4NK6A

Crystal structure of the periplasmic alginate epimerase algg
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
424
structure length
407
Chain Sequence
EMAKPVLPDLSGYTTEAALIARNKPGKITVARMMEETGLEFIGGDNMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVETGIFEIDSTKELRLSQEGSFIVSEGMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIATKMASMGYNQSSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTHGIIISREVDNSFIFRNSHNNLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
publication title Catalytic Mechanism and Mode of Action of the Periplasmic Alginate Epimerase AlgG.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
total genus 157
structure length 407
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4nk6A00
2O0VA 1OOCA 2VJIA 1NHCA 2PECA 2X3HA 4MR0A 2IQ7A 4NK8A 1O8FA 2NTQA 1PE9A 4W8SA 3FY3A 4Z06A 1IDJA 1O8DA 2NT9A 2Z8GA 3LMWA 2VBMA 3VMVA 1KTWA 3GQ8A 4OJPA 4XKWA 4YZXA 4XLFA 1IDKA 4XN3A 4XNFA 3VSTA 1BHEA 4XOPA 4XLAA 5AMVA 4OZZA 1O8MA 1WMRA 2PYHA 4XQFA 2QXZA 4U4BA 1O8GA 2X6YA 4HWVA 3T9GA 2NTPA 1PLUA 1AIRA 3VSVA 4YZ0A 3UW0A 1H80A 1QJVA 4OJ5A 4EW9A 4XM3A 3WWGA 2NT6A 2QX3A 4U49A 1BN8A 2O04A 1JTAA 2UVFA 4OJ6A 2INVA 4XL9A 2BSPA 1OFMA 1O88A 1O8IA 2VBKA 1O8KA 2ODLA 4XN0A 3JURA 2EWEA 5C1EA 4Z03A 4Z05A 1O8LA 4W8RA 4XLHA 4XLEA 2UVEA 1KCDA 2PYGA 2NSTA 2NTBA 3EQOA 1DBOA 4NK6A 4MXNA 4OJLA 3B4NA 3GQ9A 4PMHA 1O8HA 3GRHA 4YEJA 3SUCA 1IB4A 3ZPPA 2O1DA 1O8JA 3GQAA 1PXZA 4OJOA 1JRGA 4YZAA 1OFLA 4YELA 1X0CA 1HG8A 2X6WA 4C2LA 1RU4A 4W8TA 2NZMA 1RMGA 4I84A 1OGOX 1QCXA 2VBEA 2NSPA 3EQNA 1EE6A 2X85A 3GQ7A 1VBLA 4URRA 2O17A 3B8YA 3KRGA 4YZQA 1RWRA 4XLCA 1GQ8A 2INUA 1OGMX 2VJJA 5C1CA 4XONA 4XR6A 2QY1A 4XMYA 1O8EA 4AVZA 1KCCA 1K5CA 3B90A 2X6XA 1DBGA 3VSUA 1XG2A 4XKVA 4OZYA 1IA5A 3VMWA 3ZSCA 2O0WA 1CZFA 4XOTA 4W8QA 4XORA
chains in the Genus database with same CATH superfamily
2O0VA 1OOCA 2VJIA 3BH6B 1NHCA 2PECA 2X3HA 3NB2A 2IQ7A 4MR0A 4NK8A 1QRCA 1O8FA 2NTQA 1PE9A 3N90A 3FY3A 4W8SA 1OFEA 1IDJA 1O8DA 4YDTA 4Z06A 1EZGA 2NT9A 2Z8GA 2VBMA 2B0RA 3LMWA 3VMVA 1LM1A 1K4ZA 1K8FA 1KTWA 3GQ8A 4OJPA 4XKWA 4YZXA 1L1IA 4XLFA 1IDKA 4XN3A 4XNFA 3VSTA 1BHEA 3PSZA 4XOPA 4XLAA 5AMVA 4OZZA 1O8MA 1WMRA 2PYHA 4XQFA 2QXZA 4U4BA 1TYWA 1O8GA 2X6YA 4HWVA 3T9GA 2NTPA 1EA0A 1PLUA 1AIRA 3VSVA 4YZ0A 3UW0A 1KQ5A 1H80A 2BX6A 2IOUG 1QJVA 4OJ5A 5DNSA 4EW9A 3BH7B 4XM3A 3LYCA 3WWGA 2NT6A 2QX3A 2W7ZA 4U49A 1BN8A 2O04A 1JTAA 1QA1A 2UVFA 3TH0A 1TSPA 4OJ6A 1QRBA 2INVA 3SY2A 4XL9A 2BSPA 1OFMA 2VFOA 1O88A 1O8IA 2VBKA 1O8KA 2QZAA 2XT4A 2ODLA 4XN0A 3JURA 2EWEA 5C1EA 1LLWA 4Z03A 4Z05A 1O8LA 4W8RA 4XLHA 1QA2A 4XLEA 2UVEA 2G0YA 2BM5A 1KCDA 2PYGA 3P4GA 2NSTA 2BM4A 2NTBA 3EQOA 1DBOA 4JRAC 4MXNA 4NK6A 4OJLA 4YC5A 3B4NA 3GQ9A 4PMHA 1HF2A 1O8HA 1WXRA 3GRHA 4YEJA 3SUCA 2BM7A 1IB4A 3ZPPA 1LLZA 2O1DA 1O8JA 3GQAA 1PXZA 4OJOA 4OM9A 1JRGA 4YZAA 2VFNA 2F3LA 1OFLA 4YELA 1X0CA 3H09A 1TYVA 1HG8A 2V5IA 2X6WA 3RIQA 3N6ZA 4C2LA 2O6WA 1RU4A 1TYUA 3SYJA 4W8TA 4KH3A 2NZMA 1RMGA 2VFQA 2XTXA 2XTWA 4I84A 1DABA 1OGOX 1QCXA 5JLVC 3LJYA 2VBEA 3NAWA 2NSPA 2QYUA 3EQNA 1EE6A 2X85A 2XT2A 2J8IA 3GQ7A 3SZEA 5JMCB 1VBLA 4URRA 2O17A 2VFPA 3B8YA 3KRGA 4OPWA 4V02C 3JX8A 1RWRA 4XLCA 1GQ8A 2INUA 4YCQA 4YZQA 3SQVA 3DU1X 4YEIA 2XTYA 2YUHA 1TYXA 1OGMX 2VJJA 5C1CA 4XONA 2VFMA 3PSSA 4XR6A 2QY1A 4XMYA 1O8EA 4YFOA 4AVZA 1KCCA 3AK5A 2XC1A 1CLWA 1QQ1A 1K5CA 3B90A 2X6XA 1DBGA 3PETA 2BM6A 3VSUA 1XG2A 4XKVA 4OZYA 1IA5A 3VMWA 3ZSCA 2O0WA 1QA3A 1CZFA 4XOTA 1OFDA 3ML3A 4W8QA 4XORA 2J8KA
chains in the Genus database with same CATH topology
2O0VA 1OOCA 2VJIA 1NHCA 2PECA 2X3HA 4MR0A 2IQ7A 4NK8A 1O8FA 2NTQA 1PE9A 4W8SA 3FY3A 4Z06A 1IDJA 1O8DA 2NT9A 2Z8GA 3LMWA 2VBMA 3VMVA 1KTWA 3GQ8A 4OJPA 4XKWA 4YZXA 4XLFA 1IDKA 4XN3A 4XNFA 3VSTA 1BHEA 4XOPA 4XLAA 5AMVA 4OZZA 1O8MA 1WMRA 2PYHA 4XQFA 2QXZA 4U4BA 1O8GA 2X6YA 4HWVA 3T9GA 2NTPA 1PLUA 1AIRA 3VSVA 4YZ0A 3UW0A 1H80A 1QJVA 4OJ5A 4EW9A 4XM3A 3WWGA 2NT6A 2QX3A 4U49A 1BN8A 2O04A 1JTAA 2UVFA 4OJ6A 2INVA 4XL9A 2BSPA 1OFMA 1O88A 1O8IA 2VBKA 1O8KA 2ODLA 4XN0A 3JURA 2EWEA 5C1EA 4Z03A 4Z05A 1O8LA 4W8RA 4XLHA 4XLEA 2UVEA 1KCDA 2PYGA 2NSTA 2NTBA 3EQOA 1DBOA 4NK6A 4MXNA 4OJLA 3B4NA 3GQ9A 4PMHA 1O8HA 3GRHA 4YEJA 3SUCA 1IB4A 3ZPPA 2O1DA 1O8JA 3GQAA 1PXZA 4OJOA 1JRGA 4YZAA 1OFLA 4YELA 1X0CA 1HG8A 2X6WA 4C2LA 1RU4A 4W8TA 2NZMA 1RMGA 4I84A 1OGOX 1QCXA 2VBEA 2NSPA 3EQNA 1EE6A 2X85A 3GQ7A 1VBLA 4URRA 2O17A 3B8YA 3KRGA 4YZQA 1RWRA 4XLCA 1GQ8A 2INUA 1OGMX 2VJJA 5C1CA 4XONA 4XR6A 2QY1A 4XMYA 1O8EA 4AVZA 1KCCA 1K5CA 3B90A 2X6XA 1DBGA 3VSUA 1XG2A 4XKVA 4OZYA 1IA5A 3VMWA 3ZSCA 2O0WA 1CZFA 4XOTA 4W8QA 4XORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0V A;  1OOC A;  2VJI A;  1NHC A;  2PEC A;  2X3H A;  4MR0 A;  2IQ7 A;  4NK8 A;  1O8F A;  2NTQ A;  1PE9 A;  4W8S A;  3FY3 A;  4Z06 A;  1IDJ A;  1O8D A;  2NT9 A;  2Z8G A;  3LMW A;  2VBM A;  3VMV A;  1KTW A;  3GQ8 A;  4OJP A;  4XKW A;  4YZX A;  4XLF A;  1IDK A;  4XN3 A;  4XNF A;  3VST A;  1BHE A;  4XOP A;  4XLA A;  5AMV A;  4OZZ A;  1O8M A;  1WMR A;  2PYH A;  4XQF A;  2QXZ A;  4U4B A;  1O8G A;  2X6Y A;  4HWV A;  3T9G A;  2NTP A;  1PLU A;  1AIR A;  3VSV A;  4YZ0 A;  3UW0 A;  1H80 A;  1QJV A;  4OJ5 A;  4EW9 A;  4XM3 A;  3WWG A;  2NT6 A;  2QX3 A;  4U49 A;  1BN8 A;  2O04 A;  1JTA A;  2UVF A;  4OJ6 A;  2INV A;  4XL9 A;  2BSP A;  1OFM A;  1O88 A;  1O8I A;  2VBK A;  1O8K A;  2ODL A;  4XN0 A;  3JUR A;  2EWE A;  5C1E A;  4Z03 A;  4Z05 A;  1O8L A;  4W8R A;  4XLH A;  4XLE A;  2UVE A;  1KCD A;  2PYG A;  2NST A;  2NTB A;  3EQO A;  1DBO A;  4NK6 A;  4MXN A;  4OJL A;  3B4N A;  3GQ9 A;  4PMH A;  1O8H A;  3GRH A;  4YEJ A;  3SUC A;  1IB4 A;  3ZPP A;  2O1D A;  1O8J A;  3GQA A;  1PXZ A;  4OJO A;  1JRG A;  4YZA A;  1OFL A;  4YEL A;  1X0C A;  1HG8 A;  2X6W A;  4C2L A;  1RU4 A;  4W8T A;  2NZM A;  1RMG A;  4I84 A;  1OGO X;  1QCX A;  2VBE A;  2NSP A;  3EQN A;  1EE6 A;  2X85 A;  3GQ7 A;  1VBL A;  4URR A;  2O17 A;  3B8Y A;  3KRG A;  4YZQ A;  1RWR A;  4XLC A;  1GQ8 A;  2INU A;  1OGM X;  2VJJ A;  5C1C A;  4XON A;  4XR6 A;  2QY1 A;  4XMY A;  1O8E A;  4AVZ A;  1KCC A;  1K5C A;  3B90 A;  2X6X A;  1DBG A;  3VSU A;  1XG2 A;  4XKV A;  4OZY A;  1IA5 A;  3VMW A;  3ZSC A;  2O0W A;  1CZF A;  4XOT A;  4W8Q A;  4XOR A; 
#chains in the Genus database with same CATH topology
 2O0V A;  1OOC A;  2VJI A;  3BH6 B;  1NHC A;  2PEC A;  2X3H A;  3NB2 A;  2IQ7 A;  4MR0 A;  4NK8 A;  1QRC A;  1O8F A;  2NTQ A;  1PE9 A;  3N90 A;  3FY3 A;  4W8S A;  1OFE A;  1IDJ A;  1O8D A;  4YDT A;  4Z06 A;  1EZG A;  2NT9 A;  2Z8G A;  2VBM A;  2B0R A;  3LMW A;  3VMV A;  1LM1 A;  1K4Z A;  1K8F A;  1KTW A;  3GQ8 A;  4OJP A;  4XKW A;  4YZX A;  1L1I A;  4XLF A;  1IDK A;  4XN3 A;  4XNF A;  3VST A;  1BHE A;  3PSZ A;  4XOP A;  4XLA A;  5AMV A;  4OZZ A;  1O8M A;  1WMR A;  2PYH A;  4XQF A;  2QXZ A;  4U4B A;  1TYW A;  1O8G A;  2X6Y A;  4HWV A;  3T9G A;  2NTP A;  1EA0 A;  1PLU A;  1AIR A;  3VSV A;  4YZ0 A;  3UW0 A;  1KQ5 A;  1H80 A;  2BX6 A;  2IOU G;  1QJV A;  4OJ5 A;  5DNS A;  4EW9 A;  3BH7 B;  4XM3 A;  3LYC A;  3WWG A;  2NT6 A;  2QX3 A;  2W7Z A;  4U49 A;  1BN8 A;  2O04 A;  1JTA A;  1QA1 A;  2UVF A;  3TH0 A;  1TSP A;  4OJ6 A;  1QRB A;  2INV A;  3SY2 A;  4XL9 A;  2BSP A;  1OFM A;  2VFO A;  1O88 A;  1O8I A;  2VBK A;  1O8K A;  2QZA A;  2XT4 A;  2ODL A;  4XN0 A;  3JUR A;  2EWE A;  5C1E A;  1LLW A;  4Z03 A;  4Z05 A;  1O8L A;  4W8R A;  4XLH A;  1QA2 A;  4XLE A;  2UVE A;  2G0Y A;  2BM5 A;  1KCD A;  2PYG A;  3P4G A;  2NST A;  2BM4 A;  2NTB A;  3EQO A;  1DBO A;  4JRA C;  4MXN A;  4NK6 A;  4OJL A;  4YC5 A;  3B4N A;  3GQ9 A;  4PMH A;  1HF2 A;  1O8H A;  1WXR A;  3GRH A;  4YEJ A;  3SUC A;  2BM7 A;  1IB4 A;  3ZPP A;  1LLZ A;  2O1D A;  1O8J A;  3GQA A;  1PXZ A;  4OJO A;  4OM9 A;  1JRG A;  4YZA A;  2VFN A;  2F3L A;  1OFL A;  4YEL A;  1X0C A;  3H09 A;  1TYV A;  1HG8 A;  2V5I A;  2X6W A;  3RIQ A;  3N6Z A;  4C2L A;  2O6W A;  1RU4 A;  1TYU A;  3SYJ A;  4W8T A;  4KH3 A;  2NZM A;  1RMG A;  2VFQ A;  2XTX A;  2XTW A;  4I84 A;  1DAB A;  1OGO X;  1QCX A;  5JLV C;  3LJY A;  2VBE A;  3NAW A;  2NSP A;  2QYU A;  3EQN A;  1EE6 A;  2X85 A;  2XT2 A;  2J8I A;  3GQ7 A;  3SZE A;  5JMC B;  1VBL A;  4URR A;  2O17 A;  2VFP A;  3B8Y A;  3KRG A;  4OPW A;  4V02 C;  3JX8 A;  1RWR A;  4XLC A;  1GQ8 A;  2INU A;  4YCQ A;  4YZQ A;  3SQV A;  3DU1 X;  4YEI A;  2XTY A;  2YUH A;  1TYX A;  1OGM X;  2VJJ A;  5C1C A;  4XON A;  2VFM A;  3PSS A;  4XR6 A;  2QY1 A;  4XMY A;  1O8E A;  4YFO A;  4AVZ A;  1KCC A;  3AK5 A;  2XC1 A;  1CLW A;  1QQ1 A;  1K5C A;  3B90 A;  2X6X A;  1DBG A;  3PET A;  2BM6 A;  3VSU A;  1XG2 A;  4XKV A;  4OZY A;  1IA5 A;  3VMW A;  3ZSC A;  2O0W A;  1QA3 A;  1CZF A;  4XOT A;  1OFD A;  3ML3 A;  4W8Q A;  4XOR A;  2J8K A; 
#chains in the Genus database with same CATH homology
 2O0V A;  1OOC A;  2VJI A;  1NHC A;  2PEC A;  2X3H A;  4MR0 A;  2IQ7 A;  4NK8 A;  1O8F A;  2NTQ A;  1PE9 A;  4W8S A;  3FY3 A;  4Z06 A;  1IDJ A;  1O8D A;  2NT9 A;  2Z8G A;  3LMW A;  2VBM A;  3VMV A;  1KTW A;  3GQ8 A;  4OJP A;  4XKW A;  4YZX A;  4XLF A;  1IDK A;  4XN3 A;  4XNF A;  3VST A;  1BHE A;  4XOP A;  4XLA A;  5AMV A;  4OZZ A;  1O8M A;  1WMR A;  2PYH A;  4XQF A;  2QXZ A;  4U4B A;  1O8G A;  2X6Y A;  4HWV A;  3T9G A;  2NTP A;  1PLU A;  1AIR A;  3VSV A;  4YZ0 A;  3UW0 A;  1H80 A;  1QJV A;  4OJ5 A;  4EW9 A;  4XM3 A;  3WWG A;  2NT6 A;  2QX3 A;  4U49 A;  1BN8 A;  2O04 A;  1JTA A;  2UVF A;  4OJ6 A;  2INV A;  4XL9 A;  2BSP A;  1OFM A;  1O88 A;  1O8I A;  2VBK A;  1O8K A;  2ODL A;  4XN0 A;  3JUR A;  2EWE A;  5C1E A;  4Z03 A;  4Z05 A;  1O8L A;  4W8R A;  4XLH A;  4XLE A;  2UVE A;  1KCD A;  2PYG A;  2NST A;  2NTB A;  3EQO A;  1DBO A;  4NK6 A;  4MXN A;  4OJL A;  3B4N A;  3GQ9 A;  4PMH A;  1O8H A;  3GRH A;  4YEJ A;  3SUC A;  1IB4 A;  3ZPP A;  2O1D A;  1O8J A;  3GQA A;  1PXZ A;  4OJO A;  1JRG A;  4YZA A;  1OFL A;  4YEL A;  1X0C A;  1HG8 A;  2X6W A;  4C2L A;  1RU4 A;  4W8T A;  2NZM A;  1RMG A;  4I84 A;  1OGO X;  1QCX A;  2VBE A;  2NSP A;  3EQN A;  1EE6 A;  2X85 A;  3GQ7 A;  1VBL A;  4URR A;  2O17 A;  3B8Y A;  3KRG A;  4YZQ A;  1RWR A;  4XLC A;  1GQ8 A;  2INU A;  1OGM X;  2VJJ A;  5C1C A;  4XON A;  4XR6 A;  2QY1 A;  4XMY A;  1O8E A;  4AVZ A;  1KCC A;  1K5C A;  3B90 A;  2X6X A;  1DBG A;  3VSU A;  1XG2 A;  4XKV A;  4OZY A;  1IA5 A;  3VMW A;  3ZSC A;  2O0W A;  1CZF A;  4XOT A;  4W8Q A;  4XOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...