2J8IA

Structure of np275, a pentapeptide repeat protein from nostoc punctiforme
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
GLVPRGSHMDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAILHGAMLDEANLQQANLSRADLSGATLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NP275
publication title Structural Characterization of the Fusion of Two Pentapeptide Repeat Proteins, Np275 and Np276, from Nostoc Punctiforme: Resurrection of an Ancestral Protein.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Toxin
total genus 38
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2j8iA01
2G0YA 2BM7A 5JLVC 2BM4A 2W7ZA 2J8IA 4JRAC 5JMCB 2F3LA 3N90A 2BM5A 2BM6A
chains in the Genus database with same CATH superfamily
3GQ8A 1JTAA 3KRGA 2W7ZA 1O8DA 2O6WA 2X6XA 4XLAA 4YCQA 4HWVA 2XT4A 4YFOA 4Z05A 2J8KA 1QCXA 1QQ1A 1KCDA 1OGOX 1NHCA 4YZXA 4I84A 1LLZA 2INVA 4U49A 4NK6A 2NT9A 4OZYA 1O8LA 4MXNA 1KTWA 2O04A 1PXZA 2VJIA 1TSPA 3VMVA 1LM1A 1CZFA 2VBEA 2BM4A 4URRA 4YELA 4XLCA 2O0VA 3BH6B 4XORA 4XKVA 1O8KA 4YEJA 4KH3A 1CLWA 4Z06A 1QA3A 4YZAA 2UVFA 2VFQA 3SYJA 3WWGA 2QX3A 2VFPA 1O8MA 1O8HA 3LJYA 2BM5A 2V5IA 3SQVA 4XONA 1O8IA 4YDTA 1O88A 2G0YA 1TYUA 1DBGA 2BSPA 1QRCA 2O17A 1AIRA 1TYWA 1JRGA 4U4BA 2VBMA 1WMRA 2NSTA 3TH0A 4XMYA 2O1DA 2EWEA 2VFOA 3GQAA 3N6ZA 1XG2A 2BM7A 3SY2A 4Z03A 1IDJA 1GQ8A 4OJOA 3H09A 3NAWA 1HF2A 1QA1A 2B0RA 1BHEA 3PETA 2NSPA 1OFDA 1H80A 3B90A 3VSTA 3PSSA 4MR0A 2XTYA 3PSZA 2O0WA 1K5CA 1OFLA 3P4GA 2X3HA 3EQNA 1OFEA 2VFMA 4XM3A 3VMWA 2ODLA 2VJJA 2QZAA 2F3LA 3ZSCA 3UW0A 2INUA 1RU4A 1QA2A 2PECA 3LMWA 1HG8A 3T9GA 4W8RA 1OFMA 3RIQA 4XN0A 4OJ5A 4XOTA 4XOPA 1X0CA 1IB4A 1DBOA 1OGMX 3VSUA 5JLVC 4W8TA 4JRAC 4XLHA 1VBLA 2XC1A 3SZEA 1TYVA 1EE6A 3AK5A 3NB2A 1QRBA 2BM6A 3DU1X 4NK8A 1WXRA 1K4ZA 1DABA 1OOCA 3JX8A 3SUCA 1EZGA 4OM9A 5DNSA 3LYCA 2XT2A 4XR6A 2NTQA 4OJ6A 4YEIA 2Z8GA 5AMVA 1RWRA 2PYHA 4PMHA 5C1EA 2IQ7A 1L1IA 4XLFA 3EQOA 2BX6A 1TYXA 3FY3A 1LLWA 2NZMA 2QYUA 4W8SA 1KQ5A 2VBKA 3B8YA 2UVEA 2XTXA 2YUHA 4EW9A 1O8FA 4XQFA 2J8IA 1QJVA 2NTBA 4W8QA 3VSVA 4XKWA 2X85A 1IA5A 1O8JA 1O8GA 4OJLA 2NTPA 5JMCB 3ZPPA 1PE9A 3GRHA 3N90A 4OZZA 1K8FA 2NT6A 4XNFA 4V02C 3ML3A 4C2LA 2X6WA 4YZ0A 2QY1A 3B4NA 3JURA 4YZQA 2IOUG 2XTWA 2X6YA 4OJPA 4AVZA 3GQ7A 2PYGA 3BH7B 4XN3A 4XLEA 1KCCA 1EA0A 1PLUA 1IDKA 1O8EA 4XL9A 2QXZA 2VFNA 1BN8A 3GQ9A 1RMGA 5C1CA 4OPWA 4YC5A
chains in the Genus database with same CATH topology
2G0YA 1KQ5A 1TYUA 2YUHA 1QA2A 1QRCA 1TYWA 2V5IA 2W7ZA 2J8IA 3AK5A 3TH0A 3RIQA 4OJ5A 1QQ1A 2VFOA 3N6ZA 2BM7A 5JLVC 4OJLA 4OJOA 3H09A 4JRAC 2XC1A 1HF2A 5JMCB 1TYVA 2B0RA 3N90A 3PETA 1QA1A 1QRBA 2BM6A 1K8FA 1WXRA 1K4ZA 1TSPA 4V02C 1DABA 3ML3A 2BM4A 1TYXA 3JX8A 4OM9A 2IOUG 4OJPA 3LYCA 3BH6B 3BH7B 3P4GA 4OJ6A 4KH3A 1CLWA 2VFMA 1QA3A 2VFNA 2VFQA 3SYJA 2VFPA 2F3LA 4OPWA 3LJYA 2BM5A 2BX6A 3SZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0Y A;  2BM7 A;  5JLV C;  2BM4 A;  2W7Z A;  2J8I A;  4JRA C;  5JMC B;  2F3L A;  3N90 A;  2BM5 A;  2BM6 A; 
#chains in the Genus database with same CATH topology
 3GQ8 A;  1JTA A;  3KRG A;  2W7Z A;  1O8D A;  2O6W A;  2X6X A;  4XLA A;  4YCQ A;  4HWV A;  2XT4 A;  4YFO A;  4Z05 A;  2J8K A;  1QCX A;  1QQ1 A;  1KCD A;  1OGO X;  1NHC A;  4YZX A;  4I84 A;  1LLZ A;  2INV A;  4U49 A;  4NK6 A;  2NT9 A;  4OZY A;  1O8L A;  4MXN A;  1KTW A;  2O04 A;  1PXZ A;  2VJI A;  1TSP A;  3VMV A;  1LM1 A;  1CZF A;  2VBE A;  2BM4 A;  4URR A;  4YEL A;  4XLC A;  2O0V A;  3BH6 B;  4XOR A;  4XKV A;  1O8K A;  4YEJ A;  4KH3 A;  1CLW A;  4Z06 A;  1QA3 A;  4YZA A;  2UVF A;  2VFQ A;  3SYJ A;  3WWG A;  2QX3 A;  2VFP A;  1O8M A;  1O8H A;  3LJY A;  2BM5 A;  2V5I A;  3SQV A;  4XON A;  1O8I A;  4YDT A;  1O88 A;  2G0Y A;  1TYU A;  1DBG A;  2BSP A;  1QRC A;  2O17 A;  1AIR A;  1TYW A;  1JRG A;  4U4B A;  2VBM A;  1WMR A;  2NST A;  3TH0 A;  4XMY A;  2O1D A;  2EWE A;  2VFO A;  3GQA A;  3N6Z A;  1XG2 A;  2BM7 A;  3SY2 A;  4Z03 A;  1IDJ A;  1GQ8 A;  4OJO A;  3H09 A;  3NAW A;  1HF2 A;  1QA1 A;  2B0R A;  1BHE A;  3PET A;  2NSP A;  1OFD A;  1H80 A;  3B90 A;  3VST A;  3PSS A;  4MR0 A;  2XTY A;  3PSZ A;  2O0W A;  1K5C A;  1OFL A;  3P4G A;  2X3H A;  3EQN A;  1OFE A;  2VFM A;  4XM3 A;  3VMW A;  2ODL A;  2VJJ A;  2QZA A;  2F3L A;  3ZSC A;  3UW0 A;  2INU A;  1RU4 A;  1QA2 A;  2PEC A;  3LMW A;  1HG8 A;  3T9G A;  4W8R A;  1OFM A;  3RIQ A;  4XN0 A;  4OJ5 A;  4XOT A;  4XOP A;  1X0C A;  1IB4 A;  1DBO A;  1OGM X;  3VSU A;  5JLV C;  4W8T A;  4JRA C;  4XLH A;  1VBL A;  2XC1 A;  3SZE A;  1TYV A;  1EE6 A;  3AK5 A;  3NB2 A;  1QRB A;  2BM6 A;  3DU1 X;  4NK8 A;  1WXR A;  1K4Z A;  1DAB A;  1OOC A;  3JX8 A;  3SUC A;  1EZG A;  4OM9 A;  5DNS A;  3LYC A;  2XT2 A;  4XR6 A;  2NTQ A;  4OJ6 A;  4YEI A;  2Z8G A;  5AMV A;  1RWR A;  2PYH A;  4PMH A;  5C1E A;  2IQ7 A;  1L1I A;  4XLF A;  3EQO A;  2BX6 A;  1TYX A;  3FY3 A;  1LLW A;  2NZM A;  2QYU A;  4W8S A;  1KQ5 A;  2VBK A;  3B8Y A;  2UVE A;  2XTX A;  2YUH A;  4EW9 A;  1O8F A;  4XQF A;  2J8I A;  1QJV A;  2NTB A;  4W8Q A;  3VSV A;  4XKW A;  2X85 A;  1IA5 A;  1O8J A;  1O8G A;  4OJL A;  2NTP A;  5JMC B;  3ZPP A;  1PE9 A;  3GRH A;  3N90 A;  4OZZ A;  1K8F A;  2NT6 A;  4XNF A;  4V02 C;  3ML3 A;  4C2L A;  2X6W A;  4YZ0 A;  2QY1 A;  3B4N A;  3JUR A;  4YZQ A;  2IOU G;  2XTW A;  2X6Y A;  4OJP A;  4AVZ A;  3GQ7 A;  2PYG A;  3BH7 B;  4XN3 A;  4XLE A;  1KCC A;  1EA0 A;  1PLU A;  1IDK A;  1O8E A;  4XL9 A;  2QXZ A;  2VFN A;  1BN8 A;  3GQ9 A;  1RMG A;  5C1C A;  4OPW A;  4YC5 A; 
#chains in the Genus database with same CATH homology
 2G0Y A;  1KQ5 A;  1TYU A;  2YUH A;  1QA2 A;  1QRC A;  1TYW A;  2V5I A;  2W7Z A;  2J8I A;  3AK5 A;  3TH0 A;  3RIQ A;  4OJ5 A;  1QQ1 A;  2VFO A;  3N6Z A;  2BM7 A;  5JLV C;  4OJL A;  4OJO A;  3H09 A;  4JRA C;  2XC1 A;  1HF2 A;  5JMC B;  1TYV A;  2B0R A;  3N90 A;  3PET A;  1QA1 A;  1QRB A;  2BM6 A;  1K8F A;  1WXR A;  1K4Z A;  1TSP A;  4V02 C;  1DAB A;  3ML3 A;  2BM4 A;  1TYX A;  3JX8 A;  4OM9 A;  2IOU G;  4OJP A;  3LYC A;  3BH6 B;  3BH7 B;  3P4G A;  4OJ6 A;  4KH3 A;  1CLW A;  2VFM A;  1QA3 A;  2VFN A;  2VFQ A;  3SYJ A;  2VFP A;  2F3L A;  4OPW A;  3LJY A;  2BM5 A;  2BX6 A;  3SZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...