4XN3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 227
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn3A02
1O8LA 4XMYA 1OOCA 3LMWA 1EE6A 4YZXA 3SUCA 1XG2A 3B90A 3GQ9A 1VBLA 2ODLA 2X3HA 4EW9A 4XM3A 4XN3A 2QXZA 2QX3A 2X6XA 3VSUA 3EQOA 2X85A 4XLHA 4C2LA 3KRGA 4MXNA 3GRHA 2IQ7A 4XOPA 2NT6A 3GQ7A 4OJ5A 1RU4A 2NTPA 4OJPA 2UVFA 4W8TA 1O8KA 2INVA 2X6WA 3VSVA 2VBKA 3FY3A 4OJLA 1O88A 1AIRA 4XR6A 2NTQA 4Z05A 2BSPA 1PE9A 3B4NA 1X0CA 4YZ0A 3GQ8A 4XLFA 1OGOX 2Z8GA 4HWVA 4MR0A 2O0WA 4XKWA 4XORA 4Z06A 1QCXA 1QJVA 1NHCA 1KCCA 4YELA 3WWGA 1DBOA 2NZMA 4NK8A 4AVZA 1O8JA 1IB4A 4YZQA 4XLAA 2NSPA 3JURA 3VMVA 1O8FA 4OZZA 2VBEA 2VJIA 4OZYA 4OJOA 4XLCA 4XKVA 1OFMA 1PLUA 3GQAA 1BHEA 2O17A 2UVEA 2NT9A 1KCDA 1BN8A 1HG8A 4XONA 1OFLA 1KTWA 1WMRA 2PYGA 1K5CA 1O8HA 3ZSCA 4W8SA 4XQFA 4I84A 2INUA 3UW0A 1DBGA 4XLEA 4URRA 4YZAA 2NSTA 1JTAA 2PECA 4PMHA 1IDJA 4U49A 4XL9A 4XN0A 2QY1A 2NTBA 3B8YA 5C1EA 2O04A 4XOTA 2X6YA 1IA5A 2O0VA 2EWEA 4W8RA 4NK6A 3VMWA 2VBMA 2O1DA 4YEJA 3EQNA 1O8IA 2VJJA 4Z03A 1GQ8A 1RWRA 1O8GA 4W8QA 1O8MA 1RMGA 1CZFA 4U4BA 1O8DA 5C1CA 1O8EA 3VSTA 1JRGA 2PYHA 1IDKA 4OJ6A 3ZPPA 5AMVA 4XNFA 1H80A 1PXZA 3T9GA 1OGMX
chains in the Genus database with same CATH superfamily
1IAWA 2PEXA 2DIEA 4MTEA 3H09A 1AWCA 1VQ4I 2W4SA 3HOZJ 3ZMVA 4HLXA 1WH5A 1WJEA 1D0XA 3REOA 2X6XA 2GJPA 1LNWA 4PC3A 1XGSA 5DCMB 3DPLC 1RRJA 2A05A 2E60A 2KRFA 1ZELA 4A93J 2XT2A 2WAFA 5CVIA 1WORA 2OBRA 3GQ7A 1JGGA 2QQBA 3IUOA 4NUBA 3M3YJ 2IAIA 3VWBA 1KD1D 3IL2A 3HSEA 1D8TA 2EA2A 2XZPA 1UHMA 3FMSA 4K2EA 1LFBA 3JAMK 5F1JA 2MLKA 5IYDJ 2EFPA 4QPQA 3TEDA 1W0KA 2XGEA 3M7GA 3QYBA 4XRFA 2VT2A 1DDIA 3GLLA 5D8KB 3CF5F 2H09A 2V7TA 4XLPF 4A3IJ 2PMDA 1YG2A 1YIJI 2H27A 4TMTA 5GV8A 2F6CA 2W57A 4J01A 1P7IA 4N4NB 4FCYA 5TR9A 3V8KA 2W85A 4Z4WA 1TTTA 4WX9A 1FX0A 2ZJQF 1YLOA 1B4AA 2F4MB 2LY2A 1S5LC 4HQMA 4MGRA 5LGUA 3KP3A 2W82A 1O57A 3K0LA 1YJWB 1KCCA 3DQVC 3ZC3A 3W2HA 4XBFA 3VNUA 1A6IA 1OJLA 2PN6A 2XPUA 3F3XA 3ROUA 4YFXF 2W84A 1ZR4A 3F8MA 2R5YA 1MSEC 3SZGA 3JRBA 4LJZF 1G59A 4YAWA 1KZHA 1K83J 2FBKA 1WJCA 2ZJ2A 1KU3A 4OOIA 2EFQA 4A0YA 1BC8C 1VQNI 3OR2C 4R1HA 5FO0A 2O17A 2L2OA 1BOBA 4XONA 5A2QZ 5K7HA 2HZTA 2WR8A 2P5VA 3LL7A 1OYWA 2QQ9A 4YG2F 2K86A 2O9LA 2WZPP 3V7CA 2DA7A 3GVAA 1D2EA 1EJ9A 4KUMA 2OA4A 1ACIA 2INUA 4KMFA 1Z05A 2QYOA 4BKXA 1OMIA 2IS6A 2M5SA 1YX5A 2XNCA 4G1BA 5E1XA 4P12A 2QVOA 2STWA 2NSTA 2NVTJ 3BY2A 1QFJA 2XRLA 4G7OF 3CW2A 1AIPA 4U49A 1ULYA 1UZCA 4YIIA 2P81A 2XNJA 2EIJH 1KONA 3GVLA 4Y7NJ 2RN7A 1OYYA 4QUZA 5CLSA 3IKTA 5FL7A 2J7KA 2HPMA 3LAJA 2QEXI 2Y31A 2YX4A 5DCMA 1KRHA 2QQAA 1TUIA 3A8KA 2VC1A 1K7AA 3D0SA 2A6TA 2QSHX 2V1UA 3HRTA 3M4OJ 2VBMA 4RB3C 3ZPNA 2F5DA 4LG0B 2IW5A 4RAFA 3L9FA 1HA8A 1VF7A 2X1EA 2FMLA 3MFKA 3DU1X 4HDUA 2OBPA 1H8HA 2Y9YA 4IRHA 1KQ8A 3KL9A 4RMNA 4CCOA 4RDUA 5J35A 1H42A 2QENA 2QYUA 3OYHA 1UAAA 1XTAA 3MCZA 3RI4A 1VLOA 4D5CA 1IV8A 1Q81D 1EE6A 3RIRA 3QE2A 3HAGA 4C9YA 3DTKA 1IN7A 1WPKA 1RC9A 2EWNA 3QP6A 1IV6A 2L9RA 4XIDA 1K8FA 3LSRA 2O03A 2DOGA 3Q9SA 1MMGA 3DKYA 3SEQA 1X3WB 2L9VA 4J00A 2H6CA 3ZQGA 5HZBA 1KU9A 4CGZA 1WP6A 4MO7A 3U2QA 2HQRA 3OPOA 3F21A 1DP7P 3OYDA 1W7PB 3N05A 2D74A 2DDAA 1BN5A 3CC7B 2LTPA 4U9UA 2R92J 2O8XA 3JR9A 5AN9A 1ETKA 1X3ZB 1X4OA 4WXDA 5HDKA 1ZRCA 2CQXA 1XN7A 1O3RA 3CCVB 1XMAA 1OCZH 1ZREA 3BG5A 2KJCA 2DEUA 2P7CB 3WBKA 2LREA 4PGOA 2MABA 3ASOH 4XKWA 3HTSB 2CC2A 2KDZA 1JTYA 2HDDA 1ZRDA 1OFDA 1RI7A 2NNYA 1XE1A 3JQPA 5E3NA 3GWZA 4Q47A 3OEEA 1FSEA 2FU4A 3E6MA 3KE2A 3VDXA 3WU0A 3HRUA 5JVGF 2V9KA 4E0FA 4RCYA 3HHHA 3VMVA 1YFHA 1Z3YA 1HCRA 4N3NA 4UHTA 4OZZA 1FBSA 2I8DA 3UKGA 2X1CA 5C44J 3ZQFA 1IN8A 1TNTA 5B66C 3CPWB 3PQKA 5ILVA 5IYWA 1BI1A 1BN8A 2FX0A 2QF7A 2PI0A 2W00A 2EA4A 2XB0X 1HKTA 3CMEB 4ITVA 1N08A 5FFZA 1KTWA 2DT6A 1O7LA 3VYUB 4F3QA 4G6DA 3OYEA 1K4ZA 1NJID 4M72A 3E5XA 3W3CA 3WTZA 3WTWC 2DCUA 2P6TA 2DJNA 3CCEI 1T6YA 3KP4A 5IT3A 2X53S 4P6YA 1G7RA 3H94A 3UW0A 2KP6A 2PLFA 2ZB9A 3CCUB 4ESJA 1S8NA 1U5TC 3BG3A 2CW0F 3D5RC 1GHCA 1Z7LA 4UVCA 1G7SA 1DARA 1E43A 4JOMA 5FKKA 4YXWA 2EFOA 4Z4ZA 1AHDP 3HTUA 3IWZA 3RKXA 1D5YA 2WV1A 4CXFA 2A07F 1YRNA 3KEQA 3PO3J 3FM3A 4XOTA 1S3JA 1T0FC 2X6YA 4GFBA 4B3GA 5FKOA 1UJ8A 4ZDOA 3TKYA 4ZGNB 3K10A 3DCFA 2HNHA 2K4BA 2IGKA 4HLYA 3AG4H 1IDYA 2UXNA 2VBTA 2JRTA 5E3LA 2O1DA 2HQAA 3CCMB 5FNZA 1ZGJA 5K7FA 4NNJA 4ZYAA 4OIOF 5HNHA 3H36A 4F55A 3HOVJ 1UD6A 1V55H 3NAUA 4G5GA 4R71A 3CP8A 1FMVA 3UNGC 3F8NA 2VC0A 2K3PA 3RQIA 3SFIA 1TYWA 2O0WA 3HPGA 4Z1MA 1PUFB 1O8LA 4KISA 1OKRA 1YLFA 5D4SA 2DA1A 2R6HA 2RAEA 1VQ7B 3RPQA 5IP9J 1VFCA 4DK1A 3S17J 2E1MC 4WZEA 1GO2A 5KW9A 1TSPA 3GQ9A 4KT6A 3M8EA 2OBSA 3EUHA 3WY9A 1T8IA 5F1RA 1W2BB 3ZN1A 3F0CA 2QX3A 2X85A 1OQYA 4RLFA 4M3FA 4C2LA 3A3BA 2V7VA 4G6TB 5FD5A 5J3OA 1YJNB 2BXZA 2D2WA 4DQ2A 4L9NA 3KEYA 2I1LA 3SJZA 1P4WA 3B6CA 4GYIA 1R6RA 2INVA 2KDOA 3LNQA 2CG4A 5KK1A 3S16J 1F20A 3F8FA 1R5BA 1IXCA 3V42A 3OS0A 1OLTA 2JSPA 3BCAA 4HNUA 5E3MA 3OFNA 4B3FX 3I59B 4I7HA 2EIMH 1EP1B 2EIKH 3QODA 4EV0A 2V7WA 3LFUA 2LF8A 3J7ZI 1DUXC 1YS7A 3CUQB 4XK4A 2GPJA 4Q7JB 4X7CA 4S04A 4FHTA 2A5YB 1ORKA 2PIAA 2VPRA 2BM4A 3RPUA 2HYGD 3WYAA 2DA3A 2EFWA 3S15J 4BHCA 1W87A 2V31A 1RPWA 4KITB 3AL0B 1VHEA 3OYAA 4ZYEA 4P9UA 5JLVC 4S05A 1T95A 2Z16A 2L7MP 3RKYA 3ABLH 3FXQA 1PYVA 5JI6A 3ZOBA 1PUFA 1QGPA 2V6CA 1K4TA 1IJFA 4WZKA 4YZQA 2IGNA 4ZC3A 2GAUA 3VEPA 5E17F 1OYIA 1BOAA 1QUFA 2C4TA 1YIOA 2E2JJ 5BNGA 2QA4B 1NHAA 2XGCA 3NQOA 3CCSB 1MBJA 2CW7A 3AVTA 1KYZA 5J4VA 4KDPA 2BOLA 1R1TA 4HX4A 1W35A 2X8KA 2LFBA 3G05A 2PJRB 1N25A 5CQEA 4EGYA 1XSXA 4RGRA 2W1OA 2FF4A 1WJFA 2HZDA 5HLTA 2DY1A 3GZ5A 4I0BA 5HS8A 1IG7A 1UHWA 5HLHA 4N9HA 1LUJB 3GBGA 3ZMZA 4I99C 1AU7A 3I4NJ 2NV4A 2OK8A 4YHBA 3LQ6A 1VQ6B 1O8HA 3WNBA 3JTGA 1R36A 5BMZA 1IRGA 1DBGA 3HUGA 3A8IA 4ZJZA 1D1AA 2EIXA 1W5CC 1FX7A 3K9TA 4LLGF 2OBTA 4WZLA 3VR6A 3HOWJ 2P3MA 3SYJA 1JJ6C 1ETOA 3BC9A 4KYWA 3TOAA 1OCTC 2IA2A 2FQ4A 4DYQA 2O04A 2A3SA 3VYTB 1FNMA 3V8JA 2V7FA 3BG9A 4A12A 3QFSA 1TQMA 2DW4A 4RBOA 3HRMA 2R7WA 1SFUA 3BR5A 5E1WA 4UUSA 5CVJA 1BW6A 3HGYA 3OY9A 4ZCIA 3P5JA 3OYNA 2YWFA 1UG0A 2ELHA 2R7QA 1Y0YA 3O3KA 3DKWA 1ZLKA 1I6HJ 2XF6A 2M4KA 3GEZA 1MMAA 2EV0A 1D8KA 1KK1A 2ZXIA 5HDGA 1V54H 2KZGA 3ZR8X 2VOPA 2QZAA 3ABUA 5AMVA 2CQ7A 4XNFA 4M9XA 2YU3A 4UB6C 2JJ1A 2L9NA 4DNTB 5EZGA 3WXMA 4ANJA 1QA6A 2Y69H 4MFEA 2E71A 1MH3A 5HOOA 1EFCA 1TQIA 3KPHA 2COMA 5AIQA 3ZQHA 4UVAA 5E6TA 4ZCMA 4L5JA 2JJ7A 4LK0F 1N78A 4CUGA 1WHUA 2MFZA 5GAHJ 2DOFA 3ZCOA 1YJNI 2XZLA 3DEEA 4HPQA 2HKOA 1IGNA 2OQRA 2ZMEC 2ZMEB 3OKXA 4G6QA 2JT1A 3R6KA 4OJPA 5GP9A 4CDGA 5IOZA 3IHUA 1Z9CA 1HA3A 4DJAA 3VB2A 4LOCA 2DMNA 3CCJB 2L7ZA 1LVAA 1I3AA 3CCYA 5CVRA 2CUEA 1DPRA 4GRIA 4IF4A 2ZZEA 4B48A 3HOYJ 4Z4RA 5IYQA 1GXPA 1O88A 4M73A 3OS2A 4HDVA 3PVDA 1HC8A 3QQAA 2NTQA 5DD4A 1X1BA 4YZ0A 2W6JA 2QQ8A 4XLFA 4AU7A 1OGOX 4ABZA 4YRVA 2M45A 3R0AA 2VKEA 1QJVA 2BY3A 1D3YA 4D9JA 4Z2YA 3S8PA 3JRGA 3E1YE 3EPZA 3B8HA 2G0EA 1BI0A 3MN2A 3CC4I 3N90A 2OTJI 2O6GE 4I09A 2NSPA 2TCTA 2HKXA 2EB7A 2ICWG 1W36D 2C4UA 1O8FA 1V5EA 1L1IA 4P22A 3PNTA 3CO6C 2WAEA 3L2VA 4UUVA 2LKSA 1ETVA 2Q0OA 3BROA 3QFCA 3CCVI 3WGGA 4RM2A 2VNIA 3CDLA 2AO9A 2MC3A 5IP7J 4NQWB 1BM9A 1RQRA 1S7AA 2V9VA 1OFLA 4B1RA 2OK7A 1FOXA 3IAM2 3OAAA 1RIOH 4KA4A 3WG9A 4CZZA 1TLHB 3DF8A 3ONQA 1R4NB 1T33A 2VOOA 2O6WA 5HZAA 3HKZA 3FK6A 4IJAA 4B09A 3BJ6A 3S14J 3ZQ7A 1J0RA 1BW5A 3ZMTA 2V4JC 3H3VK 3A03A 3WODF 4HSRA 2HVQA 2MG4A 3H35A 4EJUA 4Y13A 1GR1A 3JRHA 3SDGA 2R7UA 5L3EA 4BAYA 5THXA 3A4CA 5K5OA 2M34A 1WFXA 2H1KA 2LKXA 4WZTA 5CVVA 1YTYA 2CV1A 1V0EA 2CW5A 2EZIA 3AG3H 2Z2SB 5E8GA 1OGJA 4Y3OA 4BY7J 4NK6A 5F4OA 1X1CA 3VMWA 3MEXA 1NK2P 2HR3A 3E6BA 3N4MA 1W5SA 2AXTC 3DBHB 2LYCA 3NRVA 3A35A 3GXOA 4J0QA 1IXRC 3HYIA 4HF2A 3W2FA 3P9CA 2M87A 3KCCA 3UR3C 2CK3A 3K4NA 4BU2A 4CZCA 3MKYB 2Y9ZA 3GIRA 1VQ4B 1F5TA 5K5RA 3QOPA 2VJ5A 4AC0A 1QCXA 2L54A 5HXBA 1I39A 1GAWA 2DYRH 2WY8Q 3KP5A 3HRSA 4Q4ZF 1KK3A 2K9QA 4Y4RA 1VQ9I 3OYKA 1V5VA 4TV7A 1U8BA 1XFOA 3KLOA 5EG0A 4FK8A 4P3IA 2Q1ZB 4FWTA 1GVJA 2HQ5A 3E97A 3GRHA 4L9TA 2JPCA 4N4OB 2XSJC 1TWFJ 2NT6A 1TQPA 1HDDC 3ZIAA 3W2WA 3F72A 1XMKA 1RR7A 4II3A 4YIFA 1QA1A 2PMZN 2K9MA 1U9NA 1ZYRF 3FY3A 2QDXA 2QTZA 4AIJA 1PJ6A 4Z4UA 3TBIA 4D7NA 5LGNA 2K4JA 2LBFB 1OISA 1DABA 2OUMA 3IH2A 2ZMEA 5EYRA 2V7UA 3S1NJ 4BPRA 2WWYA 4RS8A 1UD8A 4A2UA 4U0YA 1D0YA 1JT0A 3I9V2 3Q9VA 5HVQC 3K1PA 3GSIA 3R6JA 2HPIA 2QKMB 1Y1VJ 2DMUA 3O8GA 4IO9F 3OE7A 2DFEA 1K6YA 3QOEA 1R5HA 1VQKI 3PJRA 1WOPA 1UFMA 3AVXA 3JRFA 2RC6A 1SMYF 2JRMA 3SEJA 1P7JA 3QU3A 3FX3A 3ZBTA 5H6RA 2LG4A 1Z3XA 1BI2A 2DK8A 4C30A 3OEHA 1LE8B 3BNWA 5DUIA 3ZZUA 3PIOF 2VBEA 1J75A 2XTYA 1HLVA 1KGSA 4IQ4A 5FO5A 1K61A 5EGOA 3GTMJ 4P25A 4RB1A 3PSZA 1ON1A 3CD6I 1K78A 2ZO4A 4BJTA 1QNTA 5DYMA 5TY0A 1XB2A 1N8RD 3M8FA 2VL8A 4QHYA 3GTKJ 1I3QJ 2EBIA 1VQPB 3AKZA 4XSXF 3BH7B 3K2ZA 4OPOA 4PJMA 1UD5A 5HKKA 1T56A 1TW2A 1XCVA 3IKVA 4QPOA 2DA6A 2RREA 1FP1D 1CNEA 2LBFA 3IC7A 2ZL5A 2Z8GA 4I84A 4YC5A 4URRA 2OJED 4BQAA 3LJYA 2COBA 1KQSB 4HG2A 2C5HA 3ZGKA 1NB0A 1FNCA 2QCOA 2XAUA 4OPWA 2VQLA 3I55B 5J47A 1IZ1A 1S9HA 2NS0A 1YITI 2WV0A 2J8KA 2OD5A 2VONA 5A89A 1R49A 3BT9A 2PQ8A 3F8BA 2KIMA 4B8XA 1ITYA 1W9XA 1ZG1A 1ZLJA 3CMMA 4NBQA 1JI8A 1QO0D 4Y15A 3CLOA 3OSFA 2BPOA 1R9TJ 3QPSA 2DAOA 5FRNA 3S1RJ 1B8IB 2Y0SN 2M2EA 1FIAA 1QU3A 1FYLA 4HE6A 1KZLA 3J7YJ 1XCBA 1FMWA 4JX4A 3MMYB 5FKNA 5A8AA 3I56B 3RZDJ 2LZJA 3BR2A 3F23A 2PMUA 1K5CA 5C4XJ 1B59A 1ENHA 3O6BB 1TC3C 2BGCA 2WYRA 3PFIA 1Z21A 1ZQ3P 1MW7A 3FIWA 3X2QH 2FX3A 1I1SA 2ZFWA 1G7CA 5FRMA 4RAZA 4OIQF 5FKMA 4LIVA 1KJZA 4P9FA 2JA2A 3AVYA 2VN2A 4XLHA 4MXNA 1EZGA 1MMSA 4FT8A 4HEA2 2IQ7A 2VKVA 3H5NA 3K4LA 4RB2C 2HMAA 4M53A 4P2NA 3I59A 2ELJA 2JUGA 3C2BA 4MLOA 2WC2A 2AHOA 4R8HA 5IYPA 4RA2A 3VSVA 4ZYHA 4PAAA 4OWRB 2CBXA 4Y9UA 2FNAA 2V5IA 5CKTA 5IYRA 2XGDA 2M8EA 4CYCA 1W0UA 1WGXA 3KYDB 2DQLA 2M8GX 4GGGA 4CCJA 4ZYGA 1WWXA 1PP7U 2DBBA 1CF7A 1QGAA 2WSSA 4M1KA 2BBYA 2MA3A 2VNJA 3PUNA 2FD5A 1VQLB 1YW7A 2WAQA 4A3FJ 3FJOA 4HE5A 1P4AA 4XRMA 4M9ZA 5AIPA 1XG1A 4B3XA 1HDPA 5FFXA 1QBJA 3HEFA 5BQTA 2AQEA 1H85A 2VKDA 1YJ9B 1X1DA 5FD6A 3BR0A 4AVZA 1NB9A 3PQJA 3QYFA 1YO5C 1ZGAA 3U1KA 2JTVA 1R1UA 1LDJA 4AWXB 1SVMA 2MGQA 3EYIA 3HGGA 3V8LA 3ZQLA 2GXAA 4II2A 1W1WE 1QGZA 4WXCA 5M5WJ 4XLCA 1PJ7A 1NH3A 5IK2A 3ZUGA 1VQNB 1OFMA 1POGA 1KQ0A 3KZYA 4HAMA 5IT9Z 4NC6A 2CH0A 1W4MA 2J8IA 3KZZA 3U1DA 1BMFA 4RPDA 2O7OA 3RKWA 2IRFG 4N0BA 2KL4A 2NYXA 1Q9SA 4D5FA 1EFTA 2JA8J 2F43A 4P3YA 3IH4A 1YRNB 4DK0A 1AKHB 2NS7A 2EZHA 3WTTC 4XQFA 4IZZA 3JTHA 2PBIA 2DFHA 1FSHA 3W5UA 1N06A 4IXAA 1EKEA 2LD5A 1Y1WJ 3OYMA 1JTXA 1IDJA 2CNDA 2QY1A 4CO8A 2BGIA 1YYVA 1NBMA 2DFIA 2OF7A 3PA2A 2KMUA 4F92B 3J80K 3FKJA 4QFMA 1VQ5I 3G1LA 1A04A 4OMZA 4BQOA 3ASPA 3K7AJ 2CFOA 5FLMJ 3HBLA 1U8RA 4YFKF 3I4MJ 5M5XJ 3OW2B 3CUQC 5LHGA 1K9MD 4RM0A 2XTXA 5KAFC 1WPCA 3EQNA 1UD3A 2JN6A 3E0JB 2UZKA 4Z03A 1GQ8A 4DZJA 4P55A 4XSZF 1NDHA 4IL6C 1Y0NA 1O8DA 5C1CA 3T53B 2W7ZA 2JA7J 1FDRA 1IDKA 2BVNA 3WQZA 1W5TA 2CFXA 3B02A 3G2BA 3T1BA 3D26A 5LMZA 1OGMX 2KIFA 3T0YA 2X0KA 3K4BA 2I10A 3SJPA 1XDSA 1GV5A 5F6FA 2VPLA 4YALA 1HW2A 1F1ZA 4XN3A 4BE0A 5LFAA 2K3FA 2A6HF 4HV6A 1B6AA 1IN6A 2QE7A 1O3SA 2C77A 1VZ0A 4BH9A 4AYBN 3WTXC 3V7SA 3K4MA 2IXSA 4Y52J 3CJQB 1R4MB 2HTJA 3LAPA 3A1YA 4MYTA 2OAZA 4B4DA 2X6WA 3DFGA 1KQ5A 1Y56A 2XRNA 1QUEA 4LBVA 1R5OA 2A61A 3R0JA 2F48A 5BS6A 3OYFA 3D1NI 1PJ5A 2BSAA 2P7VB 1K6OA 1U6GA 1E17A 2HCJB 1T38A 3ZZ0A 4XR6A 3DXJF 1USSA 1GT0C 1UMQA 2BSPA 2M0MA 2P6SA 1MJBA 4ON0A 4M71A 3S1QJ 1J9IA 1RZ4A 4NC7A 2ISYA 3FXLA 4LIUA 4M74A 2B63J 3LA3A 3K6GA 1A5JA 1WH7A 2VASA 4Z06A 3MZYA 3RJPA 3S3NA 4L9VA 2ZXWH 2H8RA 3WNCA 1E2XA 3VO1A 2FXAA 1MDMA 2C6YA 1XDUA 5BSXA 1UD2A 2K9SA 1Z67A 1CNFA 3BCFA 2L02A 3E5UA 2LKPA 5DD8A 4EH1A 1U5TA 2VKHA 1LLWA 3MD2A 1P4MA 1JUSA 2BN4A 1QHHD 5J8FA 4LFUA 3E6DA 2VJIA 5DNSA 4BXXJ 2GJRA 1SKQA 3G3ZA 4Q5SF 1T39A 3KX2A 4LG0A 5J4YA 4X05A 5E1ZB 1USTA 3C1DA 1LM1A 2PLYA 3JX8A 2DJIA 2NT9A 2UVEA 3G73A 2G0YA 2L9SA 3TW6A 4RD6A 1KC8D 3CUQA 4B4CA 3LNNA 2D1VA 3ZQCA 1E3OC 2HOEA 5FROA 1W34A 1TWHJ 2K27A 3CQZJ 4BJ6C 2HVSA 1I1GA 2Q2EB 1SANA 1FY7A 1HW5A 2E7WA 3R60A 3CDIA 1T6XA 5KVRA 1QVFB 4YZAA 2ECCA 2MH9A 3M8JA 3PETA 4V2GA 5EJCA 1EWYA 4OM9A 3G4SI 5BPIA 1RR8C 3PM1A 1JJ2B 3OOCA 3R6SA 2Q8KA 3U2RA 3TL4X 1AKHA 2VYQA 3HSRA 3JU4A 2OV7A 3G6EI 3AG1H 2R7FA 5CQGA 3HOSA 1YI2I 4L18B 2KHMA 1E79A 2O0VA 4EQQA 3CMAB 2DMQA 1OCOH 2Q6OA 2DPUA 3P27A 3DU5A 1IN4A 3K4JA 2VQGA 1SFOJ 2CF4A 1MBFA 3BQYA 5FLVA 3P9IA 2ZL6A 2VE9A 3Q6RA 2R5YB 5ILUA 3MAJA 2HFHA 2RQQA 1QH0A 2Q6IA 1QHGA 4HW0A 3V7RA 1BJZA 5B3SH 4DW6A 1JKRC 5TGTA 4Y9RA 3SLNA 4JX6A 1NG7A 1LDDA 5TJJA 5EF6A 4PGGA 3JQRA 1MIJA 3G1OA 4A5MA 5DM6F 5L3FA 4M9SA 2NVYJ 4BDYA 1V3FA 4ZCLA 4RAGA 1F36A 2ODLA 4EW9A 3WG7H 1ZM4A 1ON2A 1ZHFA 5DDGA 3LO8A 1JKOC 4YAUA 5KAIC 1SFXA 4RLZA 4LB6B 5EMNA 3H3UA 3TOBA 2B0RA 1OB5A 2OCCH 2RNGA 1CGPA 1CF7B 3CC7I 3KLNA 4OJ5A 1B9NA 1YQAA 3PNYA 2X6OA 4EGZA 2VXZA 3M1EA 3WU2C 4E7JA 3AL0C 4L5IA 2BMWA 4W8TA 4XICA 3ES9A 1XD7A 3OZUA 4PC6A 4ASNA 3C2GA 4ZZDA 4FX4A 3S1MJ 2IBDA 4AIDA 3W6JB 3BWGA 4RAYA 2EZLA 1LQ1A 2HVRA 2X4HA 2HDWA 5JLWA 2HYFA 5KCMA 2ETHA 2GA1A 2X48A 1EFUA 4IRGA 4BGDA 5ED4A 1WSRA 1QZYA 4ZZLA 1OCRH 2M5WA 1R7JA 4Z4YA 3TDZC 2IJLA 2X0LA 3FHNA 2P5LC 1TW3A 3LQRA 4EM0B 2R5ZB 4E7HA 1LPQA 4TN1A 4P1VA 2DA5A 4DNCA 4X8IA 1VLYA 4E4HA 4G7WA 4PUSA 2BHYA 1XC5A 3TP3A 4CCLA 4GQNA 4OZYA 3M9AA 3A02A 1EFRA 3OP1A 1U78A 5F4JA 2CJJA 2XKPA 2ZNZA 3BTJA 3VOEA 1W36C 3ONYA 1WOOA 3S2HJ 4PZJA 2XF5A 1I6XA 1RUNA 4M0LA 2A69F 2ZITA 2EJRA 2L0KA 4N3GA 5D5UB 1LB2A 3EDPA 3RZOJ 1BX1A 1MBEA 1KMHA 3ZSCA 2ZBUA 3OR1C 3HHGA 4MTDA 2P8TA 1R00A 4D1QA 3P26A 1JNYA 2BM5A 2STTA 2HXIA 2DK5A 3HSFA 1BIAA 1V5GA 2CO5A 2C2WA 2R4GA 1A8PA 2F5FA 1QZZA 4Z4TA 4YCQA 1XB4A 2D1HA 3W2IA 3TW7A 1DDNA 3VMFA 1HVXA 1R71A 2JPBA 3SYTA 4BQQA 3GTOJ 1G4DA 3GTGJ 2HU9A 4RD4A 4P6VF 4Y17A 2R9VA 1J2XA 4RD3A 1YI2B 1E64A 3JAMZ 1IJWC 3BTIA 4AIHA 1X2MA 4M4SA 1TTYA 1R5ID 2HOTA 4BS9A 1VQ6I 1FPQA 1QRYA 2LC2A 3Q0VA 1WJDA 3DP7A 4KIFA 3H0GJ 4AYBA 5KHDA 2L5QA 4YFOA 2UXXA 4O3MA 1S72B 1U3EM 1LE8A 4PFPA 3SEZA 4XRSA 3T5XA 2L4MA 2HXOA 3KP2A 3VYSB 1QA3A 1YX3A 2GM4A 2KZVA 4CICA 1COWA 3OWTA 4C3IJ 3LQQA 1OOCA 4HZFA 4BYYA 3CCLB 5KSWB 2R5ZA 4PJLA 5ICFA 4IHYA 2VE8A 2DOEA 2PG4A 3AAFA 1PVEA 2XGXA 2MBFA 2X3UA 4TMXA 4U88A 2L7FP 3CXCB 3H9GA 4JX5A 5HS7A 3RYPA 1U2WA 2VBVA 4M2LA 2W6IA 3KRGA 3FDYA 2DQRA 3ZZTA 4I02A 2YUHA 4A6DA 3OYGA 4J19A 1B23P 1FIPA 2KRCA 1SD7A 5K5QA 3W6VA 1H9GA 3OZVA 1FEXA 4ENNA 4LK1F 2JIZA 3AFHA 1SMTA 2LMDA 1BI3A 1XGMA 3SQVA 1UELB 5K1YA 4KN4X 2Y2ZA 3ZMUA 2Q6KA 3QWLA 3BZCA 5JFRA 2RGVA 3JRAA 2DA4A 1AIRA 1T5EA 2OTJB 1HKSA 2KPMA 2R7SA 1Z7UA 1NRKA 2UUZA 2EQRA 4XLNF 2UV1A 4IHWA 3SHFA 3B82A 3MZHA 4C3JJ 4ACBA 1I50J 5HDNA 2HOSA 1MNEA 4AF7A 2EZKA 3QSYA 2RKHA 2TDXA 3OYLA 2EV6A 4E7SA 3CCQI 1QPMA 4B43A 1CQXA 4IX7A 4BBSJ 4HBLA 5F0FA 3CLQA 4DBQA 1UMKA 3DU6A 3FKIJ 5GAEJ 4YAOA 2HQNA 3HM5A 4B47A 1O8JA 1ZG3A 1VQ5B 5L3BA 4PJ0C 3LSHA 3NWTA 2E2HJ 1D1NA 2L01A 4JK1X 1JT6A 2VODA 2V1XA 3CTAA 3U21A 4NB5A 2GIVA 4XKVA 4LLLA 2L3DA 4KMUX 3Q6QA 4UZEA 2V26A 2W25A 1BL0A 2LF7A 3ASSA 3ASQA 5TV2A 3PSFA 4FXUA 1ZK8A 2BW3B 2ZXJA 3GTLJ 3FBIB 4PJNA 4L0ZB 1S7EA 5CYVA 3A01B 3KIOA 2DFFA 5TISC 3QFTA 4MIMA 2WAQN 3GW2A 4G7ZF 2ZFUA 4CYCB 1K8AD 2E1OA 1IUYA 3KEOA 1J59A 2QMUA 1LVKA 3C3WA 3ISPA 2R7TA 3IRQA 3COAC 2BGJA 1H0MA 4HYEA 4P9SA 3DPTA 2KVOA 3CPXA 1GUUA 3LSPA 1BR4A 1N0VC 2CV2A 2JDIA 2XEXA 4ZDLA 2XAGA 2ID3A 3BJOA 3NARA 4IPAA 4HF1A 2HDCA 4UZFA 2K7LA 1MD0A 1O4XA 1IA5A 5K7ZA 3U9GA 3GFLA 4CCNA 4NQWA 1J5YA 1SC7A 4KKTA 1JHHA 4PJJA 2W7NA 4MYUA 3QYEA 4Y7CA 3CCUI 3ZQQA 3CJRB 3PUMA 1BX0A 1EV7A 3K4CA 3FPPA 4YAFA 2VUMJ 2BM0A 2E7XA 3FBNB 1VJSA 4W8QA 4P96A 3WHBA 4RD0A 1YS6A 1GVDA 2M7AA 4MNUA 3GVJA 2EPFA 2A5WA 1JRGA 2R7RA 1U5TB 1K79A 2FVGA 2QGGA 2PYHA 4Z6YA 4OJ6A 2D3NA 1J09A 2ADUA 2EV5A 4HF0A 5IY5H 2PE3A 3T9GA 4BQNA 3S3OA 2DA2A 1P4XA 3K4KA 1MDMB 1DDGA 3I71A 4QWQA 4EVIA 1WSUA 2X3HA 1WVRA 1ZH5A 4A3KJ 1WOSA 3VSUA 2ZTNA 2CYYA 1WXRA 4HQEA 1LEAA 2EK5A 1FP2A 2B9SA 3GTJJ 3DV8A 2YWEA 2DMPA 4XRSG 4XOPA 1P9QC 3W2AA 2R7ZJ 2NTPA 2CUJA 2G9WA 3GZNB 3BCDA 1ELOA 3PUBA 1OGIA 1U9OA 1KYWA 3OYIA 2HS5A 2KT0A 5CVUA 3BY1A 1WI3A 2ESNA 1BJAA 5DEQA 3SY2A 2PFBA 4OINF 4I0AA 1BA5A 2V7XA 3H9NA 5CDFA 1L0OC 5FGMA 1NTCA 1ETQA 3L2UA 4ENMA 1G3WA 1C0WA 2A68F 2GK6A 3GQ8A 3S2WA 2OZUA 4XD7A 4N9IA 3CCQB 2GXBA 2JJ2A 3I0TA 2NNNA 4L0YB 2JVGA 2IA1A 5D4RA 4EATA 4YELA 1LFUP 1H8AC 2K02A 2CS3A 1IJEA 3Q3AA 4Q48A 5J1UA 3I56I 2XGJA 4JMQA 2K9LA 4I98B 3GQBA 3W5VA 2KISA 3PNVA 2DETA 3K1MA 4RLQA 2H1LA 2JSCA 2MLGA 1MMNA 4OJOA 3RPUD 1FNBA 3FK7A 5DV5A 2W24A 3LFKA 4Y33A 1UHSA 5J40A 2BE5F 4TMVA 3DTIA 1BHEA 5L3DA 3VFZA 3J81Z 1HG8A 3RSNA 3N6ZA 3H92A 1S0UA 1WMRA 1FC3A 4IEJA 3A3GA 3HG9A 4UY8I 1TP4A 4AD9A 3OJWA 3FKSA 1G3TA 4PC2A 4EEFG 1BIBA 2H94A 4DYRA 2HOAA 5TRDA 5IPAA 5EEGA 1IO2A 4W1UA 1AMOA 2XZOA 1RQPA 4FETA 1OR7C 3LSGA 1JKQC 4O5VA 3QU6A 2P4WA 4ZGQB 2LK2A 5JR3A 2NOGA 2D45A 4QIWN 1YHQI 4OIRF 3DLLF 3A8JA 2ELKA 2KJBA 2HWVA 1TYUA 1N75A 2V1DA 2DLLA 1XPXA 2DXIA 3WNDA 3BQJA 4IHXA 1LJ9A 1MMDA 1FZPB 4C2TA 2X9DA 3H9JA 3JCUC 4ASUA 1MJAA 2CSOA 2NVXJ 4OIPF 5J3LA 1P92A 1O8IA 1RWRA 3BR6A 4P26A 3ABKH 1UG2A 5EEAA 1FBUA 1RMGA 3VSTA 3W2VA 4ESFA 1GVHA 2ZKZA 2AXLA 2BVMA 2R0QC 1FTZA 3OYCA 1N77A 2ISZA 4UAJA 2QUFA 1HSTA 3KETA 3L2WA 1K28D 2F1MA 2EFNA 2PX9A 3ONUA 1A6QA 1G3YA 1YE9A 2KIQA 3NEUA 2QBYA 1KA8A 3HOXJ 3B6AA 3AGPA 3RDIA 1VBLA 1FBQA 3BLYA 2LVSA 1QQ1A 1J7KA 1X2NA 3BPXA 3MWMA 5LRRA 2Q6LA 1X1AA 2QGUA 3B73A 1BBYA 1TVCA 5F0CA 2GQQA 4MHGA 1LEBA 2QZ8A 4GDFA 1EH8A 1YJWI 2XOKA 3GZ6A 1HSJA 2E19A 1JUMA 1SVOA 2ZJPF 1LLZA 4YDTA 1MRZA 4FE4A 2ZXHA 3FXMA 4OAZA 2FJ1A 1Y6IA 2BY2A 1S72I 1VQMB 1S29A 2VBKA 2BF4A 2WPDA 2HLDA 1R22A 3PUFA 4HNTA 3KP6A 2ID6A 3EETA 5D5XB 4FASD 2BM7A 4X0GA 3BH6B 4Z05A 2MD5A 3ABTA 1LKXA 2EH3A 3HC7A 3BZ6A 5M3MJ 4PABA 5B6IA 4MR0A 2CV0A 1YW8A 3J7AO 1NHCA 3I1FA 3KYLA 3T56B 2Z5UA 2X1DA 3GLXA 1VHOA 2YPRA 2XAJA 2E1RA 4CCKA 4CH7A 5GADJ 2WY7Q 5DN6A 2ZZQA 1FNNA 4PCQA 2M4GA 3A2KA 3PENA 3H5RA 5DSZA 2LSOA 5JVTA 4X7DA 3ZN0A 4ENKA 1DU6A 2CWEA 1V0FA 1VQKB 2MYSA 4I6ZA 2XAFA 3NAWA 1TNSA 4WK8F 5E18F 4IOAF 2XNDA 4X07A 3MKLA 4H9GA 4M6VA 1A35A 1FT9A 3CJTB 4ZTJA 1H9TA 3ML3A 3OZWA 2MW8A 3GFJA 5IT9K 1ZAOA 2DMTA 1RKWA 5ICEA 2XC1A 2MH2A 1X1PA 2YUSA 4JBAA 4QVJA 4ZTFA 1HXDA 1E0EA 2E35A 1W7PD 3OS1A 2VT3A 1U0JA 3ZQIA 1LDKB 6PAXA 4A3BJ 5D6FA 3JRDA 2VQCA 3GMEA 2LY9A 2WA0A 4HOBA 2GJKA 4OOXA 2E1BA 1QRBA 3S2DJ 4MQVA 5ICCA 3ZP5A 2YS9A 3GTPJ 1ONVA 3DTEA 2IS4A 2Y48A 3IRRA 2O0YA 2BHZA 2Y0MA 4DOZA 3BH4A 3R61A 3LOCA 4LGWA 1ZM2A 3GO5A 4BNCA 1OHHA 3I53A 4NBSA 4PSXA 2NPFA 4BL0B 2D3LA 1K78B 5BSYA 1A31A 2O8KA 3OMYA 4I2OA 3U6KA 1D0ZA 1D5VA 3RQ4A 4V19K 4QTRA 1N05A 2B7EA 3FXJA 1SD4A 2LRDA 1WQ2A 2XUBA 2QEXB 2NAZA 1O8EA 1G6NA 2QSFX 2XHKA 1ZRFA 3HDDA 3TP0A 3K70D 3ZPPA 4RDLA 4BJ5C 1Q1HA 1PXZA 3OYBA 5BPDA 3MCAA 3O8HA 1JGSA 5F04A 5LRSA 1TLLA 1WTHD 2E5NA 1X4PA 2E1NA 4E7ZA 2Z99A 3B90A 2I5UA 2A6EF 1YITB 3TGNA 4XM3A 3IAS2 1EF4A 3ULQB 3RCOA 1HOMA 1QVTA 4P1WA 2EFGA 2FUG2 1Q1VA 1E3PA 2XIGA 2ZNYA 3P7NA 2RDPA 2RVCA 4M3DA 1E63A 2RC4A 4HV5A 4F7ZA 3ZPLA 1UB9A 2G7HA 5HLGA 2OC6A 2UVFA 4LMYA 4HSTA 1YW9A 1ZARA 2VI6A 4F52A 4FN5A 2RQPA 3EUKL 1O8KA 4BUPA 2RC5A 1X58A 4KIBA 3WTSC 5D5WB 2YU9J 5J1YA 3I3LA 4O6JA 3KZIC 3FXOA 1XSDA 2W48A 5D5VB 1UD4A 2OZ6A 3SZTA 3ZXSA 4TT3A 1Z6RA 1PE9A 4MEXF 4TMWA 3CCLI 3SZEA 4LBYA 5EG0B 5FA6A 1ZR2A 3ZMDA 3OOPA 1RETA 3WBJA 1H8EA 2VB6A 4AIKA 2IVMA 3LSIA 3CB4A 2PJRA 3NE5B 3FHZA 1MBHA 2ZBVA 2JQ7A 1PUEE 4RJLA 3PFYA 2K5CA 3GFIA 4X7EA 2BEOA 2IS1A 3I54A 1DPUA 3TH0A 2V6EA 5JHFA 2GOXB 2Z3YA 2CU7A 3E3VA 4AM3A 3GX4X 1ZM3A 3HXLA 1IF1A 2NZMA 3HOTA 1P2FA 3QPTA 4LD5A 1WRJA 1DGRM 4UV9A 2KFDA 1I7PA 2X51A 2BM6A 5AONA 3OOUA 2M1BA 3BP8A 1OB2A 2YR2A 3Q3SA 2K9NA 1PLUA 2XDVA 5LHHA 2F1LA 1GLNA 2FOKA 2FSWA 5B1BH 5F0HA 2BV3A 2DERA 3IV5A 1KTVA 5FKLA 3MQ0A 3CCMI 5CJ9A 5C3EJ 4A3MJ 2QTLA 1TYVA 5F27A 3CCRB 1FOYA 3CCJI 3LSKA 3OSGA 4C43A 1KK2A 2IS2A 4WCGA 1VQOI 2Z9OA 5F4MA 2XC7A 4UB8C 2O3FA 4G8XA 4XN0A 4UZUA 2WB1N 3BTLA 1OR7A 3CC2I 2H6BA 4IHSA 2L7KA 2VBWA 3QP5A 3BCBA 3A0BC 4E7IA 1F60A 4D0PA 3L1PA 3A01A 4P5OA 4RGSA 4WQMA 1M90D 2ZBKA 1VF9A 3KFWX 1JUPA 1Q7YD 2O5RA 2VJ4A 3FISA 1ZM9A 4X7FA 3T8RA 4EJTA 1QFYA 1QGYA 1S6LA 2N8GA 2F4IA 3OW7A 4OOSA 2R3SA 4MEYF 1HW1A 3W5HA 1IUFA 1IRXA 5DS9A 1D8JA 1O8MA 3Q0UA 1SVLA 5GPAA 4L5EA 2CQKA 3DWLE 4KH3A 5F08A 3KYCB 2JVHA 2B0LA 3DDYA 1H80A 2DDBA 1BLIA 2V7QA 4XMYA 2QSGX 3LMWA 1DP3A 2DI3A 3SUCA 2XTWA 2GZWA 1DGWY 3EUHC 5IP6A 5L3GA 5BOXA 1XQBA 2B5OA 1OPCA 1R58A 2VQHA 2XAQA 1REPC 2JN9A 1EP3B 2QXZA 1WI9A 4D7MA 3N97A 2YWHA 3EQOA 3NB2A 2IPQX 1U2RA 2JA6J 3MMPA 1ETYA 5JBQA 1Q86D 3LQEA 4RPBA 5J8CA 4C2UA 1OB0A 1S4MA 2RNJA 2CRGA 4ZH4F 4H4KC 1WKMA 3O2PE 1VQPI 3MKWB 1B9MA 2FBIA 4B44A 1IRFA 3M1CA 3B78A 2XKOA 4KICA 1TZLA 4RB0A 3DLAA 1T08B 2DT7B 3H3ZA 3GF2A 3CCSI 1SKYB 4AVPA 4OJLA 4X6AJ 4IVNA 5D8LB 4PC7A 4CSWA 4BY1J 4Z4VA 1PP8F 4KNYA 3ZMSA 2F5VA 4KKUA 2F3LA 1PJRA 1EP2B 4DGWB 2V4DA 2JWTA 3IWFA 4HWVA 3H1CA 4XKBA 5JLXA 4YIRX 4IQJA 2CRVA 2GXGA 4OAYA 4JRAC 4JP0A 1JA0A 1CQTA 5H59A 1ERDA 2G7UA 3WWGA 4A3CJ 4L9JA 4EM1A 3ISXA 3D5SC 3L00A 4WF2A 2DYIA 5ERIA 1IB4A 1XS9A 3GCMA 3BZKA 3SZPA 4CA0A 2FNPA 3HOUJ 1DQUA 1MJ9A 3RY8A 3CJNA 1DU0A 2DCEA 1ZKGA 1PKVA 2R7OA 1I27A 2LDUA 3WE3A 4E70A 4UNOA 2VXDA 2YWGA 3IP4B 3H0DA 2FMYA 3I5UA 1STZA 1EH6A 5FLXK 1SFEA 4RM3A 4RD1A 3J81k 1D1CA 2ZC2A 2M30A 1YJ9I 1OFEA 2KQRA 2ME6A 1R1VA 4K1XA 1TBXA 2MD0A 3H5AA 2PYGA 1FRQA 1GAQA 1SD6A 1V4RA 3WE2A 2BX6A 4ESBA 4PDKA 4QVAA 1YOVB 4XLEA 2J5OA 3LSMA 3G6EB 5GAGJ 1SFKA 2ZZGA 1GV2A 1I5ZA 1Y0UA 4PMHA 1W7PA 3TO7A 1Y39A 1BQEA 3L7WA 3S3MA 3GUDA 3HUGB 2HEOA 4OMYA 3CRZA 3CC2B 4G9YA 2NTBA 2Y75A 3I64A 5B5EC 3OJXA 3BG6A 2AS5F 1WJAA 4U0WA 2M9HA 5HLIA 2GA2A 3MVPA 2ACJA 1L3LA 1QZEA 4W8RA 4OPSA 2AQFA 5JMCB 3GTQJ 4C3HJ 4ROXA 4BHBA 1MBGA 1WJ5A 1HBXG 1QG0A 3AVVA 4RD2A 3I58A 3IH3A 3VSKA 1BJKA 2GWRA 2F5CA 3JQQA 4RCZA 3PSSA 3FMQA 1QVUA 3S32A 2JUCA 3E1SA 4IKFA 1XMXA 1O8GA 4V02C 2MSYA 3HIFA 5HNFA 1P6RA 1FYMA 2XPWA 1HZEA 1MABA 3L2QA 2ME0A 2Z33A 3D5LA 4KJZA 1YX2A 3U6BA 4LB5A 2WZNA 4KN7X 3MKZA 1ZG5A 2C5BA 1HF0A 3L09A 2IGOA 2D9RA 2XVCA 4BHPA 5B1AH 4HRIA 1IDZA 2OPTA 3E7LA 2HTSA 3SXYA 2R93J 3BJAA 3JRIA 5H5JA 4MQ9F 3Q38A 4MFDA 4F7DA 5ILSA 5A88A 3K1NA 3QAHA 2ZCWA 4AF6A 4JQFA 3QRFF 1TT5B 1Z6TA 1FNDA 4DZPA 2DU9A 5IYBJ 1FWZA 4IHTA 3DBRB 2VFQA 2AHQA 3WGIA 4QLCU 1B72B 2JZYA 2OTLI 1MGTA 1I18A 3LYCA 3DKXA 2DTRA 2EILH 3HZJA 1ETWA 4S0HB 4W97A 4IOCF 1TWCJ 1G7TA 2CGPA 3I55I 4CYDA 3JREA 3BC8A 3LMMA 3ASNH 1Y0RA 2V1NA 4LBZA 1QRCA 4BEHB 3J80Z 4G7XA 4U87A 5DTDA 1G2HA 3BR3A 3FZVA 1APLC 1MSFC 1JXSA 4NCNA 4UVBA 1SM4A 2EINH 1WU8A 1G8XA 2ZTGA 4LITA 3HPHA 2BW3A 1PDNC 4EM2A 2R7DA 4KFCA 4X1EA 5H2FC 3A1PA 4X06A 5GV7A 4BDZA 3MHPA 5E79C 4GYGA 3JW4A 1OCCH 4KKSA 4OOVA 2F4OB 1SAXA 2QBYB 5H20A 1XGNA 1VTNC 4AC9A 1DBOA 5DUKA 1X3UA 5LLQA 5C4JJ 2KLOA 2WJVA 4BXUA 3SFZA 1B1BA 4YEIA 1RNLA 5HS9A 3L2CA 2BVLA 3JURA 5L3CA 5KNLA 2M0CA 1I8DA 1IHMA 3FF5A 2B7BA 2IOUG 3CESA 4HX7A 4BACA 4U7BA 1SAUA 4AUXA 3DEUA 1IB0A 3GQAA 4M3BA 4EMSA 1F4KA 1S7OA 4A6EA 3PSIA 2XROA 2HYJA 5FLXZ 3DPUA 5CPRB 4GCVA 2CQNA 3DBLB 4A69C 4EJWA 3SJMA 3RKQA 4C0SA 4PFOA 2HDNB 1XX5A 4NC8A 4UXNA 4HNVA 1JHFA 1FTTA 4G1VA 4W8SA 1YIJB 2NXNB 4YFNF 2ZL7A 3FWEA 1RKTA 2FA5A 3E6CC 3H9QA 1FOWA 2J5PA 3CMEI 1F43A 3ML6A 5J1RA 4FTHA 2RV8A 3VODA 2YX7A 1MH4A 2DTZA 3RYRA 3BY6A 3PIPF 3CCEB 4I76A 2QKLB 2XSDC 4DQLA 1AA7A 1WDTA 2GOMA 1ZUNB 2V79A 5FIUA 1QFZA 2ESHA 3BOQA 1GJRA 1DG1G 2BXYA 4OP7A 1TL8A 1JA1A 1JB9A 1HKQA 2GK7A 3E20A 4LLNA 3LA2A 2NRAC 4E7LA 2VNHA 4A0ZA 5FJ8J 3KP7A 1OFCX 4RDJA 3LWFA 3TQNA 2FOWA 4BE1A 1EXMA 4ZDPA 1TWGJ 2VIXA 3SLDA 3OIQA 4WXHA 5FO1A 2BY1A 3TMOA 3CCRI 3HJEA 3WTVC 1MZBA 4KT5C 2O61A 1VQ9B 1VI0A 5HODA 2LR8A 4LG3A 3ERED 1JE8A 5DS0A 5LGTA 4GO1A 4H0EA 4NHJA 2OU2A 3VNVA 2Y0SA 3CMAI 1VQ8B 2V9PA 3BDDA 4M3EA 2E5ZA 4QV2A 5GTHC 4TMZA 1XG2A 1JJ8C 3CMYA 3W6KB 1MNDA 4U0VA 5DCFA 4UUSB 3FM5A 4LC0A 1SEUA 2ZSIB 2KRHA 3CP2A 1BC7C 2M7BA 3BR1A 3TO6A 2LLKA 2LP0A 2R7XA 3TO9A 5GTIC 3JRCA 2Y30A 4RGUA 3CO7C 1QQIA 3SQNA 3P9KA 5H6QA 3W2EA 3HL2A 4DBRA 2WJYA 2Z1DA 3V76A 2LNBA 3AVUA 3P4GA 2ZJRF 2DT5A 4ETSA 4G7HF 1B2RA 2GREA 4TKOB 4DQKA 4ZYDA 4NDLA 2VNKA 3V4GA 2GLOA 3JSPA 3BPVA 3T51B 1H89C 1E1QA 3PL8A 2M3AA 3G4SB 4EJOA 2F2EA 4ENJA 2VBYA 2D5VA 1Y8RB 2ZSHB 3KEWA 1X0CA 1J9ZA 3FXUA 3OIOA 5EEHA 4B3AA 2NVQJ 3FPKA 3PA1A 2OCEA 4RDKA 1GDTA 2KIUA 2LH9A 3CDHA 3E5QA 3G1MA 4XORA 3G71I 4HA8A 3RTRA 2TRTA 1ZN2A 4I01A 4X0CA 4BXFA 3RIQA 3CF2A 2E2IJ 3W2GA 1MNMC 2JA5J 3LA7A 1V5FA 1ODDA 3G71B 2QWWA 1VQ7I 5EDNA 2XASA 1WJBA 1OCPA 2BY0A 4PGHA 2E1MB 5LBQA 2WB1A 4FQGA 2OYNA 2P0WA 4U7DA 4G94A 2HI3A 5JHUA 4BE2A 2WBMA 2CW8A 2QA4I 2NVUB 1ZGWA 3T8TA 3CZ6A 2FEZA 4CHUA 2IGMA 4ZV4A 3J81K 1BR1A 4M6YA 1Q82D 3OV8A 4IRIA 1R23A 4A0XA 4LBWA 2E36A 2PECA 2FRHA 2MC4A 2VFOA 1RESA 2WTEA 3EYYA 3ASRA 1RUOA 1M1KD 2PMZA 1WZ2A 2FBHA 1IC8A 1ZTRA 1EA3A 4TSFA 4CCMA 4RGXA 4XL9A 4HX8A 3WTYC 1H88C 2XAHA 1KU7A 4WWVA 3B8YA 2VBZA 5E20A 2PJPA 4UUTA 3Q0WA 3DEWA 2K85A 4IW3B 3HKZN 1HF2A 4HIZA 1FLIA 3C7JA 4E6KG 1QVGB 2WADA 2IEKA 4F91B 2IT0A 2F4NA 3F22A 2EWEA 2F5EA 5E8IA 4A3LJ 1XGOA 2XV4S 1O7FA 3FMRA 1N07A 3LVBA 3QPLA 2VZLA 4A3DJ 3LSJA 2VFNA 9ANTA 5L46A 4YEJA 2JMWA 2VJJA 2GIZA 2JK3A 3AVWA 2Z6BD 2E34A 4DNRB 1F9NA 1T0FA 5EZHA 1IRZA 2VBUA 3QPHA 1CZFA 3AK5A 4U4BA 5LHIA 1MBKA 3HB9A 2DPDA 2C78A 3VO2A 4OU0A 2E1CA 4Z4SA 3OL3A 1VQ8I 3AG2H 2LOOA 3CUOA 3AGQA 3SKBA 2BYVE 3R4KA 4G12A 3BG7A 1O3QA 2XT4A 2XB5A 1R5NA 1IW7F 3ELKA 3K70C 1LFPA 3S93A 4PC1A 4C2MJ 1VQLI 1QA2A 2BM1A 4WWCA 3ABMH 3ESWB 3C18A 2R7VA 3EUAA 1GXQA 3PO2J 3ECOA 1RU4A 5IYCJ 3J7AY 1VNDA 1T6SA 2NS8A 5F64A 5FB2A 4OPVA 4BEHA 2VBSA 1CLWA 4A3JJ 4F93B 5M5YJ 2XPVA 1Z77A 2IA0A 1T98A 1XSVA 4A5NA 1O3TA 1HQCA 4A3GJ 4G6IA 1K4SA 2DOAA 3WTUC 2PMHA 1B72A 2Q2EA 1E3XA 4JYKA 2NOJB 3OL4A 4DYCA 1NK3P 4XKCA 5IYNA 5IOYA 4FE7A 3VPRA 3LSTA 1E3ZA 3B4NA 5DM7F 1T6ZA 3VSLA 2CMPA 2L4AA 1E3HA 2P5KA 3F9KA 3NWSA 3VYRB 3EQLF 1G3SA 4CQJA 2LY1A 3GFMA 1FRNA 3OIPA 5ICGA 3WU1B 1QPIA 3V7AA 3M07A 3K2AA 4M6XA 3L2RA 1FYKA 1JKPC 3FXKA 1E62A 1VQMI 1NG6A 2FE3A 3BTCA 3WGHA 1BPLA 2QN6A 4NK8A 5M3FJ 2K40A 5A2QK 3ASTA 5GPCA 3ZRGA 4BBRJ 2KKOA 4FX0A 3GVKA 1A36A 3JSOA 1WCMJ 3ZBUA 2VFPA 3MZ8A 3C2HA 1B8IA 4DIQA 2HGCA 1IN5A 1SD5A 3FXRA 1KU2A 2IP2A 1T2KA 3SDBA 1Y8QB 1M1EB 1KCDA 5LEKA 2CUZA 1UCRA 1WSVA 4A3EJ 3GYHX 1D1BA 4ACAA 3ECHA 1KK0A 1IXSB 2CQQA 4PK4A 3F6VA 1VQOB 1EH7A 2OQGA 4QSHA 2DODA 1FOKA 1YHQB 1BR2A 4E7KA 3CD6B 3ERMA 2BV6A 2GBYA 1JTAA 1X19A 1TWAJ 1W0TA 2XF7A 3Q5FA 2DN0A 1QX4A 5C1EA 4R79A 2DYSH 1Z1DA 4EJVA 2UWMA 3F6OA 3F8CA 1Z91A 1EA0A 2OTLB 1KQ9A 3OYJA 1FJLA 1ETXA 2CUFA 4GXOA 5D6EA 4IHVA 1N0UA 2GQFA 2FQ3A 1MKMA 2ECBA 4FISA 1K73D 1Z0XA 5E3OA 2H8WA 1W0JA 2VBXA 4L8JA 4M3GA 3QFRA 2QM3A 1E1RA 5EGOB 2B7CA 3BQZA 3CC4B 1TYXA 4YZXA 5LEJA 2VFMA 2VLAA 2YSRA 5LD2C 3WHCA 2BZTA 2QLZA 1R5GA 2ZZFA 3Q39A 4PSWA 3A0HC 3TDUC 3I4PA 2DO7A 5J6XA 1TT0A 1AOYA 4UV8A 4KIGA 4V2FA 4XLAA 3K69A
chains in the Genus database with same CATH topology
4XMYA 1OOCA 3LMWA 1DP3A 3SUCA 1DGWY 2WY8Q 2DIEA 3EUHC 2W4SA 4PJLA 4Y4RA 2VQHA 3OYKA 1WJEA 1D0XA 2QXZA 2X6XA 2GJPA 3EQOA 3DPLC 3H9GA 2E60A 2Q1ZB 1ZELA 2W6IA 3KRGA 2WAFA 3FDYA 3GRHA 4C2UA 4N4OB 1OB0A 2XSJC 3OYGA 2NT6A 3GQ7A 3ZIAA 2KRCA 3W2WA 4H4KC 3MKWB 3IUOA 4II3A 3M1CA 4NUBA 4B44A 3VWBA 2JIZA 2XZPA 3AFHA 2K9MA 1TZLA 3DLAA 3FY3A 1UELB 2DT7B 1SKYB 4OJLA 4QPQA 3TBIA 1W0KA 2LBFB 2OUMA 3QYBA 4CSWA 1AIRA 1T5EA 2KPMA 2R7SA 1NRKA 1UD8A 1D0YA 2UUZA 2F5VA 2F6CA 4J01A 2UV1A 1PJRA 3I9V2 4N4NB 4KKUA 4DGWB 2V4DA 1FX0A 5HVQC 2LY2A 1MNEA 4HWVA 4XKBA 4IQJA 2HPIA 3OYLA 2QKMB 4E7SA 4OAYA 2W82A 4B43A 3OE7A 3QOEA 1K6YA 4IX7A 1QCXA 3PJRA 1KCCA 3DQVC 1ERDA 3WWGA 4DBQA 3DU6A 3D5SC 4B47A 1O8JA 1IB4A 3LSHA 3NWTA 2LG4A 4CA0A 1Z3XA 4C30A 3OEHA 1DQUA 2VBEA 2DCEA 3SZGA 1G59A 2R7OA 1PKVA 4IQ4A 3U21A 2VXDA 1WJCA 4XKVA 3IP4B 3H0DA 3OR2C 2V26A 2O17A 4BJTA 4RM3A 1D1CA 2L2OA 2VL8A 3PSFA 1BOBA 2BW3B 4XONA 3FBIB 2KQRA 4PJNA 4FXUA 3LL7A 2MD0A 3AKZA 3H5AA 2PYGA 2WZPP 2ZFUA 4PJMA 1UD5A 5HKKA 4QPOA 2RREA 2LBFA 4I84A 2INUA 1LVKA 2IS6A 4XLEA 2R7TA 4URRA 3LSMA 1YX5A 2ZZGA 1SFKA 2NSTA 3DPTA 2KVOA 4PMHA 4HG2A 1BR4A 2CV2A 3ZGKA 3S3MA 2JDIA 3HUGB 4U49A 4ZDLA 2NTBA 2XAUA 2VQLA 1KONA 1S9HA 3GVLA 3BG6A 1WJAA 1IA5A 1W9XA 5FL7A 4W8RA 2HPMA 2AQFA 3CMMA 4CCNA 1JI8A 4KKTA 4PJJA 2W7NA 3QYEA 1WJ5A 2A6TA 2VBMA 3ZPNA 3VSKA 3ZQQA 3CJRB 5FRNA 3FPPA 3K4CA 1HA8A 1QU3A 3S32A 2X1EA 3E1SA 4IKFA 3FBNB 1VF7A 1VJSA 5HNFA 1O8GA 1HZEA 1KZLA 1MABA 4W8QA 3L2QA 3D5LA 2M7AA 1FMWA 4KJZA 3GVJA 2A5WA 3MMYB 2R7RA 1H8HA 1JRGA 2PYHA 4OJ6A 2D3NA 4RMNA 1J09A 4CCOA 3MKZA 2LZJA 3T9GA 4BQNA 3S3OA 1K5CA 2IGOA 3OYHA 3K4KA 1UAAA 1EE6A 1Z21A 1MW7A 4HRIA 3HAGA 4C9YA 3DTKA 5FRMA 2X3HA 4LIVA 3VSUA 2JA2A 2ZTNA 4XLHA 4MXNA 3SEQA 1MMGA 3DKYA 4HEA2 4JQFA 2IQ7A 3K4LA 3H5NA 4J00A 4XOPA 1P9QC 3W2AA 2ELJA 2JUGA 2CUJA 1I18A 2NTPA 1WP6A 4MLOA 3DKXA 3BCDA 3PUBA 3OPOA 3OYDA 3OYIA 3VSVA 3N05A 4OWRB 3BC8A 3LMMA 2V1NA 5CKTA 4BEHB 5CDFA 4G7XA 4U87A 3L2UA 1X4OA 4CCJA 2ZTGA 1G8XA 2GK6A 4LITA 3HPHA 2WSSA 3GQ8A 2BW3A 2LREA 2MABA 4XD7A 2JJ2A 2WAQA 4XKWA 4BDZA 2JVGA 4KKSA 4B3XA 4EATA 4YELA 2AQEA 3OEEA 2VKDA 1DBOA 1X1DA 2CS3A 4AVZA 2XGJA 3VDXA 4JMQA 2KLOA 3QYFA 2K9LA 2WJVA 3GQBA 3PNVA 2V9KA 4E0FA 4RLQA 2BVLA 3JURA 3VMVA 5KNLA 1Z3YA 1I8DA 4OZZA 2M5SA 2I8DA 4II2A 1MMNA 4OJOA 2X1CA 3RPUD 3CESA 4XLCA 4BACA 4U7BA 1SAUA 5IK2A 4Y33A 1OFMA 3GQAA 3DTIA 1BHEA 2CH0A 1BN8A 3PSIA 1BMFA 1HG8A 3RSNA 2W00A 2KL4A 3DPUA 4ITVA 5CPRB 1KTWA 1WMRA 2DT6A 3VYUB 4F3QA 4PFOA 3A3GA 3HG9A 3OYEA 2F43A 4NC8A 3FKSA 3W3CA 4DK0A 4W8SA 4XQFA 2X53S 4IZZA 3UW0A 3H9QA 3H94A 2KP6A 3D5RC 2XZOA 4YXWA 2PECA 1Z7LA 4FETA 1OR7C 3LSGA 4JOMA 3OYMA 1E43A 1IDJA 2QY1A 2QKLB 1NBMA 1AA7A 2KMUA 4F92B 2GOMA 3FKJA 3DDYA 4XOTA 4BQOA 1T0FC 2X6YA 4B3GA 2CFOA 4ZDOA 1N75A 2GK7A 3K10A 2DXIA 2HNHA 1MMDA 4E7LA 4C2TA 2IGKA 3H9JA 4ASUA 2O1DA 2HQAA 4BE1A 1WPCA 4ZDPA 1UD3A 2VIXA 3E0JB 1O8IA 3OIQA 3EQNA 4NNJA 4ZYAA 4Z03A 1GQ8A 3TMOA 1RWRA 5HNHA 4F55A 1RMGA 1UD6A 1O8DA 5C1CA 3T53B 3W2VA 3VSTA 3CP8A 1FMVA 1IDKA 4LG3A 3UNGC 3WQZA 2K3PA 2BVMA 2O0WA 3G2BA 3OYCA 3HPGA 1N77A 4Z1MA 3L2WA 1O8LA 2Y0SA 1K28D 2F1MA 1OGMX 4KISA 3K4BA 4YZXA 1YE9A 2E5ZA 1XG2A 4DK1A 2VPLA 3GQ9A 2E1MC 1VBLA 3BLYA 4KT6A 4XN3A 1MNDA 4BE0A 2QX3A 5LFAA 1X1AA 2X85A 2QE7A 2ZSIB 4RLFA 2KRHA 1VZ0A 3CP2A 3A3BA 4C2LA 2M7BA 4G6TB 2XOKA 2R7XA 3K4MA 2IXSA 3CJQB 2ZXHA 3KEYA 1COWA 4OAZA 3A1YA 3HL2A 4DBRA 2WJYA 2Z1DA 1R6RA 1Y6IA 2INVA 2KDOA 2X6WA 1Y56A 4TKOB 2VBKA 2WPDA 2HLDA 3V42A 3OS0A 3OYFA 1OLTA 2JSPA 3BCAA 4HNUA 3OFNA 3T51B 1E1QA 3PL8A 4HNTA 2M3AA 4B3FX 4XR6A 3QODA 4FASD 4Z05A 3LFUA 4X0GA 2BSPA 2M0MA 2ZSHB 3KEWA 1X0CA 1LKXA 4NC7A 3HC7A 4LIUA 3K6GA 4MR0A 2V31A 2LH9A 2VASA 4XORA 2CV0A 4KITB 3AL0B 3S3NA 4Z06A 3OYAA 1NHCA 3KYLA 3RTRA 3T56B 1T95A 2X1DA 2Z16A 1PYVA 4BXFA 4CCKA 4CH7A 3CF2A 1UD2A 3BCFA 4YZQA 2IGNA 2WY7Q 5DN6A 4ZC3A 2ZZQA 1V5FA 2M4GA 2VKHA 3A2KA 3MD2A 3H5RA 1WJBA 1QHHD 2E1MB 1V0FA 2MYSA 2WB1A 2VJIA 2CW7A 2GJRA 2P0WA 3KX2A 2XNDA 2BOLA 2X8KA 3G05A 2PJRB 2DJIA 2NT9A 4BE2A 2WBMA 2CW8A 5CQEA 4ZTJA 2UVEA 2L9SA 2W1OA 1WJFA 2HZDA 3CZ6A 5HLTA 2IGMA 3LNNA 1BR1A 3GBGA 5FROA 2HVSA 4BJ6C 1O8HA 4ZTFA 2Q2EB 1E0EA 2MC4A 3OS1A 1U0JA 1DBGA 1LDKB 4ZJZA 1D1AA 4YZAA 3M8JA 2PMZA 3VR6A 2VQCA 4TSFA 1EA3A 3BC9A 2WA0A 2GJKA 4CCMA 4XL9A 2E1BA 3B8YA 3OOCA 2O04A 3DTEA 3TL4X 3VYTB 2V7FA 2IS4A 4HIZA 3JU4A 4E6KG 2OV7A 2WADA 5CQGA 4F91B 3HOSA 2EWEA 2R7WA 2KHMA 1E79A 4DOZA 3BH4A 2O0VA 1OHHA 4PSXA 3OY9A 3DU5A 3K4JA 4BL0B 2D3LA 2VQGA 4YEJA 3OYNA 1UG0A 2R7QA 3OMYA 1D0ZA 2VJJA 2XF6A 3RQ4A 2M4KA 2Z6BD 4DNRB 1MMAA 2LRDA 2RQQA 1CZFA 2ZXIA 4U4BA 1QHGA 1O8EA 3ZR8X 3ZPPA 5AMVA 3K70D 5TGTA 4XNFA 4BJ5C 2JJ1A 1NG7A 3OL3A 3OYBA 1PXZA 2L9NA 4DNTB 2LOOA 4ANJA 1WTHD 3BG7A 2E5NA 1X4PA 4BDYA 5HOOA 4E7ZA 3B90A 2ODLA 3K70C 4EW9A 4XM3A 3IAS2 1LFPA 3RCOA 3S93A 1N78A 4P1WA 4CUGA 2MFZA 3ZCOA 2RNGA 2XZLA 2FUG2 3DEEA 4HPQA 2R7VA 3EUAA 4OJ5A 1RU4A 3J7AY 3PNYA 4BEHA 3AL0C 2VXZA 4OJPA 2OC6A 4E7JA 4F93B 2UVFA 4HSTA 1O8KA 4W8TA 4F52A 3EUKL 4DJAA 4BUPA 3C2GA 4G6IA 2DOAA 3I3LA 4GRIA 2ZZEA 1O88A 4B48A 1E3XA 2NOJB 3OL4A 2HVRA 3OS2A 4XKCA 2HDWA 1UD4A 2NTQA 3ZXSA 5KCMA 1X1BA 4TT3A 1PE9A 1E3ZA 3B4NA 3VSLA 4YZ0A 2W6JA 2CMPA 3F9KA 3NWSA 3VYRB 4XLFA 4AU7A 4BGDA 1OGOX 2Z8GA 2LY1A 1H8EA 2VB6A 3OIPA 4YRVA 3LSIA 2PJRA 3NE5B 1QJVA 3FHNA 3L2RA 3PFYA 2K5CA 4D9JA 4E7HA 2IS1A 3S8PA 1NG6A 3EPZA 5JHFA 2GOXB 2V6EA 1BPLA 2NZMA 4NK8A 3HXLA 3HOTA 2NSPA 1VLYA 3ZRGA 1W36D 4E4HA 4G7WA 4PUSA 1DGRM 1O8FA 4CCLA 1V5EA 3GVKA 2X51A 4GQNA 4P22A 3OOUA 3PNTA 4OZYA 2WAEA 3L2VA 1EFRA 3C2HA 4DIQA 1PLUA 1W36C 2XDVA 1GLNA 4RM2A 3SDBA 1KCDA 2CUZA 4NQWB 2XF5A 1OFLA 1D1BA 3IAM2 4PK4A 3OAAA 3ONQA 1KMHA 3ZSCA 3OR1C 3HKZA 1BR2A 3LSKA 2V4JC 4D1QA 4E7KA 4HSRA 2HVQA 3H35A 2IS2A 1JTAA 1X19A 1V5GA 2R4GA 2XC7A 4UZUA 4XN0A 2XF7A 2R7UA 1HVXA 5C1EA 4R79A 3A4CA 2L7KA 3SYTA 4BQQA 1WFXA 3BCBA 2HU9A 2UWMA 4E7IA 3OYJA 2CV1A 1V0EA 2R9VA 4P5OA 2Z2SB 4Y3OA 4NK6A 1X1CA 3VMWA 4BS9A 2O5RA 1W0JA 2LC2A 4L8JA 2VJ4A 1WJDA 4AYBA 5KHDA 3OW7A 2L5QA 1E1RA 2F4IA 2LYCA 3A35A 2VLAA 1IRXA 1O8MA 5LD2C 3UR3C 2ZZFA 3DWLE 2CK3A 4PFPA 3K4NA 4PSWA 3SEZA 4BU2A 4CZCA 3MKYB 2JVHA 1TT0A 3VYSB 1YX3A 2KZVA 1H80A 4XLAA 3OWTA 2VJ5A 1BLIA 2V7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8L A;  4XMY A;  1OOC A;  3LMW A;  1EE6 A;  4YZX A;  3SUC A;  1XG2 A;  3B90 A;  3GQ9 A;  1VBL A;  2ODL A;  2X3H A;  4EW9 A;  4XM3 A;  4XN3 A;  2QXZ A;  2QX3 A;  2X6X A;  3VSU A;  3EQO A;  2X85 A;  4XLH A;  4C2L A;  3KRG A;  4MXN A;  3GRH A;  2IQ7 A;  4XOP A;  2NT6 A;  3GQ7 A;  4OJ5 A;  1RU4 A;  2NTP A;  4OJP A;  2UVF A;  4W8T A;  1O8K A;  2INV A;  2X6W A;  3VSV A;  2VBK A;  3FY3 A;  4OJL A;  1O88 A;  1AIR A;  4XR6 A;  2NTQ A;  4Z05 A;  2BSP A;  1PE9 A;  3B4N A;  1X0C A;  4YZ0 A;  3GQ8 A;  4XLF A;  1OGO X;  2Z8G A;  4HWV A;  4MR0 A;  2O0W A;  4XKW A;  4XOR A;  4Z06 A;  1QCX A;  1QJV A;  1NHC A;  1KCC A;  4YEL A;  3WWG A;  1DBO A;  2NZM A;  4NK8 A;  4AVZ A;  1O8J A;  1IB4 A;  4YZQ A;  4XLA A;  2NSP A;  3JUR A;  3VMV A;  1O8F A;  4OZZ A;  2VBE A;  2VJI A;  4OZY A;  4OJO A;  4XLC A;  4XKV A;  1OFM A;  1PLU A;  3GQA A;  1BHE A;  2O17 A;  2UVE A;  2NT9 A;  1KCD A;  1BN8 A;  1HG8 A;  4XON A;  1OFL A;  1KTW A;  1WMR A;  2PYG A;  1K5C A;  1O8H A;  3ZSC A;  4W8S A;  4XQF A;  4I84 A;  2INU A;  3UW0 A;  1DBG A;  4XLE A;  4URR A;  4YZA A;  2NST A;  1JTA A;  2PEC A;  4PMH A;  1IDJ A;  4U49 A;  4XL9 A;  4XN0 A;  2QY1 A;  2NTB A;  3B8Y A;  5C1E A;  2O04 A;  4XOT A;  2X6Y A;  1IA5 A;  2O0V A;  2EWE A;  4W8R A;  4NK6 A;  3VMW A;  2VBM A;  2O1D A;  4YEJ A;  3EQN A;  1O8I A;  2VJJ A;  4Z03 A;  1GQ8 A;  1RWR A;  1O8G A;  4W8Q A;  1O8M A;  1RMG A;  1CZF A;  4U4B A;  1O8D A;  5C1C A;  1O8E A;  3VST A;  1JRG A;  2PYH A;  1IDK A;  4OJ6 A;  3ZPP A;  5AMV A;  4XNF A;  1H80 A;  1PXZ A;  3T9G A;  1OGM X; 
#chains in the Genus database with same CATH topology
 1IAW A;  2PEX A;  2DIE A;  4MTE A;  3H09 A;  1AWC A;  1VQ4 I;  2W4S A;  3HOZ J;  3ZMV A;  4HLX A;  1WH5 A;  1WJE A;  1D0X A;  3REO A;  2X6X A;  2GJP A;  1LNW A;  4PC3 A;  1XGS A;  5DCM B;  3DPL C;  1RRJ A;  2A05 A;  2E60 A;  2KRF A;  1ZEL A;  4A93 J;  2XT2 A;  2WAF A;  5CVI A;  1WOR A;  2OBR A;  3GQ7 A;  1JGG A;  2QQB A;  3IUO A;  4NUB A;  3M3Y J;  2IAI A;  3VWB A;  1KD1 D;  3IL2 A;  3HSE A;  1D8T A;  2EA2 A;  2XZP A;  1UHM A;  3FMS A;  4K2E A;  1LFB A;  3JAM K;  5F1J A;  2MLK A;  5IYD J;  2EFP A;  4QPQ A;  3TED A;  1W0K A;  2XGE A;  3M7G A;  3QYB A;  4XRF A;  2VT2 A;  1DDI A;  3GLL A;  5D8K B;  3CF5 F;  2H09 A;  2V7T A;  4XLP F;  4A3I J;  2PMD A;  1YG2 A;  1YIJ I;  2H27 A;  4TMT A;  5GV8 A;  2F6C A;  2W57 A;  4J01 A;  1P7I A;  4N4N B;  4FCY A;  5TR9 A;  3V8K A;  2W85 A;  4Z4W A;  1TTT A;  4WX9 A;  1FX0 A;  2ZJQ F;  1YLO A;  1B4A A;  2F4M B;  2LY2 A;  1S5L C;  4HQM A;  4MGR A;  5LGU A;  3KP3 A;  2W82 A;  1O57 A;  3K0L A;  1YJW B;  1KCC A;  3DQV C;  3ZC3 A;  3W2H A;  4XBF A;  3VNU A;  1A6I A;  1OJL A;  2PN6 A;  2XPU A;  3F3X A;  3ROU A;  4YFX F;  2W84 A;  1ZR4 A;  3F8M A;  2R5Y A;  1MSE C;  3SZG A;  3JRB A;  4LJZ F;  1G59 A;  4YAW A;  1KZH A;  1K83 J;  2FBK A;  1WJC A;  2ZJ2 A;  1KU3 A;  4OOI A;  2EFQ A;  4A0Y A;  1BC8 C;  1VQN I;  3OR2 C;  4R1H A;  5FO0 A;  2O17 A;  2L2O A;  1BOB A;  4XON A;  5A2Q Z;  5K7H A;  2HZT A;  2WR8 A;  2P5V A;  3LL7 A;  1OYW A;  2QQ9 A;  4YG2 F;  2K86 A;  2O9L A;  2WZP P;  3V7C A;  2DA7 A;  3GVA A;  1D2E A;  1EJ9 A;  4KUM A;  2OA4 A;  1ACI A;  2INU A;  4KMF A;  1Z05 A;  2QYO A;  4BKX A;  1OMI A;  2IS6 A;  2M5S A;  1YX5 A;  2XNC A;  4G1B A;  5E1X A;  4P12 A;  2QVO A;  2STW A;  2NST A;  2NVT J;  3BY2 A;  1QFJ A;  2XRL A;  4G7O F;  3CW2 A;  1AIP A;  4U49 A;  1ULY A;  1UZC A;  4YII A;  2P81 A;  2XNJ A;  2EIJ H;  1KON A;  3GVL A;  4Y7N J;  2RN7 A;  1OYY A;  4QUZ A;  5CLS A;  3IKT A;  5FL7 A;  2J7K A;  2HPM A;  3LAJ A;  2QEX I;  2Y31 A;  2YX4 A;  5DCM A;  1KRH A;  2QQA A;  1TUI A;  3A8K A;  2VC1 A;  1K7A A;  3D0S A;  2A6T A;  2QSH X;  2V1U A;  3HRT A;  3M4O J;  2VBM A;  4RB3 C;  3ZPN A;  2F5D A;  4LG0 B;  2IW5 A;  4RAF A;  3L9F A;  1HA8 A;  1VF7 A;  2X1E A;  2FML A;  3MFK A;  3DU1 X;  4HDU A;  2OBP A;  1H8H A;  2Y9Y A;  4IRH A;  1KQ8 A;  3KL9 A;  4RMN A;  4CCO A;  4RDU A;  5J35 A;  1H42 A;  2QEN A;  2QYU A;  3OYH A;  1UAA A;  1XTA A;  3MCZ A;  3RI4 A;  1VLO A;  4D5C A;  1IV8 A;  1Q81 D;  1EE6 A;  3RIR A;  3QE2 A;  3HAG A;  4C9Y A;  3DTK A;  1IN7 A;  1WPK A;  1RC9 A;  2EWN A;  3QP6 A;  1IV6 A;  2L9R A;  4XID A;  1K8F A;  3LSR A;  2O03 A;  2DOG A;  3Q9S A;  1MMG A;  3DKY A;  3SEQ A;  1X3W B;  2L9V A;  4J00 A;  2H6C A;  3ZQG A;  5HZB A;  1KU9 A;  4CGZ A;  1WP6 A;  4MO7 A;  3U2Q A;  2HQR A;  3OPO A;  3F21 A;  1DP7 P;  3OYD A;  1W7P B;  3N05 A;  2D74 A;  2DDA A;  1BN5 A;  3CC7 B;  2LTP A;  4U9U A;  2R92 J;  2O8X A;  3JR9 A;  5AN9 A;  1ETK A;  1X3Z B;  1X4O A;  4WXD A;  5HDK A;  1ZRC A;  2CQX A;  1XN7 A;  1O3R A;  3CCV B;  1XMA A;  1OCZ H;  1ZRE A;  3BG5 A;  2KJC A;  2DEU A;  2P7C B;  3WBK A;  2LRE A;  4PGO A;  2MAB A;  3ASO H;  4XKW A;  3HTS B;  2CC2 A;  2KDZ A;  1JTY A;  2HDD A;  1ZRD A;  1OFD A;  1RI7 A;  2NNY A;  1XE1 A;  3JQP A;  5E3N A;  3GWZ A;  4Q47 A;  3OEE A;  1FSE A;  2FU4 A;  3E6M A;  3KE2 A;  3VDX A;  3WU0 A;  3HRU A;  5JVG F;  2V9K A;  4E0F A;  4RCY A;  3HHH A;  3VMV A;  1YFH A;  1Z3Y A;  1HCR A;  4N3N A;  4UHT A;  4OZZ A;  1FBS A;  2I8D A;  3UKG A;  2X1C A;  5C44 J;  3ZQF A;  1IN8 A;  1TNT A;  5B66 C;  3CPW B;  3PQK A;  5ILV A;  5IYW A;  1BI1 A;  1BN8 A;  2FX0 A;  2QF7 A;  2PI0 A;  2W00 A;  2EA4 A;  2XB0 X;  1HKT A;  3CME B;  4ITV A;  1N08 A;  5FFZ A;  1KTW A;  2DT6 A;  1O7L A;  3VYU B;  4F3Q A;  4G6D A;  3OYE A;  1K4Z A;  1NJI D;  4M72 A;  3E5X A;  3W3C A;  3WTZ A;  3WTW C;  2DCU A;  2P6T A;  2DJN A;  3CCE I;  1T6Y A;  3KP4 A;  5IT3 A;  2X53 S;  4P6Y A;  1G7R A;  3H94 A;  3UW0 A;  2KP6 A;  2PLF A;  2ZB9 A;  3CCU B;  4ESJ A;  1S8N A;  1U5T C;  3BG3 A;  2CW0 F;  3D5R C;  1GHC A;  1Z7L A;  4UVC A;  1G7S A;  1DAR A;  1E43 A;  4JOM A;  5FKK A;  4YXW A;  2EFO A;  4Z4Z A;  1AHD P;  3HTU A;  3IWZ A;  3RKX A;  1D5Y A;  2WV1 A;  4CXF A;  2A07 F;  1YRN A;  3KEQ A;  3PO3 J;  3FM3 A;  4XOT A;  1S3J A;  1T0F C;  2X6Y A;  4GFB A;  4B3G A;  5FKO A;  1UJ8 A;  4ZDO A;  3TKY A;  4ZGN B;  3K10 A;  3DCF A;  2HNH A;  2K4B A;  2IGK A;  4HLY A;  3AG4 H;  1IDY A;  2UXN A;  2VBT A;  2JRT A;  5E3L A;  2O1D A;  2HQA A;  3CCM B;  5FNZ A;  1ZGJ A;  5K7F A;  4NNJ A;  4ZYA A;  4OIO F;  5HNH A;  3H36 A;  4F55 A;  3HOV J;  1UD6 A;  1V55 H;  3NAU A;  4G5G A;  4R71 A;  3CP8 A;  1FMV A;  3UNG C;  3F8N A;  2VC0 A;  2K3P A;  3RQI A;  3SFI A;  1TYW A;  2O0W A;  3HPG A;  4Z1M A;  1PUF B;  1O8L A;  4KIS A;  1OKR A;  1YLF A;  5D4S A;  2DA1 A;  2R6H A;  2RAE A;  1VQ7 B;  3RPQ A;  5IP9 J;  1VFC A;  4DK1 A;  3S17 J;  2E1M C;  4WZE A;  1GO2 A;  5KW9 A;  1TSP A;  3GQ9 A;  4KT6 A;  3M8E A;  2OBS A;  3EUH A;  3WY9 A;  1T8I A;  5F1R A;  1W2B B;  3ZN1 A;  3F0C A;  2QX3 A;  2X85 A;  1OQY A;  4RLF A;  4M3F A;  4C2L A;  3A3B A;  2V7V A;  4G6T B;  5FD5 A;  5J3O A;  1YJN B;  2BXZ A;  2D2W A;  4DQ2 A;  4L9N A;  3KEY A;  2I1L A;  3SJZ A;  1P4W A;  3B6C A;  4GYI A;  1R6R A;  2INV A;  2KDO A;  3LNQ A;  2CG4 A;  5KK1 A;  3S16 J;  1F20 A;  3F8F A;  1R5B A;  1IXC A;  3V42 A;  3OS0 A;  1OLT A;  2JSP A;  3BCA A;  4HNU A;  5E3M A;  3OFN A;  4B3F X;  3I59 B;  4I7H A;  2EIM H;  1EP1 B;  2EIK H;  3QOD A;  4EV0 A;  2V7W A;  3LFU A;  2LF8 A;  3J7Z I;  1DUX C;  1YS7 A;  3CUQ B;  4XK4 A;  2GPJ A;  4Q7J B;  4X7C A;  4S04 A;  4FHT A;  2A5Y B;  1ORK A;  2PIA A;  2VPR A;  2BM4 A;  3RPU A;  2HYG D;  3WYA A;  2DA3 A;  2EFW A;  3S15 J;  4BHC A;  1W87 A;  2V31 A;  1RPW A;  4KIT B;  3AL0 B;  1VHE A;  3OYA A;  4ZYE A;  4P9U A;  5JLV C;  4S05 A;  1T95 A;  2Z16 A;  2L7M P;  3RKY A;  3ABL H;  3FXQ A;  1PYV A;  5JI6 A;  3ZOB A;  1PUF A;  1QGP A;  2V6C A;  1K4T A;  1IJF A;  4WZK A;  4YZQ A;  2IGN A;  4ZC3 A;  2GAU A;  3VEP A;  5E17 F;  1OYI A;  1BOA A;  1QUF A;  2C4T A;  1YIO A;  2E2J J;  5BNG A;  2QA4 B;  1NHA A;  2XGC A;  3NQO A;  3CCS B;  1MBJ A;  2CW7 A;  3AVT A;  1KYZ A;  5J4V A;  4KDP A;  2BOL A;  1R1T A;  4HX4 A;  1W35 A;  2X8K A;  2LFB A;  3G05 A;  2PJR B;  1N25 A;  5CQE A;  4EGY A;  1XSX A;  4RGR A;  2W1O A;  2FF4 A;  1WJF A;  2HZD A;  5HLT A;  2DY1 A;  3GZ5 A;  4I0B A;  5HS8 A;  1IG7 A;  1UHW A;  5HLH A;  4N9H A;  1LUJ B;  3GBG A;  3ZMZ A;  4I99 C;  1AU7 A;  3I4N J;  2NV4 A;  2OK8 A;  4YHB A;  3LQ6 A;  1VQ6 B;  1O8H A;  3WNB A;  3JTG A;  1R36 A;  5BMZ A;  1IRG A;  1DBG A;  3HUG A;  3A8I A;  4ZJZ A;  1D1A A;  2EIX A;  1W5C C;  1FX7 A;  3K9T A;  4LLG F;  2OBT A;  4WZL A;  3VR6 A;  3HOW J;  2P3M A;  3SYJ A;  1JJ6 C;  1ETO A;  3BC9 A;  4KYW A;  3TOA A;  1OCT C;  2IA2 A;  2FQ4 A;  4DYQ A;  2O04 A;  2A3S A;  3VYT B;  1FNM A;  3V8J A;  2V7F A;  3BG9 A;  4A12 A;  3QFS A;  1TQM A;  2DW4 A;  4RBO A;  3HRM A;  2R7W A;  1SFU A;  3BR5 A;  5E1W A;  4UUS A;  5CVJ A;  1BW6 A;  3HGY A;  3OY9 A;  4ZCI A;  3P5J A;  3OYN A;  2YWF A;  1UG0 A;  2ELH A;  2R7Q A;  1Y0Y A;  3O3K A;  3DKW A;  1ZLK A;  1I6H J;  2XF6 A;  2M4K A;  3GEZ A;  1MMA A;  2EV0 A;  1D8K A;  1KK1 A;  2ZXI A;  5HDG A;  1V54 H;  2KZG A;  3ZR8 X;  2VOP A;  2QZA A;  3ABU A;  5AMV A;  2CQ7 A;  4XNF A;  4M9X A;  2YU3 A;  4UB6 C;  2JJ1 A;  2L9N A;  4DNT B;  5EZG A;  3WXM A;  4ANJ A;  1QA6 A;  2Y69 H;  4MFE A;  2E71 A;  1MH3 A;  5HOO A;  1EFC A;  1TQI A;  3KPH A;  2COM A;  5AIQ A;  3ZQH A;  4UVA A;  5E6T A;  4ZCM A;  4L5J A;  2JJ7 A;  4LK0 F;  1N78 A;  4CUG A;  1WHU A;  2MFZ A;  5GAH J;  2DOF A;  3ZCO A;  1YJN I;  2XZL A;  3DEE A;  4HPQ A;  2HKO A;  1IGN A;  2OQR A;  2ZME C;  2ZME B;  3OKX A;  4G6Q A;  2JT1 A;  3R6K A;  4OJP A;  5GP9 A;  4CDG A;  5IOZ A;  3IHU A;  1Z9C A;  1HA3 A;  4DJA A;  3VB2 A;  4LOC A;  2DMN A;  3CCJ B;  2L7Z A;  1LVA A;  1I3A A;  3CCY A;  5CVR A;  2CUE A;  1DPR A;  4GRI A;  4IF4 A;  2ZZE A;  4B48 A;  3HOY J;  4Z4R A;  5IYQ A;  1GXP A;  1O88 A;  4M73 A;  3OS2 A;  4HDV A;  3PVD A;  1HC8 A;  3QQA A;  2NTQ A;  5DD4 A;  1X1B A;  4YZ0 A;  2W6J A;  2QQ8 A;  4XLF A;  4AU7 A;  1OGO X;  4ABZ A;  4YRV A;  2M45 A;  3R0A A;  2VKE A;  1QJV A;  2BY3 A;  1D3Y A;  4D9J A;  4Z2Y A;  3S8P A;  3JRG A;  3E1Y E;  3EPZ A;  3B8H A;  2G0E A;  1BI0 A;  3MN2 A;  3CC4 I;  3N90 A;  2OTJ I;  2O6G E;  4I09 A;  2NSP A;  2TCT A;  2HKX A;  2EB7 A;  2ICW G;  1W36 D;  2C4U A;  1O8F A;  1V5E A;  1L1I A;  4P22 A;  3PNT A;  3CO6 C;  2WAE A;  3L2V A;  4UUV A;  2LKS A;  1ETV A;  2Q0O A;  3BRO A;  3QFC A;  3CCV I;  3WGG A;  4RM2 A;  2VNI A;  3CDL A;  2AO9 A;  2MC3 A;  5IP7 J;  4NQW B;  1BM9 A;  1RQR A;  1S7A A;  2V9V A;  1OFL A;  4B1R A;  2OK7 A;  1FOX A;  3IAM 2;  3OAA A;  1RIO H;  4KA4 A;  3WG9 A;  4CZZ A;  1TLH B;  3DF8 A;  3ONQ A;  1R4N B;  1T33 A;  2VOO A;  2O6W A;  5HZA A;  3HKZ A;  3FK6 A;  4IJA A;  4B09 A;  3BJ6 A;  3S14 J;  3ZQ7 A;  1J0R A;  1BW5 A;  3ZMT A;  2V4J C;  3H3V K;  3A03 A;  3WOD F;  4HSR A;  2HVQ A;  2MG4 A;  3H35 A;  4EJU A;  4Y13 A;  1GR1 A;  3JRH A;  3SDG A;  2R7U A;  5L3E A;  4BAY A;  5THX A;  3A4C A;  5K5O A;  2M34 A;  1WFX A;  2H1K A;  2LKX A;  4WZT A;  5CVV A;  1YTY A;  2CV1 A;  1V0E A;  2CW5 A;  2EZI A;  3AG3 H;  2Z2S B;  5E8G A;  1OGJ A;  4Y3O A;  4BY7 J;  4NK6 A;  5F4O A;  1X1C A;  3VMW A;  3MEX A;  1NK2 P;  2HR3 A;  3E6B A;  3N4M A;  1W5S A;  2AXT C;  3DBH B;  2LYC A;  3NRV A;  3A35 A;  3GXO A;  4J0Q A;  1IXR C;  3HYI A;  4HF2 A;  3W2F A;  3P9C A;  2M87 A;  3KCC A;  3UR3 C;  2CK3 A;  3K4N A;  4BU2 A;  4CZC A;  3MKY B;  2Y9Z A;  3GIR A;  1VQ4 B;  1F5T A;  5K5R A;  3QOP A;  2VJ5 A;  4AC0 A;  1QCX A;  2L54 A;  5HXB A;  1I39 A;  1GAW A;  2DYR H;  2WY8 Q;  3KP5 A;  3HRS A;  4Q4Z F;  1KK3 A;  2K9Q A;  4Y4R A;  1VQ9 I;  3OYK A;  1V5V A;  4TV7 A;  1U8B A;  1XFO A;  3KLO A;  5EG0 A;  4FK8 A;  4P3I A;  2Q1Z B;  4FWT A;  1GVJ A;  2HQ5 A;  3E97 A;  3GRH A;  4L9T A;  2JPC A;  4N4O B;  2XSJ C;  1TWF J;  2NT6 A;  1TQP A;  1HDD C;  3ZIA A;  3W2W A;  3F72 A;  1XMK A;  1RR7 A;  4II3 A;  4YIF A;  1QA1 A;  2PMZ N;  2K9M A;  1U9N A;  1ZYR F;  3FY3 A;  2QDX A;  2QTZ A;  4AIJ A;  1PJ6 A;  4Z4U A;  3TBI A;  4D7N A;  5LGN A;  2K4J A;  2LBF B;  1OIS A;  1DAB A;  2OUM A;  3IH2 A;  2ZME A;  5EYR A;  2V7U A;  3S1N J;  4BPR A;  2WWY A;  4RS8 A;  1UD8 A;  4A2U A;  4U0Y A;  1D0Y A;  1JT0 A;  3I9V 2;  3Q9V A;  5HVQ C;  3K1P A;  3GSI A;  3R6J A;  2HPI A;  2QKM B;  1Y1V J;  2DMU A;  3O8G A;  4IO9 F;  3OE7 A;  2DFE A;  1K6Y A;  3QOE A;  1R5H A;  1VQK I;  3PJR A;  1WOP A;  1UFM A;  3AVX A;  3JRF A;  2RC6 A;  1SMY F;  2JRM A;  3SEJ A;  1P7J A;  3QU3 A;  3FX3 A;  3ZBT A;  5H6R A;  2LG4 A;  1Z3X A;  1BI2 A;  2DK8 A;  4C30 A;  3OEH A;  1LE8 B;  3BNW A;  5DUI A;  3ZZU A;  3PIO F;  2VBE A;  1J75 A;  2XTY A;  1HLV A;  1KGS A;  4IQ4 A;  5FO5 A;  1K61 A;  5EGO A;  3GTM J;  4P25 A;  4RB1 A;  3PSZ A;  1ON1 A;  3CD6 I;  1K78 A;  2ZO4 A;  4BJT A;  1QNT A;  5DYM A;  5TY0 A;  1XB2 A;  1N8R D;  3M8F A;  2VL8 A;  4QHY A;  3GTK J;  1I3Q J;  2EBI A;  1VQP B;  3AKZ A;  4XSX F;  3BH7 B;  3K2Z A;  4OPO A;  4PJM A;  1UD5 A;  5HKK A;  1T56 A;  1TW2 A;  1XCV A;  3IKV A;  4QPO A;  2DA6 A;  2RRE A;  1FP1 D;  1CNE A;  2LBF A;  3IC7 A;  2ZL5 A;  2Z8G A;  4I84 A;  4YC5 A;  4URR A;  2OJE D;  4BQA A;  3LJY A;  2COB A;  1KQS B;  4HG2 A;  2C5H A;  3ZGK A;  1NB0 A;  1FNC A;  2QCO A;  2XAU A;  4OPW A;  2VQL A;  3I55 B;  5J47 A;  1IZ1 A;  1S9H A;  2NS0 A;  1YIT I;  2WV0 A;  2J8K A;  2OD5 A;  2VON A;  5A89 A;  1R49 A;  3BT9 A;  2PQ8 A;  3F8B A;  2KIM A;  4B8X A;  1ITY A;  1W9X A;  1ZG1 A;  1ZLJ A;  3CMM A;  4NBQ A;  1JI8 A;  1QO0 D;  4Y15 A;  3CLO A;  3OSF A;  2BPO A;  1R9T J;  3QPS A;  2DAO A;  5FRN A;  3S1R J;  1B8I B;  2Y0S N;  2M2E A;  1FIA A;  1QU3 A;  1FYL A;  4HE6 A;  1KZL A;  3J7Y J;  1XCB A;  1FMW A;  4JX4 A;  3MMY B;  5FKN A;  5A8A A;  3I56 B;  3RZD J;  2LZJ A;  3BR2 A;  3F23 A;  2PMU A;  1K5C A;  5C4X J;  1B59 A;  1ENH A;  3O6B B;  1TC3 C;  2BGC A;  2WYR A;  3PFI A;  1Z21 A;  1ZQ3 P;  1MW7 A;  3FIW A;  3X2Q H;  2FX3 A;  1I1S A;  2ZFW A;  1G7C A;  5FRM A;  4RAZ A;  4OIQ F;  5FKM A;  4LIV A;  1KJZ A;  4P9F A;  2JA2 A;  3AVY A;  2VN2 A;  4XLH A;  4MXN A;  1EZG A;  1MMS A;  4FT8 A;  4HEA 2;  2IQ7 A;  2VKV A;  3H5N A;  3K4L A;  4RB2 C;  2HMA A;  4M53 A;  4P2N A;  3I59 A;  2ELJ A;  2JUG A;  3C2B A;  4MLO A;  2WC2 A;  2AHO A;  4R8H A;  5IYP A;  4RA2 A;  3VSV A;  4ZYH A;  4PAA A;  4OWR B;  2CBX A;  4Y9U A;  2FNA A;  2V5I A;  5CKT A;  5IYR A;  2XGD A;  2M8E A;  4CYC A;  1W0U A;  1WGX A;  3KYD B;  2DQL A;  2M8G X;  4GGG A;  4CCJ A;  4ZYG A;  1WWX A;  1PP7 U;  2DBB A;  1CF7 A;  1QGA A;  2WSS A;  4M1K A;  2BBY A;  2MA3 A;  2VNJ A;  3PUN A;  2FD5 A;  1VQL B;  1YW7 A;  2WAQ A;  4A3F J;  3FJO A;  4HE5 A;  1P4A A;  4XRM A;  4M9Z A;  5AIP A;  1XG1 A;  4B3X A;  1HDP A;  5FFX A;  1QBJ A;  3HEF A;  5BQT A;  2AQE A;  1H85 A;  2VKD A;  1YJ9 B;  1X1D A;  5FD6 A;  3BR0 A;  4AVZ A;  1NB9 A;  3PQJ A;  3QYF A;  1YO5 C;  1ZGA A;  3U1K A;  2JTV A;  1R1U A;  1LDJ A;  4AWX B;  1SVM A;  2MGQ A;  3EYI A;  3HGG A;  3V8L A;  3ZQL A;  2GXA A;  4II2 A;  1W1W E;  1QGZ A;  4WXC A;  5M5W J;  4XLC A;  1PJ7 A;  1NH3 A;  5IK2 A;  3ZUG A;  1VQN B;  1OFM A;  1POG A;  1KQ0 A;  3KZY A;  4HAM A;  5IT9 Z;  4NC6 A;  2CH0 A;  1W4M A;  2J8I A;  3KZZ A;  3U1D A;  1BMF A;  4RPD A;  2O7O A;  3RKW A;  2IRF G;  4N0B A;  2KL4 A;  2NYX A;  1Q9S A;  4D5F A;  1EFT A;  2JA8 J;  2F43 A;  4P3Y A;  3IH4 A;  1YRN B;  4DK0 A;  1AKH B;  2NS7 A;  2EZH A;  3WTT C;  4XQF A;  4IZZ A;  3JTH A;  2PBI A;  2DFH A;  1FSH A;  3W5U A;  1N06 A;  4IXA A;  1EKE A;  2LD5 A;  1Y1W J;  3OYM A;  1JTX A;  1IDJ A;  2CND A;  2QY1 A;  4CO8 A;  2BGI A;  1YYV A;  1NBM A;  2DFI A;  2OF7 A;  3PA2 A;  2KMU A;  4F92 B;  3J80 K;  3FKJ A;  4QFM A;  1VQ5 I;  3G1L A;  1A04 A;  4OMZ A;  4BQO A;  3ASP A;  3K7A J;  2CFO A;  5FLM J;  3HBL A;  1U8R A;  4YFK F;  3I4M J;  5M5X J;  3OW2 B;  3CUQ C;  5LHG A;  1K9M D;  4RM0 A;  2XTX A;  5KAF C;  1WPC A;  3EQN A;  1UD3 A;  2JN6 A;  3E0J B;  2UZK A;  4Z03 A;  1GQ8 A;  4DZJ A;  4P55 A;  4XSZ F;  1NDH A;  4IL6 C;  1Y0N A;  1O8D A;  5C1C A;  3T53 B;  2W7Z A;  2JA7 J;  1FDR A;  1IDK A;  2BVN A;  3WQZ A;  1W5T A;  2CFX A;  3B02 A;  3G2B A;  3T1B A;  3D26 A;  5LMZ A;  1OGM X;  2KIF A;  3T0Y A;  2X0K A;  3K4B A;  2I10 A;  3SJP A;  1XDS A;  1GV5 A;  5F6F A;  2VPL A;  4YAL A;  1HW2 A;  1F1Z A;  4XN3 A;  4BE0 A;  5LFA A;  2K3F A;  2A6H F;  4HV6 A;  1B6A A;  1IN6 A;  2QE7 A;  1O3S A;  2C77 A;  1VZ0 A;  4BH9 A;  4AYB N;  3WTX C;  3V7S A;  3K4M A;  2IXS A;  4Y52 J;  3CJQ B;  1R4M B;  2HTJ A;  3LAP A;  3A1Y A;  4MYT A;  2OAZ A;  4B4D A;  2X6W A;  3DFG A;  1KQ5 A;  1Y56 A;  2XRN A;  1QUE A;  4LBV A;  1R5O A;  2A61 A;  3R0J A;  2F48 A;  5BS6 A;  3OYF A;  3D1N I;  1PJ5 A;  2BSA A;  2P7V B;  1K6O A;  1U6G A;  1E17 A;  2HCJ B;  1T38 A;  3ZZ0 A;  4XR6 A;  3DXJ F;  1USS A;  1GT0 C;  1UMQ A;  2BSP A;  2M0M A;  2P6S A;  1MJB A;  4ON0 A;  4M71 A;  3S1Q J;  1J9I A;  1RZ4 A;  4NC7 A;  2ISY A;  3FXL A;  4LIU A;  4M74 A;  2B63 J;  3LA3 A;  3K6G A;  1A5J A;  1WH7 A;  2VAS A;  4Z06 A;  3MZY A;  3RJP A;  3S3N A;  4L9V A;  2ZXW H;  2H8R A;  3WNC A;  1E2X A;  3VO1 A;  2FXA A;  1MDM A;  2C6Y A;  1XDU A;  5BSX A;  1UD2 A;  2K9S A;  1Z67 A;  1CNF A;  3BCF A;  2L02 A;  3E5U A;  2LKP A;  5DD8 A;  4EH1 A;  1U5T A;  2VKH A;  1LLW A;  3MD2 A;  1P4M A;  1JUS A;  2BN4 A;  1QHH D;  5J8F A;  4LFU A;  3E6D A;  2VJI A;  5DNS A;  4BXX J;  2GJR A;  1SKQ A;  3G3Z A;  4Q5S F;  1T39 A;  3KX2 A;  4LG0 A;  5J4Y A;  4X05 A;  5E1Z B;  1UST A;  3C1D A;  1LM1 A;  2PLY A;  3JX8 A;  2DJI A;  2NT9 A;  2UVE A;  3G73 A;  2G0Y A;  2L9S A;  3TW6 A;  4RD6 A;  1KC8 D;  3CUQ A;  4B4C A;  3LNN A;  2D1V A;  3ZQC A;  1E3O C;  2HOE A;  5FRO A;  1W34 A;  1TWH J;  2K27 A;  3CQZ J;  4BJ6 C;  2HVS A;  1I1G A;  2Q2E B;  1SAN A;  1FY7 A;  1HW5 A;  2E7W A;  3R60 A;  3CDI A;  1T6X A;  5KVR A;  1QVF B;  4YZA A;  2ECC A;  2MH9 A;  3M8J A;  3PET A;  4V2G A;  5EJC A;  1EWY A;  4OM9 A;  3G4S I;  5BPI A;  1RR8 C;  3PM1 A;  1JJ2 B;  3OOC A;  3R6S A;  2Q8K A;  3U2R A;  3TL4 X;  1AKH A;  2VYQ A;  3HSR A;  3JU4 A;  2OV7 A;  3G6E I;  3AG1 H;  2R7F A;  5CQG A;  3HOS A;  1YI2 I;  4L18 B;  2KHM A;  1E79 A;  2O0V A;  4EQQ A;  3CMA B;  2DMQ A;  1OCO H;  2Q6O A;  2DPU A;  3P27 A;  3DU5 A;  1IN4 A;  3K4J A;  2VQG A;  1SFO J;  2CF4 A;  1MBF A;  3BQY A;  5FLV A;  3P9I A;  2ZL6 A;  2VE9 A;  3Q6R A;  2R5Y B;  5ILU A;  3MAJ A;  2HFH A;  2RQQ A;  1QH0 A;  2Q6I A;  1QHG A;  4HW0 A;  3V7R A;  1BJZ A;  5B3S H;  4DW6 A;  1JKR C;  5TGT A;  4Y9R A;  3SLN A;  4JX6 A;  1NG7 A;  1LDD A;  5TJJ A;  5EF6 A;  4PGG A;  3JQR A;  1MIJ A;  3G1O A;  4A5M A;  5DM6 F;  5L3F A;  4M9S A;  2NVY J;  4BDY A;  1V3F A;  4ZCL A;  4RAG A;  1F36 A;  2ODL A;  4EW9 A;  3WG7 H;  1ZM4 A;  1ON2 A;  1ZHF A;  5DDG A;  3LO8 A;  1JKO C;  4YAU A;  5KAI C;  1SFX A;  4RLZ A;  4LB6 B;  5EMN A;  3H3U A;  3TOB A;  2B0R A;  1OB5 A;  2OCC H;  2RNG A;  1CGP A;  1CF7 B;  3CC7 I;  3KLN A;  4OJ5 A;  1B9N A;  1YQA A;  3PNY A;  2X6O A;  4EGZ A;  2VXZ A;  3M1E A;  3WU2 C;  4E7J A;  3AL0 C;  4L5I A;  2BMW A;  4W8T A;  4XIC A;  3ES9 A;  1XD7 A;  3OZU A;  4PC6 A;  4ASN A;  3C2G A;  4ZZD A;  4FX4 A;  3S1M J;  2IBD A;  4AID A;  3W6J B;  3BWG A;  4RAY A;  2EZL A;  1LQ1 A;  2HVR A;  2X4H A;  2HDW A;  5JLW A;  2HYF A;  5KCM A;  2ETH A;  2GA1 A;  2X48 A;  1EFU A;  4IRG A;  4BGD A;  5ED4 A;  1WSR A;  1QZY A;  4ZZL A;  1OCR H;  2M5W A;  1R7J A;  4Z4Y A;  3TDZ C;  2IJL A;  2X0L A;  3FHN A;  2P5L C;  1TW3 A;  3LQR A;  4EM0 B;  2R5Z B;  4E7H A;  1LPQ A;  4TN1 A;  4P1V A;  2DA5 A;  4DNC A;  4X8I A;  1VLY A;  4E4H A;  4G7W A;  4PUS A;  2BHY A;  1XC5 A;  3TP3 A;  4CCL A;  4GQN A;  4OZY A;  3M9A A;  3A02 A;  1EFR A;  3OP1 A;  1U78 A;  5F4J A;  2CJJ A;  2XKP A;  2ZNZ A;  3BTJ A;  3VOE A;  1W36 C;  3ONY A;  1WOO A;  3S2H J;  4PZJ A;  2XF5 A;  1I6X A;  1RUN A;  4M0L A;  2A69 F;  2ZIT A;  2EJR A;  2L0K A;  4N3G A;  5D5U B;  1LB2 A;  3EDP A;  3RZO J;  1BX1 A;  1MBE A;  1KMH A;  3ZSC A;  2ZBU A;  3OR1 C;  3HHG A;  4MTD A;  2P8T A;  1R00 A;  4D1Q A;  3P26 A;  1JNY A;  2BM5 A;  2STT A;  2HXI A;  2DK5 A;  3HSF A;  1BIA A;  1V5G A;  2CO5 A;  2C2W A;  2R4G A;  1A8P A;  2F5F A;  1QZZ A;  4Z4T A;  4YCQ A;  1XB4 A;  2D1H A;  3W2I A;  3TW7 A;  1DDN A;  3VMF A;  1HVX A;  1R71 A;  2JPB A;  3SYT A;  4BQQ A;  3GTO J;  1G4D A;  3GTG J;  2HU9 A;  4RD4 A;  4P6V F;  4Y17 A;  2R9V A;  1J2X A;  4RD3 A;  1YI2 B;  1E64 A;  3JAM Z;  1IJW C;  3BTI A;  4AIH A;  1X2M A;  4M4S A;  1TTY A;  1R5I D;  2HOT A;  4BS9 A;  1VQ6 I;  1FPQ A;  1QRY A;  2LC2 A;  3Q0V A;  1WJD A;  3DP7 A;  4KIF A;  3H0G J;  4AYB A;  5KHD A;  2L5Q A;  4YFO A;  2UXX A;  4O3M A;  1S72 B;  1U3E M;  1LE8 A;  4PFP A;  3SEZ A;  4XRS A;  3T5X A;  2L4M A;  2HXO A;  3KP2 A;  3VYS B;  1QA3 A;  1YX3 A;  2GM4 A;  2KZV A;  4CIC A;  1COW A;  3OWT A;  4C3I J;  3LQQ A;  1OOC A;  4HZF A;  4BYY A;  3CCL B;  5KSW B;  2R5Z A;  4PJL A;  5ICF A;  4IHY A;  2VE8 A;  2DOE A;  2PG4 A;  3AAF A;  1PVE A;  2XGX A;  2MBF A;  2X3U A;  4TMX A;  4U88 A;  2L7F P;  3CXC B;  3H9G A;  4JX5 A;  5HS7 A;  3RYP A;  1U2W A;  2VBV A;  4M2L A;  2W6I A;  3KRG A;  3FDY A;  2DQR A;  3ZZT A;  4I02 A;  2YUH A;  4A6D A;  3OYG A;  4J19 A;  1B23 P;  1FIP A;  2KRC A;  1SD7 A;  5K5Q A;  3W6V A;  1H9G A;  3OZV A;  1FEX A;  4ENN A;  4LK1 F;  2JIZ A;  3AFH A;  1SMT A;  2LMD A;  1BI3 A;  1XGM A;  3SQV A;  1UEL B;  5K1Y A;  4KN4 X;  2Y2Z A;  3ZMU A;  2Q6K A;  3QWL A;  3BZC A;  5JFR A;  2RGV A;  3JRA A;  2DA4 A;  1AIR A;  1T5E A;  2OTJ B;  1HKS A;  2KPM A;  2R7S A;  1Z7U A;  1NRK A;  2UUZ A;  2EQR A;  4XLN F;  2UV1 A;  4IHW A;  3SHF A;  3B82 A;  3MZH A;  4C3J J;  4ACB A;  1I50 J;  5HDN A;  2HOS A;  1MNE A;  4AF7 A;  2EZK A;  3QSY A;  2RKH A;  2TDX A;  3OYL A;  2EV6 A;  4E7S A;  3CCQ I;  1QPM A;  4B43 A;  1CQX A;  4IX7 A;  4BBS J;  4HBL A;  5F0F A;  3CLQ A;  4DBQ A;  1UMK A;  3DU6 A;  3FKI J;  5GAE J;  4YAO A;  2HQN A;  3HM5 A;  4B47 A;  1O8J A;  1ZG3 A;  1VQ5 B;  5L3B A;  4PJ0 C;  3LSH A;  3NWT A;  2E2H J;  1D1N A;  2L01 A;  4JK1 X;  1JT6 A;  2VOD A;  2V1X A;  3CTA A;  3U21 A;  4NB5 A;  2GIV A;  4XKV A;  4LLL A;  2L3D A;  4KMU X;  3Q6Q A;  4UZE A;  2V26 A;  2W25 A;  1BL0 A;  2LF7 A;  3ASS A;  3ASQ A;  5TV2 A;  3PSF A;  4FXU A;  1ZK8 A;  2BW3 B;  2ZXJ A;  3GTL J;  3FBI B;  4PJN A;  4L0Z B;  1S7E A;  5CYV A;  3A01 B;  3KIO A;  2DFF A;  5TIS C;  3QFT A;  4MIM A;  2WAQ N;  3GW2 A;  4G7Z F;  2ZFU A;  4CYC B;  1K8A D;  2E1O A;  1IUY A;  3KEO A;  1J59 A;  2QMU A;  1LVK A;  3C3W A;  3ISP A;  2R7T A;  3IRQ A;  3COA C;  2BGJ A;  1H0M A;  4HYE A;  4P9S A;  3DPT A;  2KVO A;  3CPX A;  1GUU A;  3LSP A;  1BR4 A;  1N0V C;  2CV2 A;  2JDI A;  2XEX A;  4ZDL A;  2XAG A;  2ID3 A;  3BJO A;  3NAR A;  4IPA A;  4HF1 A;  2HDC A;  4UZF A;  2K7L A;  1MD0 A;  1O4X A;  1IA5 A;  5K7Z A;  3U9G A;  3GFL A;  4CCN A;  4NQW A;  1J5Y A;  1SC7 A;  4KKT A;  1JHH A;  4PJJ A;  2W7N A;  4MYU A;  3QYE A;  4Y7C A;  3CCU I;  3ZQQ A;  3CJR B;  3PUM A;  1BX0 A;  1EV7 A;  3K4C A;  3FPP A;  4YAF A;  2VUM J;  2BM0 A;  2E7X A;  3FBN B;  1VJS A;  4W8Q A;  4P96 A;  3WHB A;  4RD0 A;  1YS6 A;  1GVD A;  2M7A A;  4MNU A;  3GVJ A;  2EPF A;  2A5W A;  1JRG A;  2R7R A;  1U5T B;  1K79 A;  2FVG A;  2QGG A;  2PYH A;  4Z6Y A;  4OJ6 A;  2D3N A;  1J09 A;  2ADU A;  2EV5 A;  4HF0 A;  5IY5 H;  2PE3 A;  3T9G A;  4BQN A;  3S3O A;  2DA2 A;  1P4X A;  3K4K A;  1MDM B;  1DDG A;  3I71 A;  4QWQ A;  4EVI A;  1WSU A;  2X3H A;  1WVR A;  1ZH5 A;  4A3K J;  1WOS A;  3VSU A;  2ZTN A;  2CYY A;  1WXR A;  4HQE A;  1LEA A;  2EK5 A;  1FP2 A;  2B9S A;  3GTJ J;  3DV8 A;  2YWE A;  2DMP A;  4XRS G;  4XOP A;  1P9Q C;  3W2A A;  2R7Z J;  2NTP A;  2CUJ A;  2G9W A;  3GZN B;  3BCD A;  1ELO A;  3PUB A;  1OGI A;  1U9O A;  1KYW A;  3OYI A;  2HS5 A;  2KT0 A;  5CVU A;  3BY1 A;  1WI3 A;  2ESN A;  1BJA A;  5DEQ A;  3SY2 A;  2PFB A;  4OIN F;  4I0A A;  1BA5 A;  2V7X A;  3H9N A;  5CDF A;  1L0O C;  5FGM A;  1NTC A;  1ETQ A;  3L2U A;  4ENM A;  1G3W A;  1C0W A;  2A68 F;  2GK6 A;  3GQ8 A;  3S2W A;  2OZU A;  4XD7 A;  4N9I A;  3CCQ B;  2GXB A;  2JJ2 A;  3I0T A;  2NNN A;  4L0Y B;  2JVG A;  2IA1 A;  5D4R A;  4EAT A;  4YEL A;  1LFU P;  1H8A C;  2K02 A;  2CS3 A;  1IJE A;  3Q3A A;  4Q48 A;  5J1U A;  3I56 I;  2XGJ A;  4JMQ A;  2K9L A;  4I98 B;  3GQB A;  3W5V A;  2KIS A;  3PNV A;  2DET A;  3K1M A;  4RLQ A;  2H1L A;  2JSC A;  2MLG A;  1MMN A;  4OJO A;  3RPU D;  1FNB A;  3FK7 A;  5DV5 A;  2W24 A;  3LFK A;  4Y33 A;  1UHS A;  5J40 A;  2BE5 F;  4TMV A;  3DTI A;  1BHE A;  5L3D A;  3VFZ A;  3J81 Z;  1HG8 A;  3RSN A;  3N6Z A;  3H92 A;  1S0U A;  1WMR A;  1FC3 A;  4IEJ A;  3A3G A;  3HG9 A;  4UY8 I;  1TP4 A;  4AD9 A;  3OJW A;  3FKS A;  1G3T A;  4PC2 A;  4EEF G;  1BIB A;  2H94 A;  4DYR A;  2HOA A;  5TRD A;  5IPA A;  5EEG A;  1IO2 A;  4W1U A;  1AMO A;  2XZO A;  1RQP A;  4FET A;  1OR7 C;  3LSG A;  1JKQ C;  4O5V A;  3QU6 A;  2P4W A;  4ZGQ B;  2LK2 A;  5JR3 A;  2NOG A;  2D45 A;  4QIW N;  1YHQ I;  4OIR F;  3DLL F;  3A8J A;  2ELK A;  2KJB A;  2HWV A;  1TYU A;  1N75 A;  2V1D A;  2DLL A;  1XPX A;  2DXI A;  3WND A;  3BQJ A;  4IHX A;  1LJ9 A;  1MMD A;  1FZP B;  4C2T A;  2X9D A;  3H9J A;  3JCU C;  4ASU A;  1MJA A;  2CSO A;  2NVX J;  4OIP F;  5J3L A;  1P92 A;  1O8I A;  1RWR A;  3BR6 A;  4P26 A;  3ABK H;  1UG2 A;  5EEA A;  1FBU A;  1RMG A;  3VST A;  3W2V A;  4ESF A;  1GVH A;  2ZKZ A;  2AXL A;  2BVM A;  2R0Q C;  1FTZ A;  3OYC A;  1N77 A;  2ISZ A;  4UAJ A;  2QUF A;  1HST A;  3KET A;  3L2W A;  1K28 D;  2F1M A;  2EFN A;  2PX9 A;  3ONU A;  1A6Q A;  1G3Y A;  1YE9 A;  2KIQ A;  3NEU A;  2QBY A;  1KA8 A;  3HOX J;  3B6A A;  3AGP A;  3RDI A;  1VBL A;  1FBQ A;  3BLY A;  2LVS A;  1QQ1 A;  1J7K A;  1X2N A;  3BPX A;  3MWM A;  5LRR A;  2Q6L A;  1X1A A;  2QGU A;  3B73 A;  1BBY A;  1TVC A;  5F0C A;  2GQQ A;  4MHG A;  1LEB A;  2QZ8 A;  4GDF A;  1EH8 A;  1YJW I;  2XOK A;  3GZ6 A;  1HSJ A;  2E19 A;  1JUM A;  1SVO A;  2ZJP F;  1LLZ A;  4YDT A;  1MRZ A;  4FE4 A;  2ZXH A;  3FXM A;  4OAZ A;  2FJ1 A;  1Y6I A;  2BY2 A;  1S72 I;  1VQM B;  1S29 A;  2VBK A;  2BF4 A;  2WPD A;  2HLD A;  1R22 A;  3PUF A;  4HNT A;  3KP6 A;  2ID6 A;  3EET A;  5D5X B;  4FAS D;  2BM7 A;  4X0G A;  3BH6 B;  4Z05 A;  2MD5 A;  3ABT A;  1LKX A;  2EH3 A;  3HC7 A;  3BZ6 A;  5M3M J;  4PAB A;  5B6I A;  4MR0 A;  2CV0 A;  1YW8 A;  3J7A O;  1NHC A;  3I1F A;  3KYL A;  3T56 B;  2Z5U A;  2X1D A;  3GLX A;  1VHO A;  2YPR A;  2XAJ A;  2E1R A;  4CCK A;  4CH7 A;  5GAD J;  2WY7 Q;  5DN6 A;  2ZZQ A;  1FNN A;  4PCQ A;  2M4G A;  3A2K A;  3PEN A;  3H5R A;  5DSZ A;  2LSO A;  5JVT A;  4X7D A;  3ZN0 A;  4ENK A;  1DU6 A;  2CWE A;  1V0F A;  1VQK B;  2MYS A;  4I6Z A;  2XAF A;  3NAW A;  1TNS A;  4WK8 F;  5E18 F;  4IOA F;  2XND A;  4X07 A;  3MKL A;  4H9G A;  4M6V A;  1A35 A;  1FT9 A;  3CJT B;  4ZTJ A;  1H9T A;  3ML3 A;  3OZW A;  2MW8 A;  3GFJ A;  5IT9 K;  1ZAO A;  2DMT A;  1RKW A;  5ICE A;  2XC1 A;  2MH2 A;  1X1P A;  2YUS A;  4JBA A;  4QVJ A;  4ZTF A;  1HXD A;  1E0E A;  2E35 A;  1W7P D;  3OS1 A;  2VT3 A;  1U0J A;  3ZQI A;  1LDK B;  6PAX A;  4A3B J;  5D6F A;  3JRD A;  2VQC A;  3GME A;  2LY9 A;  2WA0 A;  4HOB A;  2GJK A;  4OOX A;  2E1B A;  1QRB A;  3S2D J;  4MQV A;  5ICC A;  3ZP5 A;  2YS9 A;  3GTP J;  1ONV A;  3DTE A;  2IS4 A;  2Y48 A;  3IRR A;  2O0Y A;  2BHZ A;  2Y0M A;  4DOZ A;  3BH4 A;  3R61 A;  3LOC A;  4LGW A;  1ZM2 A;  3GO5 A;  4BNC A;  1OHH A;  3I53 A;  4NBS A;  4PSX A;  2NPF A;  4BL0 B;  2D3L A;  1K78 B;  5BSY A;  1A31 A;  2O8K A;  3OMY A;  4I2O A;  3U6K A;  1D0Z A;  1D5V A;  3RQ4 A;  4V19 K;  4QTR A;  1N05 A;  2B7E A;  3FXJ A;  1SD4 A;  2LRD A;  1WQ2 A;  2XUB A;  2QEX B;  2NAZ A;  1O8E A;  1G6N A;  2QSF X;  2XHK A;  1ZRF A;  3HDD A;  3TP0 A;  3K70 D;  3ZPP A;  4RDL A;  4BJ5 C;  1Q1H A;  1PXZ A;  3OYB A;  5BPD A;  3MCA A;  3O8H A;  1JGS A;  5F04 A;  5LRS A;  1TLL A;  1WTH D;  2E5N A;  1X4P A;  2E1N A;  4E7Z A;  2Z99 A;  3B90 A;  2I5U A;  2A6E F;  1YIT B;  3TGN A;  4XM3 A;  3IAS 2;  1EF4 A;  3ULQ B;  3RCO A;  1HOM A;  1QVT A;  4P1W A;  2EFG A;  2FUG 2;  1Q1V A;  1E3P A;  2XIG A;  2ZNY A;  3P7N A;  2RDP A;  2RVC A;  4M3D A;  1E63 A;  2RC4 A;  4HV5 A;  4F7Z A;  3ZPL A;  1UB9 A;  2G7H A;  5HLG A;  2OC6 A;  2UVF A;  4LMY A;  4HST A;  1YW9 A;  1ZAR A;  2VI6 A;  4F52 A;  4FN5 A;  2RQP A;  3EUK L;  1O8K A;  4BUP A;  2RC5 A;  1X58 A;  4KIB A;  3WTS C;  5D5W B;  2YU9 J;  5J1Y A;  3I3L A;  4O6J A;  3KZI C;  3FXO A;  1XSD A;  2W48 A;  5D5V B;  1UD4 A;  2OZ6 A;  3SZT A;  3ZXS A;  4TT3 A;  1Z6R A;  1PE9 A;  4MEX F;  4TMW A;  3CCL I;  3SZE A;  4LBY A;  5EG0 B;  5FA6 A;  1ZR2 A;  3ZMD A;  3OOP A;  1RET A;  3WBJ A;  1H8E A;  2VB6 A;  4AIK A;  2IVM A;  3LSI A;  3CB4 A;  2PJR A;  3NE5 B;  3FHZ A;  1MBH A;  2ZBV A;  2JQ7 A;  1PUE E;  4RJL A;  3PFY A;  2K5C A;  3GFI A;  4X7E A;  2BEO A;  2IS1 A;  3I54 A;  1DPU A;  3TH0 A;  2V6E A;  5JHF A;  2GOX B;  2Z3Y A;  2CU7 A;  3E3V A;  4AM3 A;  3GX4 X;  1ZM3 A;  3HXL A;  1IF1 A;  2NZM A;  3HOT A;  1P2F A;  3QPT A;  4LD5 A;  1WRJ A;  1DGR M;  4UV9 A;  2KFD A;  1I7P A;  2X51 A;  2BM6 A;  5AON A;  3OOU A;  2M1B A;  3BP8 A;  1OB2 A;  2YR2 A;  3Q3S A;  2K9N A;  1PLU A;  2XDV A;  5LHH A;  2F1L A;  1GLN A;  2FOK A;  2FSW A;  5B1B H;  5F0H A;  2BV3 A;  2DER A;  3IV5 A;  1KTV A;  5FKL A;  3MQ0 A;  3CCM I;  5CJ9 A;  5C3E J;  4A3M J;  2QTL A;  1TYV A;  5F27 A;  3CCR B;  1FOY A;  3CCJ I;  3LSK A;  3OSG A;  4C43 A;  1KK2 A;  2IS2 A;  4WCG A;  1VQO I;  2Z9O A;  5F4M A;  2XC7 A;  4UB8 C;  2O3F A;  4G8X A;  4XN0 A;  4UZU A;  2WB1 N;  3BTL A;  1OR7 A;  3CC2 I;  2H6B A;  4IHS A;  2L7K A;  2VBW A;  3QP5 A;  3BCB A;  3A0B C;  4E7I A;  1F60 A;  4D0P A;  3L1P A;  3A01 A;  4P5O A;  4RGS A;  4WQM A;  1M90 D;  2ZBK A;  1VF9 A;  3KFW X;  1JUP A;  1Q7Y D;  2O5R A;  2VJ4 A;  3FIS A;  1ZM9 A;  4X7F A;  3T8R A;  4EJT A;  1QFY A;  1QGY A;  1S6L A;  2N8G A;  2F4I A;  3OW7 A;  4OOS A;  2R3S A;  4MEY F;  1HW1 A;  3W5H A;  1IUF A;  1IRX A;  5DS9 A;  1D8J A;  1O8M A;  3Q0U A;  1SVL A;  5GPA A;  4L5E A;  2CQK A;  3DWL E;  4KH3 A;  5F08 A;  3KYC B;  2JVH A;  2B0L A;  3DDY A;  1H80 A;  2DDB A;  1BLI A;  2V7Q A;  4XMY A;  2QSG X;  3LMW A;  1DP3 A;  2DI3 A;  3SUC A;  2XTW A;  2GZW A;  1DGW Y;  3EUH C;  5IP6 A;  5L3G A;  5BOX A;  1XQB A;  2B5O A;  1OPC A;  1R58 A;  2VQH A;  2XAQ A;  1REP C;  2JN9 A;  1EP3 B;  2QXZ A;  1WI9 A;  4D7M A;  3N97 A;  2YWH A;  3EQO A;  3NB2 A;  2IPQ X;  1U2R A;  2JA6 J;  3MMP A;  1ETY A;  5JBQ A;  1Q86 D;  3LQE A;  4RPB A;  5J8C A;  4C2U A;  1OB0 A;  1S4M A;  2RNJ A;  2CRG A;  4ZH4 F;  4H4K C;  1WKM A;  3O2P E;  1VQP I;  3MKW B;  1B9M A;  2FBI A;  4B44 A;  1IRF A;  3M1C A;  3B78 A;  2XKO A;  4KIC A;  1TZL A;  4RB0 A;  3DLA A;  1T08 B;  2DT7 B;  3H3Z A;  3GF2 A;  3CCS I;  1SKY B;  4AVP A;  4OJL A;  4X6A J;  4IVN A;  5D8L B;  4PC7 A;  4CSW A;  4BY1 J;  4Z4V A;  1PP8 F;  4KNY A;  3ZMS A;  2F5V A;  4KKU A;  2F3L A;  1PJR A;  1EP2 B;  4DGW B;  2V4D A;  2JWT A;  3IWF A;  4HWV A;  3H1C A;  4XKB A;  5JLX A;  4YIR X;  4IQJ A;  2CRV A;  2GXG A;  4OAY A;  4JRA C;  4JP0 A;  1JA0 A;  1CQT A;  5H59 A;  1ERD A;  2G7U A;  3WWG A;  4A3C J;  4L9J A;  4EM1 A;  3ISX A;  3D5S C;  3L00 A;  4WF2 A;  2DYI A;  5ERI A;  1IB4 A;  1XS9 A;  3GCM A;  3BZK A;  3SZP A;  4CA0 A;  2FNP A;  3HOU J;  1DQU A;  1MJ9 A;  3RY8 A;  3CJN A;  1DU0 A;  2DCE A;  1ZKG A;  1PKV A;  2R7O A;  1I27 A;  2LDU A;  3WE3 A;  4E70 A;  4UNO A;  2VXD A;  2YWG A;  3IP4 B;  3H0D A;  2FMY A;  3I5U A;  1STZ A;  1EH6 A;  5FLX K;  1SFE A;  4RM3 A;  4RD1 A;  3J81 k;  1D1C A;  2ZC2 A;  2M30 A;  1YJ9 I;  1OFE A;  2KQR A;  2ME6 A;  1R1V A;  4K1X A;  1TBX A;  2MD0 A;  3H5A A;  2PYG A;  1FRQ A;  1GAQ A;  1SD6 A;  1V4R A;  3WE2 A;  2BX6 A;  4ESB A;  4PDK A;  4QVA A;  1YOV B;  4XLE A;  2J5O A;  3LSM A;  3G6E B;  5GAG J;  1SFK A;  2ZZG A;  1GV2 A;  1I5Z A;  1Y0U A;  4PMH A;  1W7P A;  3TO7 A;  1Y39 A;  1BQE A;  3L7W A;  3S3M A;  3GUD A;  3HUG B;  2HEO A;  4OMY A;  3CRZ A;  3CC2 B;  4G9Y A;  2NTB A;  2Y75 A;  3I64 A;  5B5E C;  3OJX A;  3BG6 A;  2AS5 F;  1WJA A;  4U0W A;  2M9H A;  5HLI A;  2GA2 A;  3MVP A;  2ACJ A;  1L3L A;  1QZE A;  4W8R A;  4OPS A;  2AQF A;  5JMC B;  3GTQ J;  4C3H J;  4ROX A;  4BHB A;  1MBG A;  1WJ5 A;  1HBX G;  1QG0 A;  3AVV A;  4RD2 A;  3I58 A;  3IH3 A;  3VSK A;  1BJK A;  2GWR A;  2F5C A;  3JQQ A;  4RCZ A;  3PSS A;  3FMQ A;  1QVU A;  3S32 A;  2JUC A;  3E1S A;  4IKF A;  1XMX A;  1O8G A;  4V02 C;  2MSY A;  3HIF A;  5HNF A;  1P6R A;  1FYM A;  2XPW A;  1HZE A;  1MAB A;  3L2Q A;  2ME0 A;  2Z33 A;  3D5L A;  4KJZ A;  1YX2 A;  3U6B A;  4LB5 A;  2WZN A;  4KN7 X;  3MKZ A;  1ZG5 A;  2C5B A;  1HF0 A;  3L09 A;  2IGO A;  2D9R A;  2XVC A;  4BHP A;  5B1A H;  4HRI A;  1IDZ A;  2OPT A;  3E7L A;  2HTS A;  3SXY A;  2R93 J;  3BJA A;  3JRI A;  5H5J A;  4MQ9 F;  3Q38 A;  4MFD A;  4F7D A;  5ILS A;  5A88 A;  3K1N A;  3QAH A;  2ZCW A;  4AF6 A;  4JQF A;  3QRF F;  1TT5 B;  1Z6T A;  1FND A;  4DZP A;  2DU9 A;  5IYB J;  1FWZ A;  4IHT A;  3DBR B;  2VFQ A;  2AHQ A;  3WGI A;  4QLC U;  1B72 B;  2JZY A;  2OTL I;  1MGT A;  1I18 A;  3LYC A;  3DKX A;  2DTR A;  2EIL H;  3HZJ A;  1ETW A;  4S0H B;  4W97 A;  4IOC F;  1TWC J;  1G7T A;  2CGP A;  3I55 I;  4CYD A;  3JRE A;  3BC8 A;  3LMM A;  3ASN H;  1Y0R A;  2V1N A;  4LBZ A;  1QRC A;  4BEH B;  3J80 Z;  4G7X A;  4U87 A;  5DTD A;  1G2H A;  3BR3 A;  3FZV A;  1APL C;  1MSF C;  1JXS A;  4NCN A;  4UVB A;  1SM4 A;  2EIN H;  1WU8 A;  1G8X A;  2ZTG A;  4LIT A;  3HPH A;  2BW3 A;  1PDN C;  4EM2 A;  2R7D A;  4KFC A;  4X1E A;  5H2F C;  3A1P A;  4X06 A;  5GV7 A;  4BDZ A;  3MHP A;  5E79 C;  4GYG A;  3JW4 A;  1OCC H;  4KKS A;  4OOV A;  2F4O B;  1SAX A;  2QBY B;  5H20 A;  1XGN A;  1VTN C;  4AC9 A;  1DBO A;  5DUK A;  1X3U A;  5LLQ A;  5C4J J;  2KLO A;  2WJV A;  4BXU A;  3SFZ A;  1B1B A;  4YEI A;  1RNL A;  5HS9 A;  3L2C A;  2BVL A;  3JUR A;  5L3C A;  5KNL A;  2M0C A;  1I8D A;  1IHM A;  3FF5 A;  2B7B A;  2IOU G;  3CES A;  4HX7 A;  4BAC A;  4U7B A;  1SAU A;  4AUX A;  3DEU A;  1IB0 A;  3GQA A;  4M3B A;  4EMS A;  1F4K A;  1S7O A;  4A6E A;  3PSI A;  2XRO A;  2HYJ A;  5FLX Z;  3DPU A;  5CPR B;  4GCV A;  2CQN A;  3DBL B;  4A69 C;  4EJW A;  3SJM A;  3RKQ A;  4C0S A;  4PFO A;  2HDN B;  1XX5 A;  4NC8 A;  4UXN A;  4HNV A;  1JHF A;  1FTT A;  4G1V A;  4W8S A;  1YIJ B;  2NXN B;  4YFN F;  2ZL7 A;  3FWE A;  1RKT A;  2FA5 A;  3E6C C;  3H9Q A;  1FOW A;  2J5P A;  3CME I;  1F43 A;  3ML6 A;  5J1R A;  4FTH A;  2RV8 A;  3VOD A;  2YX7 A;  1MH4 A;  2DTZ A;  3RYR A;  3BY6 A;  3PIP F;  3CCE B;  4I76 A;  2QKL B;  2XSD C;  4DQL A;  1AA7 A;  1WDT A;  2GOM A;  1ZUN B;  2V79 A;  5FIU A;  1QFZ A;  2ESH A;  3BOQ A;  1GJR A;  1DG1 G;  2BXY A;  4OP7 A;  1TL8 A;  1JA1 A;  1JB9 A;  1HKQ A;  2GK7 A;  3E20 A;  4LLN A;  3LA2 A;  2NRA C;  4E7L A;  2VNH A;  4A0Z A;  5FJ8 J;  3KP7 A;  1OFC X;  4RDJ A;  3LWF A;  3TQN A;  2FOW A;  4BE1 A;  1EXM A;  4ZDP A;  1TWG J;  2VIX A;  3SLD A;  3OIQ A;  4WXH A;  5FO1 A;  2BY1 A;  3TMO A;  3CCR I;  3HJE A;  3WTV C;  1MZB A;  4KT5 C;  2O61 A;  1VQ9 B;  1VI0 A;  5HOD A;  2LR8 A;  4LG3 A;  3ERE D;  1JE8 A;  5DS0 A;  5LGT A;  4GO1 A;  4H0E A;  4NHJ A;  2OU2 A;  3VNV A;  2Y0S A;  3CMA I;  1VQ8 B;  2V9P A;  3BDD A;  4M3E A;  2E5Z A;  4QV2 A;  5GTH C;  4TMZ A;  1XG2 A;  1JJ8 C;  3CMY A;  3W6K B;  1MND A;  4U0V A;  5DCF A;  4UUS B;  3FM5 A;  4LC0 A;  1SEU A;  2ZSI B;  2KRH A;  3CP2 A;  1BC7 C;  2M7B A;  3BR1 A;  3TO6 A;  2LLK A;  2LP0 A;  2R7X A;  3TO9 A;  5GTI C;  3JRC A;  2Y30 A;  4RGU A;  3CO7 C;  1QQI A;  3SQN A;  3P9K A;  5H6Q A;  3W2E A;  3HL2 A;  4DBR A;  2WJY A;  2Z1D A;  3V76 A;  2LNB A;  3AVU A;  3P4G A;  2ZJR F;  2DT5 A;  4ETS A;  4G7H F;  1B2R A;  2GRE A;  4TKO B;  4DQK A;  4ZYD A;  4NDL A;  2VNK A;  3V4G A;  2GLO A;  3JSP A;  3BPV A;  3T51 B;  1H89 C;  1E1Q A;  3PL8 A;  2M3A A;  3G4S B;  4EJO A;  2F2E A;  4ENJ A;  2VBY A;  2D5V A;  1Y8R B;  2ZSH B;  3KEW A;  1X0C A;  1J9Z A;  3FXU A;  3OIO A;  5EEH A;  4B3A A;  2NVQ J;  3FPK A;  3PA1 A;  2OCE A;  4RDK A;  1GDT A;  2KIU A;  2LH9 A;  3CDH A;  3E5Q A;  3G1M A;  4XOR A;  3G71 I;  4HA8 A;  3RTR A;  2TRT A;  1ZN2 A;  4I01 A;  4X0C A;  4BXF A;  3RIQ A;  3CF2 A;  2E2I J;  3W2G A;  1MNM C;  2JA5 J;  3LA7 A;  1V5F A;  1ODD A;  3G71 B;  2QWW A;  1VQ7 I;  5EDN A;  2XAS A;  1WJB A;  1OCP A;  2BY0 A;  4PGH A;  2E1M B;  5LBQ A;  2WB1 A;  4FQG A;  2OYN A;  2P0W A;  4U7D A;  4G94 A;  2HI3 A;  5JHU A;  4BE2 A;  2WBM A;  2CW8 A;  2QA4 I;  2NVU B;  1ZGW A;  3T8T A;  3CZ6 A;  2FEZ A;  4CHU A;  2IGM A;  4ZV4 A;  3J81 K;  1BR1 A;  4M6Y A;  1Q82 D;  3OV8 A;  4IRI A;  1R23 A;  4A0X A;  4LBW A;  2E36 A;  2PEC A;  2FRH A;  2MC4 A;  2VFO A;  1RES A;  2WTE A;  3EYY A;  3ASR A;  1RUO A;  1M1K D;  2PMZ A;  1WZ2 A;  2FBH A;  1IC8 A;  1ZTR A;  1EA3 A;  4TSF A;  4CCM A;  4RGX A;  4XL9 A;  4HX8 A;  3WTY C;  1H88 C;  2XAH A;  1KU7 A;  4WWV A;  3B8Y A;  2VBZ A;  5E20 A;  2PJP A;  4UUT A;  3Q0W A;  3DEW A;  2K85 A;  4IW3 B;  3HKZ N;  1HF2 A;  4HIZ A;  1FLI A;  3C7J A;  4E6K G;  1QVG B;  2WAD A;  2IEK A;  4F91 B;  2IT0 A;  2F4N A;  3F22 A;  2EWE A;  2F5E A;  5E8I A;  4A3L J;  1XGO A;  2XV4 S;  1O7F A;  3FMR A;  1N07 A;  3LVB A;  3QPL A;  2VZL A;  4A3D J;  3LSJ A;  2VFN A;  9ANT A;  5L46 A;  4YEJ A;  2JMW A;  2VJJ A;  2GIZ A;  2JK3 A;  3AVW A;  2Z6B D;  2E34 A;  4DNR B;  1F9N A;  1T0F A;  5EZH A;  1IRZ A;  2VBU A;  3QPH A;  1CZF A;  3AK5 A;  4U4B A;  5LHI A;  1MBK A;  3HB9 A;  2DPD A;  2C78 A;  3VO2 A;  4OU0 A;  2E1C A;  4Z4S A;  3OL3 A;  1VQ8 I;  3AG2 H;  2LOO A;  3CUO A;  3AGQ A;  3SKB A;  2BYV E;  3R4K A;  4G12 A;  3BG7 A;  1O3Q A;  2XT4 A;  2XB5 A;  1R5N A;  1IW7 F;  3ELK A;  3K70 C;  1LFP A;  3S93 A;  4PC1 A;  4C2M J;  1VQL I;  1QA2 A;  2BM1 A;  4WWC A;  3ABM H;  3ESW B;  3C18 A;  2R7V A;  3EUA A;  1GXQ A;  3PO2 J;  3ECO A;  1RU4 A;  5IYC J;  3J7A Y;  1VND A;  1T6S A;  2NS8 A;  5F64 A;  5FB2 A;  4OPV A;  4BEH A;  2VBS A;  1CLW A;  4A3J J;  4F93 B;  5M5Y J;  2XPV A;  1Z77 A;  2IA0 A;  1T98 A;  1XSV A;  4A5N A;  1O3T A;  1HQC A;  4A3G J;  4G6I A;  1K4S A;  2DOA A;  3WTU C;  2PMH A;  1B72 A;  2Q2E A;  1E3X A;  4JYK A;  2NOJ B;  3OL4 A;  4DYC A;  1NK3 P;  4XKC A;  5IYN A;  5IOY A;  4FE7 A;  3VPR A;  3LST A;  1E3Z A;  3B4N A;  5DM7 F;  1T6Z A;  3VSL A;  2CMP A;  2L4A A;  1E3H A;  2P5K A;  3F9K A;  3NWS A;  3VYR B;  3EQL F;  1G3S A;  4CQJ A;  2LY1 A;  3GFM A;  1FRN A;  3OIP A;  5ICG A;  3WU1 B;  1QPI A;  3V7A A;  3M07 A;  3K2A A;  4M6X A;  3L2R A;  1FYK A;  1JKP C;  3FXK A;  1E62 A;  1VQM I;  1NG6 A;  2FE3 A;  3BTC A;  3WGH A;  1BPL A;  2QN6 A;  4NK8 A;  5M3F J;  2K40 A;  5A2Q K;  3AST A;  5GPC A;  3ZRG A;  4BBR J;  2KKO A;  4FX0 A;  3GVK A;  1A36 A;  3JSO A;  1WCM J;  3ZBU A;  2VFP A;  3MZ8 A;  3C2H A;  1B8I A;  4DIQ A;  2HGC A;  1IN5 A;  1SD5 A;  3FXR A;  1KU2 A;  2IP2 A;  1T2K A;  3SDB A;  1Y8Q B;  1M1E B;  1KCD A;  5LEK A;  2CUZ A;  1UCR A;  1WSV A;  4A3E J;  3GYH X;  1D1B A;  4ACA A;  3ECH A;  1KK0 A;  1IXS B;  2CQQ A;  4PK4 A;  3F6V A;  1VQO B;  1EH7 A;  2OQG A;  4QSH A;  2DOD A;  1FOK A;  1YHQ B;  1BR2 A;  4E7K A;  3CD6 B;  3ERM A;  2BV6 A;  2GBY A;  1JTA A;  1X19 A;  1TWA J;  1W0T A;  2XF7 A;  3Q5F A;  2DN0 A;  1QX4 A;  5C1E A;  4R79 A;  2DYS H;  1Z1D A;  4EJV A;  2UWM A;  3F6O A;  3F8C A;  1Z91 A;  1EA0 A;  2OTL B;  1KQ9 A;  3OYJ A;  1FJL A;  1ETX A;  2CUF A;  4GXO A;  5D6E A;  4IHV A;  1N0U A;  2GQF A;  2FQ3 A;  1MKM A;  2ECB A;  4FIS A;  1K73 D;  1Z0X A;  5E3O A;  2H8W A;  1W0J A;  2VBX A;  4L8J A;  4M3G A;  3QFR A;  2QM3 A;  1E1R A;  5EGO B;  2B7C A;  3BQZ A;  3CC4 B;  1TYX A;  4YZX A;  5LEJ A;  2VFM A;  2VLA A;  2YSR A;  5LD2 C;  3WHC A;  2BZT A;  2QLZ A;  1R5G A;  2ZZF A;  3Q39 A;  4PSW A;  3A0H C;  3TDU C;  3I4P A;  2DO7 A;  5J6X A;  1TT0 A;  1AOY A;  4UV8 A;  4KIG A;  4V2F A;  4XLA A;  3K69 A; 
#chains in the Genus database with same CATH homology
 4XMY A;  1OOC A;  3LMW A;  1DP3 A;  3SUC A;  1DGW Y;  2WY8 Q;  2DIE A;  3EUH C;  2W4S A;  4PJL A;  4Y4R A;  2VQH A;  3OYK A;  1WJE A;  1D0X A;  2QXZ A;  2X6X A;  2GJP A;  3EQO A;  3DPL C;  3H9G A;  2E60 A;  2Q1Z B;  1ZEL A;  2W6I A;  3KRG A;  2WAF A;  3FDY A;  3GRH A;  4C2U A;  4N4O B;  1OB0 A;  2XSJ C;  3OYG A;  2NT6 A;  3GQ7 A;  3ZIA A;  2KRC A;  3W2W A;  4H4K C;  3MKW B;  3IUO A;  4II3 A;  3M1C A;  4NUB A;  4B44 A;  3VWB A;  2JIZ A;  2XZP A;  3AFH A;  2K9M A;  1TZL A;  3DLA A;  3FY3 A;  1UEL B;  2DT7 B;  1SKY B;  4OJL A;  4QPQ A;  3TBI A;  1W0K A;  2LBF B;  2OUM A;  3QYB A;  4CSW A;  1AIR A;  1T5E A;  2KPM A;  2R7S A;  1NRK A;  1UD8 A;  1D0Y A;  2UUZ A;  2F5V A;  2F6C A;  4J01 A;  2UV1 A;  1PJR A;  3I9V 2;  4N4N B;  4KKU A;  4DGW B;  2V4D A;  1FX0 A;  5HVQ C;  2LY2 A;  1MNE A;  4HWV A;  4XKB A;  4IQJ A;  2HPI A;  3OYL A;  2QKM B;  4E7S A;  4OAY A;  2W82 A;  4B43 A;  3OE7 A;  3QOE A;  1K6Y A;  4IX7 A;  1QCX A;  3PJR A;  1KCC A;  3DQV C;  1ERD A;  3WWG A;  4DBQ A;  3DU6 A;  3D5S C;  4B47 A;  1O8J A;  1IB4 A;  3LSH A;  3NWT A;  2LG4 A;  4CA0 A;  1Z3X A;  4C30 A;  3OEH A;  1DQU A;  2VBE A;  2DCE A;  3SZG A;  1G59 A;  2R7O A;  1PKV A;  4IQ4 A;  3U21 A;  2VXD A;  1WJC A;  4XKV A;  3IP4 B;  3H0D A;  3OR2 C;  2V26 A;  2O17 A;  4BJT A;  4RM3 A;  1D1C A;  2L2O A;  2VL8 A;  3PSF A;  1BOB A;  2BW3 B;  4XON A;  3FBI B;  2KQR A;  4PJN A;  4FXU A;  3LL7 A;  2MD0 A;  3AKZ A;  3H5A A;  2PYG A;  2WZP P;  2ZFU A;  4PJM A;  1UD5 A;  5HKK A;  4QPO A;  2RRE A;  2LBF A;  4I84 A;  2INU A;  1LVK A;  2IS6 A;  4XLE A;  2R7T A;  4URR A;  3LSM A;  1YX5 A;  2ZZG A;  1SFK A;  2NST A;  3DPT A;  2KVO A;  4PMH A;  4HG2 A;  1BR4 A;  2CV2 A;  3ZGK A;  3S3M A;  2JDI A;  3HUG B;  4U49 A;  4ZDL A;  2NTB A;  2XAU A;  2VQL A;  1KON A;  1S9H A;  3GVL A;  3BG6 A;  1WJA A;  1IA5 A;  1W9X A;  5FL7 A;  4W8R A;  2HPM A;  2AQF A;  3CMM A;  4CCN A;  1JI8 A;  4KKT A;  4PJJ A;  2W7N A;  3QYE A;  1WJ5 A;  2A6T A;  2VBM A;  3ZPN A;  3VSK A;  3ZQQ A;  3CJR B;  5FRN A;  3FPP A;  3K4C A;  1HA8 A;  1QU3 A;  3S32 A;  2X1E A;  3E1S A;  4IKF A;  3FBN B;  1VF7 A;  1VJS A;  5HNF A;  1O8G A;  1HZE A;  1KZL A;  1MAB A;  4W8Q A;  3L2Q A;  3D5L A;  2M7A A;  1FMW A;  4KJZ A;  3GVJ A;  2A5W A;  3MMY B;  2R7R A;  1H8H A;  1JRG A;  2PYH A;  4OJ6 A;  2D3N A;  4RMN A;  1J09 A;  4CCO A;  3MKZ A;  2LZJ A;  3T9G A;  4BQN A;  3S3O A;  1K5C A;  2IGO A;  3OYH A;  3K4K A;  1UAA A;  1EE6 A;  1Z21 A;  1MW7 A;  4HRI A;  3HAG A;  4C9Y A;  3DTK A;  5FRM A;  2X3H A;  4LIV A;  3VSU A;  2JA2 A;  2ZTN A;  4XLH A;  4MXN A;  3SEQ A;  1MMG A;  3DKY A;  4HEA 2;  4JQF A;  2IQ7 A;  3K4L A;  3H5N A;  4J00 A;  4XOP A;  1P9Q C;  3W2A A;  2ELJ A;  2JUG A;  2CUJ A;  1I18 A;  2NTP A;  1WP6 A;  4MLO A;  3DKX A;  3BCD A;  3PUB A;  3OPO A;  3OYD A;  3OYI A;  3VSV A;  3N05 A;  4OWR B;  3BC8 A;  3LMM A;  2V1N A;  5CKT A;  4BEH B;  5CDF A;  4G7X A;  4U87 A;  3L2U A;  1X4O A;  4CCJ A;  2ZTG A;  1G8X A;  2GK6 A;  4LIT A;  3HPH A;  2WSS A;  3GQ8 A;  2BW3 A;  2LRE A;  2MAB A;  4XD7 A;  2JJ2 A;  2WAQ A;  4XKW A;  4BDZ A;  2JVG A;  4KKS A;  4B3X A;  4EAT A;  4YEL A;  2AQE A;  3OEE A;  2VKD A;  1DBO A;  1X1D A;  2CS3 A;  4AVZ A;  2XGJ A;  3VDX A;  4JMQ A;  2KLO A;  3QYF A;  2K9L A;  2WJV A;  3GQB A;  3PNV A;  2V9K A;  4E0F A;  4RLQ A;  2BVL A;  3JUR A;  3VMV A;  5KNL A;  1Z3Y A;  1I8D A;  4OZZ A;  2M5S A;  2I8D A;  4II2 A;  1MMN A;  4OJO A;  2X1C A;  3RPU D;  3CES A;  4XLC A;  4BAC A;  4U7B A;  1SAU A;  5IK2 A;  4Y33 A;  1OFM A;  3GQA A;  3DTI A;  1BHE A;  2CH0 A;  1BN8 A;  3PSI A;  1BMF A;  1HG8 A;  3RSN A;  2W00 A;  2KL4 A;  3DPU A;  4ITV A;  5CPR B;  1KTW A;  1WMR A;  2DT6 A;  3VYU B;  4F3Q A;  4PFO A;  3A3G A;  3HG9 A;  3OYE A;  2F43 A;  4NC8 A;  3FKS A;  3W3C A;  4DK0 A;  4W8S A;  4XQF A;  2X53 S;  4IZZ A;  3UW0 A;  3H9Q A;  3H94 A;  2KP6 A;  3D5R C;  2XZO A;  4YXW A;  2PEC A;  1Z7L A;  4FET A;  1OR7 C;  3LSG A;  4JOM A;  3OYM A;  1E43 A;  1IDJ A;  2QY1 A;  2QKL B;  1NBM A;  1AA7 A;  2KMU A;  4F92 B;  2GOM A;  3FKJ A;  3DDY A;  4XOT A;  4BQO A;  1T0F C;  2X6Y A;  4B3G A;  2CFO A;  4ZDO A;  1N75 A;  2GK7 A;  3K10 A;  2DXI A;  2HNH A;  1MMD A;  4E7L A;  4C2T A;  2IGK A;  3H9J A;  4ASU A;  2O1D A;  2HQA A;  4BE1 A;  1WPC A;  4ZDP A;  1UD3 A;  2VIX A;  3E0J B;  1O8I A;  3OIQ A;  3EQN A;  4NNJ A;  4ZYA A;  4Z03 A;  1GQ8 A;  3TMO A;  1RWR A;  5HNH A;  4F55 A;  1RMG A;  1UD6 A;  1O8D A;  5C1C A;  3T53 B;  3W2V A;  3VST A;  3CP8 A;  1FMV A;  1IDK A;  4LG3 A;  3UNG C;  3WQZ A;  2K3P A;  2BVM A;  2O0W A;  3G2B A;  3OYC A;  3HPG A;  1N77 A;  4Z1M A;  3L2W A;  1O8L A;  2Y0S A;  1K28 D;  2F1M A;  1OGM X;  4KIS A;  3K4B A;  4YZX A;  1YE9 A;  2E5Z A;  1XG2 A;  4DK1 A;  2VPL A;  3GQ9 A;  2E1M C;  1VBL A;  3BLY A;  4KT6 A;  4XN3 A;  1MND A;  4BE0 A;  2QX3 A;  5LFA A;  1X1A A;  2X85 A;  2QE7 A;  2ZSI B;  4RLF A;  2KRH A;  1VZ0 A;  3CP2 A;  3A3B A;  4C2L A;  2M7B A;  4G6T B;  2XOK A;  2R7X A;  3K4M A;  2IXS A;  3CJQ B;  2ZXH A;  3KEY A;  1COW A;  4OAZ A;  3A1Y A;  3HL2 A;  4DBR A;  2WJY A;  2Z1D A;  1R6R A;  1Y6I A;  2INV A;  2KDO A;  2X6W A;  1Y56 A;  4TKO B;  2VBK A;  2WPD A;  2HLD A;  3V42 A;  3OS0 A;  3OYF A;  1OLT A;  2JSP A;  3BCA A;  4HNU A;  3OFN A;  3T51 B;  1E1Q A;  3PL8 A;  4HNT A;  2M3A A;  4B3F X;  4XR6 A;  3QOD A;  4FAS D;  4Z05 A;  3LFU A;  4X0G A;  2BSP A;  2M0M A;  2ZSH B;  3KEW A;  1X0C A;  1LKX A;  4NC7 A;  3HC7 A;  4LIU A;  3K6G A;  4MR0 A;  2V31 A;  2LH9 A;  2VAS A;  4XOR A;  2CV0 A;  4KIT B;  3AL0 B;  3S3N A;  4Z06 A;  3OYA A;  1NHC A;  3KYL A;  3RTR A;  3T56 B;  1T95 A;  2X1D A;  2Z16 A;  1PYV A;  4BXF A;  4CCK A;  4CH7 A;  3CF2 A;  1UD2 A;  3BCF A;  4YZQ A;  2IGN A;  2WY7 Q;  5DN6 A;  4ZC3 A;  2ZZQ A;  1V5F A;  2M4G A;  2VKH A;  3A2K A;  3MD2 A;  3H5R A;  1WJB A;  1QHH D;  2E1M B;  1V0F A;  2MYS A;  2WB1 A;  2VJI A;  2CW7 A;  2GJR A;  2P0W A;  3KX2 A;  2XND A;  2BOL A;  2X8K A;  3G05 A;  2PJR B;  2DJI A;  2NT9 A;  4BE2 A;  2WBM A;  2CW8 A;  5CQE A;  4ZTJ A;  2UVE A;  2L9S A;  2W1O A;  1WJF A;  2HZD A;  3CZ6 A;  5HLT A;  2IGM A;  3LNN A;  1BR1 A;  3GBG A;  5FRO A;  2HVS A;  4BJ6 C;  1O8H A;  4ZTF A;  2Q2E B;  1E0E A;  2MC4 A;  3OS1 A;  1U0J A;  1DBG A;  1LDK B;  4ZJZ A;  1D1A A;  4YZA A;  3M8J A;  2PMZ A;  3VR6 A;  2VQC A;  4TSF A;  1EA3 A;  3BC9 A;  2WA0 A;  2GJK A;  4CCM A;  4XL9 A;  2E1B A;  3B8Y A;  3OOC A;  2O04 A;  3DTE A;  3TL4 X;  3VYT B;  2V7F A;  2IS4 A;  4HIZ A;  3JU4 A;  4E6K G;  2OV7 A;  2WAD A;  5CQG A;  4F91 B;  3HOS A;  2EWE A;  2R7W A;  2KHM A;  1E79 A;  4DOZ A;  3BH4 A;  2O0V A;  1OHH A;  4PSX A;  3OY9 A;  3DU5 A;  3K4J A;  4BL0 B;  2D3L A;  2VQG A;  4YEJ A;  3OYN A;  1UG0 A;  2R7Q A;  3OMY A;  1D0Z A;  2VJJ A;  2XF6 A;  3RQ4 A;  2M4K A;  2Z6B D;  4DNR B;  1MMA A;  2LRD A;  2RQQ A;  1CZF A;  2ZXI A;  4U4B A;  1QHG A;  1O8E A;  3ZR8 X;  3ZPP A;  5AMV A;  3K70 D;  5TGT A;  4XNF A;  4BJ5 C;  2JJ1 A;  1NG7 A;  3OL3 A;  3OYB A;  1PXZ A;  2L9N A;  4DNT B;  2LOO A;  4ANJ A;  1WTH D;  3BG7 A;  2E5N A;  1X4P A;  4BDY A;  5HOO A;  4E7Z A;  3B90 A;  2ODL A;  3K70 C;  4EW9 A;  4XM3 A;  3IAS 2;  1LFP A;  3RCO A;  3S93 A;  1N78 A;  4P1W A;  4CUG A;  2MFZ A;  3ZCO A;  2RNG A;  2XZL A;  2FUG 2;  3DEE A;  4HPQ A;  2R7V A;  3EUA A;  4OJ5 A;  1RU4 A;  3J7A Y;  3PNY A;  4BEH A;  3AL0 C;  2VXZ A;  4OJP A;  2OC6 A;  4E7J A;  4F93 B;  2UVF A;  4HST A;  1O8K A;  4W8T A;  4F52 A;  3EUK L;  4DJA A;  4BUP A;  3C2G A;  4G6I A;  2DOA A;  3I3L A;  4GRI A;  2ZZE A;  1O88 A;  4B48 A;  1E3X A;  2NOJ B;  3OL4 A;  2HVR A;  3OS2 A;  4XKC A;  2HDW A;  1UD4 A;  2NTQ A;  3ZXS A;  5KCM A;  1X1B A;  4TT3 A;  1PE9 A;  1E3Z A;  3B4N A;  3VSL A;  4YZ0 A;  2W6J A;  2CMP A;  3F9K A;  3NWS A;  3VYR B;  4XLF A;  4AU7 A;  4BGD A;  1OGO X;  2Z8G A;  2LY1 A;  1H8E A;  2VB6 A;  3OIP A;  4YRV A;  3LSI A;  2PJR A;  3NE5 B;  1QJV A;  3FHN A;  3L2R A;  3PFY A;  2K5C A;  4D9J A;  4E7H A;  2IS1 A;  3S8P A;  1NG6 A;  3EPZ A;  5JHF A;  2GOX B;  2V6E A;  1BPL A;  2NZM A;  4NK8 A;  3HXL A;  3HOT A;  2NSP A;  1VLY A;  3ZRG A;  1W36 D;  4E4H A;  4G7W A;  4PUS A;  1DGR M;  1O8F A;  4CCL A;  1V5E A;  3GVK A;  2X51 A;  4GQN A;  4P22 A;  3OOU A;  3PNT A;  4OZY A;  2WAE A;  3L2V A;  1EFR A;  3C2H A;  4DIQ A;  1PLU A;  1W36 C;  2XDV A;  1GLN A;  4RM2 A;  3SDB A;  1KCD A;  2CUZ A;  4NQW B;  2XF5 A;  1OFL A;  1D1B A;  3IAM 2;  4PK4 A;  3OAA A;  3ONQ A;  1KMH A;  3ZSC A;  3OR1 C;  3HKZ A;  1BR2 A;  3LSK A;  2V4J C;  4D1Q A;  4E7K A;  4HSR A;  2HVQ A;  3H35 A;  2IS2 A;  1JTA A;  1X19 A;  1V5G A;  2R4G A;  2XC7 A;  4UZU A;  4XN0 A;  2XF7 A;  2R7U A;  1HVX A;  5C1E A;  4R79 A;  3A4C A;  2L7K A;  3SYT A;  4BQQ A;  1WFX A;  3BCB A;  2HU9 A;  2UWM A;  4E7I A;  3OYJ A;  2CV1 A;  1V0E A;  2R9V A;  4P5O A;  2Z2S B;  4Y3O A;  4NK6 A;  1X1C A;  3VMW A;  4BS9 A;  2O5R A;  1W0J A;  2LC2 A;  4L8J A;  2VJ4 A;  1WJD A;  4AYB A;  5KHD A;  3OW7 A;  2L5Q A;  1E1R A;  2F4I A;  2LYC A;  3A35 A;  2VLA A;  1IRX A;  1O8M A;  5LD2 C;  3UR3 C;  2ZZF A;  3DWL E;  2CK3 A;  4PFP A;  3K4N A;  4PSW A;  3SEZ A;  4BU2 A;  4CZC A;  3MKY B;  2JVH A;  1TT0 A;  3VYS B;  1YX3 A;  2KZV A;  1H80 A;  4XLA A;  3OWT A;  2VJ5 A;  1BLI A;  2V7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...