4XN3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 227
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn3A02
2UVFA 5C1CA 1BN8A 2NSTA 4OJLA 4MR0A 1PLUA 1XG2A 1WMRA 2X3HA 4XR6A 4OZYA 1O88A 1RU4A 2VJJA 4AVZA 2O0WA 2O17A 4U4BA 4W8QA 1O8MA 4YZQA 3JURA 4XOTA 1QCXA 2VJIA 1K5CA 4XLFA 3SUCA 4XLEA 2NTQA 4XLAA 4W8SA 3B8YA 1O8KA 1H80A 4OJ6A 2QY1A 4OJOA 2Z8GA 2NTBA 4YZXA 2INVA 4W8RA 2X6WA 2EWEA 3T9GA 1QJVA 3ZSCA 2IQ7A 2PECA 4XKWA 2VBEA 2X6XA 1BHEA 3EQNA 1O8FA 2NSPA 4XQFA 2O0VA 4YELA 3B90A 1AIRA 2VBKA 2QX3A 4XMYA 2NT6A 3VMVA 1O8DA 3GQ7A 3WWGA 1PXZA 1OFLA 1O8JA 1X0CA 2X85A 5AMVA 1DBGA 1KTWA 1O8LA 4NK8A 2VBMA 4XL9A 3LMWA 1IA5A 4XOPA 1OGOX 2NZMA 4NK6A 1IDKA 2QXZA 1O8EA 1O8HA 4YZAA 3VSTA 1RMGA 3GQAA 4HWVA 4XONA 1OFMA 1CZFA 2PYHA 1IDJA 1KCCA 1JRGA 3KRGA 4PMHA 2PYGA 1GQ8A 4XNFA 4MXNA 4Z03A 4OJ5A 1EE6A 1KCDA 4C2LA 1RWRA 2UVEA 3EQOA 4Z06A 3GQ8A 4YEJA 4XLCA 2BSPA 1O8IA 4URRA 3B4NA 1JTAA 4XM3A 1VBLA 2NT9A 4XN0A 3ZPPA 1OOCA 4OJPA 3VMWA 3VSVA 4EW9A 3GRHA 4I84A 2X6YA 5C1EA 1NHCA 1IB4A 4XORA 1PE9A 2INUA 1OGMX 4W8TA 4XLHA 2O1DA 3VSUA 1HG8A 4Z05A 1DBOA 3FY3A 2O04A 2ODLA 3GQ9A 4U49A 2NTPA 4OZZA 4XN3A 3UW0A 1O8GA 4YZ0A 4XKVA
chains in the Genus database with same CATH superfamily
1QPIA 1I39A 5CDFA 2ZCWA 1J7KA 5CPRB 1QA1A 2FBIA 1LE8A 1XSDA 2Q2EB 1ZR4A 3F8MA 3E5UA 3CLOA 1Y0UA 2QEXB 1W7PA 4ZJZA 3OYGA 3SEQA 2V1XA 1FRNA 1J75A 2IS4A 5L3BA 4HQEA 1W0UA 3QP6A 2ZBUA 4QHYA 4PJNA 2WA0A 4FQGA 3ZQHA 2L01A 3F3XA 3HB9A 1UD4A 2KDZA 3JURA 4ZZDA 2P4WA 3OYNA 4EMSA 2VXZA 2VJIA 2VQHA 2Z2SB 2M8EA 3I55I 5E3OA 1J09A 1QRBA 3B8YA 1H80A 1TWAJ 3H9GA 1IDZA 2CFOA 3IKVA 3KYLA 1A31A 3CUOA 4HNUA 1UMKA 4CZZA 1BI2A 1UCRA 4TN1A 4YDTA 3H1CA 1QJVA 5E17F 4HOBA 2N8GA 3ASNH 1CQTA 1BR2A 1WJAA 3KLNA 2F6CA 2GIZA 3AG4H 2OCCH 4C9YA 1FRQA 2ZMEC 5IPAA 3OYFA 1S0UA 1SAUA 4BHPA 2GJPA 4QIWN 1YJ9I 1LLWA 2JWTA 4CUGA 3B8HA 1H9GA 4Y4RA 1AIRA 4HDUA 4E7LA 1DUXC 1E3HA 2NT6A 2HKXA 2Q1ZB 2BPOA 1K4SA 1EWYA 4A5MA 2QA4I 3G4SB 2KIQA 1ONVA 1PXZA 1LEBA 4KITB 1N77A 1D5VA 3SZTA 2J8KA 3H35A 3R4KA 4NB5A 3ZC3A 1WU8A 1KTWA 2LKPA 4RDKA 1YG2A 3HKZA 4Z4RA 3P5JA 1VQNB 1V0EA 2GBYA 3WG9A 4CSWA 4Q4ZF 1FIAA 3LQEA 2VC1A 3VYUB 1FY7A 3ML3A 2QEXI 4MYTA 2R0QC 1V4RA 5FJ8J 3CC7B 1XQBA 2QQ9A 3VSTA 3M8FA 1XCBA 4Y9RA 1ZRDA 4K2EA 2IA0A 1VQ9B 3ZMDA 5F04A 5CVRA 5IYCJ 1P4XA 3V42A 2ACJA 1Q9SA 1FOYA 2BV3A 4A3IJ 3FMSA 2QM3A 1H9TA 1E1RA 2RNJA 1QBJA 3MZYA 1EE6A 1FNCA 2BE5F 2STWA 3VYTB 1ZM9A 3EQOA 4Z06A 3ONYA 3CMEI 4ENMA 4QLCU 1R1VA 2K85A 4M3GA 2R7RA 3ABMH 3BR3A 1G2HA 2W6JA 2BZTA 1QZZA 5BOXA 1T6YA 4EVIA 4TKOB 1FJLA 2WBMA 1HDDC 2MSYA 1OR7A 4OMZA 1J59A 4X06A 4YALA 3W2VA 3Q39A 1MW7A 4PSXA 5F4OA 1TYVA 2K4BA 4EW9A 2W24A 3HGGA 4I84A 3K69A 4M4SA 4TMWA 2WB1A 4CZCA 1USTA 5L3DA 5KAFC 1XE1A 1K78B 3S14J 1N06A 3HJEA 1Q86D 1TSPA 2M5SA 3GWZA 1BIAA 2HOAA 2HXIA 5M3FJ 3KP3A 3H3UA 2GQQA 4GQNA 1UAAA 3MHPA 1XX5A 3FDYA 3KFWX 1RIOH 3M3YJ 1OHHA 2L9VA 1QFYA 4A5NA 2X51A 4P3YA 3KZYA 3TW6A 1UD5A 1F20A 3BTCA 1R71A 1ZARA 3FK6A 3A2KA 1FNMA 1T56A 1VQNI 1BN8A 1QG0A 1T0FC 5DN6A 3LSHA 3ASSA 4MR0A 1FBUA 3KLOA 3M7GA 1F9NA 4PFOA 1HVXA 3ASTA 2MH2A 1YJWB 2R5ZA 3U1DA 3DXJF 1VQ9I 2HGCA 3EETA 4AVZA 3C2BA 1TP4A 1E79A 4XOTA 2CWEA 1SC7A 1D1NA 4WX9A 3LVBA 5E18F 1GVHA 3CC2I 2GK6A 3OE7A 5E1XA 4DIQA 1MNMC 1UHSA 1LB2A 4A3BJ 1NDHA 2H8WA 1P4MA 3KEQA 2R5ZB 4IJAA 5HNHA 3DLAA 3G6EB 1ZK8A 4IHWA 4OJOA 4I02A 2CV2A 3K70C 5CVJA 4HNVA 4IZZA 1IN4A 1KYWA 3RI4A 1WDTA 1QX4A 3GFJA 4LLGF 2LNBA 2Z99A 2AO9A 3EYIA 1B4AA 4XKWA 2VBEA 1KU7A 2GK7A 1RC9A 2CQXA 2GOMA 2GXGA 3EQNA 3MD2A 5TRDA 2BM4A 2NSPA 3FXRA 4DNCA 4A3JJ 2FNPA 2CS3A 4A0ZA 2KRCA 3B90A 2HYJA 1IV8A 5FA6A 3WU0A 2QYUA 4V2FA 1HKTA 3BTJA 2JPBA 2QZAA 3WWGA 3I54A 3L7WA 1FIPA 3G71B 3HDDA 1HSTA 1C0WA 4DK1A 2HTSA 2EWNA 3HOYJ 4NK8A 1ZTRA 5JLXA 1WJCA 1TL8A 2E7XA 1ETWA 2C5BA 5ILSA 4XOPA 3ZR8X 3OL3A 1Y8QB 1WXRA 4ON0A 4HF1A 3ROUA 2DOFA 2W48A 1V5EA 1RMGA 3BJAA 1D8KA 2VBUA 2CRGA 2YX4A 4P9UA 3CO7C 4E7HA 1YHQB 5E20A 1KK3A 2VE8A 1LKXA 3T0YA 4X07A 2UV1A 1Z6RA 4MO7A 2PIAA 4X05A 2P7VB 1KQ5A 2DO7A 1V54H 4F7DA 1M90D 5L46A 1ETQA 1PP7U 5BSXA 1EFTA 3K4BA 5HLIA 4AUXA 2FMLA 2K4JA 4AWXB 3EUHC 3HOUJ 1LVAA 2G0EA 4BAYA 2VODA 3J7ZI 1R4MB 2FSWA 2R7SA 4IW3B 3S8PA 3WGHA 3DBRB 5F64A 2LDUA 1ZLKA 2GXAA 2VJ4A 1JTXA 3IWZA 2MFZA 3ZN1A 2LC2A 3A0HC 3GF2A 1N0UA 3E1YE 1R6RA 2PMZA 1HF0A 3RQ4A 2LLKA 5EEAA 1PYVA 3B6AA 1QPMA 2JSPA 4PGGA 3PA2A 3GXOA 3KP6A 4EEFG 4PC2A 4ASUA 3CMAB 4RM2A 4XN3A 4OZZA 1MJBA 3UW0A 3GVLA 1SFKA 4MQ9F 1WOSA 2HU9A 2L4AA 1VZ0A 1BI3A 3DKXA 5E1WA 1GXQA 2OCEA 2M45A 4YAUA 1SFXA 1SVLA 5HDNA 1FOXA 3MQ0A 5F6FA 3KP4A 4M6YA 4DW6A 1U8RA 2V7UA 3O3KA 1R1TA 2CO5A 2XGEA 1BIBA 3SFIA 5D5UB 5IYPA 1GAQA 3CB4A 4EM1A 4HBLA 4ZH4F 2IEKA 1IN6A 1IUYA 3Q6QA 3SEJA 1QA6A 5CQGA 4EM0B 3FXUA 4OIPF 1SD7A 2EFPA 3N05A 1VQ5B 1HDPA 1WJFA 1PVEA 2HPMA 2XZLA 3N97A 4PC6A 3QU6A 3W2HA 3G1MA 2M1BA 2X1EA 4IPAA 5FROA 1YRNA 3WBKA 3TBIA 1Z6TA 3I4NJ 4FE7A 3W6KB 5JLWA 5JVGF 2IS2A 2H6CA 1DDNA 1IC8A 1FTZA 3W5UA 1VJSA 3BOQA 4G12A 3HOVJ 2L2OA 2ZFUA 5KAIC 3S32A 1YRNB 1TC3C 1KMHA 4YHBA 3PUMA 1X1CA 3OPOA 2X6XA 4R1HA 3HRUA 2H09A 3BG7A 5A88A 1MSEC 3J7AY 2GJKA 2RQQA 3CCLB 2CUJA 4LMYA 1XMXA 1LNWA 3CUQC 4C43A 5E3LA 2GA2A 4L5IA 5TJJA 4ZDLA 3GQ7A 2DT7B 2W00A 3CP8A 2OAZA 4OIRF 1FYLA 3ZRGA 3PSIA 1JXSA 2W1OA 4NUBA 3T5XA 1OMIA 3OSGA 1TNTA 2P81A 4G6IA 2DTRA 3MFKA 3RZOJ 2YWEA 4O5VA 3H9QA 3KP7A 1D8JA 2YWGA 3ZZTA 3ELKA 4RGSA 4E7SA 3LQ6A 4HDVA 2LBFB 1UD3A 3GQAA 4UVCA 3F21A 3ZMUA 5K7ZA 5J3OA 2H27A 3JAMK 5JVTA 1RR7A 1E3OC 4E7KA 1BOAA 3PUBA 5JBQA 3P4GA 1YX5A 2G9WA 2HQNA 1A5JA 4C2MJ 1ZR2A 2PMHA 1MBKA 1RPWA 4HW0A 1RWRA 3H94A 4AVPA 1TWFJ 2O3FA 2E5ZA 3PNVA 3K4NA 1I50J 2ME0A 1OKRA 4ABZA 4X6AJ 1VHEA 3KP5A 4CDGA 4B09A 1H85A 4BQQA 4HPQA 4BEHA 1JTAA 1OYWA 2MW8A 5B1AH 3EDPA 3MEXA 4UZUA 3G73A 4ETSA 4YAFA 2V1NA 2VOOA 1S72I 2EIKH 3GX4X 2JQ7A 4M9ZA 4D7MA 2INUA 4M6VA 1NJID 2KJCA 4BEHB 1ZLJA 3S2DJ 1XFOA 1XGOA 2EJRA 3TO9A 3IRRA 3HAGA 3CDHA 3B82A 3KEOA 4DYCA 2DT5A 1APLC 3JQQA 3BQJA 2M0CA 5IYQA 1U0JA 1AOYA 3Q6RA 1X2NA 2VT2A 3C7JA 4KIGA 3V4GA 3HHHA 4ANJA 1OGJA 1SKQA 1IJEA 1GUUA 4OP7A 5B3SH 1B9MA 1NB0A 2E1NA 2GLOA 4JX4A 2J7KA 1F4KA 3SLDA 3PQJA 3V8KA 3FIWA 3D1NI 5GPAA 1LEAA 3FZVA 2JVHA 5FO1A 2XB0X 3M9AA 4IL6C 3BG5A 4IQ4A 3S3MA 2DTZA 1REPC 3FPKA 4OAYA 3TKYA 2PN6A 2F1MA 4Z4UA 4OOSA 3QFRA 2CYYA 2X0LA 1S7AA 4G7ZF 4Y33A 2XAGA 1VI0A 4OOIA 2HDDA 5HS8A 3OY9A 3RIRA 4YG2F 4A3FJ 2XZPA 4ESFA 3H0DA 1ERDA 3J81k 5D6FA 3VFZA 2Y69H 2IS6A 3A8JA 1IG7A 1ZUNB 2IW5A 1R22A 3GTKJ 1XB4A 3F6VA 4KN4X 1U6GA 2A5YB 1D0YA 3SQNA 3GTOJ 2QCOA 2G0YA 2JA8J 2INVA 4IRIA 4M73A 5A8AA 3PQKA 4L8JA 3IV5A 4UB8C 2IQ7A 3F6OA 3X2QH 1EFCA 3B78A 1SFEA 1FWZA 3JRHA 2QUFA 2BY3A 1WKMA 2XGDA 4G94A 2O5RA 1SVOA 4OU0A 1J9IA 1WJDA 2ETHA 1J5YA 3TDUC 3K1NA 3QRFF 3BNWA 2F2EA 4FTHA 3W5VA 1A04A 2JPCA 2M34A 4QV2A 2QX3A 1VFCA 1UJ8A 2H94A 2D45A 2GREA 1O8DA 3LWFA 4ZYGA 2XSDC 4B4DA 2FBHA 1Y1VJ 1K6YA 1Q81D 1YYVA 1KTVA 2OZUA 1YLOA 2PQ8A 3Q3SA 4XL9A 5EJCA 2F43A 2PMUA 2J8IA 4B3AA 3CF5F 4UUSA 2ZB9A 4P9FA 2RREA 2QTLA 1F36A 1Y1WJ 2EFGA 2F4IA 2WTEA 4RD0A 3VWBA 1MD0A 2NS0A 1IF1A 2FXAA 4KIFA 3TW7A 1HSJA 4UUSB 1O3TA 5D4RA 2ID6A 5ILUA 4ZYAA 3OIQA 2ZZFA 2VONA 1QVUA 5J1RA 1ZQ3P 2R93J 2OK8A 3CMYA 1ZAOA 2DA4A 3EPZA 5K7FA 3LSMA 1MDMA 3I5UA 2UVEA 2HZTA 2ZXHA 4NBSA 1JT6A 1KQSB 1S7EA 2A6TA 2R3SA 3FBNB 4M9XA 1F1ZA 4S05A 1R5BA 2XEXA 1MNEA 4M6XA 3HYIA 3HTSB 1MDMB 1I8DA 1WSRA 4O6JA 2ZITA 3SQVA 3ASOH 2XVCA 2KMUA 1VQMB 4UV9A 3GUDA 3ZBTA 1BX1A 1QVFB 2R7QA 3GRHA 4YRVA 4UVAA 1OJLA 4A69C 3LSRA 4LBVA 1RZ4A 4A3LJ 1USSA 2I1LA 3OJWA 1HG8A 1X4PA 2O04A 2ESNA 1IRXA 3A4CA 3D5SC 1BI1A 1MBHA 3FMQA 2VI6A 4Y3OA 1G8XA 4M72A 1BJZA 4U87A 3ZIAA 4H4KC 2VFMA 3F8CA 2IP2A 1XD7A 4BH9A 3L2UA 3VOEA 1ACIA 4M3EA 1G7TA 2BSAA 2MC3A 5LLQA 4RD1A 2DPDA 4G7XA 2V7TA 2HQRA 2IOUG 4OJLA 2BF4A 2PBIA 1PLUA 2B9SA 4A6DA 2DIEA 2R9VA 5B1BH 2E1MB 4JYKA 3T8TA 1FDRA 3OMYA 1SMYF 4Y9UA 2W57A 4LD5A 2X53S 3E5QA 4J0QA 1Y56A 1LLZA 3WBJA 4U88A 2ADUA 1SKYB 3AVXA 1YFHA 3E6MA 2JTVA 2BV6A 4G9YA 2OTJI 2CNDA 3SKBA 2EV6A 4HSRA 2L9NA 2RN7A 3QPSA 5M3MJ 4FX0A 1T39A 1WP6A 3DPLC 2ME6A 3V8JA 2JJ7A 1YJNB 2QMUA 3CCVB 3JAMZ 3OEEA 1HKQA 2CF4A 2OV7A 2EA2A 1D1CA 3LSIA 1S4MA 4X7CA 3PUFA 2Z16A 2XB5A 2HVQA 4GGGA 2VZLA 5HNFA 5LEJA 4HX8A 3WXMA 2VBWA 2Y9YA 5DV5A 3BJ6A 5DUIA 3G05A 3S1QJ 3HUGA 4HSTA 5C3EJ 4OPSA 1P92A 3BC9A 4XIDA 2KZGA 3QAHA 4HE6A 3GTJJ 2ZSHB 1OQYA 3BCAA 3VEPA 1HA8A 2JJ2A 2A07F 3W2EA 4QSHA 2DA7A 2CW8A 2A5WA 3GLLA 2NVTJ 2JUCA 3CC4B 4J00A 2BHYA 2Z6BD 2ID3A 4Z4SA 1YOVB 5BSYA 2E60A 5IYDJ 1P2FA 2ELKA 1SVMA 2DFEA 3A8IA 3PIPF 1GJRA 3JCUC 1V3FA 1OFCX 3LSPA 2R7ZJ 3T53B 1JUPA 4YZAA 1ZGWA 1E62A 3ONUA 4FXUA 1FMVA 3FISA 3JR9A 2VASA 4CXFA 2LK2A 2M0MA 2NS8A 2X1DA 1B72A 2NPFA 3BLYA 3K7AJ 2A3SA 4ZYHA 1J0RA 1XDUA 3BZKA 3FBIB 3LMMA 1S29A 2X48A 4XK4A 3WTTC 1OCPA 1P7IA 3GZNB 5LHGA 3JQRA 4MFDA 4ENJA 3WG7H 1VQOB 1CLWA 5FFXA 1U5TA 4HNTA 2VN2A 2MABA 2V26A 3DU6A 1B72B 3F23A 3HSFA 2G7HA 2IGKA 1VNDA 4AIDA 4ESJA 3HOWJ 3LFKA 1JNYA 5H5JA 1TYWA 2WAFA 3W2IA 1I3QJ 2LH9A 5GP9A 2XDVA 1IXCA 1U5TB 2BM1A 3K70D 2EBIA 4I09A 5DM7F 1QA3A 1MJAA 2L02A 1P4AA 3LSGA 3MKYB 2R7WA 3JRCA 3HXLA 4L0ZB 2NVYJ 2W84A 5J8FA 2HWVA 4LG3A 2IBDA 5BQTA 1W2BB 5FLXZ 2EQRA 2WAEA 3J81K 2QE7A 1WHUA 2JDIA 4Z1MA 4F93B 3TP3A 2AHQA 2KDOA 4XKVA 2Z5UA 1W5SA 1A8PA 2O9LA 3NAWA 1I6XA 4A3DJ 3L2CA 2VKHA 1KONA 2LREA 4A0XA 5IK2A 1VQKB 2MGQA 3VO2A 1XG2A 2LMDA 5M5YJ 1GO2A 3VR6A 1KZLA 1IN7A 2E1CA 1TW3A 3H36A 1K4TA 2C77A 2VJJA 4IRHA 3V7SA 3M8JA 1W0KA 2QYOA 3HGYA 3QU3A 1BOBA 3AG3H 3S3NA 5IT9K 5F4JA 2VFNA 4G6DA 3I56I 2DPUA 3NEUA 1S8NA 4M3BA 3CCMB 2OK7A 3BC8A 4BHBA 2VL8A 1F5TA 2L7FP 3GFLA 4U0YA 2W7NA 3K2ZA 4DYRA 1TWCJ 5TISC 3I0TA 1FOKA 4OPOA 1R58A 1YITB 5J1UA 2BGIA 2RKHA 3S93A 1D1BA 4JX6A 2F5VA 1LDDA 4EJTA 2BX6A 5D6EA 1TZLA 5D8KB 4BL0B 2R92J 1S5LC 1QZEA 2TDXA 4TV7A 3VPRA 4D7NA 5L3FA 4U7BA 4KH3A 5IOYA 1I7PA 4KT6A 4LLLA 1L3LA 2O0VA 1FPQA 4EJUA 4UZEA 3WTSC 2AS5F 4M74A 1UB9A 2IA1A 2LF8A 1TT5B 2QTZA 1KYZA 5HZBA 4RGUA 3BR0A 2DXIA 1ON1A 5BS6A 2XUBA 1WJBA 2GAUA 4RPDA 4RGRA 4RLFA 3PSSA 2Q6KA 5EYRA 2Y0MA 4DQ2A 2E35A 1W0TA 4I01A 1ORKA 1T98A 1CNEA 2DT6A 2RNGA 1IN8A 3H5RA 4PFPA 3WE3A 4M53A 4XRSG 3DEEA 1YW8A 3IAM2 4FK8A 1O8HA 2IRFG 4BDYA 3ZPNA 4KUMA 2E5NA 1RUNA 4KKSA 1EKEA 2RDPA 2DDBA 3GBGA 5CQEA 3FK7A 1Z7UA 5H59A 4MXNA 2HDNB 1ZGJA 3CCJI 1ZM2A 2ISZA 1FNDA 1QHHD 1BI0A 2V6EA 4PABA 1G6NA 4CCNA 3SYTA 4DQKA 4ZCMA 1BJAA 3GTLJ 1W5TA 3I53A 2DFIA 4AIKA 2JA5J 4DK0A 3GQ8A 4ZTFA 1H8HA 2F4MB 3QPTA 4LK0F 2LZJA 5DCFA 3FHNA 2BM0A 5JFRA 3FXOA 4E7ZA 5L3EA 2R4GA 1QO0D 1VLOA 5FKMA 2AXLA 3IHUA 2VBSA 3CPWB 5GTHC 4XM3A 1MH3A 3ZMZA 3CTAA 5LGTA 3G1OA 1BC8C 3ZBUA 3REOA 2XIGA 4XN0A 3S1MJ 1O3RA 1GR1A 3BH6B 3FXLA 1E2XA 2IGMA 2WYRA 4PJMA 4W1UA 1K79A 2HVSA 1R5NA 2DMTA 1D1AA 1SFUA 5LRSA 4G1BA 3QE2A 4W8TA 5DS9A 2O1DA 2BN4A 5E3NA 1K7AA 3FY3A 2H1KA 2ODLA 1I1SA 2NTPA 3HPGA 4ZGQB 2OC6A 4M71A 2O61A 1HW1A 2KHMA 4AC0A 3R6JA 3DLLF 1RKWA 1YIJB 1GAWA 3S3OA 3OOUA 5C1CA 1W4MA 3PUNA 4YFNF 1D0ZA 2XKPA 1SANA 3DKWA 5CVIA 1K78A 5J4VA 3HTUA 4P9SA 4UNOA 3RY8A 2XT4A 2WY8Q 1W35A 1YTYA 3QYBA 2F5DA 1RU4A 3L9FA 3FM5A 3OYHA 5AN9A 3KX2A 2E1OA 2MLKA 3CDLA 3O8GA 4XBFA 3OP1A 2BM6A 3DTIA 2VNHA 4RA2A 1N05A 2H8RA 3AL0B 2DEUA 2V5IA 1O7LA 2XAFA 1QUEA 3ESWB 1MMAA 2JMWA 4XLEA 2XPVA 3G4SI 1U78A 1TW2A 3GCMA 4Z4ZA 4XRFA 2BY0A 2P3MA 2M30A 4U7DA 2VBYA 2M4KA 1ON2A 9ANTA 1K4ZA 3JW4A 5K7HA 4YZXA 2VJ5A 1SEUA 5AIPA 2EWEA 4AM3A 2VBXA 1N8RD 4YXWA 2XRNA 2M87A 2JZYA 5ERIA 1WI3A 2XGXA 3NE5B 3KPHA 5ICCA 3CC7I 2X6OA 3IRQA 4P3IA 4TMXA 1BBYA 1GVDA 4YIRX 2R7UA 3JREA 4PGOA 4DYQA 3CJRB 5GV7A 1ETOA 1RESA 1AHDP 3RDIA 3FX3A 3RPQA 2DQLA 4MFEA 3RQIA 3KETA 2HLDA 3WNDA 4ZV4A 2RAEA 4RS8A 3DPTA 3HOSA 1YIJI 1JT0A 3LSJA 4B1RA 2M4GA 2OTLB 1FBQA 4WXHA 1A6IA 1GV5A 1YI2B 3OYAA 2F5CA 4Y15A 4C0SA 1ZKGA 2B7BA 3U6KA 3FF5A 3J81Z 1Z77A 3DEUA 3W3CA 1VQ8B 4OAZA 5J6XA 2ZXIA 2BGJA 2JSCA 2QWWA 3BCBA 1QGPA 3CLQA 1JJ8C 3ZOBA 2B7CA 1EH7A 5H6QA 3ZXSA 3JRAA 1JRGA 4WK8F 4R79A 1X3UA 3BT9A 1HZEA 1UHWA 2WZNA 1XSVA 1EP2B 2K7LA 3L00A 3OW7A 3CMMA 3VSLA 3PSZA 5F0FA 3MZ8A 3EUKL 1XC5A 4BDZA 2GIVA 2BSPA 1R5ID 2L3DA 4A3MJ 2D5VA 1Z3XA 3F8BA 2B5OA 5FFZA 1MRZA 2TCTA 5DCMA 5IT9Z 2X8KA 2COMA 5LBQA 4C3JJ 3VSVA 2H1LA 1QA2A 2XOKA 1H42A 3J7YJ 3QYFA 2PMDA 5E8IA 1YJWI 1TYUA 3I9V2 1W36C 4EATA 4XORA 4RCYA 2E71A 1KQ0A 1K83J 5DCMB 2HDCA 3BTLA 2YWFA 3GYHX 3BY2A 2DOEA 4PJJA 2EINH 3BG9A 4ZYDA 3J80K 3I4MJ 4HLYA 2OZ6A 1M1EB 5F1RA 4B3XA 2DMQA 3O2PE 5D5VB 3CCRB 2LYCA 5C4XJ 3CRZA 2ELJA 3PO2J 4WZTA 3N6ZA 4P96A 1EH8A 2BMWA 1XSXA 3G6EI 2XF5A 1NTCA 4RMNA 1YI2I 2EZIA 4L5JA 4KMFA 3OYDA 3F9KA 1FNNA 1TWHJ 2CW7A 2NNNA 4RAYA 2C4UA 1WWXA 1MIJA 3H9JA 1Q82D 4AD9A 3A01A 1MBGA 5TR9A 2RQPA 2EV5A 4Q48A 4ACAA 1OR7C 1VF9A 1PKVA 2VC0A 1JTYA 1J9ZA 3OAAA 4NC7A 4TT3A 1B1BA 1O8MA 3MZHA 2EZLA 1K73D 2HFHA 4GO1A 4ZCIA 3A01B 1WI9A 1K5CA 4XLFA 3SUCA 4ENNA 2NTQA 5FLVA 5TV2A 6PAXA 4W8SA 3QODA 4S0HB 3WTZA 3G71I 1N78A 2FE3A 3OIPA 2FA5A 2JK3A 5THXA 3CXCB 4BE1A 1B23P 2BYVE 2VIXA 3TO6A 5FKLA 3BTIA 2YUSA 3MAJA 3QFSA 5KW9A 1MBEA 4CYDA 2D9RA 2JN9A 3CDIA 3HSRA 3NQOA 1HBXG 4EM2A 1R5GA 1AKHA 3WY9A 3CCQB 2V1UA 3CD6B 1WPCA 1DGRM 2O8XA 3FJOA 4CYCA 4B3GA 2HZDA 3V76A 1GXPA 2A69F 1L0OC 3OZWA 2FD5A 2Y30A 3K9TA 3DU5A 1YX3A 4PDKA 3CCRI 3E6BA 1AKHB 5CVUA 2ZC2A 3CCUB 3WHBA 2ZZEA 2CW0F 2MD5A 3OWTA 4CYCB 3JU4A 3I71A 3FXJA 3AGPA 3W2GA 3W2AA 3RCOA 3LMWA 2KKOA 5JMCB 2MLGA 4ZDPA 1IA5A 1X3ZB 2DMPA 2VQGA 2GXBA 5LGNA 1ZELA 2XASA 4N9HA 3RPUD 3PIOF 1QHGA 3H3VK 3TMOA 3QSYA 3OYLA 2VNJA 1K8AD 4CH7A 1FTTA 2J5PA 2WWYA 4HWVA 4BQNA 1UMQA 2P5LC 4IEJA 1IDJA 4LGWA 2CFXA 1VQLB 2FX3A 1DDIA 3V7CA 2YU3A 3ZP5A 5FIUA 4B43A 1SFOJ 3CMAI 3MVPA 4C2TA 2JJ1A 2Z9OA 4Y7NJ 1MNDA 1KQ8A 1FYKA 1QFJA 2KZVA 3OYKA 2BEOA 1NH3A 1T2KA 4QFMA 2YS9A 4CCMA 1F60A 3QPHA 2LBFA 3MCAA 1QGZA 3SXYA 5J4YA 4EGZA 3RKQA 2P5KA 1O3SA 1U9OA 3FXQA 3AKZA 2K9NA 4EJVA 3K4MA 1WOOA 2NOJB 2UZKA 3BZ6A 3VO1A 4HAMA 3KIOA 2NVQJ 2CW5A 1HKSA 3DDYA 2XTYA 2EFWA 5LFAA 2Q6LA 4Q5SF 5H2FC 2K02A 1U2RA 1WJEA 2M9HA 4MGRA 3HL2A 4B8XA 5JHUA 1VQ5I 1U3EM 2UXXA 4E7JA 1H88C 3WE2A 3QYEA 4YZ0A 4CCKA 3LNNA 1FX0A 3GIRA 5HDKA 4QWQA 1VTNC 2HPIA 2I10A 2CQKA 4GRIA 1TQIA 3U6BA 5B66C 1NK2P 5JI6A 4UZFA 4MQVA 4KIBA 4RB0A 2EFNA 5C4JJ 2QGGA 1JJ2B 2LY1A 3K4JA 4EGYA 4DNRB 3ULQB 5F4MA 5LD2C 2YPRA 5E3MA 2IPQX 2CUZA 2W4SA 3OL4A 3WHCA 3L2WA 2GJRA 1VQ7B 2XTXA 1VF7A 2O17A 1LDJA 2K9SA 2IJLA 2L9SA 1VQLI 2R7XA 2BVLA 2NXNB 2P8TA 1G7SA 3HRSA 2ZTGA 3TH0A 4U0VA 2OBSA 4BNCA 5FRMA 2JRMA 4TMTA 4NQWB 3C2GA 3IP4B 2AQFA 3V8LA 2FU4A 4IHXA 1YW7A 3QPLA 5CKTA 4BBRJ 5HLGA 4TSFA 1BX0A 1XGMA 3C3WA 2CQ7A 2A6HF 4YIIA 1ZG5A 3GTGJ 2Q6OA 2RGVA 4I99C 3OZUA 4LB5A 1MH4A 2LD5A 2BVNA 2PG4A 5HKKA 1ZREA 4P26A 3HIFA 4JQFA 4D1QA 1LUJB 4OPVA 4G6QA 1BN5A 3TOBA 4KDPA 2BM7A 4XKCA 4BQOA 2DW4A 4E0FA 3WU1B 4XLNF 1Y0NA 3ZQLA 1AIPA 5KCMA 3RYRA 4UXNA 5IYBJ 2KRHA 3H5AA 4FT8A 2E36A 1E43A 3FWEA 3RPUA 3PFYA 4DGWB 1SD6A 2W6IA 2P6TA 1OGIA 3T8RA 1D3YA 1SM4A 4Q7JB 4BUPA 1SAXA 3OZVA 3T56B 3KE2A 4YFOA 3DV8A 2X85A 1U2WA 1WCMJ 3JRBA 1CGPA 3FMRA 4KJZA 3ES9A 1N25A 5LMZA 1YX2A 1QU3A 4I2OA 3HSEA 3J80Z 4BE0A 3CPXA 5DNSA 2DYRH 3F0CA 4MNUA 4GDFA 5LRRA 3B73A 2XPWA 1IDKA 2KRFA 4CA0A 4IHTA 2AHOA 1BLIA 1DDGA 3SEZA 5FLXK 2ZJQF 1PJRA 3OR1C 2DMNA 4YAWA 3SLNA 3S1NJ 4O3MA 1T8IA 2J5OA 2EZKA 2EFOA 2K27A 2LY9A 4Z6YA 3BH7B 5JLVC 3WTYC 3VDXA 2XC1A 3S15J 2W85A 1XB2A 1LFBA 3KZIC 2DLLA 2E2IJ 2K5CA 3OYBA 1V5GA 3LAJA 1DP7P 4LJZF 3TEDA 1N75A 4BKXA 4Y7CA 1BC7C 1D0XA 5IYNA 4C2LA 1RRJA 2PJRA 4OMYA 4XLPF 3B6CA 4P6YA 3U21A 2V7XA 4JOMA 5FLMJ 4CGZA 3HBLA 4F7ZA 2JIZA 1G3YA 2FOWA 4BY7J 4BQAA 1XN7A 2BXZA 4V19K 2VYQA 1X1BA 2BXYA 1HF2A 2M2EA 2OBPA 3SZGA 3S17J 5C1EA 2PJRB 2NAZA 3M8EA 4G6TB 1UD6A 2GZWA 2HVRA 1R1UA 3KL9A 1OGMX 2GOXB 2HEOA 4N9IA 4WZEA 1SD4A 1VQ4B 4II3A 1PJ7A 3GLXA 1DBOA 3Q0VA 1BQEA 4KISA 3JQPA 4KT5C 3JSOA 3AVVA 4WZLA 4F92B 3EUAA 2R6HA 1I3AA 4ITVA 4CO8A 2LF7A 4A2UA 2CK3A 2OBTA 3Q0UA 2XC7A 1GT0C 1H8AC 2MBFA 4CHUA 2PFBA 3L2RA 1BW5A 3QFTA 2PE3A 1QGYA 3KYCB 4IO9F 4FN5A 2LOOA 2EZHA 2Z3YA 3LSTA 4IXAA 1GHCA 2P6SA 2QENA 3E97A 4D9JA 3CCEB 3GTPJ 5F0CA 1KU2A 3MN2A 4MEXF 1KK0A 1JUMA 4UV8A 4ENKA 3PSFA 2R7DA 1JHFA 4PCQA 4YZQA 2FRHA 3BG3A 4WWCA 3OSFA 2XAUA 1YHQI 2M7AA 2VUMJ 2M5WA 3VB2A 3AFHA 2M3AA 3JRDA 3H3ZA 2WJVA 4RB1A 4B3FX 4ZC3A 2PX9A 4IOAF 2QY1A 4LFUA 4M9SA 4IHSA 2V9VA 2PEXA 4PJ0C 4QUZA 2I5UA 2NVUB 5IT3A 1FNBA 5FL7A 3IWFA 5LGUA 2KP6A 1X3WB 2P5VA 3TDZC 1JGGA 2V7WA 1FYMA 2ZJRF 2OQRA 3ZCOA 2VNKA 4P6VF 3DBLB 3B02A 1MBFA 4HRIA 2XNJA 1OLTA 2LKSA 1UELB 1D5YA 2XZOA 4RBOA 3LAPA 3CESA 3GFIA 1X4OA 2A68F 3C18A 4PZJA 1QUFA 1VLYA 1PUEE 2E2JJ 3SDBA 2VBKA 4NC8A 2LFBA 5M5WJ 2KQRA 4NCNA 3GSIA 5ICGA 1FX7A 1HQCA 1T5EA 3D5RC 4D5FA 1KK1A 3CCSB 4BXUA 1KA8A 3I4PA 5DTDA 2OU2A 1E17A 3P9KA 1AMOA 1DPRA 3OYEA 2IGNA 4PUSA 2R7OA 1OGOX 5KK1A 1QNTA 2HQ5A 1T08B 4M3FA 1BR4A 1E3XA 5EMNA 1VQMI 5AONA 5HDGA 3KEYA 2VLAA 2GPJA 2F5FA 3A35A 4XONA 2XROA 1XS9A 4W97A 1A35A 3I59B 1N07A 4XNFA 2PYGA 2AQEA 2DCEA 2O0YA 4CCLA 3NB2A 3KYDB 1MMGA 5B5EC 4LIVA 1IV6A 5E79C 2QSHX 5F0HA 4U9UA 2ZZGA 1KCDA 3RTRA 4UVBA 4TMZA 2DERA 1O3QA 4RM3A 5HODA 2F5EA 1O8IA 3LL7A 2LRDA 4YAOA 3M4OJ 1OPCA 3QOPA 2CMPA 1MSFC 4L9JA 3F22A 1S6LA 5FB2A 1T38A 1VHOA 2VKEA 2NT9A 1FBSA 3Q5FA 2FEZA 1ZN2A 2LP0A 1NHCA 5DS0A 2V7QA 2DODA 3P9IA 4FISA 3K1MA 1Z0XA 3DKYA 1MABA 1QVGB 3BPXA 1WRJA 2ZBKA 4IOCF 1AU7A 3CJNA 3K0LA 3OS1A 5IOZA 4Y17A 1IXRC 1RQRA 4GCVA 3C2HA 4IQJA 3PO3J 2EV0A 2HKOA 2HI3A 4I0AA 1W7PD 1TUIA 1HW2A 2EIMH 2HOEA 3CJTB 4MIMA 3LYCA 3JSPA 2FOKA 2CRVA 1YJNI 3MKWB 4GXOA 1N0VC 3CCVI 1EP3B 3IAS2 4BY1J 1Y6IA 3IKTA 1JA1A 1HW5A 2BVMA 2ZMEA 3SJZA 3P9CA 3BCDA 2HNHA 1TQPA 5J3LA 2EK5A 4OZYA 2ZSIB 2XNDA 1JKQC 1Z9CA 1N08A 1EFRA 4KICA 3CP2A 2O03A 1DG1G 3HC7A 5GAGJ 4U4BA 1DP3A 3WTUC 4IF4A 1E64A 4P25A 4X0CA 3C1DA 2V31A 2ZMEB 4KKUA 1X19A 1GV2A 5E1ZB 1FMWA 4WXCA 2D3LA 4P2NA 1VQPB 2BY1A 2JRTA 3G3ZA 1RR8C 3ASRA 4XSZF 2VB6A 4XLAA 2HCJB 1KD1D 3ZQFA 2YUHA 3ABUA 4X7EA 3UR3C 3CC4I 1MJ9A 2Z8GA 3LOCA 5HLHA 2NTBA 4Z4YA 2E1MC 2HOTA 2OBRA 2QQAA 2DN0A 1IJWC 2R7TA 1QVTA 3ASPA 5EF6A 3EQLF 4HX7A 2R5YB 2ZL6A 3KCCA 2Y75A 4I7HA 2L54A 5D8LB 2JT1A 2IGOA 5GAHJ 3M07A 4RAZA 2IVMA 4EJWA 2DFHA 1B9NA 4N4OB 2O6GE 2E1RA 1O8FA 3ZZUA 4LG0A 3WTVC 3RZDJ 2VPRA 1T6ZA 1UFMA 2KLOA 4XMYA 1ZRCA 4A93J 4LBZA 4PC3A 3I55B 5IP9J 1AA7A 3AG2H 4BJ6C 1X0CA 5AMVA 2V7FA 2ZNYA 3ZQGA 1VQOI 2CH0A 2CSOA 2DA2A 1JKPC 2ZJ2A 2CGPA 4F91B 2ELHA 3DTEA 1IAWA 4LG0B 1T33A 4NNJA 1QGAA 1A6QA 5D5XB 3QWLA 2COBA 1K61A 2WPDA 3ZMTA 3K4CA 4NK6A 3QP5A 2WR8A 1O8EA 2DY1A 1BL0A 2L7MP 1WJ5A 2NOGA 2VOPA 2C78A 3OIOA 2YU9J 2PYHA 1YJ9B 3DEWA 4X7FA 3BR2A 1I5ZA 3KRGA 3ISPA 3SZEA 1MZBA 3LQRA 1V5VA 4L9TA 1IB0A 5FKKA 2QA4B 4L9NA 2XRLA 4IVNA 2EIXA 1BR1A 1PP8F 2KPMA 2KISA 1EP1B 1QQ1A 1KQ9A 3IH4A 1T0FA 3DU1X 3K10A 2ZJPF 1MKMA 4URRA 2FMYA 1NRKA 3LQQA 3RSNA 2LTPA 3A0BC 1BM9A 5BMZA 3Q0WA 5TY0A 1VQKI 3DWLE 3R0AA 4JP0A 2QKMB 5DD4A 3VYSB 1PUFA 4BACA 1TLHB 1O57A 4QPQA 3MKZA 2V1DA 1XMAA 4JMQA 5F08A 1P7JA 1K9MD 2K86A 2B0LA 2OD5A 3ZQQA 1LE8B 5F27A 4XLHA 2CC2A 3PA1A 2ECBA 4L18B 1WZ2A 2HS5A 4PSWA 1W7PB 4LB6B 3O8HA 5JR3A 1SD5A 1TNSA 1PUFB 2YWHA 3A1PA 1OFEA 2A05A 4M3DA 3JRIA 1X1AA 2DK5A 5ED4A 2D1HA 2MYSA 4AU7A 3CMEB 2Q8KA 3CCMI 2NV4A 5EZGA 3WQZA 4XICA 1YO5C 1FC3A 2XT2A 3BQYA 5DD8A 1E3PA 2NSTA 1TTYA 2MC4A 3MKLA 1U5TC 5F1JA 4YEIA 2QVOA 2QLZA 1YITI 4B4CA 4OINF 1UHMA 4P55A 3TO7A 1Q1VA 1WMRA 4XR6A 4HE5A 4CCJA 1GLNA 3NWSA 1R9TJ 5D4SA 4ACBA 1W1WE 4BGDA 1D2EA 1TVCA 4MLOA 5LEKA 4PJLA 5FD6A 5FGMA 3H09A 4KN7X 3R61A 2WY7Q 3SHFA 3P26A 1IZ1A 4PAAA 1HXDA 1WSUA 2XF7A 3BDDA 1JKOC 4RDLA 2ZL7A 2DK8A 2FJ1A 2DYIA 1NG6A 2TRTA 4OJ6A 1R5HA 2M7BA 4A3CJ 1TWGJ 3CF2A 3E3VA 3GMEA 1MMSA 3E1SA 3G2BA 1ZM4A 3BR1A 3DBHB 3FPPA 5E8GA 2P7CB 3FXKA 5A2QK 2LY2A 1P6RA 3ZSCA 3M1CA 4Z4TA 1PJ6A 5BNGA 4P5OA 2CV1A 1XGSA 2EILH 2ICWG 4OOXA 1EH6A 2F4NA 3MWMA 5LHHA 1CQXA 2IA2A 2XTWA 4G7HF 3BR6A 3UKGA 3IL2A 4RCZA 3DP7A 4YELA 2QF7A 3CC2B 2VFPA 3R0JA 5KSWB 1Z7LA 1GDTA 3EUHA 5IYRA 4RDJA 1OFLA 2A6EF 1UD8A 2YR2A 2I8DA 4P1VA 5K5QA 3SJMA 2D1VA 4KA4A 1LQ1A 3S2HJ 1EFUA 1WQ2A 4UB6C 4AC9A 4XRMA 5J40A 1I27A 1TQMA 2QXZA 4RD6A 1RKTA 4RD4A 3BY1A 3HOTA 1JE8A 1ETXA 1WORA 1BPLA 4R8HA 1QFZA 4Z4WA 2F48A 1CZFA 2FNAA 2G7UA 2ESHA 2OF7A 3HRMA 5TGTA 4WCGA 3W2FA 3KEWA 5HS7A 3E6DA 2K3FA 2STTA 1ZHFA 3H5NA 3ABKH 1ZH5A 2OPTA 3HG9A 4YEJA 1ZRFA 1IGNA 1ELOA 3OYMA 2EB7A 1STZA 3O6BB 3ZQIA 2QBYA 1UG0A 1XGNA 3VODA 2VQCA 1WPKA 2QN6A 2NRAC 2Y31A 1AWCA 5KNLA 4MYUA 4PK4A 1ENHA 3ZQ7A 3AGQA 4ZZLA 3LFUA 4HG2A 2QBYB 5FNZA 3SZPA 4OOVA 1KGSA 2ZO4A 3JTHA 4RB2C 3KP2A 4R71A 1R36A 4HIZA 3FHZA 2C2WA 4G1VA 4I76A 4JX5A 3NARA 4KYWA 4DOZA 3TL4X 2DI3A 3SY2A 2RC6A 4RLQA 3HPHA 5FRNA 3FKIJ 1NB9A 3I3LA 2FQ3A 1R5OA 1XPXA 3GZ6A 3BG6A 2B0RA 4OWRB 1RNLA 2UVFA 4IHYA 2R7VA 1QRYA 3LNQA 2B63J 1QQIA 4NHJA 2XNCA 3HM5A 4B48A 2C5HA 2L4MA 2X3HA 2HTJA 1O88A 2VE9A 2ZTNA 2L9RA 1TLLA 2O0WA 4AYBN 3CUQA 3R6KA 1WVRA 1KK2A 2L0KA 1BW6A 5J35A 3LA2A 3F8FA 1JI8A 1JB9A 1POGA 4M1KA 3AVWA 3SYJA 4E4HA 5J8CA 2QZ8A 4KKTA 1Y0YA 1K8FA 1OCRH 3ZGKA 4BYYA 3OKXA 3AK5A 4YFXF 1HOMA 4P12A 2F4OB 1DPUA 4LC0A 3CUQB 4F3QA 3HOZJ 2HYFA 1TTTA 5A89A 3H92A 4G8XA 2OTLI 3PM1A 3GEZA 3QOEA 2V79A 2X6WA 1IRGA 3W6JB 4LLNA 2XGJA 3DTKA 3GTMJ 1IN5A 3OS2A 5H20A 2VNIA 2IS1A 4ZYEA 5AIQA 1VQ8I 1FEXA 1X1PA 4LBWA 1Q1HA 5FKOA 3OOCA 4YCQA 1BHEA 3DFGA 4H0EA 2W25A 4XSXF 1ITYA 4K1XA 1G3WA 3AL0C 2DA1A 1OYIA 3MCZA 1KZHA 4C3HJ 1X1DA 3L1PA 2BHZA 3OS0A 2BBYA 1LDKB 2K9MA 1LFPA 3OYJA 1RQPA 1R00A 4WWVA 5H6RA 1E0EA 2QDXA 1BA5A 1S9HA 2GQFA 5GPCA 2E34A 4UHTA 4PC7A 3FKSA 1HA3A 1EV7A 2BGCA 1RETA 3OR2C 2OJED 1UG2A 1FOWA 2ZZQA 2V9KA 4RDUA 3D26A 3JRGA 2M8GX 2XAJA 3RKYA 3ZMSA 2HMAA 1IJFA 5BPDA 3H9NA 4AIJA 4GYIA 3L2VA 1KCCA 4PMHA 2D74A 1Z05A 4Y52J 4F52A 3IC7A 3I58A 1OB5A 1GQ8A 3RYPA 1ZG3A 4N3GA 4BXXJ 4Y13A 4PGHA 4BPRA 3G1LA 1V5FA 4XKBA 4BXFA 3S1RJ 4OPWA 3WYAA 1FP2A 1R23A 1OCTC 1RI7A 1ZGAA 5BPIA 2D2WA 5EG0A 3CCYA 2KT0A 4DBRA 1MGTA 3MMYB 4DZJA 5JHFA 2HDWA 2QQ8A 4C30A 1W87A 4ROXA 1VBLA 2VFOA 2CJJA 2QGUA 4HQMA 4BHCA 2WADA 5LHIA 3ZPPA 4DNTB 1P9QC 1YQAA 4E6KG 3A3BA 4OJPA 4EV0A 2ZFWA 2X6YA 4NBQA 1OFDA 3WU2C 4A12A 1Z91A 2O7OA 2P0WA 4L5EA 5EG0B 2DOAA 5EZHA 5C44J 3PNYA 1XCVA 2UXNA 2R7FA 1G3TA 1SMTA 2DA6A 3BR5A 3NWTA 1YE9A 2QSGX 5A2QZ 4F55A 2ZXWH 3VSUA 1S7OA 2DA5A 3SDGA 2V6CA 2WAQN 1G59A 3GQBA 3AAFA 2DA3A 1G7CA 1J2XA 4WF2A 3UNGC 1KRHA 4RD2A 1TYXA 2PLYA 3W6VA 3L09A 1E63A 1V0FA 4CQJA 3RIQA 4FE4A 3ERED 2WJYA 1OISA 1YLFA 1W9XA 2BW3A 2C4TA 1WFXA 1WOPA 2FUG2 2XV4S 3GFMA 3WTXC 1JUSA 4HEA2 3AG1H 3HZJA 3ONQA 2CU7A 2NNYA 3VYRB 2HYGD 1LJ9A 2E7WA 2LSOA 5M5XJ 3W5HA 2OQGA 4LOCA 4N3NA 2FQ4A 3VSKA 3WODF 2GM4A 3CCQI 2JN6A 3CD6I 2BW3B 1S72B 4II2A 5B6IA 3ECOA 1JHHA 3FM3A 3U2QA 4KMUX 4KNYA 4A3EJ 4OIQF 4HF0A 2VKVA 4RB3C 4QPOA 3ECHA 4EJOA 1OCZH 2DETA 3Q3AA 1H89C 1QCXA 2HR3A 2K40A 2X0KA 3U2RA 1DU6A 3IH3A 3T51B 4RAFA 3OV8A 3CCUI 3ZN0A 1DABA 4NDLA 4XRSA 2VXDA 3RKXA 2CV0A 4U0WA 4EH1A 3W2WA 1B6AA 5DDGA 1R7JA 3OYCA 4BE2A 1DQUA 4S04A 1KJZA 1UD2A 3CO6C 2LG4A 4NQWA 2V4JC 4A0YA 1HLVA 1FLIA 3V7RA 5J1YA 2D3NA 3P27A 1K28D 2WZPP 2RV8A 4HA8A 3ABTA 5ICFA 1R4NB 5DEQA 2EPFA 4NC6A 2RC4A 3H0GJ 2VBTA 1A36A 1FZPB 4PC1A 2DDAA 1FT9A 2ZNZA 3J7AO 3E5XA 4G7OF 4YFKF 3QFCA 1NBMA 3LJYA 2ISYA 3PFIA 3TQNA 1PJ5A 2HOSA 3P7NA 4BBSJ 4LIUA 1ZG1A 2V4DA 4B47A 4QTRA 1U8BA 4A3GJ 2L7ZA 4XD7A 3K4LA 3PENA 4Z2YA 5DM6F 1OB0A 1B8IA 3JTGA 4P1WA 3COAC 1GVJA 1Z21A 2DOGA 4B44A 5DYMA 3KZZA 1IDYA 1X58A 4ZTJA 2X1CA 1DGWY 1LVKA 2ECCA 4UAJA 3V7AA 3N4MA 2DU9A 2EA4A 3ZMVA 1B8IB 4FX4A 1DARA 1EA0A 2VT3A 1ODDA 1JJ6C 3GVKA 2DBBA 1LM1A 2Y0SN 2Z33A 2W7ZA 3WNBA 5J47A 2DCUA 2CG4A 2BM5A 1R49A 3B4NA 1YS6A 4BJ5C 2F1LA 4M0LA 2EH3A 3EYYA 2MD0A 2XHKA 3ISXA 3VMWA 4FHTA 5CYVA 4H9GA 2A61A 2K3PA 1VQ7I 3OJXA 3OOPA 4ASNA 2PLFA 3OYIA 1YS7A 3OEHA 4Z05A 2KIMA 3PL8A 2VQLA 3BY6A 3IH2A 4WXDA 1IW7F 1ETKA 2KFDA 2ZL5A 2KVOA 1JGSA 4D5CA 1F43A 3LA3A 4HYEA 5HS9A 1CF7A 5ILVA 4AF6A 3I64A 3GO5A 2VKDA 2LR8A 4HZFA 3CCLI 3BROA 1MMDA 2KIUA 1MBJA 3A03A 1D8TA 3GZ5A 3PETA 4X1EA 2FBKA 4BJTA 3IUOA 2NVXJ 2DQRA 3QQAA 2EFQA 4Q47A 1CF7B 2IT0A 1B2RA 3ZUGA 4RLZA 2DAOA 5CJ9A 1I6HJ 1T95A 4EQQA 3HEFA 1TT0A 3A1YA 3WTWC 4W8QA 2H6BA 1ZYRF 2FF4A 5FKNA 2Y2ZA 1XMKA 4ZCLA 3F8NA 5L3CA 4FASD 2VBZA 4GYGA 2E2HJ 3WGGA 1EF4A 4MTEA 4X0GA 3A3GA 4AYBA 4C2UA 2LVSA 2DFFA 2NS7A 3F72A 4A6EA 1NG7A 2GA1A 3SFZA 3AVYA 1B59A 2DJNA 1EA3A 3GTQJ 3M1EA 3PNTA 4AIHA 2YSRA 2CQNA 3DPUA 2WSSA 4W8RA 3S2WA 2WC2A 1IUFA 1WH5A 2FX0A 2XKOA 5DUKA 5HLTA 3ZQCA 3GW2A 1EJ9A 4UY8I 2PECA 1VQ6B 2IAIA 3CW2A 2W82A 1PDNC 3AVUA 5CLSA 4MTDA 3FXMA 1Y0RA 4X7DA 3MMPA 2Q6IA 4XQFA 3CQZJ 1X2MA 3HKZN 2HQAA 1IO2A 2OTJB 2YX7A 2K9QA 3VMVA 2E1BA 3JRFA 1FSHA 3NRVA 3L2QA 2KJBA 2QQBA 4OM9A 1DBGA 4QVAA 3SJPA 1E3ZA 1FP1D 1YIOA 1Y8RB 3E0JB 2EIJH 4KFCA 1Q7YD 4ZGNB 4E70A 1T6SA 4UUTA 5ICEA 1Y39A 2B7EA 1O4XA 3TOAA 2NZMA 1ETVA 2XF6A 1HC8A 2Q0OA 4DBQA 5KHDA 1T6XA 5GV8A 3BPVA 4OIOF 4LITA 2MG4A 2PI0A 5IP6A 4DQLA 2RC5A 1VQ4I 2Y9ZA 4IKFA 1U9NA 5DSZA 2XSJC 3RJPA 4RD3A 2MH9A 4BS9A 3I1FA 5FO0A 3N90A 1FSEA 3VNUA 2DYSH 1M1KD 3VNVA 1JA0A 4FWTA 4WQMA 5K5OA 4WZKA 3BQZA 3JX8A 1JKRC 1EXMA 2WB1N 2OA4A 5GADJ 4E7IA 4N0BA 5CVVA 3ASQA 3ZZ0A 4HF2A 3Q38A 3GVJA 3I59A 3CCEI 1QZYA 2UUZA 1VQ6I 3AVTA 1OOCA 2X9DA 4C3IJ 4M2LA 1O8GA 1W34A 4JRAC 3DCFA 3VMFA 3ZPLA 1IB4A 1PE9A 2JA6J 4JBAA 4CCOA 1OB2A 4RPBA 5K1YA 2JA2A 3CJQB 2UWMA 4U49A 4X8IA 3K2AA 3U1KA 1QH0A 3BH4A 2L7KA 2ZXJA 4L0YB 2JA7J 2E19A 1CNFA 2BOLA 4IHVA 4AF7A 3DQVC 2IXSA 2ZKZA 4YC5A 1OYYA 2V7VA 4LK1F 2KIFA 2WAQA 2RVCA 1I18A 4G5GA 2Y48A 1BJKA 2V9PA 4QVJA 2JVGA 2X3UA 2AXTC 1WTHD 4LBYA 4HV6A 3Q9SA 5HOOA 3TP0A 4G7WA 2XAHA 5D5WB 3S16J 4DZPA 5HZAA 4I6ZA 4A3KJ 4N4NB 1DU0A 2VPLA 4RJLA 2JUGA 4RM0A 4L9VA 4IRGA 1O7FA 5GAEJ 2CUFA 4J01A 2K9LA 3Q9VA 1G4DA 4I0BA 1H8EA 2HXOA 2WV0A 4HV5A 2BY2A 3CCSI 1O8KA 3HOXJ 2DMUA 4ESBA 3HUGB 5GTIC 1H0MA 1WSVA 2O6WA 1W0JA 3U9GA 3HHGA 3T9GA 2CBXA 3BZCA 3OFNA 4BU2A 3T1BA 2VBVA 3PVDA 1W5CC 3OW2B 1COWA 4DJAA 4HX4A 2PJPA 1L1IA 1MMNA 4CICA 1TBXA 1Z67A 3ML6A 3A02A 3BWGA 4JK1X 5IYWA 1XTAA 3PJRA 4MEYF 4ZDOA 3NAUA 4FETA 1LFUP 3BJOA 1WH7A 3HRTA 1HCRA 1KC8D 3ABLH 3R6SA 3I56B 5E6TA 1XG1A 4D0PA 2NYXA 3D0SA 4HLXA 3ERMA 1WGXA 2MA3A 5IY5H 3E6CC 2R5YA 5EDNA 2LKXA 1O8JA 1O8LA 3A8KA 2WV1A 3WGIA 4GFBA 4V2GA 2VBMA 2O8KA 3RKWA 1KU9A 4UUVA 1NHAA 2F3LA 1I1GA 5K5RA 3DF8A 1ETYA 1ULYA 5HXBA 3E7LA 1QRCA 1OCOH 1V55H 3K4KA 3LA7A 1IRZA 2QSFX 2FVGA 3LO8A 5EGOA 1OFMA 1IHMA 4Z4VA 1UZCA 2X4HA 4Z03A 4OJ5A 3LSKA 3BCFA 3TGNA 3CZ6A 3WNCA 1BMFA 2CQQA 4FCYA 1Z1DA 1NK3P 5FD5A 5FO5A 5HVQC 1W36D 2KL4A 5EEHA 5EGOB 4P22A 4XLCA 4J19A 1EZGA 3R60A 4MHGA 1IXSB 3K1PA 5L3GA 2XAQA 4IX7A 2PMZN 3FKJA 1E1QA 2XGCA 3BP8A 2VFQA 1Z3YA 1S3JA 2XPUA 1RUOA 2C6YA 1G7RA 1IRFA 3D5LA 2DJIA 4RGXA 1XDSA 1YW9A 1ZM3A 4YIFA 2OUMA 2Y0SA 1OCCH 4I98B 1K6OA 3E20A 1P4WA 4V02C 2QKLB 1G3SA 2L5QA 3CCJB 4RAGA 2ZBVA 3GQ9A 2Q2EA 5EEGA 5KVRA 2OYNA 1VQPI 3GVAA 2GWRA 1LPQA 1KU3A 2CUEA 3K6GA 4TMVA 2Z1DA 5IP7J
chains in the Genus database with same CATH topology
4GRIA 2UVFA 3L2UA 5CDFA 2R7VA 5CPRB 4G7XA 4OJLA 2Q2EB 1PLUA 4B48A 2LY1A 2DIEA 3K4JA 2R9VA 4DNRB 2X3HA 4ZJZA 3OYGA 2E1MB 3SEQA 5LD2C 1O88A 2IS4A 2ZTNA 2CUZA 2W4SA 3OL4A 3OMYA 3L2WA 2GJRA 2O0WA 1VF7A 2O17A 4PJNA 2WA0A 2L9SA 2R7XA 2X53S 1UD4A 2ZTGA 1Y56A 2BVLA 1JI8A 3JURA 4E4HA 1SKYB 4KKTA 3ZGKA 3OYNA 2VXZA 5FRMA 4NQWB 2VJIA 2L9NA 2VQHA 2Z2SB 3C2GA 2AQFA 3IP4B 4HSRA 5CKTA 1WP6A 1J09A 4TSFA 3DPLC 3B8YA 1H80A 3H9GA 4F3QA 2CFOA 5HKKA 3OEEA 3KYLA 4HNUA 2OV7A 3QOEA 4JQFA 2X6WA 1D1CA 3LSIA 4D1QA 1QJVA 2XGJA 3DTKA 2Z16A 1BR2A 1WJAA 3OS2A 2F6CA 2HVQA 4XKCA 4BQOA 4C9YA 2IS1A 5HNFA 3OOCA 3OYFA 4E0FA 1BHEA 5KCMA 1SAUA 3AL0C 2GJPA 2KRHA 3H5AA 1X1DA 4CUGA 3G05A 3OS0A 3OYJA 4HSTA 1LDKB 2K9MA 1LFPA 4Y4RA 1E43A 1AIRA 4E7LA 3BC9A 3PFYA 4DGWB 2NT6A 2Q1ZB 1E0EA 2W6IA 2ZSHB 1S9HA 3BCAA 4BUPA 1HA8A 4KITB 1N77A 2JJ2A 3T56B 1PXZA 2X85A 3H35A 2CW8A 2A5WA 1KTWA 4KJZA 4J00A 2Z6BD 3FKSA 3HKZA 1QU3A 2E60A 4BE0A 1V0EA 3OR2C 4CSWA 1RMGA 3VYUB 2ZZQA 2V9KA 1IDKA 4CA0A 3T53B 4YZAA 4FXUA 1BLIA 3VSTA 1FMVA 3SEZA 1PJRA 2VASA 3OR1C 3L2VA 2M0MA 2X1DA 3V42A 1KCCA 4PMHA 1GQ8A 3BLYA 4F52A 3VDXA 1E1RA 2K5CA 3FBIB 1V5GA 3OYBA 1EE6A 3LMMA 3VYTB 1V5FA 1N75A 4XKBA 4BXFA 3EQOA 1D0XA 4Z06A 4C2LA 2PJRA 2R7RA 4HNTA 2W6JA 2MABA 2V26A 3DU6A 3U21A 4JOMA 4DBRA 3MMYB 5JHFA 2HDWA 2WBMA 4C30A 2JIZA 4TKOB 1VBLA 2IGKA 2WADA 3W2VA 3ZPPA 4DNTB 1MW7A 1X1BA 1P9QC 4PSXA 2WAFA 4E6KG 2LH9A 3SZGA 3A3BA 4OJPA 4EW9A 2XDVA 2X6YA 2PJRB 4I84A 5C1EA 3K70D 2WB1A 2P0WA 4G6TB 4CZCA 2DOAA 2HVRA 1UD6A 3PNYA 3MKYB 3LSGA 2R7WA 1OGMX 2GOXB 3HXLA 2M5SA 3NWTA 1YE9A 3VSUA 4II3A 4F55A 1DBOA 4KISA 4LG3A 1G59A 3GQBA 4GQNA 1UAAA 3UNGC 2WAEA 3FDYA 4F92B 3EUAA 2QE7A 1OHHA 4ITVA 2CK3A 1V0FA 2JDIA 2X51A 4Z1MA 4F93B 2XC7A 2KDOA 4XKVA 1UD5A 1W9XA 2WJYA 2BW3A 1WFXA 3L2RA 2FUG2 4HEA2 2LOOA 2VKHA 3A2KA 1BN8A 3ONQA 1T0FC 1KONA 2LREA 3LSHA 5DN6A 5IK2A 4MR0A 1XG2A 4D9JA 3VYRB 3VR6A 4PFOA 1HVXA 1KZLA 3VSKA 2BW3B 4II2A 2VJJA 4AVZA 3PSFA 4YZQA 1E79A 3M8JA 1W0KA 4QPOA 4XOTA 1BOBA 2XAUA 2GK6A 3OE7A 1QCXA 4DIQA 2M7AA 3S3NA 3T51B 3AFHA 2M3AA 4B3FX 2WJVA 5HNHA 4ZC3A 3DLAA 3BC8A 2QY1A 4OJOA 2VL8A 2CV2A 3K70C 2VXDA 2CV0A 2W7NA 4IZZA 3W2WA 5FL7A 2KP6A 3OYCA 3S93A 1D1BA 4BE2A 1DQUA 2F5VA 1TZLA 3ZCOA 4BL0B 1UD2A 4XKWA 2VBEA 2LG4A 2V4JC 2GK7A 4HRIA 2GOMA 2D3NA 1OLTA 3EQNA 4U7BA 1UELB 1K28D 2WZPP 3MD2A 2XZOA 3CESA 1X4OA 4KT6A 2NSPA 2O0VA 1VLYA 3B90A 2CS3A 3SDBA 2KRCA 4NC8A 2VBKA 2KQRA 1T5EA 3WWGA 3D5RC 2DXIA 1WJBA 4DK1A 4NK8A 4RLFA 1NBMA 1WJCA 3OYEA 2DT6A 2IGNA 2RNGA 3H5RA 4LIUA 4PUSA 4PFPA 2V4DA 3DEEA 2R7OA 4XOPA 3ZR8X 3OL3A 4B47A 4XD7A 3K4LA 1OGOX 3IAM2 1E3XA 1OB0A 1BR4A 1O8HA 4P1WA 4BDYA 1Z21A 3ZPNA 2E5NA 4B44A 1V5EA 4KKSA 3KEYA 4ZTJA 2X1CA 3GBGA 5CQEA 2VLAA 4E7HA 1DGWY 1LVKA 4XONA 3A35A 1LKXA 2UV1A 2PYGA 4XNFA 4MXNA 2AQEA 2DCEA 4CCLA 1QHHD 2V6EA 1MMGA 4LIVA 4CCNA 3SYTA 2ZZGA 1KCDA 3RTRA 3GQ8A 4DK0A 3K4BA 4RM3A 3GVKA 4ZTFA 1H8HA 1O8IA 3EUHC 3LL7A 2LZJA 2LRDA 3FHNA 4E7ZA 2R4GA 2CMPA 3B4NA 4BJ5C 2R7SA 4XM3A 3S8PA 2NT9A 4XN0A 2MD0A 2VJ4A 3VMWA 2IGMA 4PJMA 2MFZA 2V7QA 2HVSA 2K3PA 2LC2A 1NHCA 1D1AA 3DKYA 1MABA 1R6RA 2PMZA 3RQ4A 3OYIA 3OS1A 4W8TA 1PYVA 2O1DA 3OEHA 4Z05A 2JSPA 3PL8A 2VQLA 3FY3A 4ASUA 2ODLA 3C2HA 4IQJA 2KVOA 2NTPA 3HPGA 4RM2A 4XN3A 4OZZA 3UW0A 2OC6A 3GVLA 1SFKA 2KHMA 2HU9A 2VKDA 1VZ0A 3MKWB 1MMDA 3S3OA 3DKXA 3IAS2 3OOUA 4BJTA 5C1CA 3IUOA 1Y6IA 1D0ZA 2BVMA 3BCDA 2HNHA 2WY8Q 4OZYA 2ZSIB 3QYBA 2XNDA 1RU4A 1T95A 1EFRA 3OYHA 3CP2A 3KX2A 1TT0A 3A1YA 3HC7A 4U4BA 1DP3A 4W8QA 5CQGA 2V31A 4KKUA 1X19A 4FASD 3DTIA 3N05A 1FMWA 2D3LA 1WJFA 2HPMA 3AL0B 2XZLA 4X0GA 4XLEA 1MMAA 3A3GA 2X1EA 2VB6A 4XLAA 4AYBA 5FROA 4C2UA 1NG7A 3UR3C 3TBIA 1EA3A 2M4KA 2Z8GA 3PNTA 2IS2A 2NTBA 3DPUA 2E1MC 2WSSA 2VJ5A 4YZXA 4W8RA 2EWEA 1VJSA 2R7TA 4YXWA 5HLTA 2L2OA 3NE5B 2ZFUA 3S32A 1KMHA 2PECA 1X1CA 2W82A 3OPOA 2X6XA 2IGOA 3BG7A 2R7UA 3J7AY 4N4OB 2GJKA 2RQQA 1O8FA 2CUJA 4XQFA 2HQAA 3CJRB 2KLOA 4XMYA 2HLDA 3VMVA 2E1BA 4ZDLA 3GQ7A 2DT7B 1AA7A 2W00A 3CP8A 4BJ6C 3DPTA 3L2QA 3HOSA 1X0CA 5AMVA 3ZRGA 1DBGA 2V7FA 3PSIA 2CH0A 2M4GA 2W1OA 4NUBA 4F91B 3DTEA 1E3ZA 3E0JB 4NNJA 3OYAA 4G6IA 2WPDA 3K4CA 2NZMA 3H9QA 3W3CA 4NK6A 4OAZA 2XF6A 1O8EA 2ZXIA 4DBQA 4E7SA 5KHDA 3BCBA 2LBFB 1WJ5A 4LITA 1UD3A 3GQAA 2PYHA 3ZXSA 1JRGA 3KRGA 4R79A 4E7KA 4IKFA 3PUBA 1HZEA 1YX5A 2XSJC 3OW7A 3CMMA 3VSLA 4BS9A 1BR1A 2KPMA 1RWRA 3H94A 3EUKL 4BDZA 2E5ZA 3PNVA 3K4NA 3K10A 2BSPA 4URRA 1NRKA 1Z3XA 3RSNA 4E7IA 4BQQA 4HPQA 2X8KA 4BEHA 1JTAA 3GVJA 3DWLE 4UZUA 2QKMB 2UUZA 3VYSB 2V1NA 4BACA 1OOCA 3VSVA 2XOKA 4QPQA 3QYFA 3MKZA 4JMQA 3I9V2 1IB4A 1W36C 3ZQQA 4EATA 4XORA 1PE9A 2INUA 4XLHA 4BEHB 4CCOA 3HAGA 4PSWA 4PJJA 2JA2A 3CJQB 2UWMA 4U49A 3BH4A 4B3XA 2L7KA 1U0JA 1X1AA 2LYCA 1O8GA 2ELJA 2BOLA 2MYSA 4AU7A 4ANJA 3DQVC 3WQZA 2IXSA 2XF5A 4RMNA 2WAQA 2NSTA 2MC4A 3OYDA 1I18A 3F9KA 2CW7A 2JVGA 3H9JA 1WTHD 2JVHA 1WMRA 4XR6A 4IQ4A 4CCJA 5HOOA 4G7WA 1OR7C 1GLNA 3S3MA 1PKVA 3NWSA 4OAYA 3OAAA 2F1MA 4N4NB 4BGDA 4NC7A 2VPLA 4TT3A 1O8MA 2JUGA 4Y33A 4MLOA 4PJLA 4J01A 3OY9A 2K9LA 2XZPA 1H8EA 2WY7Q 1K5CA 4XLFA 3SUCA 3H0DA 1ERDA 2NTQA 2XF7A 4W8SA 3QODA 2IS6A 1O8KA 4OJ6A 1NG6A 1N78A 3HUGB 3OIPA 2M7BA 4BE1A 3CF2A 2VIXA 1W0JA 1D0YA 3E1SA 3G2BA 2INVA 3T9GA 3FPPA 3OFNA 4BU2A 2LY2A 3ZSCA 3M1CA 4L8JA 2IQ7A 4P5OA 2CV1A 1COWA 4DJAA 1WPCA 1DGRM 1MMNA 2O5RA 1WJDA 2HZDA 3PJRA 4B3GA 4YELA 4ZDOA 4FETA 2QX3A 3DU5A 1YX3A 1O8DA 1Z7LA 1OFLA 1O8JA 2ZZEA 1UD8A 1K6YA 1O8LA 3OWTA 2I8DA 3JU4A 2VBMA 4XL9A 2F43A 3W2AA 3RCOA 3LMWA 4ZDPA 1IA5A 2VQGA 1ZELA 2RREA 3RPUD 1QHGA 3TMOA 3OYLA 2QXZA 2F4IA 4CH7A 3HOTA 3VWBA 3K4KA 1BPLA 4HWVA 4BQNA 1OFMA 1CZFA 1IDJA 5TGTA 4ZYAA 3OIQA 3KEWA 2ZZFA 4B43A 3LSKA 3BCFA 4OJ5A 3CZ6A 4Z03A 1BMFA 3H5NA 4C2TA 3EPZA 2JJ1A 3LSMA 1MNDA 5HVQC 1W36D 2UVEA 2KL4A 4P22A 2ZXHA 2KZVA 3HG9A 4XLCA 4YEJA 3OYKA 4CCMA 3OYMA 2A6TA 3FBNB 2LBFA 4IX7A 1UG0A 3FKJA 2VQCA 1E1QA 1Z3YA 1MNEA 1I8DA 3AKZA 3D5LA 2DJIA 5KNLA 2KMUA 3K4MA 3GRHA 2OUMA 4PK4A 2NOJB 2R7QA 2Y0SA 4YRVA 3LFUA 4HG2A 3DDYA 2QKLB 5LFAA 4HIZA 1HG8A 2L5QA 1WJEA 3HL2A 1X4PA 2O04A 1IRXA 4DOZA 3TL4X 3GQ9A 3A4CA 3D5SC 4E7JA 4RLQA 3HPHA 5FRNA 3QYEA 4YZ0A 3I3LA 4Y3OA 4CCKA 1G8XA 3LNNA 1FX0A 4U87A 3K6GA 4H4KC 3ZIAA 2HPIA 2Z1DA 3BG6A 4OWRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVF A;  5C1C A;  1BN8 A;  2NST A;  4OJL A;  4MR0 A;  1PLU A;  1XG2 A;  1WMR A;  2X3H A;  4XR6 A;  4OZY A;  1O88 A;  1RU4 A;  2VJJ A;  4AVZ A;  2O0W A;  2O17 A;  4U4B A;  4W8Q A;  1O8M A;  4YZQ A;  3JUR A;  4XOT A;  1QCX A;  2VJI A;  1K5C A;  4XLF A;  3SUC A;  4XLE A;  2NTQ A;  4XLA A;  4W8S A;  3B8Y A;  1O8K A;  1H80 A;  4OJ6 A;  2QY1 A;  4OJO A;  2Z8G A;  2NTB A;  4YZX A;  2INV A;  4W8R A;  2X6W A;  2EWE A;  3T9G A;  1QJV A;  3ZSC A;  2IQ7 A;  2PEC A;  4XKW A;  2VBE A;  2X6X A;  1BHE A;  3EQN A;  1O8F A;  2NSP A;  4XQF A;  2O0V A;  4YEL A;  3B90 A;  1AIR A;  2VBK A;  2QX3 A;  4XMY A;  2NT6 A;  3VMV A;  1O8D A;  3GQ7 A;  3WWG A;  1PXZ A;  1OFL A;  1O8J A;  1X0C A;  2X85 A;  5AMV A;  1DBG A;  1KTW A;  1O8L A;  4NK8 A;  2VBM A;  4XL9 A;  3LMW A;  1IA5 A;  4XOP A;  1OGO X;  2NZM A;  4NK6 A;  1IDK A;  2QXZ A;  1O8E A;  1O8H A;  4YZA A;  3VST A;  1RMG A;  3GQA A;  4HWV A;  4XON A;  1OFM A;  1CZF A;  2PYH A;  1IDJ A;  1KCC A;  1JRG A;  3KRG A;  4PMH A;  2PYG A;  1GQ8 A;  4XNF A;  4MXN A;  4Z03 A;  4OJ5 A;  1EE6 A;  1KCD A;  4C2L A;  1RWR A;  2UVE A;  3EQO A;  4Z06 A;  3GQ8 A;  4YEJ A;  4XLC A;  2BSP A;  1O8I A;  4URR A;  3B4N A;  1JTA A;  4XM3 A;  1VBL A;  2NT9 A;  4XN0 A;  3ZPP A;  1OOC A;  4OJP A;  3VMW A;  3VSV A;  4EW9 A;  3GRH A;  4I84 A;  2X6Y A;  5C1E A;  1NHC A;  1IB4 A;  4XOR A;  1PE9 A;  2INU A;  1OGM X;  4W8T A;  4XLH A;  2O1D A;  3VSU A;  1HG8 A;  4Z05 A;  1DBO A;  3FY3 A;  2O04 A;  2ODL A;  3GQ9 A;  4U49 A;  2NTP A;  4OZZ A;  4XN3 A;  3UW0 A;  1O8G A;  4YZ0 A;  4XKV A; 
#chains in the Genus database with same CATH topology
 1QPI A;  1I39 A;  5CDF A;  2ZCW A;  1J7K A;  5CPR B;  1QA1 A;  2FBI A;  1LE8 A;  1XSD A;  2Q2E B;  1ZR4 A;  3F8M A;  3E5U A;  3CLO A;  1Y0U A;  2QEX B;  1W7P A;  4ZJZ A;  3OYG A;  3SEQ A;  2V1X A;  1FRN A;  1J75 A;  2IS4 A;  5L3B A;  4HQE A;  1W0U A;  3QP6 A;  2ZBU A;  4QHY A;  4PJN A;  2WA0 A;  4FQG A;  3ZQH A;  2L01 A;  3F3X A;  3HB9 A;  1UD4 A;  2KDZ A;  3JUR A;  4ZZD A;  2P4W A;  3OYN A;  4EMS A;  2VXZ A;  2VJI A;  2VQH A;  2Z2S B;  2M8E A;  3I55 I;  5E3O A;  1J09 A;  1QRB A;  3B8Y A;  1H80 A;  1TWA J;  3H9G A;  1IDZ A;  2CFO A;  3IKV A;  3KYL A;  1A31 A;  3CUO A;  4HNU A;  1UMK A;  4CZZ A;  1BI2 A;  1UCR A;  4TN1 A;  4YDT A;  3H1C A;  1QJV A;  5E17 F;  4HOB A;  2N8G A;  3ASN H;  1CQT A;  1BR2 A;  1WJA A;  3KLN A;  2F6C A;  2GIZ A;  3AG4 H;  2OCC H;  4C9Y A;  1FRQ A;  2ZME C;  5IPA A;  3OYF A;  1S0U A;  1SAU A;  4BHP A;  2GJP A;  4QIW N;  1YJ9 I;  1LLW A;  2JWT A;  4CUG A;  3B8H A;  1H9G A;  4Y4R A;  1AIR A;  4HDU A;  4E7L A;  1DUX C;  1E3H A;  2NT6 A;  2HKX A;  2Q1Z B;  2BPO A;  1K4S A;  1EWY A;  4A5M A;  2QA4 I;  3G4S B;  2KIQ A;  1ONV A;  1PXZ A;  1LEB A;  4KIT B;  1N77 A;  1D5V A;  3SZT A;  2J8K A;  3H35 A;  3R4K A;  4NB5 A;  3ZC3 A;  1WU8 A;  1KTW A;  2LKP A;  4RDK A;  1YG2 A;  3HKZ A;  4Z4R A;  3P5J A;  1VQN B;  1V0E A;  2GBY A;  3WG9 A;  4CSW A;  4Q4Z F;  1FIA A;  3LQE A;  2VC1 A;  3VYU B;  1FY7 A;  3ML3 A;  2QEX I;  4MYT A;  2R0Q C;  1V4R A;  5FJ8 J;  3CC7 B;  1XQB A;  2QQ9 A;  3VST A;  3M8F A;  1XCB A;  4Y9R A;  1ZRD A;  4K2E A;  2IA0 A;  1VQ9 B;  3ZMD A;  5F04 A;  5CVR A;  5IYC J;  1P4X A;  3V42 A;  2ACJ A;  1Q9S A;  1FOY A;  2BV3 A;  4A3I J;  3FMS A;  2QM3 A;  1H9T A;  1E1R A;  2RNJ A;  1QBJ A;  3MZY A;  1EE6 A;  1FNC A;  2BE5 F;  2STW A;  3VYT B;  1ZM9 A;  3EQO A;  4Z06 A;  3ONY A;  3CME I;  4ENM A;  4QLC U;  1R1V A;  2K85 A;  4M3G A;  2R7R A;  3ABM H;  3BR3 A;  1G2H A;  2W6J A;  2BZT A;  1QZZ A;  5BOX A;  1T6Y A;  4EVI A;  4TKO B;  1FJL A;  2WBM A;  1HDD C;  2MSY A;  1OR7 A;  4OMZ A;  1J59 A;  4X06 A;  4YAL A;  3W2V A;  3Q39 A;  1MW7 A;  4PSX A;  5F4O A;  1TYV A;  2K4B A;  4EW9 A;  2W24 A;  3HGG A;  4I84 A;  3K69 A;  4M4S A;  4TMW A;  2WB1 A;  4CZC A;  1UST A;  5L3D A;  5KAF C;  1XE1 A;  1K78 B;  3S14 J;  1N06 A;  3HJE A;  1Q86 D;  1TSP A;  2M5S A;  3GWZ A;  1BIA A;  2HOA A;  2HXI A;  5M3F J;  3KP3 A;  3H3U A;  2GQQ A;  4GQN A;  1UAA A;  3MHP A;  1XX5 A;  3FDY A;  3KFW X;  1RIO H;  3M3Y J;  1OHH A;  2L9V A;  1QFY A;  4A5N A;  2X51 A;  4P3Y A;  3KZY A;  3TW6 A;  1UD5 A;  1F20 A;  3BTC A;  1R71 A;  1ZAR A;  3FK6 A;  3A2K A;  1FNM A;  1T56 A;  1VQN I;  1BN8 A;  1QG0 A;  1T0F C;  5DN6 A;  3LSH A;  3ASS A;  4MR0 A;  1FBU A;  3KLO A;  3M7G A;  1F9N A;  4PFO A;  1HVX A;  3AST A;  2MH2 A;  1YJW B;  2R5Z A;  3U1D A;  3DXJ F;  1VQ9 I;  2HGC A;  3EET A;  4AVZ A;  3C2B A;  1TP4 A;  1E79 A;  4XOT A;  2CWE A;  1SC7 A;  1D1N A;  4WX9 A;  3LVB A;  5E18 F;  1GVH A;  3CC2 I;  2GK6 A;  3OE7 A;  5E1X A;  4DIQ A;  1MNM C;  1UHS A;  1LB2 A;  4A3B J;  1NDH A;  2H8W A;  1P4M A;  3KEQ A;  2R5Z B;  4IJA A;  5HNH A;  3DLA A;  3G6E B;  1ZK8 A;  4IHW A;  4OJO A;  4I02 A;  2CV2 A;  3K70 C;  5CVJ A;  4HNV A;  4IZZ A;  1IN4 A;  1KYW A;  3RI4 A;  1WDT A;  1QX4 A;  3GFJ A;  4LLG F;  2LNB A;  2Z99 A;  2AO9 A;  3EYI A;  1B4A A;  4XKW A;  2VBE A;  1KU7 A;  2GK7 A;  1RC9 A;  2CQX A;  2GOM A;  2GXG A;  3EQN A;  3MD2 A;  5TRD A;  2BM4 A;  2NSP A;  3FXR A;  4DNC A;  4A3J J;  2FNP A;  2CS3 A;  4A0Z A;  2KRC A;  3B90 A;  2HYJ A;  1IV8 A;  5FA6 A;  3WU0 A;  2QYU A;  4V2F A;  1HKT A;  3BTJ A;  2JPB A;  2QZA A;  3WWG A;  3I54 A;  3L7W A;  1FIP A;  3G71 B;  3HDD A;  1HST A;  1C0W A;  4DK1 A;  2HTS A;  2EWN A;  3HOY J;  4NK8 A;  1ZTR A;  5JLX A;  1WJC A;  1TL8 A;  2E7X A;  1ETW A;  2C5B A;  5ILS A;  4XOP A;  3ZR8 X;  3OL3 A;  1Y8Q B;  1WXR A;  4ON0 A;  4HF1 A;  3ROU A;  2DOF A;  2W48 A;  1V5E A;  1RMG A;  3BJA A;  1D8K A;  2VBU A;  2CRG A;  2YX4 A;  4P9U A;  3CO7 C;  4E7H A;  1YHQ B;  5E20 A;  1KK3 A;  2VE8 A;  1LKX A;  3T0Y A;  4X07 A;  2UV1 A;  1Z6R A;  4MO7 A;  2PIA A;  4X05 A;  2P7V B;  1KQ5 A;  2DO7 A;  1V54 H;  4F7D A;  1M90 D;  5L46 A;  1ETQ A;  1PP7 U;  5BSX A;  1EFT A;  3K4B A;  5HLI A;  4AUX A;  2FML A;  2K4J A;  4AWX B;  3EUH C;  3HOU J;  1LVA A;  2G0E A;  4BAY A;  2VOD A;  3J7Z I;  1R4M B;  2FSW A;  2R7S A;  4IW3 B;  3S8P A;  3WGH A;  3DBR B;  5F64 A;  2LDU A;  1ZLK A;  2GXA A;  2VJ4 A;  1JTX A;  3IWZ A;  2MFZ A;  3ZN1 A;  2LC2 A;  3A0H C;  3GF2 A;  1N0U A;  3E1Y E;  1R6R A;  2PMZ A;  1HF0 A;  3RQ4 A;  2LLK A;  5EEA A;  1PYV A;  3B6A A;  1QPM A;  2JSP A;  4PGG A;  3PA2 A;  3GXO A;  3KP6 A;  4EEF G;  4PC2 A;  4ASU A;  3CMA B;  4RM2 A;  4XN3 A;  4OZZ A;  1MJB A;  3UW0 A;  3GVL A;  1SFK A;  4MQ9 F;  1WOS A;  2HU9 A;  2L4A A;  1VZ0 A;  1BI3 A;  3DKX A;  5E1W A;  1GXQ A;  2OCE A;  2M45 A;  4YAU A;  1SFX A;  1SVL A;  5HDN A;  1FOX A;  3MQ0 A;  5F6F A;  3KP4 A;  4M6Y A;  4DW6 A;  1U8R A;  2V7U A;  3O3K A;  1R1T A;  2CO5 A;  2XGE A;  1BIB A;  3SFI A;  5D5U B;  5IYP A;  1GAQ A;  3CB4 A;  4EM1 A;  4HBL A;  4ZH4 F;  2IEK A;  1IN6 A;  1IUY A;  3Q6Q A;  3SEJ A;  1QA6 A;  5CQG A;  4EM0 B;  3FXU A;  4OIP F;  1SD7 A;  2EFP A;  3N05 A;  1VQ5 B;  1HDP A;  1WJF A;  1PVE A;  2HPM A;  2XZL A;  3N97 A;  4PC6 A;  3QU6 A;  3W2H A;  3G1M A;  2M1B A;  2X1E A;  4IPA A;  5FRO A;  1YRN A;  3WBK A;  3TBI A;  1Z6T A;  3I4N J;  4FE7 A;  3W6K B;  5JLW A;  5JVG F;  2IS2 A;  2H6C A;  1DDN A;  1IC8 A;  1FTZ A;  3W5U A;  1VJS A;  3BOQ A;  4G12 A;  3HOV J;  2L2O A;  2ZFU A;  5KAI C;  3S32 A;  1YRN B;  1TC3 C;  1KMH A;  4YHB A;  3PUM A;  1X1C A;  3OPO A;  2X6X A;  4R1H A;  3HRU A;  2H09 A;  3BG7 A;  5A88 A;  1MSE C;  3J7A Y;  2GJK A;  2RQQ A;  3CCL B;  2CUJ A;  4LMY A;  1XMX A;  1LNW A;  3CUQ C;  4C43 A;  5E3L A;  2GA2 A;  4L5I A;  5TJJ A;  4ZDL A;  3GQ7 A;  2DT7 B;  2W00 A;  3CP8 A;  2OAZ A;  4OIR F;  1FYL A;  3ZRG A;  3PSI A;  1JXS A;  2W1O A;  4NUB A;  3T5X A;  1OMI A;  3OSG A;  1TNT A;  2P81 A;  4G6I A;  2DTR A;  3MFK A;  3RZO J;  2YWE A;  4O5V A;  3H9Q A;  3KP7 A;  1D8J A;  2YWG A;  3ZZT A;  3ELK A;  4RGS A;  4E7S A;  3LQ6 A;  4HDV A;  2LBF B;  1UD3 A;  3GQA A;  4UVC A;  3F21 A;  3ZMU A;  5K7Z A;  5J3O A;  2H27 A;  3JAM K;  5JVT A;  1RR7 A;  1E3O C;  4E7K A;  1BOA A;  3PUB A;  5JBQ A;  3P4G A;  1YX5 A;  2G9W A;  2HQN A;  1A5J A;  4C2M J;  1ZR2 A;  2PMH A;  1MBK A;  1RPW A;  4HW0 A;  1RWR A;  3H94 A;  4AVP A;  1TWF J;  2O3F A;  2E5Z A;  3PNV A;  3K4N A;  1I50 J;  2ME0 A;  1OKR A;  4ABZ A;  4X6A J;  1VHE A;  3KP5 A;  4CDG A;  4B09 A;  1H85 A;  4BQQ A;  4HPQ A;  4BEH A;  1JTA A;  1OYW A;  2MW8 A;  5B1A H;  3EDP A;  3MEX A;  4UZU A;  3G73 A;  4ETS A;  4YAF A;  2V1N A;  2VOO A;  1S72 I;  2EIK H;  3GX4 X;  2JQ7 A;  4M9Z A;  4D7M A;  2INU A;  4M6V A;  1NJI D;  2KJC A;  4BEH B;  1ZLJ A;  3S2D J;  1XFO A;  1XGO A;  2EJR A;  3TO9 A;  3IRR A;  3HAG A;  3CDH A;  3B82 A;  3KEO A;  4DYC A;  2DT5 A;  1APL C;  3JQQ A;  3BQJ A;  2M0C A;  5IYQ A;  1U0J A;  1AOY A;  3Q6R A;  1X2N A;  2VT2 A;  3C7J A;  4KIG A;  3V4G A;  3HHH A;  4ANJ A;  1OGJ A;  1SKQ A;  1IJE A;  1GUU A;  4OP7 A;  5B3S H;  1B9M A;  1NB0 A;  2E1N A;  2GLO A;  4JX4 A;  2J7K A;  1F4K A;  3SLD A;  3PQJ A;  3V8K A;  3FIW A;  3D1N I;  5GPA A;  1LEA A;  3FZV A;  2JVH A;  5FO1 A;  2XB0 X;  3M9A A;  4IL6 C;  3BG5 A;  4IQ4 A;  3S3M A;  2DTZ A;  1REP C;  3FPK A;  4OAY A;  3TKY A;  2PN6 A;  2F1M A;  4Z4U A;  4OOS A;  3QFR A;  2CYY A;  2X0L A;  1S7A A;  4G7Z F;  4Y33 A;  2XAG A;  1VI0 A;  4OOI A;  2HDD A;  5HS8 A;  3OY9 A;  3RIR A;  4YG2 F;  4A3F J;  2XZP A;  4ESF A;  3H0D A;  1ERD A;  3J81 k;  5D6F A;  3VFZ A;  2Y69 H;  2IS6 A;  3A8J A;  1IG7 A;  1ZUN B;  2IW5 A;  1R22 A;  3GTK J;  1XB4 A;  3F6V A;  4KN4 X;  1U6G A;  2A5Y B;  1D0Y A;  3SQN A;  3GTO J;  2QCO A;  2G0Y A;  2JA8 J;  2INV A;  4IRI A;  4M73 A;  5A8A A;  3PQK A;  4L8J A;  3IV5 A;  4UB8 C;  2IQ7 A;  3F6O A;  3X2Q H;  1EFC A;  3B78 A;  1SFE A;  1FWZ A;  3JRH A;  2QUF A;  2BY3 A;  1WKM A;  2XGD A;  4G94 A;  2O5R A;  1SVO A;  4OU0 A;  1J9I A;  1WJD A;  2ETH A;  1J5Y A;  3TDU C;  3K1N A;  3QRF F;  3BNW A;  2F2E A;  4FTH A;  3W5V A;  1A04 A;  2JPC A;  2M34 A;  4QV2 A;  2QX3 A;  1VFC A;  1UJ8 A;  2H94 A;  2D45 A;  2GRE A;  1O8D A;  3LWF A;  4ZYG A;  2XSD C;  4B4D A;  2FBH A;  1Y1V J;  1K6Y A;  1Q81 D;  1YYV A;  1KTV A;  2OZU A;  1YLO A;  2PQ8 A;  3Q3S A;  4XL9 A;  5EJC A;  2F43 A;  2PMU A;  2J8I A;  4B3A A;  3CF5 F;  4UUS A;  2ZB9 A;  4P9F A;  2RRE A;  2QTL A;  1F36 A;  1Y1W J;  2EFG A;  2F4I A;  2WTE A;  4RD0 A;  3VWB A;  1MD0 A;  2NS0 A;  1IF1 A;  2FXA A;  4KIF A;  3TW7 A;  1HSJ A;  4UUS B;  1O3T A;  5D4R A;  2ID6 A;  5ILU A;  4ZYA A;  3OIQ A;  2ZZF A;  2VON A;  1QVU A;  5J1R A;  1ZQ3 P;  2R93 J;  2OK8 A;  3CMY A;  1ZAO A;  2DA4 A;  3EPZ A;  5K7F A;  3LSM A;  1MDM A;  3I5U A;  2UVE A;  2HZT A;  2ZXH A;  4NBS A;  1JT6 A;  1KQS B;  1S7E A;  2A6T A;  2R3S A;  3FBN B;  4M9X A;  1F1Z A;  4S05 A;  1R5B A;  2XEX A;  1MNE A;  4M6X A;  3HYI A;  3HTS B;  1MDM B;  1I8D A;  1WSR A;  4O6J A;  2ZIT A;  3SQV A;  3ASO H;  2XVC A;  2KMU A;  1VQM B;  4UV9 A;  3GUD A;  3ZBT A;  1BX1 A;  1QVF B;  2R7Q A;  3GRH A;  4YRV A;  4UVA A;  1OJL A;  4A69 C;  3LSR A;  4LBV A;  1RZ4 A;  4A3L J;  1USS A;  2I1L A;  3OJW A;  1HG8 A;  1X4P A;  2O04 A;  2ESN A;  1IRX A;  3A4C A;  3D5S C;  1BI1 A;  1MBH A;  3FMQ A;  2VI6 A;  4Y3O A;  1G8X A;  4M72 A;  1BJZ A;  4U87 A;  3ZIA A;  4H4K C;  2VFM A;  3F8C A;  2IP2 A;  1XD7 A;  4BH9 A;  3L2U A;  3VOE A;  1ACI A;  4M3E A;  1G7T A;  2BSA A;  2MC3 A;  5LLQ A;  4RD1 A;  2DPD A;  4G7X A;  2V7T A;  2HQR A;  2IOU G;  4OJL A;  2BF4 A;  2PBI A;  1PLU A;  2B9S A;  4A6D A;  2DIE A;  2R9V A;  5B1B H;  2E1M B;  4JYK A;  3T8T A;  1FDR A;  3OMY A;  1SMY F;  4Y9U A;  2W57 A;  4LD5 A;  2X53 S;  3E5Q A;  4J0Q A;  1Y56 A;  1LLZ A;  3WBJ A;  4U88 A;  2ADU A;  1SKY B;  3AVX A;  1YFH A;  3E6M A;  2JTV A;  2BV6 A;  4G9Y A;  2OTJ I;  2CND A;  3SKB A;  2EV6 A;  4HSR A;  2L9N A;  2RN7 A;  3QPS A;  5M3M J;  4FX0 A;  1T39 A;  1WP6 A;  3DPL C;  2ME6 A;  3V8J A;  2JJ7 A;  1YJN B;  2QMU A;  3CCV B;  3JAM Z;  3OEE A;  1HKQ A;  2CF4 A;  2OV7 A;  2EA2 A;  1D1C A;  3LSI A;  1S4M A;  4X7C A;  3PUF A;  2Z16 A;  2XB5 A;  2HVQ A;  4GGG A;  2VZL A;  5HNF A;  5LEJ A;  4HX8 A;  3WXM A;  2VBW A;  2Y9Y A;  5DV5 A;  3BJ6 A;  5DUI A;  3G05 A;  3S1Q J;  3HUG A;  4HST A;  5C3E J;  4OPS A;  1P92 A;  3BC9 A;  4XID A;  2KZG A;  3QAH A;  4HE6 A;  3GTJ J;  2ZSH B;  1OQY A;  3BCA A;  3VEP A;  1HA8 A;  2JJ2 A;  2A07 F;  3W2E A;  4QSH A;  2DA7 A;  2CW8 A;  2A5W A;  3GLL A;  2NVT J;  2JUC A;  3CC4 B;  4J00 A;  2BHY A;  2Z6B D;  2ID3 A;  4Z4S A;  1YOV B;  5BSY A;  2E60 A;  5IYD J;  1P2F A;  2ELK A;  1SVM A;  2DFE A;  3A8I A;  3PIP F;  1GJR A;  3JCU C;  1V3F A;  1OFC X;  3LSP A;  2R7Z J;  3T53 B;  1JUP A;  4YZA A;  1ZGW A;  1E62 A;  3ONU A;  4FXU A;  1FMV A;  3FIS A;  3JR9 A;  2VAS A;  4CXF A;  2LK2 A;  2M0M A;  2NS8 A;  2X1D A;  1B72 A;  2NPF A;  3BLY A;  3K7A J;  2A3S A;  4ZYH A;  1J0R A;  1XDU A;  3BZK A;  3FBI B;  3LMM A;  1S29 A;  2X48 A;  4XK4 A;  3WTT C;  1OCP A;  1P7I A;  3GZN B;  5LHG A;  3JQR A;  4MFD A;  4ENJ A;  3WG7 H;  1VQO B;  1CLW A;  5FFX A;  1U5T A;  4HNT A;  2VN2 A;  2MAB A;  2V26 A;  3DU6 A;  1B72 B;  3F23 A;  3HSF A;  2G7H A;  2IGK A;  1VND A;  4AID A;  4ESJ A;  3HOW J;  3LFK A;  1JNY A;  5H5J A;  1TYW A;  2WAF A;  3W2I A;  1I3Q J;  2LH9 A;  5GP9 A;  2XDV A;  1IXC A;  1U5T B;  2BM1 A;  3K70 D;  2EBI A;  4I09 A;  5DM7 F;  1QA3 A;  1MJA A;  2L02 A;  1P4A A;  3LSG A;  3MKY B;  2R7W A;  3JRC A;  3HXL A;  4L0Z B;  2NVY J;  2W84 A;  5J8F A;  2HWV A;  4LG3 A;  2IBD A;  5BQT A;  1W2B B;  5FLX Z;  2EQR A;  2WAE A;  3J81 K;  2QE7 A;  1WHU A;  2JDI A;  4Z1M A;  4F93 B;  3TP3 A;  2AHQ A;  2KDO A;  4XKV A;  2Z5U A;  1W5S A;  1A8P A;  2O9L A;  3NAW A;  1I6X A;  4A3D J;  3L2C A;  2VKH A;  1KON A;  2LRE A;  4A0X A;  5IK2 A;  1VQK B;  2MGQ A;  3VO2 A;  1XG2 A;  2LMD A;  5M5Y J;  1GO2 A;  3VR6 A;  1KZL A;  1IN7 A;  2E1C A;  1TW3 A;  3H36 A;  1K4T A;  2C77 A;  2VJJ A;  4IRH A;  3V7S A;  3M8J A;  1W0K A;  2QYO A;  3HGY A;  3QU3 A;  1BOB A;  3AG3 H;  3S3N A;  5IT9 K;  5F4J A;  2VFN A;  4G6D A;  3I56 I;  2DPU A;  3NEU A;  1S8N A;  4M3B A;  3CCM B;  2OK7 A;  3BC8 A;  4BHB A;  2VL8 A;  1F5T A;  2L7F P;  3GFL A;  4U0Y A;  2W7N A;  3K2Z A;  4DYR A;  1TWC J;  5TIS C;  3I0T A;  1FOK A;  4OPO A;  1R58 A;  1YIT B;  5J1U A;  2BGI A;  2RKH A;  3S93 A;  1D1B A;  4JX6 A;  2F5V A;  1LDD A;  4EJT A;  2BX6 A;  5D6E A;  1TZL A;  5D8K B;  4BL0 B;  2R92 J;  1S5L C;  1QZE A;  2TDX A;  4TV7 A;  3VPR A;  4D7N A;  5L3F A;  4U7B A;  4KH3 A;  5IOY A;  1I7P A;  4KT6 A;  4LLL A;  1L3L A;  2O0V A;  1FPQ A;  4EJU A;  4UZE A;  3WTS C;  2AS5 F;  4M74 A;  1UB9 A;  2IA1 A;  2LF8 A;  1TT5 B;  2QTZ A;  1KYZ A;  5HZB A;  4RGU A;  3BR0 A;  2DXI A;  1ON1 A;  5BS6 A;  2XUB A;  1WJB A;  2GAU A;  4RPD A;  4RGR A;  4RLF A;  3PSS A;  2Q6K A;  5EYR A;  2Y0M A;  4DQ2 A;  2E35 A;  1W0T A;  4I01 A;  1ORK A;  1T98 A;  1CNE A;  2DT6 A;  2RNG A;  1IN8 A;  3H5R A;  4PFP A;  3WE3 A;  4M53 A;  4XRS G;  3DEE A;  1YW8 A;  3IAM 2;  4FK8 A;  1O8H A;  2IRF G;  4BDY A;  3ZPN A;  4KUM A;  2E5N A;  1RUN A;  4KKS A;  1EKE A;  2RDP A;  2DDB A;  3GBG A;  5CQE A;  3FK7 A;  1Z7U A;  5H59 A;  4MXN A;  2HDN B;  1ZGJ A;  3CCJ I;  1ZM2 A;  2ISZ A;  1FND A;  1QHH D;  1BI0 A;  2V6E A;  4PAB A;  1G6N A;  4CCN A;  3SYT A;  4DQK A;  4ZCM A;  1BJA A;  3GTL J;  1W5T A;  3I53 A;  2DFI A;  4AIK A;  2JA5 J;  4DK0 A;  3GQ8 A;  4ZTF A;  1H8H A;  2F4M B;  3QPT A;  4LK0 F;  2LZJ A;  5DCF A;  3FHN A;  2BM0 A;  5JFR A;  3FXO A;  4E7Z A;  5L3E A;  2R4G A;  1QO0 D;  1VLO A;  5FKM A;  2AXL A;  3IHU A;  2VBS A;  3CPW B;  5GTH C;  4XM3 A;  1MH3 A;  3ZMZ A;  3CTA A;  5LGT A;  3G1O A;  1BC8 C;  3ZBU A;  3REO A;  2XIG A;  4XN0 A;  3S1M J;  1O3R A;  1GR1 A;  3BH6 B;  3FXL A;  1E2X A;  2IGM A;  2WYR A;  4PJM A;  4W1U A;  1K79 A;  2HVS A;  1R5N A;  2DMT A;  1D1A A;  1SFU A;  5LRS A;  4G1B A;  3QE2 A;  4W8T A;  5DS9 A;  2O1D A;  2BN4 A;  5E3N A;  1K7A A;  3FY3 A;  2H1K A;  2ODL A;  1I1S A;  2NTP A;  3HPG A;  4ZGQ B;  2OC6 A;  4M71 A;  2O61 A;  1HW1 A;  2KHM A;  4AC0 A;  3R6J A;  3DLL F;  1RKW A;  1YIJ B;  1GAW A;  3S3O A;  3OOU A;  5C1C A;  1W4M A;  3PUN A;  4YFN F;  1D0Z A;  2XKP A;  1SAN A;  3DKW A;  5CVI A;  1K78 A;  5J4V A;  3HTU A;  4P9S A;  4UNO A;  3RY8 A;  2XT4 A;  2WY8 Q;  1W35 A;  1YTY A;  3QYB A;  2F5D A;  1RU4 A;  3L9F A;  3FM5 A;  3OYH A;  5AN9 A;  3KX2 A;  2E1O A;  2MLK A;  3CDL A;  3O8G A;  4XBF A;  3OP1 A;  2BM6 A;  3DTI A;  2VNH A;  4RA2 A;  1N05 A;  2H8R A;  3AL0 B;  2DEU A;  2V5I A;  1O7L A;  2XAF A;  1QUE A;  3ESW B;  1MMA A;  2JMW A;  4XLE A;  2XPV A;  3G4S I;  1U78 A;  1TW2 A;  3GCM A;  4Z4Z A;  4XRF A;  2BY0 A;  2P3M A;  2M30 A;  4U7D A;  2VBY A;  2M4K A;  1ON2 A;  9ANT A;  1K4Z A;  3JW4 A;  5K7H A;  4YZX A;  2VJ5 A;  1SEU A;  5AIP A;  2EWE A;  4AM3 A;  2VBX A;  1N8R D;  4YXW A;  2XRN A;  2M87 A;  2JZY A;  5ERI A;  1WI3 A;  2XGX A;  3NE5 B;  3KPH A;  5ICC A;  3CC7 I;  2X6O A;  3IRQ A;  4P3I A;  4TMX A;  1BBY A;  1GVD A;  4YIR X;  2R7U A;  3JRE A;  4PGO A;  4DYQ A;  3CJR B;  5GV7 A;  1ETO A;  1RES A;  1AHD P;  3RDI A;  3FX3 A;  3RPQ A;  2DQL A;  4MFE A;  3RQI A;  3KET A;  2HLD A;  3WND A;  4ZV4 A;  2RAE A;  4RS8 A;  3DPT A;  3HOS A;  1YIJ I;  1JT0 A;  3LSJ A;  4B1R A;  2M4G A;  2OTL B;  1FBQ A;  4WXH A;  1A6I A;  1GV5 A;  1YI2 B;  3OYA A;  2F5C A;  4Y15 A;  4C0S A;  1ZKG A;  2B7B A;  3U6K A;  3FF5 A;  3J81 Z;  1Z77 A;  3DEU A;  3W3C A;  1VQ8 B;  4OAZ A;  5J6X A;  2ZXI A;  2BGJ A;  2JSC A;  2QWW A;  3BCB A;  1QGP A;  3CLQ A;  1JJ8 C;  3ZOB A;  2B7C A;  1EH7 A;  5H6Q A;  3ZXS A;  3JRA A;  1JRG A;  4WK8 F;  4R79 A;  1X3U A;  3BT9 A;  1HZE A;  1UHW A;  2WZN A;  1XSV A;  1EP2 B;  2K7L A;  3L00 A;  3OW7 A;  3CMM A;  3VSL A;  3PSZ A;  5F0F A;  3MZ8 A;  3EUK L;  1XC5 A;  4BDZ A;  2GIV A;  2BSP A;  1R5I D;  2L3D A;  4A3M J;  2D5V A;  1Z3X A;  3F8B A;  2B5O A;  5FFZ A;  1MRZ A;  2TCT A;  5DCM A;  5IT9 Z;  2X8K A;  2COM A;  5LBQ A;  4C3J J;  3VSV A;  2H1L A;  1QA2 A;  2XOK A;  1H42 A;  3J7Y J;  3QYF A;  2PMD A;  5E8I A;  1YJW I;  1TYU A;  3I9V 2;  1W36 C;  4EAT A;  4XOR A;  4RCY A;  2E71 A;  1KQ0 A;  1K83 J;  5DCM B;  2HDC A;  3BTL A;  2YWF A;  3GYH X;  3BY2 A;  2DOE A;  4PJJ A;  2EIN H;  3BG9 A;  4ZYD A;  3J80 K;  3I4M J;  4HLY A;  2OZ6 A;  1M1E B;  5F1R A;  4B3X A;  2DMQ A;  3O2P E;  5D5V B;  3CCR B;  2LYC A;  5C4X J;  3CRZ A;  2ELJ A;  3PO2 J;  4WZT A;  3N6Z A;  4P96 A;  1EH8 A;  2BMW A;  1XSX A;  3G6E I;  2XF5 A;  1NTC A;  4RMN A;  1YI2 I;  2EZI A;  4L5J A;  4KMF A;  3OYD A;  3F9K A;  1FNN A;  1TWH J;  2CW7 A;  2NNN A;  4RAY A;  2C4U A;  1WWX A;  1MIJ A;  3H9J A;  1Q82 D;  4AD9 A;  3A01 A;  1MBG A;  5TR9 A;  2RQP A;  2EV5 A;  4Q48 A;  4ACA A;  1OR7 C;  1VF9 A;  1PKV A;  2VC0 A;  1JTY A;  1J9Z A;  3OAA A;  4NC7 A;  4TT3 A;  1B1B A;  1O8M A;  3MZH A;  2EZL A;  1K73 D;  2HFH A;  4GO1 A;  4ZCI A;  3A01 B;  1WI9 A;  1K5C A;  4XLF A;  3SUC A;  4ENN A;  2NTQ A;  5FLV A;  5TV2 A;  6PAX A;  4W8S A;  3QOD A;  4S0H B;  3WTZ A;  3G71 I;  1N78 A;  2FE3 A;  3OIP A;  2FA5 A;  2JK3 A;  5THX A;  3CXC B;  4BE1 A;  1B23 P;  2BYV E;  2VIX A;  3TO6 A;  5FKL A;  3BTI A;  2YUS A;  3MAJ A;  3QFS A;  5KW9 A;  1MBE A;  4CYD A;  2D9R A;  2JN9 A;  3CDI A;  3HSR A;  3NQO A;  1HBX G;  4EM2 A;  1R5G A;  1AKH A;  3WY9 A;  3CCQ B;  2V1U A;  3CD6 B;  1WPC A;  1DGR M;  2O8X A;  3FJO A;  4CYC A;  4B3G A;  2HZD A;  3V76 A;  1GXP A;  2A69 F;  1L0O C;  3OZW A;  2FD5 A;  2Y30 A;  3K9T A;  3DU5 A;  1YX3 A;  4PDK A;  3CCR I;  3E6B A;  1AKH B;  5CVU A;  2ZC2 A;  3CCU B;  3WHB A;  2ZZE A;  2CW0 F;  2MD5 A;  3OWT A;  4CYC B;  3JU4 A;  3I71 A;  3FXJ A;  3AGP A;  3W2G A;  3W2A A;  3RCO A;  3LMW A;  2KKO A;  5JMC B;  2MLG A;  4ZDP A;  1IA5 A;  1X3Z B;  2DMP A;  2VQG A;  2GXB A;  5LGN A;  1ZEL A;  2XAS A;  4N9H A;  3RPU D;  3PIO F;  1QHG A;  3H3V K;  3TMO A;  3QSY A;  3OYL A;  2VNJ A;  1K8A D;  4CH7 A;  1FTT A;  2J5P A;  2WWY A;  4HWV A;  4BQN A;  1UMQ A;  2P5L C;  4IEJ A;  1IDJ A;  4LGW A;  2CFX A;  1VQL B;  2FX3 A;  1DDI A;  3V7C A;  2YU3 A;  3ZP5 A;  5FIU A;  4B43 A;  1SFO J;  3CMA I;  3MVP A;  4C2T A;  2JJ1 A;  2Z9O A;  4Y7N J;  1MND A;  1KQ8 A;  1FYK A;  1QFJ A;  2KZV A;  3OYK A;  2BEO A;  1NH3 A;  1T2K A;  4QFM A;  2YS9 A;  4CCM A;  1F60 A;  3QPH A;  2LBF A;  3MCA A;  1QGZ A;  3SXY A;  5J4Y A;  4EGZ A;  3RKQ A;  2P5K A;  1O3S A;  1U9O A;  3FXQ A;  3AKZ A;  2K9N A;  4EJV A;  3K4M A;  1WOO A;  2NOJ B;  2UZK A;  3BZ6 A;  3VO1 A;  4HAM A;  3KIO A;  2NVQ J;  2CW5 A;  1HKS A;  3DDY A;  2XTY A;  2EFW A;  5LFA A;  2Q6L A;  4Q5S F;  5H2F C;  2K02 A;  1U2R A;  1WJE A;  2M9H A;  4MGR A;  3HL2 A;  4B8X A;  5JHU A;  1VQ5 I;  1U3E M;  2UXX A;  4E7J A;  1H88 C;  3WE2 A;  3QYE A;  4YZ0 A;  4CCK A;  3LNN A;  1FX0 A;  3GIR A;  5HDK A;  4QWQ A;  1VTN C;  2HPI A;  2I10 A;  2CQK A;  4GRI A;  1TQI A;  3U6B A;  5B66 C;  1NK2 P;  5JI6 A;  4UZF A;  4MQV A;  4KIB A;  4RB0 A;  2EFN A;  5C4J J;  2QGG A;  1JJ2 B;  2LY1 A;  3K4J A;  4EGY A;  4DNR B;  3ULQ B;  5F4M A;  5LD2 C;  2YPR A;  5E3M A;  2IPQ X;  2CUZ A;  2W4S A;  3OL4 A;  3WHC A;  3L2W A;  2GJR A;  1VQ7 B;  2XTX A;  1VF7 A;  2O17 A;  1LDJ A;  2K9S A;  2IJL A;  2L9S A;  1VQL I;  2R7X A;  2BVL A;  2NXN B;  2P8T A;  1G7S A;  3HRS A;  2ZTG A;  3TH0 A;  4U0V A;  2OBS A;  4BNC A;  5FRM A;  2JRM A;  4TMT A;  4NQW B;  3C2G A;  3IP4 B;  2AQF A;  3V8L A;  2FU4 A;  4IHX A;  1YW7 A;  3QPL A;  5CKT A;  4BBR J;  5HLG A;  4TSF A;  1BX0 A;  1XGM A;  3C3W A;  2CQ7 A;  2A6H F;  4YII A;  1ZG5 A;  3GTG J;  2Q6O A;  2RGV A;  4I99 C;  3OZU A;  4LB5 A;  1MH4 A;  2LD5 A;  2BVN A;  2PG4 A;  5HKK A;  1ZRE A;  4P26 A;  3HIF A;  4JQF A;  4D1Q A;  1LUJ B;  4OPV A;  4G6Q A;  1BN5 A;  3TOB A;  4KDP A;  2BM7 A;  4XKC A;  4BQO A;  2DW4 A;  4E0F A;  3WU1 B;  4XLN F;  1Y0N A;  3ZQL A;  1AIP A;  5KCM A;  3RYR A;  4UXN A;  5IYB J;  2KRH A;  3H5A A;  4FT8 A;  2E36 A;  1E43 A;  3FWE A;  3RPU A;  3PFY A;  4DGW B;  1SD6 A;  2W6I A;  2P6T A;  1OGI A;  3T8R A;  1D3Y A;  1SM4 A;  4Q7J B;  4BUP A;  1SAX A;  3OZV A;  3T56 B;  3KE2 A;  4YFO A;  3DV8 A;  2X85 A;  1U2W A;  1WCM J;  3JRB A;  1CGP A;  3FMR A;  4KJZ A;  3ES9 A;  1N25 A;  5LMZ A;  1YX2 A;  1QU3 A;  4I2O A;  3HSE A;  3J80 Z;  4BE0 A;  3CPX A;  5DNS A;  2DYR H;  3F0C A;  4MNU A;  4GDF A;  5LRR A;  3B73 A;  2XPW A;  1IDK A;  2KRF A;  4CA0 A;  4IHT A;  2AHO A;  1BLI A;  1DDG A;  3SEZ A;  5FLX K;  2ZJQ F;  1PJR A;  3OR1 C;  2DMN A;  4YAW A;  3SLN A;  3S1N J;  4O3M A;  1T8I A;  2J5O A;  2EZK A;  2EFO A;  2K27 A;  2LY9 A;  4Z6Y A;  3BH7 B;  5JLV C;  3WTY C;  3VDX A;  2XC1 A;  3S15 J;  2W85 A;  1XB2 A;  1LFB A;  3KZI C;  2DLL A;  2E2I J;  2K5C A;  3OYB A;  1V5G A;  3LAJ A;  1DP7 P;  4LJZ F;  3TED A;  1N75 A;  4BKX A;  4Y7C A;  1BC7 C;  1D0X A;  5IYN A;  4C2L A;  1RRJ A;  2PJR A;  4OMY A;  4XLP F;  3B6C A;  4P6Y A;  3U21 A;  2V7X A;  4JOM A;  5FLM J;  4CGZ A;  3HBL A;  4F7Z A;  2JIZ A;  1G3Y A;  2FOW A;  4BY7 J;  4BQA A;  1XN7 A;  2BXZ A;  4V19 K;  2VYQ A;  1X1B A;  2BXY A;  1HF2 A;  2M2E A;  2OBP A;  3SZG A;  3S17 J;  5C1E A;  2PJR B;  2NAZ A;  3M8E A;  4G6T B;  1UD6 A;  2GZW A;  2HVR A;  1R1U A;  3KL9 A;  1OGM X;  2GOX B;  2HEO A;  4N9I A;  4WZE A;  1SD4 A;  1VQ4 B;  4II3 A;  1PJ7 A;  3GLX A;  1DBO A;  3Q0V A;  1BQE A;  4KIS A;  3JQP A;  4KT5 C;  3JSO A;  3AVV A;  4WZL A;  4F92 B;  3EUA A;  2R6H A;  1I3A A;  4ITV A;  4CO8 A;  2LF7 A;  4A2U A;  2CK3 A;  2OBT A;  3Q0U A;  2XC7 A;  1GT0 C;  1H8A C;  2MBF A;  4CHU A;  2PFB A;  3L2R A;  1BW5 A;  3QFT A;  2PE3 A;  1QGY A;  3KYC B;  4IO9 F;  4FN5 A;  2LOO A;  2EZH A;  2Z3Y A;  3LST A;  4IXA A;  1GHC A;  2P6S A;  2QEN A;  3E97 A;  4D9J A;  3CCE B;  3GTP J;  5F0C A;  1KU2 A;  3MN2 A;  4MEX F;  1KK0 A;  1JUM A;  4UV8 A;  4ENK A;  3PSF A;  2R7D A;  1JHF A;  4PCQ A;  4YZQ A;  2FRH A;  3BG3 A;  4WWC A;  3OSF A;  2XAU A;  1YHQ I;  2M7A A;  2VUM J;  2M5W A;  3VB2 A;  3AFH A;  2M3A A;  3JRD A;  3H3Z A;  2WJV A;  4RB1 A;  4B3F X;  4ZC3 A;  2PX9 A;  4IOA F;  2QY1 A;  4LFU A;  4M9S A;  4IHS A;  2V9V A;  2PEX A;  4PJ0 C;  4QUZ A;  2I5U A;  2NVU B;  5IT3 A;  1FNB A;  5FL7 A;  3IWF A;  5LGU A;  2KP6 A;  1X3W B;  2P5V A;  3TDZ C;  1JGG A;  2V7W A;  1FYM A;  2ZJR F;  2OQR A;  3ZCO A;  2VNK A;  4P6V F;  3DBL B;  3B02 A;  1MBF A;  4HRI A;  2XNJ A;  1OLT A;  2LKS A;  1UEL B;  1D5Y A;  2XZO A;  4RBO A;  3LAP A;  3CES A;  3GFI A;  1X4O A;  2A68 F;  3C18 A;  4PZJ A;  1QUF A;  1VLY A;  1PUE E;  2E2J J;  3SDB A;  2VBK A;  4NC8 A;  2LFB A;  5M5W J;  2KQR A;  4NCN A;  3GSI A;  5ICG A;  1FX7 A;  1HQC A;  1T5E A;  3D5R C;  4D5F A;  1KK1 A;  3CCS B;  4BXU A;  1KA8 A;  3I4P A;  5DTD A;  2OU2 A;  1E17 A;  3P9K A;  1AMO A;  1DPR A;  3OYE A;  2IGN A;  4PUS A;  2R7O A;  1OGO X;  5KK1 A;  1QNT A;  2HQ5 A;  1T08 B;  4M3F A;  1BR4 A;  1E3X A;  5EMN A;  1VQM I;  5AON A;  5HDG A;  3KEY A;  2VLA A;  2GPJ A;  2F5F A;  3A35 A;  4XON A;  2XRO A;  1XS9 A;  4W97 A;  1A35 A;  3I59 B;  1N07 A;  4XNF A;  2PYG A;  2AQE A;  2DCE A;  2O0Y A;  4CCL A;  3NB2 A;  3KYD B;  1MMG A;  5B5E C;  4LIV A;  1IV6 A;  5E79 C;  2QSH X;  5F0H A;  4U9U A;  2ZZG A;  1KCD A;  3RTR A;  4UVB A;  4TMZ A;  2DER A;  1O3Q A;  4RM3 A;  5HOD A;  2F5E A;  1O8I A;  3LL7 A;  2LRD A;  4YAO A;  3M4O J;  1OPC A;  3QOP A;  2CMP A;  1MSF C;  4L9J A;  3F22 A;  1S6L A;  5FB2 A;  1T38 A;  1VHO A;  2VKE A;  2NT9 A;  1FBS A;  3Q5F A;  2FEZ A;  1ZN2 A;  2LP0 A;  1NHC A;  5DS0 A;  2V7Q A;  2DOD A;  3P9I A;  4FIS A;  3K1M A;  1Z0X A;  3DKY A;  1MAB A;  1QVG B;  3BPX A;  1WRJ A;  2ZBK A;  4IOC F;  1AU7 A;  3CJN A;  3K0L A;  3OS1 A;  5IOZ A;  4Y17 A;  1IXR C;  1RQR A;  4GCV A;  3C2H A;  4IQJ A;  3PO3 J;  2EV0 A;  2HKO A;  2HI3 A;  4I0A A;  1W7P D;  1TUI A;  1HW2 A;  2EIM H;  2HOE A;  3CJT B;  4MIM A;  3LYC A;  3JSP A;  2FOK A;  2CRV A;  1YJN I;  3MKW B;  4GXO A;  1N0V C;  3CCV I;  1EP3 B;  3IAS 2;  4BY1 J;  1Y6I A;  3IKT A;  1JA1 A;  1HW5 A;  2BVM A;  2ZME A;  3SJZ A;  3P9C A;  3BCD A;  2HNH A;  1TQP A;  5J3L A;  2EK5 A;  4OZY A;  2ZSI B;  2XND A;  1JKQ C;  1Z9C A;  1N08 A;  1EFR A;  4KIC A;  3CP2 A;  2O03 A;  1DG1 G;  3HC7 A;  5GAG J;  4U4B A;  1DP3 A;  3WTU C;  4IF4 A;  1E64 A;  4P25 A;  4X0C A;  3C1D A;  2V31 A;  2ZME B;  4KKU A;  1X19 A;  1GV2 A;  5E1Z B;  1FMW A;  4WXC A;  2D3L A;  4P2N A;  1VQP B;  2BY1 A;  2JRT A;  3G3Z A;  1RR8 C;  3ASR A;  4XSZ F;  2VB6 A;  4XLA A;  2HCJ B;  1KD1 D;  3ZQF A;  2YUH A;  3ABU A;  4X7E A;  3UR3 C;  3CC4 I;  1MJ9 A;  2Z8G A;  3LOC A;  5HLH A;  2NTB A;  4Z4Y A;  2E1M C;  2HOT A;  2OBR A;  2QQA A;  2DN0 A;  1IJW C;  2R7T A;  1QVT A;  3ASP A;  5EF6 A;  3EQL F;  4HX7 A;  2R5Y B;  2ZL6 A;  3KCC A;  2Y75 A;  4I7H A;  2L54 A;  5D8L B;  2JT1 A;  2IGO A;  5GAH J;  3M07 A;  4RAZ A;  2IVM A;  4EJW A;  2DFH A;  1B9N A;  4N4O B;  2O6G E;  2E1R A;  1O8F A;  3ZZU A;  4LG0 A;  3WTV C;  3RZD J;  2VPR A;  1T6Z A;  1UFM A;  2KLO A;  4XMY A;  1ZRC A;  4A93 J;  4LBZ A;  4PC3 A;  3I55 B;  5IP9 J;  1AA7 A;  3AG2 H;  4BJ6 C;  1X0C A;  5AMV A;  2V7F A;  2ZNY A;  3ZQG A;  1VQO I;  2CH0 A;  2CSO A;  2DA2 A;  1JKP C;  2ZJ2 A;  2CGP A;  4F91 B;  2ELH A;  3DTE A;  1IAW A;  4LG0 B;  1T33 A;  4NNJ A;  1QGA A;  1A6Q A;  5D5X B;  3QWL A;  2COB A;  1K61 A;  2WPD A;  3ZMT A;  3K4C A;  4NK6 A;  3QP5 A;  2WR8 A;  1O8E A;  2DY1 A;  1BL0 A;  2L7M P;  1WJ5 A;  2NOG A;  2VOP A;  2C78 A;  3OIO A;  2YU9 J;  2PYH A;  1YJ9 B;  3DEW A;  4X7F A;  3BR2 A;  1I5Z A;  3KRG A;  3ISP A;  3SZE A;  1MZB A;  3LQR A;  1V5V A;  4L9T A;  1IB0 A;  5FKK A;  2QA4 B;  4L9N A;  2XRL A;  4IVN A;  2EIX A;  1BR1 A;  1PP8 F;  2KPM A;  2KIS A;  1EP1 B;  1QQ1 A;  1KQ9 A;  3IH4 A;  1T0F A;  3DU1 X;  3K10 A;  2ZJP F;  1MKM A;  4URR A;  2FMY A;  1NRK A;  3LQQ A;  3RSN A;  2LTP A;  3A0B C;  1BM9 A;  5BMZ A;  3Q0W A;  5TY0 A;  1VQK I;  3DWL E;  3R0A A;  4JP0 A;  2QKM B;  5DD4 A;  3VYS B;  1PUF A;  4BAC A;  1TLH B;  1O57 A;  4QPQ A;  3MKZ A;  2V1D A;  1XMA A;  4JMQ A;  5F08 A;  1P7J A;  1K9M D;  2K86 A;  2B0L A;  2OD5 A;  3ZQQ A;  1LE8 B;  5F27 A;  4XLH A;  2CC2 A;  3PA1 A;  2ECB A;  4L18 B;  1WZ2 A;  2HS5 A;  4PSW A;  1W7P B;  4LB6 B;  3O8H A;  5JR3 A;  1SD5 A;  1TNS A;  1PUF B;  2YWH A;  3A1P A;  1OFE A;  2A05 A;  4M3D A;  3JRI A;  1X1A A;  2DK5 A;  5ED4 A;  2D1H A;  2MYS A;  4AU7 A;  3CME B;  2Q8K A;  3CCM I;  2NV4 A;  5EZG A;  3WQZ A;  4XIC A;  1YO5 C;  1FC3 A;  2XT2 A;  3BQY A;  5DD8 A;  1E3P A;  2NST A;  1TTY A;  2MC4 A;  3MKL A;  1U5T C;  5F1J A;  4YEI A;  2QVO A;  2QLZ A;  1YIT I;  4B4C A;  4OIN F;  1UHM A;  4P55 A;  3TO7 A;  1Q1V A;  1WMR A;  4XR6 A;  4HE5 A;  4CCJ A;  1GLN A;  3NWS A;  1R9T J;  5D4S A;  4ACB A;  1W1W E;  4BGD A;  1D2E A;  1TVC A;  4MLO A;  5LEK A;  4PJL A;  5FD6 A;  5FGM A;  3H09 A;  4KN7 X;  3R61 A;  2WY7 Q;  3SHF A;  3P26 A;  1IZ1 A;  4PAA A;  1HXD A;  1WSU A;  2XF7 A;  3BDD A;  1JKO C;  4RDL A;  2ZL7 A;  2DK8 A;  2FJ1 A;  2DYI A;  1NG6 A;  2TRT A;  4OJ6 A;  1R5H A;  2M7B A;  4A3C J;  1TWG J;  3CF2 A;  3E3V A;  3GME A;  1MMS A;  3E1S A;  3G2B A;  1ZM4 A;  3BR1 A;  3DBH B;  3FPP A;  5E8G A;  2P7C B;  3FXK A;  5A2Q K;  2LY2 A;  1P6R A;  3ZSC A;  3M1C A;  4Z4T A;  1PJ6 A;  5BNG A;  4P5O A;  2CV1 A;  1XGS A;  2EIL H;  2ICW G;  4OOX A;  1EH6 A;  2F4N A;  3MWM A;  5LHH A;  1CQX A;  2IA2 A;  2XTW A;  4G7H F;  3BR6 A;  3UKG A;  3IL2 A;  4RCZ A;  3DP7 A;  4YEL A;  2QF7 A;  3CC2 B;  2VFP A;  3R0J A;  5KSW B;  1Z7L A;  1GDT A;  3EUH A;  5IYR A;  4RDJ A;  1OFL A;  2A6E F;  1UD8 A;  2YR2 A;  2I8D A;  4P1V A;  5K5Q A;  3SJM A;  2D1V A;  4KA4 A;  1LQ1 A;  3S2H J;  1EFU A;  1WQ2 A;  4UB6 C;  4AC9 A;  4XRM A;  5J40 A;  1I27 A;  1TQM A;  2QXZ A;  4RD6 A;  1RKT A;  4RD4 A;  3BY1 A;  3HOT A;  1JE8 A;  1ETX A;  1WOR A;  1BPL A;  4R8H A;  1QFZ A;  4Z4W A;  2F48 A;  1CZF A;  2FNA A;  2G7U A;  2ESH A;  2OF7 A;  3HRM A;  5TGT A;  4WCG A;  3W2F A;  3KEW A;  5HS7 A;  3E6D A;  2K3F A;  2STT A;  1ZHF A;  3H5N A;  3ABK H;  1ZH5 A;  2OPT A;  3HG9 A;  4YEJ A;  1ZRF A;  1IGN A;  1ELO A;  3OYM A;  2EB7 A;  1STZ A;  3O6B B;  3ZQI A;  2QBY A;  1UG0 A;  1XGN A;  3VOD A;  2VQC A;  1WPK A;  2QN6 A;  2NRA C;  2Y31 A;  1AWC A;  5KNL A;  4MYU A;  4PK4 A;  1ENH A;  3ZQ7 A;  3AGQ A;  4ZZL A;  3LFU A;  4HG2 A;  2QBY B;  5FNZ A;  3SZP A;  4OOV A;  1KGS A;  2ZO4 A;  3JTH A;  4RB2 C;  3KP2 A;  4R71 A;  1R36 A;  4HIZ A;  3FHZ A;  2C2W A;  4G1V A;  4I76 A;  4JX5 A;  3NAR A;  4KYW A;  4DOZ A;  3TL4 X;  2DI3 A;  3SY2 A;  2RC6 A;  4RLQ A;  3HPH A;  5FRN A;  3FKI J;  1NB9 A;  3I3L A;  2FQ3 A;  1R5O A;  1XPX A;  3GZ6 A;  3BG6 A;  2B0R A;  4OWR B;  1RNL A;  2UVF A;  4IHY A;  2R7V A;  1QRY A;  3LNQ A;  2B63 J;  1QQI A;  4NHJ A;  2XNC A;  3HM5 A;  4B48 A;  2C5H A;  2L4M A;  2X3H A;  2HTJ A;  1O88 A;  2VE9 A;  2ZTN A;  2L9R A;  1TLL A;  2O0W A;  4AYB N;  3CUQ A;  3R6K A;  1WVR A;  1KK2 A;  2L0K A;  1BW6 A;  5J35 A;  3LA2 A;  3F8F A;  1JI8 A;  1JB9 A;  1POG A;  4M1K A;  3AVW A;  3SYJ A;  4E4H A;  5J8C A;  2QZ8 A;  4KKT A;  1Y0Y A;  1K8F A;  1OCR H;  3ZGK A;  4BYY A;  3OKX A;  3AK5 A;  4YFX F;  1HOM A;  4P12 A;  2F4O B;  1DPU A;  4LC0 A;  3CUQ B;  4F3Q A;  3HOZ J;  2HYF A;  1TTT A;  5A89 A;  3H92 A;  4G8X A;  2OTL I;  3PM1 A;  3GEZ A;  3QOE A;  2V79 A;  2X6W A;  1IRG A;  3W6J B;  4LLN A;  2XGJ A;  3DTK A;  3GTM J;  1IN5 A;  3OS2 A;  5H20 A;  2VNI A;  2IS1 A;  4ZYE A;  5AIQ A;  1VQ8 I;  1FEX A;  1X1P A;  4LBW A;  1Q1H A;  5FKO A;  3OOC A;  4YCQ A;  1BHE A;  3DFG A;  4H0E A;  2W25 A;  4XSX F;  1ITY A;  4K1X A;  1G3W A;  3AL0 C;  2DA1 A;  1OYI A;  3MCZ A;  1KZH A;  4C3H J;  1X1D A;  3L1P A;  2BHZ A;  3OS0 A;  2BBY A;  1LDK B;  2K9M A;  1LFP A;  3OYJ A;  1RQP A;  1R00 A;  4WWV A;  5H6R A;  1E0E A;  2QDX A;  1BA5 A;  1S9H A;  2GQF A;  5GPC A;  2E34 A;  4UHT A;  4PC7 A;  3FKS A;  1HA3 A;  1EV7 A;  2BGC A;  1RET A;  3OR2 C;  2OJE D;  1UG2 A;  1FOW A;  2ZZQ A;  2V9K A;  4RDU A;  3D26 A;  3JRG A;  2M8G X;  2XAJ A;  3RKY A;  3ZMS A;  2HMA A;  1IJF A;  5BPD A;  3H9N A;  4AIJ A;  4GYI A;  3L2V A;  1KCC A;  4PMH A;  2D74 A;  1Z05 A;  4Y52 J;  4F52 A;  3IC7 A;  3I58 A;  1OB5 A;  1GQ8 A;  3RYP A;  1ZG3 A;  4N3G A;  4BXX J;  4Y13 A;  4PGH A;  4BPR A;  3G1L A;  1V5F A;  4XKB A;  4BXF A;  3S1R J;  4OPW A;  3WYA A;  1FP2 A;  1R23 A;  1OCT C;  1RI7 A;  1ZGA A;  5BPI A;  2D2W A;  5EG0 A;  3CCY A;  2KT0 A;  4DBR A;  1MGT A;  3MMY B;  4DZJ A;  5JHF A;  2HDW A;  2QQ8 A;  4C30 A;  1W87 A;  4ROX A;  1VBL A;  2VFO A;  2CJJ A;  2QGU A;  4HQM A;  4BHC A;  2WAD A;  5LHI A;  3ZPP A;  4DNT B;  1P9Q C;  1YQA A;  4E6K G;  3A3B A;  4OJP A;  4EV0 A;  2ZFW A;  2X6Y A;  4NBQ A;  1OFD A;  3WU2 C;  4A12 A;  1Z91 A;  2O7O A;  2P0W A;  4L5E A;  5EG0 B;  2DOA A;  5EZH A;  5C44 J;  3PNY A;  1XCV A;  2UXN A;  2R7F A;  1G3T A;  1SMT A;  2DA6 A;  3BR5 A;  3NWT A;  1YE9 A;  2QSG X;  5A2Q Z;  4F55 A;  2ZXW H;  3VSU A;  1S7O A;  2DA5 A;  3SDG A;  2V6C A;  2WAQ N;  1G59 A;  3GQB A;  3AAF A;  2DA3 A;  1G7C A;  1J2X A;  4WF2 A;  3UNG C;  1KRH A;  4RD2 A;  1TYX A;  2PLY A;  3W6V A;  3L09 A;  1E63 A;  1V0F A;  4CQJ A;  3RIQ A;  4FE4 A;  3ERE D;  2WJY A;  1OIS A;  1YLF A;  1W9X A;  2BW3 A;  2C4T A;  1WFX A;  1WOP A;  2FUG 2;  2XV4 S;  3GFM A;  3WTX C;  1JUS A;  4HEA 2;  3AG1 H;  3HZJ A;  3ONQ A;  2CU7 A;  2NNY A;  3VYR B;  2HYG D;  1LJ9 A;  2E7W A;  2LSO A;  5M5X J;  3W5H A;  2OQG A;  4LOC A;  4N3N A;  2FQ4 A;  3VSK A;  3WOD F;  2GM4 A;  3CCQ I;  2JN6 A;  3CD6 I;  2BW3 B;  1S72 B;  4II2 A;  5B6I A;  3ECO A;  1JHH A;  3FM3 A;  3U2Q A;  4KMU X;  4KNY A;  4A3E J;  4OIQ F;  4HF0 A;  2VKV A;  4RB3 C;  4QPO A;  3ECH A;  4EJO A;  1OCZ H;  2DET A;  3Q3A A;  1H89 C;  1QCX A;  2HR3 A;  2K40 A;  2X0K A;  3U2R A;  1DU6 A;  3IH3 A;  3T51 B;  4RAF A;  3OV8 A;  3CCU I;  3ZN0 A;  1DAB A;  4NDL A;  4XRS A;  2VXD A;  3RKX A;  2CV0 A;  4U0W A;  4EH1 A;  3W2W A;  1B6A A;  5DDG A;  1R7J A;  3OYC A;  4BE2 A;  1DQU A;  4S04 A;  1KJZ A;  1UD2 A;  3CO6 C;  2LG4 A;  4NQW A;  2V4J C;  4A0Y A;  1HLV A;  1FLI A;  3V7R A;  5J1Y A;  2D3N A;  3P27 A;  1K28 D;  2WZP P;  2RV8 A;  4HA8 A;  3ABT A;  5ICF A;  1R4N B;  5DEQ A;  2EPF A;  4NC6 A;  2RC4 A;  3H0G J;  2VBT A;  1A36 A;  1FZP B;  4PC1 A;  2DDA A;  1FT9 A;  2ZNZ A;  3J7A O;  3E5X A;  4G7O F;  4YFK F;  3QFC A;  1NBM A;  3LJY A;  2ISY A;  3PFI A;  3TQN A;  1PJ5 A;  2HOS A;  3P7N A;  4BBS J;  4LIU A;  1ZG1 A;  2V4D A;  4B47 A;  4QTR A;  1U8B A;  4A3G J;  2L7Z A;  4XD7 A;  3K4L A;  3PEN A;  4Z2Y A;  5DM6 F;  1OB0 A;  1B8I A;  3JTG A;  4P1W A;  3COA C;  1GVJ A;  1Z21 A;  2DOG A;  4B44 A;  5DYM A;  3KZZ A;  1IDY A;  1X58 A;  4ZTJ A;  2X1C A;  1DGW Y;  1LVK A;  2ECC A;  4UAJ A;  3V7A A;  3N4M A;  2DU9 A;  2EA4 A;  3ZMV A;  1B8I B;  4FX4 A;  1DAR A;  1EA0 A;  2VT3 A;  1ODD A;  1JJ6 C;  3GVK A;  2DBB A;  1LM1 A;  2Y0S N;  2Z33 A;  2W7Z A;  3WNB A;  5J47 A;  2DCU A;  2CG4 A;  2BM5 A;  1R49 A;  3B4N A;  1YS6 A;  4BJ5 C;  2F1L A;  4M0L A;  2EH3 A;  3EYY A;  2MD0 A;  2XHK A;  3ISX A;  3VMW A;  4FHT A;  5CYV A;  4H9G A;  2A61 A;  2K3P A;  1VQ7 I;  3OJX A;  3OOP A;  4ASN A;  2PLF A;  3OYI A;  1YS7 A;  3OEH A;  4Z05 A;  2KIM A;  3PL8 A;  2VQL A;  3BY6 A;  3IH2 A;  4WXD A;  1IW7 F;  1ETK A;  2KFD A;  2ZL5 A;  2KVO A;  1JGS A;  4D5C A;  1F43 A;  3LA3 A;  4HYE A;  5HS9 A;  1CF7 A;  5ILV A;  4AF6 A;  3I64 A;  3GO5 A;  2VKD A;  2LR8 A;  4HZF A;  3CCL I;  3BRO A;  1MMD A;  2KIU A;  1MBJ A;  3A03 A;  1D8T A;  3GZ5 A;  3PET A;  4X1E A;  2FBK A;  4BJT A;  3IUO A;  2NVX J;  2DQR A;  3QQA A;  2EFQ A;  4Q47 A;  1CF7 B;  2IT0 A;  1B2R A;  3ZUG A;  4RLZ A;  2DAO A;  5CJ9 A;  1I6H J;  1T95 A;  4EQQ A;  3HEF A;  1TT0 A;  3A1Y A;  3WTW C;  4W8Q A;  2H6B A;  1ZYR F;  2FF4 A;  5FKN A;  2Y2Z A;  1XMK A;  4ZCL A;  3F8N A;  5L3C A;  4FAS D;  2VBZ A;  4GYG A;  2E2H J;  3WGG A;  1EF4 A;  4MTE A;  4X0G A;  3A3G A;  4AYB A;  4C2U A;  2LVS A;  2DFF A;  2NS7 A;  3F72 A;  4A6E A;  1NG7 A;  2GA1 A;  3SFZ A;  3AVY A;  1B59 A;  2DJN A;  1EA3 A;  3GTQ J;  3M1E A;  3PNT A;  4AIH A;  2YSR A;  2CQN A;  3DPU A;  2WSS A;  4W8R A;  3S2W A;  2WC2 A;  1IUF A;  1WH5 A;  2FX0 A;  2XKO A;  5DUK A;  5HLT A;  3ZQC A;  3GW2 A;  1EJ9 A;  4UY8 I;  2PEC A;  1VQ6 B;  2IAI A;  3CW2 A;  2W82 A;  1PDN C;  3AVU A;  5CLS A;  4MTD A;  3FXM A;  1Y0R A;  4X7D A;  3MMP A;  2Q6I A;  4XQF A;  3CQZ J;  1X2M A;  3HKZ N;  2HQA A;  1IO2 A;  2OTJ B;  2YX7 A;  2K9Q A;  3VMV A;  2E1B A;  3JRF A;  1FSH A;  3NRV A;  3L2Q A;  2KJB A;  2QQB A;  4OM9 A;  1DBG A;  4QVA A;  3SJP A;  1E3Z A;  1FP1 D;  1YIO A;  1Y8R B;  3E0J B;  2EIJ H;  4KFC A;  1Q7Y D;  4ZGN B;  4E70 A;  1T6S A;  4UUT A;  5ICE A;  1Y39 A;  2B7E A;  1O4X A;  3TOA A;  2NZM A;  1ETV A;  2XF6 A;  1HC8 A;  2Q0O A;  4DBQ A;  5KHD A;  1T6X A;  5GV8 A;  3BPV A;  4OIO F;  4LIT A;  2MG4 A;  2PI0 A;  5IP6 A;  4DQL A;  2RC5 A;  1VQ4 I;  2Y9Z A;  4IKF A;  1U9N A;  5DSZ A;  2XSJ C;  3RJP A;  4RD3 A;  2MH9 A;  4BS9 A;  3I1F A;  5FO0 A;  3N90 A;  1FSE A;  3VNU A;  2DYS H;  1M1K D;  3VNV A;  1JA0 A;  4FWT A;  4WQM A;  5K5O A;  4WZK A;  3BQZ A;  3JX8 A;  1JKR C;  1EXM A;  2WB1 N;  2OA4 A;  5GAD J;  4E7I A;  4N0B A;  5CVV A;  3ASQ A;  3ZZ0 A;  4HF2 A;  3Q38 A;  3GVJ A;  3I59 A;  3CCE I;  1QZY A;  2UUZ A;  1VQ6 I;  3AVT A;  1OOC A;  2X9D A;  4C3I J;  4M2L A;  1O8G A;  1W34 A;  4JRA C;  3DCF A;  3VMF A;  3ZPL A;  1IB4 A;  1PE9 A;  2JA6 J;  4JBA A;  4CCO A;  1OB2 A;  4RPB A;  5K1Y A;  2JA2 A;  3CJQ B;  2UWM A;  4U49 A;  4X8I A;  3K2A A;  3U1K A;  1QH0 A;  3BH4 A;  2L7K A;  2ZXJ A;  4L0Y B;  2JA7 J;  2E19 A;  1CNF A;  2BOL A;  4IHV A;  4AF7 A;  3DQV C;  2IXS A;  2ZKZ A;  4YC5 A;  1OYY A;  2V7V A;  4LK1 F;  2KIF A;  2WAQ A;  2RVC A;  1I18 A;  4G5G A;  2Y48 A;  1BJK A;  2V9P A;  4QVJ A;  2JVG A;  2X3U A;  2AXT C;  1WTH D;  4LBY A;  4HV6 A;  3Q9S A;  5HOO A;  3TP0 A;  4G7W A;  2XAH A;  5D5W B;  3S16 J;  4DZP A;  5HZA A;  4I6Z A;  4A3K J;  4N4N B;  1DU0 A;  2VPL A;  4RJL A;  2JUG A;  4RM0 A;  4L9V A;  4IRG A;  1O7F A;  5GAE J;  2CUF A;  4J01 A;  2K9L A;  3Q9V A;  1G4D A;  4I0B A;  1H8E A;  2HXO A;  2WV0 A;  4HV5 A;  2BY2 A;  3CCS I;  1O8K A;  3HOX J;  2DMU A;  4ESB A;  3HUG B;  5GTI C;  1H0M A;  1WSV A;  2O6W A;  1W0J A;  3U9G A;  3HHG A;  3T9G A;  2CBX A;  3BZC A;  3OFN A;  4BU2 A;  3T1B A;  2VBV A;  3PVD A;  1W5C C;  3OW2 B;  1COW A;  4DJA A;  4HX4 A;  2PJP A;  1L1I A;  1MMN A;  4CIC A;  1TBX A;  1Z67 A;  3ML6 A;  3A02 A;  3BWG A;  4JK1 X;  5IYW A;  1XTA A;  3PJR A;  4MEY F;  4ZDO A;  3NAU A;  4FET A;  1LFU P;  3BJO A;  1WH7 A;  3HRT A;  1HCR A;  1KC8 D;  3ABL H;  3R6S A;  3I56 B;  5E6T A;  1XG1 A;  4D0P A;  2NYX A;  3D0S A;  4HLX A;  3ERM A;  1WGX A;  2MA3 A;  5IY5 H;  3E6C C;  2R5Y A;  5EDN A;  2LKX A;  1O8J A;  1O8L A;  3A8K A;  2WV1 A;  3WGI A;  4GFB A;  4V2G A;  2VBM A;  2O8K A;  3RKW A;  1KU9 A;  4UUV A;  1NHA A;  2F3L A;  1I1G A;  5K5R A;  3DF8 A;  1ETY A;  1ULY A;  5HXB A;  3E7L A;  1QRC A;  1OCO H;  1V55 H;  3K4K A;  3LA7 A;  1IRZ A;  2QSF X;  2FVG A;  3LO8 A;  5EGO A;  1OFM A;  1IHM A;  4Z4V A;  1UZC A;  2X4H A;  4Z03 A;  4OJ5 A;  3LSK A;  3BCF A;  3TGN A;  3CZ6 A;  3WNC A;  1BMF A;  2CQQ A;  4FCY A;  1Z1D A;  1NK3 P;  5FD5 A;  5FO5 A;  5HVQ C;  1W36 D;  2KL4 A;  5EEH A;  5EGO B;  4P22 A;  4XLC A;  4J19 A;  1EZG A;  3R60 A;  4MHG A;  1IXS B;  3K1P A;  5L3G A;  2XAQ A;  4IX7 A;  2PMZ N;  3FKJ A;  1E1Q A;  2XGC A;  3BP8 A;  2VFQ A;  1Z3Y A;  1S3J A;  2XPU A;  1RUO A;  2C6Y A;  1G7R A;  1IRF A;  3D5L A;  2DJI A;  4RGX A;  1XDS A;  1YW9 A;  1ZM3 A;  4YIF A;  2OUM A;  2Y0S A;  1OCC H;  4I98 B;  1K6O A;  3E20 A;  1P4W A;  4V02 C;  2QKL B;  1G3S A;  2L5Q A;  3CCJ B;  4RAG A;  2ZBV A;  3GQ9 A;  2Q2E A;  5EEG A;  5KVR A;  2OYN A;  1VQP I;  3GVA A;  2GWR A;  1LPQ A;  1KU3 A;  2CUE A;  3K6G A;  4TMV A;  2Z1D A;  5IP7 J; 
#chains in the Genus database with same CATH homology
 4GRI A;  2UVF A;  3L2U A;  5CDF A;  2R7V A;  5CPR B;  4G7X A;  4OJL A;  2Q2E B;  1PLU A;  4B48 A;  2LY1 A;  2DIE A;  3K4J A;  2R9V A;  4DNR B;  2X3H A;  4ZJZ A;  3OYG A;  2E1M B;  3SEQ A;  5LD2 C;  1O88 A;  2IS4 A;  2ZTN A;  2CUZ A;  2W4S A;  3OL4 A;  3OMY A;  3L2W A;  2GJR A;  2O0W A;  1VF7 A;  2O17 A;  4PJN A;  2WA0 A;  2L9S A;  2R7X A;  2X53 S;  1UD4 A;  2ZTG A;  1Y56 A;  2BVL A;  1JI8 A;  3JUR A;  4E4H A;  1SKY B;  4KKT A;  3ZGK A;  3OYN A;  2VXZ A;  5FRM A;  4NQW B;  2VJI A;  2L9N A;  2VQH A;  2Z2S B;  3C2G A;  2AQF A;  3IP4 B;  4HSR A;  5CKT A;  1WP6 A;  1J09 A;  4TSF A;  3DPL C;  3B8Y A;  1H80 A;  3H9G A;  4F3Q A;  2CFO A;  5HKK A;  3OEE A;  3KYL A;  4HNU A;  2OV7 A;  3QOE A;  4JQF A;  2X6W A;  1D1C A;  3LSI A;  4D1Q A;  1QJV A;  2XGJ A;  3DTK A;  2Z16 A;  1BR2 A;  1WJA A;  3OS2 A;  2F6C A;  2HVQ A;  4XKC A;  4BQO A;  4C9Y A;  2IS1 A;  5HNF A;  3OOC A;  3OYF A;  4E0F A;  1BHE A;  5KCM A;  1SAU A;  3AL0 C;  2GJP A;  2KRH A;  3H5A A;  1X1D A;  4CUG A;  3G05 A;  3OS0 A;  3OYJ A;  4HST A;  1LDK B;  2K9M A;  1LFP A;  4Y4R A;  1E43 A;  1AIR A;  4E7L A;  3BC9 A;  3PFY A;  4DGW B;  2NT6 A;  2Q1Z B;  1E0E A;  2W6I A;  2ZSH B;  1S9H A;  3BCA A;  4BUP A;  1HA8 A;  4KIT B;  1N77 A;  2JJ2 A;  3T56 B;  1PXZ A;  2X85 A;  3H35 A;  2CW8 A;  2A5W A;  1KTW A;  4KJZ A;  4J00 A;  2Z6B D;  3FKS A;  3HKZ A;  1QU3 A;  2E60 A;  4BE0 A;  1V0E A;  3OR2 C;  4CSW A;  1RMG A;  3VYU B;  2ZZQ A;  2V9K A;  1IDK A;  4CA0 A;  3T53 B;  4YZA A;  4FXU A;  1BLI A;  3VST A;  1FMV A;  3SEZ A;  1PJR A;  2VAS A;  3OR1 C;  3L2V A;  2M0M A;  2X1D A;  3V42 A;  1KCC A;  4PMH A;  1GQ8 A;  3BLY A;  4F52 A;  3VDX A;  1E1R A;  2K5C A;  3FBI B;  1V5G A;  3OYB A;  1EE6 A;  3LMM A;  3VYT B;  1V5F A;  1N75 A;  4XKB A;  4BXF A;  3EQO A;  1D0X A;  4Z06 A;  4C2L A;  2PJR A;  2R7R A;  4HNT A;  2W6J A;  2MAB A;  2V26 A;  3DU6 A;  3U21 A;  4JOM A;  4DBR A;  3MMY B;  5JHF A;  2HDW A;  2WBM A;  4C30 A;  2JIZ A;  4TKO B;  1VBL A;  2IGK A;  2WAD A;  3W2V A;  3ZPP A;  4DNT B;  1MW7 A;  1X1B A;  1P9Q C;  4PSX A;  2WAF A;  4E6K G;  2LH9 A;  3SZG A;  3A3B A;  4OJP A;  4EW9 A;  2XDV A;  2X6Y A;  2PJR B;  4I84 A;  5C1E A;  3K70 D;  2WB1 A;  2P0W A;  4G6T B;  4CZC A;  2DOA A;  2HVR A;  1UD6 A;  3PNY A;  3MKY B;  3LSG A;  2R7W A;  1OGM X;  2GOX B;  3HXL A;  2M5S A;  3NWT A;  1YE9 A;  3VSU A;  4II3 A;  4F55 A;  1DBO A;  4KIS A;  4LG3 A;  1G59 A;  3GQB A;  4GQN A;  1UAA A;  3UNG C;  2WAE A;  3FDY A;  4F92 B;  3EUA A;  2QE7 A;  1OHH A;  4ITV A;  2CK3 A;  1V0F A;  2JDI A;  2X51 A;  4Z1M A;  4F93 B;  2XC7 A;  2KDO A;  4XKV A;  1UD5 A;  1W9X A;  2WJY A;  2BW3 A;  1WFX A;  3L2R A;  2FUG 2;  4HEA 2;  2LOO A;  2VKH A;  3A2K A;  1BN8 A;  3ONQ A;  1T0F C;  1KON A;  2LRE A;  3LSH A;  5DN6 A;  5IK2 A;  4MR0 A;  1XG2 A;  4D9J A;  3VYR B;  3VR6 A;  4PFO A;  1HVX A;  1KZL A;  3VSK A;  2BW3 B;  4II2 A;  2VJJ A;  4AVZ A;  3PSF A;  4YZQ A;  1E79 A;  3M8J A;  1W0K A;  4QPO A;  4XOT A;  1BOB A;  2XAU A;  2GK6 A;  3OE7 A;  1QCX A;  4DIQ A;  2M7A A;  3S3N A;  3T51 B;  3AFH A;  2M3A A;  4B3F X;  2WJV A;  5HNH A;  4ZC3 A;  3DLA A;  3BC8 A;  2QY1 A;  4OJO A;  2VL8 A;  2CV2 A;  3K70 C;  2VXD A;  2CV0 A;  2W7N A;  4IZZ A;  3W2W A;  5FL7 A;  2KP6 A;  3OYC A;  3S93 A;  1D1B A;  4BE2 A;  1DQU A;  2F5V A;  1TZL A;  3ZCO A;  4BL0 B;  1UD2 A;  4XKW A;  2VBE A;  2LG4 A;  2V4J C;  2GK7 A;  4HRI A;  2GOM A;  2D3N A;  1OLT A;  3EQN A;  4U7B A;  1UEL B;  1K28 D;  2WZP P;  3MD2 A;  2XZO A;  3CES A;  1X4O A;  4KT6 A;  2NSP A;  2O0V A;  1VLY A;  3B90 A;  2CS3 A;  3SDB A;  2KRC A;  4NC8 A;  2VBK A;  2KQR A;  1T5E A;  3WWG A;  3D5R C;  2DXI A;  1WJB A;  4DK1 A;  4NK8 A;  4RLF A;  1NBM A;  1WJC A;  3OYE A;  2DT6 A;  2IGN A;  2RNG A;  3H5R A;  4LIU A;  4PUS A;  4PFP A;  2V4D A;  3DEE A;  2R7O A;  4XOP A;  3ZR8 X;  3OL3 A;  4B47 A;  4XD7 A;  3K4L A;  1OGO X;  3IAM 2;  1E3X A;  1OB0 A;  1BR4 A;  1O8H A;  4P1W A;  4BDY A;  1Z21 A;  3ZPN A;  2E5N A;  4B44 A;  1V5E A;  4KKS A;  3KEY A;  4ZTJ A;  2X1C A;  3GBG A;  5CQE A;  2VLA A;  4E7H A;  1DGW Y;  1LVK A;  4XON A;  3A35 A;  1LKX A;  2UV1 A;  2PYG A;  4XNF A;  4MXN A;  2AQE A;  2DCE A;  4CCL A;  1QHH D;  2V6E A;  1MMG A;  4LIV A;  4CCN A;  3SYT A;  2ZZG A;  1KCD A;  3RTR A;  3GQ8 A;  4DK0 A;  3K4B A;  4RM3 A;  3GVK A;  4ZTF A;  1H8H A;  1O8I A;  3EUH C;  3LL7 A;  2LZJ A;  2LRD A;  3FHN A;  4E7Z A;  2R4G A;  2CMP A;  3B4N A;  4BJ5 C;  2R7S A;  4XM3 A;  3S8P A;  2NT9 A;  4XN0 A;  2MD0 A;  2VJ4 A;  3VMW A;  2IGM A;  4PJM A;  2MFZ A;  2V7Q A;  2HVS A;  2K3P A;  2LC2 A;  1NHC A;  1D1A A;  3DKY A;  1MAB A;  1R6R A;  2PMZ A;  3RQ4 A;  3OYI A;  3OS1 A;  4W8T A;  1PYV A;  2O1D A;  3OEH A;  4Z05 A;  2JSP A;  3PL8 A;  2VQL A;  3FY3 A;  4ASU A;  2ODL A;  3C2H A;  4IQJ A;  2KVO A;  2NTP A;  3HPG A;  4RM2 A;  4XN3 A;  4OZZ A;  3UW0 A;  2OC6 A;  3GVL A;  1SFK A;  2KHM A;  2HU9 A;  2VKD A;  1VZ0 A;  3MKW B;  1MMD A;  3S3O A;  3DKX A;  3IAS 2;  3OOU A;  4BJT A;  5C1C A;  3IUO A;  1Y6I A;  1D0Z A;  2BVM A;  3BCD A;  2HNH A;  2WY8 Q;  4OZY A;  2ZSI B;  3QYB A;  2XND A;  1RU4 A;  1T95 A;  1EFR A;  3OYH A;  3CP2 A;  3KX2 A;  1TT0 A;  3A1Y A;  3HC7 A;  4U4B A;  1DP3 A;  4W8Q A;  5CQG A;  2V31 A;  4KKU A;  1X19 A;  4FAS D;  3DTI A;  3N05 A;  1FMW A;  2D3L A;  1WJF A;  2HPM A;  3AL0 B;  2XZL A;  4X0G A;  4XLE A;  1MMA A;  3A3G A;  2X1E A;  2VB6 A;  4XLA A;  4AYB A;  5FRO A;  4C2U A;  1NG7 A;  3UR3 C;  3TBI A;  1EA3 A;  2M4K A;  2Z8G A;  3PNT A;  2IS2 A;  2NTB A;  3DPU A;  2E1M C;  2WSS A;  2VJ5 A;  4YZX A;  4W8R A;  2EWE A;  1VJS A;  2R7T A;  4YXW A;  5HLT A;  2L2O A;  3NE5 B;  2ZFU A;  3S32 A;  1KMH A;  2PEC A;  1X1C A;  2W82 A;  3OPO A;  2X6X A;  2IGO A;  3BG7 A;  2R7U A;  3J7A Y;  4N4O B;  2GJK A;  2RQQ A;  1O8F A;  2CUJ A;  4XQF A;  2HQA A;  3CJR B;  2KLO A;  4XMY A;  2HLD A;  3VMV A;  2E1B A;  4ZDL A;  3GQ7 A;  2DT7 B;  1AA7 A;  2W00 A;  3CP8 A;  4BJ6 C;  3DPT A;  3L2Q A;  3HOS A;  1X0C A;  5AMV A;  3ZRG A;  1DBG A;  2V7F A;  3PSI A;  2CH0 A;  2M4G A;  2W1O A;  4NUB A;  4F91 B;  3DTE A;  1E3Z A;  3E0J B;  4NNJ A;  3OYA A;  4G6I A;  2WPD A;  3K4C A;  2NZM A;  3H9Q A;  3W3C A;  4NK6 A;  4OAZ A;  2XF6 A;  1O8E A;  2ZXI A;  4DBQ A;  4E7S A;  5KHD A;  3BCB A;  2LBF B;  1WJ5 A;  4LIT A;  1UD3 A;  3GQA A;  2PYH A;  3ZXS A;  1JRG A;  3KRG A;  4R79 A;  4E7K A;  4IKF A;  3PUB A;  1HZE A;  1YX5 A;  2XSJ C;  3OW7 A;  3CMM A;  3VSL A;  4BS9 A;  1BR1 A;  2KPM A;  1RWR A;  3H94 A;  3EUK L;  4BDZ A;  2E5Z A;  3PNV A;  3K4N A;  3K10 A;  2BSP A;  4URR A;  1NRK A;  1Z3X A;  3RSN A;  4E7I A;  4BQQ A;  4HPQ A;  2X8K A;  4BEH A;  1JTA A;  3GVJ A;  3DWL E;  4UZU A;  2QKM B;  2UUZ A;  3VYS B;  2V1N A;  4BAC A;  1OOC A;  3VSV A;  2XOK A;  4QPQ A;  3QYF A;  3MKZ A;  4JMQ A;  3I9V 2;  1IB4 A;  1W36 C;  3ZQQ A;  4EAT A;  4XOR A;  1PE9 A;  2INU A;  4XLH A;  4BEH B;  4CCO A;  3HAG A;  4PSW A;  4PJJ A;  2JA2 A;  3CJQ B;  2UWM A;  4U49 A;  3BH4 A;  4B3X A;  2L7K A;  1U0J A;  1X1A A;  2LYC A;  1O8G A;  2ELJ A;  2BOL A;  2MYS A;  4AU7 A;  4ANJ A;  3DQV C;  3WQZ A;  2IXS A;  2XF5 A;  4RMN A;  2WAQ A;  2NST A;  2MC4 A;  3OYD A;  1I18 A;  3F9K A;  2CW7 A;  2JVG A;  3H9J A;  1WTH D;  2JVH A;  1WMR A;  4XR6 A;  4IQ4 A;  4CCJ A;  5HOO A;  4G7W A;  1OR7 C;  1GLN A;  3S3M A;  1PKV A;  3NWS A;  4OAY A;  3OAA A;  2F1M A;  4N4N B;  4BGD A;  4NC7 A;  2VPL A;  4TT3 A;  1O8M A;  2JUG A;  4Y33 A;  4MLO A;  4PJL A;  4J01 A;  3OY9 A;  2K9L A;  2XZP A;  1H8E A;  2WY7 Q;  1K5C A;  4XLF A;  3SUC A;  3H0D A;  1ERD A;  2NTQ A;  2XF7 A;  4W8S A;  3QOD A;  2IS6 A;  1O8K A;  4OJ6 A;  1NG6 A;  1N78 A;  3HUG B;  3OIP A;  2M7B A;  4BE1 A;  3CF2 A;  2VIX A;  1W0J A;  1D0Y A;  3E1S A;  3G2B A;  2INV A;  3T9G A;  3FPP A;  3OFN A;  4BU2 A;  2LY2 A;  3ZSC A;  3M1C A;  4L8J A;  2IQ7 A;  4P5O A;  2CV1 A;  1COW A;  4DJA A;  1WPC A;  1DGR M;  1MMN A;  2O5R A;  1WJD A;  2HZD A;  3PJR A;  4B3G A;  4YEL A;  4ZDO A;  4FET A;  2QX3 A;  3DU5 A;  1YX3 A;  1O8D A;  1Z7L A;  1OFL A;  1O8J A;  2ZZE A;  1UD8 A;  1K6Y A;  1O8L A;  3OWT A;  2I8D A;  3JU4 A;  2VBM A;  4XL9 A;  2F43 A;  3W2A A;  3RCO A;  3LMW A;  4ZDP A;  1IA5 A;  2VQG A;  1ZEL A;  2RRE A;  3RPU D;  1QHG A;  3TMO A;  3OYL A;  2QXZ A;  2F4I A;  4CH7 A;  3HOT A;  3VWB A;  3K4K A;  1BPL A;  4HWV A;  4BQN A;  1OFM A;  1CZF A;  1IDJ A;  5TGT A;  4ZYA A;  3OIQ A;  3KEW A;  2ZZF A;  4B43 A;  3LSK A;  3BCF A;  4OJ5 A;  3CZ6 A;  4Z03 A;  1BMF A;  3H5N A;  4C2T A;  3EPZ A;  2JJ1 A;  3LSM A;  1MND A;  5HVQ C;  1W36 D;  2UVE A;  2KL4 A;  4P22 A;  2ZXH A;  2KZV A;  3HG9 A;  4XLC A;  4YEJ A;  3OYK A;  4CCM A;  3OYM A;  2A6T A;  3FBN B;  2LBF A;  4IX7 A;  1UG0 A;  3FKJ A;  2VQC A;  1E1Q A;  1Z3Y A;  1MNE A;  1I8D A;  3AKZ A;  3D5L A;  2DJI A;  5KNL A;  2KMU A;  3K4M A;  3GRH A;  2OUM A;  4PK4 A;  2NOJ B;  2R7Q A;  2Y0S A;  4YRV A;  3LFU A;  4HG2 A;  3DDY A;  2QKL B;  5LFA A;  4HIZ A;  1HG8 A;  2L5Q A;  1WJE A;  3HL2 A;  1X4P A;  2O04 A;  1IRX A;  4DOZ A;  3TL4 X;  3GQ9 A;  3A4C A;  3D5S C;  4E7J A;  4RLQ A;  3HPH A;  5FRN A;  3QYE A;  4YZ0 A;  3I3L A;  4Y3O A;  4CCK A;  1G8X A;  3LNN A;  1FX0 A;  4U87 A;  3K6G A;  4H4K C;  3ZIA A;  2HPI A;  2Z1D A;  3BG6 A;  4OWR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...