2J8IA

Structure of np275, a pentapeptide repeat protein from nostoc punctiforme
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
b'GLVPRGSHMDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAILHGAMLDEANLQQANLSRADLSGATLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NP275
publication title Structural Characterization of the Fusion of Two Pentapeptide Repeat Proteins, Np275 and Np276, from Nostoc Punctiforme: Resurrection of an Ancestral Protein.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Toxin
total genus 38
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2j8iA01
2BM6A 2BM5A 2J8IA 3N90A 5JMCB 2BM7A 2W7ZA 5JLVC 2G0YA 2BM4A 4JRAC 2F3LA
chains in the Genus database with same CATH superfamily
2X3HA 4EW9A 2VFQA 1LLWA 3JX8A 3N90A 2VBEA 2XT2A 4AVZA 1CZFA 4OPWA 1OFMA 1DBGA 4YZAA 4YEJA 1RMGA 4XOPA 2XTXA 1HG8A 4MR0A 3JURA 5C1EA 3N6ZA 2J8IA 4NK8A 4XKWA 3PSSA 4Z06A 1KQ5A 4XOTA 1DABA 2QXZA 3VSVA 1TYWA 3WWGA 1XG2A 2PYHA 1EA0A 4XMYA 1X0CA 4XR6A 4Z03A 4JRAC 1CLWA 2J8KA 4YCQA 1O8HA 1PXZA 2QYUA 1HF2A 3H09A 2B0RA 1TYXA 1JTAA 4OZYA 4W8RA 4YEIA 1WMRA 2V5IA 3LJYA 3EQOA 1PLUA 1OFLA 4KH3A 1QA3A 1PE9A 2NT9A 3NAWA 2XC1A 4XLCA 4W8TA 1O8IA 1O8DA 3LMWA 4XM3A 1DBOA 5JLVC 3SZEA 2EWEA 2XT4A 3UW0A 2NTBA 4C2LA 1LLZA 2O0WA 1NHCA 2BM7A 3GQ9A 3DU1X 3GQ7A 1RWRA 2BM5A 2NT6A 4XN0A 1AIRA 1VBLA 4XLAA 1OGMX 3VMWA 1H80A 1BN8A 3LYCA 4URRA 2UVFA 4XNFA 4YDTA 3SUCA 1O8GA 4OJ6A 5AMVA 4YELA 1TYUA 2BSPA 1L1IA 3GQ8A 1JRGA 1O8JA 2UVEA 2X6YA 5JMCB 2VBKA 2Z8GA 1K8FA 3SY2A 3ZPPA 3ML3A 2VJIA 2O04A 1O8MA 3SYJA 3T9GA 1QRBA 1QRCA 2NSPA 2XTWA 2IOUG 1OOCA 2PYGA 1EZGA 1KCDA 4PMHA 4XLEA 2O17A 5DNSA 2VBMA 4YZ0A 1IDJA 4XN3A 2VFPA 2VFMA 4U49A 2NSTA 3VMVA 2BM4A 4HWVA 2X6XA 2O0VA 1O8EA 3FY3A 1O8FA 1IDKA 4YZXA 3PETA 4NK6A 4OM9A 2ODLA 2VFNA 4OJOA 3RIQA 5C1CA 2QZAA 3TH0A 2XTYA 2BM6A 2BX6A 2INVA 4Z05A 2QX3A 1TSPA 3B4NA 3KRGA 4OJPA 4XLFA 3B90A 1O88A 3BH6B 4W8SA 4XLHA 2F3LA 4XL9A 2X6WA 2X85A 3SQVA 3GRHA 3AK5A 3NB2A 1QCXA 1QJVA 4YC5A 3B8YA 4XONA 2G0YA 4YZQA 4YFOA 1IB4A 4MXNA 3VSTA 2IQ7A 1K5CA 4W8QA 4XQFA 2VFOA 1WXRA 1K4ZA 1GQ8A 2W7ZA 1TYVA 1KTWA 4OJLA 1LM1A 1O8KA 2NTQA 3EQNA 2NTPA 1BHEA 4OZZA 1QA2A 3P4GA 1OGOX 2O6WA 1KCCA 3PSZA 3VSUA 3ZSCA 4V02C 1RU4A 2PECA 1O8LA 1EE6A 1QQ1A 4XORA 1OFDA 3GQAA 2QY1A 2NZMA 2INUA 1QA1A 4OJ5A 3BH7B 4I84A 1IA5A 2YUHA 4XKVA 2O1DA 2VJJA 4U4BA 1OFEA
chains in the Genus database with same CATH topology
3ML3A 4KH3A 2VFQA 2XC1A 3JX8A 3N90A 3AK5A 3SYJA 4OPWA 1QRBA 1QRCA 5JLVC 2IOUG 2G0YA 3SZEA 3N6ZA 2J8IA 2VFOA 2BM7A 1K4ZA 2VFMA 2VFPA 1TYVA 2W7ZA 3BH7B 1WXRA 2BM5A 2BM4A 1KQ5A 4OJLA 1DABA 1QA2A 3P4GA 1TYWA 3LYCA 3PETA 4V02C 4OM9A 3RIQA 2VFNA 4OJOA 4OJ6A 1QQ1A 1CLWA 4JRAC 3TH0A 2BM6A 1TYUA 2BX6A 1HF2A 1QA1A 3H09A 1TSPA 4OJPA 5JMCB 2B0RA 1TYXA 3BH6B 2V5IA 1K8FA 3LJYA 4OJ5A 2YUHA 2F3LA 1QA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM6 A;  2BM5 A;  2J8I A;  3N90 A;  5JMC B;  2BM7 A;  2W7Z A;  5JLV C;  2G0Y A;  2BM4 A;  4JRA C;  2F3L A; 
#chains in the Genus database with same CATH topology
 2X3H A;  4EW9 A;  2VFQ A;  1LLW A;  3JX8 A;  3N90 A;  2VBE A;  2XT2 A;  4AVZ A;  1CZF A;  4OPW A;  1OFM A;  1DBG A;  4YZA A;  4YEJ A;  1RMG A;  4XOP A;  2XTX A;  1HG8 A;  4MR0 A;  3JUR A;  5C1E A;  3N6Z A;  2J8I A;  4NK8 A;  4XKW A;  3PSS A;  4Z06 A;  1KQ5 A;  4XOT A;  1DAB A;  2QXZ A;  3VSV A;  1TYW A;  3WWG A;  1XG2 A;  2PYH A;  1EA0 A;  4XMY A;  1X0C A;  4XR6 A;  4Z03 A;  4JRA C;  1CLW A;  2J8K A;  4YCQ A;  1O8H A;  1PXZ A;  2QYU A;  1HF2 A;  3H09 A;  2B0R A;  1TYX A;  1JTA A;  4OZY A;  4W8R A;  4YEI A;  1WMR A;  2V5I A;  3LJY A;  3EQO A;  1PLU A;  1OFL A;  4KH3 A;  1QA3 A;  1PE9 A;  2NT9 A;  3NAW A;  2XC1 A;  4XLC A;  4W8T A;  1O8I A;  1O8D A;  3LMW A;  4XM3 A;  1DBO A;  5JLV C;  3SZE A;  2EWE A;  2XT4 A;  3UW0 A;  2NTB A;  4C2L A;  1LLZ A;  2O0W A;  1NHC A;  2BM7 A;  3GQ9 A;  3DU1 X;  3GQ7 A;  1RWR A;  2BM5 A;  2NT6 A;  4XN0 A;  1AIR A;  1VBL A;  4XLA A;  1OGM X;  3VMW A;  1H80 A;  1BN8 A;  3LYC A;  4URR A;  2UVF A;  4XNF A;  4YDT A;  3SUC A;  1O8G A;  4OJ6 A;  5AMV A;  4YEL A;  1TYU A;  2BSP A;  1L1I A;  3GQ8 A;  1JRG A;  1O8J A;  2UVE A;  2X6Y A;  5JMC B;  2VBK A;  2Z8G A;  1K8F A;  3SY2 A;  3ZPP A;  3ML3 A;  2VJI A;  2O04 A;  1O8M A;  3SYJ A;  3T9G A;  1QRB A;  1QRC A;  2NSP A;  2XTW A;  2IOU G;  1OOC A;  2PYG A;  1EZG A;  1KCD A;  4PMH A;  4XLE A;  2O17 A;  5DNS A;  2VBM A;  4YZ0 A;  1IDJ A;  4XN3 A;  2VFP A;  2VFM A;  4U49 A;  2NST A;  3VMV A;  2BM4 A;  4HWV A;  2X6X A;  2O0V A;  1O8E A;  3FY3 A;  1O8F A;  1IDK A;  4YZX A;  3PET A;  4NK6 A;  4OM9 A;  2ODL A;  2VFN A;  4OJO A;  3RIQ A;  5C1C A;  2QZA A;  3TH0 A;  2XTY A;  2BM6 A;  2BX6 A;  2INV A;  4Z05 A;  2QX3 A;  1TSP A;  3B4N A;  3KRG A;  4OJP A;  4XLF A;  3B90 A;  1O88 A;  3BH6 B;  4W8S A;  4XLH A;  2F3L A;  4XL9 A;  2X6W A;  2X85 A;  3SQV A;  3GRH A;  3AK5 A;  3NB2 A;  1QCX A;  1QJV A;  4YC5 A;  3B8Y A;  4XON A;  2G0Y A;  4YZQ A;  4YFO A;  1IB4 A;  4MXN A;  3VST A;  2IQ7 A;  1K5C A;  4W8Q A;  4XQF A;  2VFO A;  1WXR A;  1K4Z A;  1GQ8 A;  2W7Z A;  1TYV A;  1KTW A;  4OJL A;  1LM1 A;  1O8K A;  2NTQ A;  3EQN A;  2NTP A;  1BHE A;  4OZZ A;  1QA2 A;  3P4G A;  1OGO X;  2O6W A;  1KCC A;  3PSZ A;  3VSU A;  3ZSC A;  4V02 C;  1RU4 A;  2PEC A;  1O8L A;  1EE6 A;  1QQ1 A;  4XOR A;  1OFD A;  3GQA A;  2QY1 A;  2NZM A;  2INU A;  1QA1 A;  4OJ5 A;  3BH7 B;  4I84 A;  1IA5 A;  2YUH A;  4XKV A;  2O1D A;  2VJJ A;  4U4B A;  1OFE A; 
#chains in the Genus database with same CATH homology
 3ML3 A;  4KH3 A;  2VFQ A;  2XC1 A;  3JX8 A;  3N90 A;  3AK5 A;  3SYJ A;  4OPW A;  1QRB A;  1QRC A;  5JLV C;  2IOU G;  2G0Y A;  3SZE A;  3N6Z A;  2J8I A;  2VFO A;  2BM7 A;  1K4Z A;  2VFM A;  2VFP A;  1TYV A;  2W7Z A;  3BH7 B;  1WXR A;  2BM5 A;  2BM4 A;  1KQ5 A;  4OJL A;  1DAB A;  1QA2 A;  3P4G A;  1TYW A;  3LYC A;  3PET A;  4V02 C;  4OM9 A;  3RIQ A;  2VFN A;  4OJO A;  4OJ6 A;  1QQ1 A;  1CLW A;  4JRA C;  3TH0 A;  2BM6 A;  1TYU A;  2BX6 A;  1HF2 A;  1QA1 A;  3H09 A;  1TSP A;  4OJP A;  5JMC B;  2B0R A;  1TYX A;  3BH6 B;  2V5I A;  1K8F A;  3LJY A;  4OJ5 A;  2YUH A;  2F3L A;  1QA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...