 4XLFA 2BSPA 1O8DA 3B90A 3VSUA 3B4NA
chains in the Genus database with same CATH superfamily
4NDLA 4YXWA 4CCOA 5GAHJ 3V7SA 5EZGA 2ZMEC 5CQEA 4E0FA 1S8NA 2WB1N 1X3ZB 3EUHC 3DP7A 4XLPF 2DIEA 3S1QJ 1QVTA 2A5WA 2KL4A 4IF4A 2DOGA 1WXRA 1PVEA 1S7EA 1XQBA 5IK2A 5FD6A 3BG3A 2L5QA 4NQWB 1QRBA 1W1WE 2IXSA 5CKTA 1W0TA 1F9NA 1IV6A 4M53A 1NDHA 4BY7J 4MYTA 1ETXA 3HOYJ 1K78B 1P7JA 3TO6A 3B6AA 4OZZA 2L0KA 1RUOA 3GVKA 1WCMJ 1SM4A 3LQ6A 5IYNA 3HC7A 4X05A 2E1RA 1R6RA 4YIFA 1AU7A 4MFDA 3JAMK 1EZGA 3CUQB 3ZQIA 2VT2A 3I4NJ 3BPVA 4I84A 1XB4A 4R8HA 3GTPJ 1QVFB 2H09A 2UVEA 4P5OA 5DD8A 4RB2C 2XTWA 2N8GA 3HPHA 1GXQA 1GDTA 3A8IA 3W6KB 3ASQA 1Z9CA 2F2EA 3H5AA 3AGQA 4CYCB 3NB2A 1QCXA 2YUHA 2E35A 1S9HA 3RI4A 2X4HA 2XDVA 1WI3A 2COBA 1YIJI 2OPTA 3GWZA 5C1EA 4UZFA 5E3NA 3JTGA 2DYIA 1UHWA 5B1AH 3A2KA 4M1KA 4FETA 5DTDA 4BXFA 2Y9YA 4CDGA 2HQRA 3QP6A 4CCLA 2NVXJ 1XB2A 4HE5A 2GXBA 3V76A 3CMEI 1H42A 2QEXI 9ANTA 2VL8A 2XZOA 1UHMA 2BHZA 2QUFA 4KH3A 3NAWA 5D8KB 4LB5A 4HWVA 5KW9A 3P4GA 4OJ5A 4PK4A 1R49A 2KPMA 1VNDA 4N0BA 2K3FA 2DK8A 2C5BA 3B8HA 4RB0A 4G9YA 1OJLA 1Q1HA 2L7MP 1EP3B 3WU0A 4L0YB 5BOXA 4U49A 4I09A 1N78A 1I3AA 3FM5A 4J01A 1YJNI 4PC7A 3VB2A 2JQ7A 2GAUA 3Q0WA 5ILVA 1ODDA 2E71A 2HKXA 2OCEA 2DYSH 1FOYA 2WY8Q 4TMWA 4PSXA 1Z3YA 4I02A 2EIXA 4HNVA 1XDSA 2DOAA 3OOPA 1VQPI 3D5SC 1YIOA 1OFEA 3OYJA 2OTLB 3SZEA 1P4WA 3LSRA 4W1UA 2DA1A 2DCUA 1SFUA 1ONVA 3EUAA 1W87A 4KKUA 3B02A 1K4TA 1TWFJ 3HSRA 4HSTA 1MNEA 2PLFA 4YIRX 1JXSA 1IJFA 2NTPA 4ENNA 1E3HA 2NOJB 4FXUA 3K2ZA 1PP7U 1S6LA 4I01A 3PUMA 3G6EB 2HPIA 1UD2A 3BY1A 3CF5F 2PECA 4D5CA 4OJPA 5LLQA 3L00A 2H27A 4R71A 4KDPA 3QODA 1VTNC 2WPDA 3AGPA 4W8QA 4ZH4F 1R4MB 2V7VA 4RBOA 1UAAA 4E7ZA 5GTHC 5JLWA 1YS7A 4X7EA 3SUCA 5D5XB 3A01A 4PGGA 3GBGA 2C5HA 1VQ8B 1XMXA 2LTPA 3W2AA 1QH0A 5B6IA 5FO5A 3V7RA 3VMFA 1KQSB 4G6IA 4Z4TA 1LJ9A 1K79A 4DJAA 2F5FA 2XGDA 1NB9A 5DUIA 3L2CA 2LG4A 3H94A 1ON1A 4XKVA 3IUOA 4AVPA 2NXNB 1GV5A 1B9NA 3C7JA 2A61A 3HUGB 4MIMA 1YS6A 3QAHA 3CJQB 5HODA 4XN3A 2WWYA 1H9GA 4IRIA 3GTGJ 1D1AA 1HKQA 2ZZFA 1WOSA 2QVOA 3WTXC 3ZMUA 3B82A 1UD6A 3AVTA 4EQQA 2C77A 2A69F 4KT5C 3TDZC 3HYIA 4NCNA 2OBRA 4LOCA 1KJZA 2BPOA 2B5OA 5HS7A 4A3GJ 1O8JA 4ABZA 2UV1A 4BJ6C 1QZEA 4MO7A 5F4OA 1YHQB 1MMGA 3ZPLA 3J81K 3S15J 3AVYA 1U5TA 1B23P 2M3AA 1JUSA 2PBIA 1Z7LA 4Q5SF 5HDKA 2PMZA 2MG4A 1IDKA 2VBZA 4KITB 4P9FA 2XNJA 2Y69H 4ZJZA 1OR7A 4B47A 3GTJJ 2EFQA 1A36A 2KRCA 4M9SA 1RPWA 2TCTA 2CW7A 3OL4A 3WG7H 2NT9A 5FO1A 5EJCA 1AKHB 1I3QJ 1U2WA 2A5YB 1ZH5A 4S0HB 3RTRA 2DQRA 2O3FA 2DMPA 4UZUA 3A3GA 3BJOA 1VF7A 2BY1A 3GTMJ 4OJLA 5E20A 1OGOX 3V7AA 1GAQA 3T56B 3C1DA 3DLAA 1Y8QB 3LWFA 1NRKA 1A6QA 3AAFA 4BACA 2QZ8A 1UMQA 4XRFA 3CP2A 4XKWA 2BN4A 1LFPA 1VQNI 1QQ1A 3GRHA 3VSLA 3DPLC 3VODA 2EZHA 3DKWA 3FKJA 1VQLI 2VONA 3VYUB 5KAIC 4PJLA 4X1EA 1PJ5A 2EB7A 2D45A 3CW2A 1BHEA 4A3DJ 4OMYA 2PJPA 2K40A 4XICA 2IEKA 2Y0SN 5FA6A 3K4KA 1I1SA 1KU7A 2DXIA 3N6ZA 5M5YJ 5HZBA 3AVXA 2K85A 2CSOA 3RSNA 4ACBA 2Q1ZB 2QQ9A 4OM9A 2O7OA 1AOYA 3OS0A 2MYSA 2BVMA 1KU9A 1WSVA 1YLOA 2O6WA 1QA3A 3FMRA 1W36D 3Q5FA 2BOLA 3M4OJ 3VO1A 2B63J 2M30A 2W82A 2GPJA 4U4BA 1VLYA 1JE8A 1A04A 5BNGA 3RYPA 1OCZH 1Q86D 1N25A 1VQ5I 4WZKA 5FIUA 3GQ7A 3TP0A 5A2QK 3ABUA 1K83J 4ZYAA 1VQ8I 3JR9A 1FOWA 2M87A 4E7JA 1FC3A 5JMCB 3ULQB 3SLNA 3RKXA 2HOEA 5C4JJ 1T38A 4Y9RA 2A3SA 2JTVA 3MZHA 1V4RA 1WJBA 3BG5A 5FB2A 2M4KA 2M1BA 1RC9A 2PJRA 2OBPA 1YI2B 2HTJA 4CQJA 2DPDA 1SVOA 1UD5A 3H36A 3CC4I 3JURA 3VSTA 1SD4A 4P1VA 4OMZA 2MLKA 1EH7A 1R5ID 3QE2A 3GMEA 2LYCA 3F8FA 2F5CA 3ZQ7A 5LEJA 1I5ZA 1BJAA 4HF0A 2X48A 1YJ9I 1MBKA 1VF9A 1IAWA 3JRAA 2RQQA 1O8EA 3G71B 1DGRM 2PYGA 3E5QA 1ZHFA 2KIQA 2X8KA 2VBKA 4A3JJ 1LEBA 3OFNA 3KEQA 1D2EA 2BXYA 3NEUA 2VKDA 2O8KA 4UNOA 2CW5A 3BH4A 4LGWA 4F7DA 4RCYA 5K7ZA 1Z67A 2DOEA 1GHCA 3KZZA 2KISA 4X8IA 4EGYA 5JI6A 2K9LA 1IB0A 3ECOA 3BCDA 3ZSCA 1ZARA 2YWFA 3FMSA 2NVTJ 3PSZA 3S16J 2XRLA 2BM1A 1WHUA 4HNUA 5FRNA 4PFOA 2K5CA 1LNWA 2HYJA 2RC4A 1HXDA 3DTEA 1V3FA 4I0AA 5EYRA 2COMA 5LBQA 1MMSA 3O8GA 2CQXA 4XRSA 4BBSJ 3BTIA 2YPRA 4RLFA 5DN6A 3OJXA 3IWFA 2QTLA 1O8LA 2E1MC 3UKGA 5D6EA 3HAGA 5THXA 1P9QC 4ESJA 2R7FA 5TV2A 3MFKA 2JUCA 4LB6B 4FN5A 3ZN1A 4RB1A 3FHNA 4KA4A 2VQGA 1TYUA 2KT0A 1QQIA 1WJDA 5TJJA 2F5EA 3OS2A 3ZGKA 3COAC 2HEOA 5K5QA 2C4TA 2H8WA 1VHEA 4DYQA 1WKMA 2FD5A 1HW5A 2RNGA 4XBFA 3VOEA 5DEQA 4BQAA 5H59A 4NC7A 2F43A 3R4KA 3BCFA 5LRRA 2F3LA 4Y3OA 1W7PA 3SYJA 4G1BA 3MKZA 2R7SA 3K1PA 3G1OA 2J8IA 2EH3A 3H9GA 3CDHA 1O8DA 3B90A 2B7CA 3HOVJ 1DDGA 2RAEA 3MCAA 2P5VA 2VXDA 4YZQA 3HRUA 1QZZA 3GX4X 3AL0C 1WJAA 3TOAA 3V4GA 5KCMA 4F91B 4AC9A 3W3CA 3PFYA 1SAUA 1KK0A 3WTZA 5C1CA 2FUG2 4Q48A 5IOYA 2HVRA 4Z1MA 1YG2A 4HPQA 2IGKA 4M6XA 2W6IA 2PYHA 1QO0D 4M72A 2PFBA 1U0JA 1IUYA 1YX2A 2Q8KA 2GZWA 1A6IA 3BPXA 5ILUA 3JRCA 4A3LJ 3ECHA 2JT1A 1V5FA 2ZB9A 2ISZA 1R36A 1YE9A 5ERIA 5JFRA 3SJPA 3A0BC 1TQMA 2ICWG 2EZIA 3FXLA 2Z9OA 1WP6A 1UHSA 2WAEA 3Q0UA 1J75A 3A0HC 1QHHD 2Q6KA 3IC7A 3PUBA 5GP9A 3CPWB 3DTKA 3A01B 3ML3A 1B1BA 1YLFA 2CQ7A 2DO7A 3P7NA 2VQHA 4AF6A 1FOKA 1TNSA 1ETYA 1W7PD 4XRMA 1QRYA 2HTSA 4C3HJ 4YFKF 4P1WA 1I39A 4HG2A 4BHBA 4MLOA 1D0XA 2W7NA 1S72B 4XMYA 1WTHD 5AIPA 3I71A 3HL2A 3G73A 1BMFA 3PUNA 5EEHA 1BR2A 2O1DA 2LLKA 2MABA 3LSHA 3JRDA 3DU5A 1QU3A 3GVJA 2DA5A 3F8BA 2E7XA 2FVGA 3OY9A 4HZFA 3WGHA 1X4OA 2I5UA 3WTTC 3HKZA 5FKLA 3CD6I 3OW7A 4YAWA 1APLC 2OF7A 4UHTA 2DYRH 2FU4A 2GJKA 2ZC2A 4QTRA 2ZCWA 2R92J 3EDPA 2V7FA 4QSHA 1JGSA 4ETSA 4Z05A 4D7MA 4HX8A 5JHFA 3WNCA 3D5LA 1YITI 5E3MA 2NSPA 1V5GA 1RRJA 1HW2A 3A35A 2DK5A 1K5CA 2UXXA 3J7YJ 3ES9A 4A3FJ 4J0QA 4KKSA 3RY8A 3CCQB 1BW6A 1U5TB 1TLHB 4MFEA 4BHCA 2Z3YA 3QPHA 1VQ4I 2XHKA 2ZSHB 3KRGA 3HOWJ 2XSDC 1FNCA 3CCSB 4PC2A 3S2DJ 2KZGA 2P0WA 3LL7A 4LITA 5AONA 3MMPA 1Y0YA 4XL9A 1SEUA 3VO2A 1HG8A 1QPMA 3KYCB 1G7RA 3K4LA 4XLCA 2MLGA 3L2UA 1OCRH 3I56B 1P6RA 4CZCA 3LVBA 2ZMEA 5CQGA 1BC7C 1R5OA 4RAYA 1UELB 5F08A 4TMXA 3GZNB 4PDKA 3CESA 5BQTA 4UVAA 1HDDC 2BVNA 5CJ9A 5E8IA 2DFHA 3VR6A 4M3DA 4O5VA 1ZQ3P 3BTCA 3QP5A 1IGNA 2BXZA 4CH7A 1ZRDA 1GQ8A 2VFNA 1I27A 1T6YA 4YAUA 5FKMA 3OYFA 2LKSA 2QA4B 1KZHA 3UR3C 2HDWA 3FXOA 4IRHA 3V8LA 1SFEA 2XC7A 4IHYA 1T08B 2XGEA 3CC7B 2L7KA 2HKOA 4WWVA 4E7LA 2BY0A 1X3UA 4OIPF 2EV0A 3HB9A 2EINH 1VQMB 2YUSA 1Y1WJ 4X06A 3E1SA 3PQJA 2ZJPF 4A93J 3ZC3A 2V6CA 2CFXA 1T33A 3MQ0A 3N05A 3S2HJ 1ZUNB 3RYRA 4V02C 2QSGX 4RLZA 2WADA 4HIZA 2AQEA 3ZN0A 3LSKA 1USTA 2DCEA 4RPDA 3F8MA 2HQNA 2ZNZA 1A5JA 1TT0A 1WJEA 2X51A 5FRMA 4MQVA 1WSUA 2E1OA 2DAOA 2VPRA 5JHUA 4WZEA 3D1NI 2HXOA 1Y0UA 2FXAA 1MGTA 2QYOA 4RGUA 1IO2A 3KYDB 2NRAC 3GIRA 4IO9F 4BXXJ 2VKEA 1DQUA 1WGXA 4M3EA 4WF2A 1N06A 2DY1A 2VKVA 3CLOA 1O8IA 4AYBA 1PDNC 1IB4A 1EWYA 1P92A 1FZPB 3K4CA 1ZM9A 2CNDA 2G7UA 3U2RA 1HF0A 3HGYA 2M0CA 3GTQJ 2QDXA 2HQAA 2PJRB 2BV6A 2BY3A 2M8EA 1STZA 3QU3A 2M4GA 3OYBA 2O9LA 3AFHA 4LBYA 1I7PA 4QHYA 2K86A 1OLTA 1TTTA 2GIZA 5CPRB 5LD2C 3CCEI 4CUGA 2GLOA 2X85A 2ZJRF 3BC8A 2V7QA 4EJOA 3JRIA 3OYDA 2UUZA 1OB5A 4G6QA 1E17A 4AWXB 3WQZA 1VZ0A 4DBQA 4YG2F 2QQ8A 4B43A 4RDUA 3BQJA 3LNNA 1KONA 2DA7A 3OIOA 1IXSB 3CB4A 3CCLB 3DQVC 2LNBA 2ESNA 3OMYA 4BE1A 5TGTA 2XZLA 2LP0A 3DEWA 3CCQI 1BA5A 3L2QA 2I8DA 2P3MA 3QWLA 4XR6A 3WBJA 3OIPA 4G12A 1S4MA 2HYFA 1OYIA 2XUBA 2IP2A 4JYKA 2DMTA 2XRNA 3RQIA 2EFWA 4BDYA 4E7KA 1ORKA 3CCSI 3OZUA 3TBIA 5CVIA 4GCVA 3DKYA 4L0ZB 3LSGA 1LUJB 2GJPA 1HDPA 2MA3A 1ZR4A 1DU0A 2ISYA 2Z5UA 5DDGA 2NVQJ 2JA2A 4BJ5C 3NARA 3PL8A 1ZM2A 2GREA 1Z7UA 1IXCA 1VQ9B 4PJ0C 2LY1A 2VJ4A 4JMQA 4WQMA 1GV2A 5CVRA 1J2XA 4Z03A 1XGOA 4M73A 3GSIA 2JPCA 1VJSA 3JQQA 3GLLA 4QVJA 3LO8A 2FQ4A 3FXRA 5FLVA 4IW3B 1QA1A 3I53A 4D9JA 1ULYA 1GVHA 3GZ6A 3HXLA 1U3EM 1NB0A 2ZZEA 1AIRA 1YX5A 5E79C 5E6TA 3CMAB 3LQQA 3GW2A 2QA4I 1XSVA 3GQ9A 2E2JJ 1SVLA 1W4MA 4PGHA 1Z0XA 1F1ZA 3K69A 4ZDOA 1DG1G 3CC7I 1P4AA 4NK8A 2Y30A 4NC6A 1BX0A 2YWGA 1AA7A 4IL6C 1XD7A 1Z91A 2OAZA 3ZR8X 3DLLF 1K73D 4IQJA 1VQMI 1I50J 2ZXJA 1U9OA 2V1XA 1EF4A 2VJJA 3KP5A 1X0CA 1W7PB 1DUXC 4N4OB 3HRSA 1WORA 3T8RA 4FASD 4XQFA 4MR0A 4F7ZA 3VPRA 4DK0A 3JQRA 5HLHA 4C2TA 4HW0A 2HNHA 1ZG1A 2X6YA 1EA3A 1FPQA 4EJTA 2BBYA 1R00A 1R7JA 2JRMA 1IUFA 4WWCA 4L9TA 5E1WA 3LA2A 4HLYA 1G59A 1D5YA 3KLNA 2WR8A 3AVVA 4XK4A 3S3OA 1OPCA 2OYNA 3WTUC 1Z6TA 2JA7J 4AVZA 3L2RA 2WB1A 2KFDA 5BS6A 3CDLA 3Q38A 1ZGJA 3H1CA 4KMFA 3Q9VA 3ONUA 1EFCA 2R7XA 3PNVA 4Z2YA 2BGIA 1OYWA 2HOAA 1R9TJ 5HS9A 2KLOA 3VWBA 1EA0A 5F1RA 3ZMTA 2CJJA 1HZEA 1MD0A 4TMZA 2X6XA 4ZYGA 4KIGA 4U0YA 1WJCA 1SMTA 1TSPA 4P55A 3WU1B 1W0KA 1BR4A 2KRFA 3KZYA 2WJYA 4GDFA 4WX9A 2L9RA 1RKWA 2V26A 3NWSA 1BJKA 1FOXA 3WBKA 4F93B 4Y17A 4FX4A 3H0GJ 1CZFA 1Z6RA 4ON0A 2F5VA 3SZPA 3SXYA 2LY2A 4MEXF 2H8RA 2VBVA 1O8FA 1JTYA 2ZSIB 1I6XA 3K6GA 4IVNA 2VE8A 2CO5A 3E6BA 1P7IA 1OFCX 2R7QA 5FROA 4XIDA 3P26A 2FBKA 3HHHA 2FNPA 3IH4A 2VXZA 5E3OA 4BAYA 4ROXA 3CCLI 4RAGA 5JVTA 2R7ZJ 2KHMA 2Z33A 2CV1A 1IW7F 2RVCA 4M9XA 5CVVA 4GGGA 4ZC3A 1B72A 1W5TA 3EQNA 2VQLA 2X1DA 3J7AY 2XIGA 2OC6A 3EPZA 2VYQA 3JRGA 5GPCA 1KCCA 4FHTA 2QLZA 2DMUA 2E1CA 2XAFA 3LQRA 4LLNA 3TP3A 2E36A 3LAPA 3EETA 3S1MJ 2VZLA 5FKNA 1O8MA 3AVUA 3CQZJ 4XNFA 2G0EA 3GXOA 3AKZA 2C78A 3K9TA 1CQTA 2D1VA 1O7LA 3AVWA 3HTSB 4XONA 4PMHA 3G2BA 3KP2A 3PUFA 1USSA 1MRZA 1OHHA 2LY9A 1SVMA 2MC3A 2NS0A 3CCYA 2E34A 5HKKA 3S1RJ 2VC0A 2PIAA 3OYNA 2CUFA 2E5NA 4MQ9F 4M0LA 3BR0A 1HBXG 1ACIA 2L9NA 4ZZDA 1J9ZA 3G4SI 3SJMA 3FXQA 2M2EA 1WWXA 4BPRA 2ZMEB 3CCJI 5H6QA 2AS5F 1LB2A 1FSHA 3U2QA 3K7AJ 3TEDA 2UXNA 2CU7A 1J0RA 2ID6A 5J3OA 2HDDA 1W5SA 2K4BA 2P6SA 4ZYEA 2KZVA 4GXOA 4AM3A 3U1DA 1M1KD 2KDZA 4ZCLA 1PP8F 2V9VA 1O3RA 2R6HA 5BSYA 1XX5A 4DK1A 2CS3A 4TV7A 4EATA 2IJLA 3ASSA 2ZL6A 1YO5C 1NG7A 2KIUA 3DEUA 3AG2H 4DQ2A 2BE5F 2IW5A 3K4NA 3PNTA 3CCMI 1AWCA 3C3WA 2NS8A 1EJ9A 2M34A 5K5OA 1QZYA 5TR9A 3RZDJ 4Y9UA 1FY7A 4MGRA 3WGIA 4YFNF 1UCRA 3OYEA 4TT3A 1X2NA 1XC5A 2E60A 2IGMA 2G7HA 3HBLA 3QOEA 5ICGA 4QV2A 2HDCA 3S3NA 4KT6A 3VMWA 3ABLH 3UNGC 1OCCH 1R58A 5J40A 5J47A 2RREA 1FTTA 2Q6LA 2NNNA 4BHPA 2JVHA 3S8PA 1OFLA 1KZLA 2ZBUA 5A88A 1YJWB 3GQBA 3F9KA 3JTHA 1ETKA 1TZLA 3E6DA 5B1BH 1VQ7B 3L2VA 3KEOA 1JGGA 2FX0A 5HVQC 5K5RA 4L8JA 3M1EA 4LLGF 2GJRA 3ZCOA 2NT6A 2KJBA 2BHYA 5FNZA 5LGUA 1QVUA 3T51B 1U9NA 4IRGA 1K61A 3VNVA 2ZXIA 3BZCA 4HBLA 3OYCA 1SD7A 3DF8A 2Y9ZA 4P25A 3E3VA 2FMLA 3FMQA 5F0HA 5BSXA 1SFOJ 2DQLA 3ASRA 1Q81D 2NAZA 1S0UA 5D5WB 2GBYA 4Y15A 3MKYB 5BPIA 1RQRA 2L4AA 2OTJB 1Q7YD 3BR1A 2OUMA 5GPAA 3A02A 3S32A 3J7AO 4ZTJA 2WAQA 4N9HA 3J80Z 3E5UA 2O6GE 4BGDA 4DZPA 1K4ZA 3PA1A 3RKYA 1O3QA 1XFOA 3ZZUA 2VFMA 3EQOA 3SDGA 4NNJA 3KETA 3IRRA 2X1CA 1B2RA 4RD4A 4TN1A 5FL7A 1TYVA 3NE5B 4C9YA 1NHCA 1IA5A 3JW4A 1XG1A 4BU2A 5HNFA 1IZ1A 2OJED 2EFOA 3Q6RA 5IT9Z 5AMVA 2YX4A 1EFTA 1U8RA 2IAIA 3KL9A 2L7FP 2I1LA 4JX4A 2PQ8A 3LSPA 2Q2EA 2E19A 3OSFA 4U7BA 2LMDA 3IL2A 3SKBA 4RS8A 1I8DA 3QU6A 1LE8A 1V5VA 3BCAA 3GEZA 3KFWX 4XOPA 1YX3A 4OAYA 4C30A 1XN7A 2D2WA 4LG0A 2PMZN 3DDYA 5EF6A 1W0JA 3JU4A 1PUFA 4EGZA 2HVSA 4V19K 4X7DA 4L9NA 2OQGA 4F3QA 2AXTC 4DQLA 1VQOB 3CP8A 1DBGA 1TT5B 2VBYA 3T5XA 1ZN2A 2IGNA 4H9GA 2OTLI 1KYZA 1YW7A 4UV9A 2MGQA 4KFCA 2PMHA 2EZLA 2ZBKA 1BR1A 2DLLA 2KQRA 3DPTA 3FK7A 3IAS2 4LD5A 4PUSA 4XRSG 5KAFC 2DT6A 2XGJA 4EV0A 4A3EJ 5JLVC 4B4CA 4HOBA 4UXNA 1O4XA 3G3ZA 3FX3A 3GZ5A 1COWA 1OGIA 1TWGJ 4UB8C 1LDJA 4YIIA 1K9MD 3PJRA 1G3SA 1JB9A 3G6EI 1DBOA 3PSSA 4M3FA 1LQ1A 4P3YA 1YW8A 2HS5A 1JKOC 2J8KA 2EK5A 5DM7F 4ENKA 2XOKA 4J19A 2IS1A 5M3MJ 1QFYA 1T56A 2ZXHA 4IQ4A 1T39A 1D5VA 2MBFA 1QFZA 2M9HA 3VEPA 1G4DA 1I18A 4QLCU 4E70A 3RPQA 3HOSA 3GF2A 2EJRA 2HZTA 5HDGA 1HCRA 1FX7A 2VODA 1W9XA 3SFZA 2DJNA 2JSCA 3HOTA 5B66C 3S14J 4G6DA 2H1LA 1J59A 1FP2A 2RV8A 4UVBA 2DTRA 1YJWI 3BG7A 3BQYA 1RZ4A 3IAM2 4O3MA 3CPXA 1MBHA 1N05A 1DARA 4ZTFA 1Z1DA 2BZTA 1VQ7I 1FBUA 1ZGWA 1JJ8C 2QSHX 4RPBA 4WZTA 3CF2A 4DYRA 3WWGA 1FWZA 2FSWA 2L4MA 3BQZA 3CDIA 4X0CA 1V55H 3T1BA 5HXBA 3T0YA 3BDDA 2ZFWA 4M3BA 3FKSA 4JRAC 1SD6A 4AIHA 4BXUA 4DGWB 2NS7A 3BOQA 2HOTA 1SAXA 1WMRA 2F1MA 4RD0A 3FWEA 4XOTA 2LD5A 3I55B 4L5JA 2JK3A 3MAJA 2K02A 1X1BA 4UVCA 5L3EA 1JI8A 5IYBJ 2V31A 4FT8A 2Z6BD 3ZZ0A 5J1RA 2OA4A 4UUVA 2BGCA 1VHOA 2R7RA 4NBQA 2M7BA 3HSFA 4HA8A 1YHQI 2IS2A 4RAFA 2GK7A 2JN6A 2M5SA 1CF7A 3WY9A 3RZOJ 4AF7A 4XN0A 2O03A 4KYWA 4W8SA 1R1UA 1A35A 1RESA 2FA5A 3F8CA 4S05A 3KP4A 3PIPF 1HLVA 3DBHB 3KP7A 3HOXJ 1Q1VA 5GTIC 4GQNA 4A0YA 3U1KA 2NNYA 2VB6A 4CCJA 4G6TB 4PFPA 4ZDLA 3BR5A 3PO2J 3H3ZA 5CDFA 1QA2A 1IRFA 1Q9SA 2RN7A 4A5NA 2D3NA 1R1TA 1Z77A 4O6JA 2E7WA 1XMAA 4EM2A 1T98A 5EG0A 2LREA 3CJTB 1R1VA 4AIDA 4NC8A 2W57A 4N3GA 3K4JA 3ZMDA 1RETA 2FJ1A 1JNYA 1NK3P 4A3BJ 4I6ZA 2D3LA 4X7CA 1WJFA 2EWNA 4PSWA 5J4VA 2VNHA 4X07A 4B1RA 4J00A 2XTYA 2I10A 4FTHA 3FISA 1B72B 1YQAA 1IN4A 3H9JA 3ML6A 1JKQC 3OYMA 1TW2A 1E79A 3GVAA 1G7CA 1QHGA 2HR3A 2XAHA 1NJID 3DU1X 3OYKA 4XLAA 1KGSA 1VQOI 3H5RA 1QFJA 2KJCA 2QGUA 2Z8GA 1J7KA 1IN7A 3H35A 4AIJA 4OIOF 1F43A 1FTZA 1QUFA 1G6NA 4BBRJ 4I7HA 4W97A 4BE0A 3ONYA 1QNTA 2HQ5A 2ZL7A 5EEAA 2VC1A 2LVSA 3MCZA 4G7ZF 2A6EF 2QQBA 3A4CA 3PFIA 5D6FA 3F21A 2UWMA 1ERDA 2PMUA 2HVQA 1MNDA 4B4DA 2CUJA 3ASTA 2EQRA 1CNEA 1ZR2A 1C0WA 1ETVA 1O3SA 5CVJA 3ROUA 3KPHA 1XGNA 1ZM4A 3SLDA 4E4HA 2VT3A 4LFUA 4F92B 4BY1J 3R6SA 1G2HA 3W5UA 1LFBA 1RUNA 3LNQA 4JOMA 3ZUGA 4W8RA 2XASA 4HX7A 5M5WJ 3K4MA 1KU2A 3NRVA 1JT0A 3PO3J 1H8HA 5ILSA 4CO8A 2ZXWH 4B09A 3M9AA 3E6CC 1JKRC 3E20A 4XLHA 3IRQA 4ESBA 1B59A 2NPFA 5E1ZB 4TMTA 3A03A 3QRFF 2O0YA 5BMZA 3WHBA 1IJWC 3HEFA 3F0CA 1QPIA 1HA3A 4NB5A 4R79A 3A1PA 1YI2I 4URRA 1VLOA 3W2FA 3F6VA 2ECCA 2VJIA 5TRDA 2VOOA 1KK2A 2R7DA 4I76A 3CCVB 1IXRC 2OV7A 2CF4A 5CLSA 2FEZA 4V2FA 4GRIA 4FCYA 3OSGA 2CGPA 3D5RC 2CRGA 5DNSA 2M7AA 3I54A 4PCQA 3ZPPA 1S29A 1KQ8A 4YEIA 2FOKA 5DCMA 3J80K 4DIQA 4BS9A 2OCCH 2DJIA 3HRMA 5IT3A 2VBSA 3CCRB 1X1AA 1TYXA 2W7ZA 1UD4A 2KRHA 4ANJA 3G71I 4QUZA 2LRDA 3OZWA 3SYTA 1T2KA 2Z1DA 4LG3A 2O0VA 1BX1A 5H2FC 5IT9K 3FK6A 5H5JA 2E1MB 2W84A 3BTLA 2WY7Q 2VBMA 3GUDA 5DCFA 3GFJA 1MBEA 2UVFA 1JUMA 4KN7X 1O57A 3IH2A 4FE4A 1KQ0A 3GCMA 2KIFA 2G0YA 1D0YA 1Y1VJ 5LGTA 1I6HJ 1M1EB 4XSXF 1B6AA 2ID3A 1LM1A 2K3PA 1Y39A 3O3KA 1IRGA 1WRJA 2XKOA 2XAUA 4AC0A 5FO0A 5B3SH 4EH1A 1PLUA 2M8GX 3VYRB 1QGZA 2D5VA 2RNJA 2E2IJ 2V7TA 4G7HF 3KX2A 3HKZN 1IRZA 3OYAA 4M6VA 4BYYA 4RAZA 1KQ9A 2ACJA 2XF6A 3SEJA 1BIBA 4A0ZA 1O3TA 3WE3A 1MBGA 3JAMZ 2RQPA 4EEFG 2QN6A 3CJNA 3PETA 3WU2C 1D1NA 4A3IJ 3AL0B 1FIAA 2XGCA 1LE8B 1UZCA 1GLNA 2VBUA 1TP4A 1ZREA 2F5DA 1DP3A 4HYEA 4XKBA 3K70C 4I0BA 2OQRA 1TQIA 2Y48A 4LG0B 4KNYA 4I99C 2XSJC 3V7CA 2BV3A 3IKVA 3OKXA 2XT2A 2XPUA 1VQ6B 1PUFB 4QIWN 1IDZA 2Q6OA 4Q47A 3OYIA 1TNTA 1P4XA 3B8YA 2QZAA 2GQQA 5D5UB 2EZKA 1XSXA 3I59A 1UB9A 4IHXA 1PUEE 2L2OA 1E63A 1KK1A 1R4NB 2OBTA 3OYGA 2ADUA 3BROA 3EUKL 3G1LA 2WJVA 4G8XA 5L3GA 2O5RA 2WYRA 4QVAA 3K0LA 4HV5A 4R1HA 1UG0A 4YELA 2R7UA 4ZCIA 1E62A 3U6BA 5FJ8J 2XPVA 1ZTRA 4GYGA 5DUKA 3VYSB 1TL8A 2R7TA 1EV7A 4XM3A 1KQ5A 3F22A 1RWRA 1T6XA 2JDIA 2OD5A 4II2A 4YEJA 2GA2A 3Q3AA 1RNLA 3BJ6A 1BOBA 4I98B 3LOCA 1A8PA 3I4PA 3FXUA 3PSFA 3BCBA 1X1DA 5FLMJ 2HYGD 2ZTNA 2NVUB 1TWHJ 2XB5A 2CFOA 2DA3A 3Q9SA 1Y6IA 5FKOA 4FK8A 4DBRA 1WPKA 2VQCA 3FDYA 1PYVA 4RDKA 3CCUB 1Z05A 1FBSA 4F52A 1FYMA 5DYMA 1PE9A 2JWTA 1PJ6A 4OOSA 3OYLA 2A68F 5TY0A 2LR8A 2CQNA 4MTEA 4RD3A 2R0QC 1HKTA 3OR2C 1U6GA 2Y31A 2W25A 4LK1F 2O61A 4P26A 3ABTA 2INUA 4PC6A 2C4UA 1S72I 4A6EA 4OZYA 1EP1B 1POGA 4KMUX 3OP1A 2LC2A 3D26A 1CLWA 5F4MA 2KIMA 4FQGA 3SEZA 4RCZA 3OYHA 2DDBA 2XF7A 2YU9J 3NAUA 2JJ1A 2V7UA 1IV8A 1Q82D 1D1CA 3W6VA 1QG0A 1ETWA 4UB6C 1XE1A 1LFUP 5GV7A 2J5PA 2X3UA 5DSZA 2B0LA 3OOUA 2DDAA 3WNDA 3FXMA 4LIVA 2HU9A 1H85A 5GV8A 3H92A 1SANA 2CWEA 2IBDA 2VBTA 2WC2A 2WSSA 2KDOA 3OWTA 1OOCA 1R5NA 3FJOA 2F48A 1X19A 2VJ5A 2FQ3A 1WZ2A 1YOVB 1BPLA 1CF7B 1RQPA 4OOXA 2E1NA 3BR3A 1BOAA 2BYVE 5IYDJ 4ZCMA 5IP9J 1VBLA 4A6DA 3PSIA 1K4SA 2H1KA 2OBSA 2XROA 2XZPA 4G7XA 3OL3A 4HQMA 2B7BA 3CTAA 3HPGA 3EYIA 2QBYA 3I0TA 4TMVA 1EP2B 1MNMC 3LA3A 1MIJA 2WTEA 3W5VA 5IYPA 2ODLA 2HGCA 1R22A 3I56I 5F4JA 1HVXA 3MEXA 1QX4A 3HHGA 3M07A 5LFAA 1MJBA 1YW9A 1BJZA 5LRSA 5EG0B 4IZZA 3K2AA 2HI3A 2IS6A 2YWHA 4LBVA 4PGOA 1HF2A 4Y13A 4C2UA 1E64A 1BQEA 2F4MB 4LK0F 4ZDPA 4Z4YA 3TQNA 2V9KA 3ESWB 3Q6QA 4C0SA 5FFXA 1YIJB 1WOOA 1MKMA 1WDTA 4HEA2 2WAFA 3CUQC 2H94A 2JA6J 2GQFA 1O8HA 2KP6A 5HOOA 1FYKA 3ISPA 2CH0A 1BI0A 1OYYA 4D1QA 4BQQA 2ME6A 1DP7P 1JTXA 3CMEB 3VFZA 4ZYDA 2EIJH 4WK8F 4LJZF 2DODA 4B48A 3DPUA 3KZIC 2XB0X 4OU0A 1YYVA 2ZZQA 2GOXB 5GAGJ 4NBSA 1ZRFA 4HDUA 3R0JA 2HLDA 3ZIAA 4PAAA 2FF4A 2EPFA 1MZBA 3HOUJ 4N3NA 1OMIA 3TW7A 3BP8A 1N07A 5FD5A 3W2HA 5KHDA 4ENJA 4Z4RA 3DFGA 1HKSA 1MMNA 1TC3C 1X2MA 1NG6A 3JQPA 2BY2A 2NVYJ 2ZNYA 2GXAA 4YRVA 2X0LA 3KP6A 4H4KC 2O0WA 3IKTA 1FEXA 2EBIA 2QX3A 3CO7C 4KIBA 3WODF 4Z4WA 4YCQA 1ZRCA 3FXJA 5F04A 1VQPB 1EKEA 2VIXA 1K8AD 4U87A 2LF8A 3ZQCA 1X1CA 4D5FA 4ZGQB 1LVKA 3P5JA 2STTA 1RIOH 2ZL5A 4QFMA 3PQKA 4WCGA 1H8EA 3QFRA 2AHOA 2EIKH 3HGGA 4Z4ZA 4CSWA 1Z21A 2V5IA 4CICA 1W35A 4WZLA 2XAJA 4RB3C 3LYCA 5A8AA 2R9VA 2FE3A 2IS4A 2K27A 3T8TA 3WYAA 3OPOA 3DCFA 4UZEA 4B3XA 1H0MA 3I58A 3ELKA 4CHUA 2VBWA 3OZVA 3HOZJ 1KD1D 4YAOA 5A89A 2DMNA 1H80A 2QMUA 2PEXA 1MDMA 2RGVA 3SZTA 3GQ8A 2FRHA 2ZO4A 2VFQA 1KA8A 5M5XJ 1GR1A 4BNCA 2GWRA 4WXHA 3RKWA 1U2RA 1EE6A 3ZPNA 4E6KG 1IN6A 1F60A 4P9UA 3SQNA 1E3ZA 1ETQA 3F3XA 5JLXA 4CCNA 1IC8A 2CC2A 3MHPA 3ZMZA 4HNTA 5DCMB 1E2XA 4KIFA 1G7SA 3E0JB 3ISXA 3OE7A 4M4SA 2V79A 2DERA 5F0FA 3SQVA 2CQKA 3OIQA 1JRGA 5A2QZ 1HA8A 2V7WA 2JN9A 1ON2A 3VDXA 1WFXA 4MXNA 3L2WA 3FPKA 3RIQA 2HDNB 1EH6A 3DBRB 1JA1A 2BM5A 1R23A 4L9JA 3H0DA 1ZYRF 2XV4S 4L9VA 3TKYA 3BJAA 1TWAJ 1EFRA 4ZZLA 2X6OA 5IY5H 3I5UA 3W2WA 4FWTA 4H0EA 3A1YA 4D7NA 2KKOA 2EILH 3SHFA 2DA4A 2HPMA 3OEEA 2JUGA 3FKIJ 4C2LA 2JPBA 2QENA 1JJ6C 3BR6A 1VQ9I 3WG9A 4YDTA 4PZJA 2Z2SB 3FHZA 1KTVA 1K6YA 1T6ZA 1WOPA 4HF1A 1AMOA 1FJLA 3QYEA 3GTKJ 4KUMA 1K28D 1IN5A 4DOZA 3BNWA 5HDNA 4BH9A 3FM3A 1OGJA 2YSRA 2TDXA 3O2PE 3RCOA 3V42A 4A3MJ 3WGGA 1HOMA 2JMWA 1S7OA 5FGMA 3OEHA 2DFIA 1E43A 2NTBA 1QA6A 3CMAI 3GFLA 1OGMX 1SFKA 2LOOA 2P8TA 3IP4B 3LMMA 1P2FA 3WTWC 1RMGA 2IQ7A 2K7LA 4MHGA 4AU7A 5DS9A 1V0FA 1V5EA 2M0MA 3EQLF 1RR8C 3H9QA 5C44J 4M2LA 2W24A 2WV0A 1DU6A 3PIOF 4X6AJ 3VNUA 1XTAA 4IHTA 4CCMA 1W34A 3AG3H 2DFFA 1E1QA 3DV8A 1BW5A 1TWCJ 3MZYA 2EA4A 1IG7A 2NV4A 4QPOA 4OP7A 4LBZA 2WA0A 3ZBUA 4UUSA 1DDNA 2JA5J 3L7WA 3MKLA 1B8IA 1MSEC 2PX9A 1MBFA 3ABKH 4C3IJ 3WTSC 3I59B 2LH9A 3A8KA 4OPOA 3SEQA 4Z4VA 2R7OA 1ZAOA 2DFEA 2CYYA 3O6BB 1SD5A 4C3JJ 4CCKA 2VNIA 1VQNB 5FLXZ 1VQLB 3WTVC 2HOSA 1F36A 1OISA 3Q39A 4G94A 1T0FC 3E6MA 4L18B 5KVRA 1WSRA 1W0UA 3GO5A 3ZXSA 4IOAF 5ED4A 3J81k 4FX0A 3OAAA 1F5TA 4OINF 4E7IA 2QE7A 2XKPA 2XT4A 4IHWA 5J1UA 3SFIA 1MH3A 4K2EA 5E17F 2XF5A 3B6CA 1K8FA 3HSEA 3HIFA 1FNNA 1IF1A 2BM6A 2L01A 3LA7A 1WPCA 5JVGF 1BLIA 4YAFA 2PN6A 2O04A 1F4KA 1BN5A 1VQKB 4UUTA 2DA2A 5HLIA 1KTWA 5D4RA 3RPUA 3MD2A 1XS9A 2V1DA 2EV6A 1MH4A 3ERMA 4BEHA 1J09A 3SZGA 1U8BA 1QVGB 3LFUA 1G3WA 2M45A 3Q3SA 1VQ5B 2ESHA 1MW7A 3E97A 3CRZA 1TQPA 1FIPA 2CMPA 4UY8I 1GT0C 3I9V2 4RLQA 4U7DA 4P6VF 3L1PA 4E7HA 4II3A 2DI3A 3FXKA 4IPAA 3S3MA 2LBFA 3PENA 3KEYA 1GAWA 1KRHA 3U9GA 1QRCA 2LFBA 3ZP5A 3ABMH 5D5VB 4AIKA 3CC4B 5J8FA 2K9NA 5FKKA 1SC7A 3FIWA 1BI3A 4OIQF 1BI2A 2JA8J 3C18A 2MFZA 4A0XA 3TO7A 4TSFA 2NSTA 4ASUA 2X53S 1U78A 1XGMA 3K1MA 3ZBTA 4RGXA 1GXPA 1KCDA 1DDIA 1BM9A 1M90D 2C2WA 4YHBA 3BH6B 1YJ9B 1NH3A 2XC1A 4OIRF 1XCBA 1DGWY 1PJRA 2WAQN 5J8CA 3ZZTA 1OQYA 2VBXA 1FX0A 2R7WA 2E1BA 1JUPA 2IA1A 3HM5A 3W6JB 1R71A 3FPPA 5C4XJ 3BY2A 2AHQA 2QYUA 3JRBA 2NZMA 2AQFA 2BVLA 5HS8A 4HLXA 4B3AA 3M8JA 3CXCB 2V1NA 4P3IA 4G5GA 3RPUD 2RC6A 1N0UA 4LC0A 2QBYB 2IGOA 1LDDA 5DV5A 3ZQFA 3I64A 4D0PA 5EGOA 3QFTA 1MMAA 3TH0A 2D9RA 4Y7CA 3LSJA 2R5ZA 1KC8D 1V54H 4YFOA 1LEAA 3ZMVA 3KE2A 4Q7JB 3BR2A 1E1RA 3DWLE 3S17J 3F6OA 4L5EA 2VNJA 2CUZA 3GLXA 4EW9A 2IVMA 4OOVA 3IH3A 2Y0SA 5EZHA 4ENMA 1WQ2A 4IXAA 1ELOA 3LSTA 2FOWA 3R61A 2DU9A 2ZTGA 2XGXA 2XVCA 3Q0VA 4KISA 5IP6A 5M3FJ 6PAXA 1JT6A 2YWEA 1FDRA 4ESFA 2ZKZA 4JX5A 2HCJB 4B3FX 4KN4X 2EFPA 4OJOA 3DKXA 4G1VA 2AXLA 4DNCA 1LLZA 2YR2A 3K1NA 4AUXA 5F6FA 3L9FA 4YC5A 5HLGA 2DW4A 1H9TA 1F20A 1UJ8A 1SFXA 2R5YA 1FLIA 4RM2A 1ZELA 4OPVA 1H88C 4Z4SA 1W5CC 2YU3A 4A2UA 3WNBA 2D1HA 4K1XA 1E0EA 1UMKA 2YX7A 1UG2A 5D4SA 3REOA 1WI9A 3W2IA 1VQKI 3SJZA 5IP7J 2DT5A 3ASOH 5L3DA 5JR3A 1OFMA 3CZ6A 2GIVA 1FBQA 3JCUC 2VPLA 1KK3A 2DOFA 3JSPA 4EJUA 2DT7B 1H89C 2RC5A 3HDDA 1EH8A 4XKCA 5BPDA 2PLYA 3TW6A 1UFMA 1WH7A 5F1JA 3P9IA 4P22A 4RD2A 1FRNA 2V4JC 1V0EA 4MYUA 1BC8C 4MNUA 2W4SA 2VFPA 1ZLKA 4YZAA 1T95A 3VMVA 4BQOA 5B5EC 2OTJI 3SY2A 2X0KA 1AHDP 3C2HA 4XLFA 4FE7A 2GM4A 3QFSA 2L3DA 1FRQA 4KKTA 3GFIA 2O17A 2J5OA 1MDMB 2L02A 2JJ7A 4M6YA 2IA0A 3CC2B 2H6BA 4HX4A 2RDPA 3B73A 3G05A 5HNHA 1BN8A 3LFKA 4TKOB 1RU4A 1FMVA 4OPWA 3MMYB 2PG4A 3W2VA 2BMWA 3FY3A 1YRNA 2A05A 1TBXA 4GYIA 1N77A 4JP0A 1NBMA 2MH2A 2FNAA 4PC3A 4MTDA 3I4MJ 4DNTB 1TVCA 3WE2A 4Z06A 4LBWA 1X3WB 1AIPA 1ZK8A 2ZZGA 2OK8A 2VBEA 4U9UA 3DU6A 4IEJA 3VSKA 3AG1H 4EVIA 5E8GA 3WHCA 3P9CA 3K10A 3M8EA 4IX7A 1IRXA 1QGPA 2JVGA 1XMKA 2DPUA 4RM0A 3CD6B 3H5NA 3UW0A 2O8XA 4RM3A 1LPQA 3R6JA 3ZRGA 2ELHA 3OJWA 4EM1A 3E7LA 4Y52J 4GO1A 1O88A 3OR1C 2QQAA 4QWQA 4BKXA 3L09A 3GYHX 2CV2A 1QUEA 3QPTA 4RD6A 1YITB 1QBJA 1IJEA 4M71A 2J7KA 3QPLA 3N97A 5TISC 1XCVA 2FBHA 1JTAA 4IKFA 2Z16A 2BW3A 3BLYA 4B3GA 1O8GA 2Z99A 4B8XA 1P4MA 1O8KA 4DQKA 1VQ4B 2JJ2A 5AIQA 2B9SA 1GUUA 1MJAA 4M3GA 3PM1A 3RQ4A 3K70D 3JRHA 3TMOA 3GTLJ 5FLXK 4IHSA 2A6TA 2VOPA 2INVA 1UD3A 2HWVA 1IDYA 3H3UA 2K9MA 4Q4ZF 3BY6A 1O7FA 4HF2A 2C6YA 2PMDA 4IJAA 1CNFA 1KYWA 3IHUA 5CYVA 3C2GA 1A31A 4Y4RA 2W00A 5J4YA 1U5TC 4CGZA 2VUMJ 1FNMA 3V8KA 2OK7A 4LMYA 3TL4X 3GVLA 1KMHA 5EMNA 3E1YE 5AN9A 3DXJF 1IN8A 4UUSB 2CRVA 5ICCA 1H8AC 4XD7A 5KK1A 1D8TA 2KMUA 1B8IB 3I1FA 1XDUA 1OR7C 1T5EA 1TUIA 4RD1A 4HRIA 3LMWA 2YS9A 3R60A 4RA2A 2R93J 1W36C 2R4GA 1FMWA 1VFCA 4M9ZA 2VNKA 4RDLA 3TGNA 1GO2A 2BF4A 3O8HA 2ELKA 1EXMA 2QGGA 3JSOA 5D8LB 1PXZA 3E5XA 3FF5A 4CXFA 1PJ7A 1D8JA 4UV8A 2VE9A 3S1NJ 5HZAA 2D74A 2VFOA 4WXDA 4PJNA 4W8TA 3F72A 3KCCA 3PVDA 4NQWA 3BH7B 2ZFUA 3W2GA 3DTIA 2P5LC 3I55I 5L3CA 2QTZA 3ONQA 4P96A 3F23A 1RKTA 4ZGNB 2BM7A 1TTYA 2WZNA 1K78A 2V1UA 2DBBA 1BIAA 3KIOA 1CGPA 2BSPA 4KJZA 1OCOH 1TW3A 3VSUA 1HC8A 3MKWB 3B4NA 1Y8RB 4N4NB 2CQQA 5IYCJ 3QYFA 1UD8A 2W6JA 3MWMA 1PKVA 2ZBVA 1K6OA 4IOCF 1BL0A 1TLLA 3AK5A 4ZYHA 4BL0B 3CC2I 4RDJA 3CUQA 5L46A 4RMNA 3P9KA 1G8XA 3TDUC 4BEHB 1R5GA 3PNYA 2M5WA 4A69C 2ZJQF 2CV0A 2V6EA 3B78A 4I2OA 2QWWA 5J6XA 5JBQA 1L1IA 3FBNB 3S2WA 4OWRB 1D8KA 2DA6A 4N9IA 2KVOA 2CK3A 4NK6A 3BZ6A 4XLNF 2X1EA 2L54A 3KLOA 3JRFA 2DEUA 1CQXA 2V7XA 3ASPA 4X7FA 1DABA 4CYCA 4WXCA 2LBFB 4G7OF 1T8IA 3NQOA 2BM0A 4DYCA 3ASNH 4U88A 1SMYF 2L9VA 3ZQLA 1NK2P 2ECBA 5K7HA 3CCEB 2UZKA 2X6WA 3X2QH 4DNRB 2FX3A 2WBMA 1N75A 4A3CJ 2NTQA 1W2BB 2BX6A 2ELJA 2F6CA 1QJVA 1DPRA 2EFGA 3F8NA 4GFBA 1LDKB 5H20A 2Q2EB 3OS1A 3HZJA 2VLAA 3M1CA 2DN0A 2HXIA 2BSAA 1IDJA 3U21A 2VASA 1X58A 2XAQA 2XAGA 3G1MA 4M74A 1JHFA 1KU3A 4IHVA 5E1XA 1E3XA 1BBYA 1HW1A 1Y0RA 3PA2A 3U6KA 4RGRA 2F4NA 4C2MJ 4UAJA 3RDIA 4NUBA 3N4MA 3BC9A 2DTZA 3IV5A 4YALA 1MJ9A 5CVUA 3RKQA 3ZMSA 3KYLA 1ZLJA 1GVJA 1GVDA 2Y75A 3QQAA 4X0GA 3HG9A 2K9QA 3H9NA 1S3JA 4EJVA 5EGOB 1NTCA 2F4IA 2Q6IA 2WZPP 1Z3XA 2MH9A 4AD9A 5HLTA 2P81A 2B0RA 4OOIA 4HE6A 2CW0F 3T53B 2R5ZB 2CBXA 4P6YA 1TYWA 3H3VK 4OJ6A 3CJRB 2V9PA 3EUHA 1E3OC 3BZKA 4DZJA 3OOCA 2IA2A 5LHIA 2HFHA 1FYLA 5DM6F 3I3LA 5F64A 3GQAA 3QOPA 4C43A 4DW6A 2EIMH 1OB2A 4EM0B 4BE2A 2GK6A 3QSYA 2X3HA 2Y2ZA 4ASNA 4LIUA 4HSRA 3A3BA 3VSVA 2JRTA 1XSDA 1QGYA 4B44A 4YFXF 2K4JA 2L7ZA 1L0OC 2RKHA 3LQEA 3CUOA 4CA0A 1QGAA 4BQNA 2NYXA 2QKMB 3HRTA 3V8JA 1FP1D 2P4WA 5L3FA 3QFCA 2GA1A 3KP3A 4Z6YA 5LHHA 1REPC 1R5BA 3AG4H 3OW2B 2QCOA 3MVPA 1XGSA 5EEGA 3CCVI 1ZG3A 1LKXA 4YZ0A 2EWEA 2B7EA 3M8FA 3KEWA 2EV5A 5IYWA 2X9DA 1XG2A 5KNLA 3J7ZI 1X1PA 5J35A 2R5YB 2P7CB 1Y0NA 3CCRI 2IT0A 3NWTA 3CMYA 2V4DA 2FMYA 4P2NA 4PJMA 4FISA 3LAJA 3T9GA 2AO9A 3GTOJ 2K9SA 3WXMA 3CCMB 3MN2A 1OFDA 5FFZA 2L9SA 5C3EJ 2QF7A 1B4AA 3M3YJ 4RJLA 5IYRA 1MABA 1HQCA 3HUGA 3LSMA 4A5MA 4Y7NJ 1XPXA 1MSFC 1ENHA 2XPWA 4XSZF 1ZM3A 4BUPA 2CG4A 3LSIA 4EMSA 3DEEA 4U0VA 2MD5A 2LSOA 3D0SA 5E18F 1NHAA 2IRFG 1WH5A 2JZYA 4P9SA 1IHMA 3C2BA 1VI0A 5LMZA 4RGSA 4AYBN 1JKPC 3JREA 3ERED 2R7VA 2Y0MA 5E3LA 1SKQA 4HV6A 4V2GA 2IOUG 4MEYF 2OZUA 3IWZA 3W5HA 3QPSA 2CUEA 3TO9A 1LVAA 2LKXA 1FNDA 1N0VC 2ETHA 3CMMA 2NOGA 3FZVA 2ZITA 1FSEA 4ZV4A 2A07F 1N08A 2ZJ2A 5GAEJ 3LJYA 2CW8A 1HSJA 5K1YA 1MMDA 2LKPA 1S7AA 2XNCA 1JJ2B 2E2HJ 3OV8A 4EJWA 1X4PA 2WV1A 3S93A 5L3BA 1D3YA 3MZ8A 2LZJA 1WJ5A 2DETA 1GJRA 3H09A 1YFHA 4ITVA 2MC4A 4CZZA 5DD4A 1YTYA 1YRNB 3ZOBA 2ME0A 5K7FA 1WU8A 3A8JA 2DMQA 1AKHA 2R3SA 5LEKA 3GFMA 1T6SA 4Y33A 1RI7A 4OPSA 3QYBA 4HAMA 5F27A 3CO6C 5KSWB 4P12A 1Y56A 4PABA 1OCPA 4XLEA 4HDVA 3BT9A 1G3TA 2FBIA 1T0FA 3DBLB 4BDZA 1OB0A 1JA0A 2XEXA 1I1GA 3CLQA 3P27A 1S5LC 1MBJA 3K4BA 5DS0A 1R5HA 2P5KA 2PE3A 5H6RA 3J81Z 2VI6A 2QXZA 1HSTA 1VQ6I 1JHHA 4QPQA 5GADJ 2P6TA 2JIZA 5IPAA 1EFUA 3N90A 2QSFX 2QEXB 1ITYA 2VKHA 3TOBA 5J3LA 2GXGA 2LK2A 3RIRA 5LGNA 3BWGA 3SDBA 1WVRA 3HJEA 3ZQGA 1J9IA 1DPUA 2IPQX 2W48A 4E7SA 2LF7A 3W2EA 3BTJA 1G7TA 5LHGA 4G7WA 1D0ZA 4HQEA 3FBIB 1FNBA 2BW3B 4JQFA 5F0CA 5EDNA 4Z4UA 1K7AA 2GOMA 1SKYB 2XTXA 1ETOA 2TRTA 1LLWA 2W85A 4JBAA 2MSYA 4YZXA 3R0AA 1YJNB 3WTYC 4BJTA 2G9WA 2QM3A 1N8RD 3BG9A 2MW8A 1ZKGA 4PJJA 2HMAA 3VYTB 4NHJA 2OU2A 4S04A 2P7VB 1OKRA 2W1OA 1E3PA 1ZGAA 3R6KA 3RJPA 4F55A 4PC1A 4A12A 2QY1A 2PI0A 1B9MA 2JSPA 3EYYA 4XORA 3G4SB 3JX8A 1FT9A 2LDUA 4CYDA 4L5IA 5J1YA 4ACAA 2E5ZA 2XNDA 3CCJB 1L3LA 2HZDA 1OCTC 1ZG5A 5ICEA 3CCUI 1RR7A 2H6CA 3ZQHA 2MD0A 4U0WA 4A3KJ 1BI1A 2OZ6A 2VN2A 2BGJA 2F1LA 2STWA 3ZQQA 3BG6A 1D1BA 2QKLB 2EFNA 4JX6A 4LLLA 5ICFA 5IYQA 4KICA 3M7GA 4OAZA 1J5YA 2BEOA 2A6HF 2F4OB 5IOZA 1G3YA 2BM4A 2EA2A 4JK1X 2Q0OA 3HTUA
chains in the Genus database with same CATH topology
3UR3C 2HDWA 2XC7A 4YXWA 4CCOA 1E79A 3H9JA 3OYMA 5CQEA 4E0FA 1QHGA 2L7KA 3EUHC 3OYKA 4XLAA 4E7LA 2DIEA 2A5WA 2MFZA 3H5RA 2Z8GA 2KL4A 3H35A 4TSFA 2NSTA 4ASUA 2X53S 5IK2A 4BE0A 2L5QA 1KCDA 3E1SA 4NQWB 2IXSA 5CKTA 3N05A 1DGWY 1PJRA 1FX0A 2R7WA 2WADA 3A4CA 2E1BA 2AQEA 2UWMA 4HIZA 3LSKA 3FPPA 3GVKA 4OZZA 2DCEA 1ERDA 2HVQA 1MNDA 3HC7A 1TT0A 1WJEA 2AQFA 2BVLA 2CUJA 2X51A 5FRMA 2NZMA 1R6RA 3M8JA 2V1NA 3RPUD 4E4HA 2IGOA 4F92B 4I84A 2UVEA 1MMAA 4P5OA 4JOMA 4W8RA 3HPHA 1DQUA 1H8HA 3K4MA 1O8IA 4AYBA 1IB4A 3H5AA 1E1RA 3DWLE 4XLHA 2CUZA 3K4CA 1QCXA 1S9HA 4EW9A 2XDVA 2Y0SA 2HQAA 5C1EA 2PJRB 2M4GA 3OYBA 3AFHA 3A2KA 4FETA 2ZTGA 4BXFA 1OLTA 4R79A 5CPRB 4KISA 5LD2C 4CCLA 4URRA 4CUGA 2X85A 2VJIA 3BC8A 4B3FX 2XZOA 2VL8A 2V7QA 3OYDA 2UUZA 2OV7A 3DKXA 4OJOA 4HWVA 4GRIA 4OJ5A 4PK4A 3D5RC 3WQZA 2KPMA 1VZ0A 2M7AA 4DBQA 3ZPPA 4B43A 3LNNA 1KONA 3DQVC 4DIQA 4BS9A 2DJIA 3OMYA 1X1AA 4U49A 4BE1A 5TGTA 1N78A 4J01A 1UD4A 2XZLA 3L2QA 2I8DA 2KRHA 4RM2A 1ZELA 4XR6A 4ANJA 3OIPA 2LRDA 3SYTA 4BDYA 2Z1DA 4LG3A 4E7KA 2O0VA 3TBIA 2WY8Q 1E0EA 3DKYA 4PSXA 1Z3YA 2E1MB 3LSGA 2DOAA 2GJPA 2WY7Q 2VBMA 3D5SC 3OYJA 2UVFA 2JA2A 4BJ5C 3PL8A 1OFMA 3CZ6A 2LY1A 2VJ4A 2VPLA 4JMQA 3EUAA 2DT7B 4Z03A 4XKCA 1D0YA 4KKUA 1VJSA 4P22A 2V4JC 4HSTA 1V0EA 2K3PA 1MNEA 2W4SA 4D9JA 4YZAA 3VMVA 1T95A 4BQOA 3HXLA 2XAUA 2ZZEA 1AIRA 1PLUA 2NTPA 1YX5A 3C2HA 4XLFA 3VYRB 2NOJB 4FXUA 3KX2A 4KKTA 3OYAA 2O17A 3GQ9A 2HPIA 1UD2A 2PECA 4OJPA 4ZDOA 2XF6A 3QODA 2WPDA 4W8QA 4NK8A 3G05A 5HNHA 1BN8A 1AA7A 1UAAA 4TKOB 1RU4A 4E7ZA 1FMVA 3ZR8X 3SUCA 3MMYB 4IQJA 3W2VA 3AL0B 3FY3A 3GBGA 1N77A 1NBMA 1GLNA 2VJJA 3W2AA 1DP3A 1X0CA 4G6IA 4N4OB 4XKBA 4DNTB 3K70C 4Z06A 4FASD 4XQFA 4MR0A 2ZZGA 2VBEA 4DJAA 4DK0A 2XSJC 3DU6A 2LG4A 2HNHA 3VSKA 2X6YA 4C2TA 1EA3A 3H94A 4XKVA 3K10A 4IX7A 1IRXA 2JVGA 3IUOA 3OYIA 1G59A 1UD8A 3B8YA 3HUGB 3H5NA 3UW0A 4RM3A 3CJQB 3S3OA 2L2OA 4XN3A 3ZRGA 2ZZFA 1D1AA 3OYGA 4AVZA 3L2RA 1O88A 2WB1A 3OR1C 3EUKL 2CV2A 2WJVA 1UD6A 2R7XA 2O5RA 3PNVA 1UG0A 4YELA 2KLOA 2R7UA 3VWBA 1JTAA 4IKFA 2Z16A 2BW3A 3BLYA 2R7TA 1HZEA 3VYSB 4B3GA 2UV1A 2X6XA 4BJ6C 4XM3A 1O8JA 1O8GA 1O8KA 1MMGA 1RWRA 1WJCA 2JDIA 4II2A 2JJ2A 4YEJA 3RQ4A 1BOBA 1W0KA 3K70D 1BR4A 2M3AA 3TMOA 2WJYA 3PSFA 3BCBA 1X1DA 1Z7LA 2ZTNA 2V26A 3NWSA 2A6TA 2CFOA 2PMZA 1Y6IA 1UD3A 4KITB 4F93B 1IDKA 2INVA 4DBRA 4ZJZA 2VQCA 3FDYA 1PYVA 4B47A 2F5VA 1CZFA 2K9MA 2LY2A 2KRCA 4F52A 1PE9A 1O8FA 2ZSIB 2CW7A 3OL4A 3K6GA 2NT9A 3OYLA 3C2GA 4Y4RA 2W00A 2R7QA 5FROA 3GVLA 3OR2C 2VXZA 3RTRA 3TL4X 4UZUA 1KMHA 3A3GA 1VF7A 4XD7A 2INUA 4OJLA 2KMUA 1OGOX 4OZYA 2KHMA 1OR7C 1T5EA 4HRIA 3T56B 2LC2A 3LMWA 3DLAA 3SEZA 1W36C 2R4GA 2CV1A 1NRKA 1FMWA 3OYHA 4BACA 2XF7A 4ZC3A 3EQNA 2VQLA 2JJ1A 2X1DA 3J7AY 3CP2A 1D1CA 4XKWA 2OC6A 1LFPA 3EPZA 3GRHA 3VSLA 1PXZA 3DPLC 3OOUA 3FKJA 1KCCA 3VYUB 4PJLA 4LIVA 1BHEA 4PJNA 2HU9A 1O8MA 4W8TA 4XNFA 2ZFUA 2KDOA 3OWTA 3DTIA 2WSSA 3AKZA 1OOCA 3ONQA 3K4KA 1X19A 2VJ5A 1BPLA 4XONA 2DXIA 3G2BA 4PMHA 1OHHA 4KJZA 2BSPA 3VSUA 3RSNA 3MKWB 5HKKA 3B4NA 2Q1ZB 4N4NB 1VBLA 3QYFA 3OYNA 2W6JA 3PSIA 2MYSA 2BVMA 3OS0A 2XZPA 2VBKA 4G7XA 2E5NA 3OL3A 4BL0B 3HPGA 4RMNA 4BEHB 1G8XA 1W36D 2L9NA 3PNYA 2BOLA 2V6EA 2CV0A 4U4BA 2W82A 1VLYA 3FBNB 4OWRB 2ODLA 1HVXA 2KVOA 2CK3A 5LFAA 3GQ7A 4NK6A 4IZZA 2IS6A 4ZYAA 2X1EA 4E7JA 4C2UA 2KZVA 4ZDPA 2V9KA 2LBFB 4HEA2 4DK1A 2WAFA 1O8HA 2CS3A 4EATA 1WJBA 1NG7A 2M4KA 2KP6A 2PJRA 5HOOA 3PNTA 2CH0A 3K4NA 2X6WA 4D1QA 4BQQA 4DNRB 1UD5A 2WBMA 1N75A 4B48A 2NTQA 3JURA 3VSTA 3DPUA 2ELJA 2F6CA 1QJVA 2ZZQA 2GOXB 3OYEA 1LDKB 4TT3A 2E60A 2IGMA 2Q2EB 3QOEA 3OS1A 2VLAA 2HLDA 3ZIAA 3M1CA 2LYCA 3VMWA 3S3NA 4KT6A 1IDJA 3U21A 2VASA 3UNGC 5KHDA 2RREA 1MMNA 1E3XA 2JVHA 1NG6A 2RQQA 3S8PA 1O8EA 1OFLA 1KZLA 4YRVA 4H4KC 1DGRM 4NUBA 2PYGA 2O0WA 3BC9A 3GQBA 2X8KA 3F9KA 1TZLA 3OFNA 3KYLA 2QX3A 3L2VA 4X0GA 2VKDA 3HG9A 3BH4A 2VIXA 2F4IA 4U87A 5HVQC 2WZPP 1Z3XA 4L8JA 1X1CA 5HLTA 1LVKA 2K9LA 3ZCOA 2GJRA 2NT6A 3BCDA 3ZSCA 3T51B 3T53B 1H8EA 2ZXIA 3OYCA 4OJ6A 3CJRB 4HNUA 4CSWA 1Z21A 2K5CA 4PFOA 5FRNA 3OOCA 3DTEA 3I3LA 2R9VA 3MKYB 2IS4A 3GQAA 4RLFA 5DN6A 3OPOA 2OUMA 4BE2A 3S32A 4B3XA 2GK6A 4ZTJA 2E1MC 2WAQA 3HAGA 1O8LA 2X3HA 4LIUA 4HSRA 4BGDA 3A3BA 3EQOA 3VSVA 1P9QC 4B44A 4NNJA 1H80A 2X1CA 5FL7A 3FHNA 2VQGA 1WJDA 3NE5B 3OS2A 4C9YA 3ZGKA 4CA0A 3GQ8A 4BQNA 1IA5A 4BU2A 1NHCA 2QKMB 5HNFA 1EE6A 5AMVA 3ZPNA 4E6KG 1E3ZA 2RNGA 4CCNA 4NC7A 4HNTA 4U7BA 2F43A 1LKXA 4YZ0A 3E0JB 3BCFA 1I8DA 3KEWA 3OE7A 2EWEA 1XG2A 5KNLA 3OIQA 4Y3OA 3BCAA 1JRGA 4XOPA 1HA8A 1YX3A 4OAYA 4C30A 3VDXA 1WFXA 3MKZA 2R7SA 4MXNA 3L2WA 3H9GA 3NWTA 1O8DA 3B90A 2V4DA 4PJMA 3DDYA 3T9GA 1W0JA 3H0DA 3JU4A 2VXDA 2L9SA 2HVSA 1EFRA 4YZQA 1MABA 4F3QA 3AL0C 1WJAA 3LSMA 3W2WA 4F91B 5KCMA 3CP8A 1DBGA 3A1YA 3W3CA 3PFYA 3LSIA 2IGNA 1SAUA 3DEEA 4BUPA 2HPMA 5C1CA 3OEEA 2FUG2 2JUGA 4C2LA 2HVRA 4Z1MA 3IAS2 1BR1A 3DPTA 2KQRA 2R7VA 4HPQA 2IGKA 2W6IA 4PUSA 2Z2SB 2DT6A 2PYHA 1K6YA 2XGJA 1U0JA 1K28D 3QYEA 1PKVA 4DOZA 3CMMA 1V5FA 3RCOA 3V42A 3OEHA 1YE9A 1COWA 1E43A 2NTBA 2CW8A 1MMDA 1OGMX 1DBOA 3PJRA 1SFKA 2LOOA 3IP4B 1X4PA 3LMMA 1RMGA 1WP6A 3S93A 2IQ7A 2LZJA 4AU7A 1WJ5A 2WAEA 1V0FA 1V5EA 2M0MA 2XOKA 1QHHD 3H9QA 4ITVA 3PUBA 2IS1A 3DTKA 2MC4A 2ZXHA 4IQ4A 2VQHA 1I18A 4Y33A 4CCMA 3QYBA 3HOSA 1E1QA 4P1WA 4HG2A 1W9XA 1Y56A 4MLOA 4XLEA 1D0XA 2W7NA 4QPOA 4XMYA 3HOTA 4BDZA 1OB0A 1WTHD 3HL2A 2WA0A 1BMFA 1BR2A 2O1DA 3BG7A 3IAM2 3K4BA 2MABA 3LSHA 3DU5A 1QU3A 3GVJA 4ZTFA 2QXZA 3OY9A 2LH9A 4QPQA 1X4OA 3SEQA 3HKZA 2JIZA 3CF2A 2R7OA 3OW7A 3WWGA 4CCKA 2GJKA 2VKHA 3FKSA 3SDBA 2V7FA 4Z05A 1T0FC 4E7SA 4DGWB 1WMRA 4G7WA 5JHFA 2F1MA 1D0ZA 3D5LA 3FBIB 4XOTA 2NSPA 1V5GA 2BW3B 4JQFA 3ZXSA 3OAAA 2GOMA 1JI8A 1SKYB 1X1BA 2Z6BD 3A35A 1K5CA 4E7IA 2QE7A 2V31A 4YZXA 4KKSA 2GK7A 2R7RA 2IS2A 2M7BA 4BJTA 4PJJA 2M5SA 2ZSHB 2XF5A 3VYTB 3KRGA 4XN0A 4W8SA 2P0WA 2W1OA 3LL7A 4LITA 1WPCA 4F55A 1BLIA 2QY1A 2JSPA 4XORA 2O04A 4XL9A 1HG8A 1KTWA 3K4LA 4XLCA 2E5ZA 3MD2A 2XNDA 4GQNA 4BEHA 2HZDA 2VB6A 3L2UA 1J09A 3SZGA 4CCJA 3LFUA 4G6TB 4PFPA 4ZDLA 4CZCA 2MD0A 1MW7A 5CDFA 5CQGA 2D3NA 1UELB 3ZQQA 2CMPA 3BG6A 1D1BA 2QKLB 3I9V2 2LREA 4RLQA 3CESA 4NC8A 4OAZA 3K4JA 4E7HA 4II3A 3VR6A 1GQ8A 4CH7A 3S3MA 1WJFA 2D3LA 2LBFA 4PSWA 3KEYA 3OYFA 4J00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O17 A;  3GQ9 A;  1VBL A;  2PEC A;  3T9G A;  4OJP A;  4YZQ A;  2VBK A;  4XLA A;  4W8Q A;  1DBG A;  4NK8 A;  2Z8G A;  4U4B A;  2NST A;  1BN8 A;  5C1C A;  1RU4 A;  2ODL A;  3SUC A;  4C2L A;  3FY3 A;  1KCD A;  3GQ7 A;  4NK6 A;  2VJJ A;  2PYH A;  1X0C A;  4Z06 A;  4XQF A;  4MR0 A;  4OZZ A;  2VBE A;  1O8H A;  2NTB A;  2X6Y A;  2NZM A;  4XKV A;  1OGM X;  1DBO A;  3B8Y A;  1RMG A;  2X6W A;  2IQ7 A;  3UW0 A;  4XN3 A;  4I84 A;  2NTQ A;  3JUR A;  3VST A;  4AVZ A;  1O88 A;  2UVE A;  1QJV A;  4W8R A;  3VMW A;  4YEL A;  1IDJ A;  1O8I A;  1IB4 A;  1JTA A;  1O8J A;  1O8G A;  4XLE A;  4XLH A;  2X6X A;  4XM3 A;  1QCX A;  4XMY A;  1O8K A;  1O8E A;  1OFL A;  1RWR A;  4EW9 A;  4YEJ A;  2O1D A;  2PYG A;  2O0W A;  5C1E A;  2QXZ A;  2QX3 A;  2INV A;  1IDK A;  4URR A;  3WWG A;  2X85 A;  1CZF A;  2VJI A;  2NT6 A;  1PE9 A;  1O8F A;  3ZSC A;  4OJO A;  2NT9 A;  4HWV A;  4Z05 A;  4OJ5 A;  4OJ6 A;  1WMR A;  3ZPP A;  2NSP A;  4XOT A;  1K5C A;  3GQA A;  4YZX A;  2INU A;  4U49 A;  4OJL A;  1O8L A;  1OGO X;  2X3H A;  4OZY A;  4XR6 A;  3KRG A;  3EQO A;  3LMW A;  3VSV A;  2O0V A;  4XN0 A;  4W8S A;  1H80 A;  2QY1 A;  3GQ8 A;  4XOR A;  2O04 A;  3EQN A;  4XL9 A;  1IA5 A;  1NHC A;  1HG8 A;  4XKW A;  2VBM A;  1KTW A;  1EE6 A;  4XLC A;  5AMV A;  3GRH A;  1PXZ A;  2UVF A;  1OFM A;  1KCC A;  1BHE A;  4YZ0 A;  1O8M A;  4W8T A;  2EWE A;  4Z03 A;  4XNF A;  1XG2 A;  1OOC A;  1JRG A;  4XOP A;  4YZA A;  3VMV A;  1GQ8 A;  1AIR A;  4MXN A;  4XON A;  2NTP A;  1PLU A;  4PMH A;  4XLF A;  2BSP A;  1O8D A;  3B90 A;  3VSU A;  3B4N A; 
#chains in the Genus database with same CATH topology
 4NDL A;  4YXW A;  4CCO A;  5GAH J;  3V7S A;  5EZG A;  2ZME C;  5CQE A;  4E0F A;  1S8N A;  2WB1 N;  1X3Z B;  3EUH C;  3DP7 A;  4XLP F;  2DIE A;  3S1Q J;  1QVT A;  2A5W A;  2KL4 A;  4IF4 A;  2DOG A;  1WXR A;  1PVE A;  1S7E A;  1XQB A;  5IK2 A;  5FD6 A;  3BG3 A;  2L5Q A;  4NQW B;  1QRB A;  1W1W E;  2IXS A;  5CKT A;  1W0T A;  1F9N A;  1IV6 A;  4M53 A;  1NDH A;  4BY7 J;  4MYT A;  1ETX A;  3HOY J;  1K78 B;  1P7J A;  3TO6 A;  3B6A A;  4OZZ A;  2L0K A;  1RUO A;  3GVK A;  1WCM J;  1SM4 A;  3LQ6 A;  5IYN A;  3HC7 A;  4X05 A;  2E1R A;  1R6R A;  4YIF A;  1AU7 A;  4MFD A;  3JAM K;  1EZG A;  3CUQ B;  3ZQI A;  2VT2 A;  3I4N J;  3BPV A;  4I84 A;  1XB4 A;  4R8H A;  3GTP J;  1QVF B;  2H09 A;  2UVE A;  4P5O A;  5DD8 A;  4RB2 C;  2XTW A;  2N8G A;  3HPH A;  1GXQ A;  1GDT A;  3A8I A;  3W6K B;  3ASQ A;  1Z9C A;  2F2E A;  3H5A A;  3AGQ A;  4CYC B;  3NB2 A;  1QCX A;  2YUH A;  2E35 A;  1S9H A;  3RI4 A;  2X4H A;  2XDV A;  1WI3 A;  2COB A;  1YIJ I;  2OPT A;  3GWZ A;  5C1E A;  4UZF A;  5E3N A;  3JTG A;  2DYI A;  1UHW A;  5B1A H;  3A2K A;  4M1K A;  4FET A;  5DTD A;  4BXF A;  2Y9Y A;  4CDG A;  2HQR A;  3QP6 A;  4CCL A;  2NVX J;  1XB2 A;  4HE5 A;  2GXB A;  3V76 A;  3CME I;  1H42 A;  2QEX I;  9ANT A;  2VL8 A;  2XZO A;  1UHM A;  2BHZ A;  2QUF A;  4KH3 A;  3NAW A;  5D8K B;  4LB5 A;  4HWV A;  5KW9 A;  3P4G A;  4OJ5 A;  4PK4 A;  1R49 A;  2KPM A;  1VND A;  4N0B A;  2K3F A;  2DK8 A;  2C5B A;  3B8H A;  4RB0 A;  4G9Y A;  1OJL A;  1Q1H A;  2L7M P;  1EP3 B;  3WU0 A;  4L0Y B;  5BOX A;  4U49 A;  4I09 A;  1N78 A;  1I3A A;  3FM5 A;  4J01 A;  1YJN I;  4PC7 A;  3VB2 A;  2JQ7 A;  2GAU A;  3Q0W A;  5ILV A;  1ODD A;  2E71 A;  2HKX A;  2OCE A;  2DYS H;  1FOY A;  2WY8 Q;  4TMW A;  4PSX A;  1Z3Y A;  4I02 A;  2EIX A;  4HNV A;  1XDS A;  2DOA A;  3OOP A;  1VQP I;  3D5S C;  1YIO A;  1OFE A;  3OYJ A;  2OTL B;  3SZE A;  1P4W A;  3LSR A;  4W1U A;  2DA1 A;  2DCU A;  1SFU A;  1ONV A;  3EUA A;  1W87 A;  4KKU A;  3B02 A;  1K4T A;  1TWF J;  3HSR A;  4HST A;  1MNE A;  2PLF A;  4YIR X;  1JXS A;  1IJF A;  2NTP A;  4ENN A;  1E3H A;  2NOJ B;  4FXU A;  3K2Z A;  1PP7 U;  1S6L A;  4I01 A;  3PUM A;  3G6E B;  2HPI A;  1UD2 A;  3BY1 A;  3CF5 F;  2PEC A;  4D5C A;  4OJP A;  5LLQ A;  3L00 A;  2H27 A;  4R71 A;  4KDP A;  3QOD A;  1VTN C;  2WPD A;  3AGP A;  4W8Q A;  4ZH4 F;  1R4M B;  2V7V A;  4RBO A;  1UAA A;  4E7Z A;  5GTH C;  5JLW A;  1YS7 A;  4X7E A;  3SUC A;  5D5X B;  3A01 A;  4PGG A;  3GBG A;  2C5H A;  1VQ8 B;  1XMX A;  2LTP A;  3W2A A;  1QH0 A;  5B6I A;  5FO5 A;  3V7R A;  3VMF A;  1KQS B;  4G6I A;  4Z4T A;  1LJ9 A;  1K79 A;  4DJA A;  2F5F A;  2XGD A;  1NB9 A;  5DUI A;  3L2C A;  2LG4 A;  3H94 A;  1ON1 A;  4XKV A;  3IUO A;  4AVP A;  2NXN B;  1GV5 A;  1B9N A;  3C7J A;  2A61 A;  3HUG B;  4MIM A;  1YS6 A;  3QAH A;  3CJQ B;  5HOD A;  4XN3 A;  2WWY A;  1H9G A;  4IRI A;  3GTG J;  1D1A A;  1HKQ A;  2ZZF A;  1WOS A;  2QVO A;  3WTX C;  3ZMU A;  3B82 A;  1UD6 A;  3AVT A;  4EQQ A;  2C77 A;  2A69 F;  4KT5 C;  3TDZ C;  3HYI A;  4NCN A;  2OBR A;  4LOC A;  1KJZ A;  2BPO A;  2B5O A;  5HS7 A;  4A3G J;  1O8J A;  4ABZ A;  2UV1 A;  4BJ6 C;  1QZE A;  4MO7 A;  5F4O A;  1YHQ B;  1MMG A;  3ZPL A;  3J81 K;  3S15 J;  3AVY A;  1U5T A;  1B23 P;  2M3A A;  1JUS A;  2PBI A;  1Z7L A;  4Q5S F;  5HDK A;  2PMZ A;  2MG4 A;  1IDK A;  2VBZ A;  4KIT B;  4P9F A;  2XNJ A;  2Y69 H;  4ZJZ A;  1OR7 A;  4B47 A;  3GTJ J;  2EFQ A;  1A36 A;  2KRC A;  4M9S A;  1RPW A;  2TCT A;  2CW7 A;  3OL4 A;  3WG7 H;  2NT9 A;  5FO1 A;  5EJC A;  1AKH B;  1I3Q J;  1U2W A;  2A5Y B;  1ZH5 A;  4S0H B;  3RTR A;  2DQR A;  2O3F A;  2DMP A;  4UZU A;  3A3G A;  3BJO A;  1VF7 A;  2BY1 A;  3GTM J;  4OJL A;  5E20 A;  1OGO X;  3V7A A;  1GAQ A;  3T56 B;  3C1D A;  3DLA A;  1Y8Q B;  3LWF A;  1NRK A;  1A6Q A;  3AAF A;  4BAC A;  2QZ8 A;  1UMQ A;  4XRF A;  3CP2 A;  4XKW A;  2BN4 A;  1LFP A;  1VQN I;  1QQ1 A;  3GRH A;  3VSL A;  3DPL C;  3VOD A;  2EZH A;  3DKW A;  3FKJ A;  1VQL I;  2VON A;  3VYU B;  5KAI C;  4PJL A;  4X1E A;  1PJ5 A;  2EB7 A;  2D45 A;  3CW2 A;  1BHE A;  4A3D J;  4OMY A;  2PJP A;  2K40 A;  4XIC A;  2IEK A;  2Y0S N;  5FA6 A;  3K4K A;  1I1S A;  1KU7 A;  2DXI A;  3N6Z A;  5M5Y J;  5HZB A;  3AVX A;  2K85 A;  2CSO A;  3RSN A;  4ACB A;  2Q1Z B;  2QQ9 A;  4OM9 A;  2O7O A;  1AOY A;  3OS0 A;  2MYS A;  2BVM A;  1KU9 A;  1WSV A;  1YLO A;  2O6W A;  1QA3 A;  3FMR A;  1W36 D;  3Q5F A;  2BOL A;  3M4O J;  3VO1 A;  2B63 J;  2M30 A;  2W82 A;  2GPJ A;  4U4B A;  1VLY A;  1JE8 A;  1A04 A;  5BNG A;  3RYP A;  1OCZ H;  1Q86 D;  1N25 A;  1VQ5 I;  4WZK A;  5FIU A;  3GQ7 A;  3TP0 A;  5A2Q K;  3ABU A;  1K83 J;  4ZYA A;  1VQ8 I;  3JR9 A;  1FOW A;  2M87 A;  4E7J A;  1FC3 A;  5JMC B;  3ULQ B;  3SLN A;  3RKX A;  2HOE A;  5C4J J;  1T38 A;  4Y9R A;  2A3S A;  2JTV A;  3MZH A;  1V4R A;  1WJB A;  3BG5 A;  5FB2 A;  2M4K A;  2M1B A;  1RC9 A;  2PJR A;  2OBP A;  1YI2 B;  2HTJ A;  4CQJ A;  2DPD A;  1SVO A;  1UD5 A;  3H36 A;  3CC4 I;  3JUR A;  3VST A;  1SD4 A;  4P1V A;  4OMZ A;  2MLK A;  1EH7 A;  1R5I D;  3QE2 A;  3GME A;  2LYC A;  3F8F A;  2F5C A;  3ZQ7 A;  5LEJ A;  1I5Z A;  1BJA A;  4HF0 A;  2X48 A;  1YJ9 I;  1MBK A;  1VF9 A;  1IAW A;  3JRA A;  2RQQ A;  1O8E A;  3G71 B;  1DGR M;  2PYG A;  3E5Q A;  1ZHF A;  2KIQ A;  2X8K A;  2VBK A;  4A3J J;  1LEB A;  3OFN A;  3KEQ A;  1D2E A;  2BXY A;  3NEU A;  2VKD A;  2O8K A;  4UNO A;  2CW5 A;  3BH4 A;  4LGW A;  4F7D A;  4RCY A;  5K7Z A;  1Z67 A;  2DOE A;  1GHC A;  3KZZ A;  2KIS A;  4X8I A;  4EGY A;  5JI6 A;  2K9L A;  1IB0 A;  3ECO A;  3BCD A;  3ZSC A;  1ZAR A;  2YWF A;  3FMS A;  2NVT J;  3PSZ A;  3S16 J;  2XRL A;  2BM1 A;  1WHU A;  4HNU A;  5FRN A;  4PFO A;  2K5C A;  1LNW A;  2HYJ A;  2RC4 A;  1HXD A;  3DTE A;  1V3F A;  4I0A A;  5EYR A;  2COM A;  5LBQ A;  1MMS A;  3O8G A;  2CQX A;  4XRS A;  4BBS J;  3BTI A;  2YPR A;  4RLF A;  5DN6 A;  3OJX A;  3IWF A;  2QTL A;  1O8L A;  2E1M C;  3UKG A;  5D6E A;  3HAG A;  5THX A;  1P9Q C;  4ESJ A;  2R7F A;  5TV2 A;  3MFK A;  2JUC A;  4LB6 B;  4FN5 A;  3ZN1 A;  4RB1 A;  3FHN A;  4KA4 A;  2VQG A;  1TYU A;  2KT0 A;  1QQI A;  1WJD A;  5TJJ A;  2F5E A;  3OS2 A;  3ZGK A;  3COA C;  2HEO A;  5K5Q A;  2C4T A;  2H8W A;  1VHE A;  4DYQ A;  1WKM A;  2FD5 A;  1HW5 A;  2RNG A;  4XBF A;  3VOE A;  5DEQ A;  4BQA A;  5H59 A;  4NC7 A;  2F43 A;  3R4K A;  3BCF A;  5LRR A;  2F3L A;  4Y3O A;  1W7P A;  3SYJ A;  4G1B A;  3MKZ A;  2R7S A;  3K1P A;  3G1O A;  2J8I A;  2EH3 A;  3H9G A;  3CDH A;  1O8D A;  3B90 A;  2B7C A;  3HOV J;  1DDG A;  2RAE A;  3MCA A;  2P5V A;  2VXD A;  4YZQ A;  3HRU A;  1QZZ A;  3GX4 X;  3AL0 C;  1WJA A;  3TOA A;  3V4G A;  5KCM A;  4F91 B;  4AC9 A;  3W3C A;  3PFY A;  1SAU A;  1KK0 A;  3WTZ A;  5C1C A;  2FUG 2;  4Q48 A;  5IOY A;  2HVR A;  4Z1M A;  1YG2 A;  4HPQ A;  2IGK A;  4M6X A;  2W6I A;  2PYH A;  1QO0 D;  4M72 A;  2PFB A;  1U0J A;  1IUY A;  1YX2 A;  2Q8K A;  2GZW A;  1A6I A;  3BPX A;  5ILU A;  3JRC A;  4A3L J;  3ECH A;  2JT1 A;  1V5F A;  2ZB9 A;  2ISZ A;  1R36 A;  1YE9 A;  5ERI A;  5JFR A;  3SJP A;  3A0B C;  1TQM A;  2ICW G;  2EZI A;  3FXL A;  2Z9O A;  1WP6 A;  1UHS A;  2WAE A;  3Q0U A;  1J75 A;  3A0H C;  1QHH D;  2Q6K A;  3IC7 A;  3PUB A;  5GP9 A;  3CPW B;  3DTK A;  3A01 B;  3ML3 A;  1B1B A;  1YLF A;  2CQ7 A;  2DO7 A;  3P7N A;  2VQH A;  4AF6 A;  1FOK A;  1TNS A;  1ETY A;  1W7P D;  4XRM A;  1QRY A;  2HTS A;  4C3H J;  4YFK F;  4P1W A;  1I39 A;  4HG2 A;  4BHB A;  4MLO A;  1D0X A;  2W7N A;  1S72 B;  4XMY A;  1WTH D;  5AIP A;  3I71 A;  3HL2 A;  3G73 A;  1BMF A;  3PUN A;  5EEH A;  1BR2 A;  2O1D A;  2LLK A;  2MAB A;  3LSH A;  3JRD A;  3DU5 A;  1QU3 A;  3GVJ A;  2DA5 A;  3F8B A;  2E7X A;  2FVG A;  3OY9 A;  4HZF A;  3WGH A;  1X4O A;  2I5U A;  3WTT C;  3HKZ A;  5FKL A;  3CD6 I;  3OW7 A;  4YAW A;  1APL C;  2OF7 A;  4UHT A;  2DYR H;  2FU4 A;  2GJK A;  2ZC2 A;  4QTR A;  2ZCW A;  2R92 J;  3EDP A;  2V7F A;  4QSH A;  1JGS A;  4ETS A;  4Z05 A;  4D7M A;  4HX8 A;  5JHF A;  3WNC A;  3D5L A;  1YIT I;  5E3M A;  2NSP A;  1V5G A;  1RRJ A;  1HW2 A;  3A35 A;  2DK5 A;  1K5C A;  2UXX A;  3J7Y J;  3ES9 A;  4A3F J;  4J0Q A;  4KKS A;  3RY8 A;  3CCQ B;  1BW6 A;  1U5T B;  1TLH B;  4MFE A;  4BHC A;  2Z3Y A;  3QPH A;  1VQ4 I;  2XHK A;  2ZSH B;  3KRG A;  3HOW J;  2XSD C;  1FNC A;  3CCS B;  4PC2 A;  3S2D J;  2KZG A;  2P0W A;  3LL7 A;  4LIT A;  5AON A;  3MMP A;  1Y0Y A;  4XL9 A;  1SEU A;  3VO2 A;  1HG8 A;  1QPM A;  3KYC B;  1G7R A;  3K4L A;  4XLC A;  2MLG A;  3L2U A;  1OCR H;  3I56 B;  1P6R A;  4CZC A;  3LVB A;  2ZME A;  5CQG A;  1BC7 C;  1R5O A;  4RAY A;  1UEL B;  5F08 A;  4TMX A;  3GZN B;  4PDK A;  3CES A;  5BQT A;  4UVA A;  1HDD C;  2BVN A;  5CJ9 A;  5E8I A;  2DFH A;  3VR6 A;  4M3D A;  4O5V A;  1ZQ3 P;  3BTC A;  3QP5 A;  1IGN A;  2BXZ A;  4CH7 A;  1ZRD A;  1GQ8 A;  2VFN A;  1I27 A;  1T6Y A;  4YAU A;  5FKM A;  3OYF A;  2LKS A;  2QA4 B;  1KZH A;  3UR3 C;  2HDW A;  3FXO A;  4IRH A;  3V8L A;  1SFE A;  2XC7 A;  4IHY A;  1T08 B;  2XGE A;  3CC7 B;  2L7K A;  2HKO A;  4WWV A;  4E7L A;  2BY0 A;  1X3U A;  4OIP F;  2EV0 A;  3HB9 A;  2EIN H;  1VQM B;  2YUS A;  1Y1W J;  4X06 A;  3E1S A;  3PQJ A;  2ZJP F;  4A93 J;  3ZC3 A;  2V6C A;  2CFX A;  1T33 A;  3MQ0 A;  3N05 A;  3S2H J;  1ZUN B;  3RYR A;  4V02 C;  2QSG X;  4RLZ A;  2WAD A;  4HIZ A;  2AQE A;  3ZN0 A;  3LSK A;  1UST A;  2DCE A;  4RPD A;  3F8M A;  2HQN A;  2ZNZ A;  1A5J A;  1TT0 A;  1WJE A;  2X51 A;  5FRM A;  4MQV A;  1WSU A;  2E1O A;  2DAO A;  2VPR A;  5JHU A;  4WZE A;  3D1N I;  2HXO A;  1Y0U A;  2FXA A;  1MGT A;  2QYO A;  4RGU A;  1IO2 A;  3KYD B;  2NRA C;  3GIR A;  4IO9 F;  4BXX J;  2VKE A;  1DQU A;  1WGX A;  4M3E A;  4WF2 A;  1N06 A;  2DY1 A;  2VKV A;  3CLO A;  1O8I A;  4AYB A;  1PDN C;  1IB4 A;  1EWY A;  1P92 A;  1FZP B;  3K4C A;  1ZM9 A;  2CND A;  2G7U A;  3U2R A;  1HF0 A;  3HGY A;  2M0C A;  3GTQ J;  2QDX A;  2HQA A;  2PJR B;  2BV6 A;  2BY3 A;  2M8E A;  1STZ A;  3QU3 A;  2M4G A;  3OYB A;  2O9L A;  3AFH A;  4LBY A;  1I7P A;  4QHY A;  2K86 A;  1OLT A;  1TTT A;  2GIZ A;  5CPR B;  5LD2 C;  3CCE I;  4CUG A;  2GLO A;  2X85 A;  2ZJR F;  3BC8 A;  2V7Q A;  4EJO A;  3JRI A;  3OYD A;  2UUZ A;  1OB5 A;  4G6Q A;  1E17 A;  4AWX B;  3WQZ A;  1VZ0 A;  4DBQ A;  4YG2 F;  2QQ8 A;  4B43 A;  4RDU A;  3BQJ A;  3LNN A;  1KON A;  2DA7 A;  3OIO A;  1IXS B;  3CB4 A;  3CCL B;  3DQV C;  2LNB A;  2ESN A;  3OMY A;  4BE1 A;  5TGT A;  2XZL A;  2LP0 A;  3DEW A;  3CCQ I;  1BA5 A;  3L2Q A;  2I8D A;  2P3M A;  3QWL A;  4XR6 A;  3WBJ A;  3OIP A;  4G12 A;  1S4M A;  2HYF A;  1OYI A;  2XUB A;  2IP2 A;  4JYK A;  2DMT A;  2XRN A;  3RQI A;  2EFW A;  4BDY A;  4E7K A;  1ORK A;  3CCS I;  3OZU A;  3TBI A;  5CVI A;  4GCV A;  3DKY A;  4L0Z B;  3LSG A;  1LUJ B;  2GJP A;  1HDP A;  2MA3 A;  1ZR4 A;  1DU0 A;  2ISY A;  2Z5U A;  5DDG A;  2NVQ J;  2JA2 A;  4BJ5 C;  3NAR A;  3PL8 A;  1ZM2 A;  2GRE A;  1Z7U A;  1IXC A;  1VQ9 B;  4PJ0 C;  2LY1 A;  2VJ4 A;  4JMQ A;  4WQM A;  1GV2 A;  5CVR A;  1J2X A;  4Z03 A;  1XGO A;  4M73 A;  3GSI A;  2JPC A;  1VJS A;  3JQQ A;  3GLL A;  4QVJ A;  3LO8 A;  2FQ4 A;  3FXR A;  5FLV A;  4IW3 B;  1QA1 A;  3I53 A;  4D9J A;  1ULY A;  1GVH A;  3GZ6 A;  3HXL A;  1U3E M;  1NB0 A;  2ZZE A;  1AIR A;  1YX5 A;  5E79 C;  5E6T A;  3CMA B;  3LQQ A;  3GW2 A;  2QA4 I;  1XSV A;  3GQ9 A;  2E2J J;  1SVL A;  1W4M A;  4PGH A;  1Z0X A;  1F1Z A;  3K69 A;  4ZDO A;  1DG1 G;  3CC7 I;  1P4A A;  4NK8 A;  2Y30 A;  4NC6 A;  1BX0 A;  2YWG A;  1AA7 A;  4IL6 C;  1XD7 A;  1Z91 A;  2OAZ A;  3ZR8 X;  3DLL F;  1K73 D;  4IQJ A;  1VQM I;  1I50 J;  2ZXJ A;  1U9O A;  2V1X A;  1EF4 A;  2VJJ A;  3KP5 A;  1X0C A;  1W7P B;  1DUX C;  4N4O B;  3HRS A;  1WOR A;  3T8R A;  4FAS D;  4XQF A;  4MR0 A;  4F7Z A;  3VPR A;  4DK0 A;  3JQR A;  5HLH A;  4C2T A;  4HW0 A;  2HNH A;  1ZG1 A;  2X6Y A;  1EA3 A;  1FPQ A;  4EJT A;  2BBY A;  1R00 A;  1R7J A;  2JRM A;  1IUF A;  4WWC A;  4L9T A;  5E1W A;  3LA2 A;  4HLY A;  1G59 A;  1D5Y A;  3KLN A;  2WR8 A;  3AVV A;  4XK4 A;  3S3O A;  1OPC A;  2OYN A;  3WTU C;  1Z6T A;  2JA7 J;  4AVZ A;  3L2R A;  2WB1 A;  2KFD A;  5BS6 A;  3CDL A;  3Q38 A;  1ZGJ A;  3H1C A;  4KMF A;  3Q9V A;  3ONU A;  1EFC A;  2R7X A;  3PNV A;  4Z2Y A;  2BGI A;  1OYW A;  2HOA A;  1R9T J;  5HS9 A;  2KLO A;  3VWB A;  1EA0 A;  5F1R A;  3ZMT A;  2CJJ A;  1HZE A;  1MD0 A;  4TMZ A;  2X6X A;  4ZYG A;  4KIG A;  4U0Y A;  1WJC A;  1SMT A;  1TSP A;  4P55 A;  3WU1 B;  1W0K A;  1BR4 A;  2KRF A;  3KZY A;  2WJY A;  4GDF A;  4WX9 A;  2L9R A;  1RKW A;  2V26 A;  3NWS A;  1BJK A;  1FOX A;  3WBK A;  4F93 B;  4Y17 A;  4FX4 A;  3H0G J;  1CZF A;  1Z6R A;  4ON0 A;  2F5V A;  3SZP A;  3SXY A;  2LY2 A;  4MEX F;  2H8R A;  2VBV A;  1O8F A;  1JTY A;  2ZSI B;  1I6X A;  3K6G A;  4IVN A;  2VE8 A;  2CO5 A;  3E6B A;  1P7I A;  1OFC X;  2R7Q A;  5FRO A;  4XID A;  3P26 A;  2FBK A;  3HHH A;  2FNP A;  3IH4 A;  2VXZ A;  5E3O A;  4BAY A;  4ROX A;  3CCL I;  4RAG A;  5JVT A;  2R7Z J;  2KHM A;  2Z33 A;  2CV1 A;  1IW7 F;  2RVC A;  4M9X A;  5CVV A;  4GGG A;  4ZC3 A;  1B72 A;  1W5T A;  3EQN A;  2VQL A;  2X1D A;  3J7A Y;  2XIG A;  2OC6 A;  3EPZ A;  2VYQ A;  3JRG A;  5GPC A;  1KCC A;  4FHT A;  2QLZ A;  2DMU A;  2E1C A;  2XAF A;  3LQR A;  4LLN A;  3TP3 A;  2E36 A;  3LAP A;  3EET A;  3S1M J;  2VZL A;  5FKN A;  1O8M A;  3AVU A;  3CQZ J;  4XNF A;  2G0E A;  3GXO A;  3AKZ A;  2C78 A;  3K9T A;  1CQT A;  2D1V A;  1O7L A;  3AVW A;  3HTS B;  4XON A;  4PMH A;  3G2B A;  3KP2 A;  3PUF A;  1USS A;  1MRZ A;  1OHH A;  2LY9 A;  1SVM A;  2MC3 A;  2NS0 A;  3CCY A;  2E34 A;  5HKK A;  3S1R J;  2VC0 A;  2PIA A;  3OYN A;  2CUF A;  2E5N A;  4MQ9 F;  4M0L A;  3BR0 A;  1HBX G;  1ACI A;  2L9N A;  4ZZD A;  1J9Z A;  3G4S I;  3SJM A;  3FXQ A;  2M2E A;  1WWX A;  4BPR A;  2ZME B;  3CCJ I;  5H6Q A;  2AS5 F;  1LB2 A;  1FSH A;  3U2Q A;  3K7A J;  3TED A;  2UXN A;  2CU7 A;  1J0R A;  2ID6 A;  5J3O A;  2HDD A;  1W5S A;  2K4B A;  2P6S A;  4ZYE A;  2KZV A;  4GXO A;  4AM3 A;  3U1D A;  1M1K D;  2KDZ A;  4ZCL A;  1PP8 F;  2V9V A;  1O3R A;  2R6H A;  5BSY A;  1XX5 A;  4DK1 A;  2CS3 A;  4TV7 A;  4EAT A;  2IJL A;  3ASS A;  2ZL6 A;  1YO5 C;  1NG7 A;  2KIU A;  3DEU A;  3AG2 H;  4DQ2 A;  2BE5 F;  2IW5 A;  3K4N A;  3PNT A;  3CCM I;  1AWC A;  3C3W A;  2NS8 A;  1EJ9 A;  2M34 A;  5K5O A;  1QZY A;  5TR9 A;  3RZD J;  4Y9U A;  1FY7 A;  4MGR A;  3WGI A;  4YFN F;  1UCR A;  3OYE A;  4TT3 A;  1X2N A;  1XC5 A;  2E60 A;  2IGM A;  2G7H A;  3HBL A;  3QOE A;  5ICG A;  4QV2 A;  2HDC A;  3S3N A;  4KT6 A;  3VMW A;  3ABL H;  3UNG C;  1OCC H;  1R58 A;  5J40 A;  5J47 A;  2RRE A;  1FTT A;  2Q6L A;  2NNN A;  4BHP A;  2JVH A;  3S8P A;  1OFL A;  1KZL A;  2ZBU A;  5A88 A;  1YJW B;  3GQB A;  3F9K A;  3JTH A;  1ETK A;  1TZL A;  3E6D A;  5B1B H;  1VQ7 B;  3L2V A;  3KEO A;  1JGG A;  2FX0 A;  5HVQ C;  5K5R A;  4L8J A;  3M1E A;  4LLG F;  2GJR A;  3ZCO A;  2NT6 A;  2KJB A;  2BHY A;  5FNZ A;  5LGU A;  1QVU A;  3T51 B;  1U9N A;  4IRG A;  1K61 A;  3VNV A;  2ZXI A;  3BZC A;  4HBL A;  3OYC A;  1SD7 A;  3DF8 A;  2Y9Z A;  4P25 A;  3E3V A;  2FML A;  3FMQ A;  5F0H A;  5BSX A;  1SFO J;  2DQL A;  3ASR A;  1Q81 D;  2NAZ A;  1S0U A;  5D5W B;  2GBY A;  4Y15 A;  3MKY B;  5BPI A;  1RQR A;  2L4A A;  2OTJ B;  1Q7Y D;  3BR1 A;  2OUM A;  5GPA A;  3A02 A;  3S32 A;  3J7A O;  4ZTJ A;  2WAQ A;  4N9H A;  3J80 Z;  3E5U A;  2O6G E;  4BGD A;  4DZP A;  1K4Z A;  3PA1 A;  3RKY A;  1O3Q A;  1XFO A;  3ZZU A;  2VFM A;  3EQO A;  3SDG A;  4NNJ A;  3KET A;  3IRR A;  2X1C A;  1B2R A;  4RD4 A;  4TN1 A;  5FL7 A;  1TYV A;  3NE5 B;  4C9Y A;  1NHC A;  1IA5 A;  3JW4 A;  1XG1 A;  4BU2 A;  5HNF A;  1IZ1 A;  2OJE D;  2EFO A;  3Q6R A;  5IT9 Z;  5AMV A;  2YX4 A;  1EFT A;  1U8R A;  2IAI A;  3KL9 A;  2L7F P;  2I1L A;  4JX4 A;  2PQ8 A;  3LSP A;  2Q2E A;  2E19 A;  3OSF A;  4U7B A;  2LMD A;  3IL2 A;  3SKB A;  4RS8 A;  1I8D A;  3QU6 A;  1LE8 A;  1V5V A;  3BCA A;  3GEZ A;  3KFW X;  4XOP A;  1YX3 A;  4OAY A;  4C30 A;  1XN7 A;  2D2W A;  4LG0 A;  2PMZ N;  3DDY A;  5EF6 A;  1W0J A;  3JU4 A;  1PUF A;  4EGZ A;  2HVS A;  4V19 K;  4X7D A;  4L9N A;  2OQG A;  4F3Q A;  2AXT C;  4DQL A;  1VQO B;  3CP8 A;  1DBG A;  1TT5 B;  2VBY A;  3T5X A;  1ZN2 A;  2IGN A;  4H9G A;  2OTL I;  1KYZ A;  1YW7 A;  4UV9 A;  2MGQ A;  4KFC A;  2PMH A;  2EZL A;  2ZBK A;  1BR1 A;  2DLL A;  2KQR A;  3DPT A;  3FK7 A;  3IAS 2;  4LD5 A;  4PUS A;  4XRS G;  5KAF C;  2DT6 A;  2XGJ A;  4EV0 A;  4A3E J;  5JLV C;  4B4C A;  4HOB A;  4UXN A;  1O4X A;  3G3Z A;  3FX3 A;  3GZ5 A;  1COW A;  1OGI A;  1TWG J;  4UB8 C;  1LDJ A;  4YII A;  1K9M D;  3PJR A;  1G3S A;  1JB9 A;  3G6E I;  1DBO A;  3PSS A;  4M3F A;  1LQ1 A;  4P3Y A;  1YW8 A;  2HS5 A;  1JKO C;  2J8K A;  2EK5 A;  5DM7 F;  4ENK A;  2XOK A;  4J19 A;  2IS1 A;  5M3M J;  1QFY A;  1T56 A;  2ZXH A;  4IQ4 A;  1T39 A;  1D5V A;  2MBF A;  1QFZ A;  2M9H A;  3VEP A;  1G4D A;  1I18 A;  4QLC U;  4E70 A;  3RPQ A;  3HOS A;  3GF2 A;  2EJR A;  2HZT A;  5HDG A;  1HCR A;  1FX7 A;  2VOD A;  1W9X A;  3SFZ A;  2DJN A;  2JSC A;  3HOT A;  5B66 C;  3S14 J;  4G6D A;  2H1L A;  1J59 A;  1FP2 A;  2RV8 A;  4UVB A;  2DTR A;  1YJW I;  3BG7 A;  3BQY A;  1RZ4 A;  3IAM 2;  4O3M A;  3CPX A;  1MBH A;  1N05 A;  1DAR A;  4ZTF A;  1Z1D A;  2BZT A;  1VQ7 I;  1FBU A;  1ZGW A;  1JJ8 C;  2QSH X;  4RPB A;  4WZT A;  3CF2 A;  4DYR A;  3WWG A;  1FWZ A;  2FSW A;  2L4M A;  3BQZ A;  3CDI A;  4X0C A;  1V55 H;  3T1B A;  5HXB A;  3T0Y A;  3BDD A;  2ZFW A;  4M3B A;  3FKS A;  4JRA C;  1SD6 A;  4AIH A;  4BXU A;  4DGW B;  2NS7 A;  3BOQ A;  2HOT A;  1SAX A;  1WMR A;  2F1M A;  4RD0 A;  3FWE A;  4XOT A;  2LD5 A;  3I55 B;  4L5J A;  2JK3 A;  3MAJ A;  2K02 A;  1X1B A;  4UVC A;  5L3E A;  1JI8 A;  5IYB J;  2V31 A;  4FT8 A;  2Z6B D;  3ZZ0 A;  5J1R A;  2OA4 A;  4UUV A;  2BGC A;  1VHO A;  2R7R A;  4NBQ A;  2M7B A;  3HSF A;  4HA8 A;  1YHQ I;  2IS2 A;  4RAF A;  2GK7 A;  2JN6 A;  2M5S A;  1CF7 A;  3WY9 A;  3RZO J;  4AF7 A;  4XN0 A;  2O03 A;  4KYW A;  4W8S A;  1R1U A;  1A35 A;  1RES A;  2FA5 A;  3F8C A;  4S05 A;  3KP4 A;  3PIP F;  1HLV A;  3DBH B;  3KP7 A;  3HOX J;  1Q1V A;  5GTI C;  4GQN A;  4A0Y A;  3U1K A;  2NNY A;  2VB6 A;  4CCJ A;  4G6T B;  4PFP A;  4ZDL A;  3BR5 A;  3PO2 J;  3H3Z A;  5CDF A;  1QA2 A;  1IRF A;  1Q9S A;  2RN7 A;  4A5N A;  2D3N A;  1R1T A;  1Z77 A;  4O6J A;  2E7W A;  1XMA A;  4EM2 A;  1T98 A;  5EG0 A;  2LRE A;  3CJT B;  1R1V A;  4AID A;  4NC8 A;  2W57 A;  4N3G A;  3K4J A;  3ZMD A;  1RET A;  2FJ1 A;  1JNY A;  1NK3 P;  4A3B J;  4I6Z A;  2D3L A;  4X7C A;  1WJF A;  2EWN A;  4PSW A;  5J4V A;  2VNH A;  4X07 A;  4B1R A;  4J00 A;  2XTY A;  2I10 A;  4FTH A;  3FIS A;  1B72 B;  1YQA A;  1IN4 A;  3H9J A;  3ML6 A;  1JKQ C;  3OYM A;  1TW2 A;  1E79 A;  3GVA A;  1G7C A;  1QHG A;  2HR3 A;  2XAH A;  1NJI D;  3DU1 X;  3OYK A;  4XLA A;  1KGS A;  1VQO I;  3H5R A;  1QFJ A;  2KJC A;  2QGU A;  2Z8G A;  1J7K A;  1IN7 A;  3H35 A;  4AIJ A;  4OIO F;  1F43 A;  1FTZ A;  1QUF A;  1G6N A;  4BBR J;  4I7H A;  4W97 A;  4BE0 A;  3ONY A;  1QNT A;  2HQ5 A;  2ZL7 A;  5EEA A;  2VC1 A;  2LVS A;  3MCZ A;  4G7Z F;  2A6E F;  2QQB A;  3A4C A;  3PFI A;  5D6F A;  3F21 A;  2UWM A;  1ERD A;  2PMU A;  2HVQ A;  1MND A;  4B4D A;  2CUJ A;  3AST A;  2EQR A;  1CNE A;  1ZR2 A;  1C0W A;  1ETV A;  1O3S A;  5CVJ A;  3ROU A;  3KPH A;  1XGN A;  1ZM4 A;  3SLD A;  4E4H A;  2VT3 A;  4LFU A;  4F92 B;  4BY1 J;  3R6S A;  1G2H A;  3W5U A;  1LFB A;  1RUN A;  3LNQ A;  4JOM A;  3ZUG A;  4W8R A;  2XAS A;  4HX7 A;  5M5W J;  3K4M A;  1KU2 A;  3NRV A;  1JT0 A;  3PO3 J;  1H8H A;  5ILS A;  4CO8 A;  2ZXW H;  4B09 A;  3M9A A;  3E6C C;  1JKR C;  3E20 A;  4XLH A;  3IRQ A;  4ESB A;  1B59 A;  2NPF A;  5E1Z B;  4TMT A;  3A03 A;  3QRF F;  2O0Y A;  5BMZ A;  3WHB A;  1IJW C;  3HEF A;  3F0C A;  1QPI A;  1HA3 A;  4NB5 A;  4R79 A;  3A1P A;  1YI2 I;  4URR A;  1VLO A;  3W2F A;  3F6V A;  2ECC A;  2VJI A;  5TRD A;  2VOO A;  1KK2 A;  2R7D A;  4I76 A;  3CCV B;  1IXR C;  2OV7 A;  2CF4 A;  5CLS A;  2FEZ A;  4V2F A;  4GRI A;  4FCY A;  3OSG A;  2CGP A;  3D5R C;  2CRG A;  5DNS A;  2M7A A;  3I54 A;  4PCQ A;  3ZPP A;  1S29 A;  1KQ8 A;  4YEI A;  2FOK A;  5DCM A;  3J80 K;  4DIQ A;  4BS9 A;  2OCC H;  2DJI A;  3HRM A;  5IT3 A;  2VBS A;  3CCR B;  1X1A A;  1TYX A;  2W7Z A;  1UD4 A;  2KRH A;  4ANJ A;  3G71 I;  4QUZ A;  2LRD A;  3OZW A;  3SYT A;  1T2K A;  2Z1D A;  4LG3 A;  2O0V A;  1BX1 A;  5H2F C;  5IT9 K;  3FK6 A;  5H5J A;  2E1M B;  2W84 A;  3BTL A;  2WY7 Q;  2VBM A;  3GUD A;  5DCF A;  3GFJ A;  1MBE A;  2UVF A;  1JUM A;  4KN7 X;  1O57 A;  3IH2 A;  4FE4 A;  1KQ0 A;  3GCM A;  2KIF A;  2G0Y A;  1D0Y A;  1Y1V J;  5LGT A;  1I6H J;  1M1E B;  4XSX F;  1B6A A;  2ID3 A;  1LM1 A;  2K3P A;  1Y39 A;  3O3K A;  1IRG A;  1WRJ A;  2XKO A;  2XAU A;  4AC0 A;  5FO0 A;  5B3S H;  4EH1 A;  1PLU A;  2M8G X;  3VYR B;  1QGZ A;  2D5V A;  2RNJ A;  2E2I J;  2V7T A;  4G7H F;  3KX2 A;  3HKZ N;  1IRZ A;  3OYA A;  4M6V A;  4BYY A;  4RAZ A;  1KQ9 A;  2ACJ A;  2XF6 A;  3SEJ A;  1BIB A;  4A0Z A;  1O3T A;  3WE3 A;  1MBG A;  3JAM Z;  2RQP A;  4EEF G;  2QN6 A;  3CJN A;  3PET A;  3WU2 C;  1D1N A;  4A3I J;  3AL0 B;  1FIA A;  2XGC A;  1LE8 B;  1UZC A;  1GLN A;  2VBU A;  1TP4 A;  1ZRE A;  2F5D A;  1DP3 A;  4HYE A;  4XKB A;  3K70 C;  4I0B A;  2OQR A;  1TQI A;  2Y48 A;  4LG0 B;  4KNY A;  4I99 C;  2XSJ C;  3V7C A;  2BV3 A;  3IKV A;  3OKX A;  2XT2 A;  2XPU A;  1VQ6 B;  1PUF B;  4QIW N;  1IDZ A;  2Q6O A;  4Q47 A;  3OYI A;  1TNT A;  1P4X A;  3B8Y A;  2QZA A;  2GQQ A;  5D5U B;  2EZK A;  1XSX A;  3I59 A;  1UB9 A;  4IHX A;  1PUE E;  2L2O A;  1E63 A;  1KK1 A;  1R4N B;  2OBT A;  3OYG A;  2ADU A;  3BRO A;  3EUK L;  3G1L A;  2WJV A;  4G8X A;  5L3G A;  2O5R A;  2WYR A;  4QVA A;  3K0L A;  4HV5 A;  4R1H A;  1UG0 A;  4YEL A;  2R7U A;  4ZCI A;  1E62 A;  3U6B A;  5FJ8 J;  2XPV A;  1ZTR A;  4GYG A;  5DUK A;  3VYS B;  1TL8 A;  2R7T A;  1EV7 A;  4XM3 A;  1KQ5 A;  3F22 A;  1RWR A;  1T6X A;  2JDI A;  2OD5 A;  4II2 A;  4YEJ A;  2GA2 A;  3Q3A A;  1RNL A;  3BJ6 A;  1BOB A;  4I98 B;  3LOC A;  1A8P A;  3I4P A;  3FXU A;  3PSF A;  3BCB A;  1X1D A;  5FLM J;  2HYG D;  2ZTN A;  2NVU B;  1TWH J;  2XB5 A;  2CFO A;  2DA3 A;  3Q9S A;  1Y6I A;  5FKO A;  4FK8 A;  4DBR A;  1WPK A;  2VQC A;  3FDY A;  1PYV A;  4RDK A;  3CCU B;  1Z05 A;  1FBS A;  4F52 A;  1FYM A;  5DYM A;  1PE9 A;  2JWT A;  1PJ6 A;  4OOS A;  3OYL A;  2A68 F;  5TY0 A;  2LR8 A;  2CQN A;  4MTE A;  4RD3 A;  2R0Q C;  1HKT A;  3OR2 C;  1U6G A;  2Y31 A;  2W25 A;  4LK1 F;  2O61 A;  4P26 A;  3ABT A;  2INU A;  4PC6 A;  2C4U A;  1S72 I;  4A6E A;  4OZY A;  1EP1 B;  1POG A;  4KMU X;  3OP1 A;  2LC2 A;  3D26 A;  1CLW A;  5F4M A;  2KIM A;  4FQG A;  3SEZ A;  4RCZ A;  3OYH A;  2DDB A;  2XF7 A;  2YU9 J;  3NAU A;  2JJ1 A;  2V7U A;  1IV8 A;  1Q82 D;  1D1C A;  3W6V A;  1QG0 A;  1ETW A;  4UB6 C;  1XE1 A;  1LFU P;  5GV7 A;  2J5P A;  2X3U A;  5DSZ A;  2B0L A;  3OOU A;  2DDA A;  3WND A;  3FXM A;  4LIV A;  2HU9 A;  1H85 A;  5GV8 A;  3H92 A;  1SAN A;  2CWE A;  2IBD A;  2VBT A;  2WC2 A;  2WSS A;  2KDO A;  3OWT A;  1OOC A;  1R5N A;  3FJO A;  2F48 A;  1X19 A;  2VJ5 A;  2FQ3 A;  1WZ2 A;  1YOV B;  1BPL A;  1CF7 B;  1RQP A;  4OOX A;  2E1N A;  3BR3 A;  1BOA A;  2BYV E;  5IYD J;  4ZCM A;  5IP9 J;  1VBL A;  4A6D A;  3PSI A;  1K4S A;  2H1K A;  2OBS A;  2XRO A;  2XZP A;  4G7X A;  3OL3 A;  4HQM A;  2B7B A;  3CTA A;  3HPG A;  3EYI A;  2QBY A;  3I0T A;  4TMV A;  1EP2 B;  1MNM C;  3LA3 A;  1MIJ A;  2WTE A;  3W5V A;  5IYP A;  2ODL A;  2HGC A;  1R22 A;  3I56 I;  5F4J A;  1HVX A;  3MEX A;  1QX4 A;  3HHG A;  3M07 A;  5LFA A;  1MJB A;  1YW9 A;  1BJZ A;  5LRS A;  5EG0 B;  4IZZ A;  3K2A A;  2HI3 A;  2IS6 A;  2YWH A;  4LBV A;  4PGO A;  1HF2 A;  4Y13 A;  4C2U A;  1E64 A;  1BQE A;  2F4M B;  4LK0 F;  4ZDP A;  4Z4Y A;  3TQN A;  2V9K A;  3ESW B;  3Q6Q A;  4C0S A;  5FFX A;  1YIJ B;  1WOO A;  1MKM A;  1WDT A;  4HEA 2;  2WAF A;  3CUQ C;  2H94 A;  2JA6 J;  2GQF A;  1O8H A;  2KP6 A;  5HOO A;  1FYK A;  3ISP A;  2CH0 A;  1BI0 A;  1OYY A;  4D1Q A;  4BQQ A;  2ME6 A;  1DP7 P;  1JTX A;  3CME B;  3VFZ A;  4ZYD A;  2EIJ H;  4WK8 F;  4LJZ F;  2DOD A;  4B48 A;  3DPU A;  3KZI C;  2XB0 X;  4OU0 A;  1YYV A;  2ZZQ A;  2GOX B;  5GAG J;  4NBS A;  1ZRF A;  4HDU A;  3R0J A;  2HLD A;  3ZIA A;  4PAA A;  2FF4 A;  2EPF A;  1MZB A;  3HOU J;  4N3N A;  1OMI A;  3TW7 A;  3BP8 A;  1N07 A;  5FD5 A;  3W2H A;  5KHD A;  4ENJ A;  4Z4R A;  3DFG A;  1HKS A;  1MMN A;  1TC3 C;  1X2M A;  1NG6 A;  3JQP A;  2BY2 A;  2NVY J;  2ZNY A;  2GXA A;  4YRV A;  2X0L A;  3KP6 A;  4H4K C;  2O0W A;  3IKT A;  1FEX A;  2EBI A;  2QX3 A;  3CO7 C;  4KIB A;  3WOD F;  4Z4W A;  4YCQ A;  1ZRC A;  3FXJ A;  5F04 A;  1VQP B;  1EKE A;  2VIX A;  1K8A D;  4U87 A;  2LF8 A;  3ZQC A;  1X1C A;  4D5F A;  4ZGQ B;  1LVK A;  3P5J A;  2STT A;  1RIO H;  2ZL5 A;  4QFM A;  3PQK A;  4WCG A;  1H8E A;  3QFR A;  2AHO A;  2EIK H;  3HGG A;  4Z4Z A;  4CSW A;  1Z21 A;  2V5I A;  4CIC A;  1W35 A;  4WZL A;  2XAJ A;  4RB3 C;  3LYC A;  5A8A A;  2R9V A;  2FE3 A;  2IS4 A;  2K27 A;  3T8T A;  3WYA A;  3OPO A;  3DCF A;  4UZE A;  4B3X A;  1H0M A;  3I58 A;  3ELK A;  4CHU A;  2VBW A;  3OZV A;  3HOZ J;  1KD1 D;  4YAO A;  5A89 A;  2DMN A;  1H80 A;  2QMU A;  2PEX A;  1MDM A;  2RGV A;  3SZT A;  3GQ8 A;  2FRH A;  2ZO4 A;  2VFQ A;  1KA8 A;  5M5X J;  1GR1 A;  4BNC A;  2GWR A;  4WXH A;  3RKW A;  1U2R A;  1EE6 A;  3ZPN A;  4E6K G;  1IN6 A;  1F60 A;  4P9U A;  3SQN A;  1E3Z A;  1ETQ A;  3F3X A;  5JLX A;  4CCN A;  1IC8 A;  2CC2 A;  3MHP A;  3ZMZ A;  4HNT A;  5DCM B;  1E2X A;  4KIF A;  1G7S A;  3E0J B;  3ISX A;  3OE7 A;  4M4S A;  2V79 A;  2DER A;  5F0F A;  3SQV A;  2CQK A;  3OIQ A;  1JRG A;  5A2Q Z;  1HA8 A;  2V7W A;  2JN9 A;  1ON2 A;  3VDX A;  1WFX A;  4MXN A;  3L2W A;  3FPK A;  3RIQ A;  2HDN B;  1EH6 A;  3DBR B;  1JA1 A;  2BM5 A;  1R23 A;  4L9J A;  3H0D A;  1ZYR F;  2XV4 S;  4L9V A;  3TKY A;  3BJA A;  1TWA J;  1EFR A;  4ZZL A;  2X6O A;  5IY5 H;  3I5U A;  3W2W A;  4FWT A;  4H0E A;  3A1Y A;  4D7N A;  2KKO A;  2EIL H;  3SHF A;  2DA4 A;  2HPM A;  3OEE A;  2JUG A;  3FKI J;  4C2L A;  2JPB A;  2QEN A;  1JJ6 C;  3BR6 A;  1VQ9 I;  3WG9 A;  4YDT A;  4PZJ A;  2Z2S B;  3FHZ A;  1KTV A;  1K6Y A;  1T6Z A;  1WOP A;  4HF1 A;  1AMO A;  1FJL A;  3QYE A;  3GTK J;  4KUM A;  1K28 D;  1IN5 A;  4DOZ A;  3BNW A;  5HDN A;  4BH9 A;  3FM3 A;  1OGJ A;  2YSR A;  2TDX A;  3O2P E;  3RCO A;  3V42 A;  4A3M J;  3WGG A;  1HOM A;  2JMW A;  1S7O A;  5FGM A;  3OEH A;  2DFI A;  1E43 A;  2NTB A;  1QA6 A;  3CMA I;  3GFL A;  1OGM X;  1SFK A;  2LOO A;  2P8T A;  3IP4 B;  3LMM A;  1P2F A;  3WTW C;  1RMG A;  2IQ7 A;  2K7L A;  4MHG A;  4AU7 A;  5DS9 A;  1V0F A;  1V5E A;  2M0M A;  3EQL F;  1RR8 C;  3H9Q A;  5C44 J;  4M2L A;  2W24 A;  2WV0 A;  1DU6 A;  3PIO F;  4X6A J;  3VNU A;  1XTA A;  4IHT A;  4CCM A;  1W34 A;  3AG3 H;  2DFF A;  1E1Q A;  3DV8 A;  1BW5 A;  1TWC J;  3MZY A;  2EA4 A;  1IG7 A;  2NV4 A;  4QPO A;  4OP7 A;  4LBZ A;  2WA0 A;  3ZBU A;  4UUS A;  1DDN A;  2JA5 J;  3L7W A;  3MKL A;  1B8I A;  1MSE C;  2PX9 A;  1MBF A;  3ABK H;  4C3I J;  3WTS C;  3I59 B;  2LH9 A;  3A8K A;  4OPO A;  3SEQ A;  4Z4V A;  2R7O A;  1ZAO A;  2DFE A;  2CYY A;  3O6B B;  1SD5 A;  4C3J J;  4CCK A;  2VNI A;  1VQN B;  5FLX Z;  1VQL B;  3WTV C;  2HOS A;  1F36 A;  1OIS A;  3Q39 A;  4G94 A;  1T0F C;  3E6M A;  4L18 B;  5KVR A;  1WSR A;  1W0U A;  3GO5 A;  3ZXS A;  4IOA F;  5ED4 A;  3J81 k;  4FX0 A;  3OAA A;  1F5T A;  4OIN F;  4E7I A;  2QE7 A;  2XKP A;  2XT4 A;  4IHW A;  5J1U A;  3SFI A;  1MH3 A;  4K2E A;  5E17 F;  2XF5 A;  3B6C A;  1K8F A;  3HSE A;  3HIF A;  1FNN A;  1IF1 A;  2BM6 A;  2L01 A;  3LA7 A;  1WPC A;  5JVG F;  1BLI A;  4YAF A;  2PN6 A;  2O04 A;  1F4K A;  1BN5 A;  1VQK B;  4UUT A;  2DA2 A;  5HLI A;  1KTW A;  5D4R A;  3RPU A;  3MD2 A;  1XS9 A;  2V1D A;  2EV6 A;  1MH4 A;  3ERM A;  4BEH A;  1J09 A;  3SZG A;  1U8B A;  1QVG B;  3LFU A;  1G3W A;  2M45 A;  3Q3S A;  1VQ5 B;  2ESH A;  1MW7 A;  3E97 A;  3CRZ A;  1TQP A;  1FIP A;  2CMP A;  4UY8 I;  1GT0 C;  3I9V 2;  4RLQ A;  4U7D A;  4P6V F;  3L1P A;  4E7H A;  4II3 A;  2DI3 A;  3FXK A;  4IPA A;  3S3M A;  2LBF A;  3PEN A;  3KEY A;  1GAW A;  1KRH A;  3U9G A;  1QRC A;  2LFB A;  3ZP5 A;  3ABM H;  5D5V B;  4AIK A;  3CC4 B;  5J8F A;  2K9N A;  5FKK A;  1SC7 A;  3FIW A;  1BI3 A;  4OIQ F;  1BI2 A;  2JA8 J;  3C18 A;  2MFZ A;  4A0X A;  3TO7 A;  4TSF A;  2NST A;  4ASU A;  2X53 S;  1U78 A;  1XGM A;  3K1M A;  3ZBT A;  4RGX A;  1GXP A;  1KCD A;  1DDI A;  1BM9 A;  1M90 D;  2C2W A;  4YHB A;  3BH6 B;  1YJ9 B;  1NH3 A;  2XC1 A;  4OIR F;  1XCB A;  1DGW Y;  1PJR A;  2WAQ N;  5J8C A;  3ZZT A;  1OQY A;  2VBX A;  1FX0 A;  2R7W A;  2E1B A;  1JUP A;  2IA1 A;  3HM5 A;  3W6J B;  1R71 A;  3FPP A;  5C4X J;  3BY2 A;  2AHQ A;  2QYU A;  3JRB A;  2NZM A;  2AQF A;  2BVL A;  5HS8 A;  4HLX A;  4B3A A;  3M8J A;  3CXC B;  2V1N A;  4P3I A;  4G5G A;  3RPU D;  2RC6 A;  1N0U A;  4LC0 A;  2QBY B;  2IGO A;  1LDD A;  5DV5 A;  3ZQF A;  3I64 A;  4D0P A;  5EGO A;  3QFT A;  1MMA A;  3TH0 A;  2D9R A;  4Y7C A;  3LSJ A;  2R5Z A;  1KC8 D;  1V54 H;  4YFO A;  1LEA A;  3ZMV A;  3KE2 A;  4Q7J B;  3BR2 A;  1E1R A;  3DWL E;  3S17 J;  3F6O A;  4L5E A;  2VNJ A;  2CUZ A;  3GLX A;  4EW9 A;  2IVM A;  4OOV A;  3IH3 A;  2Y0S A;  5EZH A;  4ENM A;  1WQ2 A;  4IXA A;  1ELO A;  3LST A;  2FOW A;  3R61 A;  2DU9 A;  2ZTG A;  2XGX A;  2XVC A;  3Q0V A;  4KIS A;  5IP6 A;  5M3F J;  6PAX A;  1JT6 A;  2YWE A;  1FDR A;  4ESF A;  2ZKZ A;  4JX5 A;  2HCJ B;  4B3F X;  4KN4 X;  2EFP A;  4OJO A;  3DKX A;  4G1V A;  2AXL A;  4DNC A;  1LLZ A;  2YR2 A;  3K1N A;  4AUX A;  5F6F A;  3L9F A;  4YC5 A;  5HLG A;  2DW4 A;  1H9T A;  1F20 A;  1UJ8 A;  1SFX A;  2R5Y A;  1FLI A;  4RM2 A;  1ZEL A;  4OPV A;  1H88 C;  4Z4S A;  1W5C C;  2YU3 A;  4A2U A;  3WNB A;  2D1H A;  4K1X A;  1E0E A;  1UMK A;  2YX7 A;  1UG2 A;  5D4S A;  3REO A;  1WI9 A;  3W2I A;  1VQK I;  3SJZ A;  5IP7 J;  2DT5 A;  3ASO H;  5L3D A;  5JR3 A;  1OFM A;  3CZ6 A;  2GIV A;  1FBQ A;  3JCU C;  2VPL A;  1KK3 A;  2DOF A;  3JSP A;  4EJU A;  2DT7 B;  1H89 C;  2RC5 A;  3HDD A;  1EH8 A;  4XKC A;  5BPD A;  2PLY A;  3TW6 A;  1UFM A;  1WH7 A;  5F1J A;  3P9I A;  4P22 A;  4RD2 A;  1FRN A;  2V4J C;  1V0E A;  4MYU A;  1BC8 C;  4MNU A;  2W4S A;  2VFP A;  1ZLK A;  4YZA A;  1T95 A;  3VMV A;  4BQO A;  5B5E C;  2OTJ I;  3SY2 A;  2X0K A;  1AHD P;  3C2H A;  4XLF A;  4FE7 A;  2GM4 A;  3QFS A;  2L3D A;  1FRQ A;  4KKT A;  3GFI A;  2O17 A;  2J5O A;  1MDM B;  2L02 A;  2JJ7 A;  4M6Y A;  2IA0 A;  3CC2 B;  2H6B A;  4HX4 A;  2RDP A;  3B73 A;  3G05 A;  5HNH A;  1BN8 A;  3LFK A;  4TKO B;  1RU4 A;  1FMV A;  4OPW A;  3MMY B;  2PG4 A;  3W2V A;  2BMW A;  3FY3 A;  1YRN A;  2A05 A;  1TBX A;  4GYI A;  1N77 A;  4JP0 A;  1NBM A;  2MH2 A;  2FNA A;  4PC3 A;  4MTD A;  3I4M J;  4DNT B;  1TVC A;  3WE2 A;  4Z06 A;  4LBW A;  1X3W B;  1AIP A;  1ZK8 A;  2ZZG A;  2OK8 A;  2VBE A;  4U9U A;  3DU6 A;  4IEJ A;  3VSK A;  3AG1 H;  4EVI A;  5E8G A;  3WHC A;  3P9C A;  3K10 A;  3M8E A;  4IX7 A;  1IRX A;  1QGP A;  2JVG A;  1XMK A;  2DPU A;  4RM0 A;  3CD6 B;  3H5N A;  3UW0 A;  2O8X A;  4RM3 A;  1LPQ A;  3R6J A;  3ZRG A;  2ELH A;  3OJW A;  4EM1 A;  3E7L A;  4Y52 J;  4GO1 A;  1O88 A;  3OR1 C;  2QQA A;  4QWQ A;  4BKX A;  3L09 A;  3GYH X;  2CV2 A;  1QUE A;  3QPT A;  4RD6 A;  1YIT B;  1QBJ A;  1IJE A;  4M71 A;  2J7K A;  3QPL A;  3N97 A;  5TIS C;  1XCV A;  2FBH A;  1JTA A;  4IKF A;  2Z16 A;  2BW3 A;  3BLY A;  4B3G A;  1O8G A;  2Z99 A;  4B8X A;  1P4M A;  1O8K A;  4DQK A;  1VQ4 B;  2JJ2 A;  5AIQ A;  2B9S A;  1GUU A;  1MJA A;  4M3G A;  3PM1 A;  3RQ4 A;  3K70 D;  3JRH A;  3TMO A;  3GTL J;  5FLX K;  4IHS A;  2A6T A;  2VOP A;  2INV A;  1UD3 A;  2HWV A;  1IDY A;  3H3U A;  2K9M A;  4Q4Z F;  3BY6 A;  1O7F A;  4HF2 A;  2C6Y A;  2PMD A;  4IJA A;  1CNF A;  1KYW A;  3IHU A;  5CYV A;  3C2G A;  1A31 A;  4Y4R A;  2W00 A;  5J4Y A;  1U5T C;  4CGZ A;  2VUM J;  1FNM A;  3V8K A;  2OK7 A;  4LMY A;  3TL4 X;  3GVL A;  1KMH A;  5EMN A;  3E1Y E;  5AN9 A;  3DXJ F;  1IN8 A;  4UUS B;  2CRV A;  5ICC A;  1H8A C;  4XD7 A;  5KK1 A;  1D8T A;  2KMU A;  1B8I B;  3I1F A;  1XDU A;  1OR7 C;  1T5E A;  1TUI A;  4RD1 A;  4HRI A;  3LMW A;  2YS9 A;  3R60 A;  4RA2 A;  2R93 J;  1W36 C;  2R4G A;  1FMW A;  1VFC A;  4M9Z A;  2VNK A;  4RDL A;  3TGN A;  1GO2 A;  2BF4 A;  3O8H A;  2ELK A;  1EXM A;  2QGG A;  3JSO A;  5D8L B;  1PXZ A;  3E5X A;  3FF5 A;  4CXF A;  1PJ7 A;  1D8J A;  4UV8 A;  2VE9 A;  3S1N J;  5HZA A;  2D74 A;  2VFO A;  4WXD A;  4PJN A;  4W8T A;  3F72 A;  3KCC A;  3PVD A;  4NQW A;  3BH7 B;  2ZFU A;  3W2G A;  3DTI A;  2P5L C;  3I55 I;  5L3C A;  2QTZ A;  3ONQ A;  4P96 A;  3F23 A;  1RKT A;  4ZGN B;  2BM7 A;  1TTY A;  2WZN A;  1K78 A;  2V1U A;  2DBB A;  1BIA A;  3KIO A;  1CGP A;  2BSP A;  4KJZ A;  1OCO H;  1TW3 A;  3VSU A;  1HC8 A;  3MKW B;  3B4N A;  1Y8R B;  4N4N B;  2CQQ A;  5IYC J;  3QYF A;  1UD8 A;  2W6J A;  3MWM A;  1PKV A;  2ZBV A;  1K6O A;  4IOC F;  1BL0 A;  1TLL A;  3AK5 A;  4ZYH A;  4BL0 B;  3CC2 I;  4RDJ A;  3CUQ A;  5L46 A;  4RMN A;  3P9K A;  1G8X A;  3TDU C;  4BEH B;  1R5G A;  3PNY A;  2M5W A;  4A69 C;  2ZJQ F;  2CV0 A;  2V6E A;  3B78 A;  4I2O A;  2QWW A;  5J6X A;  5JBQ A;  1L1I A;  3FBN B;  3S2W A;  4OWR B;  1D8K A;  2DA6 A;  4N9I A;  2KVO A;  2CK3 A;  4NK6 A;  3BZ6 A;  4XLN F;  2X1E A;  2L54 A;  3KLO A;  3JRF A;  2DEU A;  1CQX A;  2V7X A;  3ASP A;  4X7F A;  1DAB A;  4CYC A;  4WXC A;  2LBF B;  4G7O F;  1T8I A;  3NQO A;  2BM0 A;  4DYC A;  3ASN H;  4U88 A;  1SMY F;  2L9V A;  3ZQL A;  1NK2 P;  2ECB A;  5K7H A;  3CCE B;  2UZK A;  2X6W A;  3X2Q H;  4DNR B;  2FX3 A;  2WBM A;  1N75 A;  4A3C J;  2NTQ A;  1W2B B;  2BX6 A;  2ELJ A;  2F6C A;  1QJV A;  1DPR A;  2EFG A;  3F8N A;  4GFB A;  1LDK B;  5H20 A;  2Q2E B;  3OS1 A;  3HZJ A;  2VLA A;  3M1C A;  2DN0 A;  2HXI A;  2BSA A;  1IDJ A;  3U21 A;  2VAS A;  1X58 A;  2XAQ A;  2XAG A;  3G1M A;  4M74 A;  1JHF A;  1KU3 A;  4IHV A;  5E1X A;  1E3X A;  1BBY A;  1HW1 A;  1Y0R A;  3PA2 A;  3U6K A;  4RGR A;  2F4N A;  4C2M J;  4UAJ A;  3RDI A;  4NUB A;  3N4M A;  3BC9 A;  2DTZ A;  3IV5 A;  4YAL A;  1MJ9 A;  5CVU A;  3RKQ A;  3ZMS A;  3KYL A;  1ZLJ A;  1GVJ A;  1GVD A;  2Y75 A;  3QQA A;  4X0G A;  3HG9 A;  2K9Q A;  3H9N A;  1S3J A;  4EJV A;  5EGO B;  1NTC A;  2F4I A;  2Q6I A;  2WZP P;  1Z3X A;  2MH9 A;  4AD9 A;  5HLT A;  2P81 A;  2B0R A;  4OOI A;  4HE6 A;  2CW0 F;  3T53 B;  2R5Z B;  2CBX A;  4P6Y A;  1TYW A;  3H3V K;  4OJ6 A;  3CJR B;  2V9P A;  3EUH A;  1E3O C;  3BZK A;  4DZJ A;  3OOC A;  2IA2 A;  5LHI A;  2HFH A;  1FYL A;  5DM6 F;  3I3L A;  5F64 A;  3GQA A;  3QOP A;  4C43 A;  4DW6 A;  2EIM H;  1OB2 A;  4EM0 B;  4BE2 A;  2GK6 A;  3QSY A;  2X3H A;  2Y2Z A;  4ASN A;  4LIU A;  4HSR A;  3A3B A;  3VSV A;  2JRT A;  1XSD A;  1QGY A;  4B44 A;  4YFX F;  2K4J A;  2L7Z A;  1L0O C;  2RKH A;  3LQE A;  3CUO A;  4CA0 A;  1QGA A;  4BQN A;  2NYX A;  2QKM B;  3HRT A;  3V8J A;  1FP1 D;  2P4W A;  5L3F A;  3QFC A;  2GA1 A;  3KP3 A;  4Z6Y A;  5LHH A;  1REP C;  1R5B A;  3AG4 H;  3OW2 B;  2QCO A;  3MVP A;  1XGS A;  5EEG A;  3CCV I;  1ZG3 A;  1LKX A;  4YZ0 A;  2EWE A;  2B7E A;  3M8F A;  3KEW A;  2EV5 A;  5IYW A;  2X9D A;  1XG2 A;  5KNL A;  3J7Z I;  1X1P A;  5J35 A;  2R5Y B;  2P7C B;  1Y0N A;  3CCR I;  2IT0 A;  3NWT A;  3CMY A;  2V4D A;  2FMY A;  4P2N A;  4PJM A;  4FIS A;  3LAJ A;  3T9G A;  2AO9 A;  3GTO J;  2K9S A;  3WXM A;  3CCM B;  3MN2 A;  1OFD A;  5FFZ A;  2L9S A;  5C3E J;  2QF7 A;  1B4A A;  3M3Y J;  4RJL A;  5IYR A;  1MAB A;  1HQC A;  3HUG A;  3LSM A;  4A5M A;  4Y7N J;  1XPX A;  1MSF C;  1ENH A;  2XPW A;  4XSZ F;  1ZM3 A;  4BUP A;  2CG4 A;  3LSI A;  4EMS A;  3DEE A;  4U0V A;  2MD5 A;  2LSO A;  3D0S A;  5E18 F;  1NHA A;  2IRF G;  1WH5 A;  2JZY A;  4P9S A;  1IHM A;  3C2B A;  1VI0 A;  5LMZ A;  4RGS A;  4AYB N;  1JKP C;  3JRE A;  3ERE D;  2R7V A;  2Y0M A;  5E3L A;  1SKQ A;  4HV6 A;  4V2G A;  2IOU G;  4MEY F;  2OZU A;  3IWZ A;  3W5H A;  3QPS A;  2CUE A;  3TO9 A;  1LVA A;  2LKX A;  1FND A;  1N0V C;  2ETH A;  3CMM A;  2NOG A;  3FZV A;  2ZIT A;  1FSE A;  4ZV4 A;  2A07 F;  1N08 A;  2ZJ2 A;  5GAE J;  3LJY A;  2CW8 A;  1HSJ A;  5K1Y A;  1MMD A;  2LKP A;  1S7A A;  2XNC A;  1JJ2 B;  2E2H J;  3OV8 A;  4EJW A;  1X4P A;  2WV1 A;  3S93 A;  5L3B A;  1D3Y A;  3MZ8 A;  2LZJ A;  1WJ5 A;  2DET A;  1GJR A;  3H09 A;  1YFH A;  4ITV A;  2MC4 A;  4CZZ A;  5DD4 A;  1YTY A;  1YRN B;  3ZOB A;  2ME0 A;  5K7F A;  1WU8 A;  3A8J A;  2DMQ A;  1AKH A;  2R3S A;  5LEK A;  3GFM A;  1T6S A;  4Y33 A;  1RI7 A;  4OPS A;  3QYB A;  4HAM A;  5F27 A;  3CO6 C;  5KSW B;  4P12 A;  1Y56 A;  4PAB A;  1OCP A;  4XLE A;  4HDV A;  3BT9 A;  1G3T A;  2FBI A;  1T0F A;  3DBL B;  4BDZ A;  1OB0 A;  1JA0 A;  2XEX A;  1I1G A;  3CLQ A;  3P27 A;  1S5L C;  1MBJ A;  3K4B A;  5DS0 A;  1R5H A;  2P5K A;  2PE3 A;  5H6R A;  3J81 Z;  2VI6 A;  2QXZ A;  1HST A;  1VQ6 I;  1JHH A;  4QPQ A;  5GAD J;  2P6T A;  2JIZ A;  5IPA A;  1EFU A;  3N90 A;  2QSF X;  2QEX B;  1ITY A;  2VKH A;  3TOB A;  5J3L A;  2GXG A;  2LK2 A;  3RIR A;  5LGN A;  3BWG A;  3SDB A;  1WVR A;  3HJE A;  3ZQG A;  1J9I A;  1DPU A;  2IPQ X;  2W48 A;  4E7S A;  2LF7 A;  3W2E A;  3BTJ A;  1G7T A;  5LHG A;  4G7W A;  1D0Z A;  4HQE A;  3FBI B;  1FNB A;  2BW3 B;  4JQF A;  5F0C A;  5EDN A;  4Z4U A;  1K7A A;  2GOM A;  1SKY B;  2XTX A;  1ETO A;  2TRT A;  1LLW A;  2W85 A;  4JBA A;  2MSY A;  4YZX A;  3R0A A;  1YJN B;  3WTY C;  4BJT A;  2G9W A;  2QM3 A;  1N8R D;  3BG9 A;  2MW8 A;  1ZKG A;  4PJJ A;  2HMA A;  3VYT B;  4NHJ A;  2OU2 A;  4S04 A;  2P7V B;  1OKR A;  2W1O A;  1E3P A;  1ZGA A;  3R6K A;  3RJP A;  4F55 A;  4PC1 A;  4A12 A;  2QY1 A;  2PI0 A;  1B9M A;  2JSP A;  3EYY A;  4XOR A;  3G4S B;  3JX8 A;  1FT9 A;  2LDU A;  4CYD A;  4L5I A;  5J1Y A;  4ACA A;  2E5Z A;  2XND A;  3CCJ B;  1L3L A;  2HZD A;  1OCT C;  1ZG5 A;  5ICE A;  3CCU I;  1RR7 A;  2H6C A;  3ZQH A;  2MD0 A;  4U0W A;  4A3K J;  1BI1 A;  2OZ6 A;  2VN2 A;  2BGJ A;  2F1L A;  2STW A;  3ZQQ A;  3BG6 A;  1D1B A;  2QKL B;  2EFN A;  4JX6 A;  4LLL A;  5ICF A;  5IYQ A;  4KIC A;  3M7G A;  4OAZ A;  1J5Y A;  2BEO A;  2A6H F;  2F4O B;  5IOZ A;  1G3Y A;  2BM4 A;  2EA2 A;  4JK1 X;  2Q0O A;  3HTU A; 
#chains in the Genus database with same CATH homology
 3UR3 C;  2HDW A;  2XC7 A;  4YXW A;  4CCO A;  1E79 A;  3H9J A;  3OYM A;  5CQE A;  4E0F A;  1QHG A;  2L7K A;  3EUH C;  3OYK A;  4XLA A;  4E7L A;  2DIE A;  2A5W A;  2MFZ A;  3H5R A;  2Z8G A;  2KL4 A;  3H35 A;  4TSF A;  2NST A;  4ASU A;  2X53 S;  5IK2 A;  4BE0 A;  2L5Q A;  1KCD A;  3E1S A;  4NQW B;  2IXS A;  5CKT A;  3N05 A;  1DGW Y;  1PJR A;  1FX0 A;  2R7W A;  2WAD A;  3A4C A;  2E1B A;  2AQE A;  2UWM A;  4HIZ A;  3LSK A;  3FPP A;  3GVK A;  4OZZ A;  2DCE A;  1ERD A;  2HVQ A;  1MND A;  3HC7 A;  1TT0 A;  1WJE A;  2AQF A;  2BVL A;  2CUJ A;  2X51 A;  5FRM A;  2NZM A;  1R6R A;  3M8J A;  2V1N A;  3RPU D;  4E4H A;  2IGO A;  4F92 B;  4I84 A;  2UVE A;  1MMA A;  4P5O A;  4JOM A;  4W8R A;  3HPH A;  1DQU A;  1H8H A;  3K4M A;  1O8I A;  4AYB A;  1IB4 A;  3H5A A;  1E1R A;  3DWL E;  4XLH A;  2CUZ A;  3K4C A;  1QCX A;  1S9H A;  4EW9 A;  2XDV A;  2Y0S A;  2HQA A;  5C1E A;  2PJR B;  2M4G A;  3OYB A;  3AFH A;  3A2K A;  4FET A;  2ZTG A;  4BXF A;  1OLT A;  4R79 A;  5CPR B;  4KIS A;  5LD2 C;  4CCL A;  4URR A;  4CUG A;  2X85 A;  2VJI A;  3BC8 A;  4B3F X;  2XZO A;  2VL8 A;  2V7Q A;  3OYD A;  2UUZ A;  2OV7 A;  3DKX A;  4OJO A;  4HWV A;  4GRI A;  4OJ5 A;  4PK4 A;  3D5R C;  3WQZ A;  2KPM A;  1VZ0 A;  2M7A A;  4DBQ A;  3ZPP A;  4B43 A;  3LNN A;  1KON A;  3DQV C;  4DIQ A;  4BS9 A;  2DJI A;  3OMY A;  1X1A A;  4U49 A;  4BE1 A;  5TGT A;  1N78 A;  4J01 A;  1UD4 A;  2XZL A;  3L2Q A;  2I8D A;  2KRH A;  4RM2 A;  1ZEL A;  4XR6 A;  4ANJ A;  3OIP A;  2LRD A;  3SYT A;  4BDY A;  2Z1D A;  4LG3 A;  4E7K A;  2O0V A;  3TBI A;  2WY8 Q;  1E0E A;  3DKY A;  4PSX A;  1Z3Y A;  2E1M B;  3LSG A;  2DOA A;  2GJP A;  2WY7 Q;  2VBM A;  3D5S C;  3OYJ A;  2UVF A;  2JA2 A;  4BJ5 C;  3PL8 A;  1OFM A;  3CZ6 A;  2LY1 A;  2VJ4 A;  2VPL A;  4JMQ A;  3EUA A;  2DT7 B;  4Z03 A;  4XKC A;  1D0Y A;  4KKU A;  1VJS A;  4P22 A;  2V4J C;  4HST A;  1V0E A;  2K3P A;  1MNE A;  2W4S A;  4D9J A;  4YZA A;  3VMV A;  1T95 A;  4BQO A;  3HXL A;  2XAU A;  2ZZE A;  1AIR A;  1PLU A;  2NTP A;  1YX5 A;  3C2H A;  4XLF A;  3VYR B;  2NOJ B;  4FXU A;  3KX2 A;  4KKT A;  3OYA A;  2O17 A;  3GQ9 A;  2HPI A;  1UD2 A;  2PEC A;  4OJP A;  4ZDO A;  2XF6 A;  3QOD A;  2WPD A;  4W8Q A;  4NK8 A;  3G05 A;  5HNH A;  1BN8 A;  1AA7 A;  1UAA A;  4TKO B;  1RU4 A;  4E7Z A;  1FMV A;  3ZR8 X;  3SUC A;  3MMY B;  4IQJ A;  3W2V A;  3AL0 B;  3FY3 A;  3GBG A;  1N77 A;  1NBM A;  1GLN A;  2VJJ A;  3W2A A;  1DP3 A;  1X0C A;  4G6I A;  4N4O B;  4XKB A;  4DNT B;  3K70 C;  4Z06 A;  4FAS D;  4XQF A;  4MR0 A;  2ZZG A;  2VBE A;  4DJA A;  4DK0 A;  2XSJ C;  3DU6 A;  2LG4 A;  2HNH A;  3VSK A;  2X6Y A;  4C2T A;  1EA3 A;  3H94 A;  4XKV A;  3K10 A;  4IX7 A;  1IRX A;  2JVG A;  3IUO A;  3OYI A;  1G59 A;  1UD8 A;  3B8Y A;  3HUG B;  3H5N A;  3UW0 A;  4RM3 A;  3CJQ B;  3S3O A;  2L2O A;  4XN3 A;  3ZRG A;  2ZZF A;  1D1A A;  3OYG A;  4AVZ A;  3L2R A;  1O88 A;  2WB1 A;  3OR1 C;  3EUK L;  2CV2 A;  2WJV A;  1UD6 A;  2R7X A;  2O5R A;  3PNV A;  1UG0 A;  4YEL A;  2KLO A;  2R7U A;  3VWB A;  1JTA A;  4IKF A;  2Z16 A;  2BW3 A;  3BLY A;  2R7T A;  1HZE A;  3VYS B;  4B3G A;  2UV1 A;  2X6X A;  4BJ6 C;  4XM3 A;  1O8J A;  1O8G A;  1O8K A;  1MMG A;  1RWR A;  1WJC A;  2JDI A;  4II2 A;  2JJ2 A;  4YEJ A;  3RQ4 A;  1BOB A;  1W0K A;  3K70 D;  1BR4 A;  2M3A A;  3TMO A;  2WJY A;  3PSF A;  3BCB A;  1X1D A;  1Z7L A;  2ZTN A;  2V26 A;  3NWS A;  2A6T A;  2CFO A;  2PMZ A;  1Y6I A;  1UD3 A;  4KIT B;  4F93 B;  1IDK A;  2INV A;  4DBR A;  4ZJZ A;  2VQC A;  3FDY A;  1PYV A;  4B47 A;  2F5V A;  1CZF A;  2K9M A;  2LY2 A;  2KRC A;  4F52 A;  1PE9 A;  1O8F A;  2ZSI B;  2CW7 A;  3OL4 A;  3K6G A;  2NT9 A;  3OYL A;  3C2G A;  4Y4R A;  2W00 A;  2R7Q A;  5FRO A;  3GVL A;  3OR2 C;  2VXZ A;  3RTR A;  3TL4 X;  4UZU A;  1KMH A;  3A3G A;  1VF7 A;  4XD7 A;  2INU A;  4OJL A;  2KMU A;  1OGO X;  4OZY A;  2KHM A;  1OR7 C;  1T5E A;  4HRI A;  3T56 B;  2LC2 A;  3LMW A;  3DLA A;  3SEZ A;  1W36 C;  2R4G A;  2CV1 A;  1NRK A;  1FMW A;  3OYH A;  4BAC A;  2XF7 A;  4ZC3 A;  3EQN A;  2VQL A;  2JJ1 A;  2X1D A;  3J7A Y;  3CP2 A;  1D1C A;  4XKW A;  2OC6 A;  1LFP A;  3EPZ A;  3GRH A;  3VSL A;  1PXZ A;  3DPL C;  3OOU A;  3FKJ A;  1KCC A;  3VYU B;  4PJL A;  4LIV A;  1BHE A;  4PJN A;  2HU9 A;  1O8M A;  4W8T A;  4XNF A;  2ZFU A;  2KDO A;  3OWT A;  3DTI A;  2WSS A;  3AKZ A;  1OOC A;  3ONQ A;  3K4K A;  1X19 A;  2VJ5 A;  1BPL A;  4XON A;  2DXI A;  3G2B A;  4PMH A;  1OHH A;  4KJZ A;  2BSP A;  3VSU A;  3RSN A;  3MKW B;  5HKK A;  3B4N A;  2Q1Z B;  4N4N B;  1VBL A;  3QYF A;  3OYN A;  2W6J A;  3PSI A;  2MYS A;  2BVM A;  3OS0 A;  2XZP A;  2VBK A;  4G7X A;  2E5N A;  3OL3 A;  4BL0 B;  3HPG A;  4RMN A;  4BEH B;  1G8X A;  1W36 D;  2L9N A;  3PNY A;  2BOL A;  2V6E A;  2CV0 A;  4U4B A;  2W82 A;  1VLY A;  3FBN B;  4OWR B;  2ODL A;  1HVX A;  2KVO A;  2CK3 A;  5LFA A;  3GQ7 A;  4NK6 A;  4IZZ A;  2IS6 A;  4ZYA A;  2X1E A;  4E7J A;  4C2U A;  2KZV A;  4ZDP A;  2V9K A;  2LBF B;  4HEA 2;  4DK1 A;  2WAF A;  1O8H A;  2CS3 A;  4EAT A;  1WJB A;  1NG7 A;  2M4K A;  2KP6 A;  2PJR A;  5HOO A;  3PNT A;  2CH0 A;  3K4N A;  2X6W A;  4D1Q A;  4BQQ A;  4DNR B;  1UD5 A;  2WBM A;  1N75 A;  4B48 A;  2NTQ A;  3JUR A;  3VST A;  3DPU A;  2ELJ A;  2F6C A;  1QJV A;  2ZZQ A;  2GOX B;  3OYE A;  1LDK B;  4TT3 A;  2E60 A;  2IGM A;  2Q2E B;  3QOE A;  3OS1 A;  2VLA A;  2HLD A;  3ZIA A;  3M1C A;  2LYC A;  3VMW A;  3S3N A;  4KT6 A;  1IDJ A;  3U21 A;  2VAS A;  3UNG C;  5KHD A;  2RRE A;  1MMN A;  1E3X A;  2JVH A;  1NG6 A;  2RQQ A;  3S8P A;  1O8E A;  1OFL A;  1KZL A;  4YRV A;  4H4K C;  1DGR M;  4NUB A;  2PYG A;  2O0W A;  3BC9 A;  3GQB A;  2X8K A;  3F9K A;  1TZL A;  3OFN A;  3KYL A;  2QX3 A;  3L2V A;  4X0G A;  2VKD A;  3HG9 A;  3BH4 A;  2VIX A;  2F4I A;  4U87 A;  5HVQ C;  2WZP P;  1Z3X A;  4L8J A;  1X1C A;  5HLT A;  1LVK A;  2K9L A;  3ZCO A;  2GJR A;  2NT6 A;  3BCD A;  3ZSC A;  3T51 B;  3T53 B;  1H8E A;  2ZXI A;  3OYC A;  4OJ6 A;  3CJR B;  4HNU A;  4CSW A;  1Z21 A;  2K5C A;  4PFO A;  5FRN A;  3OOC A;  3DTE A;  3I3L A;  2R9V A;  3MKY B;  2IS4 A;  3GQA A;  4RLF A;  5DN6 A;  3OPO A;  2OUM A;  4BE2 A;  3S32 A;  4B3X A;  2GK6 A;  4ZTJ A;  2E1M C;  2WAQ A;  3HAG A;  1O8L A;  2X3H A;  4LIU A;  4HSR A;  4BGD A;  3A3B A;  3EQO A;  3VSV A;  1P9Q C;  4B44 A;  4NNJ A;  1H80 A;  2X1C A;  5FL7 A;  3FHN A;  2VQG A;  1WJD A;  3NE5 B;  3OS2 A;  4C9Y A;  3ZGK A;  4CA0 A;  3GQ8 A;  4BQN A;  1IA5 A;  4BU2 A;  1NHC A;  2QKM B;  5HNF A;  1EE6 A;  5AMV A;  3ZPN A;  4E6K G;  1E3Z A;  2RNG A;  4CCN A;  4NC7 A;  4HNT A;  4U7B A;  2F43 A;  1LKX A;  4YZ0 A;  3E0J B;  3BCF A;  1I8D A;  3KEW A;  3OE7 A;  2EWE A;  1XG2 A;  5KNL A;  3OIQ A;  4Y3O A;  3BCA A;  1JRG A;  4XOP A;  1HA8 A;  1YX3 A;  4OAY A;  4C30 A;  3VDX A;  1WFX A;  3MKZ A;  2R7S A;  4MXN A;  3L2W A;  3H9G A;  3NWT A;  1O8D A;  3B90 A;  2V4D A;  4PJM A;  3DDY A;  3T9G A;  1W0J A;  3H0D A;  3JU4 A;  2VXD A;  2L9S A;  2HVS A;  1EFR A;  4YZQ A;  1MAB A;  4F3Q A;  3AL0 C;  1WJA A;  3LSM A;  3W2W A;  4F91 B;  5KCM A;  3CP8 A;  1DBG A;  3A1Y A;  3W3C A;  3PFY A;  3LSI A;  2IGN A;  1SAU A;  3DEE A;  4BUP A;  2HPM A;  5C1C A;  3OEE A;  2FUG 2;  2JUG A;  4C2L A;  2HVR A;  4Z1M A;  3IAS 2;  1BR1 A;  3DPT A;  2KQR A;  2R7V A;  4HPQ A;  2IGK A;  2W6I A;  4PUS A;  2Z2S B;  2DT6 A;  2PYH A;  1K6Y A;  2XGJ A;  1U0J A;  1K28 D;  3QYE A;  1PKV A;  4DOZ A;  3CMM A;  1V5F A;  3RCO A;  3V42 A;  3OEH A;  1YE9 A;  1COW A;  1E43 A;  2NTB A;  2CW8 A;  1MMD A;  1OGM X;  1DBO A;  3PJR A;  1SFK A;  2LOO A;  3IP4 B;  1X4P A;  3LMM A;  1RMG A;  1WP6 A;  3S93 A;  2IQ7 A;  2LZJ A;  4AU7 A;  1WJ5 A;  2WAE A;  1V0F A;  1V5E A;  2M0M A;  2XOK A;  1QHH D;  3H9Q A;  4ITV A;  3PUB A;  2IS1 A;  3DTK A;  2MC4 A;  2ZXH A;  4IQ4 A;  2VQH A;  1I18 A;  4Y33 A;  4CCM A;  3QYB A;  3HOS A;  1E1Q A;  4P1W A;  4HG2 A;  1W9X A;  1Y56 A;  4MLO A;  4XLE A;  1D0X A;  2W7N A;  4QPO A;  4XMY A;  3HOT A;  4BDZ A;  1OB0 A;  1WTH D;  3HL2 A;  2WA0 A;  1BMF A;  1BR2 A;  2O1D A;  3BG7 A;  3IAM 2;  3K4B A;  2MAB A;  3LSH A;  3DU5 A;  1QU3 A;  3GVJ A;  4ZTF A;  2QXZ A;  3OY9 A;  2LH9 A;  4QPQ A;  1X4O A;  3SEQ A;  3HKZ A;  2JIZ A;  3CF2 A;  2R7O A;  3OW7 A;  3WWG A;  4CCK A;  2GJK A;  2VKH A;  3FKS A;  3SDB A;  2V7F A;  4Z05 A;  1T0F C;  4E7S A;  4DGW B;  1WMR A;  4G7W A;  5JHF A;  2F1M A;  1D0Z A;  3D5L A;  3FBI B;  4XOT A;  2NSP A;  1V5G A;  2BW3 B;  4JQF A;  3ZXS A;  3OAA A;  2GOM A;  1JI8 A;  1SKY B;  1X1B A;  2Z6B D;  3A35 A;  1K5C A;  4E7I A;  2QE7 A;  2V31 A;  4YZX A;  4KKS A;  2GK7 A;  2R7R A;  2IS2 A;  2M7B A;  4BJT A;  4PJJ A;  2M5S A;  2ZSH B;  2XF5 A;  3VYT B;  3KRG A;  4XN0 A;  4W8S A;  2P0W A;  2W1O A;  3LL7 A;  4LIT A;  1WPC A;  4F55 A;  1BLI A;  2QY1 A;  2JSP A;  4XOR A;  2O04 A;  4XL9 A;  1HG8 A;  1KTW A;  3K4L A;  4XLC A;  2E5Z A;  3MD2 A;  2XND A;  4GQN A;  4BEH A;  2HZD A;  2VB6 A;  3L2U A;  1J09 A;  3SZG A;  4CCJ A;  3LFU A;  4G6T B;  4PFP A;  4ZDL A;  4CZC A;  2MD0 A;  1MW7 A;  5CDF A;  5CQG A;  2D3N A;  1UEL B;  3ZQQ A;  2CMP A;  3BG6 A;  1D1B A;  2QKL B;  3I9V 2;  2LRE A;  4RLQ A;  3CES A;  4NC8 A;  4OAZ A;  3K4J A;  4E7H A;  4II3 A;  3VR6 A;  1GQ8 A;  4CH7 A;  3S3M A;  1WJF A;  2D3L A;  2LBF A;  4PSW A;  3KEY A;  3OYF A;  4J00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...