4NK6A

Crystal structure of the periplasmic alginate epimerase algg
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
424
structure length
407
Chain Sequence
b'EMAKPVLPDLSGYTTEAALIARNKPGKITVARMMEETGLEFIGGDNMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVETGIFEIDSTKELRLSQEGSFIVSEGMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIATKMASMGYNQSSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTHGIIISREVDNSFIFRNSHNNLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
publication title Catalytic Mechanism and Mode of Action of the Periplasmic Alginate Epimerase AlgG.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
total genus 157
structure length 407
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4nk6A00
4XOTA 2NTQA 2PYHA 1RWRA 3B8YA 4XL9A 1KCDA 4XM3A 1IDKA 1PE9A 2X6XA 1O8HA 2NTPA 4XKVA 4NK6A 1EE6A 4XLAA 1JRGA 1O8DA 2VBMA 4OJ6A 2BSPA 3JURA 3T9GA 1O88A 4XN0A 3VSUA 1H80A 2X3HA 3UW0A 2VBKA 4XLHA 4HWVA 2NSPA 5C1EA 1BHEA 2PYGA 2VJJA 2QX3A 1HG8A 3GQ9A 1X0CA 1IDJA 2NZMA 1RMGA 1AIRA 4YZQA 1DBGA 4OJPA 4W8SA 4Z05A 4W8QA 4Z03A 3ZPPA 2NT6A 4W8TA 3SUCA 2X85A 4XN3A 2INUA 4OZYA 4YELA 2ODLA 2O0VA 1PLUA 2NT9A 4XLCA 3KRGA 3EQOA 2NSTA 4XKWA 3GRHA 3VMWA 1IB4A 1KTWA 2QY1A 4XOPA 3GQAA 4Z06A 4XORA 2UVEA 1O8JA 4EW9A 1O8FA 4XLFA 3VMVA 2IQ7A 1NHCA 2INVA 4YZAA 1XG2A 1GQ8A 1O8GA 3VSTA 1JTAA 1IA5A 2UVFA 2VBEA 1O8LA 1O8KA 1VBLA 4XNFA 1K5CA 2X6WA 1CZFA 1O8IA 2PECA 4C2LA 2O04A 4PMHA 3GQ7A 1RU4A 4U49A 1WMRA 4NK8A 4OJ5A 4XLEA 5AMVA 2O1DA 5C1CA 3WWGA 2X6YA 2O17A 1DBOA 3GQ8A 4XONA 4XQFA 1QCXA 3B90A 2NTBA 4W8RA 1OFLA 1KCCA 1OOCA 3B4NA 1O8EA 1QJVA 4AVZA 2QXZA 4URRA 4U4BA 4MR0A 1OGOX 4OJOA 4XMYA 1O8MA 4MXNA 1OFMA 2VJIA 1PXZA 1OGMX 3FY3A 1BN8A 4I84A 4YZXA 3EQNA 3VSVA 4XR6A 4OZZA 2O0WA 3ZSCA 2EWEA 4YEJA 4OJLA 2Z8GA 4YZ0A 3LMWA
chains in the Genus database with same CATH superfamily
4XOTA 5JMCB 2NTQA 2PYHA 1RWRA 2XC1A 3B8YA 4XL9A 1KCDA 4XM3A 3H09A 1IDKA 1PE9A 1TYVA 2X6XA 3SQVA 1O8HA 2NTPA 4XKVA 4YFOA 4NK6A 3SZEA 1EE6A 4XLAA 1EA0A 1JRGA 2G0YA 3PETA 3N90A 1O8DA 2VBMA 4OJ6A 2BSPA 3JURA 3T9GA 5DNSA 1O88A 4XN0A 3VSUA 1H80A 2X3HA 2J8KA 2XTYA 1OFDA 4KH3A 3UW0A 2VBKA 4XLHA 4HWVA 5JLVC 2NSPA 5C1EA 1TYUA 3DU1X 1BHEA 1TSPA 4YEIA 2PYGA 2VJJA 2VFQA 2QX3A 1HG8A 1LM1A 3GQ9A 1X0CA 2BX6A 3BH6B 1IDJA 3SY2A 2NZMA 1RMGA 1AIRA 4YZQA 1DBGA 2O6WA 2XT4A 4JRAC 3BH7B 4OJPA 4W8SA 4Z05A 1KQ5A 4W8QA 4Z03A 3TH0A 1QA2A 3ZPPA 1LLZA 2NT6A 4W8TA 1K4ZA 2X85A 4XN3A 2INUA 3SUCA 2QYUA 4OZYA 2BM6A 1QQ1A 4YELA 2ODLA 2O0VA 1PLUA 2NT9A 4XLCA 3KRGA 3EQOA 2NSTA 2VFMA 4XKWA 1HF2A 2BM7A 3GRHA 2QZAA 3VMWA 1IB4A 1KTWA 2W7ZA 2QY1A 4XOPA 3GQAA 4Z06A 1QA1A 2F3LA 4XORA 2UVEA 1L1IA 1O8JA 3RIQA 2B0RA 4EW9A 1K8FA 2J8IA 1QRCA 1O8FA 4XLFA 3VMVA 2IQ7A 1NHCA 1OFEA 2INVA 4YZAA 1XG2A 1GQ8A 1O8GA 3VSTA 1JTAA 3NB2A 1IA5A 2UVFA 2BM5A 2VBEA 1O8LA 1O8KA 1VBLA 4OPWA 4XNFA 1K5CA 3AK5A 1CLWA 2X6WA 1CZFA 1O8IA 2PECA 4C2LA 2O04A 2IOUG 2XTWA 4PMHA 2BM4A 1RU4A 3GQ7A 4U49A 1WMRA 2VFNA 4NK8A 3LYCA 4OJ5A 1TYWA 4XLEA 2XTXA 2O1DA 5AMVA 3ML3A 3WWGA 5C1CA 2X6YA 2O17A 1DBOA 3GQ8A 4XONA 1EZGA 4XQFA 1QCXA 3B90A 2NTBA 1QRBA 4W8RA 1OFLA 1KCCA 1OOCA 3B4NA 3JX8A 3LJYA 1O8EA 1QJVA 3NAWA 4AVZA 2QXZA 4URRA 4OM9A 4U4BA 4MR0A 2V5IA 4V02C 1TYXA 1OGOX 4OJOA 3P4GA 4XMYA 4YCQA 1DABA 4YDTA 1O8MA 4MXNA 1LLWA 1OFMA 2YUHA 2VJIA 1PXZA 1OGMX 3FY3A 1BN8A 3PSZA 2VFOA 4I84A 4YZXA 4YC5A 3EQNA 2XT2A 3PSSA 3VSVA 1WXRA 2VFPA 4OZZA 4XR6A 2O0WA 3N6ZA 2EWEA 4YEJA 3ZSCA 1QA3A 4OJLA 2Z8GA 3SYJA 4YZ0A 3LMWA
chains in the Genus database with same CATH topology
4XOTA 2NTQA 2PYHA 1RWRA 3B8YA 4XL9A 1KCDA 4XM3A 1IDKA 1PE9A 2X6XA 1O8HA 2NTPA 4XKVA 4NK6A 1EE6A 4XLAA 1JRGA 1O8DA 2VBMA 4OJ6A 2BSPA 3JURA 3T9GA 1O88A 4XN0A 3VSUA 1H80A 2X3HA 3UW0A 2VBKA 4XLHA 4HWVA 2NSPA 5C1EA 1BHEA 2PYGA 2VJJA 2QX3A 1HG8A 3GQ9A 1X0CA 1IDJA 2NZMA 1RMGA 1AIRA 4YZQA 1DBGA 4OJPA 4W8SA 4Z05A 4W8QA 4Z03A 3ZPPA 2NT6A 4W8TA 3SUCA 2X85A 4XN3A 2INUA 4OZYA 4YELA 2ODLA 2O0VA 1PLUA 2NT9A 4XLCA 3KRGA 3EQOA 2NSTA 4XKWA 3GRHA 3VMWA 1IB4A 1KTWA 2QY1A 4XOPA 3GQAA 4Z06A 4XORA 2UVEA 1O8JA 4EW9A 1O8FA 4XLFA 3VMVA 2IQ7A 1NHCA 2INVA 4YZAA 1XG2A 1GQ8A 1O8GA 3VSTA 1JTAA 1IA5A 2UVFA 2VBEA 1O8LA 1O8KA 1VBLA 4XNFA 1K5CA 2X6WA 1CZFA 1O8IA 2PECA 4C2LA 2O04A 4PMHA 3GQ7A 1RU4A 4U49A 1WMRA 4NK8A 4OJ5A 4XLEA 5AMVA 2O1DA 5C1CA 3WWGA 2X6YA 2O17A 1DBOA 3GQ8A 4XONA 4XQFA 1QCXA 3B90A 2NTBA 4W8RA 1OFLA 1KCCA 1OOCA 3B4NA 1O8EA 1QJVA 4AVZA 2QXZA 4URRA 4U4BA 4MR0A 1OGOX 4OJOA 4XMYA 1O8MA 4MXNA 1OFMA 2VJIA 1PXZA 1OGMX 3FY3A 1BN8A 4I84A 4YZXA 3EQNA 3VSVA 4XR6A 4OZZA 2O0WA 3ZSCA 2EWEA 4YEJA 4OJLA 2Z8GA 4YZ0A 3LMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XOT A;  2NTQ A;  2PYH A;  1RWR A;  3B8Y A;  4XL9 A;  1KCD A;  4XM3 A;  1IDK A;  1PE9 A;  2X6X A;  1O8H A;  2NTP A;  4XKV A;  4NK6 A;  1EE6 A;  4XLA A;  1JRG A;  1O8D A;  2VBM A;  4OJ6 A;  2BSP A;  3JUR A;  3T9G A;  1O88 A;  4XN0 A;  3VSU A;  1H80 A;  2X3H A;  3UW0 A;  2VBK A;  4XLH A;  4HWV A;  2NSP A;  5C1E A;  1BHE A;  2PYG A;  2VJJ A;  2QX3 A;  1HG8 A;  3GQ9 A;  1X0C A;  1IDJ A;  2NZM A;  1RMG A;  1AIR A;  4YZQ A;  1DBG A;  4OJP A;  4W8S A;  4Z05 A;  4W8Q A;  4Z03 A;  3ZPP A;  2NT6 A;  4W8T A;  3SUC A;  2X85 A;  4XN3 A;  2INU A;  4OZY A;  4YEL A;  2ODL A;  2O0V A;  1PLU A;  2NT9 A;  4XLC A;  3KRG A;  3EQO A;  2NST A;  4XKW A;  3GRH A;  3VMW A;  1IB4 A;  1KTW A;  2QY1 A;  4XOP A;  3GQA A;  4Z06 A;  4XOR A;  2UVE A;  1O8J A;  4EW9 A;  1O8F A;  4XLF A;  3VMV A;  2IQ7 A;  1NHC A;  2INV A;  4YZA A;  1XG2 A;  1GQ8 A;  1O8G A;  3VST A;  1JTA A;  1IA5 A;  2UVF A;  2VBE A;  1O8L A;  1O8K A;  1VBL A;  4XNF A;  1K5C A;  2X6W A;  1CZF A;  1O8I A;  2PEC A;  4C2L A;  2O04 A;  4PMH A;  3GQ7 A;  1RU4 A;  4U49 A;  1WMR A;  4NK8 A;  4OJ5 A;  4XLE A;  5AMV A;  2O1D A;  5C1C A;  3WWG A;  2X6Y A;  2O17 A;  1DBO A;  3GQ8 A;  4XON A;  4XQF A;  1QCX A;  3B90 A;  2NTB A;  4W8R A;  1OFL A;  1KCC A;  1OOC A;  3B4N A;  1O8E A;  1QJV A;  4AVZ A;  2QXZ A;  4URR A;  4U4B A;  4MR0 A;  1OGO X;  4OJO A;  4XMY A;  1O8M A;  4MXN A;  1OFM A;  2VJI A;  1PXZ A;  1OGM X;  3FY3 A;  1BN8 A;  4I84 A;  4YZX A;  3EQN A;  3VSV A;  4XR6 A;  4OZZ A;  2O0W A;  3ZSC A;  2EWE A;  4YEJ A;  4OJL A;  2Z8G A;  4YZ0 A;  3LMW A; 
#chains in the Genus database with same CATH topology
 4XOT A;  5JMC B;  2NTQ A;  2PYH A;  1RWR A;  2XC1 A;  3B8Y A;  4XL9 A;  1KCD A;  4XM3 A;  3H09 A;  1IDK A;  1PE9 A;  1TYV A;  2X6X A;  3SQV A;  1O8H A;  2NTP A;  4XKV A;  4YFO A;  4NK6 A;  3SZE A;  1EE6 A;  4XLA A;  1EA0 A;  1JRG A;  2G0Y A;  3PET A;  3N90 A;  1O8D A;  2VBM A;  4OJ6 A;  2BSP A;  3JUR A;  3T9G A;  5DNS A;  1O88 A;  4XN0 A;  3VSU A;  1H80 A;  2X3H A;  2J8K A;  2XTY A;  1OFD A;  4KH3 A;  3UW0 A;  2VBK A;  4XLH A;  4HWV A;  5JLV C;  2NSP A;  5C1E A;  1TYU A;  3DU1 X;  1BHE A;  1TSP A;  4YEI A;  2PYG A;  2VJJ A;  2VFQ A;  2QX3 A;  1HG8 A;  1LM1 A;  3GQ9 A;  1X0C A;  2BX6 A;  3BH6 B;  1IDJ A;  3SY2 A;  2NZM A;  1RMG A;  1AIR A;  4YZQ A;  1DBG A;  2O6W A;  2XT4 A;  4JRA C;  3BH7 B;  4OJP A;  4W8S A;  4Z05 A;  1KQ5 A;  4W8Q A;  4Z03 A;  3TH0 A;  1QA2 A;  3ZPP A;  1LLZ A;  2NT6 A;  4W8T A;  1K4Z A;  2X85 A;  4XN3 A;  2INU A;  3SUC A;  2QYU A;  4OZY A;  2BM6 A;  1QQ1 A;  4YEL A;  2ODL A;  2O0V A;  1PLU A;  2NT9 A;  4XLC A;  3KRG A;  3EQO A;  2NST A;  2VFM A;  4XKW A;  1HF2 A;  2BM7 A;  3GRH A;  2QZA A;  3VMW A;  1IB4 A;  1KTW A;  2W7Z A;  2QY1 A;  4XOP A;  3GQA A;  4Z06 A;  1QA1 A;  2F3L A;  4XOR A;  2UVE A;  1L1I A;  1O8J A;  3RIQ A;  2B0R A;  4EW9 A;  1K8F A;  2J8I A;  1QRC A;  1O8F A;  4XLF A;  3VMV A;  2IQ7 A;  1NHC A;  1OFE A;  2INV A;  4YZA A;  1XG2 A;  1GQ8 A;  1O8G A;  3VST A;  1JTA A;  3NB2 A;  1IA5 A;  2UVF A;  2BM5 A;  2VBE A;  1O8L A;  1O8K A;  1VBL A;  4OPW A;  4XNF A;  1K5C A;  3AK5 A;  1CLW A;  2X6W A;  1CZF A;  1O8I A;  2PEC A;  4C2L A;  2O04 A;  2IOU G;  2XTW A;  4PMH A;  2BM4 A;  1RU4 A;  3GQ7 A;  4U49 A;  1WMR A;  2VFN A;  4NK8 A;  3LYC A;  4OJ5 A;  1TYW A;  4XLE A;  2XTX A;  2O1D A;  5AMV A;  3ML3 A;  3WWG A;  5C1C A;  2X6Y A;  2O17 A;  1DBO A;  3GQ8 A;  4XON A;  1EZG A;  4XQF A;  1QCX A;  3B90 A;  2NTB A;  1QRB A;  4W8R A;  1OFL A;  1KCC A;  1OOC A;  3B4N A;  3JX8 A;  3LJY A;  1O8E A;  1QJV A;  3NAW A;  4AVZ A;  2QXZ A;  4URR A;  4OM9 A;  4U4B A;  4MR0 A;  2V5I A;  4V02 C;  1TYX A;  1OGO X;  4OJO A;  3P4G A;  4XMY A;  4YCQ A;  1DAB A;  4YDT A;  1O8M A;  4MXN A;  1LLW A;  1OFM A;  2YUH A;  2VJI A;  1PXZ A;  1OGM X;  3FY3 A;  1BN8 A;  3PSZ A;  2VFO A;  4I84 A;  4YZX A;  4YC5 A;  3EQN A;  2XT2 A;  3PSS A;  3VSV A;  1WXR A;  2VFP A;  4OZZ A;  4XR6 A;  2O0W A;  3N6Z A;  2EWE A;  4YEJ A;  3ZSC A;  1QA3 A;  4OJL A;  2Z8G A;  3SYJ A;  4YZ0 A;  3LMW A; 
#chains in the Genus database with same CATH homology
 4XOT A;  2NTQ A;  2PYH A;  1RWR A;  3B8Y A;  4XL9 A;  1KCD A;  4XM3 A;  1IDK A;  1PE9 A;  2X6X A;  1O8H A;  2NTP A;  4XKV A;  4NK6 A;  1EE6 A;  4XLA A;  1JRG A;  1O8D A;  2VBM A;  4OJ6 A;  2BSP A;  3JUR A;  3T9G A;  1O88 A;  4XN0 A;  3VSU A;  1H80 A;  2X3H A;  3UW0 A;  2VBK A;  4XLH A;  4HWV A;  2NSP A;  5C1E A;  1BHE A;  2PYG A;  2VJJ A;  2QX3 A;  1HG8 A;  3GQ9 A;  1X0C A;  1IDJ A;  2NZM A;  1RMG A;  1AIR A;  4YZQ A;  1DBG A;  4OJP A;  4W8S A;  4Z05 A;  4W8Q A;  4Z03 A;  3ZPP A;  2NT6 A;  4W8T A;  3SUC A;  2X85 A;  4XN3 A;  2INU A;  4OZY A;  4YEL A;  2ODL A;  2O0V A;  1PLU A;  2NT9 A;  4XLC A;  3KRG A;  3EQO A;  2NST A;  4XKW A;  3GRH A;  3VMW A;  1IB4 A;  1KTW A;  2QY1 A;  4XOP A;  3GQA A;  4Z06 A;  4XOR A;  2UVE A;  1O8J A;  4EW9 A;  1O8F A;  4XLF A;  3VMV A;  2IQ7 A;  1NHC A;  2INV A;  4YZA A;  1XG2 A;  1GQ8 A;  1O8G A;  3VST A;  1JTA A;  1IA5 A;  2UVF A;  2VBE A;  1O8L A;  1O8K A;  1VBL A;  4XNF A;  1K5C A;  2X6W A;  1CZF A;  1O8I A;  2PEC A;  4C2L A;  2O04 A;  4PMH A;  3GQ7 A;  1RU4 A;  4U49 A;  1WMR A;  4NK8 A;  4OJ5 A;  4XLE A;  5AMV A;  2O1D A;  5C1C A;  3WWG A;  2X6Y A;  2O17 A;  1DBO A;  3GQ8 A;  4XON A;  4XQF A;  1QCX A;  3B90 A;  2NTB A;  4W8R A;  1OFL A;  1KCC A;  1OOC A;  3B4N A;  1O8E A;  1QJV A;  4AVZ A;  2QXZ A;  4URR A;  4U4B A;  4MR0 A;  1OGO X;  4OJO A;  4XMY A;  1O8M A;  4MXN A;  1OFM A;  2VJI A;  1PXZ A;  1OGM X;  3FY3 A;  1BN8 A;  4I84 A;  4YZX A;  3EQN A;  3VSV A;  4XR6 A;  4OZZ A;  2O0W A;  3ZSC A;  2EWE A;  4YEJ A;  4OJL A;  2Z8G A;  4YZ0 A;  3LMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...