4NK6A

Crystal structure of the periplasmic alginate epimerase algg
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
424
structure length
407
Chain Sequence
EMAKPVLPDLSGYTTEAALIARNKPGKITVARMMEETGLEFIGGDNMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVETGIFEIDSTKELRLSQEGSFIVSEGMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIATKMASMGYNQSSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTHGIIISREVDNSFIFRNSHNNLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic Mechanism and Mode of Action of the Periplasmic Alginate Epimerase AlgG.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
total genus 157
structure length 407
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4nk6A00
3GQ7A 4OZYA 2NZMA 2PYGA 1O8FA 2PECA 3GQAA 2QX3A 2VJIA 5C1CA 2VBKA 4XLEA 4YZ0A 2NT6A 1OFMA 2IQ7A 1IB4A 3ZSCA 3WWGA 3VSTA 3VMVA 4XOPA 1K5CA 1X0CA 4OJOA 1OFLA 3VSUA 1IA5A 4NK6A 2O1DA 1BN8A 2VBEA 4OJPA 1OGMX 4XN3A 4XKWA 4XL9A 4Z06A 2O0VA 2X6YA 1QCXA 4Z05A 3EQNA 3T9GA 1JTAA 1O8GA 4OJLA 4AVZA 4OZZA 4YZXA 2Z8GA 4OJ5A 4YELA 4YZQA 4XKVA 1PLUA 1O8MA 3LMWA 4XLHA 5C1EA 4W8TA 3SUCA 4PMHA 1HG8A 4W8QA 2NSPA 1O8IA 2QXZA 3KRGA 1PXZA 1IDJA 2NTPA 1O8KA 2VBMA 4XNFA 1KTWA 3GQ8A 1O8LA 2O17A 1JRGA 4XOTA 1H80A 3VSVA 1OOCA 3B8YA 1DBOA 1CZFA 3JURA 4OJ6A 4NK8A 2NTQA 4XONA 1IDKA 1OGOX 2UVFA 4W8RA 4EW9A 1KCCA 3B4NA 1RU4A 1WMRA 1RMGA 2X6XA 4XLCA 3VMWA 2PYHA 3B90A 1QJVA 1DBGA 2O0WA 2X3HA 4XLAA 4C2LA 1O8DA 2BSPA 1PE9A 4I84A 4W8SA 4MR0A 4XLFA 4XMYA 5AMVA 1BHEA 2X85A 2ODLA 2INVA 4MXNA 3ZPPA 4HWVA 4XN0A 2EWEA 4XQFA 1NHCA 1O8EA 3UW0A 3FY3A 2X6WA 2NSTA 2NTBA 4XORA 1VBLA 2NT9A 1O8HA 2VJJA 4U4BA 4U49A 2UVEA 1O88A 2INUA 4Z03A 3GRHA 4URRA 1KCDA 2QY1A 2O04A 1O8JA 1GQ8A 3EQOA 3GQ9A 4YEJA 1XG2A 1RWRA 1AIRA 4XM3A 4XR6A 1EE6A 4YZAA
chains in the Genus database with same CATH superfamily
2BM7A 2VFQA 3GQ7A 3NB2A 3SY2A 1QRBA 1DABA 1TYVA 3DU1X 3N90A 4OZYA 2NZMA 2PYGA 3SQVA 1QA1A 1O8FA 2PECA 3GQAA 2QX3A 1WXRA 2VJIA 5C1CA 1L1IA 2VBKA 4XLEA 3PSSA 4YZ0A 2NT6A 1OFMA 2IQ7A 1IB4A 3ZSCA 3WWGA 3VSTA 2G0YA 3VMVA 2BM5A 4XOPA 1K5CA 4YDTA 4JRAC 1X0CA 4YCQA 4OJOA 1QA3A 2QYUA 1OFLA 3VSUA 1IA5A 4NK6A 2O1DA 1BN8A 1EZGA 2F3LA 2VBEA 4OJPA 4OPWA 1OGMX 4XN3A 4XKWA 4XL9A 4Z06A 1QCXA 2O0VA 1K4ZA 2X6YA 2XC1A 4Z05A 3EQNA 3T9GA 1JTAA 1O8GA 4OJLA 4AVZA 4OZZA 3SYJA 3PSZA 4YZXA 1HF2A 1OFDA 2Z8GA 4V02C 4OJ5A 4YELA 4YZQA 4XKVA 1LM1A 1EA0A 2BX6A 1PLUA 2XTYA 3BH7B 1O8MA 3PETA 3BH6B 3LMWA 3SZEA 3ML3A 4KH3A 2XT4A 4XLHA 5C1EA 4W8TA 3SUCA 4PMHA 1HG8A 2XTWA 2NSPA 4W8QA 1O8IA 3N6ZA 1QRCA 2QXZA 2VFNA 3KRGA 1PXZA 1IDJA 2NTPA 1O8KA 2VBMA 4XNFA 1QA2A 3TH0A 3AK5A 1KTWA 3P4GA 3GQ8A 4YC5A 1QQ1A 2V5IA 1O8LA 4YEIA 2BM6A 2O17A 1JRGA 2B0RA 1LLZA 1H80A 4XOTA 5JLVC 3VSVA 1OOCA 2J8KA 3B8YA 1DBOA 1LLWA 1CZFA 3JURA 1CLWA 4NK8A 2NTQA 4OJ6A 4YFOA 1OFEA 4XONA 1IDKA 1OGOX 2UVFA 4W8RA 4EW9A 1KCCA 3B4NA 1RU4A 1WMRA 1RMGA 2X6XA 4XLCA 3VMWA 2XT2A 2PYHA 3B90A 3NAWA 1QJVA 1DBGA 2O0WA 3JX8A 2O6WA 2X3HA 4XLAA 4C2LA 2J8IA 1O8DA 2BSPA 1PE9A 4I84A 4W8SA 4MR0A 4XLFA 4XMYA 5AMVA 1TSPA 2W7ZA 1K8FA 1BHEA 2X85A 2ODLA 1TYWA 2INVA 4MXNA 3RIQA 2VFOA 3ZPPA 4HWVA 4XN0A 2EWEA 2BM4A 4XQFA 1NHCA 1O8EA 3LJYA 3UW0A 3FY3A 1KQ5A 5DNSA 3H09A 2X6WA 2NSTA 2NTBA 3LYCA 4OM9A 4XORA 1VBLA 2NT9A 1O8HA 2YUHA 2VJJA 4U4BA 4U49A 1TYXA 2VFPA 2UVEA 1O88A 2IOUG 2INUA 5JMCB 4Z03A 2XTXA 3GRHA 4URRA 2QZAA 1KCDA 2QY1A 2O04A 1O8JA 1GQ8A 3EQOA 3GQ9A 4YEJA 1XG2A 1RWRA 1AIRA 4XM3A 1TYUA 4XR6A 2VFMA 1EE6A 4YZAA
chains in the Genus database with same CATH topology
3GQ7A 4OZYA 2NZMA 2PYGA 1O8FA 2PECA 3GQAA 2QX3A 2VJIA 5C1CA 2VBKA 4XLEA 4YZ0A 2NT6A 1OFMA 2IQ7A 1IB4A 3ZSCA 3WWGA 3VSTA 3VMVA 4XOPA 1K5CA 1X0CA 4OJOA 1OFLA 3VSUA 1IA5A 4NK6A 2O1DA 1BN8A 2VBEA 4OJPA 1OGMX 4XN3A 4XKWA 4XL9A 4Z06A 2O0VA 2X6YA 1QCXA 4Z05A 3EQNA 3T9GA 1JTAA 1O8GA 4OJLA 4AVZA 4OZZA 4YZXA 2Z8GA 4OJ5A 4YELA 4YZQA 4XKVA 1PLUA 1O8MA 3LMWA 4XLHA 5C1EA 4W8TA 3SUCA 4PMHA 1HG8A 4W8QA 2NSPA 1O8IA 2QXZA 3KRGA 1PXZA 1IDJA 2NTPA 1O8KA 2VBMA 4XNFA 1KTWA 3GQ8A 1O8LA 2O17A 1JRGA 4XOTA 1H80A 3VSVA 1OOCA 3B8YA 1DBOA 1CZFA 3JURA 4OJ6A 4NK8A 2NTQA 4XONA 1IDKA 1OGOX 2UVFA 4W8RA 4EW9A 1KCCA 3B4NA 1RU4A 1WMRA 1RMGA 2X6XA 4XLCA 3VMWA 2PYHA 3B90A 1QJVA 1DBGA 2O0WA 2X3HA 4XLAA 4C2LA 1O8DA 2BSPA 1PE9A 4I84A 4W8SA 4MR0A 4XLFA 4XMYA 5AMVA 1BHEA 2X85A 2ODLA 2INVA 4MXNA 3ZPPA 4HWVA 4XN0A 2EWEA 4XQFA 1NHCA 1O8EA 3UW0A 3FY3A 2X6WA 2NSTA 2NTBA 4XORA 1VBLA 2NT9A 1O8HA 2VJJA 4U4BA 4U49A 2UVEA 1O88A 2INUA 4Z03A 3GRHA 4URRA 1KCDA 2QY1A 2O04A 1O8JA 1GQ8A 3EQOA 3GQ9A 4YEJA 1XG2A 1RWRA 1AIRA 4XM3A 4XR6A 1EE6A 4YZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ7 A;  4OZY A;  2NZM A;  2PYG A;  1O8F A;  2PEC A;  3GQA A;  2QX3 A;  2VJI A;  5C1C A;  2VBK A;  4XLE A;  4YZ0 A;  2NT6 A;  1OFM A;  2IQ7 A;  1IB4 A;  3ZSC A;  3WWG A;  3VST A;  3VMV A;  4XOP A;  1K5C A;  1X0C A;  4OJO A;  1OFL A;  3VSU A;  1IA5 A;  4NK6 A;  2O1D A;  1BN8 A;  2VBE A;  4OJP A;  1OGM X;  4XN3 A;  4XKW A;  4XL9 A;  4Z06 A;  2O0V A;  2X6Y A;  1QCX A;  4Z05 A;  3EQN A;  3T9G A;  1JTA A;  1O8G A;  4OJL A;  4AVZ A;  4OZZ A;  4YZX A;  2Z8G A;  4OJ5 A;  4YEL A;  4YZQ A;  4XKV A;  1PLU A;  1O8M A;  3LMW A;  4XLH A;  5C1E A;  4W8T A;  3SUC A;  4PMH A;  1HG8 A;  4W8Q A;  2NSP A;  1O8I A;  2QXZ A;  3KRG A;  1PXZ A;  1IDJ A;  2NTP A;  1O8K A;  2VBM A;  4XNF A;  1KTW A;  3GQ8 A;  1O8L A;  2O17 A;  1JRG A;  4XOT A;  1H80 A;  3VSV A;  1OOC A;  3B8Y A;  1DBO A;  1CZF A;  3JUR A;  4OJ6 A;  4NK8 A;  2NTQ A;  4XON A;  1IDK A;  1OGO X;  2UVF A;  4W8R A;  4EW9 A;  1KCC A;  3B4N A;  1RU4 A;  1WMR A;  1RMG A;  2X6X A;  4XLC A;  3VMW A;  2PYH A;  3B90 A;  1QJV A;  1DBG A;  2O0W A;  2X3H A;  4XLA A;  4C2L A;  1O8D A;  2BSP A;  1PE9 A;  4I84 A;  4W8S A;  4MR0 A;  4XLF A;  4XMY A;  5AMV A;  1BHE A;  2X85 A;  2ODL A;  2INV A;  4MXN A;  3ZPP A;  4HWV A;  4XN0 A;  2EWE A;  4XQF A;  1NHC A;  1O8E A;  3UW0 A;  3FY3 A;  2X6W A;  2NST A;  2NTB A;  4XOR A;  1VBL A;  2NT9 A;  1O8H A;  2VJJ A;  4U4B A;  4U49 A;  2UVE A;  1O88 A;  2INU A;  4Z03 A;  3GRH A;  4URR A;  1KCD A;  2QY1 A;  2O04 A;  1O8J A;  1GQ8 A;  3EQO A;  3GQ9 A;  4YEJ A;  1XG2 A;  1RWR A;  1AIR A;  4XM3 A;  4XR6 A;  1EE6 A;  4YZA A; 
#chains in the Genus database with same CATH topology
 2BM7 A;  2VFQ A;  3GQ7 A;  3NB2 A;  3SY2 A;  1QRB A;  1DAB A;  1TYV A;  3DU1 X;  3N90 A;  4OZY A;  2NZM A;  2PYG A;  3SQV A;  1QA1 A;  1O8F A;  2PEC A;  3GQA A;  2QX3 A;  1WXR A;  2VJI A;  5C1C A;  1L1I A;  2VBK A;  4XLE A;  3PSS A;  4YZ0 A;  2NT6 A;  1OFM A;  2IQ7 A;  1IB4 A;  3ZSC A;  3WWG A;  3VST A;  2G0Y A;  3VMV A;  2BM5 A;  4XOP A;  1K5C A;  4YDT A;  4JRA C;  1X0C A;  4YCQ A;  4OJO A;  1QA3 A;  2QYU A;  1OFL A;  3VSU A;  1IA5 A;  4NK6 A;  2O1D A;  1BN8 A;  1EZG A;  2F3L A;  2VBE A;  4OJP A;  4OPW A;  1OGM X;  4XN3 A;  4XKW A;  4XL9 A;  4Z06 A;  1QCX A;  2O0V A;  1K4Z A;  2X6Y A;  2XC1 A;  4Z05 A;  3EQN A;  3T9G A;  1JTA A;  1O8G A;  4OJL A;  4AVZ A;  4OZZ A;  3SYJ A;  3PSZ A;  4YZX A;  1HF2 A;  1OFD A;  2Z8G A;  4V02 C;  4OJ5 A;  4YEL A;  4YZQ A;  4XKV A;  1LM1 A;  1EA0 A;  2BX6 A;  1PLU A;  2XTY A;  3BH7 B;  1O8M A;  3PET A;  3BH6 B;  3LMW A;  3SZE A;  3ML3 A;  4KH3 A;  2XT4 A;  4XLH A;  5C1E A;  4W8T A;  3SUC A;  4PMH A;  1HG8 A;  2XTW A;  2NSP A;  4W8Q A;  1O8I A;  3N6Z A;  1QRC A;  2QXZ A;  2VFN A;  3KRG A;  1PXZ A;  1IDJ A;  2NTP A;  1O8K A;  2VBM A;  4XNF A;  1QA2 A;  3TH0 A;  3AK5 A;  1KTW A;  3P4G A;  3GQ8 A;  4YC5 A;  1QQ1 A;  2V5I A;  1O8L A;  4YEI A;  2BM6 A;  2O17 A;  1JRG A;  2B0R A;  1LLZ A;  1H80 A;  4XOT A;  5JLV C;  3VSV A;  1OOC A;  2J8K A;  3B8Y A;  1DBO A;  1LLW A;  1CZF A;  3JUR A;  1CLW A;  4NK8 A;  2NTQ A;  4OJ6 A;  4YFO A;  1OFE A;  4XON A;  1IDK A;  1OGO X;  2UVF A;  4W8R A;  4EW9 A;  1KCC A;  3B4N A;  1RU4 A;  1WMR A;  1RMG A;  2X6X A;  4XLC A;  3VMW A;  2XT2 A;  2PYH A;  3B90 A;  3NAW A;  1QJV A;  1DBG A;  2O0W A;  3JX8 A;  2O6W A;  2X3H A;  4XLA A;  4C2L A;  2J8I A;  1O8D A;  2BSP A;  1PE9 A;  4I84 A;  4W8S A;  4MR0 A;  4XLF A;  4XMY A;  5AMV A;  1TSP A;  2W7Z A;  1K8F A;  1BHE A;  2X85 A;  2ODL A;  1TYW A;  2INV A;  4MXN A;  3RIQ A;  2VFO A;  3ZPP A;  4HWV A;  4XN0 A;  2EWE A;  2BM4 A;  4XQF A;  1NHC A;  1O8E A;  3LJY A;  3UW0 A;  3FY3 A;  1KQ5 A;  5DNS A;  3H09 A;  2X6W A;  2NST A;  2NTB A;  3LYC A;  4OM9 A;  4XOR A;  1VBL A;  2NT9 A;  1O8H A;  2YUH A;  2VJJ A;  4U4B A;  4U49 A;  1TYX A;  2VFP A;  2UVE A;  1O88 A;  2IOU G;  2INU A;  5JMC B;  4Z03 A;  2XTX A;  3GRH A;  4URR A;  2QZA A;  1KCD A;  2QY1 A;  2O04 A;  1O8J A;  1GQ8 A;  3EQO A;  3GQ9 A;  4YEJ A;  1XG2 A;  1RWR A;  1AIR A;  4XM3 A;  1TYU A;  4XR6 A;  2VFM A;  1EE6 A;  4YZA A; 
#chains in the Genus database with same CATH homology
 3GQ7 A;  4OZY A;  2NZM A;  2PYG A;  1O8F A;  2PEC A;  3GQA A;  2QX3 A;  2VJI A;  5C1C A;  2VBK A;  4XLE A;  4YZ0 A;  2NT6 A;  1OFM A;  2IQ7 A;  1IB4 A;  3ZSC A;  3WWG A;  3VST A;  3VMV A;  4XOP A;  1K5C A;  1X0C A;  4OJO A;  1OFL A;  3VSU A;  1IA5 A;  4NK6 A;  2O1D A;  1BN8 A;  2VBE A;  4OJP A;  1OGM X;  4XN3 A;  4XKW A;  4XL9 A;  4Z06 A;  2O0V A;  2X6Y A;  1QCX A;  4Z05 A;  3EQN A;  3T9G A;  1JTA A;  1O8G A;  4OJL A;  4AVZ A;  4OZZ A;  4YZX A;  2Z8G A;  4OJ5 A;  4YEL A;  4YZQ A;  4XKV A;  1PLU A;  1O8M A;  3LMW A;  4XLH A;  5C1E A;  4W8T A;  3SUC A;  4PMH A;  1HG8 A;  4W8Q A;  2NSP A;  1O8I A;  2QXZ A;  3KRG A;  1PXZ A;  1IDJ A;  2NTP A;  1O8K A;  2VBM A;  4XNF A;  1KTW A;  3GQ8 A;  1O8L A;  2O17 A;  1JRG A;  4XOT A;  1H80 A;  3VSV A;  1OOC A;  3B8Y A;  1DBO A;  1CZF A;  3JUR A;  4OJ6 A;  4NK8 A;  2NTQ A;  4XON A;  1IDK A;  1OGO X;  2UVF A;  4W8R A;  4EW9 A;  1KCC A;  3B4N A;  1RU4 A;  1WMR A;  1RMG A;  2X6X A;  4XLC A;  3VMW A;  2PYH A;  3B90 A;  1QJV A;  1DBG A;  2O0W A;  2X3H A;  4XLA A;  4C2L A;  1O8D A;  2BSP A;  1PE9 A;  4I84 A;  4W8S A;  4MR0 A;  4XLF A;  4XMY A;  5AMV A;  1BHE A;  2X85 A;  2ODL A;  2INV A;  4MXN A;  3ZPP A;  4HWV A;  4XN0 A;  2EWE A;  4XQF A;  1NHC A;  1O8E A;  3UW0 A;  3FY3 A;  2X6W A;  2NST A;  2NTB A;  4XOR A;  1VBL A;  2NT9 A;  1O8H A;  2VJJ A;  4U4B A;  4U49 A;  2UVE A;  1O88 A;  2INU A;  4Z03 A;  3GRH A;  4URR A;  1KCD A;  2QY1 A;  2O04 A;  1O8J A;  1GQ8 A;  3EQO A;  3GQ9 A;  4YEJ A;  1XG2 A;  1RWR A;  1AIR A;  4XM3 A;  4XR6 A;  1EE6 A;  4YZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...