4NK6A

Crystal structure of the periplasmic alginate epimerase algg
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
424
structure length
407
Chain Sequence
EMAKPVLPDLSGYTTEAALIARNKPGKITVARMMEETGLEFIGGDNMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVETGIFEIDSTKELRLSQEGSFIVSEGMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIATKMASMGYNQSSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTHGIIISREVDNSFIFRNSHNNLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
publication title Catalytic Mechanism and Mode of Action of the Periplasmic Alginate Epimerase AlgG.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 157
structure length 407
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4nk6A00
2QX3A 1GQ8A 4YZ0A 1O8EA 2X85A 1HG8A 4OJ5A 4XONA 1JRGA 1O8KA 4OJ6A 4W8TA 1PE9A 4NK8A 4OJLA 4W8QA 1K5CA 2O04A 4OJPA 3VSVA 2O1DA 4XMYA 2NSPA 1JTAA 2VJIA 1BN8A 4PMHA 1O8JA 3VSTA 2O0VA 4I84A 2UVFA 4XQFA 1O8LA 1QJVA 3KRGA 1KCCA 3GQ7A 1DBOA 5AMVA 2O17A 1IDJA 2QY1A 2PECA 1WMRA 1IB4A 3EQNA 4XN3A 4Z06A 4YZQA 1RWRA 4URRA 4XNFA 2NT6A 1XG2A 1IA5A 1AIRA 4XKVA 4XLEA 4YELA 1O88A 2BSPA 4U4BA 2NTQA 2VBMA 4Z03A 2O0WA 2X6XA 4Z05A 3B8YA 4XN0A 1H80A 3ZSCA 2NZMA 4OZYA 2VJJA 4W8SA 1PLUA 1KTWA 4XLFA 2UVEA 2PYGA 1OGOX 4XL9A 1O8MA 4HWVA 4XOPA 1RU4A 4XOTA 4XORA 3GQ9A 3VMVA 1OFLA 2X6WA 4EW9A 4MR0A 1O8DA 1O8FA 1PXZA 5C1EA 2X6YA 4XM3A 4XLHA 3GRHA 4XR6A 3UW0A 4OZZA 3VMWA 4W8RA 4AVZA 1BHEA 3B4NA 3ZPPA 2NTPA 1OFMA 1RMGA 5C1CA 2NT9A 2QXZA 2IQ7A 2INUA 3B90A 4NK6A 2INVA 1DBGA 2VBEA 3JURA 4OJOA 1O8GA 3WWGA 4YZAA 1O8IA 4XLAA 1CZFA 1OOCA 4U49A 3VSUA 2PYHA 1KCDA 2X3HA 2VBKA 4MXNA 3EQOA 3GQ8A 4YZXA 1X0CA 4XLCA 3SUCA 1NHCA 2EWEA 4C2LA 2NSTA 2NTBA 1EE6A 1O8HA 3LMWA 3FY3A 3T9GA 2ODLA 4XKWA 1OGMX 1VBLA 1QCXA 3GQAA 4YEJA 1IDKA 2Z8GA
chains in the Genus database with same CATH superfamily
3SY2A 2QX3A 1GQ8A 4YZ0A 1O8EA 1DABA 1QQ1A 2X85A 1HG8A 4OJ5A 1CLWA 1HF2A 2VFPA 4YCQA 2O6WA 1JRGA 4XONA 1O8KA 4OJ6A 4W8TA 1PE9A 2XT4A 4NK8A 2B0RA 2XTWA 4OJLA 4W8QA 1K5CA 2BM6A 2J8KA 2O04A 3H09A 4OJPA 3VSVA 2O1DA 4XMYA 2NSPA 1JTAA 2V5IA 2VJIA 1BN8A 3NB2A 4PMHA 1O8JA 2VFNA 3VSTA 2O0VA 4I84A 3P4GA 2UVFA 4XQFA 1O8LA 4OM9A 1QJVA 3KRGA 1KCCA 3GQ7A 4KH3A 1DBOA 5AMVA 2IOUG 2O17A 1IDJA 3DU1X 2QY1A 1QRCA 2PECA 1WMRA 2VFOA 1IB4A 3EQNA 4XN3A 1OFEA 4Z06A 1LLWA 2VFMA 1RWRA 3BH7B 4URRA 4YZQA 4XNFA 4YEIA 2NT6A 2QZAA 1XG2A 1IA5A 1AIRA 5DNSA 3RIQA 2XT2A 4XKVA 4XLEA 4YDTA 4YELA 1O88A 2BSPA 3BH6B 4U4BA 2NTQA 2VBMA 1QA1A 4Z03A 2O0WA 2XTXA 2X6XA 1TSPA 4Z05A 3B8YA 4XN0A 3SYJA 3N90A 1H80A 3ZSCA 2NZMA 2F3LA 4OZYA 2VJJA 4W8SA 1PLUA 1KTWA 4XLFA 1WXRA 2UVEA 1EZGA 1LM1A 2PYGA 5JMCB 1OGOX 4XL9A 1O8MA 4HWVA 4XOPA 1RU4A 4XOTA 2VFQA 4XORA 2BX6A 3PSZA 3GQ9A 3VMVA 2W7ZA 1OFLA 2XTYA 2X6WA 4EW9A 2BM5A 4MR0A 1O8DA 4OPWA 1O8FA 1PXZA 3PSSA 5C1EA 2X6YA 3SZEA 3PETA 4XM3A 4XLHA 3GRHA 4XR6A 1TYVA 3UW0A 1TYUA 4OZZA 1K4ZA 3VMWA 4W8RA 4AVZA 1BHEA 3N6ZA 2G0YA 1EA0A 3B4NA 5JLVC 3ZPPA 2NTPA 1OFMA 1QA2A 1RMGA 5C1CA 4V02C 2NT9A 3JX8A 1TYXA 3AK5A 2QXZA 2IQ7A 2INUA 3B90A 2YUHA 4NK6A 4JRAC 2INVA 1QRBA 3TH0A 1DBGA 2VBEA 3JURA 4OJOA 1LLZA 1O8GA 2QYUA 3WWGA 4YZAA 1TYWA 1O8IA 4XLAA 1CZFA 1OOCA 1L1IA 4U49A 3VSUA 1KQ5A 3NAWA 2PYHA 1KCDA 2X3HA 3ML3A 2VBKA 1OFDA 3EQOA 4MXNA 3GQ8A 2XC1A 2BM4A 4YZXA 1X0CA 3LYCA 2BM7A 4XLCA 3SUCA 1NHCA 2EWEA 4C2LA 2NSTA 2NTBA 1QA3A 3LJYA 1EE6A 1O8HA 4YC5A 3LMWA 1K8FA 2J8IA 3FY3A 3T9GA 2ODLA 4XKWA 3SQVA 1OGMX 1VBLA 1QCXA 3GQAA 4YEJA 4YFOA 1IDKA 2Z8GA
chains in the Genus database with same CATH topology
2QX3A 1GQ8A 4YZ0A 1O8EA 2X85A 1HG8A 4OJ5A 4XONA 1JRGA 1O8KA 4OJ6A 4W8TA 1PE9A 4NK8A 4OJLA 4W8QA 1K5CA 2O04A 4OJPA 3VSVA 2O1DA 4XMYA 2NSPA 1JTAA 2VJIA 1BN8A 4PMHA 1O8JA 3VSTA 2O0VA 4I84A 2UVFA 4XQFA 1O8LA 1QJVA 3KRGA 1KCCA 3GQ7A 1DBOA 5AMVA 2O17A 1IDJA 2QY1A 2PECA 1WMRA 1IB4A 3EQNA 4XN3A 4Z06A 4YZQA 1RWRA 4URRA 4XNFA 2NT6A 1XG2A 1IA5A 1AIRA 4XKVA 4XLEA 4YELA 1O88A 2BSPA 4U4BA 2NTQA 2VBMA 4Z03A 2O0WA 2X6XA 4Z05A 3B8YA 4XN0A 1H80A 3ZSCA 2NZMA 4OZYA 2VJJA 4W8SA 1PLUA 1KTWA 4XLFA 2UVEA 2PYGA 1OGOX 4XL9A 1O8MA 4HWVA 4XOPA 1RU4A 4XOTA 4XORA 3GQ9A 3VMVA 1OFLA 2X6WA 4EW9A 4MR0A 1O8DA 1O8FA 1PXZA 5C1EA 2X6YA 4XM3A 4XLHA 3GRHA 4XR6A 3UW0A 4OZZA 3VMWA 4W8RA 4AVZA 1BHEA 3B4NA 3ZPPA 2NTPA 1OFMA 1RMGA 5C1CA 2NT9A 2QXZA 2IQ7A 2INUA 3B90A 4NK6A 2INVA 1DBGA 2VBEA 3JURA 4OJOA 1O8GA 3WWGA 4YZAA 1O8IA 4XLAA 1CZFA 1OOCA 4U49A 3VSUA 2PYHA 1KCDA 2X3HA 2VBKA 4MXNA 3EQOA 3GQ8A 4YZXA 1X0CA 4XLCA 3SUCA 1NHCA 2EWEA 4C2LA 2NSTA 2NTBA 1EE6A 1O8HA 3LMWA 3FY3A 3T9GA 2ODLA 4XKWA 1OGMX 1VBLA 1QCXA 3GQAA 4YEJA 1IDKA 2Z8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QX3 A;  1GQ8 A;  4YZ0 A;  1O8E A;  2X85 A;  1HG8 A;  4OJ5 A;  4XON A;  1JRG A;  1O8K A;  4OJ6 A;  4W8T A;  1PE9 A;  4NK8 A;  4OJL A;  4W8Q A;  1K5C A;  2O04 A;  4OJP A;  3VSV A;  2O1D A;  4XMY A;  2NSP A;  1JTA A;  2VJI A;  1BN8 A;  4PMH A;  1O8J A;  3VST A;  2O0V A;  4I84 A;  2UVF A;  4XQF A;  1O8L A;  1QJV A;  3KRG A;  1KCC A;  3GQ7 A;  1DBO A;  5AMV A;  2O17 A;  1IDJ A;  2QY1 A;  2PEC A;  1WMR A;  1IB4 A;  3EQN A;  4XN3 A;  4Z06 A;  4YZQ A;  1RWR A;  4URR A;  4XNF A;  2NT6 A;  1XG2 A;  1IA5 A;  1AIR A;  4XKV A;  4XLE A;  4YEL A;  1O88 A;  2BSP A;  4U4B A;  2NTQ A;  2VBM A;  4Z03 A;  2O0W A;  2X6X A;  4Z05 A;  3B8Y A;  4XN0 A;  1H80 A;  3ZSC A;  2NZM A;  4OZY A;  2VJJ A;  4W8S A;  1PLU A;  1KTW A;  4XLF A;  2UVE A;  2PYG A;  1OGO X;  4XL9 A;  1O8M A;  4HWV A;  4XOP A;  1RU4 A;  4XOT A;  4XOR A;  3GQ9 A;  3VMV A;  1OFL A;  2X6W A;  4EW9 A;  4MR0 A;  1O8D A;  1O8F A;  1PXZ A;  5C1E A;  2X6Y A;  4XM3 A;  4XLH A;  3GRH A;  4XR6 A;  3UW0 A;  4OZZ A;  3VMW A;  4W8R A;  4AVZ A;  1BHE A;  3B4N A;  3ZPP A;  2NTP A;  1OFM A;  1RMG A;  5C1C A;  2NT9 A;  2QXZ A;  2IQ7 A;  2INU A;  3B90 A;  4NK6 A;  2INV A;  1DBG A;  2VBE A;  3JUR A;  4OJO A;  1O8G A;  3WWG A;  4YZA A;  1O8I A;  4XLA A;  1CZF A;  1OOC A;  4U49 A;  3VSU A;  2PYH A;  1KCD A;  2X3H A;  2VBK A;  4MXN A;  3EQO A;  3GQ8 A;  4YZX A;  1X0C A;  4XLC A;  3SUC A;  1NHC A;  2EWE A;  4C2L A;  2NST A;  2NTB A;  1EE6 A;  1O8H A;  3LMW A;  3FY3 A;  3T9G A;  2ODL A;  4XKW A;  1OGM X;  1VBL A;  1QCX A;  3GQA A;  4YEJ A;  1IDK A;  2Z8G A; 
#chains in the Genus database with same CATH topology
 3SY2 A;  2QX3 A;  1GQ8 A;  4YZ0 A;  1O8E A;  1DAB A;  1QQ1 A;  2X85 A;  1HG8 A;  4OJ5 A;  1CLW A;  1HF2 A;  2VFP A;  4YCQ A;  2O6W A;  1JRG A;  4XON A;  1O8K A;  4OJ6 A;  4W8T A;  1PE9 A;  2XT4 A;  4NK8 A;  2B0R A;  2XTW A;  4OJL A;  4W8Q A;  1K5C A;  2BM6 A;  2J8K A;  2O04 A;  3H09 A;  4OJP A;  3VSV A;  2O1D A;  4XMY A;  2NSP A;  1JTA A;  2V5I A;  2VJI A;  1BN8 A;  3NB2 A;  4PMH A;  1O8J A;  2VFN A;  3VST A;  2O0V A;  4I84 A;  3P4G A;  2UVF A;  4XQF A;  1O8L A;  4OM9 A;  1QJV A;  3KRG A;  1KCC A;  3GQ7 A;  4KH3 A;  1DBO A;  5AMV A;  2IOU G;  2O17 A;  1IDJ A;  3DU1 X;  2QY1 A;  1QRC A;  2PEC A;  1WMR A;  2VFO A;  1IB4 A;  3EQN A;  4XN3 A;  1OFE A;  4Z06 A;  1LLW A;  2VFM A;  1RWR A;  3BH7 B;  4URR A;  4YZQ A;  4XNF A;  4YEI A;  2NT6 A;  2QZA A;  1XG2 A;  1IA5 A;  1AIR A;  5DNS A;  3RIQ A;  2XT2 A;  4XKV A;  4XLE A;  4YDT A;  4YEL A;  1O88 A;  2BSP A;  3BH6 B;  4U4B A;  2NTQ A;  2VBM A;  1QA1 A;  4Z03 A;  2O0W A;  2XTX A;  2X6X A;  1TSP A;  4Z05 A;  3B8Y A;  4XN0 A;  3SYJ A;  3N90 A;  1H80 A;  3ZSC A;  2NZM A;  2F3L A;  4OZY A;  2VJJ A;  4W8S A;  1PLU A;  1KTW A;  4XLF A;  1WXR A;  2UVE A;  1EZG A;  1LM1 A;  2PYG A;  5JMC B;  1OGO X;  4XL9 A;  1O8M A;  4HWV A;  4XOP A;  1RU4 A;  4XOT A;  2VFQ A;  4XOR A;  2BX6 A;  3PSZ A;  3GQ9 A;  3VMV A;  2W7Z A;  1OFL A;  2XTY A;  2X6W A;  4EW9 A;  2BM5 A;  4MR0 A;  1O8D A;  4OPW A;  1O8F A;  1PXZ A;  3PSS A;  5C1E A;  2X6Y A;  3SZE A;  3PET A;  4XM3 A;  4XLH A;  3GRH A;  4XR6 A;  1TYV A;  3UW0 A;  1TYU A;  4OZZ A;  1K4Z A;  3VMW A;  4W8R A;  4AVZ A;  1BHE A;  3N6Z A;  2G0Y A;  1EA0 A;  3B4N A;  5JLV C;  3ZPP A;  2NTP A;  1OFM A;  1QA2 A;  1RMG A;  5C1C A;  4V02 C;  2NT9 A;  3JX8 A;  1TYX A;  3AK5 A;  2QXZ A;  2IQ7 A;  2INU A;  3B90 A;  2YUH A;  4NK6 A;  4JRA C;  2INV A;  1QRB A;  3TH0 A;  1DBG A;  2VBE A;  3JUR A;  4OJO A;  1LLZ A;  1O8G A;  2QYU A;  3WWG A;  4YZA A;  1TYW A;  1O8I A;  4XLA A;  1CZF A;  1OOC A;  1L1I A;  4U49 A;  3VSU A;  1KQ5 A;  3NAW A;  2PYH A;  1KCD A;  2X3H A;  3ML3 A;  2VBK A;  1OFD A;  3EQO A;  4MXN A;  3GQ8 A;  2XC1 A;  2BM4 A;  4YZX A;  1X0C A;  3LYC A;  2BM7 A;  4XLC A;  3SUC A;  1NHC A;  2EWE A;  4C2L A;  2NST A;  2NTB A;  1QA3 A;  3LJY A;  1EE6 A;  1O8H A;  4YC5 A;  3LMW A;  1K8F A;  2J8I A;  3FY3 A;  3T9G A;  2ODL A;  4XKW A;  3SQV A;  1OGM X;  1VBL A;  1QCX A;  3GQA A;  4YEJ A;  4YFO A;  1IDK A;  2Z8G A; 
#chains in the Genus database with same CATH homology
 2QX3 A;  1GQ8 A;  4YZ0 A;  1O8E A;  2X85 A;  1HG8 A;  4OJ5 A;  4XON A;  1JRG A;  1O8K A;  4OJ6 A;  4W8T A;  1PE9 A;  4NK8 A;  4OJL A;  4W8Q A;  1K5C A;  2O04 A;  4OJP A;  3VSV A;  2O1D A;  4XMY A;  2NSP A;  1JTA A;  2VJI A;  1BN8 A;  4PMH A;  1O8J A;  3VST A;  2O0V A;  4I84 A;  2UVF A;  4XQF A;  1O8L A;  1QJV A;  3KRG A;  1KCC A;  3GQ7 A;  1DBO A;  5AMV A;  2O17 A;  1IDJ A;  2QY1 A;  2PEC A;  1WMR A;  1IB4 A;  3EQN A;  4XN3 A;  4Z06 A;  4YZQ A;  1RWR A;  4URR A;  4XNF A;  2NT6 A;  1XG2 A;  1IA5 A;  1AIR A;  4XKV A;  4XLE A;  4YEL A;  1O88 A;  2BSP A;  4U4B A;  2NTQ A;  2VBM A;  4Z03 A;  2O0W A;  2X6X A;  4Z05 A;  3B8Y A;  4XN0 A;  1H80 A;  3ZSC A;  2NZM A;  4OZY A;  2VJJ A;  4W8S A;  1PLU A;  1KTW A;  4XLF A;  2UVE A;  2PYG A;  1OGO X;  4XL9 A;  1O8M A;  4HWV A;  4XOP A;  1RU4 A;  4XOT A;  4XOR A;  3GQ9 A;  3VMV A;  1OFL A;  2X6W A;  4EW9 A;  4MR0 A;  1O8D A;  1O8F A;  1PXZ A;  5C1E A;  2X6Y A;  4XM3 A;  4XLH A;  3GRH A;  4XR6 A;  3UW0 A;  4OZZ A;  3VMW A;  4W8R A;  4AVZ A;  1BHE A;  3B4N A;  3ZPP A;  2NTP A;  1OFM A;  1RMG A;  5C1C A;  2NT9 A;  2QXZ A;  2IQ7 A;  2INU A;  3B90 A;  4NK6 A;  2INV A;  1DBG A;  2VBE A;  3JUR A;  4OJO A;  1O8G A;  3WWG A;  4YZA A;  1O8I A;  4XLA A;  1CZF A;  1OOC A;  4U49 A;  3VSU A;  2PYH A;  1KCD A;  2X3H A;  2VBK A;  4MXN A;  3EQO A;  3GQ8 A;  4YZX A;  1X0C A;  4XLC A;  3SUC A;  1NHC A;  2EWE A;  4C2L A;  2NST A;  2NTB A;  1EE6 A;  1O8H A;  3LMW A;  3FY3 A;  3T9G A;  2ODL A;  4XKW A;  1OGM X;  1VBL A;  1QCX A;  3GQA A;  4YEJ A;  1IDK A;  2Z8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...