2J8IA

Structure of np275, a pentapeptide repeat protein from nostoc punctiforme
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
b'GLVPRGSHMDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAILHGAMLDEANLQQANLSRADLSGATLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NP275
molecule tags Toxin
source organism Nostoc punctiforme
publication title Structural Characterization of the Fusion of Two Pentapeptide Repeat Proteins, Np275 and Np276, from Nostoc Punctiforme: Resurrection of an Ancestral Protein.
pubmed doi rcsb
total genus 38
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2j8iA01
4JRAC 5JMCB 2BM5A 2BM7A 2J8IA 3N90A 2BM4A 2BM6A 2G0YA 2W7ZA 2F3LA 5JLVC
chains in the Genus database with same CATH superfamily
4MR0A 1O8JA 1IA5A 3SUCA 3BH6B 3ZSCA 2BM4A 4XQFA 2W7ZA 3AK5A 1O8IA 1RMGA 1QA3A 4C2LA 1JRGA 2QXZA 4OJ5A 4Z05A 3VMVA 3EQOA 1RWRA 2XT4A 4Z03A 4XLHA 1AIRA 2IOUG 2IQ7A 3N6ZA 1JTAA 1HF2A 1OGMX 3NAWA 2XTWA 1EE6A 2XC1A 2XT2A 4NK6A 3SQVA 2NZMA 3SZEA 2NSPA 4U49A 2NTPA 1DABA 1QA1A 1H80A 2X6XA 1TYWA 4NK8A 2YUHA 4V02C 1EA0A 4U4BA 1BHEA 1X0CA 4I84A 5DNSA 1QJVA 3N90A 2EWEA 1OGOX 3DU1X 4OJ6A 4W8QA 3LYCA 2NTBA 1IDJA 2XTXA 2PECA 2VFMA 4XLEA 5C1EA 4AVZA 1IB4A 2O0VA 1TYXA 4OJLA 4YFOA 1PLUA 3SY2A 4XNFA 4XONA 1OOCA 2VBKA 3NB2A 2PYHA 4PMHA 3WWGA 4OJOA 4W8RA 2ODLA 4XLFA 5C1CA 1XG2A 3LJYA 4YZAA 4HWVA 2INVA 3GQ7A 3BH7B 4XL9A 1PXZA 4XOTA 4OZYA 3VSTA 2G0YA 1K8FA 3KRGA 1O88A 2NT6A 4YC5A 2QZAA 2BM5A 2J8IA 2J8KA 2QY1A 2NSTA 1CLWA 3P4GA 1LLZA 1O8EA 2QX3A 4OM9A 3RIQA 2BX6A 1DBOA 4W8SA 1KCDA 1O8GA 2BM7A 3JX8A 2X3HA 2BM6A 2O1DA 2X6YA 2VFNA 4YZ0A 3B4NA 4XMYA 1L1IA 1O8MA 3PSSA 5JLVC 1EZGA 4YCQA 4XKWA 4Z06A 2VBMA 1KQ5A 3GRHA 1CZFA 2X85A 2V5IA 1QA2A 1K5CA 1O8FA 4XLAA 4KH3A 4YELA 3PETA 2VFPA 1K4ZA 2O6WA 2X6WA 2VFOA 1QCXA 1TSPA 3T9GA 1O8DA 1NHCA 4XN0A 2O0WA 2UVFA 1PE9A 1WMRA 1OFMA 2UVEA 2VJIA 3TH0A 3VSVA 2Z8GA 4YZXA 1RU4A 1KTWA 2VBEA 4W8TA 1KCCA 2QYUA 3VSUA 1WXRA 3ML3A 1OFEA 2O04A 4XN3A 4XKVA 2VFQA 4XORA 4OJPA 1TYUA 1QRCA 1VBLA 4MXNA 3B90A 2O17A 5AMVA 1HG8A 2INUA 1BN8A 3GQAA 5JMCB 3EQNA 1O8LA 3PSZA 4XM3A 3SYJA 2XTYA 2VJJA 4OPWA 4YDTA 3UW0A 2B0RA 1O8KA 4URRA 4YEJA 4XR6A 3VMWA 2NT9A 1O8HA 1LM1A 2PYGA 1IDKA 1DBGA 1OFLA 2NTQA 3FY3A 2BSPA 4EW9A 4XOPA 4YEIA 4JRAC 1QRBA 1QQ1A 1GQ8A 1OFDA 4OZZA 1LLWA 3LMWA 4YZQA 4XLCA 3H09A 3ZPPA 3JURA 3GQ9A 3GQ8A 3B8YA 1TYVA 2F3LA
chains in the Genus database with same CATH topology
3ML3A 1TYXA 2BM7A 3BH6B 4OJLA 2VFQA 2BM4A 3JX8A 2BM6A 2W7ZA 1TYUA 1QRCA 2VFNA 4OJPA 3AK5A 1QA3A 4OJ5A 4OJOA 5JLVC 5JMCB 1KQ5A 3LJYA 2V5IA 1QA2A 2IOUG 3BH7B 4KH3A 3SYJA 3N6ZA 4OPWA 1HF2A 3PETA 2VFPA 1K4ZA 2B0RA 2XC1A 2VFOA 2G0YA 3SZEA 1K8FA 1DABA 1TSPA 1QA1A 1TYWA 2YUHA 4JRAC 4V02C 1QRBA 2BM5A 2J8IA 3P4GA 1CLWA 3N90A 4OJ6A 1QQ1A 1WXRA 3LYCA 3TH0A 3H09A 4OM9A 3RIQA 2VFMA 2BX6A 1TYVA 2F3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRA C;  5JMC B;  2BM5 A;  2BM7 A;  2J8I A;  3N90 A;  2BM4 A;  2BM6 A;  2G0Y A;  2W7Z A;  2F3L A;  5JLV C; 
#chains in the Genus database with same CATH topology
 4MR0 A;  1O8J A;  1IA5 A;  3SUC A;  3BH6 B;  3ZSC A;  2BM4 A;  4XQF A;  2W7Z A;  3AK5 A;  1O8I A;  1RMG A;  1QA3 A;  4C2L A;  1JRG A;  2QXZ A;  4OJ5 A;  4Z05 A;  3VMV A;  3EQO A;  1RWR A;  2XT4 A;  4Z03 A;  4XLH A;  1AIR A;  2IOU G;  2IQ7 A;  3N6Z A;  1JTA A;  1HF2 A;  1OGM X;  3NAW A;  2XTW A;  1EE6 A;  2XC1 A;  2XT2 A;  4NK6 A;  3SQV A;  2NZM A;  3SZE A;  2NSP A;  4U49 A;  2NTP A;  1DAB A;  1QA1 A;  1H80 A;  2X6X A;  1TYW A;  4NK8 A;  2YUH A;  4V02 C;  1EA0 A;  4U4B A;  1BHE A;  1X0C A;  4I84 A;  5DNS A;  1QJV A;  3N90 A;  2EWE A;  1OGO X;  3DU1 X;  4OJ6 A;  4W8Q A;  3LYC A;  2NTB A;  1IDJ A;  2XTX A;  2PEC A;  2VFM A;  4XLE A;  5C1E A;  4AVZ A;  1IB4 A;  2O0V A;  1TYX A;  4OJL A;  4YFO A;  1PLU A;  3SY2 A;  4XNF A;  4XON A;  1OOC A;  2VBK A;  3NB2 A;  2PYH A;  4PMH A;  3WWG A;  4OJO A;  4W8R A;  2ODL A;  4XLF A;  5C1C A;  1XG2 A;  3LJY A;  4YZA A;  4HWV A;  2INV A;  3GQ7 A;  3BH7 B;  4XL9 A;  1PXZ A;  4XOT A;  4OZY A;  3VST A;  2G0Y A;  1K8F A;  3KRG A;  1O88 A;  2NT6 A;  4YC5 A;  2QZA A;  2BM5 A;  2J8I A;  2J8K A;  2QY1 A;  2NST A;  1CLW A;  3P4G A;  1LLZ A;  1O8E A;  2QX3 A;  4OM9 A;  3RIQ A;  2BX6 A;  1DBO A;  4W8S A;  1KCD A;  1O8G A;  2BM7 A;  3JX8 A;  2X3H A;  2BM6 A;  2O1D A;  2X6Y A;  2VFN A;  4YZ0 A;  3B4N A;  4XMY A;  1L1I A;  1O8M A;  3PSS A;  5JLV C;  1EZG A;  4YCQ A;  4XKW A;  4Z06 A;  2VBM A;  1KQ5 A;  3GRH A;  1CZF A;  2X85 A;  2V5I A;  1QA2 A;  1K5C A;  1O8F A;  4XLA A;  4KH3 A;  4YEL A;  3PET A;  2VFP A;  1K4Z A;  2O6W A;  2X6W A;  2VFO A;  1QCX A;  1TSP A;  3T9G A;  1O8D A;  1NHC A;  4XN0 A;  2O0W A;  2UVF A;  1PE9 A;  1WMR A;  1OFM A;  2UVE A;  2VJI A;  3TH0 A;  3VSV A;  2Z8G A;  4YZX A;  1RU4 A;  1KTW A;  2VBE A;  4W8T A;  1KCC A;  2QYU A;  3VSU A;  1WXR A;  3ML3 A;  1OFE A;  2O04 A;  4XN3 A;  4XKV A;  2VFQ A;  4XOR A;  4OJP A;  1TYU A;  1QRC A;  1VBL A;  4MXN A;  3B90 A;  2O17 A;  5AMV A;  1HG8 A;  2INU A;  1BN8 A;  3GQA A;  5JMC B;  3EQN A;  1O8L A;  3PSZ A;  4XM3 A;  3SYJ A;  2XTY A;  2VJJ A;  4OPW A;  4YDT A;  3UW0 A;  2B0R A;  1O8K A;  4URR A;  4YEJ A;  4XR6 A;  3VMW A;  2NT9 A;  1O8H A;  1LM1 A;  2PYG A;  1IDK A;  1DBG A;  1OFL A;  2NTQ A;  3FY3 A;  2BSP A;  4EW9 A;  4XOP A;  4YEI A;  4JRA C;  1QRB A;  1QQ1 A;  1GQ8 A;  1OFD A;  4OZZ A;  1LLW A;  3LMW A;  4YZQ A;  4XLC A;  3H09 A;  3ZPP A;  3JUR A;  3GQ9 A;  3GQ8 A;  3B8Y A;  1TYV A;  2F3L A; 
#chains in the Genus database with same CATH homology
 3ML3 A;  1TYX A;  2BM7 A;  3BH6 B;  4OJL A;  2VFQ A;  2BM4 A;  3JX8 A;  2BM6 A;  2W7Z A;  1TYU A;  1QRC A;  2VFN A;  4OJP A;  3AK5 A;  1QA3 A;  4OJ5 A;  4OJO A;  5JLV C;  5JMC B;  1KQ5 A;  3LJY A;  2V5I A;  1QA2 A;  2IOU G;  3BH7 B;  4KH3 A;  3SYJ A;  3N6Z A;  4OPW A;  1HF2 A;  3PET A;  2VFP A;  1K4Z A;  2B0R A;  2XC1 A;  2VFO A;  2G0Y A;  3SZE A;  1K8F A;  1DAB A;  1TSP A;  1QA1 A;  1TYW A;  2YUH A;  4JRA C;  4V02 C;  1QRB A;  2BM5 A;  2J8I A;  3P4G A;  1CLW A;  3N90 A;  4OJ6 A;  1QQ1 A;  1WXR A;  3LYC A;  3TH0 A;  3H09 A;  4OM9 A;  3RIQ A;  2VFM A;  2BX6 A;  1TYV A;  2F3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...