4XN3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
596
structure length
596
Chain Sequence
b'FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 227
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn3A02
1KCDA 2O17A 1VBLA 1RU4A 2IQ7A 3KRGA 4URRA 4XR6A 1O8FA 4XM3A 1HG8A 3T9GA 1IDKA 3FY3A 1WMRA 1BHEA 3GQ8A 4OJ5A 3VMVA 3VSTA 4XKVA 1OGOX 2X6YA 4U4BA 4W8TA 4NK6A 1PE9A 3EQNA 1O88A 1KTWA 4XN0A 1X0CA 4Z03A 1O8MA 4XOTA 4MXNA 5AMVA 4I84A 4XLAA 4XLFA 2VBKA 3VSUA 2O04A 4NK8A 4XN3A 3ZSCA 2UVEA 4XL9A 4XLEA 1JRGA 2NT9A 4OJLA 1JTAA 4OZYA 1KCCA 4OJOA 1RMGA 2QY1A 1OFLA 1K5CA 1QCXA 3B8YA 3ZPPA 1PLUA 4W8SA 2X3HA 3JURA 1O8JA 1AIRA 1H80A 3LMWA 2O1DA 2NT6A 4OJ6A 1EE6A 4C2LA 2VBEA 4YZAA 4YZQA 2Z8GA 3GQAA 3B90A 1O8GA 4XKWA 4XOPA 2QX3A 4OZZA 1QJVA 1GQ8A 4XLCA 1O8KA 1XG2A 2QXZA 3WWGA 2X6XA 2NSPA 3B4NA 1OFMA 4OJPA 2NZMA 1O8DA 1O8LA 2VJIA 1O8EA 4XNFA 4Z05A 4YZ0A 4XONA 4AVZA 1O8IA 3GQ7A 4XORA 1DBOA 3VSVA 2VBMA 3GRHA 1RWRA 2PYHA 4W8RA 2UVFA 4MR0A 2PECA 4U49A 3SUCA 2O0WA 2X6WA 2NSTA 2VJJA 1IDJA 2INUA 1CZFA 1OOCA 2NTPA 3UW0A 1IA5A 5C1CA 4XQFA 4EW9A 4Z06A 1O8HA 4W8QA 3VMWA 4PMHA 2NTQA 2NTBA 2EWEA 2PYGA 1IB4A 2O0VA 4YZXA 1BN8A 1OGMX 2BSPA 4XLHA 4YELA 4YEJA 5C1EA 3EQOA 2ODLA 1DBGA 1NHCA 3GQ9A 1PXZA 4HWVA 2X85A 2INVA 4XMYA
chains in the Genus database with same CATH superfamily
1K78A 2LY2A 1F4KA 2B0RA 2P81A 2WADA 3C1DA 5K5QA 2BV3A 1WDTA 1BIAA 1V5EA 2M4GA 4OINF 4CCKA 4IRIA 4E0FA 3HRTA 3T56B 2HXIA 3OIPA 1GVHA 3RZDJ 3L09A 3AVUA 4AF6A 2VN2A 1HSTA 3DBHB 4PDKA 1QRCA 2VE9A 4IL6C 1O3SA 1BR1A 3G4SB 1TWAJ 2EFPA 1QRYA 1MBKA 5CPRB 2CSOA 2CRVA 4P6YA 4LB5A 1M90D 5HLIA 3KEOA 3KX2A 1VQ9B 3TH0A 4X0GA 1DPUA 3CUOA 2M2EA 3CP2A 3FMRA 1WI9A 3KP2A 4NHJA 3WXMA 3IKVA 4Q48A 4XN3A 4BQNA 4QIWN 5EF6A 2DA5A 4BHBA 4BDYA 3PENA 1B23P 1KCCA 2E1OA 4BEHA 2HMAA 3FXJA 5FJ8J 5IYWA 5EZHA 2JSCA 3J81Z 2O61A 4ZH4F 4RPBA 4W8SA 5FA6A 1O8JA 3OYMA 1B6AA 4NCNA 3ASSA 4ITVA 1QUEA 4QFMA 2XGJA 1EE6A 2XKPA 3SHFA 3HOZJ 3Q6QA 1LUJB 2IP2A 2VXZA 5KAFC 2D74A 2FOWA 5IYQA 4M9ZA 3DKWA 3OFNA 3F8MA 4X6AJ 2LF8A 2V9PA 3OYHA 4DK1A 2CC2A 2B0LA 2HZDA 4XRSG 1MMDA 3G73A 1SAUA 4QWQA 2MW8A 3H94A 3FXMA 3RCOA 5A8AA 3HB9A 4AIDA 1BJAA 4DW6A 3G1OA 2V1UA 4U0VA 2VNIA 4FWTA 2H8RA 1H8HA 1O8DA 2IS6A 4E4HA 1D1BA 4A3DJ 3DEUA 4RGXA 3W2IA 4Z05A 1RI7A 1O8IA 1KQSB 3DQVC 1STZA 2XV4S 3OR2C 4E7JA 1IJWC 4AIKA 1D8KA 1BI0A 4L9NA 4Y9RA 2QLZA 2XB5A 3VEPA 5J35A 4P3YA 4RD3A 1IDJA 2L9RA 3KP3A 1FDRA 4C0SA 1VQKB 4M9SA 2INUA 4IRHA 5L3FA 4NC6A 1O7LA 5FKLA 2V7WA 3J81K 1MD0A 2ZZGA 1SD4A 2OZUA 3VNUA 1T8IA 1WP6A 2M0MA 1J75A 1H9GA 5HVQC 3VMWA 5IYCJ 2DMQA 2HOEA 1TTTA 1I6HJ 2BM7A 2DDBA 2DI3A 1C0WA 3MHPA 2EWEA 1QGZA 4I02A 3OYEA 4MEXF 1T08B 2MBFA 3BQZA 3NAWA 1TWGJ 3HUGB 4YEJA 1R71A 5ILVA 2ZZEA 2W25A 1P7JA 2BY2A 5HLGA 1MDMA 4X07A 1KGSA 1MBGA 3PUMA 2ZBKA 4PFPA 2X85A 3BWGA 1KA8A 4BHCA 2IJLA 2VPLA 3ZQ7A 4LGWA 2ZB9A 5L3GA 2J7KA 3VO2A 3GZ5A 3CJNA 5HS9A 2H94A 2Q2EA 3F3XA 3QU3A 1BQEA 1YRNB 1PJ6A 1HW5A 5H2FC 5IK2A 1LM1A 4P2NA 1SC7A 1IDKA 3C7JA 1JKPC 4BXFA 2R5ZA 2FEZA 3AVWA 3OZVA 2NNNA 2VJ5A 3QWLA 4YHBA 1REPC 2OC6A 1OFCX 5LRRA 4CCMA 3BPXA 3E3VA 3ELKA 4FCYA 3DTIA 3K1NA 4EM1A 1OGOX 3HYIA 3TOAA 4O6JA 2YS9A 3QPHA 1BI3A 1PJ7A 1XMKA 3ASOH 3PL8A 2IS2A 2QWWA 3SLDA 2KQRA 3T53B 1H42A 2R92J 4D7NA 3HPHA 3I59A 2K3PA 1HBXG 3FM3A 2ZMEB 1MSEC 1WOOA 1JT6A 4CO8A 2P8TA 5J1YA 2DPDA 4S05A 1HA3A 3UNGC 2BHZA 4UZEA 2KZGA 1KU7A 4RD4A 4B4DA 1IF1A 3ZSCA 2L4AA 3HIFA 4L5IA 1KYZA 4BGDA 1NRKA 3Q39A 2LY9A 2RNGA 4CZCA 3W6VA 2H27A 1WH5A 1K83J 5JR3A 2KJCA 3T0YA 4IHYA 2FMLA 3B8HA 2D1HA 3IC7A 1EA0A 3BNWA 2VL8A 3CZ6A 1T6ZA 1EH7A 1YLFA 4BU2A 1QHHD 1WTHD 3VFZA 3CTAA 4BHPA 4NNJA 3GQAA 4B47A 2DU9A 2EIJH 3S1MJ 3DKYA 5HZAA 2CWEA 2RNJA 4W97A 5CVRA 4HNUA 2XAFA 4M3GA 3FXUA 2LBFB 5KNLA 2M7AA 5JVGF 4X8IA 1X3UA 1XS9A 2X6XA 3KLOA 4YIRX 4WZKA 2VT2A 2BVMA 3R0AA 1FNCA 2HQ5A 1KONA 4YIIA 5F08A 4P96A 1Z0XA 1I1SA 1PDNC 3BCDA 3ML3A 2D3NA 1G3SA 2QF7A 2O6GE 3SEJA 1FPQA 3CDLA 1XDSA 4HZFA 3MZHA 3EUHC 2A07F 4I0AA 2QA4B 3MKYB 5FFZA 2FUG2 4IXAA 3QYBA 2VUMJ 1FBUA 1VLOA 4L18B 3CXCB 3CCSB 2HFHA 4KT6A 2KIQA 1JKOC 5J1UA 3BTCA 4A12A 3EUKL 4OAZA 2HVSA 3QAHA 4BJ5C 1U8BA 3CMEI 1LVAA 3ZIAA 3A35A 5C1CA 3IH2A 2R7WA 4KIFA 2VYQA 1XB2A 5D5UB 1VQ6B 2LOOA 1DDGA 4YFNF 1GR1A 5FO0A 4CH7A 1USTA 2E36A 2QE7A 4Z4TA 3ZBTA 1Z67A 3WTWC 1VQOI 3GTKJ 2B63J 1FC3A 1UD3A 2H6BA 2HKXA 4HAMA 3U9GA 1ZYRF 3JQQA 1SD7A 1NHAA 3CCLB 5DCFA 4HX7A 2PJRB 1R23A 4ENKA 1WOSA 2ZCWA 1W7PA 3ERED 2CQNA 2X1CA 4MO7A 2BGIA 4K2EA 4CA0A 2YX4A 1Z9CA 3LNQA 3V4GA 1T56A 4PGOA 3CCMB 4V2FA 3NQOA 2KL4A 4LG0A 4KIGA 2WY8Q 4IHXA 5IP6A 1O3QA 2HLDA 2K5CA 3H5AA 3JW4A 3GZ6A 4X0CA 2QM3A 1O8FA 3NARA 4UUTA 1O57A 3BJ6A 5HKKA 3A03A 4XLNF 2MLKA 2ID6A 3HRUA 2RC6A 4PCQA 2K7LA 2LG4A 3K69A 4IOAF 2PFBA 3OZUA 2ELKA 1S9HA 4I6ZA 2MSYA 3H9NA 2X51A 2OV7A 1I5ZA 5F1JA 1PUEE 3GLLA 4BXUA 2XEXA 5CVUA 3VWBA 3FPPA 3AL0C 3C2HA 4GGGA 1FSEA 1JUPA 2BW3B 3FZVA 2V7VA 3BG6A 1QH0A 4PC7A 1TW3A 4DGWB 2HS5A 3NWSA 1IC8A 4D9JA 2OBTA 2ZJQF 1O3RA 5HDNA 4MIMA 3GVLA 3BY1A 5E1ZB 5BMZA 4AIHA 5E8GA 1KU9A 1N75A 1XC5A 4RMNA 2QMUA 3ZQHA 2FX3A 4OJOA 1ZLJA 2EZKA 1G7TA 2OPTA 2WAQA 3KZZA 3GIRA 2R7UA 4EJWA 2GJKA 2MC4A 2MABA 3PFYA 1Q9SA 1IV6A 2O1DA 1BW6A 1BPLA 3CF2A 1S7OA 1U2WA 4MLOA 1LFUP 2RV8A 2GXAA 4U9UA 1O8GA 1XSVA 5LGTA 3JSOA 3QP5A 2VFMA 1S5LC 4N0BA 5CKTA 3V7CA 5JI6A 3PIOF 2VFOA 4M3BA 2WV1A 2IBDA 2GXGA 1E3OC 5F04A 3QFSA 4A3JJ 1WKMA 2NSPA 3HL2A 4OJPA 1W0KA 3OPOA 3OIOA 3KPHA 3HKZA 4C3JJ 3ZC3A 2AO9A 2X6OA 5FKKA 1XGOA 2OA4A 3CMMA 4NB5A 4M9XA 3GRHA 2PYHA 4BJTA 4ZDPA 1H89C 3U2RA 5A89A 4R1HA 3B6CA 3ZMZA 2QEXI 2O8KA 5D4RA 5F0FA 1YITI 3PNVA 3OYGA 5A2QZ 3ONUA 2C4UA 3I54A 1VQ7I 3UW0A 2DQLA 4EGZA 2WC2A 1TLLA 2VLAA 1BM9A 3O3KA 1USSA 2O3FA 3OYKA 4GDFA 1CLWA 4XQFA 2F5FA 4BDZA 5LHHA 2F1LA 5BSXA 4Z06A 1WOPA 1K7AA 1JJ8C 2VXDA 1QHGA 1YW8A 3RIQA 3X2QH 3R0JA 2YWHA 4QSHA 2NPFA 4QHYA 2HYJA 2R3SA 4ZDLA 2O0VA 1LE8A 2M0CA 4XLHA 5DCMA 2TCTA 2KJBA 4MQ9F 1XMAA 2YSRA 2X0LA 3ZPLA 4MTDA 3O2PE 1JA0A 2HDNB 1K4TA 3W2FA 3BR5A 1VNDA 2DK8A 2DMTA 2FXAA 1BMFA 3CCUB 3GQ9A 1RUOA 4F3QA 4EMSA 3J7AO 2QCOA 1LPQA 1HVXA 4XMYA 1VQLB 4Z4YA 2WAQN 4I99C 5K5OA 1PUFA 1VBLA 3BDDA 4ROXA 4YRVA 1R1VA 2IGOA 2M30A 4HG2A 2ME6A 2BEOA 2NVUB 3A0HC 2MGQA 3DF8A 5J3OA 2OZ6A 3ULQB 2QTLA 4OWRB 2FA5A 2OD5A 3E6BA 3FXRA 3K6GA 4UUSB 2C5BA 3SQNA 5A2QK 3GTPJ 1RR7A 4MGRA 3SQVA 3ABUA 2EK5A 1NTCA 3GWZA 5EGOB 3N4MA 2EH3A 2W57A 4UZFA 2VODA 3F72A 2KLOA 2FVGA 1O8MA 2W4SA 3S1RJ 4OOXA 2WZNA 2Z16A 1WHUA 4IF4A 2J5OA 1F20A 2KDZA 3FBIB 5H59A 4IHTA 5JFRA 3NRVA 2DW4A 3CUQC 3K1PA 2XUBA 3KIOA 3CMYA 2VBKA 3ABKH 5F6FA 1JE8A 4WX9A 5DDGA 1HZEA 2OTJB 2W6JA 4UXNA 1UHSA 1YFHA 2MH9A 1O7FA 1BX1A 5DV5A 4P3IA 4AC9A 2KRHA 1VTNC 1V5GA 4GXOA 3E97A 3PUNA 1HW1A 1W36D 3L2WA 4IX7A 3MCZA 3FMQA 2XT4A 2N8GA 1FP2A 4NDLA 3NWTA 4FHTA 1JHFA 2R93J 1CF7B 3LA7A 2DYIA 4YZQA 1I3QJ 2EZHA 3RQ4A 3GFLA 5E79C 2BPOA 1UJ8A 2Y2ZA 3SYTA 1OB0A 3ISPA 2R5YB 1QJVA 3Q3AA 2DOFA 1IUYA 3EQLF 2DAOA 4LJZF 5HS7A 2EB7A 1YHQI 3RKYA 5J4YA 1TNTA 3FWEA 2F6CA 3ML6A 1DU0A 1PJ5A 3OSFA 1FYKA 3DP7A 1IV8A 2NZMA 3NB2A 1JT0A 4HRIA 1FNMA 4FE4A 3ASNH 2BYVE 1MMSA 5D5VB 3VSKA 2V26A 3K10A 1FRNA 2DLLA 1U5TC 5LHGA 2V1DA 4KUMA 3ZZUA 5DUIA 3V8KA 4IHWA 1IB0A 5GAEJ 3G4SI 3E5UA 2E5NA 1R00A 4YG2F 2NSTA 2LLKA 4U49A 2K9QA 2L0KA 4DYQA 2J5PA 2VE8A 3WG9A 3LSKA 4HA8A 3N05A 1FSHA 1TYUA 5DS0A 1RPWA 2XAGA 1HKSA 1FMVA 1Y8QB 2BMWA 1BOBA 2BN4A 1VQ9I 1R49A 3ONYA 3CJTB 2F5EA 4GQNA 3S17J 4TMWA 3W2VA 4YIFA 1ETOA 1POGA 4M3DA 1BN8A 3BC8A 1N78A 3TOBA 2HZTA 1WFXA 2OAZA 4E7ZA 5JLWA 2PIAA 3JX8A 3I4MJ 1W1WE 1QG0A 2ZFUA 4M53A 3WTVC 5H20A 2R0QC 2E2HJ 3K4MA 2RQPA 1MBFA 2LF7A 2VNKA 1YIJB 1U9NA 2HQRA 4A3EJ 1XFOA 4LMYA 2FNPA 1ZG3A 1UMKA 2A61A 1XSDA 4RCYA 4N3NA 3FY3A 2P5KA 5IYRA 2BE5F 2MD0A 1EV7A 1E17A 1EFCA 2CW7A 1ZR2A 4MYUA 3FDYA 3B6AA 3WTZA 3BY2A 3LVBA 3CJQB 5FL7A 1XSXA 1S29A 4V02C 1W9XA 4HW0A 4CQJA 2KMUA 2WYRA 2W24A 4OIOF 3BG9A 5BQTA 5LGUA 2JPCA 1IG7A 1K78B 4ZGQB 1MJ9A 3EUHA 3RPUA 1JHHA 2ADUA 1G4DA 2V6EA 2VBUA 5AMVA 1JUMA 3J7YJ 2TRTA 2IW5A 2L3DA 2CQKA 2XGCA 2O04A 1N07A 4I98B 2NOGA 1I50J 4FISA 5L3BA 4P9UA 3BR1A 3CC2B 5DEQA 4L9JA 3OL3A 1Y56A 3I1FA 5HOOA 3EUAA 1Z7LA 1RKTA 1O4XA 4A0YA 3OSGA 1BI2A 2IT0A 3VYRB 4LG3A 1DG1G 4JRAC 2STTA 2ZC2A 1Z05A 4OJ6A 4MQVA 2H1LA 3G1LA 4TV7A 3GVKA 4YZAA 4HDVA 5BPIA 4U88A 1K8AD 2IOUG 1W5TA 3DBRB 1QFJA 4XRMA 3BR3A 4OZZA 1TVCA 1TTYA 1O8KA 2LDUA 1UCRA 1ZKGA 1KQ8A 4G7OF 5FLVA 1E3XA 2MLGA 1Q1HA 3MWMA 4RM2A 4BEHB 4CYCA 3L1PA 3L2QA 5D5XB 3ECOA 2DFHA 3QYEA 2ZJPF 1IN5A 3LSTA 2XTYA 1T95A 1FOYA 2CV2A 1KD1D 1Y6IA 2WPDA 2M7BA 4YZ0A 5ICGA 1R1UA 3OYIA 3ZBUA 6PAXA 3ZMUA 2C78A 2DT7B 1Z1DA 1OR7C 4PK4A 1NBMA 4X7DA 5TY0A 2WB1N 1SD6A 2M3AA 5FKMA 3GFJA 2IS1A 2JRTA 5BS6A 1IRZA 4MR0A 5FKOA 5HLHA 1QQ1A 1K28D 2YU3A 2Z6BD 3KETA 1KU3A 2L02A 4RGSA 1E3HA 2E19A 2JK3A 1JJ6C 3K9TA 3ZP5A 3QPLA 1Z6TA 3U21A 2XSDC 1T5EA 1MBEA 3S2HJ 4P1WA 2VC0A 3GBGA 4F52A 3A02A 3WTTC 1F1ZA 3E0JB 2CW5A 3A8JA 4PUSA 1GVDA 2OU2A 2BVNA 5E1XA 2K4JA 5F27A 4HLYA 3AGPA 1T2KA 3CCJB 1OGMX 4A6EA 4DBQA 1NB0A 3TL4X 4ZYHA 5AONA 3L2VA 2YU9J 5F1RA 4DBRA 2F5CA 4XIDA 4P25A 1PKVA 4ENJA 2E1RA 3PO2J 4IQJA 3LAJA 3OWTA 4UAJA 2XB0X 2COMA 2ZO4A 2Y48A 1S72B 3AVXA 5B3SH 1T98A 2W84A 1E62A 4ZC3A 1K4SA 1UD6A 2K9SA 4XRSA 3BTJA 3A2KA 2L2OA 4Z4VA 3LAPA 1S7EA 1RKWA 3VYUB 3D1NI 1XE1A 3AK5A 1FTTA 1MMNA 1XTAA 4N4OB 1JJ2B 3OYLA 2BY3A 1VF9A 4UB8C 1B4AA 3CLQA 4XKCA 2XROA 4KISA 2PLFA 1NJID 3GTJJ 1K4ZA 4U4BA 1N0UA 3CCRB 1MDMB 1FT9A 3DKXA 1ZTRA 3JRGA 4MFDA 2CQ7A 2M87A 2AS5F 3ASTA 3EQNA 4WXHA 2ID3A 1QA6A 4U0WA 1D3YA 3ABMH 1NDHA 4IW3B 1B72A 1ZM9A 2E34A 3ABTA 1HF0A 4ZV4A 3ZMVA 4EJTA 2Q2EB 2V4DA 4EVIA 2QA4I 1YJ9B 2WAEA 4XLFA 2GBYA 2R5ZB 3R6KA 3AGQA 4ESBA 1J5YA 4V2GA 2B7EA 2HR3A 4FASD 3PA1A 2NVXJ 4HF2A 3IUOA 3GTLJ 4OZYA 3MVPA 4C3HJ 1R5ID 3ZQIA 2UV1A 2D3LA 4YAFA 5FB2A 4EGYA 2IA2A 3OEHA 1OB5A 5LMZA 1PLUA 1GLNA 2ZNZA 1PP8F 2OF7A 2Y30A 4KMUX 2AQFA 5EYRA 5TR9A 1VQ6I 4OOSA 3I3LA 2QGUA 3OYNA 4FX0A 3I59B 4IEJA 1V54H 2DTRA 3SFZA 3H92A 2Z8GA 5DD4A 5ICEA 2YWGA 5E6TA 3H3VK 5TRDA 4JOMA 2XGEA 3HRMA 1EP3B 3I64A 1ETYA 2IA1A 2ACJA 3PUFA 1YX2A 4YAWA 1E64A 3DFGA 3AG3H 4KT5C 1ZGAA 4Z4RA 2NYXA 4Z4UA 3P9IA 2X0KA 3F8BA 4A3GJ 2JWTA 4QVAA 4XD7A 3IH3A 3IRRA 4LBVA 3CCMI 1HDDC 5F4OA 2QTZA 5HNHA 1BC8C 3K1MA 2ELJA 2X1EA 3Q6RA 2ESHA 2QSHX 3K2AA 2D9RA 2AXTC 5GP9A 3S1NJ 4X7CA 1T33A 1DGWY 4B09A 2LRDA 5FLXZ 1X1DA 2IVMA 3N97A 2ZL5A 4ENNA 2DA7A 2BM1A 4XBFA 4D1QA 2VBYA 3R61A 4PJMA 5IP9J 4Y52J 3CCVB 4OIRF 2E2IJ 1CQTA 3SJZA 3KP5A 2J8IA 3QYFA 2ZITA 1ZELA 2BGCA 2KHMA 5LGNA 2D1VA 1QBJA 4QUZA 5FO1A 2E1MB 2Y0SA 4HE5A 4F92B 4LLNA 3MFKA 2EIKH 1FY7A 4W8QA 1RUNA 3BQYA 4LFUA 1DDIA 2OQRA 2F48A 4RGUA 4DYRA 5K1YA 1WCMJ 5DTDA 3CUQA 3WYAA 1YX3A 2NS7A 3SXYA 3CMAI 2DODA 1WSUA 2XTXA 4Y4RA 4M73A 4ASUA 3W5HA 3EQOA 2R7RA 4JX4A 3TMOA 5ICCA 1N77A 3BQJA 2VBXA 2FRHA 1KMHA 2ZBUA 3I56B 4G94A 2FBIA 3GEZA 4G9YA 4BNCA 3P26A 3PETA 2M34A 1QPIA 2IQ7A 3W3CA 3KRGA 4URRA 4XM3A 3HDDA 3CJRB 1WH7A 3WODF 3IH4A 3TO7A 1RC9A 1Y1VJ 4YFXF 1B9MA 4C3IJ 5FLXK 1BN5A 2JQ7A 1ETWA 2QN6A 3GQBA 3U6BA 3W6JB 5GV7A 4JQFA 3TO6A 4LOCA 2B7CA 1UELB 4W8TA 3GTOJ 2YWFA 3S93A 5JHUA 2MH2A 2JA2A 1P6RA 3SZTA 1W7PB 1S8NA 1BOAA 1W5SA 5KSWB 3FK7A 4KN7X 2CUEA 2M1BA 2VBVA 3E1SA 4DZPA 2E1NA 3S2DJ 1QVTA 1VHOA 4MNUA 1TBXA 1FTZA 3BG3A 1TQIA 4HNVA 2DMUA 4LG0B 1LEAA 1U5TA 3LNNA 2YPRA 1AA7A 3BCAA 4UHTA 2KIMA 1KTVA 2ZTNA 4L8JA 3BH6B 3FIWA 2JT1A 3M1EA 4ZCLA 4KJZA 2IGKA 4XLEA 3WGIA 1KK1A 3A1PA 3OAAA 4Z4SA 3OY9A 1D2EA 1OFDA 4RB1A 1KK0A 1BBYA 5IYNA 3K7AJ 2GA1A 2UZKA 1XCVA 1WJCA 1TT0A 4YXWA 3G1MA 3H1CA 3GFMA 3MCAA 2DJNA 5EZGA 2Y0SN 2NS8A 2XDVA 1JUSA 1X3WB 1F9NA 4IOCF 1TWFJ 1KK3A 2BGJA 5EG0A 3JU4A 2LKPA 4TMVA 2L5QA 1D5VA 4C43A 3Q38A 1IRFA 4A69C 5C3EJ 4FN5A 4N4NB 3CCUI 3FXQA 1VQ8B 3WWGA 1SVMA 1UFMA 1PVEA 2GIVA 2O5RA 2NVYJ 5ILSA 1YOVB 5A88A 4ZCMA 1VQLI 2NVQJ 1B1BA 3AG1H 5DD8A 5J8CA 1JGGA 1NB9A 1FIPA 2FU4A 1ZGWA 2BZTA 3S8PA 4UVBA 2ZBVA 4AVZA 1XPXA 4O3MA 3RPUD 3ZQFA 5IT9Z 4EATA 4B1RA 1DDNA 2A6TA 4P1VA 3SJPA 4F7ZA 4LBYA 3I55B 1VQPB 3W5VA 1D1NA 1WGXA 5CVVA 2O9LA 1LEBA 2ZL6A 4W8RA 2UVFA 3OOCA 1IUFA 4P9FA 2X1DA 4Z2YA 3TKYA 3DWLE 1S4MA 4AYBA 2B7BA 2GJRA 1Q82D 3OV8A 1IN4A 4D5FA 4ZYEA 1E63A 1FP1D 5B6IA 2O0YA 4HX8A 2ZTGA 1T38A 2VASA 1OB2A 5FKNA 3CDIA 2LC2A 4BL0B 4PC2A 3MZ8A 4ETSA 2WWYA 4YALA 4LIVA 4L5EA 4M72A 2VQGA 4M3EA 3ZN0A 1D1CA 2ECBA 3H36A 1N8RD 2FBHA 1ZLKA 2BSAA 2BY1A 2F4OB 1X4OA 1N08A 4HSRA 5J3LA 1GAQA 1B59A 2OBSA 5E18F 2XIGA 2MA3A 1Y1WJ 1V0FA 4G7ZF 1FOXA 5IYPA 4ASNA 2DYSH 2PE3A 1VQNB 4OPOA 1BL0A 2INVA 4UV9A 1R36A 4A5NA 1VQMB 1KK2A 2QBYA 3ESWB 4IZZA 4PJ0C 4N9HA 4B48A 1U2RA 2C2WA 1Z3XA 2P6SA 4RAZA 4RM3A 1OCTC 3WE3A 5IT9K 1ZRFA 4A5MA 3BCBA 4LB6B 2L7KA 2LSOA 3ZQGA 2STWA 3GQ8A 3F21A 1BI1A 3S3OA 2Z9OA 3OS1A 2QQBA 3V8JA 1LE8B 4IHSA 1XB4A 3F0CA 5KAIC 1MJAA 1BR2A 4FX4A 2K27A 5DCMB 2QZ8A 2PN6A 3ZRGA 1FYMA 3S32A 3DDYA 4NK6A 1WI3A 3WBJA 2BM4A 3JQRA 5CJ9A 3K4CA 2BXZA 4ZYGA 1KTWA 2CQQA 5F0HA 5KHDA 4BYYA 4AVPA 4E7LA 1ETXA 2QKMB 2QSGX 1GO2A 1AIPA 4OPWA 1LFPA 1PUFB 2PMUA 2CFOA 1FRQA 1R5OA 1VLYA 1OR7A 3S2WA 2QUFA 2OTLI 1FX7A 1F60A 2PBIA 1NK3P 3A4CA 1QZZA 2WTEA 4Y15A 2PG4A 3RYRA 5FROA 5B1AH 5IOZA 4FTHA 1AOYA 2E1BA 3AVYA 4XK4A 4AYBN 2M8EA 5J40A 1P92A 3RKXA 1RMGA 2GJPA 3FHNA 2H09A 2NXNB 3HOSA 5DM6F 1Y0RA 3LQEA 4Y33A 3DU5A 3FXLA 3BR0A 3LSMA 1IW7F 3ECHA 1H80A 3WHBA 5LLQA 4I09A 4E7KA 2G7HA 5FD6A 2IRFG 2UWMA 1QNTA 4XICA 4G7WA 1WWXA 2ISYA 4XOPA 1W5CC 2JN6A 4EM0B 5F0CA 3D5SC 1MRZA 3UKGA 3QOPA 3W5UA 3VB2A 1YIJI 1GJRA 1YW9A 5ICFA 1U0JA 4L9VA 1Y39A 1VJSA 3DPUA 2CV1A 5IYBJ 1KQ5A 3ZPNA 2GK7A 3GQ7A 3G6EI 2MD5A 2JRMA 3QSYA 2B5OA 2ZXHA 2DQRA 3LSHA 5E20A 3K4JA 1TL8A 1VQ5I 1KZLA 4ACBA 1YO5C 4TMTA 1P4WA 4BJ6C 2VBMA 1JA1A 4PC6A 3JRDA 3PA2A 2LREA 2X48A 4RGRA 3SYJA 3K0LA 4L9TA 3GF2A 4ZJZA 2CF4A 2WJYA 2VBSA 3PSIA 5EDNA 4M6XA 1QFZA 5CQGA 1EZGA 1MKMA 2OYNA 4X06A 3CD6B 2HU9A 3OS0A 1CZFA 2EBIA 1OHHA 3KL9A 1OOCA 1X58A 3D5LA 3TBIA 2LMDA 2C77A 3H09A 2RDPA 4RBOA 1X3ZB 2JA5J 2EFOA 4ENMA 2H1KA 2L7MP 2VPRA 2P6TA 1X1CA 1TP4A 2OUMA 1ULYA 2GAUA 1V4RA 3P7NA 4PJLA 5FRNA 3I5UA 2A6HF 3CESA 3OL4A 3RZOJ 4RM0A 3BH7B 2RC4A 2HXOA 2QSFX 1J0RA 4PFOA 3PQKA 2XHKA 4BPRA 4HWVA 1XGSA 4PJNA 3HSFA 1S0UA 2QGGA 3M8JA 3R60A 4CUGA 4ESFA 4F55A 4G5GA 2O17A 1A35A 2KP6A 1JI8A 3B82A 4A93J 2DOEA 2KIFA 4IRGA 3DEWA 3H9JA 4XR6A 3BZCA 3TDUC 3TW7A 4IO9F 4Z4ZA 1ZAOA 2I10A 4LK1F 3VSLA 3ZGKA 4RB3C 2NNYA 1FZPB 2NS0A 3HOTA 1OCRH 4FT8A 1NG6A 4CSWA 3COAC 3H35A 2FNAA 1ETVA 1DABA 4HF0A 3W2EA 4E70A 2G7UA 3DU6A 2VBZA 3NAUA 2K3FA 4A3FJ 2LH9A 5K7FA 1DGRM 3PSSA 3HM5A 5DUKA 2CQXA 1MBHA 4RD2A 2G0YA 1Z77A 2JMWA 1R1TA 1IN6A 3LSRA 2HCJB 1TNSA 2DA1A 1EP1B 2KKOA 4HV6A 4G7HF 3R6JA 3MD2A 2UVEA 3WU1B 4J0QA 2Q6OA 2G9WA 2E7XA 5LEJA 3GVAA 4CICA 4IHVA 3HOYJ 1SVLA 2O7OA 4KNYA 4P12A 4XRFA 1B8IA 4L0YB 4FXUA 2JUCA 3HSRA 4CYDA 3ZPPA 1LDJA 3VO1A 5ILUA 1BX0A 2NT6A 4W1UA 1IXCA 2E7WA 3W2WA 5JLVC 2JIZA 1W0JA 3G71B 2I8DA 3WGHA 1IJFA 3S3NA 3E6MA 4AWXB 2XTWA 1OKRA 1AKHA 1VZ0A 1AHDP 3SKBA 2WZPP 2CUFA 3HBLA 2EFNA 4R71A 2EFWA 2FX0A 3BZKA 3I9V2 1HKQA 2VKEA 3CC4I 2TDXA 3A3BA 4WZTA 2OBRA 1FWZA 2F1MA 2JJ2A 1S72I 1D8JA 2DFIA 1U3EM 4WWCA 2BM0A 2ZNYA 2Y0MA 3IHUA 4UVAA 3QE2A 1KU2A 4G1VA 1ITYA 2JVGA 3QP6A 3MKWB 1T39A 1D0ZA 1G3YA 3SZPA 4M74A 2YUSA 1ZM4A 4HSTA 5FD5A 4AUXA 4DOZA 3SEQA 4B8XA 2V9KA 2VI6A 5IOYA 5CDFA 2VNJA 2VJJA 3CCRI 3K70D 4N9IA 3ABLH 2L7FP 2CGPA 2GXBA 1H85A 1MABA 2QYOA 4CYCB 1A6QA 5F4JA 1EWYA 2NTPA 1SD5A 2W7NA 1WU8A 2Z33A 3CPWB 1TYXA 4A3LJ 4PC1A 3C2GA 3RY8A 2IEKA 5JVTA 1YJ9I 3LQQA 1PP7U 4H0EA 1O8HA 3BZ6A 3HTUA 2EFGA 1G7RA 4HLXA 1D0YA 2CYYA 2Q6IA 1NG7A 2D2WA 5HXBA 2KDOA 2QKLB 4EJUA 1WSRA 2BSPA 1KZHA 1TZLA 2JDIA 5C1EA 4A3KJ 2PQ8A 4II2A 3S3MA 3LYCA 2K4BA 5EMNA 4JYKA 3AVTA 3S16J 5KVRA 2P3MA 3HPGA 1HSJA 3ROUA 1ZH5A 5CVIA 1JGSA 3AL0B 3PSFA 3T8RA 3A01A 4QPQA 1I7PA 3VYSB 1WJEA 3VSUA 2BXYA 2CBXA 4YDTA 2ETHA 2RC5A 2OBPA 3REOA 3VR6A 3GYHX 4RDUA 1TSPA 3LA2A 2AQEA 4G1BA 4QPOA 1QRBA 1YW7A 5M5YJ 2VIXA 2DOGA 1V3FA 5HS8A 2K85A 3CC7B 2JN9A 1E1RA 4CDGA 4AM3A 1RIOH 1UD5A 5IPAA 5B1BH 2F3LA 1HQCA 2QVOA 3H9QA 3DEEA 3MEXA 2GIZA 4TMXA 4I84A 1FNBA 2GZWA 2HVRA 1R4NB 3S15J 3WY9A 4I01A 5HODA 1IXSB 2CK3A 5K7ZA 4UB6C 1SFKA 1JRGA 3VOEA 4AF7A 1YJNB 1NK2P 3FK6A 2EV5A 2WB1A 3HGGA 3O8GA 1UB9A 2Y31A 3TP0A 4EEFG 3B8YA 5K7HA 2EV6A 2ICWG 3FBNB 2E2JJ 1LB2A 4C2LA 1R5HA 1UMQA 3L2RA 3C18A 1Y0UA 1MMAA 2EILH 1LQ1A 4B3XA 4WXCA 2IXSA 4IJAA 1B72B 4UVCA 5GPAA 4ZYDA 1ACIA 2DO7A 1I1GA 3JRIA 1X1PA 2DK5A 4IPAA 1G8XA 3RI4A 3ASQA 3JREA 3CCEB 4TT3A 1DU6A 1X2NA 3WNDA 3RTRA 1Z7UA 2R7QA 4GYGA 3F6OA 4X7EA 3I56I 3WQZA 2K9MA 1VQKI 2RN7A 3AFHA 1ZM2A 2E60A 3GCMA 1W7PD 1R5BA 3ASRA 4BQQA 1WJ5A 2VKVA 4HNTA 1MIJA 2HOAA 3BROA 4H4KC 2EQRA 2KPMA 3E6DA 4RLQA 4J01A 1DQUA 2MC3A 2XPUA 1ZN2A 4U87A 1SKYB 4RD1A 2VQHA 1OCOH 1S3JA 3TQNA 1J9ZA 4C9YA 4BY7J 2L4MA 4U0YA 2K40A 2HKOA 5TJJA 1T6SA 3F9KA 3JRHA 5C4XJ 3OJXA 2FQ4A 4R8HA 1ETKA 3OYAA 2EJRA 1U78A 1K79A 4H9GA 2EZIA 1X4PA 1K8FA 3ZR8X 1G2HA 3HEFA 2L01A 1FYLA 2C4TA 4RJLA 2J8KA 4HBLA 1P4MA 5FGMA 4B3AA 3TEDA 3K4LA 4IKFA 4BACA 1TWCJ 4XKBA 4YEIA 1EH6A 2HTJA 2XT2A 2ZXJA 4QVJA 3WTXC 2F4IA 1LVKA 2EA2A 2WR8A 4ON0A 1SAXA 2PMDA 3SY2A 4ABZA 1B2RA 2HWVA 2BM5A 1I6XA 2PJPA 3SDGA 1UD8A 1R9TJ 4LBZA 1IHMA 3FPKA 2YX7A 4DNTB 3M3YJ 4G6TB 5E3OA 3KP6A 1KRHA 1K73D 4DYCA 2HNHA 3TDZC 4MYTA 2R7ZJ 1TYWA 2VT3A 2Z3YA 4C30A 1SMYF 1DPRA 1WMRA 3OW2B 5EEAA 4Q5SF 3V7RA 2OK8A 4E7HA 3CUQB 2O03A 4JBAA 5FO5A 1CNFA 4Y3OA 2QENA 3K2ZA 1AMOA 5JLXA 4KN4X 2X6YA 2RQQA 2CS3A 5J4VA 1CGPA 4RD0A 2XF6A 2NRAC 3C2BA 2LY1A 3ES9A 4EH1A 3W6KB 3TP3A 1VQ4B 1OLTA 2LP0A 1IDYA 4B3FX 3LSGA 2LFBA 3OZWA 2HDWA 3I55I 4Z03A 1VQPI 1P9QC 2HYGD 3HHHA 4XOTA 1QFYA 2KISA 2NAZA 4E7IA 1MH3A 1MNDA 1OQYA 1HXDA 3FXKA 2A3SA 2HQAA 4M6YA 3IP4B 4ZTJA 1A36A 1ZHFA 4I76A 3R6SA 2Y9ZA 1ZQ3P 1BLIA 2ZKZA 1KC8D 3G2BA 1F36A 2JA8J 1V5VA 1KQ9A 4OJLA 2DY1A 3TW6A 4BS9A 4P9SA 2R7FA 4PABA 5CQEA 4JP0A 1N25A 5E3LA 3E5XA 5BOXA 2VOPA 1OFLA 2EIMH 1QCXA 1K5CA 1GVJA 2Q1ZB 3RSNA 2X53S 1QPMA 2VKDA 2X3HA 1M1EB 4HPQA 4KIBA 2DFFA 1P4XA 2CH0A 2FJ1A 3MQ0A 2ZMEC 4G6QA 3U6KA 2OJED 2HGCA 1IN8A 4RA2A 2XZPA 4X7FA 1MSFC 3SEZA 3KE2A 1U5TB 3SFIA 2CJJA 2V7TA 2XZOA 4CHUA 3K4NA 1WRJA 2Q6KA 4PGHA 1UD2A 3VNVA 3QFCA 2A6EF 3BTIA 1UHWA 1YI2B 4EJVA 1QVFB 1VQNI 3CCSI 4BUPA 3CPXA 1UD4A 1WJFA 2Z1DA 2ZSIB 3LSJA 4YC5A 3L7WA 1H8AC 1BC7C 3Q0UA 1ZM3A 3VMFA 3J7ZI 3FJOA 3WNCA 1O8LA 2CFXA 4XONA 3H3UA 1DP7P 3LQRA 5E3NA 2GM4A 1KJZA 1OGIA 3BJOA 4I2OA 4P55A 2F5DA 3HJEA 2JUGA 5EG0B 4BE2A 1SM4A 1YHQB 2Z2SB 2PECA 1E3ZA 5L3EA 1XCBA 1EKEA 4RD6A 1R7JA 2PX9A 2A69F 5J47A 1H9TA 2V7QA 4RB2C 3CCLI 2R7XA 4FK8A 4XLPF 3A8KA 2XKOA 3QPSA 5H6RA 1OCCH 4OP7A 4M0LA 1WJBA 3G3ZA 2Q8KA 2PEXA 2XGDA 1J9IA 3MKZA 3CDHA 2JSPA 2M8GX 3E1YE 1OYYA 4EQQA 2M5WA 2LTPA 5D8LB 4WQMA 1E3PA 3DXJF 1ZK8A 2ELHA 5KCMA 3Q3SA 3RJPA 1UAAA 1FEXA 1S6LA 3WU2C 1MBJA 4UUVA 2Y9YA 3CO6C 1LFBA 4OOIA 1WSVA 3I4PA 4HQMA 5FNZA 3NEUA 2F43A 3ASPA 4CCJA 1QZEA 2DMPA 3JSPA 3KEQA 4OOVA 4G6DA 2CV0A 4RDLA 2A05A 4JX5A 2UUZA 3T9GA 3GXOA 3JR9A 2W48A 3T51B 1M1KD 1E43A 1OPCA 2LKSA 3B73A 3RKWA 5GAHJ 2PI0A 3DBLB 2FSWA 1EP2B 4PSXA 1RQRA 5DNSA 3E7LA 4OJ5A 4DNCA 5DN6A 3N6ZA 4NC7A 4XKVA 5M3MJ 3CCQB 4PZJA 4OIQF 2XPWA 4Y7NJ 4M4SA 1K61A 5L46A 5M5XJ 1RESA 2JA7J 4CCNA 1Q7YD 4GFBA 3F22A 4NBSA 2K86A 2XOKA 3I58A 1P2FA 2QBYB 1BA5A 4J00A 3JTGA 5L3CA 1R4MB 2I5UA 3VODA 1XDUA 2V1XA 1CQXA 3B02A 3CW2A 3A3GA 3BH4A 3BT9A 2BX6A 1JTAA 4GCVA 1FBQA 3CD6I 1FNDA 4RLZA 1DUXC 4DZJA 3MKLA 2XC1A 3ZMTA 3JRBA 3ZMDA 3PVDA 2ESNA 1V5FA 3HOUJ 4FE7A 4DNRB 1TQPA 2DETA 2V5IA 4CCOA 3PJRA 4YAUA 3JURA 1AIRA 2WJVA 3P27A 1ZUNB 1Y0YA 3HOXJ 2VBEA 5DYMA 1A04A 1BIBA 3JRAA 2V7UA 2G0EA 2EFQA 3ZOBA 4CCLA 4QV2A 3WGGA 1F5TA 4XKWA 1SEUA 3AG4H 2DJIA 3OMYA 3OOUA 3DV8A 2DFEA 3F6VA 4NQWA 5GADJ 3T8TA 1E0EA 1GQ8A 4AIJA 2GA2A 3A8IA 1YX5A 2V4JC 5GTIC 5LFAA 3OKXA 3OIQA 3WG7H 1X1BA 2M45A 3J81k 2P7VB 1GV5A 4P5OA 3IRQA 1TWHJ 2MFZA 5BPDA 3EDPA 3HSEA 1ETQA 3LFKA 2GOXB 4XNFA 1R22A 2KT0A 1RETA 2V79A 2VKHA 1BJKA 1I3AA 1A5JA 1LJ9A 2VQLA 1I8DA 4XORA 1SFUA 2I1LA 2P5VA 3H5NA 2FE3A 2V9VA 4LIUA 2IS4A 2WSSA 3WE2A 1HLVA 2X4HA 2B9SA 5HZBA 3PNYA 4F93B 5IP7J 4RDKA 3SUCA 3MMYB 2W82A 3OS2A 4RAGA 3JRCA 1OJLA 3DPTA 3U1DA 1WVRA 2CRGA 2KZVA 3Q5FA 2QDXA 4K1XA 1EF4A 2LKXA 4OM9A 2V6CA 2ZSHB 3M8FA 4JX6A 3HHGA 1XG1A 5FIUA 3BG7A 2LYCA 1SVOA 1IJEA 1N06A 4G12A 3L2UA 2DA3A 3QODA 1APLC 4TMZA 2LNBA 4PMHA 1YS6A 1FLIA 3HG9A 5E8IA 4HYEA 1ZG1A 3JQPA 2QQ8A 2GLOA 5D8KB 4DQKA 4YZXA 1YQAA 5GV8A 2CU7A 3N90A 3IWFA 1DP3A 3GVJA 1R5NA 2P4WA 3IWZA 1TC3C 3TO9A 1Q86D 3PFIA 4AU7A 3F23A 1KCDA 4S04A 1RU4A 3JRFA 5AIPA 2EWNA 9ANTA 1HKTA 3BY6A 3G71I 1ZR4A 4OIPF 2JVHA 2JA6J 5ERIA 3K4BA 2EZLA 2HOTA 5KK1A 5LEKA 1GT0C 5E17F 1PJRA 3ZCOA 2R9VA 2DCUA 3D26A 1H8EA 3PUBA 3VMVA 2ZZFA 3GO5A 1WPCA 4N3GA 1W0TA 1BR4A 3BPVA 4M3FA 4C2TA 2VNHA 2OTJI 1WJDA 1V55H 1XGNA 3OYCA 5FRMA 1FX0A 3DLLF 2BVLA 2GQFA 3LQ6A 1TLHB 4BBRJ 1YJWB 3IAM2 2K9NA 1S7AA 2GQQA 2F4NA 2LR8A 2R7OA 2Z5UA 2XRLA 3BR6A 2W7ZA 3LOCA 4Z1MA 3S14J 3HGYA 2R7SA 2A5WA 3PIPF 2VZLA 4XLAA 4E7SA 1GXPA 2E5ZA 3RQIA 3KFWX 2MG4A 3WNBA 1IGNA 5HDKA 4KH3A 1WQ2A 3OOPA 4NK8A 2D45A 1R6RA 1XGMA 2NT9A 1HA8A 4ANJA 3WTSC 2VBWA 2DEUA 3VDXA 3GZNB 2EIXA 3QQAA 5D6EA 1HOMA 1JNYA 2VJ4A 4HDUA 2IGMA 1D0XA 5IT3A 2IPQX 5EJCA 2L9VA 3P5JA 3M9AA 3CRZA 3T1BA 1KYWA 3SJMA 4OPSA 1MNMC 3AAFA 1W2BB 1UG2A 4HF1A 2W6IA 4WCGA 1B9NA 3IV5A 3GUDA 4XSXF 4AD9A 4UNOA 2PMHA 4RS8A 4DIQA 4MFEA 5FFXA 4R79A 4XLCA 3HRSA 4Q7JB 2QXZA 1WORA 2QZAA 1T0FC 2XAQA 3AKZA 4YFOA 1G3TA 1B8IB 2XF7A 1CNEA 1UZCA 3HTSB 4A6DA 3QFRA 5LBQA 5JHFA 1MW7A 5B5EC 3MAJA 4EM2A 2R4GA 1RR8C 2A68F 3D5RC 3VSVA 2H8WA 3EYYA 3AG2H 1U8RA 5J6XA 2XSJC 3HUGA 2HEOA 3V8LA 5J8FA 3CC7I 3U1KA 2M4KA 2IAIA 2NOJB 1Z21A 4EJOA 2P7CB 1AU7A 3FKIJ 4ZZLA 1AKHB 1E2XA 2ZFWA 4BQAA 4G7XA 1J09A 3Q0WA 1OFEA 1U9OA 2XGXA 1FBSA 1D8TA 1YS7A 2D5VA 2F2EA 2Q0OA 5DS9A 1ZREA 1IA5A 3B78A 1DARA 2XVCA 1YRNA 3AVVA 2HI3A 2W00A 1HC8A 2JJ1A 2XAUA 1E79A 3W2GA 1TW2A 2LZJA 3O8HA 2VB6A 3KP4A 1G7SA 4B3GA 3F8FA 1IB4A 3GTQJ 1D5YA 1EFTA 3LFUA 3DPLC 1A31A 4YELA 1YJNI 3HOWJ 1GAWA 4WF2A 4PSWA 4B44A 2DIEA 4PJJA 4BQOA 4KYWA 4BE0A 1ZRDA 5DM7F 5H5JA 4Y13A 1X2MA 1Z91A 1UHMA 2V7FA 2DPUA 2CO5A 5F64A 1XX5A 1Q1VA 2L54A 2HDCA 2X8KA 1TYVA 4ESJA 2ZMEA 3LSPA 3CB4A 1EA3A 3CMAB 3TGNA 4Z6YA 1L1IA 3HXLA 3CCEI 4HIZA 2RGVA 5ED4A 3E6CC 1ERDA 1QU3A 4ZGNB 2DT5A 3VSTA 4A0XA 5LHIA 1TT5B 1YYVA 3J7AY 1PYVA 3D0SA 1Z3YA 4D5CA 1O3TA 3CC2I 5IYDJ 2AHQA 3P9CA 1U6GA 2R7TA 1G3WA 3BR2A 2LK2A 3L00A 4XN0A 1X0CA 1D1AA 4AC0A 4P6VF 2YUHA 1BW5A 3A01B 3P4GA 1W34A 2CW8A 3L2CA 2GREA 1W35A 1W87A 1FMWA 3EETA 2ZZQA 2L9NA 3BC9A 2LBFA 2OK7A 3DLAA 3M7GA 2WAFA 2OCCH 3CLOA 4M6VA 4M1KA 1EFUA 4OMZA 2JJ7A 3CCYA 2XASA 3I71A 1AWCA 2DA6A 3KEYA 1J7KA 3LMMA 2FD5A 2CUJA 1FNNA 1J2XA 2DOAA 3HC7A 1IRXA 2E1CA 1KQ0A 1ENHA 2DBBA 2VFQA 1XMXA 3EPZA 5CYVA 2X3UA 1JXSA 1MZBA 3B90A 5LD2C 1IRGA 4RAFA 1WZ2A 2LD5A 4NUBA 3GX4X 2XC7A 1JKQC 4YAOA 1P7IA 1Q81D 3H3ZA 4JK1X 4A3BJ 4BAYA 1HCRA 1X1AA 2FMYA 3HZJA 1XG2A 3T5XA 1IXRC 3FKJA 2WV0A 2HPIA 5F4MA 1V0EA 1MJBA 3NE5B 3B4NA 1OFMA 4FETA 2KIUA 2VFNA 2WA0A 2C6YA 1OYWA 4XSZF 4A3IJ 4C2UA 4U7DA 4U7BA 2BY0A 4KDPA 1YE9A 3FF5A 3LO8A 2GWRA 4A0ZA 5DSZA 3V76A 2VFPA 1FIAA 1LNWA 4HV5A 3SDBA 2XZLA 1HF2A 4KKTA 1RWRA 2V7XA 2JZYA 3BCFA 3WBKA 4KICA 2XAJA 2VC1A 1VHEA 1ODDA 4G8XA 3BJAA 1YIOA 2LVSA 2PJRA 3CCJI 1E1QA 3CO7C 1QGYA 2JTVA 4OMYA 1T6XA 1W4MA 4B4CA 4LLLA 4Y9UA 5TISC 1VQ4I 2E35A 2AXLA 2V31A 3RYPA 2VBTA 4RAYA 2GOMA 5GTHC 1BJZA 3SLNA 4BBSJ 4KKUA 3CF5F 5TV2A 3KLNA 2NTBA 4A2UA 1QVUA 2BV6A 3RIRA 1N05A 3OJWA 1K6YA 4HOBA 1I39A 1JTXA 3A0BC 5JMCB 2V1NA 3V7SA 3IKTA 1H88C 4JMQA 2L7ZA 3GFIA 1EJ9A 3CP8A 4C2MJ 5BSYA 3F8CA 2EV0A 3H0DA 1R58A 2XAHA 3JTHA 1UG0A 4L5JA 3HKZN 5AIQA 1QVGB 1NHCA 1XQBA 1SMTA 1X19A 4NBQA 2BW3A 2H6CA 2M9HA 4I0BA 2HOSA 4PC3A 3LSIA 3MZYA 5FLMJ 2BM6A 4YFKF 3JAMZ 1GHCA 1WJAA 5C44J 1HW2A 1BHEA 1IN7A 4J19A 3GLXA 2VONA 2HDDA 4LK0F 3IL2A 2HQNA 3QOEA 2R6HA 1YI2I 3I4NJ 4X1EA 2IGNA 2DXIA 4D7MA 1P4AA 4X05A 1QZYA 2P5LC 3V7AA 1OISA 1TUIA 1ON2A 1IO2A 2HYFA 3U2QA 2KFDA 1SFEA 4CXFA 4WK8F 3RKQA 4GYIA 3CMEB 1A6IA 1QQIA 3Q0VA 3OYJA 2FQ3A 4WZLA 3SZGA 3ZUGA 1MGTA 4MXNA 3K4KA 3M8EA 3OYDA 1I27A 1XD7A 1LLWA 2K9LA 3KZIC 3RDIA 2CW0F 3QPTA 2DA4A 1Y0NA 2XRNA 3FX3A 4V19K 1VQOB 4GRIA 1GUUA 3H5RA 3PO3J 2QY1A 4ZCIA 2Q6LA 1JB9A 4RDJA 3MMPA 4UZUA 1XN7A 1VFCA 3KYLA 2UXXA 4ACAA 2DDAA 3LJYA 2ISZA 4MEYF 3ONQA 4MHGA 1SFXA 3ZMSA 5HLTA 1SKQA 2GK6A 3QFTA 2HVQA 1W36C 2KVOA 4HE6A 3OYFA 3LMWA 1QA2A 4KITB 4M2LA 3KCCA 3L9FA 3JAMK 2PLYA 2OTLB 2DMNA 1N0VC 1QA1A 4TSFA 3H9GA 2EPFA 3J80Z 5J1RA 3GTGJ 3BG5A 1W0UA 3UR3C 3OP1A 4OAYA 3FHZA 3K70C 1WXRA 1RZ4A 1LLZA 2R7VA 1ORKA 2IA0A 4MTEA 1F43A 4TKOB 3LWFA 4PGGA 1QUFA 2YR2A 5AN9A 2X9DA 3LL7A 5C4JJ 3CCVI 5BNGA 2QYUA 3V42A 3VYTB 2VJIA 2DN0A 4LITA 3A1YA 1Y8RB 3WTYC 1R5GA 3EYIA 5B66C 5D5WB 2KRFA 2O8XA 2M5SA 1L3LA 1G7CA 3FXOA 5CLSA 3PNTA 5HDGA 2PMZA 2OCEA 4II3A 5K5RA 3CCQI 3Q9SA 1H0MA 1YG2A 4UY8I 2O0WA 4I7HA 4B43A 4OU0A 2R7DA 5M5WJ 1J59A 2NV4A 2DT6A 2XF5A 4DK0A 2JPBA 3G6EB 3BOQA 3BP8A 4P26A 2NVTJ 4LD5A 3GTMJ 4BE1A 1VQ5B 4EW9A 5THXA 3Q9VA 3FM5A 3QU6A 2GPJA 5IY5H 3FMSA 2NTQA 3M4OJ 4QLCU 1VI0A 2W85A 3J80K 3GSIA 1QO0D 4F7DA 3KZYA 1IAWA 2C5HA 2P0WA 2DYRH 2ZL7A 3MN2A 3I0TA 4G6IA 4UUSA 5GAGJ 1A8PA 1JTYA 3ZXSA 3OYBA 2K02A 5HNFA 2KRCA 4Q4ZF 4KFCA 4D0PA 3IAS2 1DBOA 5EGOA 2A5YB 1VF7A 4BY1J 2WBMA 5GPCA 2E1MC 3RPQA 3G05A 5E1WA 3C3WA 3ZN1A 1ZG5A 4RB0A 4Z4WA 4HX4A 2CNDA 3BLYA 1HG8A 3KYCB 3O6BB 3F8NA 4BKXA 1FJLA 5L3DA 2YWEA 1COWA 2L9SA 5M3FJ 3DU1X 4KA4A 3SZEA 1Z6RA 2CUZA 3R4KA 3W2AA 4LC0A 3WTUC 2Y75A 3M1CA 4IVNA 3PQJA 3ZQLA 1QGPA 1G59A 2CMPA 1ELOA 1ZGJA 1MH4A 2QEXB 1SFOJ 1T0FA 4DJAA 5CVJA 2XNCA 1YITB 1PE9A 4M71A 2FBKA 2E71A 3JCUC 1RRJA 1ONVA 3CQZJ 2RKHA 1O88A 1LDDA 2VQCA 4LBWA 2ZJRF 3S1QJ 3GW2A 3ZQCA 1VQ7B 1CF7A 2DERA 2EA4A 4L0ZB 3QRFF 1OGJA 2WY7Q 1K6OA 4OPVA 1NH3A 2F5VA 2CG4A 2R5YA 2UXNA 4HEA2 4S0HB 4XL9A 2Z99A 2ZJ2A 3ERMA 4FQGA 2PMZN 4DQLA 4IQ4A 3OEEA 4Y7CA 2COBA 5TGTA 2XNJA 2QQ9A 3I53A 1QX4A 1VQ8I 1TQMA 1L0OC 1RNLA 3OR1C 5D4SA 3PM1A 4CZZA 2BHYA 3DTEA 2HTSA 4NC8A 2FOKA 1EXMA 2AHOA 1WPKA 1MMGA 1FOWA 1IZ1A 2Y69H 4F91B 1OMIA 3LA3A 1JKRC 4BH9A 2RREA 4WWVA 5KW9A 3ISXA 1T6YA 2QX3A 2BBYA 2ECCA 5LRSA 4QTRA 1FOKA 2MYSA 4Y17A 3ZQQA 4TN1A 4EV0A 1LKXA 1YLOA 1GXQA 2DA2A 3VPRA 3KYDB 2ME0A 1OCPA 1ON1A 1QA3A 4LLGF 2O6WA 2RAEA 2ZXIA 3FKSA 2HPMA 4CGZA 4ZDOA 1EFRA 4ZTFA 1HDPA 3E20A 1I18A 1O8EA 5H6QA 4DQ2A 2DTZA 1RQPA 1GV2A 4RPDA 3HOVJ 4ZYAA 2FF4A 5EEHA 2VOOA 4YCQA 1ZRCA 3W2HA 2F4MB 4GO1A 4PAAA 2X6WA 4NQWB 5EEGA 3CC4B 1IDZA 2QQAA 2RVCA 3GMEA 4RCZA 3ZZ0A 3WHCA 2OQGA 4WZEA 2XPVA 4UV8A 1YJWI 3WU0A 5JBQA 2ZXWH 4Q47A 4KMFA 3KP7A 4A3MJ 4KKSA 1K9MD 1MNEA 1GDTA 1YTYA 4HQEA 1VQMI 2DCEA 1OCZH 2BOLA 2EINH 5E3MA 2W1OA 3OW7A 3ZZTA 1EH8A 3H0GJ 4WXDA 1G6NA 4ZZDA 2PYGA 3PSZA 4A3CJ 3FISA 4BXXJ 4P22A 4E6KG 1OYIA 1QGAA 3M07A 2ODLA 1DBGA 3DTKA 3OE7A 3E5QA 5D6FA 1LDKB 1PXZA 1ZARA 4O5VA 2BF4A 3KEWA 3P9KA 4RLFA 3HAGA 2XNDA 1SANA 3DCFA 3BTLA
chains in the Genus database with same CATH topology
1KCDA 4F55A 2O17A 2LY2A 2KP6A 1JI8A 1RU4A 4XR6A 2WADA 3H9JA 3FY3A 2JVHA 1V5EA 2M4GA 4CCKA 3VSLA 3ZGKA 4E0FA 3K4BA 3T56B 2MD0A 3OIPA 1PJRA 3ZCOA 2CW7A 3HOTA 3FDYA 2R9VA 1H8EA 3PUBA 3VMVA 1NG6A 2ZZFA 4CSWA 1WPCA 3H35A 3CJQB 5FL7A 1BR1A 1BR4A 4C2TA 5CPRB 1W9XA 1WJDA 2KMUA 3DU6A 3OYCA 5FRMA 1FX0A 2BVLA 2LH9A 3IAM2 1DGRM 2R7OA 3KX2A 2V6EA 4X0GA 2R7SA 4Z1MA 5AMVA 2A5WA 4XLAA 4E7SA 3CP2A 2E5ZA 2O04A 4NK8A 4XN3A 4BQNA 3MD2A 2UVEA 1R6RA 4BDYA 2NT9A 1HA8A 4ANJA 3VDXA 1KCCA 3OL3A 4BEHA 1Y56A 5HOOA 3EUAA 1Z7LA 4FXUA 2VJ4A 3ZPPA 4W8SA 2IGMA 3VYRB 1D0XA 4LG3A 3OYMA 1O8JA 2XGJA 4ITVA 2NT6A 4OJ6A 3GVKA 1EE6A 3W2WA 2VXZA 4YZAA 2JIZA 1W0JA 2I8DA 3OFNA 3S3NA 2W6IA 4DK1A 3OYHA 4OZZA 2HZDA 1MMDA 4DIQA 1SAUA 1VZ0A 4R79A 3H94A 4XLCA 2WZPP 1O8KA 2QXZA 3RCOA 1E3XA 3I9V2 4RM2A 1T0FC 4BEHB 3AKZA 3L2QA 3A3BA 2F1MA 2JJ2A 3QYEA 2XF7A 1H8HA 1O8DA 2IS6A 4E4HA 1D1BA 1T95A 2CV2A 5JHFA 1MW7A 1Y6IA 2M7BA 2WPDA 4Z05A 4YZ0A 1O8IA 2JVGA 2R4GA 3MKWB 3D5RC 3DQVC 3OYIA 1D0ZA 3VSVA 4E7JA 3OR2C 4HSTA 2DT7B 1NBMA 1OR7C 4PK4A 4DOZA 2XSJC 3SEQA 2M3AA 4MR0A 2IS1A 2M4KA 2NOJB 2V9KA 1Z21A 4G7XA 5CDFA 2VJJA 1K28D 3K70D 1IDJA 2Z6BD 1J09A 2INUA 1MABA 2BSPA 2NTPA 3U21A 2ZZGA 2W7NA 1IA5A 1T5EA 1WP6A 2M0MA 3C2GA 2W00A 2JJ1A 1O8HA 4P1WA 5HVQC 2XAUA 4F52A 3GBGA 3VMWA 3E0JB 1E79A 2LZJA 4PUSA 2VB6A 2EWEA 4B3GA 1D0YA 1IB4A 1NG7A 3OYEA 3LFUA 2KDOA 2QKLB 3DPLC 4DBQA 1OGMX 4YELA 1TZLA 3HUGB 4YEJA 3TL4X 4PSWA 4B44A 3L2VA 2DIEA 2JDIA 4PJJA 4DBRA 2ZZEA 5C1EA 4II2A 3S3MA 1PKVA 4BQOA 4BE0A 4IQJA 3OWTA 4PFPA 2X85A 2V7FA 3HPGA 2VPLA 3AL0B 2X8KA 3PSFA 4QPQA 4ZC3A 3VYSB 1EA3A 1WJEA 5IK2A 1UD6A 1IDKA 3A2KA 2L2OA 4BXFA 3HXLA 3VR6A 3VYUB 2VJ5A 4HIZA 1MMNA 2AQEA 4QPOA 2VIXA 2OC6A 4CCMA 4N4OB 1QU3A 1ERDA 3OYLA 4XKCA 3DTIA 4KISA 3VSTA 1OGOX 3J7AY 4U4BA 1PYVA 1E1RA 1Z3YA 3DKXA 3PL8A 2IS2A 3EQNA 2R7TA 2KQRA 1UD5A 3T53B 4XN0A 3HPHA 1X0CA 1D1AA 2K3PA 4CUGA 2Q2EB 2V4DA 3H9QA 3DEEA 2CW8A 3UNGC 4I84A 2HVRA 2WAEA 4XLFA 2CK3A 1FMWA 2ZZQA 2L9NA 4FASD 4BGDA 2LBFA 1SFKA 1NRKA 3BC9A 1JRGA 3DLAA 3ZSCA 2RNGA 4CZCA 2WAFA 3IUOA 4OZYA 2WB1A 2D3LA 2UV1A 3OEHA 2VL8A 3B8YA 3CZ6A 1GLNA 3KEYA 1PLUA 3LMMA 2AQFA 2CUJA 3FBNB 3I3LA 3OYNA 4C2LA 2DOAA 3HC7A 1IRXA 4BU2A 3L2RA 1QHHD 1WTHD 1MMAA 3EPZA 4B3XA 2IXSA 2Z8GA 4NNJA 3GQAA 4B47A 3B90A 5LD2C 3DKYA 4JOMA 4NUBA 1G8XA 2XC7A 4HNUA 4TT3A 2LBFB 5KNLA 2M7AA 1XG2A 1X1AA 3RTRA 2R7QA 3FKJA 2HPIA 2X6XA 1V0EA 4XD7A 3NE5B 3WQZA 2K9MA 2BVMA 4FETA 1OFMA 3AFHA 3B4NA 1KONA 5HNHA 2WA0A 2E60A 3BCDA 2ELJA 2X1EA 4BQQA 1WJ5A 2D3NA 4C2UA 4HNTA 4H4KC 4U7BA 1YE9A 4RLQA 2KPMA 3EUHC 4J01A 1DQUA 4U87A 1DGWY 3SDBA 2LRDA 1SKYB 2XZLA 4KKTA 1RWRA 1X1DA 2VQHA 3MKYB 3BCFA 2FUG2 3QYBA 4D1QA 4C9YA 4PJMA 1E1QA 2PJRA 4KT6A 3F9KA 3QYFA 1ZELA 2V31A 2KHMA 3EUKL 4OAZA 2HVSA 4BJ5C 3ZIAA 2E1MB 2GOMA 3OYAA 2Y0SA 3A35A 1X4PA 5C1CA 3ZR8X 4F92B 2R7WA 2X3HA 4W8QA 2LOOA 4KKUA 3K4LA 2NTBA 4CH7A 4IKFA 2QE7A 4BACA 1YX3A 4XKBA 1K6YA 1UD3A 4Y4RA 2V1NA 2F4IA 4ASUA 1LVKA 4JMQA 3EQOA 3CP8A 2R7RA 2PJRB 3TMOA 3H0DA 1N77A 1NHCA 1UG0A 2X1CA 1UD8A 4CA0A 1X19A 1KMHA 2BW3A 4DNTB 4G6TB 2KL4A 2HNHA 3LSIA 3W3CA 2IQ7A 2WY8Q 2HLDA 3KRGA 4URRA 1O8FA 2K5CA 1WJAA 3H5AA 4XM3A 4C30A 3CJRB 1WMRA 1BHEA 5HKKA 4E7HA 3QOEA 2LG4A 4Y3OA 3GQBA 2X6YA 4JQFA 2IGNA 2RQQA 2CS3A 1S9HA 1UELB 2DXIA 4W8TA 3S93A 2X51A 2OV7A 2XF6A 2JA2A 2LY1A 3VWBA 3FPPA 1OLTA 3AL0C 3C2HA 4B3FX 3LSGA 3E1SA 2BW3B 2HDWA 4Z03A 3BG6A 3OYJA 1P9QC 3SZGA 4XOTA 4DGWB 4MXNA 3LNNA 3K4KA 3OYDA 4E7IA 1AA7A 3BCAA 3NWSA 1MNDA 2K9LA 2ZTNA 4L8JA 2HQAA 4ZTJA 3IP4B 4D9JA 1BLIA 3GVLA 3G2BA 2IGKA 4KJZA 4XLEA 3OAAA 4GRIA 4OJLA 1N75A 3H5RA 4RMNA 4BS9A 3OY9A 4OJOA 2QY1A 5CQEA 1OFLA 1K5CA 4UZUA 1QCXA 2WAQA 3RSNA 2Q1ZB 2X53S 3KYLA 1WJCA 2VKDA 1TT0A 2R7UA 5HLTA 3ONQA 2GJKA 4YXWA 2GK6A 4HPQA 2MC4A 2MABA 3PFYA 2HVQA 1W36C 2KVOA 2O1DA 3OYFA 3LMWA 2CH0A 2XDVA 4KITB 1BPLA 2XZPA 4TSFA 3H9GA 3CF2A 4MLOA 3SEZA 1O8GA 3JU4A 2XZOA 3K4NA 3UR3C 4OAYA 3K70C 2L5QA 1UD2A 2R7VA 5CKTA 4TKOB 4N4NB 3WWGA 2O5RA 4BUPA 3LL7A 1UD4A 2NSPA 1WJFA 2Z1DA 2ZSIB 3HL2A 4OJPA 1W0KA 3OPOA 3V42A 3VYTB 3HKZA 1O8LA 2VJIA 4LITA 3S8PA 3A1YA 4XONA 4AVZA 3RPUD 4EATA 1DBOA 2A6TA 3CMMA 2M5SA 2PYHA 4BJTA 3GRHA 4ZDPA 2UVFA 4W8RA 2JUGA 3OOCA 4BE2A 3PNTA 2PMZA 4II3A 2Z2SB 2PECA 2X1DA 1E3ZA 2O0WA 3DWLE 4AYBA 2GJRA 3PNVA 3OYGA 4B43A 2V7QA 2ZTGA 2R7XA 2DT6A 2VASA 3UW0A 2LC2A 2XF5A 4BL0B 4DK0A 2VLAA 3OYKA 4LIVA 4BE1A 1WJBA 4XQFA 2VQGA 4BDZA 4Z06A 4EW9A 1D1CA 3MKZA 2VXDA 3JURA 1QHGA 2NTQA 2JSPA 4ZDLA 2O0VA 2P0WA 1X4OA 4XLHA 4HSRA 4G6IA 5KCMA 1UAAA 3ZXSA 3OYBA 1V0FA 5HNFA 2KRCA 1BMFA 3GQ9A 3IAS2 4F3QA 1VF7A 2WBMA 1HVXA 4XMYA 2INVA 2E1MC 2F43A 4CCJA 3G05A 1VBLA 4IZZA 2CV0A 4B48A 1Z3XA 2UUZA 3BLYA 4RM3A 4YRVA 1HG8A 3T9GA 3T51B 2IGOA 1E43A 3BCBA 4HG2A 1COWA 2L9SA 2L7KA 4PSXA 2CUZA 3S3OA 3W2AA 3GQ8A 4OJ5A 3OS1A 1G59A 3M1CA 5DN6A 4NC7A 2CMPA 1BR2A 4OWRB 4XKVA 3K6GA 3ZRGA 4DJAA 3DDYA 3S32A 4NK6A 1PE9A 4CCNA 3K4CA 1O88A 2VQCA 1KTWA 2XOKA 5KHDA 4E7LA 2QKMB 2KLOA 1LFPA 1O8MA 2W4SA 4J00A 2CFOA 1VLYA 2Z16A 2WY7Q 3FBIB 2F5VA 2VBKA 3VSUA 4HEA2 3A4CA 4XL9A 3A3GA 1HZEA 2E1BA 3BH4A 5FROA 2W6JA 1JTAA 4IQ4A 3OEEA 1RMGA 5TGTA 2GJPA 3FHNA 3HOSA 2KRHA 4DNRB 4Y33A 1V5GA 1V5FA 3DU5A 3OR1C 4CCOA 3L2WA 3DTEA 4IX7A 3LSMA 1W36D 3PJRA 1AIRA 2WJVA 1H80A 4NC8A 3NWTA 4E7KA 2VBEA 1MMGA 4YZQA 4F91B 2UWMA 4CCLA 3RQ4A 4G7WA 2RREA 4XKWA 2DJIA 3OMYA 3OOUA 4XOPA 3SYTA 1OB0A 2QX3A 1E0EA 2MYSA 1QJVA 1GQ8A 3ZQQA 1YX5A 2V4JC 5LFAA 1LKXA 3OIQA 1X1BA 3D5SC 4P5OA 2F6CA 1U0JA 2MFZA 1VJSA 2NZMA 3DPUA 2ZXIA 2CV1A 3FKSA 2HPMA 4HRIA 4ZDOA 1EFRA 4ZTFA 2GOXB 1I18A 4XNFA 1O8EA 2VKHA 3ZPNA 2GK7A 3GQ7A 2VQLA 1I8DA 4XORA 2ZXHA 2V26A 3K10A 3LSHA 3K4JA 3VSKA 3H5NA 2IS4A 4LIUA 4ZYAA 1KZLA 2WSSA 2VBMA 4BJ6C 2LREA 3PNYA 4F93B 2WJYA 4ZJZA 4U49A 3SUCA 2E5NA 2X6WA 2W82A 3MMYB 3PSIA 4NQWB 3OS2A 5CQGA 2NSTA 3DPTA 2KZVA 3LSKA 3N05A 1CZFA 2HU9A 3OS0A 1OOCA 2ZSHB 1OHHA 3D5LA 3TBIA 3BG7A 2LYCA 1FMVA 4KKSA 1BOBA 3L2UA 1MNEA 3QODA 2DCEA 4PMHA 4GQNA 2BOLA 3HG9A 2W1OA 3W2VA 3OW7A 1X1CA 2PYGA 2OUMA 4YZXA 4P22A 4PJLA 1BN8A 3BC8A 4E6KG 1N78A 5FRNA 1WFXA 3CESA 3OL4A 4E7ZA 2ODLA 1DP3A 1DBGA 2ZFUA 4PFOA 3DTKA 3OE7A 3GVJA 1PXZA 1LDKB 4HWVA 4PJNA 3K4MA 3KEWA 4RLFA 3HAGA 2XNDA 4AU7A 3M8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KCD A;  2O17 A;  1VBL A;  1RU4 A;  2IQ7 A;  3KRG A;  4URR A;  4XR6 A;  1O8F A;  4XM3 A;  1HG8 A;  3T9G A;  1IDK A;  3FY3 A;  1WMR A;  1BHE A;  3GQ8 A;  4OJ5 A;  3VMV A;  3VST A;  4XKV A;  1OGO X;  2X6Y A;  4U4B A;  4W8T A;  4NK6 A;  1PE9 A;  3EQN A;  1O88 A;  1KTW A;  4XN0 A;  1X0C A;  4Z03 A;  1O8M A;  4XOT A;  4MXN A;  5AMV A;  4I84 A;  4XLA A;  4XLF A;  2VBK A;  3VSU A;  2O04 A;  4NK8 A;  4XN3 A;  3ZSC A;  2UVE A;  4XL9 A;  4XLE A;  1JRG A;  2NT9 A;  4OJL A;  1JTA A;  4OZY A;  1KCC A;  4OJO A;  1RMG A;  2QY1 A;  1OFL A;  1K5C A;  1QCX A;  3B8Y A;  3ZPP A;  1PLU A;  4W8S A;  2X3H A;  3JUR A;  1O8J A;  1AIR A;  1H80 A;  3LMW A;  2O1D A;  2NT6 A;  4OJ6 A;  1EE6 A;  4C2L A;  2VBE A;  4YZA A;  4YZQ A;  2Z8G A;  3GQA A;  3B90 A;  1O8G A;  4XKW A;  4XOP A;  2QX3 A;  4OZZ A;  1QJV A;  1GQ8 A;  4XLC A;  1O8K A;  1XG2 A;  2QXZ A;  3WWG A;  2X6X A;  2NSP A;  3B4N A;  1OFM A;  4OJP A;  2NZM A;  1O8D A;  1O8L A;  2VJI A;  1O8E A;  4XNF A;  4Z05 A;  4YZ0 A;  4XON A;  4AVZ A;  1O8I A;  3GQ7 A;  4XOR A;  1DBO A;  3VSV A;  2VBM A;  3GRH A;  1RWR A;  2PYH A;  4W8R A;  2UVF A;  4MR0 A;  2PEC A;  4U49 A;  3SUC A;  2O0W A;  2X6W A;  2NST A;  2VJJ A;  1IDJ A;  2INU A;  1CZF A;  1OOC A;  2NTP A;  3UW0 A;  1IA5 A;  5C1C A;  4XQF A;  4EW9 A;  4Z06 A;  1O8H A;  4W8Q A;  3VMW A;  4PMH A;  2NTQ A;  2NTB A;  2EWE A;  2PYG A;  1IB4 A;  2O0V A;  4YZX A;  1BN8 A;  1OGM X;  2BSP A;  4XLH A;  4YEL A;  4YEJ A;  5C1E A;  3EQO A;  2ODL A;  1DBG A;  1NHC A;  3GQ9 A;  1PXZ A;  4HWV A;  2X85 A;  2INV A;  4XMY A; 
#chains in the Genus database with same CATH topology
 1K78 A;  2LY2 A;  1F4K A;  2B0R A;  2P81 A;  2WAD A;  3C1D A;  5K5Q A;  2BV3 A;  1WDT A;  1BIA A;  1V5E A;  2M4G A;  4OIN F;  4CCK A;  4IRI A;  4E0F A;  3HRT A;  3T56 B;  2HXI A;  3OIP A;  1GVH A;  3RZD J;  3L09 A;  3AVU A;  4AF6 A;  2VN2 A;  1HST A;  3DBH B;  4PDK A;  1QRC A;  2VE9 A;  4IL6 C;  1O3S A;  1BR1 A;  3G4S B;  1TWA J;  2EFP A;  1QRY A;  1MBK A;  5CPR B;  2CSO A;  2CRV A;  4P6Y A;  4LB5 A;  1M90 D;  5HLI A;  3KEO A;  3KX2 A;  1VQ9 B;  3TH0 A;  4X0G A;  1DPU A;  3CUO A;  2M2E A;  3CP2 A;  3FMR A;  1WI9 A;  3KP2 A;  4NHJ A;  3WXM A;  3IKV A;  4Q48 A;  4XN3 A;  4BQN A;  4QIW N;  5EF6 A;  2DA5 A;  4BHB A;  4BDY A;  3PEN A;  1B23 P;  1KCC A;  2E1O A;  4BEH A;  2HMA A;  3FXJ A;  5FJ8 J;  5IYW A;  5EZH A;  2JSC A;  3J81 Z;  2O61 A;  4ZH4 F;  4RPB A;  4W8S A;  5FA6 A;  1O8J A;  3OYM A;  1B6A A;  4NCN A;  3ASS A;  4ITV A;  1QUE A;  4QFM A;  2XGJ A;  1EE6 A;  2XKP A;  3SHF A;  3HOZ J;  3Q6Q A;  1LUJ B;  2IP2 A;  2VXZ A;  5KAF C;  2D74 A;  2FOW A;  5IYQ A;  4M9Z A;  3DKW A;  3OFN A;  3F8M A;  4X6A J;  2LF8 A;  2V9P A;  3OYH A;  4DK1 A;  2CC2 A;  2B0L A;  2HZD A;  4XRS G;  1MMD A;  3G73 A;  1SAU A;  4QWQ A;  2MW8 A;  3H94 A;  3FXM A;  3RCO A;  5A8A A;  3HB9 A;  4AID A;  1BJA A;  4DW6 A;  3G1O A;  2V1U A;  4U0V A;  2VNI A;  4FWT A;  2H8R A;  1H8H A;  1O8D A;  2IS6 A;  4E4H A;  1D1B A;  4A3D J;  3DEU A;  4RGX A;  3W2I A;  4Z05 A;  1RI7 A;  1O8I A;  1KQS B;  3DQV C;  1STZ A;  2XV4 S;  3OR2 C;  4E7J A;  1IJW C;  4AIK A;  1D8K A;  1BI0 A;  4L9N A;  4Y9R A;  2QLZ A;  2XB5 A;  3VEP A;  5J35 A;  4P3Y A;  4RD3 A;  1IDJ A;  2L9R A;  3KP3 A;  1FDR A;  4C0S A;  1VQK B;  4M9S A;  2INU A;  4IRH A;  5L3F A;  4NC6 A;  1O7L A;  5FKL A;  2V7W A;  3J81 K;  1MD0 A;  2ZZG A;  1SD4 A;  2OZU A;  3VNU A;  1T8I A;  1WP6 A;  2M0M A;  1J75 A;  1H9G A;  5HVQ C;  3VMW A;  5IYC J;  2DMQ A;  2HOE A;  1TTT A;  1I6H J;  2BM7 A;  2DDB A;  2DI3 A;  1C0W A;  3MHP A;  2EWE A;  1QGZ A;  4I02 A;  3OYE A;  4MEX F;  1T08 B;  2MBF A;  3BQZ A;  3NAW A;  1TWG J;  3HUG B;  4YEJ A;  1R71 A;  5ILV A;  2ZZE A;  2W25 A;  1P7J A;  2BY2 A;  5HLG A;  1MDM A;  4X07 A;  1KGS A;  1MBG A;  3PUM A;  2ZBK A;  4PFP A;  2X85 A;  3BWG A;  1KA8 A;  4BHC A;  2IJL A;  2VPL A;  3ZQ7 A;  4LGW A;  2ZB9 A;  5L3G A;  2J7K A;  3VO2 A;  3GZ5 A;  3CJN A;  5HS9 A;  2H94 A;  2Q2E A;  3F3X A;  3QU3 A;  1BQE A;  1YRN B;  1PJ6 A;  1HW5 A;  5H2F C;  5IK2 A;  1LM1 A;  4P2N A;  1SC7 A;  1IDK A;  3C7J A;  1JKP C;  4BXF A;  2R5Z A;  2FEZ A;  3AVW A;  3OZV A;  2NNN A;  2VJ5 A;  3QWL A;  4YHB A;  1REP C;  2OC6 A;  1OFC X;  5LRR A;  4CCM A;  3BPX A;  3E3V A;  3ELK A;  4FCY A;  3DTI A;  3K1N A;  4EM1 A;  1OGO X;  3HYI A;  3TOA A;  4O6J A;  2YS9 A;  3QPH A;  1BI3 A;  1PJ7 A;  1XMK A;  3ASO H;  3PL8 A;  2IS2 A;  2QWW A;  3SLD A;  2KQR A;  3T53 B;  1H42 A;  2R92 J;  4D7N A;  3HPH A;  3I59 A;  2K3P A;  1HBX G;  3FM3 A;  2ZME B;  1MSE C;  1WOO A;  1JT6 A;  4CO8 A;  2P8T A;  5J1Y A;  2DPD A;  4S05 A;  1HA3 A;  3UNG C;  2BHZ A;  4UZE A;  2KZG A;  1KU7 A;  4RD4 A;  4B4D A;  1IF1 A;  3ZSC A;  2L4A A;  3HIF A;  4L5I A;  1KYZ A;  4BGD A;  1NRK A;  3Q39 A;  2LY9 A;  2RNG A;  4CZC A;  3W6V A;  2H27 A;  1WH5 A;  1K83 J;  5JR3 A;  2KJC A;  3T0Y A;  4IHY A;  2FML A;  3B8H A;  2D1H A;  3IC7 A;  1EA0 A;  3BNW A;  2VL8 A;  3CZ6 A;  1T6Z A;  1EH7 A;  1YLF A;  4BU2 A;  1QHH D;  1WTH D;  3VFZ A;  3CTA A;  4BHP A;  4NNJ A;  3GQA A;  4B47 A;  2DU9 A;  2EIJ H;  3S1M J;  3DKY A;  5HZA A;  2CWE A;  2RNJ A;  4W97 A;  5CVR A;  4HNU A;  2XAF A;  4M3G A;  3FXU A;  2LBF B;  5KNL A;  2M7A A;  5JVG F;  4X8I A;  1X3U A;  1XS9 A;  2X6X A;  3KLO A;  4YIR X;  4WZK A;  2VT2 A;  2BVM A;  3R0A A;  1FNC A;  2HQ5 A;  1KON A;  4YII A;  5F08 A;  4P96 A;  1Z0X A;  1I1S A;  1PDN C;  3BCD A;  3ML3 A;  2D3N A;  1G3S A;  2QF7 A;  2O6G E;  3SEJ A;  1FPQ A;  3CDL A;  1XDS A;  4HZF A;  3MZH A;  3EUH C;  2A07 F;  4I0A A;  2QA4 B;  3MKY B;  5FFZ A;  2FUG 2;  4IXA A;  3QYB A;  2VUM J;  1FBU A;  1VLO A;  4L18 B;  3CXC B;  3CCS B;  2HFH A;  4KT6 A;  2KIQ A;  1JKO C;  5J1U A;  3BTC A;  4A12 A;  3EUK L;  4OAZ A;  2HVS A;  3QAH A;  4BJ5 C;  1U8B A;  3CME I;  1LVA A;  3ZIA A;  3A35 A;  5C1C A;  3IH2 A;  2R7W A;  4KIF A;  2VYQ A;  1XB2 A;  5D5U B;  1VQ6 B;  2LOO A;  1DDG A;  4YFN F;  1GR1 A;  5FO0 A;  4CH7 A;  1UST A;  2E36 A;  2QE7 A;  4Z4T A;  3ZBT A;  1Z67 A;  3WTW C;  1VQO I;  3GTK J;  2B63 J;  1FC3 A;  1UD3 A;  2H6B A;  2HKX A;  4HAM A;  3U9G A;  1ZYR F;  3JQQ A;  1SD7 A;  1NHA A;  3CCL B;  5DCF A;  4HX7 A;  2PJR B;  1R23 A;  4ENK A;  1WOS A;  2ZCW A;  1W7P A;  3ERE D;  2CQN A;  2X1C A;  4MO7 A;  2BGI A;  4K2E A;  4CA0 A;  2YX4 A;  1Z9C A;  3LNQ A;  3V4G A;  1T56 A;  4PGO A;  3CCM B;  4V2F A;  3NQO A;  2KL4 A;  4LG0 A;  4KIG A;  2WY8 Q;  4IHX A;  5IP6 A;  1O3Q A;  2HLD A;  2K5C A;  3H5A A;  3JW4 A;  3GZ6 A;  4X0C A;  2QM3 A;  1O8F A;  3NAR A;  4UUT A;  1O57 A;  3BJ6 A;  5HKK A;  3A03 A;  4XLN F;  2MLK A;  2ID6 A;  3HRU A;  2RC6 A;  4PCQ A;  2K7L A;  2LG4 A;  3K69 A;  4IOA F;  2PFB A;  3OZU A;  2ELK A;  1S9H A;  4I6Z A;  2MSY A;  3H9N A;  2X51 A;  2OV7 A;  1I5Z A;  5F1J A;  1PUE E;  3GLL A;  4BXU A;  2XEX A;  5CVU A;  3VWB A;  3FPP A;  3AL0 C;  3C2H A;  4GGG A;  1FSE A;  1JUP A;  2BW3 B;  3FZV A;  2V7V A;  3BG6 A;  1QH0 A;  4PC7 A;  1TW3 A;  4DGW B;  2HS5 A;  3NWS A;  1IC8 A;  4D9J A;  2OBT A;  2ZJQ F;  1O3R A;  5HDN A;  4MIM A;  3GVL A;  3BY1 A;  5E1Z B;  5BMZ A;  4AIH A;  5E8G A;  1KU9 A;  1N75 A;  1XC5 A;  4RMN A;  2QMU A;  3ZQH A;  2FX3 A;  4OJO A;  1ZLJ A;  2EZK A;  1G7T A;  2OPT A;  2WAQ A;  3KZZ A;  3GIR A;  2R7U A;  4EJW A;  2GJK A;  2MC4 A;  2MAB A;  3PFY A;  1Q9S A;  1IV6 A;  2O1D A;  1BW6 A;  1BPL A;  3CF2 A;  1S7O A;  1U2W A;  4MLO A;  1LFU P;  2RV8 A;  2GXA A;  4U9U A;  1O8G A;  1XSV A;  5LGT A;  3JSO A;  3QP5 A;  2VFM A;  1S5L C;  4N0B A;  5CKT A;  3V7C A;  5JI6 A;  3PIO F;  2VFO A;  4M3B A;  2WV1 A;  2IBD A;  2GXG A;  1E3O C;  5F04 A;  3QFS A;  4A3J J;  1WKM A;  2NSP A;  3HL2 A;  4OJP A;  1W0K A;  3OPO A;  3OIO A;  3KPH A;  3HKZ A;  4C3J J;  3ZC3 A;  2AO9 A;  2X6O A;  5FKK A;  1XGO A;  2OA4 A;  3CMM A;  4NB5 A;  4M9X A;  3GRH A;  2PYH A;  4BJT A;  4ZDP A;  1H89 C;  3U2R A;  5A89 A;  4R1H A;  3B6C A;  3ZMZ A;  2QEX I;  2O8K A;  5D4R A;  5F0F A;  1YIT I;  3PNV A;  3OYG A;  5A2Q Z;  3ONU A;  2C4U A;  3I54 A;  1VQ7 I;  3UW0 A;  2DQL A;  4EGZ A;  2WC2 A;  1TLL A;  2VLA A;  1BM9 A;  3O3K A;  1USS A;  2O3F A;  3OYK A;  4GDF A;  1CLW A;  4XQF A;  2F5F A;  4BDZ A;  5LHH A;  2F1L A;  5BSX A;  4Z06 A;  1WOP A;  1K7A A;  1JJ8 C;  2VXD A;  1QHG A;  1YW8 A;  3RIQ A;  3X2Q H;  3R0J A;  2YWH A;  4QSH A;  2NPF A;  4QHY A;  2HYJ A;  2R3S A;  4ZDL A;  2O0V A;  1LE8 A;  2M0C A;  4XLH A;  5DCM A;  2TCT A;  2KJB A;  4MQ9 F;  1XMA A;  2YSR A;  2X0L A;  3ZPL A;  4MTD A;  3O2P E;  1JA0 A;  2HDN B;  1K4T A;  3W2F A;  3BR5 A;  1VND A;  2DK8 A;  2DMT A;  2FXA A;  1BMF A;  3CCU B;  3GQ9 A;  1RUO A;  4F3Q A;  4EMS A;  3J7A O;  2QCO A;  1LPQ A;  1HVX A;  4XMY A;  1VQL B;  4Z4Y A;  2WAQ N;  4I99 C;  5K5O A;  1PUF A;  1VBL A;  3BDD A;  4ROX A;  4YRV A;  1R1V A;  2IGO A;  2M30 A;  4HG2 A;  2ME6 A;  2BEO A;  2NVU B;  3A0H C;  2MGQ A;  3DF8 A;  5J3O A;  2OZ6 A;  3ULQ B;  2QTL A;  4OWR B;  2FA5 A;  2OD5 A;  3E6B A;  3FXR A;  3K6G A;  4UUS B;  2C5B A;  3SQN A;  5A2Q K;  3GTP J;  1RR7 A;  4MGR A;  3SQV A;  3ABU A;  2EK5 A;  1NTC A;  3GWZ A;  5EGO B;  3N4M A;  2EH3 A;  2W57 A;  4UZF A;  2VOD A;  3F72 A;  2KLO A;  2FVG A;  1O8M A;  2W4S A;  3S1R J;  4OOX A;  2WZN A;  2Z16 A;  1WHU A;  4IF4 A;  2J5O A;  1F20 A;  2KDZ A;  3FBI B;  5H59 A;  4IHT A;  5JFR A;  3NRV A;  2DW4 A;  3CUQ C;  3K1P A;  2XUB A;  3KIO A;  3CMY A;  2VBK A;  3ABK H;  5F6F A;  1JE8 A;  4WX9 A;  5DDG A;  1HZE A;  2OTJ B;  2W6J A;  4UXN A;  1UHS A;  1YFH A;  2MH9 A;  1O7F A;  1BX1 A;  5DV5 A;  4P3I A;  4AC9 A;  2KRH A;  1VTN C;  1V5G A;  4GXO A;  3E97 A;  3PUN A;  1HW1 A;  1W36 D;  3L2W A;  4IX7 A;  3MCZ A;  3FMQ A;  2XT4 A;  2N8G A;  1FP2 A;  4NDL A;  3NWT A;  4FHT A;  1JHF A;  2R93 J;  1CF7 B;  3LA7 A;  2DYI A;  4YZQ A;  1I3Q J;  2EZH A;  3RQ4 A;  3GFL A;  5E79 C;  2BPO A;  1UJ8 A;  2Y2Z A;  3SYT A;  1OB0 A;  3ISP A;  2R5Y B;  1QJV A;  3Q3A A;  2DOF A;  1IUY A;  3EQL F;  2DAO A;  4LJZ F;  5HS7 A;  2EB7 A;  1YHQ I;  3RKY A;  5J4Y A;  1TNT A;  3FWE A;  2F6C A;  3ML6 A;  1DU0 A;  1PJ5 A;  3OSF A;  1FYK A;  3DP7 A;  1IV8 A;  2NZM A;  3NB2 A;  1JT0 A;  4HRI A;  1FNM A;  4FE4 A;  3ASN H;  2BYV E;  1MMS A;  5D5V B;  3VSK A;  2V26 A;  3K10 A;  1FRN A;  2DLL A;  1U5T C;  5LHG A;  2V1D A;  4KUM A;  3ZZU A;  5DUI A;  3V8K A;  4IHW A;  1IB0 A;  5GAE J;  3G4S I;  3E5U A;  2E5N A;  1R00 A;  4YG2 F;  2NST A;  2LLK A;  4U49 A;  2K9Q A;  2L0K A;  4DYQ A;  2J5P A;  2VE8 A;  3WG9 A;  3LSK A;  4HA8 A;  3N05 A;  1FSH A;  1TYU A;  5DS0 A;  1RPW A;  2XAG A;  1HKS A;  1FMV A;  1Y8Q B;  2BMW A;  1BOB A;  2BN4 A;  1VQ9 I;  1R49 A;  3ONY A;  3CJT B;  2F5E A;  4GQN A;  3S17 J;  4TMW A;  3W2V A;  4YIF A;  1ETO A;  1POG A;  4M3D A;  1BN8 A;  3BC8 A;  1N78 A;  3TOB A;  2HZT A;  1WFX A;  2OAZ A;  4E7Z A;  5JLW A;  2PIA A;  3JX8 A;  3I4M J;  1W1W E;  1QG0 A;  2ZFU A;  4M53 A;  3WTV C;  5H20 A;  2R0Q C;  2E2H J;  3K4M A;  2RQP A;  1MBF A;  2LF7 A;  2VNK A;  1YIJ B;  1U9N A;  2HQR A;  4A3E J;  1XFO A;  4LMY A;  2FNP A;  1ZG3 A;  1UMK A;  2A61 A;  1XSD A;  4RCY A;  4N3N A;  3FY3 A;  2P5K A;  5IYR A;  2BE5 F;  2MD0 A;  1EV7 A;  1E17 A;  1EFC A;  2CW7 A;  1ZR2 A;  4MYU A;  3FDY A;  3B6A A;  3WTZ A;  3BY2 A;  3LVB A;  3CJQ B;  5FL7 A;  1XSX A;  1S29 A;  4V02 C;  1W9X A;  4HW0 A;  4CQJ A;  2KMU A;  2WYR A;  2W24 A;  4OIO F;  3BG9 A;  5BQT A;  5LGU A;  2JPC A;  1IG7 A;  1K78 B;  4ZGQ B;  1MJ9 A;  3EUH A;  3RPU A;  1JHH A;  2ADU A;  1G4D A;  2V6E A;  2VBU A;  5AMV A;  1JUM A;  3J7Y J;  2TRT A;  2IW5 A;  2L3D A;  2CQK A;  2XGC A;  2O04 A;  1N07 A;  4I98 B;  2NOG A;  1I50 J;  4FIS A;  5L3B A;  4P9U A;  3BR1 A;  3CC2 B;  5DEQ A;  4L9J A;  3OL3 A;  1Y56 A;  3I1F A;  5HOO A;  3EUA A;  1Z7L A;  1RKT A;  1O4X A;  4A0Y A;  3OSG A;  1BI2 A;  2IT0 A;  3VYR B;  4LG3 A;  1DG1 G;  4JRA C;  2STT A;  2ZC2 A;  1Z05 A;  4OJ6 A;  4MQV A;  2H1L A;  3G1L A;  4TV7 A;  3GVK A;  4YZA A;  4HDV A;  5BPI A;  4U88 A;  1K8A D;  2IOU G;  1W5T A;  3DBR B;  1QFJ A;  4XRM A;  3BR3 A;  4OZZ A;  1TVC A;  1TTY A;  1O8K A;  2LDU A;  1UCR A;  1ZKG A;  1KQ8 A;  4G7O F;  5FLV A;  1E3X A;  2MLG A;  1Q1H A;  3MWM A;  4RM2 A;  4BEH B;  4CYC A;  3L1P A;  3L2Q A;  5D5X B;  3ECO A;  2DFH A;  3QYE A;  2ZJP F;  1IN5 A;  3LST A;  2XTY A;  1T95 A;  1FOY A;  2CV2 A;  1KD1 D;  1Y6I A;  2WPD A;  2M7B A;  4YZ0 A;  5ICG A;  1R1U A;  3OYI A;  3ZBU A;  6PAX A;  3ZMU A;  2C78 A;  2DT7 B;  1Z1D A;  1OR7 C;  4PK4 A;  1NBM A;  4X7D A;  5TY0 A;  2WB1 N;  1SD6 A;  2M3A A;  5FKM A;  3GFJ A;  2IS1 A;  2JRT A;  5BS6 A;  1IRZ A;  4MR0 A;  5FKO A;  5HLH A;  1QQ1 A;  1K28 D;  2YU3 A;  2Z6B D;  3KET A;  1KU3 A;  2L02 A;  4RGS A;  1E3H A;  2E19 A;  2JK3 A;  1JJ6 C;  3K9T A;  3ZP5 A;  3QPL A;  1Z6T A;  3U21 A;  2XSD C;  1T5E A;  1MBE A;  3S2H J;  4P1W A;  2VC0 A;  3GBG A;  4F52 A;  3A02 A;  3WTT C;  1F1Z A;  3E0J B;  2CW5 A;  3A8J A;  4PUS A;  1GVD A;  2OU2 A;  2BVN A;  5E1X A;  2K4J A;  5F27 A;  4HLY A;  3AGP A;  1T2K A;  3CCJ B;  1OGM X;  4A6E A;  4DBQ A;  1NB0 A;  3TL4 X;  4ZYH A;  5AON A;  3L2V A;  2YU9 J;  5F1R A;  4DBR A;  2F5C A;  4XID A;  4P25 A;  1PKV A;  4ENJ A;  2E1R A;  3PO2 J;  4IQJ A;  3LAJ A;  3OWT A;  4UAJ A;  2XB0 X;  2COM A;  2ZO4 A;  2Y48 A;  1S72 B;  3AVX A;  5B3S H;  1T98 A;  2W84 A;  1E62 A;  4ZC3 A;  1K4S A;  1UD6 A;  2K9S A;  4XRS A;  3BTJ A;  3A2K A;  2L2O A;  4Z4V A;  3LAP A;  1S7E A;  1RKW A;  3VYU B;  3D1N I;  1XE1 A;  3AK5 A;  1FTT A;  1MMN A;  1XTA A;  4N4O B;  1JJ2 B;  3OYL A;  2BY3 A;  1VF9 A;  4UB8 C;  1B4A A;  3CLQ A;  4XKC A;  2XRO A;  4KIS A;  2PLF A;  1NJI D;  3GTJ J;  1K4Z A;  4U4B A;  1N0U A;  3CCR B;  1MDM B;  1FT9 A;  3DKX A;  1ZTR A;  3JRG A;  4MFD A;  2CQ7 A;  2M87 A;  2AS5 F;  3AST A;  3EQN A;  4WXH A;  2ID3 A;  1QA6 A;  4U0W A;  1D3Y A;  3ABM H;  1NDH A;  4IW3 B;  1B72 A;  1ZM9 A;  2E34 A;  3ABT A;  1HF0 A;  4ZV4 A;  3ZMV A;  4EJT A;  2Q2E B;  2V4D A;  4EVI A;  2QA4 I;  1YJ9 B;  2WAE A;  4XLF A;  2GBY A;  2R5Z B;  3R6K A;  3AGQ A;  4ESB A;  1J5Y A;  4V2G A;  2B7E A;  2HR3 A;  4FAS D;  3PA1 A;  2NVX J;  4HF2 A;  3IUO A;  3GTL J;  4OZY A;  3MVP A;  4C3H J;  1R5I D;  3ZQI A;  2UV1 A;  2D3L A;  4YAF A;  5FB2 A;  4EGY A;  2IA2 A;  3OEH A;  1OB5 A;  5LMZ A;  1PLU A;  1GLN A;  2ZNZ A;  1PP8 F;  2OF7 A;  2Y30 A;  4KMU X;  2AQF A;  5EYR A;  5TR9 A;  1VQ6 I;  4OOS A;  3I3L A;  2QGU A;  3OYN A;  4FX0 A;  3I59 B;  4IEJ A;  1V54 H;  2DTR A;  3SFZ A;  3H92 A;  2Z8G A;  5DD4 A;  5ICE A;  2YWG A;  5E6T A;  3H3V K;  5TRD A;  4JOM A;  2XGE A;  3HRM A;  1EP3 B;  3I64 A;  1ETY A;  2IA1 A;  2ACJ A;  3PUF A;  1YX2 A;  4YAW A;  1E64 A;  3DFG A;  3AG3 H;  4KT5 C;  1ZGA A;  4Z4R A;  2NYX A;  4Z4U A;  3P9I A;  2X0K A;  3F8B A;  4A3G J;  2JWT A;  4QVA A;  4XD7 A;  3IH3 A;  3IRR A;  4LBV A;  3CCM I;  1HDD C;  5F4O A;  2QTZ A;  5HNH A;  1BC8 C;  3K1M A;  2ELJ A;  2X1E A;  3Q6R A;  2ESH A;  2QSH X;  3K2A A;  2D9R A;  2AXT C;  5GP9 A;  3S1N J;  4X7C A;  1T33 A;  1DGW Y;  4B09 A;  2LRD A;  5FLX Z;  1X1D A;  2IVM A;  3N97 A;  2ZL5 A;  4ENN A;  2DA7 A;  2BM1 A;  4XBF A;  4D1Q A;  2VBY A;  3R61 A;  4PJM A;  5IP9 J;  4Y52 J;  3CCV B;  4OIR F;  2E2I J;  1CQT A;  3SJZ A;  3KP5 A;  2J8I A;  3QYF A;  2ZIT A;  1ZEL A;  2BGC A;  2KHM A;  5LGN A;  2D1V A;  1QBJ A;  4QUZ A;  5FO1 A;  2E1M B;  2Y0S A;  4HE5 A;  4F92 B;  4LLN A;  3MFK A;  2EIK H;  1FY7 A;  4W8Q A;  1RUN A;  3BQY A;  4LFU A;  1DDI A;  2OQR A;  2F48 A;  4RGU A;  4DYR A;  5K1Y A;  1WCM J;  5DTD A;  3CUQ A;  3WYA A;  1YX3 A;  2NS7 A;  3SXY A;  3CMA I;  2DOD A;  1WSU A;  2XTX A;  4Y4R A;  4M73 A;  4ASU A;  3W5H A;  3EQO A;  2R7R A;  4JX4 A;  3TMO A;  5ICC A;  1N77 A;  3BQJ A;  2VBX A;  2FRH A;  1KMH A;  2ZBU A;  3I56 B;  4G94 A;  2FBI A;  3GEZ A;  4G9Y A;  4BNC A;  3P26 A;  3PET A;  2M34 A;  1QPI A;  2IQ7 A;  3W3C A;  3KRG A;  4URR A;  4XM3 A;  3HDD A;  3CJR B;  1WH7 A;  3WOD F;  3IH4 A;  3TO7 A;  1RC9 A;  1Y1V J;  4YFX F;  1B9M A;  4C3I J;  5FLX K;  1BN5 A;  2JQ7 A;  1ETW A;  2QN6 A;  3GQB A;  3U6B A;  3W6J B;  5GV7 A;  4JQF A;  3TO6 A;  4LOC A;  2B7C A;  1UEL B;  4W8T A;  3GTO J;  2YWF A;  3S93 A;  5JHU A;  2MH2 A;  2JA2 A;  1P6R A;  3SZT A;  1W7P B;  1S8N A;  1BOA A;  1W5S A;  5KSW B;  3FK7 A;  4KN7 X;  2CUE A;  2M1B A;  2VBV A;  3E1S A;  4DZP A;  2E1N A;  3S2D J;  1QVT A;  1VHO A;  4MNU A;  1TBX A;  1FTZ A;  3BG3 A;  1TQI A;  4HNV A;  2DMU A;  4LG0 B;  1LEA A;  1U5T A;  3LNN A;  2YPR A;  1AA7 A;  3BCA A;  4UHT A;  2KIM A;  1KTV A;  2ZTN A;  4L8J A;  3BH6 B;  3FIW A;  2JT1 A;  3M1E A;  4ZCL A;  4KJZ A;  2IGK A;  4XLE A;  3WGI A;  1KK1 A;  3A1P A;  3OAA A;  4Z4S A;  3OY9 A;  1D2E A;  1OFD A;  4RB1 A;  1KK0 A;  1BBY A;  5IYN A;  3K7A J;  2GA1 A;  2UZK A;  1XCV A;  1WJC A;  1TT0 A;  4YXW A;  3G1M A;  3H1C A;  3GFM A;  3MCA A;  2DJN A;  5EZG A;  2Y0S N;  2NS8 A;  2XDV A;  1JUS A;  1X3W B;  1F9N A;  4IOC F;  1TWF J;  1KK3 A;  2BGJ A;  5EG0 A;  3JU4 A;  2LKP A;  4TMV A;  2L5Q A;  1D5V A;  4C43 A;  3Q38 A;  1IRF A;  4A69 C;  5C3E J;  4FN5 A;  4N4N B;  3CCU I;  3FXQ A;  1VQ8 B;  3WWG A;  1SVM A;  1UFM A;  1PVE A;  2GIV A;  2O5R A;  2NVY J;  5ILS A;  1YOV B;  5A88 A;  4ZCM A;  1VQL I;  2NVQ J;  1B1B A;  3AG1 H;  5DD8 A;  5J8C A;  1JGG A;  1NB9 A;  1FIP A;  2FU4 A;  1ZGW A;  2BZT A;  3S8P A;  4UVB A;  2ZBV A;  4AVZ A;  1XPX A;  4O3M A;  3RPU D;  3ZQF A;  5IT9 Z;  4EAT A;  4B1R A;  1DDN A;  2A6T A;  4P1V A;  3SJP A;  4F7Z A;  4LBY A;  3I55 B;  1VQP B;  3W5V A;  1D1N A;  1WGX A;  5CVV A;  2O9L A;  1LEB A;  2ZL6 A;  4W8R A;  2UVF A;  3OOC A;  1IUF A;  4P9F A;  2X1D A;  4Z2Y A;  3TKY A;  3DWL E;  1S4M A;  4AYB A;  2B7B A;  2GJR A;  1Q82 D;  3OV8 A;  1IN4 A;  4D5F A;  4ZYE A;  1E63 A;  1FP1 D;  5B6I A;  2O0Y A;  4HX8 A;  2ZTG A;  1T38 A;  2VAS A;  1OB2 A;  5FKN A;  3CDI A;  2LC2 A;  4BL0 B;  4PC2 A;  3MZ8 A;  4ETS A;  2WWY A;  4YAL A;  4LIV A;  4L5E A;  4M72 A;  2VQG A;  4M3E A;  3ZN0 A;  1D1C A;  2ECB A;  3H36 A;  1N8R D;  2FBH A;  1ZLK A;  2BSA A;  2BY1 A;  2F4O B;  1X4O A;  1N08 A;  4HSR A;  5J3L A;  1GAQ A;  1B59 A;  2OBS A;  5E18 F;  2XIG A;  2MA3 A;  1Y1W J;  1V0F A;  4G7Z F;  1FOX A;  5IYP A;  4ASN A;  2DYS H;  2PE3 A;  1VQN B;  4OPO A;  1BL0 A;  2INV A;  4UV9 A;  1R36 A;  4A5N A;  1VQM B;  1KK2 A;  2QBY A;  3ESW B;  4IZZ A;  4PJ0 C;  4N9H A;  4B48 A;  1U2R A;  2C2W A;  1Z3X A;  2P6S A;  4RAZ A;  4RM3 A;  1OCT C;  3WE3 A;  5IT9 K;  1ZRF A;  4A5M A;  3BCB A;  4LB6 B;  2L7K A;  2LSO A;  3ZQG A;  2STW A;  3GQ8 A;  3F21 A;  1BI1 A;  3S3O A;  2Z9O A;  3OS1 A;  2QQB A;  3V8J A;  1LE8 B;  4IHS A;  1XB4 A;  3F0C A;  5KAI C;  1MJA A;  1BR2 A;  4FX4 A;  2K27 A;  5DCM B;  2QZ8 A;  2PN6 A;  3ZRG A;  1FYM A;  3S32 A;  3DDY A;  4NK6 A;  1WI3 A;  3WBJ A;  2BM4 A;  3JQR A;  5CJ9 A;  3K4C A;  2BXZ A;  4ZYG A;  1KTW A;  2CQQ A;  5F0H A;  5KHD A;  4BYY A;  4AVP A;  4E7L A;  1ETX A;  2QKM B;  2QSG X;  1GO2 A;  1AIP A;  4OPW A;  1LFP A;  1PUF B;  2PMU A;  2CFO A;  1FRQ A;  1R5O A;  1VLY A;  1OR7 A;  3S2W A;  2QUF A;  2OTL I;  1FX7 A;  1F60 A;  2PBI A;  1NK3 P;  3A4C A;  1QZZ A;  2WTE A;  4Y15 A;  2PG4 A;  3RYR A;  5FRO A;  5B1A H;  5IOZ A;  4FTH A;  1AOY A;  2E1B A;  3AVY A;  4XK4 A;  4AYB N;  2M8E A;  5J40 A;  1P92 A;  3RKX A;  1RMG A;  2GJP A;  3FHN A;  2H09 A;  2NXN B;  3HOS A;  5DM6 F;  1Y0R A;  3LQE A;  4Y33 A;  3DU5 A;  3FXL A;  3BR0 A;  3LSM A;  1IW7 F;  3ECH A;  1H80 A;  3WHB A;  5LLQ A;  4I09 A;  4E7K A;  2G7H A;  5FD6 A;  2IRF G;  2UWM A;  1QNT A;  4XIC A;  4G7W A;  1WWX A;  2ISY A;  4XOP A;  1W5C C;  2JN6 A;  4EM0 B;  5F0C A;  3D5S C;  1MRZ A;  3UKG A;  3QOP A;  3W5U A;  3VB2 A;  1YIJ I;  1GJR A;  1YW9 A;  5ICF A;  1U0J A;  4L9V A;  1Y39 A;  1VJS A;  3DPU A;  2CV1 A;  5IYB J;  1KQ5 A;  3ZPN A;  2GK7 A;  3GQ7 A;  3G6E I;  2MD5 A;  2JRM A;  3QSY A;  2B5O A;  2ZXH A;  2DQR A;  3LSH A;  5E20 A;  3K4J A;  1TL8 A;  1VQ5 I;  1KZL A;  4ACB A;  1YO5 C;  4TMT A;  1P4W A;  4BJ6 C;  2VBM A;  1JA1 A;  4PC6 A;  3JRD A;  3PA2 A;  2LRE A;  2X48 A;  4RGR A;  3SYJ A;  3K0L A;  4L9T A;  3GF2 A;  4ZJZ A;  2CF4 A;  2WJY A;  2VBS A;  3PSI A;  5EDN A;  4M6X A;  1QFZ A;  5CQG A;  1EZG A;  1MKM A;  2OYN A;  4X06 A;  3CD6 B;  2HU9 A;  3OS0 A;  1CZF A;  2EBI A;  1OHH A;  3KL9 A;  1OOC A;  1X58 A;  3D5L A;  3TBI A;  2LMD A;  2C77 A;  3H09 A;  2RDP A;  4RBO A;  1X3Z B;  2JA5 J;  2EFO A;  4ENM A;  2H1K A;  2L7M P;  2VPR A;  2P6T A;  1X1C A;  1TP4 A;  2OUM A;  1ULY A;  2GAU A;  1V4R A;  3P7N A;  4PJL A;  5FRN A;  3I5U A;  2A6H F;  3CES A;  3OL4 A;  3RZO J;  4RM0 A;  3BH7 B;  2RC4 A;  2HXO A;  2QSF X;  1J0R A;  4PFO A;  3PQK A;  2XHK A;  4BPR A;  4HWV A;  1XGS A;  4PJN A;  3HSF A;  1S0U A;  2QGG A;  3M8J A;  3R60 A;  4CUG A;  4ESF A;  4F55 A;  4G5G A;  2O17 A;  1A35 A;  2KP6 A;  1JI8 A;  3B82 A;  4A93 J;  2DOE A;  2KIF A;  4IRG A;  3DEW A;  3H9J A;  4XR6 A;  3BZC A;  3TDU C;  3TW7 A;  4IO9 F;  4Z4Z A;  1ZAO A;  2I10 A;  4LK1 F;  3VSL A;  3ZGK A;  4RB3 C;  2NNY A;  1FZP B;  2NS0 A;  3HOT A;  1OCR H;  4FT8 A;  1NG6 A;  4CSW A;  3COA C;  3H35 A;  2FNA A;  1ETV A;  1DAB A;  4HF0 A;  3W2E A;  4E70 A;  2G7U A;  3DU6 A;  2VBZ A;  3NAU A;  2K3F A;  4A3F J;  2LH9 A;  5K7F A;  1DGR M;  3PSS A;  3HM5 A;  5DUK A;  2CQX A;  1MBH A;  4RD2 A;  2G0Y A;  1Z77 A;  2JMW A;  1R1T A;  1IN6 A;  3LSR A;  2HCJ B;  1TNS A;  2DA1 A;  1EP1 B;  2KKO A;  4HV6 A;  4G7H F;  3R6J A;  3MD2 A;  2UVE A;  3WU1 B;  4J0Q A;  2Q6O A;  2G9W A;  2E7X A;  5LEJ A;  3GVA A;  4CIC A;  4IHV A;  3HOY J;  1SVL A;  2O7O A;  4KNY A;  4P12 A;  4XRF A;  1B8I A;  4L0Y B;  4FXU A;  2JUC A;  3HSR A;  4CYD A;  3ZPP A;  1LDJ A;  3VO1 A;  5ILU A;  1BX0 A;  2NT6 A;  4W1U A;  1IXC A;  2E7W A;  3W2W A;  5JLV C;  2JIZ A;  1W0J A;  3G71 B;  2I8D A;  3WGH A;  1IJF A;  3S3N A;  3E6M A;  4AWX B;  2XTW A;  1OKR A;  1AKH A;  1VZ0 A;  1AHD P;  3SKB A;  2WZP P;  2CUF A;  3HBL A;  2EFN A;  4R71 A;  2EFW A;  2FX0 A;  3BZK A;  3I9V 2;  1HKQ A;  2VKE A;  3CC4 I;  2TDX A;  3A3B A;  4WZT A;  2OBR A;  1FWZ A;  2F1M A;  2JJ2 A;  1S72 I;  1D8J A;  2DFI A;  1U3E M;  4WWC A;  2BM0 A;  2ZNY A;  2Y0M A;  3IHU A;  4UVA A;  3QE2 A;  1KU2 A;  4G1V A;  1ITY A;  2JVG A;  3QP6 A;  3MKW B;  1T39 A;  1D0Z A;  1G3Y A;  3SZP A;  4M74 A;  2YUS A;  1ZM4 A;  4HST A;  5FD5 A;  4AUX A;  4DOZ A;  3SEQ A;  4B8X A;  2V9K A;  2VI6 A;  5IOY A;  5CDF A;  2VNJ A;  2VJJ A;  3CCR I;  3K70 D;  4N9I A;  3ABL H;  2L7F P;  2CGP A;  2GXB A;  1H85 A;  1MAB A;  2QYO A;  4CYC B;  1A6Q A;  5F4J A;  1EWY A;  2NTP A;  1SD5 A;  2W7N A;  1WU8 A;  2Z33 A;  3CPW B;  1TYX A;  4A3L J;  4PC1 A;  3C2G A;  3RY8 A;  2IEK A;  5JVT A;  1YJ9 I;  3LQQ A;  1PP7 U;  4H0E A;  1O8H A;  3BZ6 A;  3HTU A;  2EFG A;  1G7R A;  4HLX A;  1D0Y A;  2CYY A;  2Q6I A;  1NG7 A;  2D2W A;  5HXB A;  2KDO A;  2QKL B;  4EJU A;  1WSR A;  2BSP A;  1KZH A;  1TZL A;  2JDI A;  5C1E A;  4A3K J;  2PQ8 A;  4II2 A;  3S3M A;  3LYC A;  2K4B A;  5EMN A;  4JYK A;  3AVT A;  3S16 J;  5KVR A;  2P3M A;  3HPG A;  1HSJ A;  3ROU A;  1ZH5 A;  5CVI A;  1JGS A;  3AL0 B;  3PSF A;  3T8R A;  3A01 A;  4QPQ A;  1I7P A;  3VYS B;  1WJE A;  3VSU A;  2BXY A;  2CBX A;  4YDT A;  2ETH A;  2RC5 A;  2OBP A;  3REO A;  3VR6 A;  3GYH X;  4RDU A;  1TSP A;  3LA2 A;  2AQE A;  4G1B A;  4QPO A;  1QRB A;  1YW7 A;  5M5Y J;  2VIX A;  2DOG A;  1V3F A;  5HS8 A;  2K85 A;  3CC7 B;  2JN9 A;  1E1R A;  4CDG A;  4AM3 A;  1RIO H;  1UD5 A;  5IPA A;  5B1B H;  2F3L A;  1HQC A;  2QVO A;  3H9Q A;  3DEE A;  3MEX A;  2GIZ A;  4TMX A;  4I84 A;  1FNB A;  2GZW A;  2HVR A;  1R4N B;  3S15 J;  3WY9 A;  4I01 A;  5HOD A;  1IXS B;  2CK3 A;  5K7Z A;  4UB6 C;  1SFK A;  1JRG A;  3VOE A;  4AF7 A;  1YJN B;  1NK2 P;  3FK6 A;  2EV5 A;  2WB1 A;  3HGG A;  3O8G A;  1UB9 A;  2Y31 A;  3TP0 A;  4EEF G;  3B8Y A;  5K7H A;  2EV6 A;  2ICW G;  3FBN B;  2E2J J;  1LB2 A;  4C2L A;  1R5H A;  1UMQ A;  3L2R A;  3C18 A;  1Y0U A;  1MMA A;  2EIL H;  1LQ1 A;  4B3X A;  4WXC A;  2IXS A;  4IJA A;  1B72 B;  4UVC A;  5GPA A;  4ZYD A;  1ACI A;  2DO7 A;  1I1G A;  3JRI A;  1X1P A;  2DK5 A;  4IPA A;  1G8X A;  3RI4 A;  3ASQ A;  3JRE A;  3CCE B;  4TT3 A;  1DU6 A;  1X2N A;  3WND A;  3RTR A;  1Z7U A;  2R7Q A;  4GYG A;  3F6O A;  4X7E A;  3I56 I;  3WQZ A;  2K9M A;  1VQK I;  2RN7 A;  3AFH A;  1ZM2 A;  2E60 A;  3GCM A;  1W7P D;  1R5B A;  3ASR A;  4BQQ A;  1WJ5 A;  2VKV A;  4HNT A;  1MIJ A;  2HOA A;  3BRO A;  4H4K C;  2EQR A;  2KPM A;  3E6D A;  4RLQ A;  4J01 A;  1DQU A;  2MC3 A;  2XPU A;  1ZN2 A;  4U87 A;  1SKY B;  4RD1 A;  2VQH A;  1OCO H;  1S3J A;  3TQN A;  1J9Z A;  4C9Y A;  4BY7 J;  2L4M A;  4U0Y A;  2K40 A;  2HKO A;  5TJJ A;  1T6S A;  3F9K A;  3JRH A;  5C4X J;  3OJX A;  2FQ4 A;  4R8H A;  1ETK A;  3OYA A;  2EJR A;  1U78 A;  1K79 A;  4H9G A;  2EZI A;  1X4P A;  1K8F A;  3ZR8 X;  1G2H A;  3HEF A;  2L01 A;  1FYL A;  2C4T A;  4RJL A;  2J8K A;  4HBL A;  1P4M A;  5FGM A;  4B3A A;  3TED A;  3K4L A;  4IKF A;  4BAC A;  1TWC J;  4XKB A;  4YEI A;  1EH6 A;  2HTJ A;  2XT2 A;  2ZXJ A;  4QVJ A;  3WTX C;  2F4I A;  1LVK A;  2EA2 A;  2WR8 A;  4ON0 A;  1SAX A;  2PMD A;  3SY2 A;  4ABZ A;  1B2R A;  2HWV A;  2BM5 A;  1I6X A;  2PJP A;  3SDG A;  1UD8 A;  1R9T J;  4LBZ A;  1IHM A;  3FPK A;  2YX7 A;  4DNT B;  3M3Y J;  4G6T B;  5E3O A;  3KP6 A;  1KRH A;  1K73 D;  4DYC A;  2HNH A;  3TDZ C;  4MYT A;  2R7Z J;  1TYW A;  2VT3 A;  2Z3Y A;  4C30 A;  1SMY F;  1DPR A;  1WMR A;  3OW2 B;  5EEA A;  4Q5S F;  3V7R A;  2OK8 A;  4E7H A;  3CUQ B;  2O03 A;  4JBA A;  5FO5 A;  1CNF A;  4Y3O A;  2QEN A;  3K2Z A;  1AMO A;  5JLX A;  4KN4 X;  2X6Y A;  2RQQ A;  2CS3 A;  5J4V A;  1CGP A;  4RD0 A;  2XF6 A;  2NRA C;  3C2B A;  2LY1 A;  3ES9 A;  4EH1 A;  3W6K B;  3TP3 A;  1VQ4 B;  1OLT A;  2LP0 A;  1IDY A;  4B3F X;  3LSG A;  2LFB A;  3OZW A;  2HDW A;  3I55 I;  4Z03 A;  1VQP I;  1P9Q C;  2HYG D;  3HHH A;  4XOT A;  1QFY A;  2KIS A;  2NAZ A;  4E7I A;  1MH3 A;  1MND A;  1OQY A;  1HXD A;  3FXK A;  2A3S A;  2HQA A;  4M6Y A;  3IP4 B;  4ZTJ A;  1A36 A;  1ZHF A;  4I76 A;  3R6S A;  2Y9Z A;  1ZQ3 P;  1BLI A;  2ZKZ A;  1KC8 D;  3G2B A;  1F36 A;  2JA8 J;  1V5V A;  1KQ9 A;  4OJL A;  2DY1 A;  3TW6 A;  4BS9 A;  4P9S A;  2R7F A;  4PAB A;  5CQE A;  4JP0 A;  1N25 A;  5E3L A;  3E5X A;  5BOX A;  2VOP A;  1OFL A;  2EIM H;  1QCX A;  1K5C A;  1GVJ A;  2Q1Z B;  3RSN A;  2X53 S;  1QPM A;  2VKD A;  2X3H A;  1M1E B;  4HPQ A;  4KIB A;  2DFF A;  1P4X A;  2CH0 A;  2FJ1 A;  3MQ0 A;  2ZME C;  4G6Q A;  3U6K A;  2OJE D;  2HGC A;  1IN8 A;  4RA2 A;  2XZP A;  4X7F A;  1MSF C;  3SEZ A;  3KE2 A;  1U5T B;  3SFI A;  2CJJ A;  2V7T A;  2XZO A;  4CHU A;  3K4N A;  1WRJ A;  2Q6K A;  4PGH A;  1UD2 A;  3VNV A;  3QFC A;  2A6E F;  3BTI A;  1UHW A;  1YI2 B;  4EJV A;  1QVF B;  1VQN I;  3CCS I;  4BUP A;  3CPX A;  1UD4 A;  1WJF A;  2Z1D A;  2ZSI B;  3LSJ A;  4YC5 A;  3L7W A;  1H8A C;  1BC7 C;  3Q0U A;  1ZM3 A;  3VMF A;  3J7Z I;  3FJO A;  3WNC A;  1O8L A;  2CFX A;  4XON A;  3H3U A;  1DP7 P;  3LQR A;  5E3N A;  2GM4 A;  1KJZ A;  1OGI A;  3BJO A;  4I2O A;  4P55 A;  2F5D A;  3HJE A;  2JUG A;  5EG0 B;  4BE2 A;  1SM4 A;  1YHQ B;  2Z2S B;  2PEC A;  1E3Z A;  5L3E A;  1XCB A;  1EKE A;  4RD6 A;  1R7J A;  2PX9 A;  2A69 F;  5J47 A;  1H9T A;  2V7Q A;  4RB2 C;  3CCL I;  2R7X A;  4FK8 A;  4XLP F;  3A8K A;  2XKO A;  3QPS A;  5H6R A;  1OCC H;  4OP7 A;  4M0L A;  1WJB A;  3G3Z A;  2Q8K A;  2PEX A;  2XGD A;  1J9I A;  3MKZ A;  3CDH A;  2JSP A;  2M8G X;  3E1Y E;  1OYY A;  4EQQ A;  2M5W A;  2LTP A;  5D8L B;  4WQM A;  1E3P A;  3DXJ F;  1ZK8 A;  2ELH A;  5KCM A;  3Q3S A;  3RJP A;  1UAA A;  1FEX A;  1S6L A;  3WU2 C;  1MBJ A;  4UUV A;  2Y9Y A;  3CO6 C;  1LFB A;  4OOI A;  1WSV A;  3I4P A;  4HQM A;  5FNZ A;  3NEU A;  2F43 A;  3ASP A;  4CCJ A;  1QZE A;  2DMP A;  3JSP A;  3KEQ A;  4OOV A;  4G6D A;  2CV0 A;  4RDL A;  2A05 A;  4JX5 A;  2UUZ A;  3T9G A;  3GXO A;  3JR9 A;  2W48 A;  3T51 B;  1M1K D;  1E43 A;  1OPC A;  2LKS A;  3B73 A;  3RKW A;  5GAH J;  2PI0 A;  3DBL B;  2FSW A;  1EP2 B;  4PSX A;  1RQR A;  5DNS A;  3E7L A;  4OJ5 A;  4DNC A;  5DN6 A;  3N6Z A;  4NC7 A;  4XKV A;  5M3M J;  3CCQ B;  4PZJ A;  4OIQ F;  2XPW A;  4Y7N J;  4M4S A;  1K61 A;  5L46 A;  5M5X J;  1RES A;  2JA7 J;  4CCN A;  1Q7Y D;  4GFB A;  3F22 A;  4NBS A;  2K86 A;  2XOK A;  3I58 A;  1P2F A;  2QBY B;  1BA5 A;  4J00 A;  3JTG A;  5L3C A;  1R4M B;  2I5U A;  3VOD A;  1XDU A;  2V1X A;  1CQX A;  3B02 A;  3CW2 A;  3A3G A;  3BH4 A;  3BT9 A;  2BX6 A;  1JTA A;  4GCV A;  1FBQ A;  3CD6 I;  1FND A;  4RLZ A;  1DUX C;  4DZJ A;  3MKL A;  2XC1 A;  3ZMT A;  3JRB A;  3ZMD A;  3PVD A;  2ESN A;  1V5F A;  3HOU J;  4FE7 A;  4DNR B;  1TQP A;  2DET A;  2V5I A;  4CCO A;  3PJR A;  4YAU A;  3JUR A;  1AIR A;  2WJV A;  3P27 A;  1ZUN B;  1Y0Y A;  3HOX J;  2VBE A;  5DYM A;  1A04 A;  1BIB A;  3JRA A;  2V7U A;  2G0E A;  2EFQ A;  3ZOB A;  4CCL A;  4QV2 A;  3WGG A;  1F5T A;  4XKW A;  1SEU A;  3AG4 H;  2DJI A;  3OMY A;  3OOU A;  3DV8 A;  2DFE A;  3F6V A;  4NQW A;  5GAD J;  3T8T A;  1E0E A;  1GQ8 A;  4AIJ A;  2GA2 A;  3A8I A;  1YX5 A;  2V4J C;  5GTI C;  5LFA A;  3OKX A;  3OIQ A;  3WG7 H;  1X1B A;  2M45 A;  3J81 k;  2P7V B;  1GV5 A;  4P5O A;  3IRQ A;  1TWH J;  2MFZ A;  5BPD A;  3EDP A;  3HSE A;  1ETQ A;  3LFK A;  2GOX B;  4XNF A;  1R22 A;  2KT0 A;  1RET A;  2V79 A;  2VKH A;  1BJK A;  1I3A A;  1A5J A;  1LJ9 A;  2VQL A;  1I8D A;  4XOR A;  1SFU A;  2I1L A;  2P5V A;  3H5N A;  2FE3 A;  2V9V A;  4LIU A;  2IS4 A;  2WSS A;  3WE2 A;  1HLV A;  2X4H A;  2B9S A;  5HZB A;  3PNY A;  4F93 B;  5IP7 J;  4RDK A;  3SUC A;  3MMY B;  2W82 A;  3OS2 A;  4RAG A;  3JRC A;  1OJL A;  3DPT A;  3U1D A;  1WVR A;  2CRG A;  2KZV A;  3Q5F A;  2QDX A;  4K1X A;  1EF4 A;  2LKX A;  4OM9 A;  2V6C A;  2ZSH B;  3M8F A;  4JX6 A;  3HHG A;  1XG1 A;  5FIU A;  3BG7 A;  2LYC A;  1SVO A;  1IJE A;  1N06 A;  4G12 A;  3L2U A;  2DA3 A;  3QOD A;  1APL C;  4TMZ A;  2LNB A;  4PMH A;  1YS6 A;  1FLI A;  3HG9 A;  5E8I A;  4HYE A;  1ZG1 A;  3JQP A;  2QQ8 A;  2GLO A;  5D8K B;  4DQK A;  4YZX A;  1YQA A;  5GV8 A;  2CU7 A;  3N90 A;  3IWF A;  1DP3 A;  3GVJ A;  1R5N A;  2P4W A;  3IWZ A;  1TC3 C;  3TO9 A;  1Q86 D;  3PFI A;  4AU7 A;  3F23 A;  1KCD A;  4S04 A;  1RU4 A;  3JRF A;  5AIP A;  2EWN A;  9ANT A;  1HKT A;  3BY6 A;  3G71 I;  1ZR4 A;  4OIP F;  2JVH A;  2JA6 J;  5ERI A;  3K4B A;  2EZL A;  2HOT A;  5KK1 A;  5LEK A;  1GT0 C;  5E17 F;  1PJR A;  3ZCO A;  2R9V A;  2DCU A;  3D26 A;  1H8E A;  3PUB A;  3VMV A;  2ZZF A;  3GO5 A;  1WPC A;  4N3G A;  1W0T A;  1BR4 A;  3BPV A;  4M3F A;  4C2T A;  2VNH A;  2OTJ I;  1WJD A;  1V55 H;  1XGN A;  3OYC A;  5FRM A;  1FX0 A;  3DLL F;  2BVL A;  2GQF A;  3LQ6 A;  1TLH B;  4BBR J;  1YJW B;  3IAM 2;  2K9N A;  1S7A A;  2GQQ A;  2F4N A;  2LR8 A;  2R7O A;  2Z5U A;  2XRL A;  3BR6 A;  2W7Z A;  3LOC A;  4Z1M A;  3S14 J;  3HGY A;  2R7S A;  2A5W A;  3PIP F;  2VZL A;  4XLA A;  4E7S A;  1GXP A;  2E5Z A;  3RQI A;  3KFW X;  2MG4 A;  3WNB A;  1IGN A;  5HDK A;  4KH3 A;  1WQ2 A;  3OOP A;  4NK8 A;  2D45 A;  1R6R A;  1XGM A;  2NT9 A;  1HA8 A;  4ANJ A;  3WTS C;  2VBW A;  2DEU A;  3VDX A;  3GZN B;  2EIX A;  3QQA A;  5D6E A;  1HOM A;  1JNY A;  2VJ4 A;  4HDU A;  2IGM A;  1D0X A;  5IT3 A;  2IPQ X;  5EJC A;  2L9V A;  3P5J A;  3M9A A;  3CRZ A;  3T1B A;  1KYW A;  3SJM A;  4OPS A;  1MNM C;  3AAF A;  1W2B B;  1UG2 A;  4HF1 A;  2W6I A;  4WCG A;  1B9N A;  3IV5 A;  3GUD A;  4XSX F;  4AD9 A;  4UNO A;  2PMH A;  4RS8 A;  4DIQ A;  4MFE A;  5FFX A;  4R79 A;  4XLC A;  3HRS A;  4Q7J B;  2QXZ A;  1WOR A;  2QZA A;  1T0F C;  2XAQ A;  3AKZ A;  4YFO A;  1G3T A;  1B8I B;  2XF7 A;  1CNE A;  1UZC A;  3HTS B;  4A6D A;  3QFR A;  5LBQ A;  5JHF A;  1MW7 A;  5B5E C;  3MAJ A;  4EM2 A;  2R4G A;  1RR8 C;  2A68 F;  3D5R C;  3VSV A;  2H8W A;  3EYY A;  3AG2 H;  1U8R A;  5J6X A;  2XSJ C;  3HUG A;  2HEO A;  3V8L A;  5J8F A;  3CC7 I;  3U1K A;  2M4K A;  2IAI A;  2NOJ B;  1Z21 A;  4EJO A;  2P7C B;  1AU7 A;  3FKI J;  4ZZL A;  1AKH B;  1E2X A;  2ZFW A;  4BQA A;  4G7X A;  1J09 A;  3Q0W A;  1OFE A;  1U9O A;  2XGX A;  1FBS A;  1D8T A;  1YS7 A;  2D5V A;  2F2E A;  2Q0O A;  5DS9 A;  1ZRE A;  1IA5 A;  3B78 A;  1DAR A;  2XVC A;  1YRN A;  3AVV A;  2HI3 A;  2W00 A;  1HC8 A;  2JJ1 A;  2XAU A;  1E79 A;  3W2G A;  1TW2 A;  2LZJ A;  3O8H A;  2VB6 A;  3KP4 A;  1G7S A;  4B3G A;  3F8F A;  1IB4 A;  3GTQ J;  1D5Y A;  1EFT A;  3LFU A;  3DPL C;  1A31 A;  4YEL A;  1YJN I;  3HOW J;  1GAW A;  4WF2 A;  4PSW A;  4B44 A;  2DIE A;  4PJJ A;  4BQO A;  4KYW A;  4BE0 A;  1ZRD A;  5DM7 F;  5H5J A;  4Y13 A;  1X2M A;  1Z91 A;  1UHM A;  2V7F A;  2DPU A;  2CO5 A;  5F64 A;  1XX5 A;  1Q1V A;  2L54 A;  2HDC A;  2X8K A;  1TYV A;  4ESJ A;  2ZME A;  3LSP A;  3CB4 A;  1EA3 A;  3CMA B;  3TGN A;  4Z6Y A;  1L1I A;  3HXL A;  3CCE I;  4HIZ A;  2RGV A;  5ED4 A;  3E6C C;  1ERD A;  1QU3 A;  4ZGN B;  2DT5 A;  3VST A;  4A0X A;  5LHI A;  1TT5 B;  1YYV A;  3J7A Y;  1PYV A;  3D0S A;  1Z3Y A;  4D5C A;  1O3T A;  3CC2 I;  5IYD J;  2AHQ A;  3P9C A;  1U6G A;  2R7T A;  1G3W A;  3BR2 A;  2LK2 A;  3L00 A;  4XN0 A;  1X0C A;  1D1A A;  4AC0 A;  4P6V F;  2YUH A;  1BW5 A;  3A01 B;  3P4G A;  1W34 A;  2CW8 A;  3L2C A;  2GRE A;  1W35 A;  1W87 A;  1FMW A;  3EET A;  2ZZQ A;  2L9N A;  3BC9 A;  2LBF A;  2OK7 A;  3DLA A;  3M7G A;  2WAF A;  2OCC H;  3CLO A;  4M6V A;  4M1K A;  1EFU A;  4OMZ A;  2JJ7 A;  3CCY A;  2XAS A;  3I71 A;  1AWC A;  2DA6 A;  3KEY A;  1J7K A;  3LMM A;  2FD5 A;  2CUJ A;  1FNN A;  1J2X A;  2DOA A;  3HC7 A;  1IRX A;  2E1C A;  1KQ0 A;  1ENH A;  2DBB A;  2VFQ A;  1XMX A;  3EPZ A;  5CYV A;  2X3U A;  1JXS A;  1MZB A;  3B90 A;  5LD2 C;  1IRG A;  4RAF A;  1WZ2 A;  2LD5 A;  4NUB A;  3GX4 X;  2XC7 A;  1JKQ C;  4YAO A;  1P7I A;  1Q81 D;  3H3Z A;  4JK1 X;  4A3B J;  4BAY A;  1HCR A;  1X1A A;  2FMY A;  3HZJ A;  1XG2 A;  3T5X A;  1IXR C;  3FKJ A;  2WV0 A;  2HPI A;  5F4M A;  1V0E A;  1MJB A;  3NE5 B;  3B4N A;  1OFM A;  4FET A;  2KIU A;  2VFN A;  2WA0 A;  2C6Y A;  1OYW A;  4XSZ F;  4A3I J;  4C2U A;  4U7D A;  4U7B A;  2BY0 A;  4KDP A;  1YE9 A;  3FF5 A;  3LO8 A;  2GWR A;  4A0Z A;  5DSZ A;  3V76 A;  2VFP A;  1FIA A;  1LNW A;  4HV5 A;  3SDB A;  2XZL A;  1HF2 A;  4KKT A;  1RWR A;  2V7X A;  2JZY A;  3BCF A;  3WBK A;  4KIC A;  2XAJ A;  2VC1 A;  1VHE A;  1ODD A;  4G8X A;  3BJA A;  1YIO A;  2LVS A;  2PJR A;  3CCJ I;  1E1Q A;  3CO7 C;  1QGY A;  2JTV A;  4OMY A;  1T6X A;  1W4M A;  4B4C A;  4LLL A;  4Y9U A;  5TIS C;  1VQ4 I;  2E35 A;  2AXL A;  2V31 A;  3RYP A;  2VBT A;  4RAY A;  2GOM A;  5GTH C;  1BJZ A;  3SLN A;  4BBS J;  4KKU A;  3CF5 F;  5TV2 A;  3KLN A;  2NTB A;  4A2U A;  1QVU A;  2BV6 A;  3RIR A;  1N05 A;  3OJW A;  1K6Y A;  4HOB A;  1I39 A;  1JTX A;  3A0B C;  5JMC B;  2V1N A;  3V7S A;  3IKT A;  1H88 C;  4JMQ A;  2L7Z A;  3GFI A;  1EJ9 A;  3CP8 A;  4C2M J;  5BSY A;  3F8C A;  2EV0 A;  3H0D A;  1R58 A;  2XAH A;  3JTH A;  1UG0 A;  4L5J A;  3HKZ N;  5AIQ A;  1QVG B;  1NHC A;  1XQB A;  1SMT A;  1X19 A;  4NBQ A;  2BW3 A;  2H6C A;  2M9H A;  4I0B A;  2HOS A;  4PC3 A;  3LSI A;  3MZY A;  5FLM J;  2BM6 A;  4YFK F;  3JAM Z;  1GHC A;  1WJA A;  5C44 J;  1HW2 A;  1BHE A;  1IN7 A;  4J19 A;  3GLX A;  2VON A;  2HDD A;  4LK0 F;  3IL2 A;  2HQN A;  3QOE A;  2R6H A;  1YI2 I;  3I4N J;  4X1E A;  2IGN A;  2DXI A;  4D7M A;  1P4A A;  4X05 A;  1QZY A;  2P5L C;  3V7A A;  1OIS A;  1TUI A;  1ON2 A;  1IO2 A;  2HYF A;  3U2Q A;  2KFD A;  1SFE A;  4CXF A;  4WK8 F;  3RKQ A;  4GYI A;  3CME B;  1A6I A;  1QQI A;  3Q0V A;  3OYJ A;  2FQ3 A;  4WZL A;  3SZG A;  3ZUG A;  1MGT A;  4MXN A;  3K4K A;  3M8E A;  3OYD A;  1I27 A;  1XD7 A;  1LLW A;  2K9L A;  3KZI C;  3RDI A;  2CW0 F;  3QPT A;  2DA4 A;  1Y0N A;  2XRN A;  3FX3 A;  4V19 K;  1VQO B;  4GRI A;  1GUU A;  3H5R A;  3PO3 J;  2QY1 A;  4ZCI A;  2Q6L A;  1JB9 A;  4RDJ A;  3MMP A;  4UZU A;  1XN7 A;  1VFC A;  3KYL A;  2UXX A;  4ACA A;  2DDA A;  3LJY A;  2ISZ A;  4MEY F;  3ONQ A;  4MHG A;  1SFX A;  3ZMS A;  5HLT A;  1SKQ A;  2GK6 A;  3QFT A;  2HVQ A;  1W36 C;  2KVO A;  4HE6 A;  3OYF A;  3LMW A;  1QA2 A;  4KIT B;  4M2L A;  3KCC A;  3L9F A;  3JAM K;  2PLY A;  2OTL B;  2DMN A;  1N0V C;  1QA1 A;  4TSF A;  3H9G A;  2EPF A;  3J80 Z;  5J1R A;  3GTG J;  3BG5 A;  1W0U A;  3UR3 C;  3OP1 A;  4OAY A;  3FHZ A;  3K70 C;  1WXR A;  1RZ4 A;  1LLZ A;  2R7V A;  1ORK A;  2IA0 A;  4MTE A;  1F43 A;  4TKO B;  3LWF A;  4PGG A;  1QUF A;  2YR2 A;  5AN9 A;  2X9D A;  3LL7 A;  5C4J J;  3CCV I;  5BNG A;  2QYU A;  3V42 A;  3VYT B;  2VJI A;  2DN0 A;  4LIT A;  3A1Y A;  1Y8R B;  3WTY C;  1R5G A;  3EYI A;  5B66 C;  5D5W B;  2KRF A;  2O8X A;  2M5S A;  1L3L A;  1G7C A;  3FXO A;  5CLS A;  3PNT A;  5HDG A;  2PMZ A;  2OCE A;  4II3 A;  5K5R A;  3CCQ I;  3Q9S A;  1H0M A;  1YG2 A;  4UY8 I;  2O0W A;  4I7H A;  4B43 A;  4OU0 A;  2R7D A;  5M5W J;  1J59 A;  2NV4 A;  2DT6 A;  2XF5 A;  4DK0 A;  2JPB A;  3G6E B;  3BOQ A;  3BP8 A;  4P26 A;  2NVT J;  4LD5 A;  3GTM J;  4BE1 A;  1VQ5 B;  4EW9 A;  5THX A;  3Q9V A;  3FM5 A;  3QU6 A;  2GPJ A;  5IY5 H;  3FMS A;  2NTQ A;  3M4O J;  4QLC U;  1VI0 A;  2W85 A;  3J80 K;  3GSI A;  1QO0 D;  4F7D A;  3KZY A;  1IAW A;  2C5H A;  2P0W A;  2DYR H;  2ZL7 A;  3MN2 A;  3I0T A;  4G6I A;  4UUS A;  5GAG J;  1A8P A;  1JTY A;  3ZXS A;  3OYB A;  2K02 A;  5HNF A;  2KRC A;  4Q4Z F;  4KFC A;  4D0P A;  3IAS 2;  1DBO A;  5EGO A;  2A5Y B;  1VF7 A;  4BY1 J;  2WBM A;  5GPC A;  2E1M C;  3RPQ A;  3G05 A;  5E1W A;  3C3W A;  3ZN1 A;  1ZG5 A;  4RB0 A;  4Z4W A;  4HX4 A;  2CND A;  3BLY A;  1HG8 A;  3KYC B;  3O6B B;  3F8N A;  4BKX A;  1FJL A;  5L3D A;  2YWE A;  1COW A;  2L9S A;  5M3F J;  3DU1 X;  4KA4 A;  3SZE A;  1Z6R A;  2CUZ A;  3R4K A;  3W2A A;  4LC0 A;  3WTU C;  2Y75 A;  3M1C A;  4IVN A;  3PQJ A;  3ZQL A;  1QGP A;  1G59 A;  2CMP A;  1ELO A;  1ZGJ A;  1MH4 A;  2QEX B;  1SFO J;  1T0F A;  4DJA A;  5CVJ A;  2XNC A;  1YIT B;  1PE9 A;  4M71 A;  2FBK A;  2E71 A;  3JCU C;  1RRJ A;  1ONV A;  3CQZ J;  2RKH A;  1O88 A;  1LDD A;  2VQC A;  4LBW A;  2ZJR F;  3S1Q J;  3GW2 A;  3ZQC A;  1VQ7 B;  1CF7 A;  2DER A;  2EA4 A;  4L0Z B;  3QRF F;  1OGJ A;  2WY7 Q;  1K6O A;  4OPV A;  1NH3 A;  2F5V A;  2CG4 A;  2R5Y A;  2UXN A;  4HEA 2;  4S0H B;  4XL9 A;  2Z99 A;  2ZJ2 A;  3ERM A;  4FQG A;  2PMZ N;  4DQL A;  4IQ4 A;  3OEE A;  4Y7C A;  2COB A;  5TGT A;  2XNJ A;  2QQ9 A;  3I53 A;  1QX4 A;  1VQ8 I;  1TQM A;  1L0O C;  1RNL A;  3OR1 C;  5D4S A;  3PM1 A;  4CZZ A;  2BHY A;  3DTE A;  2HTS A;  4NC8 A;  2FOK A;  1EXM A;  2AHO A;  1WPK A;  1MMG A;  1FOW A;  1IZ1 A;  2Y69 H;  4F91 B;  1OMI A;  3LA3 A;  1JKR C;  4BH9 A;  2RRE A;  4WWV A;  5KW9 A;  3ISX A;  1T6Y A;  2QX3 A;  2BBY A;  2ECC A;  5LRS A;  4QTR A;  1FOK A;  2MYS A;  4Y17 A;  3ZQQ A;  4TN1 A;  4EV0 A;  1LKX A;  1YLO A;  1GXQ A;  2DA2 A;  3VPR A;  3KYD B;  2ME0 A;  1OCP A;  1ON1 A;  1QA3 A;  4LLG F;  2O6W A;  2RAE A;  2ZXI A;  3FKS A;  2HPM A;  4CGZ A;  4ZDO A;  1EFR A;  4ZTF A;  1HDP A;  3E20 A;  1I18 A;  1O8E A;  5H6Q A;  4DQ2 A;  2DTZ A;  1RQP A;  1GV2 A;  4RPD A;  3HOV J;  4ZYA A;  2FF4 A;  5EEH A;  2VOO A;  4YCQ A;  1ZRC A;  3W2H A;  2F4M B;  4GO1 A;  4PAA A;  2X6W A;  4NQW B;  5EEG A;  3CC4 B;  1IDZ A;  2QQA A;  2RVC A;  3GME A;  4RCZ A;  3ZZ0 A;  3WHC A;  2OQG A;  4WZE A;  2XPV A;  4UV8 A;  1YJW I;  3WU0 A;  5JBQ A;  2ZXW H;  4Q47 A;  4KMF A;  3KP7 A;  4A3M J;  4KKS A;  1K9M D;  1MNE A;  1GDT A;  1YTY A;  4HQE A;  1VQM I;  2DCE A;  1OCZ H;  2BOL A;  2EIN H;  5E3M A;  2W1O A;  3OW7 A;  3ZZT A;  1EH8 A;  3H0G J;  4WXD A;  1G6N A;  4ZZD A;  2PYG A;  3PSZ A;  4A3C J;  3FIS A;  4BXX J;  4P22 A;  4E6K G;  1OYI A;  1QGA A;  3M07 A;  2ODL A;  1DBG A;  3DTK A;  3OE7 A;  3E5Q A;  5D6F A;  1LDK B;  1PXZ A;  1ZAR A;  4O5V A;  2BF4 A;  3KEW A;  3P9K A;  4RLF A;  3HAG A;  2XND A;  1SAN A;  3DCF A;  3BTL A; 
#chains in the Genus database with same CATH homology
 1KCD A;  4F55 A;  2O17 A;  2LY2 A;  2KP6 A;  1JI8 A;  1RU4 A;  4XR6 A;  2WAD A;  3H9J A;  3FY3 A;  2JVH A;  1V5E A;  2M4G A;  4CCK A;  3VSL A;  3ZGK A;  4E0F A;  3K4B A;  3T56 B;  2MD0 A;  3OIP A;  1PJR A;  3ZCO A;  2CW7 A;  3HOT A;  3FDY A;  2R9V A;  1H8E A;  3PUB A;  3VMV A;  1NG6 A;  2ZZF A;  4CSW A;  1WPC A;  3H35 A;  3CJQ B;  5FL7 A;  1BR1 A;  1BR4 A;  4C2T A;  5CPR B;  1W9X A;  1WJD A;  2KMU A;  3DU6 A;  3OYC A;  5FRM A;  1FX0 A;  2BVL A;  2LH9 A;  3IAM 2;  1DGR M;  2R7O A;  3KX2 A;  2V6E A;  4X0G A;  2R7S A;  4Z1M A;  5AMV A;  2A5W A;  4XLA A;  4E7S A;  3CP2 A;  2E5Z A;  2O04 A;  4NK8 A;  4XN3 A;  4BQN A;  3MD2 A;  2UVE A;  1R6R A;  4BDY A;  2NT9 A;  1HA8 A;  4ANJ A;  3VDX A;  1KCC A;  3OL3 A;  4BEH A;  1Y56 A;  5HOO A;  3EUA A;  1Z7L A;  4FXU A;  2VJ4 A;  3ZPP A;  4W8S A;  2IGM A;  3VYR B;  1D0X A;  4LG3 A;  3OYM A;  1O8J A;  2XGJ A;  4ITV A;  2NT6 A;  4OJ6 A;  3GVK A;  1EE6 A;  3W2W A;  2VXZ A;  4YZA A;  2JIZ A;  1W0J A;  2I8D A;  3OFN A;  3S3N A;  2W6I A;  4DK1 A;  3OYH A;  4OZZ A;  2HZD A;  1MMD A;  4DIQ A;  1SAU A;  1VZ0 A;  4R79 A;  3H94 A;  4XLC A;  2WZP P;  1O8K A;  2QXZ A;  3RCO A;  1E3X A;  3I9V 2;  4RM2 A;  1T0F C;  4BEH B;  3AKZ A;  3L2Q A;  3A3B A;  2F1M A;  2JJ2 A;  3QYE A;  2XF7 A;  1H8H A;  1O8D A;  2IS6 A;  4E4H A;  1D1B A;  1T95 A;  2CV2 A;  5JHF A;  1MW7 A;  1Y6I A;  2M7B A;  2WPD A;  4Z05 A;  4YZ0 A;  1O8I A;  2JVG A;  2R4G A;  3MKW B;  3D5R C;  3DQV C;  3OYI A;  1D0Z A;  3VSV A;  4E7J A;  3OR2 C;  4HST A;  2DT7 B;  1NBM A;  1OR7 C;  4PK4 A;  4DOZ A;  2XSJ C;  3SEQ A;  2M3A A;  4MR0 A;  2IS1 A;  2M4K A;  2NOJ B;  2V9K A;  1Z21 A;  4G7X A;  5CDF A;  2VJJ A;  1K28 D;  3K70 D;  1IDJ A;  2Z6B D;  1J09 A;  2INU A;  1MAB A;  2BSP A;  2NTP A;  3U21 A;  2ZZG A;  2W7N A;  1IA5 A;  1T5E A;  1WP6 A;  2M0M A;  3C2G A;  2W00 A;  2JJ1 A;  1O8H A;  4P1W A;  5HVQ C;  2XAU A;  4F52 A;  3GBG A;  3VMW A;  3E0J B;  1E79 A;  2LZJ A;  4PUS A;  2VB6 A;  2EWE A;  4B3G A;  1D0Y A;  1IB4 A;  1NG7 A;  3OYE A;  3LFU A;  2KDO A;  2QKL B;  3DPL C;  4DBQ A;  1OGM X;  4YEL A;  1TZL A;  3HUG B;  4YEJ A;  3TL4 X;  4PSW A;  4B44 A;  3L2V A;  2DIE A;  2JDI A;  4PJJ A;  4DBR A;  2ZZE A;  5C1E A;  4II2 A;  3S3M A;  1PKV A;  4BQO A;  4BE0 A;  4IQJ A;  3OWT A;  4PFP A;  2X85 A;  2V7F A;  3HPG A;  2VPL A;  3AL0 B;  2X8K A;  3PSF A;  4QPQ A;  4ZC3 A;  3VYS B;  1EA3 A;  1WJE A;  5IK2 A;  1UD6 A;  1IDK A;  3A2K A;  2L2O A;  4BXF A;  3HXL A;  3VR6 A;  3VYU B;  2VJ5 A;  4HIZ A;  1MMN A;  2AQE A;  4QPO A;  2VIX A;  2OC6 A;  4CCM A;  4N4O B;  1QU3 A;  1ERD A;  3OYL A;  4XKC A;  3DTI A;  4KIS A;  3VST A;  1OGO X;  3J7A Y;  4U4B A;  1PYV A;  1E1R A;  1Z3Y A;  3DKX A;  3PL8 A;  2IS2 A;  3EQN A;  2R7T A;  2KQR A;  1UD5 A;  3T53 B;  4XN0 A;  3HPH A;  1X0C A;  1D1A A;  2K3P A;  4CUG A;  2Q2E B;  2V4D A;  3H9Q A;  3DEE A;  2CW8 A;  3UNG C;  4I84 A;  2HVR A;  2WAE A;  4XLF A;  2CK3 A;  1FMW A;  2ZZQ A;  2L9N A;  4FAS D;  4BGD A;  2LBF A;  1SFK A;  1NRK A;  3BC9 A;  1JRG A;  3DLA A;  3ZSC A;  2RNG A;  4CZC A;  2WAF A;  3IUO A;  4OZY A;  2WB1 A;  2D3L A;  2UV1 A;  3OEH A;  2VL8 A;  3B8Y A;  3CZ6 A;  1GLN A;  3KEY A;  1PLU A;  3LMM A;  2AQF A;  2CUJ A;  3FBN B;  3I3L A;  3OYN A;  4C2L A;  2DOA A;  3HC7 A;  1IRX A;  4BU2 A;  3L2R A;  1QHH D;  1WTH D;  1MMA A;  3EPZ A;  4B3X A;  2IXS A;  2Z8G A;  4NNJ A;  3GQA A;  4B47 A;  3B90 A;  5LD2 C;  3DKY A;  4JOM A;  4NUB A;  1G8X A;  2XC7 A;  4HNU A;  4TT3 A;  2LBF B;  5KNL A;  2M7A A;  1XG2 A;  1X1A A;  3RTR A;  2R7Q A;  3FKJ A;  2HPI A;  2X6X A;  1V0E A;  4XD7 A;  3NE5 B;  3WQZ A;  2K9M A;  2BVM A;  4FET A;  1OFM A;  3AFH A;  3B4N A;  1KON A;  5HNH A;  2WA0 A;  2E60 A;  3BCD A;  2ELJ A;  2X1E A;  4BQQ A;  1WJ5 A;  2D3N A;  4C2U A;  4HNT A;  4H4K C;  4U7B A;  1YE9 A;  4RLQ A;  2KPM A;  3EUH C;  4J01 A;  1DQU A;  4U87 A;  1DGW Y;  3SDB A;  2LRD A;  1SKY B;  2XZL A;  4KKT A;  1RWR A;  1X1D A;  2VQH A;  3MKY B;  3BCF A;  2FUG 2;  3QYB A;  4D1Q A;  4C9Y A;  4PJM A;  1E1Q A;  2PJR A;  4KT6 A;  3F9K A;  3QYF A;  1ZEL A;  2V31 A;  2KHM A;  3EUK L;  4OAZ A;  2HVS A;  4BJ5 C;  3ZIA A;  2E1M B;  2GOM A;  3OYA A;  2Y0S A;  3A35 A;  1X4P A;  5C1C A;  3ZR8 X;  4F92 B;  2R7W A;  2X3H A;  4W8Q A;  2LOO A;  4KKU A;  3K4L A;  2NTB A;  4CH7 A;  4IKF A;  2QE7 A;  4BAC A;  1YX3 A;  4XKB A;  1K6Y A;  1UD3 A;  4Y4R A;  2V1N A;  2F4I A;  4ASU A;  1LVK A;  4JMQ A;  3EQO A;  3CP8 A;  2R7R A;  2PJR B;  3TMO A;  3H0D A;  1N77 A;  1NHC A;  1UG0 A;  2X1C A;  1UD8 A;  4CA0 A;  1X19 A;  1KMH A;  2BW3 A;  4DNT B;  4G6T B;  2KL4 A;  2HNH A;  3LSI A;  3W3C A;  2IQ7 A;  2WY8 Q;  2HLD A;  3KRG A;  4URR A;  1O8F A;  2K5C A;  1WJA A;  3H5A A;  4XM3 A;  4C30 A;  3CJR B;  1WMR A;  1BHE A;  5HKK A;  4E7H A;  3QOE A;  2LG4 A;  4Y3O A;  3GQB A;  2X6Y A;  4JQF A;  2IGN A;  2RQQ A;  2CS3 A;  1S9H A;  1UEL B;  2DXI A;  4W8T A;  3S93 A;  2X51 A;  2OV7 A;  2XF6 A;  2JA2 A;  2LY1 A;  3VWB A;  3FPP A;  1OLT A;  3AL0 C;  3C2H A;  4B3F X;  3LSG A;  3E1S A;  2BW3 B;  2HDW A;  4Z03 A;  3BG6 A;  3OYJ A;  1P9Q C;  3SZG A;  4XOT A;  4DGW B;  4MXN A;  3LNN A;  3K4K A;  3OYD A;  4E7I A;  1AA7 A;  3BCA A;  3NWS A;  1MND A;  2K9L A;  2ZTN A;  4L8J A;  2HQA A;  4ZTJ A;  3IP4 B;  4D9J A;  1BLI A;  3GVL A;  3G2B A;  2IGK A;  4KJZ A;  4XLE A;  3OAA A;  4GRI A;  4OJL A;  1N75 A;  3H5R A;  4RMN A;  4BS9 A;  3OY9 A;  4OJO A;  2QY1 A;  5CQE A;  1OFL A;  1K5C A;  4UZU A;  1QCX A;  2WAQ A;  3RSN A;  2Q1Z B;  2X53 S;  3KYL A;  1WJC A;  2VKD A;  1TT0 A;  2R7U A;  5HLT A;  3ONQ A;  2GJK A;  4YXW A;  2GK6 A;  4HPQ A;  2MC4 A;  2MAB A;  3PFY A;  2HVQ A;  1W36 C;  2KVO A;  2O1D A;  3OYF A;  3LMW A;  2CH0 A;  2XDV A;  4KIT B;  1BPL A;  2XZP A;  4TSF A;  3H9G A;  3CF2 A;  4MLO A;  3SEZ A;  1O8G A;  3JU4 A;  2XZO A;  3K4N A;  3UR3 C;  4OAY A;  3K70 C;  2L5Q A;  1UD2 A;  2R7V A;  5CKT A;  4TKO B;  4N4N B;  3WWG A;  2O5R A;  4BUP A;  3LL7 A;  1UD4 A;  2NSP A;  1WJF A;  2Z1D A;  2ZSI B;  3HL2 A;  4OJP A;  1W0K A;  3OPO A;  3V42 A;  3VYT B;  3HKZ A;  1O8L A;  2VJI A;  4LIT A;  3S8P A;  3A1Y A;  4XON A;  4AVZ A;  3RPU D;  4EAT A;  1DBO A;  2A6T A;  3CMM A;  2M5S A;  2PYH A;  4BJT A;  3GRH A;  4ZDP A;  2UVF A;  4W8R A;  2JUG A;  3OOC A;  4BE2 A;  3PNT A;  2PMZ A;  4II3 A;  2Z2S B;  2PEC A;  2X1D A;  1E3Z A;  2O0W A;  3DWL E;  4AYB A;  2GJR A;  3PNV A;  3OYG A;  4B43 A;  2V7Q A;  2ZTG A;  2R7X A;  2DT6 A;  2VAS A;  3UW0 A;  2LC2 A;  2XF5 A;  4BL0 B;  4DK0 A;  2VLA A;  3OYK A;  4LIV A;  4BE1 A;  1WJB A;  4XQF A;  2VQG A;  4BDZ A;  4Z06 A;  4EW9 A;  1D1C A;  3MKZ A;  2VXD A;  3JUR A;  1QHG A;  2NTQ A;  2JSP A;  4ZDL A;  2O0V A;  2P0W A;  1X4O A;  4XLH A;  4HSR A;  4G6I A;  5KCM A;  1UAA A;  3ZXS A;  3OYB A;  1V0F A;  5HNF A;  2KRC A;  1BMF A;  3GQ9 A;  3IAS 2;  4F3Q A;  1VF7 A;  2WBM A;  1HVX A;  4XMY A;  2INV A;  2E1M C;  2F43 A;  4CCJ A;  3G05 A;  1VBL A;  4IZZ A;  2CV0 A;  4B48 A;  1Z3X A;  2UUZ A;  3BLY A;  4RM3 A;  4YRV A;  1HG8 A;  3T9G A;  3T51 B;  2IGO A;  1E43 A;  3BCB A;  4HG2 A;  1COW A;  2L9S A;  2L7K A;  4PSX A;  2CUZ A;  3S3O A;  3W2A A;  3GQ8 A;  4OJ5 A;  3OS1 A;  1G59 A;  3M1C A;  5DN6 A;  4NC7 A;  2CMP A;  1BR2 A;  4OWR B;  4XKV A;  3K6G A;  3ZRG A;  4DJA A;  3DDY A;  3S32 A;  4NK6 A;  1PE9 A;  4CCN A;  3K4C A;  1O88 A;  2VQC A;  1KTW A;  2XOK A;  5KHD A;  4E7L A;  2QKM B;  2KLO A;  1LFP A;  1O8M A;  2W4S A;  4J00 A;  2CFO A;  1VLY A;  2Z16 A;  2WY7 Q;  3FBI B;  2F5V A;  2VBK A;  3VSU A;  4HEA 2;  3A4C A;  4XL9 A;  3A3G A;  1HZE A;  2E1B A;  3BH4 A;  5FRO A;  2W6J A;  1JTA A;  4IQ4 A;  3OEE A;  1RMG A;  5TGT A;  2GJP A;  3FHN A;  3HOS A;  2KRH A;  4DNR B;  4Y33 A;  1V5G A;  1V5F A;  3DU5 A;  3OR1 C;  4CCO A;  3L2W A;  3DTE A;  4IX7 A;  3LSM A;  1W36 D;  3PJR A;  1AIR A;  2WJV A;  1H80 A;  4NC8 A;  3NWT A;  4E7K A;  2VBE A;  1MMG A;  4YZQ A;  4F91 B;  2UWM A;  4CCL A;  3RQ4 A;  4G7W A;  2RRE A;  4XKW A;  2DJI A;  3OMY A;  3OOU A;  4XOP A;  3SYT A;  1OB0 A;  2QX3 A;  1E0E A;  2MYS A;  1QJV A;  1GQ8 A;  3ZQQ A;  1YX5 A;  2V4J C;  5LFA A;  1LKX A;  3OIQ A;  1X1B A;  3D5S C;  4P5O A;  2F6C A;  1U0J A;  2MFZ A;  1VJS A;  2NZM A;  3DPU A;  2ZXI A;  2CV1 A;  3FKS A;  2HPM A;  4HRI A;  4ZDO A;  1EFR A;  4ZTF A;  2GOX B;  1I18 A;  4XNF A;  1O8E A;  2VKH A;  3ZPN A;  2GK7 A;  3GQ7 A;  2VQL A;  1I8D A;  4XOR A;  2ZXH A;  2V26 A;  3K10 A;  3LSH A;  3K4J A;  3VSK A;  3H5N A;  2IS4 A;  4LIU A;  4ZYA A;  1KZL A;  2WSS A;  2VBM A;  4BJ6 C;  2LRE A;  3PNY A;  4F93 B;  2WJY A;  4ZJZ A;  4U49 A;  3SUC A;  2E5N A;  2X6W A;  2W82 A;  3MMY B;  3PSI A;  4NQW B;  3OS2 A;  5CQG A;  2NST A;  3DPT A;  2KZV A;  3LSK A;  3N05 A;  1CZF A;  2HU9 A;  3OS0 A;  1OOC A;  2ZSH B;  1OHH A;  3D5L A;  3TBI A;  3BG7 A;  2LYC A;  1FMV A;  4KKS A;  1BOB A;  3L2U A;  1MNE A;  3QOD A;  2DCE A;  4PMH A;  4GQN A;  2BOL A;  3HG9 A;  2W1O A;  3W2V A;  3OW7 A;  1X1C A;  2PYG A;  2OUM A;  4YZX A;  4P22 A;  4PJL A;  1BN8 A;  3BC8 A;  4E6K G;  1N78 A;  5FRN A;  1WFX A;  3CES A;  3OL4 A;  4E7Z A;  2ODL A;  1DP3 A;  1DBG A;  2ZFU A;  4PFO A;  3DTK A;  3OE7 A;  3GVJ A;  1PXZ A;  1LDK B;  4HWV A;  4PJN A;  3K4M A;  3KEW A;  4RLF A;  3HAG A;  2XND A;  4AU7 A;  3M8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...