4NK6A

Crystal structure of the periplasmic alginate epimerase algg
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
424
structure length
407
Chain Sequence
EMAKPVLPDLSGYTTEAALIARNKPGKITVARMMEETGLEFIGGDNMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVETGIFEIDSTKELRLSQEGSFIVSEGMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIATKMASMGYNQSSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTHGIIISREVDNSFIFRNSHNNLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic Mechanism and Mode of Action of the Periplasmic Alginate Epimerase AlgG.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
total genus 157
structure length 407
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4nk6A00
4NK8A 4PMHA 1RU4A 4XN3A 2NTQA 4OJPA 4URRA 3VSUA 4YZ0A 2INVA 2BSPA 2NTPA 4XN0A 2ODLA 1BN8A 2QXZA 3B8YA 3EQOA 2VBMA 2O17A 4MR0A 4OJLA 5C1CA 1K5CA 2VBEA 2NT9A 4OJ5A 4W8QA 4MXNA 4XKVA 1DBOA 3GQ7A 1QJVA 1IA5A 1O8KA 4XLEA 1DBGA 3UW0A 2X6XA 3T9GA 2UVFA 2X6YA 1JRGA 2UVEA 1EE6A 1PXZA 1KCCA 1WMRA 3ZPPA 4XQFA 3JURA 4U4BA 4NK6A 4YZQA 2X6WA 1IDKA 1JTAA 3FY3A 4XORA 2QX3A 3SUCA 1KCDA 5AMVA 2INUA 4AVZA 4XMYA 3VSTA 3B90A 1OOCA 4W8RA 1AIRA 4Z06A 1NHCA 4OJOA 4C2LA 3GQ8A 1OFMA 4XLFA 5C1EA 2NT6A 3VMVA 3EQNA 1OFLA 2NSPA 3VSVA 1OGMX 3B4NA 1PLUA 2QY1A 4YZAA 4XLHA 2O0VA 1PE9A 2NTBA 4OZYA 2EWEA 3GQAA 1QCXA 2Z8GA 3GQ9A 4HWVA 4YELA 2O04A 1KTWA 1O8HA 4Z05A 4I84A 4YZXA 2X85A 1X0CA 1GQ8A 2O1DA 4XLCA 2PECA 2PYGA 4U49A 4XKWA 1H80A 1O8MA 1RMGA 2X3HA 4OZZA 1O8LA 4W8SA 1CZFA 1IDJA 4XOTA 3GRHA 1BHEA 1O88A 2O0WA 4W8TA 4XR6A 1O8DA 4XM3A 2IQ7A 3ZSCA 1VBLA 1XG2A 1IB4A 4OJ6A 2VBKA 4Z03A 1O8JA 3KRGA 4EW9A 2PYHA 2VJIA 1O8GA 4XOPA 3LMWA 1O8FA 2NSTA 4YEJA 1O8IA 4XONA 2NZMA 2VJJA 1OGOX 4XLAA 1HG8A 3WWGA 4XNFA 1RWRA 4XL9A 1O8EA 3VMWA
chains in the Genus database with same CATH superfamily
4NK8A 2XTWA 4PMHA 1RU4A 4XN3A 4YDTA 2NTQA 3P4GA 1EZGA 4OJPA 4URRA 3VSUA 3ML3A 4OPWA 4YZ0A 2INVA 2BSPA 2G0YA 2NTPA 4XN0A 2ODLA 1BN8A 2QXZA 1QQ1A 3B8YA 2VBMA 3EQOA 2O17A 2YUHA 2XT4A 4MR0A 1TYXA 2QYUA 4OJLA 5C1CA 1K5CA 3PETA 2VBEA 2NT9A 4OJ5A 5JMCB 1OFEA 4W8QA 4MXNA 5JLVC 4XKVA 3TH0A 1DBOA 2BM4A 1EA0A 3GQ7A 1QJVA 1IA5A 1O8KA 4XLEA 1DBGA 3SYJA 3UW0A 2X6XA 1QRBA 3T9GA 2UVFA 2X6YA 1JRGA 2UVEA 1EE6A 3SQVA 1PXZA 1KCCA 1WMRA 3ZPPA 4XQFA 3JURA 4U4BA 4NK6A 4YZQA 3BH7B 2O6WA 2X6WA 1IDKA 1JTAA 2F3LA 3FY3A 4XORA 2QX3A 3H09A 3SUCA 1KCDA 5AMVA 2INUA 4AVZA 3LJYA 4XMYA 2J8KA 3VSTA 2XTYA 3B90A 3PSZA 1OOCA 4W8RA 3N90A 4JRAC 3PSSA 1AIRA 4Z06A 1NHCA 3LYCA 4OJOA 2XC1A 4C2LA 3SZEA 3GQ8A 1OFMA 4XLFA 1QA3A 3NB2A 2BM7A 5C1EA 1QRCA 2VFMA 2NT6A 2XTXA 3VMVA 3JX8A 1TYUA 3EQNA 1OFLA 2NSPA 2VFOA 3VSVA 1OGMX 3B4NA 4V02C 4YEIA 1K4ZA 1TYVA 1LM1A 1PLUA 2QY1A 5DNSA 1LLWA 1TYWA 4YZAA 2BX6A 4XLHA 2O0VA 4OM9A 1PE9A 2NTBA 4KH3A 4OZYA 4YCQA 2EWEA 3GQAA 3RIQA 1QCXA 2Z8GA 3GQ9A 2BM6A 4HWVA 4YELA 3NAWA 2O04A 1KTWA 1O8HA 4Z05A 4I84A 4YZXA 1OFDA 2X85A 1X0CA 1GQ8A 2O1DA 4XLCA 2PECA 2PYGA 4U49A 4XKWA 1H80A 1O8MA 1RMGA 2X3HA 1QA1A 2B0RA 4OZZA 3SY2A 2QZAA 1O8LA 4W8SA 1CZFA 1IDJA 3DU1X 4XOTA 1DABA 1WXRA 3GRHA 1CLWA 1BHEA 1O88A 2O0WA 2VFQA 3AK5A 3BH6B 4W8TA 1QA2A 4XR6A 1O8DA 2VFPA 2J8IA 2IOUG 4XM3A 1TSPA 2IQ7A 1K8FA 3N6ZA 1VBLA 1XG2A 3ZSCA 2VFNA 2BM5A 4OJ6A 1IB4A 2VBKA 2XT2A 4Z03A 1O8JA 3KRGA 4EW9A 2PYHA 2VJIA 1O8GA 4XOPA 3LMWA 1O8FA 2W7ZA 2NSTA 4YEJA 1O8IA 4XONA 2V5IA 1L1IA 1KQ5A 1LLZA 2NZMA 1HF2A 2VJJA 4YC5A 1OGOX 4XLAA 1HG8A 3WWGA 4XNFA 1RWRA 4YFOA 4XL9A 1O8EA 3VMWA
chains in the Genus database with same CATH topology
4NK8A 4PMHA 1RU4A 4XN3A 2NTQA 4OJPA 4URRA 3VSUA 4YZ0A 2INVA 2BSPA 2NTPA 4XN0A 2ODLA 1BN8A 2QXZA 3B8YA 3EQOA 2VBMA 2O17A 4MR0A 4OJLA 5C1CA 1K5CA 2VBEA 2NT9A 4OJ5A 4W8QA 4MXNA 4XKVA 1DBOA 3GQ7A 1QJVA 1IA5A 1O8KA 4XLEA 1DBGA 3UW0A 2X6XA 3T9GA 2UVFA 2X6YA 1JRGA 2UVEA 1EE6A 1PXZA 1KCCA 1WMRA 3ZPPA 4XQFA 3JURA 4U4BA 4NK6A 4YZQA 2X6WA 1IDKA 1JTAA 3FY3A 4XORA 2QX3A 3SUCA 1KCDA 5AMVA 2INUA 4AVZA 4XMYA 3VSTA 3B90A 1OOCA 4W8RA 1AIRA 4Z06A 1NHCA 4OJOA 4C2LA 3GQ8A 1OFMA 4XLFA 5C1EA 2NT6A 3VMVA 3EQNA 1OFLA 2NSPA 3VSVA 1OGMX 3B4NA 1PLUA 2QY1A 4YZAA 4XLHA 2O0VA 1PE9A 2NTBA 4OZYA 2EWEA 3GQAA 1QCXA 2Z8GA 3GQ9A 4HWVA 4YELA 2O04A 1KTWA 1O8HA 4Z05A 4I84A 4YZXA 2X85A 1X0CA 1GQ8A 2O1DA 4XLCA 2PECA 2PYGA 4U49A 4XKWA 1H80A 1O8MA 1RMGA 2X3HA 4OZZA 1O8LA 4W8SA 1CZFA 1IDJA 4XOTA 3GRHA 1BHEA 1O88A 2O0WA 4W8TA 4XR6A 1O8DA 4XM3A 2IQ7A 3ZSCA 1VBLA 1XG2A 1IB4A 4OJ6A 2VBKA 4Z03A 1O8JA 3KRGA 4EW9A 2PYHA 2VJIA 1O8GA 4XOPA 3LMWA 1O8FA 2NSTA 4YEJA 1O8IA 4XONA 2NZMA 2VJJA 1OGOX 4XLAA 1HG8A 3WWGA 4XNFA 1RWRA 4XL9A 1O8EA 3VMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NK8 A;  4PMH A;  1RU4 A;  4XN3 A;  2NTQ A;  4OJP A;  4URR A;  3VSU A;  4YZ0 A;  2INV A;  2BSP A;  2NTP A;  4XN0 A;  2ODL A;  1BN8 A;  2QXZ A;  3B8Y A;  3EQO A;  2VBM A;  2O17 A;  4MR0 A;  4OJL A;  5C1C A;  1K5C A;  2VBE A;  2NT9 A;  4OJ5 A;  4W8Q A;  4MXN A;  4XKV A;  1DBO A;  3GQ7 A;  1QJV A;  1IA5 A;  1O8K A;  4XLE A;  1DBG A;  3UW0 A;  2X6X A;  3T9G A;  2UVF A;  2X6Y A;  1JRG A;  2UVE A;  1EE6 A;  1PXZ A;  1KCC A;  1WMR A;  3ZPP A;  4XQF A;  3JUR A;  4U4B A;  4NK6 A;  4YZQ A;  2X6W A;  1IDK A;  1JTA A;  3FY3 A;  4XOR A;  2QX3 A;  3SUC A;  1KCD A;  5AMV A;  2INU A;  4AVZ A;  4XMY A;  3VST A;  3B90 A;  1OOC A;  4W8R A;  1AIR A;  4Z06 A;  1NHC A;  4OJO A;  4C2L A;  3GQ8 A;  1OFM A;  4XLF A;  5C1E A;  2NT6 A;  3VMV A;  3EQN A;  1OFL A;  2NSP A;  3VSV A;  1OGM X;  3B4N A;  1PLU A;  2QY1 A;  4YZA A;  4XLH A;  2O0V A;  1PE9 A;  2NTB A;  4OZY A;  2EWE A;  3GQA A;  1QCX A;  2Z8G A;  3GQ9 A;  4HWV A;  4YEL A;  2O04 A;  1KTW A;  1O8H A;  4Z05 A;  4I84 A;  4YZX A;  2X85 A;  1X0C A;  1GQ8 A;  2O1D A;  4XLC A;  2PEC A;  2PYG A;  4U49 A;  4XKW A;  1H80 A;  1O8M A;  1RMG A;  2X3H A;  4OZZ A;  1O8L A;  4W8S A;  1CZF A;  1IDJ A;  4XOT A;  3GRH A;  1BHE A;  1O88 A;  2O0W A;  4W8T A;  4XR6 A;  1O8D A;  4XM3 A;  2IQ7 A;  3ZSC A;  1VBL A;  1XG2 A;  1IB4 A;  4OJ6 A;  2VBK A;  4Z03 A;  1O8J A;  3KRG A;  4EW9 A;  2PYH A;  2VJI A;  1O8G A;  4XOP A;  3LMW A;  1O8F A;  2NST A;  4YEJ A;  1O8I A;  4XON A;  2NZM A;  2VJJ A;  1OGO X;  4XLA A;  1HG8 A;  3WWG A;  4XNF A;  1RWR A;  4XL9 A;  1O8E A;  3VMW A; 
#chains in the Genus database with same CATH topology
 4NK8 A;  2XTW A;  4PMH A;  1RU4 A;  4XN3 A;  4YDT A;  2NTQ A;  3P4G A;  1EZG A;  4OJP A;  4URR A;  3VSU A;  3ML3 A;  4OPW A;  4YZ0 A;  2INV A;  2BSP A;  2G0Y A;  2NTP A;  4XN0 A;  2ODL A;  1BN8 A;  2QXZ A;  1QQ1 A;  3B8Y A;  2VBM A;  3EQO A;  2O17 A;  2YUH A;  2XT4 A;  4MR0 A;  1TYX A;  2QYU A;  4OJL A;  5C1C A;  1K5C A;  3PET A;  2VBE A;  2NT9 A;  4OJ5 A;  5JMC B;  1OFE A;  4W8Q A;  4MXN A;  5JLV C;  4XKV A;  3TH0 A;  1DBO A;  2BM4 A;  1EA0 A;  3GQ7 A;  1QJV A;  1IA5 A;  1O8K A;  4XLE A;  1DBG A;  3SYJ A;  3UW0 A;  2X6X A;  1QRB A;  3T9G A;  2UVF A;  2X6Y A;  1JRG A;  2UVE A;  1EE6 A;  3SQV A;  1PXZ A;  1KCC A;  1WMR A;  3ZPP A;  4XQF A;  3JUR A;  4U4B A;  4NK6 A;  4YZQ A;  3BH7 B;  2O6W A;  2X6W A;  1IDK A;  1JTA A;  2F3L A;  3FY3 A;  4XOR A;  2QX3 A;  3H09 A;  3SUC A;  1KCD A;  5AMV A;  2INU A;  4AVZ A;  3LJY A;  4XMY A;  2J8K A;  3VST A;  2XTY A;  3B90 A;  3PSZ A;  1OOC A;  4W8R A;  3N90 A;  4JRA C;  3PSS A;  1AIR A;  4Z06 A;  1NHC A;  3LYC A;  4OJO A;  2XC1 A;  4C2L A;  3SZE A;  3GQ8 A;  1OFM A;  4XLF A;  1QA3 A;  3NB2 A;  2BM7 A;  5C1E A;  1QRC A;  2VFM A;  2NT6 A;  2XTX A;  3VMV A;  3JX8 A;  1TYU A;  3EQN A;  1OFL A;  2NSP A;  2VFO A;  3VSV A;  1OGM X;  3B4N A;  4V02 C;  4YEI A;  1K4Z A;  1TYV A;  1LM1 A;  1PLU A;  2QY1 A;  5DNS A;  1LLW A;  1TYW A;  4YZA A;  2BX6 A;  4XLH A;  2O0V A;  4OM9 A;  1PE9 A;  2NTB A;  4KH3 A;  4OZY A;  4YCQ A;  2EWE A;  3GQA A;  3RIQ A;  1QCX A;  2Z8G A;  3GQ9 A;  2BM6 A;  4HWV A;  4YEL A;  3NAW A;  2O04 A;  1KTW A;  1O8H A;  4Z05 A;  4I84 A;  4YZX A;  1OFD A;  2X85 A;  1X0C A;  1GQ8 A;  2O1D A;  4XLC A;  2PEC A;  2PYG A;  4U49 A;  4XKW A;  1H80 A;  1O8M A;  1RMG A;  2X3H A;  1QA1 A;  2B0R A;  4OZZ A;  3SY2 A;  2QZA A;  1O8L A;  4W8S A;  1CZF A;  1IDJ A;  3DU1 X;  4XOT A;  1DAB A;  1WXR A;  3GRH A;  1CLW A;  1BHE A;  1O88 A;  2O0W A;  2VFQ A;  3AK5 A;  3BH6 B;  4W8T A;  1QA2 A;  4XR6 A;  1O8D A;  2VFP A;  2J8I A;  2IOU G;  4XM3 A;  1TSP A;  2IQ7 A;  1K8F A;  3N6Z A;  1VBL A;  1XG2 A;  3ZSC A;  2VFN A;  2BM5 A;  4OJ6 A;  1IB4 A;  2VBK A;  2XT2 A;  4Z03 A;  1O8J A;  3KRG A;  4EW9 A;  2PYH A;  2VJI A;  1O8G A;  4XOP A;  3LMW A;  1O8F A;  2W7Z A;  2NST A;  4YEJ A;  1O8I A;  4XON A;  2V5I A;  1L1I A;  1KQ5 A;  1LLZ A;  2NZM A;  1HF2 A;  2VJJ A;  4YC5 A;  1OGO X;  4XLA A;  1HG8 A;  3WWG A;  4XNF A;  1RWR A;  4YFO A;  4XL9 A;  1O8E A;  3VMW A; 
#chains in the Genus database with same CATH homology
 4NK8 A;  4PMH A;  1RU4 A;  4XN3 A;  2NTQ A;  4OJP A;  4URR A;  3VSU A;  4YZ0 A;  2INV A;  2BSP A;  2NTP A;  4XN0 A;  2ODL A;  1BN8 A;  2QXZ A;  3B8Y A;  3EQO A;  2VBM A;  2O17 A;  4MR0 A;  4OJL A;  5C1C A;  1K5C A;  2VBE A;  2NT9 A;  4OJ5 A;  4W8Q A;  4MXN A;  4XKV A;  1DBO A;  3GQ7 A;  1QJV A;  1IA5 A;  1O8K A;  4XLE A;  1DBG A;  3UW0 A;  2X6X A;  3T9G A;  2UVF A;  2X6Y A;  1JRG A;  2UVE A;  1EE6 A;  1PXZ A;  1KCC A;  1WMR A;  3ZPP A;  4XQF A;  3JUR A;  4U4B A;  4NK6 A;  4YZQ A;  2X6W A;  1IDK A;  1JTA A;  3FY3 A;  4XOR A;  2QX3 A;  3SUC A;  1KCD A;  5AMV A;  2INU A;  4AVZ A;  4XMY A;  3VST A;  3B90 A;  1OOC A;  4W8R A;  1AIR A;  4Z06 A;  1NHC A;  4OJO A;  4C2L A;  3GQ8 A;  1OFM A;  4XLF A;  5C1E A;  2NT6 A;  3VMV A;  3EQN A;  1OFL A;  2NSP A;  3VSV A;  1OGM X;  3B4N A;  1PLU A;  2QY1 A;  4YZA A;  4XLH A;  2O0V A;  1PE9 A;  2NTB A;  4OZY A;  2EWE A;  3GQA A;  1QCX A;  2Z8G A;  3GQ9 A;  4HWV A;  4YEL A;  2O04 A;  1KTW A;  1O8H A;  4Z05 A;  4I84 A;  4YZX A;  2X85 A;  1X0C A;  1GQ8 A;  2O1D A;  4XLC A;  2PEC A;  2PYG A;  4U49 A;  4XKW A;  1H80 A;  1O8M A;  1RMG A;  2X3H A;  4OZZ A;  1O8L A;  4W8S A;  1CZF A;  1IDJ A;  4XOT A;  3GRH A;  1BHE A;  1O88 A;  2O0W A;  4W8T A;  4XR6 A;  1O8D A;  4XM3 A;  2IQ7 A;  3ZSC A;  1VBL A;  1XG2 A;  1IB4 A;  4OJ6 A;  2VBK A;  4Z03 A;  1O8J A;  3KRG A;  4EW9 A;  2PYH A;  2VJI A;  1O8G A;  4XOP A;  3LMW A;  1O8F A;  2NST A;  4YEJ A;  1O8I A;  4XON A;  2NZM A;  2VJJ A;  1OGO X;  4XLA A;  1HG8 A;  3WWG A;  4XNF A;  1RWR A;  4XL9 A;  1O8E A;  3VMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...