2J8IA

Structure of np275, a pentapeptide repeat protein from nostoc punctiforme
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
GLVPRGSHMDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAILHGAMLDEANLQQANLSRADLSGATLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords NP275
publication title Structural Characterization of the Fusion of Two Pentapeptide Repeat Proteins, Np275 and Np276, from Nostoc Punctiforme: Resurrection of an Ancestral Protein.
pubmed doi rcsb
source organism Nostoc punctiforme
total genus 38
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2j8iA01
2J8IA 2BM6A 5JMCB 2W7ZA 5JLVC 4JRAC 2BM5A 3N90A 2BM4A 2G0YA 2F3LA 2BM7A
chains in the Genus database with same CATH superfamily
2NZMA 1O8HA 4YELA 3UW0A 4XR6A 1IDKA 1TSPA 1OFMA 1VBLA 1KCDA 2J8KA 1XG2A 3SZEA 1CZFA 2G0YA 1O8FA 3LJYA 2XC1A 2XT2A 3LMWA 3H09A 3B8YA 4XLAA 1TYVA 2X6XA 4XKWA 2NT6A 2EWEA 3WWGA 2BM7A 4XQFA 4XMYA 4YDTA 4YZAA 1AIRA 4OZYA 4EW9A 5JMCB 1O8MA 5DNSA 3BH7B 3SYJA 4OPWA 1CLWA 2BM4A 4XOTA 3SY2A 1RMGA 1OGMX 4XN0A 4YZXA 3VMWA 2VBMA 2O04A 2PYHA 2XTYA 2XTXA 4URRA 2O1DA 2PYGA 4XNFA 2IOUG 4YZ0A 1EE6A 2VFNA 1KQ5A 4OM9A 1DABA 4OJOA 4PMHA 1QA3A 2NTPA 4XKVA 1O88A 1LLZA 2NT9A 3NAWA 3VSVA 1NHCA 3RIQA 1EA0A 1PXZA 2QXZA 4NK8A 4Z06A 1GQ8A 1WXRA 4XLEA 4XLCA 1WMRA 2O17A 3VSUA 4AVZA 1OOCA 4W8RA 2XT4A 3JX8A 3SUCA 1O8KA 1QCXA 1QRBA 3GQ8A 1QJVA 3PSZA 4W8SA 4Z05A 1K8FA 4OZZA 3N90A 3LYCA 1RU4A 2QZAA 4XOPA 2QY1A 3EQNA 3T9GA 4XLHA 3VSTA 1IB4A 4MXNA 1L1IA 1BHEA 1LM1A 2BM6A 2O0VA 2W7ZA 4V02C 1QA1A 1HG8A 4YEIA 3TH0A 1OGOX 1QRCA 2BSPA 2X3HA 3GQ7A 2UVEA 4OJ6A 2J8IA 3NB2A 4NK6A 4XN3A 4YC5A 2ODLA 4OJPA 1TYWA 2UVFA 3B90A 1LLWA 5C1EA 2QYUA 2YUHA 5AMVA 1X0CA 4XORA 4U4BA 1K4ZA 1O8GA 4OJ5A 1KCCA 2VFQA 2NSTA 3GRHA 1KTWA 1O8EA 2VBKA 2X6WA 2X85A 3FY3A 1O8IA 1TYUA 1EZGA 1DBOA 1DBGA 2B0RA 2VFPA 3VMVA 3P4GA 1K5CA 2VFOA 3PSSA 5C1CA 2BM5A 2BX6A 2NTBA 1O8JA 5JLVC 1PLUA 2Z8GA 2X6YA 2O0WA 4W8QA 1RWRA 3SQVA 1QA2A 1O8DA 3JURA 3GQ9A 3ZPPA 4XONA 1O8LA 3B4NA 2IQ7A 1IA5A 2VJIA 4MR0A 2NTQA 3KRGA 4XL9A 1BN8A 4C2LA 1TYXA 2PECA 3BH6B 1HF2A 2VFMA 2INVA 4OJLA 4XM3A 4YZQA 4Z03A 1IDJA 1OFDA 2O6WA 2XTWA 2NSPA 4YFOA 3ZSCA 2VJJA 3DU1X 4U49A 4KH3A 2QX3A 3N6ZA 1H80A 3GQAA 1OFLA 4I84A 4HWVA 3AK5A 3EQOA 1OFEA 4W8TA 2INUA 2VBEA 3PETA 4JRAC 1PE9A 4YEJA 1JRGA 4XLFA 2V5IA 3ML3A 2F3LA 4YCQA 1QQ1A 1JTAA
chains in the Genus database with same CATH topology
2J8IA 1DABA 4OJOA 1QA3A 4OJPA 2IOUG 1TSPA 1TYWA 1TYXA 3SZEA 2G0YA 3RIQA 3BH6B 2YUHA 1HF2A 2VFMA 2XC1A 3LJYA 1K4ZA 3H09A 4OJ5A 4OJLA 2VFQA 1WXRA 1TYVA 3JX8A 4OM9A 2BM7A 1QRBA 1K8FA 1TYUA 4KH3A 3SYJA 5JMCB 3BH7B 3N90A 3N6ZA 2B0RA 3LYCA 4OPWA 2VFPA 3P4GA 1CLWA 2BM4A 2VFOA 3AK5A 2BM5A 2BX6A 2BM6A 4V02C 1QA1A 2W7ZA 5JLVC 4JRAC 3PETA 3TH0A 1QRCA 2V5IA 4OJ6A 3ML3A 1QA2A 2F3LA 2VFNA 1QQ1A 1KQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8I A;  2BM6 A;  5JMC B;  2W7Z A;  5JLV C;  4JRA C;  2BM5 A;  3N90 A;  2BM4 A;  2G0Y A;  2F3L A;  2BM7 A; 
#chains in the Genus database with same CATH topology
 2NZM A;  1O8H A;  4YEL A;  3UW0 A;  4XR6 A;  1IDK A;  1TSP A;  1OFM A;  1VBL A;  1KCD A;  2J8K A;  1XG2 A;  3SZE A;  1CZF A;  2G0Y A;  1O8F A;  3LJY A;  2XC1 A;  2XT2 A;  3LMW A;  3H09 A;  3B8Y A;  4XLA A;  1TYV A;  2X6X A;  4XKW A;  2NT6 A;  2EWE A;  3WWG A;  2BM7 A;  4XQF A;  4XMY A;  4YDT A;  4YZA A;  1AIR A;  4OZY A;  4EW9 A;  5JMC B;  1O8M A;  5DNS A;  3BH7 B;  3SYJ A;  4OPW A;  1CLW A;  2BM4 A;  4XOT A;  3SY2 A;  1RMG A;  1OGM X;  4XN0 A;  4YZX A;  3VMW A;  2VBM A;  2O04 A;  2PYH A;  2XTY A;  2XTX A;  4URR A;  2O1D A;  2PYG A;  4XNF A;  2IOU G;  4YZ0 A;  1EE6 A;  2VFN A;  1KQ5 A;  4OM9 A;  1DAB A;  4OJO A;  4PMH A;  1QA3 A;  2NTP A;  4XKV A;  1O88 A;  1LLZ A;  2NT9 A;  3NAW A;  3VSV A;  1NHC A;  3RIQ A;  1EA0 A;  1PXZ A;  2QXZ A;  4NK8 A;  4Z06 A;  1GQ8 A;  1WXR A;  4XLE A;  4XLC A;  1WMR A;  2O17 A;  3VSU A;  4AVZ A;  1OOC A;  4W8R A;  2XT4 A;  3JX8 A;  3SUC A;  1O8K A;  1QCX A;  1QRB A;  3GQ8 A;  1QJV A;  3PSZ A;  4W8S A;  4Z05 A;  1K8F A;  4OZZ A;  3N90 A;  3LYC A;  1RU4 A;  2QZA A;  4XOP A;  2QY1 A;  3EQN A;  3T9G A;  4XLH A;  3VST A;  1IB4 A;  4MXN A;  1L1I A;  1BHE A;  1LM1 A;  2BM6 A;  2O0V A;  2W7Z A;  4V02 C;  1QA1 A;  1HG8 A;  4YEI A;  3TH0 A;  1OGO X;  1QRC A;  2BSP A;  2X3H A;  3GQ7 A;  2UVE A;  4OJ6 A;  2J8I A;  3NB2 A;  4NK6 A;  4XN3 A;  4YC5 A;  2ODL A;  4OJP A;  1TYW A;  2UVF A;  3B90 A;  1LLW A;  5C1E A;  2QYU A;  2YUH A;  5AMV A;  1X0C A;  4XOR A;  4U4B A;  1K4Z A;  1O8G A;  4OJ5 A;  1KCC A;  2VFQ A;  2NST A;  3GRH A;  1KTW A;  1O8E A;  2VBK A;  2X6W A;  2X85 A;  3FY3 A;  1O8I A;  1TYU A;  1EZG A;  1DBO A;  1DBG A;  2B0R A;  2VFP A;  3VMV A;  3P4G A;  1K5C A;  2VFO A;  3PSS A;  5C1C A;  2BM5 A;  2BX6 A;  2NTB A;  1O8J A;  5JLV C;  1PLU A;  2Z8G A;  2X6Y A;  2O0W A;  4W8Q A;  1RWR A;  3SQV A;  1QA2 A;  1O8D A;  3JUR A;  3GQ9 A;  3ZPP A;  4XON A;  1O8L A;  3B4N A;  2IQ7 A;  1IA5 A;  2VJI A;  4MR0 A;  2NTQ A;  3KRG A;  4XL9 A;  1BN8 A;  4C2L A;  1TYX A;  2PEC A;  3BH6 B;  1HF2 A;  2VFM A;  2INV A;  4OJL A;  4XM3 A;  4YZQ A;  4Z03 A;  1IDJ A;  1OFD A;  2O6W A;  2XTW A;  2NSP A;  4YFO A;  3ZSC A;  2VJJ A;  3DU1 X;  4U49 A;  4KH3 A;  2QX3 A;  3N6Z A;  1H80 A;  3GQA A;  1OFL A;  4I84 A;  4HWV A;  3AK5 A;  3EQO A;  1OFE A;  4W8T A;  2INU A;  2VBE A;  3PET A;  4JRA C;  1PE9 A;  4YEJ A;  1JRG A;  4XLF A;  2V5I A;  3ML3 A;  2F3L A;  4YCQ A;  1QQ1 A;  1JTA A; 
#chains in the Genus database with same CATH homology
 2J8I A;  1DAB A;  4OJO A;  1QA3 A;  4OJP A;  2IOU G;  1TSP A;  1TYW A;  1TYX A;  3SZE A;  2G0Y A;  3RIQ A;  3BH6 B;  2YUH A;  1HF2 A;  2VFM A;  2XC1 A;  3LJY A;  1K4Z A;  3H09 A;  4OJ5 A;  4OJL A;  2VFQ A;  1WXR A;  1TYV A;  3JX8 A;  4OM9 A;  2BM7 A;  1QRB A;  1K8F A;  1TYU A;  4KH3 A;  3SYJ A;  5JMC B;  3BH7 B;  3N90 A;  3N6Z A;  2B0R A;  3LYC A;  4OPW A;  2VFP A;  3P4G A;  1CLW A;  2BM4 A;  2VFO A;  3AK5 A;  2BM5 A;  2BX6 A;  2BM6 A;  4V02 C;  1QA1 A;  2W7Z A;  5JLV C;  4JRA C;  3PET A;  3TH0 A;  1QRC A;  2V5I A;  4OJ6 A;  3ML3 A;  1QA2 A;  2F3L A;  2VFN A;  1QQ1 A;  1KQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...