4XN3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 227
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn3A02
4YZAA 4YZ0A 2X85A 3VSUA 4XLAA 1JTAA 4XLCA 4XL9A 2X6XA 2X6WA 2PYGA 3VMWA 4YZQA 1EE6A 1O8HA 2UVFA 2QY1A 4PMHA 3GQ9A 2VBMA 3GQ7A 1RMGA 1VBLA 2QX3A 3JURA 4OJPA 4OJ5A 2NTBA 4Z05A 1O88A 2VJJA 3SUCA 5AMVA 3T9GA 4OJLA 1X0CA 4XONA 4OZYA 4I84A 1OFMA 4W8RA 2NTQA 4W8TA 1IDJA 1H80A 2O04A 4YEJA 2O0WA 3VMVA 3VSVA 2UVEA 1HG8A 4OJ6A 4XOTA 1XG2A 3GQ8A 2O1DA 2NTPA 2BSPA 1NHCA 1CZFA 2VBKA 4YZXA 4Z03A 1KCDA 2VJIA 4MR0A 1BN8A 4NK6A 3WWGA 3B4NA 4URRA 2EWEA 1IDKA 1OFLA 1PE9A 4W8SA 1DBGA 2X6YA 2INUA 1KTWA 2O0VA 3GQAA 1WMRA 5C1CA 1RU4A 1PXZA 4NK8A 1QJVA 3LMWA 4XORA 1O8GA 3FY3A 1O8FA 3EQNA 1O8KA 3GRHA 4U4BA 1AIRA 2Z8GA 2INVA 1K5CA 3B8YA 2NSPA 4XN3A 2NT9A 1IA5A 2PECA 4XR6A 4C2LA 4EW9A 2QXZA 3KRGA 1O8EA 4HWVA 1OGOX 1OGMX 1DBOA 4XQFA 2PYHA 3UW0A 2O17A 3VSTA 1O8MA 4OZZA 2NSTA 4YELA 4XM3A 2ODLA 3ZPPA 3EQOA 1O8IA 1PLUA 4W8QA 2IQ7A 4XLFA 1O8LA 4XOPA 2X3HA 4XKWA 4XLEA 2VBEA 4XKVA 4XNFA 1RWRA 1KCCA 4XMYA 4MXNA 1BHEA 4OJOA 4XLHA 1O8JA 3ZSCA 3B90A 1IB4A 4XN0A 1JRGA 1OOCA 4U49A 4Z06A 5C1EA 1QCXA 4AVZA 2NT6A 1O8DA 2NZMA 1GQ8A
chains in the Genus database with same CATH superfamily
3HHHA 2EFQA 2E7XA 1P7JA 2KKOA 3CD6I 2R7SA 2E2JJ 5EYRA 2XAQA 4XL9A 4RDUA 4CXFA 2HDNB 2HKOA 2HPMA 2GQQA 4CDGA 5THXA 2LBFB 1BMFA 5JR3A 2LSOA 2UXNA 4BS9A 1RQRA 4UXNA 2HQAA 2P6SA 2M5WA 3BPXA 2DCEA 3BR6A 1KMHA 1ETWA 4WXDA 2VKVA 1T38A 4BHPA 2X51A 4CYCB 1DU0A 1AOYA 4P6VF 3M8FA 2HPIA 5E1XA 2R5YA 1RMGA 1G3YA 3KZYA 1RUOA 5D6EA 4KITB 3S15J 4AIJA 5LHIA 1JNYA 4HF2A 3FZVA 3FHZA 5KSWB 3J81K 2OBTA 4Z4SA 3LYCA 4OJLA 4IL6C 1DABA 5TJJA 3TO6A 1HDDC 1XFOA 2H8WA 2LF8A 5BPIA 2XNJA 3S2DJ 2HZTA 1MBKA 1U9NA 3CZ6A 1A35A 1OFDA 4BJ5C 2QYUA 5BS6A 2NS7A 2LD5A 3VMVA 2MD5A 3BQZA 1LVKA 2HR3A 3M1EA 4LD5A 3E6CC 3Q39A 3VSVA 1R1TA 4LOCA 1Z91A 1T6ZA 4CA0A 1E3XA 3BH7B 4X7FA 3DP7A 1KQ5A 5F0CA 1KK2A 4HDVA 1N77A 4WZTA 2D45A 2IS6A 1H9TA 1BLIA 5E6TA 3W5UA 4NK6A 1NDHA 4HV6A 1EH6A 3Q0WA 3WGHA 1I6HJ 4BKXA 2YWFA 4BAYA 2OTLB 2XZOA 3CUQA 3O8HA 3AL0C 2IEKA 3E1SA 5ED4A 5JFRA 2HOAA 3QAHA 4D5CA 2KRHA 2O0YA 1A31A 1S8NA 1P9QC 2FF4A 1FP1D 4NHJA 1QFJA 3G73A 3R0JA 1GVDA 4G12A 1XC5A 2XRLA 5FO5A 1W1WE 2ECCA 2O6WA 1W7PD 2XKPA 2FQ4A 4PC3A 1B72A 1FRQA 2QGUA 2NSPA 2ELHA 4BE0A 1QGYA 4UV8A 2Z16A 4BU2A 4EQQA 1VQOB 4Y33A 1J2XA 3TMOA 2PMDA 4PJMA 4IHWA 2DLLA 1O8EA 1HBXG 3EUHA 4JX4A 1NH3A 1E0EA 1COWA 1N06A 4HOBA 3IKVA 4X8IA 2KLOA 2AXLA 3UKGA 5KVRA 1TVCA 3QE2A 2O9LA 4RPBA 1EA3A 4G1BA 4E6KG 4BH9A 4C0SA 4B48A 2XT2A 3VSTA 3T51B 3A3BA 2BYVE 5J4VA 2QEXI 1VJSA 1WTHD 4YFNF 4C9YA 3T0YA 1U6GA 1U2RA 4F55A 3S1RJ 4QPOA 4IHVA 1O8LA 1PJ5A 1JTYA 1FOKA 2Y2ZA 3QYBA 3K4BA 4B44A 2VC0A 3OYGA 4JBAA 1FSHA 3ZZTA 2YX7A 4AC0A 3JREA 4KJZA 5F04A 2D3LA 1MDMB 2GK6A 1S4MA 4A3EJ 1W0UA 4B4CA 3CCQI 2DO7A 3W2HA 4YRVA 1O7FA 1YW7A 2QUFA 3BCBA 5B5EC 1K73D 2Y0MA 2LKSA 1DARA 3OJWA 3Q38A 1KYZA 1XMKA 2EZIA 1FYKA 3VSUA 1GVHA 4MFEA 1WPCA 4PK4A 2HDCA 5FGMA 4L0YB 3KLNA 3OYNA 3CO7C 3ABKH 2FBHA 3H94A 1Q1VA 4EJTA 1JGSA 3WTYC 2DIEA 2M9HA 1P4AA 2J8KA 1FT9A 2KPMA 3ZZ0A 3HOWJ 4QWQA 3PSFA 3CUOA 1FYLA 1TWCJ 2V9VA 2WAQA 4CH7A 1VQ7B 1O8MA 1Z3XA 1FY7A 1EFUA 2VBWA 4B3FX 1TLLA 4KDPA 2QTLA 3LA3A 4YDTA 4MYUA 3DTEA 3HTUA 4DZPA 2F5CA 3Q0UA 2HYJA 4Z05A 4A69C 1RI7A 4A12A 2I8DA 4EJVA 3OYKA 4Q5SF 3LA2A 1W0JA 4WWVA 3CP8A 4IOAF 1PUFB 3K2ZA 4RAGA 1X0CA 1Y8QB 5J3LA 4KYWA 1VQ5I 1OFMA 5GAEJ 3ZUGA 2YUHA 4FISA 3A0HC 3C18A 2E71A 2P0WA 4EGZA 2UVEA 4FHTA 4I02A 2G0EA 3I71A 1ITYA 5M5YJ 2O3FA 2OBSA 2JSPA 3W6VA 3I59B 1ORKA 4A0ZA 2IBDA 1EH8A 1ERDA 2G9WA 2EWNA 2K7LA 3FXOA 4C2TA 2KMUA 1T33A 4HNVA 1N75A 2F2EA 4DNTB 3SFZA 1W7PB 5J1RA 1W34A 4P1VA 3LAPA 2VBXA 1WMRA 3A8IA 1ZR4A 1EP3B 1BL0A 1BJZA 1V5FA 4XORA 3JRDA 4G7OF 1G3TA 1ETKA 4IRHA 3OW2B 3CC7I 3B8HA 3GRHA 4P22A 2XF5A 1WU8A 4UB6C 4LLLA 4IHXA 3G05A 3SDBA 3FJOA 2QXZA 3ASPA 5KAIC 4EEFG 2BHZA 2B7EA 4BYYA 1W0TA 2I5UA 1EKEA 4O3MA 1FLIA 2B7CA 4EM0B 3CMEB 3HRSA 1FRNA 1FNCA 1BX1A 1VLOA 4L5IA 1W9XA 3HAGA 1ETQA 1XCVA 2DI3A 4OPWA 3PENA 2GBYA 5HDNA 1YJNI 3FXJA 1PJ6A 4TMTA 1X4PA 3ASTA 1I5ZA 4XM3A 2VFMA 2RGVA 2R7TA 1B2RA 1WJDA 5FD5A 2JJ2A 1TYVA 2F5VA 3CCSI 2NNNA 3QU6A 3C1DA 2XPWA 2ZXIA 4X0CA 1ENHA 1LDKB 1MH4A 5FLVA 3IH3A 2QN6A 1R22A 5F0HA 1RR8C 4YEIA 5DS9A 4U87A 5CVRA 1BR2A 3CCYA 2PJRA 4XLHA 2EFOA 2E1CA 1LE8A 1X3UA 4FE7A 2EV6A 2O8KA 1Z21A 2ADUA 2BGIA 1GV2A 3E7LA 2F1LA 5C1EA 2RQPA 1F1ZA 1PDNC 4RB0A 4FTHA 5M5XJ 4XICA 1KD1D 3CCUI 3OFNA 2JN9A 3K4NA 3OIPA 4YAUA 3HOTA 3W2FA 2X6XA 3OKXA 5FJ8J 4HEA2 3I3LA 2QDXA 1J09A 1AA7A 1JHHA 4L9VA 5E8GA 2PBIA 1YS7A 5KHDA 4XRFA 3PSSA 2C4UA 2H09A 1XQBA 4RM3A 1Z6RA 5A8AA 3F8FA 4RGSA 2HVSA 2IA2A 4R71A 4N4OB 3S2HJ 3HZJA 3D5RC 3G1LA 1NB0A 3L2UA 1Y0UA 1XB2A 2DU9A 5GTIC 4MFDA 3NAUA 1CNFA 2GJPA 1W35A 1OCRH 1ON1A 1XG1A 2IGKA 3PM1A 4CICA 3S14J 2VOPA 5EZGA 2LP0A 1AMOA 3QFCA 1Y1VJ 2DODA 4XK4A 3JRBA 1QVUA 4HAMA 4XONA 3VFZA 3MWMA 3CDLA 4ZYGA 4LC0A 2E1OA 2E35A 5HS8A 3VYTB 4E7HA 1G8XA 4P9FA 3A03A 3A01B 1OCTC 4P9SA 4CQJA 5IYNA 2O04A 3LVBA 1I1GA 4DK0A 3CPXA 2FEZA 1EJ9A 2LK2A 4ZDLA 2XTXA 1LFBA 4PABA 1XG2A 3HRUA 5BMZA 3R6JA 1PJRA 3H92A 1JI8A 3MN2A 1UCRA 2DA3A 3CLQA 1L0OC 2CFXA 1DDNA 3TQNA 3TW6A 5H20A 3FXLA 2DA4A 3CJQB 4UVCA 4I09A 3WBJA 3MFKA 3G2BA 3KP4A 1Y0NA 5KCMA 3W3CA 2YSRA 1OGJA 2VL8A 1WJFA 2IS1A 1OB5A 1ZKGA 1VQMI 1RU4A 2VFNA 2IT0A 1E3ZA 2WZPP 1TYWA 2CGPA 5HS7A 1SKQA 3IWZA 5DSZA 1AIRA 5EMNA 2J8IA 4FT8A 5A2QK 2Z8GA 2GWRA 4ZTJA 4FE4A 4M3EA 1VLYA 3O2PE 1HKQA 4HV5A 4RA2A 1OHHA 4G7ZF 2C77A 1IN6A 5BNGA 2VNJA 2L7MP 3BTJA 5H2FC 1J9IA 3OYDA 2OQGA 4XRSA 2V1DA 4M72A 3HOXJ 3VOEA 4M74A 2E1BA 4QHYA 1OGMX 4P25A 1PYVA 2XPUA 3E6BA 3GIRA 2VZLA 5H59A 2ZB9A 3FK7A 1TWAJ 1UD2A 1YHQI 3JRFA 4DYQA 2H6BA 3B6CA 3FKJA 3IWFA 4LFUA 4JK1X 3NRVA 2OBRA 4YFOA 3BG5A 3MMYB 4NNJA 4W8QA 3ZCOA 1HW1A 5HDGA 5L3EA 5FD6A 1UAAA 4AVPA 2JN6A 3FMRA 2X3HA 2DMTA 3FX3A 1OCZH 3ZQQA 4X7CA 3AK5A 3EETA 4MXNA 4CZCA 3JQPA 1QQIA 2KL4A 2VQCA 2F5DA 1B9NA 2DY1A 4OJOA 3PUNA 4HW0A 3B90A 2MC3A 3ZQ7A 4N3NA 2JA6J 2E1RA 1V4RA 1AHDP 4LBVA 3BQYA 2NT6A 2KRFA 1R6RA 4G94A 1KGSA 2ZL5A 2VKHA 4TMWA 2WB1A 4B47A 4YZ0A 2GOMA 2HTSA 1ZRCA 1U5TB 2QQBA 4BPRA 4XLAA 3F6VA 1R1VA 1KQ0A 3CCVB 4E7IA 2DW4A 3E20A 2JZYA 1MJAA 2LF7A 2QWWA 3CRZA 1ZG5A 1D8TA 2CBXA 2GREA 4YIRX 5BOXA 4D9JA 3OZVA 4AYBA 1B9MA 2XGEA 3GTMJ 1BIBA 2CYYA 2X1DA 1KA8A 2CH0A 3HSEA 3I56I 4OPVA 3WNDA 5M5WJ 3IRRA 2ZZGA 3PSZA 2RQQA 3WHBA 1XGNA 2O8XA 2KIQA 3FIWA 5J1YA 1ZGWA 2WV1A 4YALA 3QP6A 3A4CA 4BHCA 1QX4A 3HG9A 2WJYA 3WTWC 4IF4A 3OYCA 4A3CJ 2ID6A 2WY7Q 3BTCA 1F5TA 3T56B 2QLZA 2FXAA 3IH2A 1IDJA 5FRMA 4YEJA 5IK2A 1VQLI 5CVIA 5DM7F 2K9QA 2W6IA 4OJ6A 3PIPF 2VFOA 3P7NA 1JJ8C 2UV1A 3UNGC 1AKHA 2IGOA 3M8EA 4TT3A 3WWGA 2JSCA 1W5TA 3DEUA 3LSMA 2R5ZA 2EV5A 2R7QA 3W6JB 1T39A 3SJZA 3W5VA 1E64A 2ZSHB 3BLYA 5LMZA 2NPFA 3RQ4A 3L2QA 3LA7A 3U1KA 4W8SA 2HNHA 3K2AA 3ONUA 1SMTA 2EZKA 3WTSC 2QSHX 3EPZA 3L09A 5ERIA 3CC7B 3RPQA 3CDHA 4M6XA 4BQNA 4OPOA 3SYJA 4GXOA 5GP9A 2M4KA 2Z1DA 3C2HA 5EEGA 3PSIA 2D74A 2J5OA 3D5LA 2XGCA 2V5IA 1MMAA 3QFRA 1DPRA 2BXZA 3Q5FA 1Q9SA 5TRDA 2PN6A 2CQXA 5KNLA 1X4OA 4L8JA 4FX0A 3MVPA 3JRCA 3BNWA 3TKYA 1HZEA 4OIOF 4BXFA 4Y15A 5KAFC 1BN5A 2QZ8A 5IOZA 5K1YA 2F3LA 2ZMEB 4KA4A 2OTLI 2BVNA 4JRAC 3CJNA 2RAEA 5GAHJ 2A6HF 3RCOA 4NDLA 4YELA 4DNCA 3OYJA 4M71A 1I18A 1QA1A 2V9PA 4ESBA 4GDFA 4WZLA 4NQWB 1T5EA 3CCSB 1GV5A 2HWVA 2EA2A 2HLDA 1VQ4B 1HSTA 4HG2A 5EGOB 2FQ3A 2JVGA 1ZGAA 4DYRA 2FVGA 2K85A 2VQHA 5FKKA 2XOKA 1BX0A 4G1VA 3O8GA 1SAXA 2EFNA 2H8RA 3ZSCA 3S32A 4P3IA 3IRQA 3A8KA 3Q0VA 2JQ7A 1QCXA 2RC5A 1OCCH 2LY2A 3DLLF 4Z4ZA 5E17F 1GQ8A 5F1RA 1W5CC 2DA6A 1FYMA 2ZXJA 3GFLA 5IYPA 1IHMA 4X6AJ 3EYYA 3CMMA 3HXLA 3CCRI 1G7TA 2L9RA 4MNUA 3G71B 1XX5A 1Q82D 3AVUA 2CU7A 2E34A 4UVBA 4YXWA 5DCMB 2ZZFA 1J5YA 5ICEA 4PGGA 4F52A 1UD8A 4HZFA 2CC2A 3AVYA 4MGRA 4PFPA 1YX3A 2I10A 5HODA 4LBWA 1TLHB 4MIMA 2R93J 1YO5C 3BR5A 5E3NA 2VIXA 2X53S 2VUMJ 1FBUA 1G3SA 3J80K 3HDDA 2GPJA 3ZQLA 2KISA 1UG0A 3AG2H 2FSWA 3ABUA 2KDZA 3F9KA 4AM3A 1SVMA 1IRFA 1OCPA 2FD5A 5H6QA 1WP6A 4O5VA 4BBSJ 2LVSA 3DDYA 2QBYA 5FIUA 3M07A 4B43A 3QU3A 1E3HA 5C44J 5J6XA 1IO2A 2CF4A 1W87A 3VO1A 5JMCB 1KQ9A 2W82A 2B9SA 2JRMA 2LLKA 2LMDA 3J81Z 4U0VA 3AG4H 2V26A 3WGGA 1MNDA 4ZDOA 2LDUA 1MW7A 2Q2EA 4ZYDA 2NTPA 4RB2C 4QIWN 2DCUA 4AC9A 4Z03A 1VQ7I 3GTKJ 3ZBTA 4HYEA 1KCDA 2Y0SA 2CW8A 1AIPA 4A3IJ 3D1NI 1ONVA 3SEQA 3TBIA 4EGYA 1FJLA 5CVVA 3AVTA 1YI2B 2MH9A 3C2BA 3V4GA 1HF0A 4JYKA 1WOOA 4TSFA 3CO6C 2F1MA 4KH3A 2DAOA 3MKWB 4ZYEA 4BE2A 1YJ9I 2GK7A 3SZEA 3IAS2 5FFZA 3H09A 4GYGA 5DS0A 3EQNA 1S72B 2KQRA 3V42A 2GJKA 4U4BA 3R61A 2P3MA 4Z4YA 4UZEA 5ILSA 1TC3C 1K5CA 2HXOA 3SEZA 3Q6RA 3VO2A 1NB9A 4ITVA 1KQ8A 1K4TA 3RPUD 5IP9J 3FKIJ 1JA1A 1OR7C 3ELKA 1MRZA 4RDJA 2CV0A 1XGMA 3QRFF 2EPFA 4LB5A 5K7ZA 2I1LA 2LKPA 5DUKA 1WOPA 1LFUP 1YHQB 3B73A 2DDBA 1E1QA 1O88A 1S7EA 3B02A 3ZQIA 4CCKA 1JT0A 4RMNA 4B1RA 3EQOA 3MKLA 5JLXA 3ZQGA 4HSTA 4UUSB 4XLFA 1BOAA 4IPAA 2ICWG 2BF4A 3J7YJ 1SFEA 1V5EA 1TQPA 1QG0A 3GQBA 1A6QA 2C4TA 1L3LA 4ZDPA 2L4MA 1V5VA 3K9TA 1QGPA 4XNFA 2ELJA 4YIFA 1KCCA 1SMYF 4V2GA 4LIVA 1VTNC 1BI0A 1GO2A 2D9RA 1JE8A 1X3ZB 1JRGA 4DGWB 5C4XJ 2DN0A 3JX8A 3H9NA 2O03A 3CMEI 3WNCA 1U2WA 2LR8A 5C3EJ 2IJLA 3BDDA 3I5UA 2FA5A 4TMXA 2UWMA 1Q81D 5LBQA 1UHSA 2Q1ZB 3OAAA 4M3GA 1GXPA 3GVAA 4H0EA 1B23P 4Q47A 4M6YA 3EDPA 2K9NA 1S9HA 2VOOA 4YAOA 4ZH4F 2HDDA 4YZQA 1JUMA 4X05A 3HL2A 2XAGA 4IKFA 5H5JA 2HQRA 3MZ8A 1QFZA 5ICCA 3I53A 1QRBA 2VNHA 2Y75A 1IN5A 1Z6TA 2CRGA 1K8FA 1LFPA 5GV8A 4MYTA 2RDPA 2EJRA 1XSXA 2FMLA 5LD2C 2QX3A 1I6XA 1KYWA 3BH4A 2Q6OA 3V76A 2RREA 1U8BA 4CYCA 4LK1F 1V54H 1IDZA 2ZO4A 2PLYA 4KIGA 1XTAA 4MQ9F 4C30A 4CCLA 3JTGA 4XRMA 3M9AA 1D8KA 3ABMH 1DUXC 4W8RA 3P9KA 3IAM2 2JVHA 1TL8A 1N05A 2OAZA 1VNDA 4PAAA 1VQLB 3PA1A 1QA6A 5EF6A 4E7SA 2LZJA 2XEXA 4ZZDA 2LKXA 2W48A 4XOTA 3OS0A 2X0KA 3BG7A 2WYRA 2BY3A 1J59A 4A0XA 2XROA 3M8JA 5HLHA 1JA0A 4YFXF 2KZGA 1I3AA 1WGXA 5L3CA 2KIFA 4HX7A 1UHWA 4M2LA 3K4CA 1ZRDA 3CC4B 2Q6LA 3TDZC 1WH7A 1APLC 1F9NA 2Y69H 1BC8C 1UB9A 2HI3A 1SD5A 1H88C 2GOXB 5BQTA 2KFDA 3GF2A 1YITB 5DDGA 1PXZA 3KPHA 3PQJA 5D6FA 3FXKA 4XBFA 2L5QA 2L3DA 3JSPA 2CRVA 3U2RA 3UR3C 5IT3A 4FCYA 4PC1A 3A2KA 1OKRA 1AWCA 1MMSA 2UUZA 3FBNB 4RAFA 3JRIA 1K4ZA 3TP3A 2DEUA 4CHUA 2GJRA 1IZ1A 1R58A 2W84A 1R5OA 2ZJQF 4WZKA 5HNHA 3L1PA 1V5GA 4MHGA 4HWVA 1OGOX 3W2WA 1X2MA 2ZZEA 3OYHA 5JVGF 2CQKA 3ZGKA 2L9SA 1U78A 3ZN0A 2PG4A 5L3FA 2ZL7A 3UW0A 2C6YA 3WG7H 3EUHC 1UD5A 2BM4A 4EATA 2NVTJ 1E79A 2PMUA 3FM5A 5B6IA 3F0CA 4BEHB 1MMNA 3MZYA 3GUDA 3E5XA 3GXOA 3KP7A 1FTTA 4A0YA 3BH6B 3G4SB 3AFHA 2Z3YA 5LFAA 2DJIA 3BWGA 3CF2A 2XZLA 3J7ZI 3TW7A 4B09A 2KVOA 4BGDA 2IGMA 4I76A 4A2UA 2OD5A 1H42A 3IV5A 2EIJH 4PZJA 2ZXWH 5F64A 5BSYA 1I27A 1V55H 4Z06A 3P5JA 1TYXA 2DMPA 2LC2A 3K1MA 1MDMA 1Z1DA 3GBGA 1O8DA 2CO5A 4XR6A 4Z4WA 2TCTA 4RGRA 5EJCA 2XC7A 2EZHA 2WTEA 2X85A 4DQKA 3HRTA 3CCRB 1JB9A 4OOIA 2M4GA 3RKXA 1NBMA 3NE5B 3QWLA 1T98A 2XNDA 4IHYA 2KT0A 4B8XA 3ISXA 1X1AA 2X8KA 2JJ1A 4G9YA 1DGWY 4ZCLA 2IGNA 4XSZF 1QGAA 5DYMA 2ISYA 3IP4B 1HDPA 1N07A 3BZ6A 5F08A 3DLAA 1TYUA 4DNRB 2ESNA 1I8DA 4PC7A 3AVWA 4II3A 3GSIA 1VQ9I 4IHSA 4A93J 2Y30A 1WWXA 3ZXSA 3DCFA 4Q4ZF 1RPWA 3OL4A 4PFOA 1YX2A 4M1KA 1FX0A 3B6AA 1A6IA 1R5GA 5M3FJ 2VBSA 4M9XA 1FMWA 5IYDJ 3HRMA 3OWTA 3CCVI 1HCRA 4JX6A 1PUFA 2WJVA 2PMHA 4XLPF 5EEAA 1GDTA 6PAXA 1KZLA 1WSRA 1VQNB 2K9MA 3CXCB 3BCAA 1D3YA 2CV2A 3AL0B 2R7OA 5HS9A 2QCOA 5ICFA 1TTTA 4L9TA 2DPDA 2PE3A 1IRXA 1WQ2A 5ILVA 2VBTA 2MG4A 3WGIA 2XSDC 5FNZA 1MMDA 2A6EF 3GO5A 3MAJA 3WE2A 1WZ2A 1MSEC 2RNGA 2DFFA 4GRIA 4JOMA 3VSLA 2ZBUA 5CQGA 3KL9A 1PE9A 4DW6A 4M9SA 3QP5A 1O57A 2XAHA 4C43A 5D4SA 1YJ9B 4RDLA 4G6TB 3OSGA 4ZTFA 5IYQA 1O8GA 1SFUA 3KP5A 2P5LC 1QJVA 1W7PA 3FY3A 3L9FA 4E0FA 2JWTA 2WBMA 3KZIC 2X9DA 4BJTA 2TDXA 4EM1A 2J5PA 3GWZA 3ASNH 3S1MJ 2EIKH 5F6FA 4ANJA 3WU2C 4C2LA 1RESA 2A3SA 2E2HJ 5A2QZ 2Y48A 1R36A 2JK3A 5E1ZB 2HKXA 2COBA 2MC4A 3JSOA 5FO0A 5E1WA 4OP7A 4Z4UA 1S6LA 2X4HA 1WVRA 2DXIA 1Z9CA 3U9GA 2YU3A 3I64A 4R8HA 2DBBA 1XCBA 4CYDA 4WXHA 1ZQ3P 1GJRA 2BM0A 3WY9A 3LOCA 4LMYA 3P4GA 1TT0A 4PJ0C 4HQEA 1EWYA 2M45A 1FWZA 1F20A 3RZDJ 2MH2A 3RDIA 2FOKA 2BVMA 4XKVA 4E7ZA 4F91B 2YUSA 1TNTA 3S16J 2R7UA 1KK3A 3CDIA 1LM1A 2AQEA 2CQNA 1P4MA 3VODA 3ZN1A 1UMQA 4ZZLA 4Y3OA 2W25A 1TWHJ 2BGCA 1XSDA 5FKNA 1TSPA 4XRSG 1R00A 1OOCA 4PJNA 4YG2F 1L1IA 4P1WA 3ZQCA 3OEEA 4HE5A 4J01A 2PMZN 2FOWA 2L54A 2M1BA 1E17A 5GPCA 1IG7A 1YJWB 3WG9A 1K83J 2ZTGA 1T0FC 2DOAA 3S3NA 2EFWA 1D1CA 3FXUA 4JX5A 1YS6A 4XLCA 4KKUA 3CC2B 3CP2A 2VLAA 2HOSA 1ZM3A 4FX4A 3Q3SA 1E63A 1FBSA 3SLNA 3LSTA 1VQ4I 3S17J 2M8EA 4KN4X 1UHMA 5CVJA 3X2QH 3A1PA 2L9VA 3ERED 3F21A 1PUEE 1TTYA 1UJ8A 2V7UA 1ZTRA 2DPUA 3F22A 4HX4A 1BI2A 2F43A 4RLQA 3RJPA 4V2FA 4L0ZB 2QE7A 3M4OJ 4HIZA 4ACBA 2QKLB 4IJAA 1IGNA 4A6DA 5D8LB 4IXAA 4LB6B 4EMSA 2EINH 4IEJA 1D1BA 2BM6A 1QA2A 3ASOH 1RKWA 3CJTB 3H5AA 3QODA 4I01A 3G71I 1MNMC 3FMSA 3AAFA 4XLNF 4A3KJ 1YRNB 4FXUA 4DQLA 1X1BA 2VXDA 4BDYA 3A01A 4LBZA 1H8AC 3OIQA 1T6YA 3KEOA 5TR9A 3KEYA 3OOCA 1WHUA 2P6TA 2XTYA 2F5EA 3AG1H 2X6OA 2VJIA 5IT9K 2B0RA 2CG4A 3VYSB 1RIOH 2XF6A 4FASD 2X6YA 3DPUA 3FWEA 2LOOA 3PJRA 2RVCA 5LRSA 2CUFA 2Y9ZA 1GR1A 3K6GA 3ZIAA 2VXZA 4Z4TA 3DTIA 5D5XB 2K4JA 3A02A 2D1HA 2DT5A 3OMYA 4M9ZA 5F1JA 2ZTNA 1OQYA 3V8KA 1SM4A 1F43A 3RYRA 3OS1A 4QV2A 2N8GA 4O6JA 5F0FA 3LSRA 3SQVA 1OJLA 3W6KB 4XD7A 3S8PA 3F8CA 3E6DA 3PUFA 4C2MJ 4YAFA 2PECA 3CESA 2HZDA 3BJOA 3RYPA 3MZHA 1N0VC 4CCMA 2K9SA 3AKZA 4ZCIA 2Q0OA 3RSNA 1ZG3A 4A5NA 5LEJA 4MTDA 1VFCA 2K86A 1IXRC 3GFIA 2V7XA 4HE6A 1YI2I 5DTDA 1W2BB 2WV0A 1FNBA 4IZZA 3KZZA 1O3RA 3DQVC 5IYBJ 1WRJA 4G6IA 1N08A 1BBYA 1CF7B 4P6YA 3SYTA 1KC8D 2GLOA 2NVUB 2DYSH 3WBKA 1S72I 2HTJA 1YTYA 4L5JA 3O6BB 3DU1X 3LSJA 4N9HA 3OR1C 2EIXA 3NB2A 2WAQN 4BY1J 2STTA 1H9GA 1P7IA 3G3ZA 2IW5A 2VPLA 1DDIA 3CJRB 1ZRFA 1HOMA 1O8JA 2CQQA 2R9VA 1REPC 3ZBUA 3OZUA 3ZMUA 4OMZA 1NK3P 4AD9A 2V6CA 2P4WA 3SJMA 2HCJB 2OYNA 3WXMA 3BZKA 5K5OA 4WCGA 2RKHA 4FK8A 1OFCX 2P5KA 1SANA 2GA2A 3T5XA 4BQQA 3BCDA 2DA2A 2HFHA 1DP3A 1U5TA 3SKBA 2CS3A 1FOYA 2DA1A 3DU6A 4ZCMA 3TP0A 3TO7A 4HLXA 4HDUA 1BIAA 4II2A 5TV2A 2HDWA 3U6KA 1K61A 2DK5A 3FXMA 3ZRGA 2VQLA 4F3QA 1XDSA 5C1CA 1IN4A 2OBPA 2QM3A 3HOSA 1FDRA 2KJBA 4BBRJ 3GQ7A 1VBLA 2KHMA 2W4SA 1VQ9B 2QZAA 1E1RA 2Q8KA 2HVQA 4DIQA 3RI4A 2WR8A 4F7DA 2K5CA 4RD3A 2EA4A 5HLTA 3DFGA 2DTZA 4LGWA 3J80Z 3GTOJ 4ESJA 4WXCA 4OAZA 3ZQHA 1UD6A 3J81k 4OZYA 2NTQA 3LO8A 2A68F 3ML6A 4PCQA 1NTCA 2CJJA 4W1UA 2O0WA 4OWRB 3EUAA 1YX5A 2DYIA 3BY6A 2A69F 4A3BJ 3K70C 1JKRC 1HXDA 4OOXA 2EV0A 3BG6A 3E3VA 2ELKA 1EXMA 1FIPA 1G3WA 1RETA 2CNDA 5K5RA 2IPQX 4ZV4A 2R7FA 2IA1A 2YU9J 2DT7B 1G2HA 4L5EA 1TWGJ 4AIDA 1D5VA 3OYEA 3TH0A 1IAWA 2V7WA 2M8GX 3GQAA 3ZMSA 1QQ1A 1TW3A 4LLNA 2DFHA 2RC4A 2HMAA 5HVQC 3NWTA 5CQEA 4QUZA 3VSKA 2E1MC 2VJ5A 1G7SA 1Q86D 1O8FA 2R4GA 1NJID 4Z2YA 2DMNA 3OW7A 1TQMA 2H6CA 4PDKA 1MNEA 3HUGB 5E3LA 1R23A 4HF1A 3KIOA 1IB0A 2DETA 2ZJPF 3I58A 3S1QJ 4BQAA 1G6NA 4ON0A 1ETOA 1LVAA 4RGUA 2H1KA 2NS8A 1X1DA 4Y7CA 4UY8I 1PJ7A 4RBOA 3A0BC 2B5OA 1WJCA 3OY9A 3JQRA 1D1AA 2EZLA 1F60A 1Z3YA 5DUIA 3CC4I 2K3FA 3S93A 2JA8J 2BX6A 4OZZA 3OYIA 4Q7JB 1HSJA 1UELB 1GLNA 4KN7X 4QTRA 1YITI 2E36A 2ZMEA 1O8IA 4RPDA 3FISA 3DPLC 3M3YJ 2M34A 3H5NA 4ETSA 5FLMJ 2L7ZA 4XKWA 5LLQA 4UB8C 3V7RA 2FMYA 1MZBA 1WJEA 3D0SA 2A07F 3SLDA 3H1CA 4XIDA 5EG0B 1T56A 4XMYA 1J75A 2FX3A 4P9UA 4KKSA 1BJKA 1BHEA 5EGOA 1PP7U 4UAJA 3HIFA 2K27A 4DBRA 3RTRA 2LTPA 3JRGA 1R49A 4PGOA 3W2GA 4EH1A 3ZQFA 3COAC 5KW9A 1HW5A 2L7FP 4AVZA 2NZMA 4WQMA 3T9GA 5J4YA 1T8IA 3T8RA 2NYXA 4Z4RA 2XZPA 1W5SA 2JTVA 3GX4X 3WHCA 3DTKA 4YCQA 2JDIA 2ZJ2A 4BDZA 1ZLKA 1QHHD 3KP6A 2DOFA 1QRCA 2DQRA 1IXCA 1K78B 4S05A 1VHOA 3MMPA 3ZOBA 3G4SI 1I1SA 1O8HA 4WX9A 2JUGA 2M87A 2WA0A 5DCMA 1QUFA 2M7BA 4M73A 4CO8A 4ENMA 3CMYA 2E2IJ 3GQ9A 2OJED 2BY1A 4HQMA 3IL2A 5AN9A 2E1MB 4BXXJ 3SZTA 2DQLA 1LPQA 4F92B 1Y8RB 1A5JA 4EJOA 4U0YA 3H35A 4OJ5A 3QQAA 2LRDA 1NG7A 1SVOA 1TQIA 1I39A 2QENA 2VJJA 2QKMB 1R5NA 3L2RA 2PLFA 4RD2A 3GVLA 1EV7A 3GMEA 3B78A 1QNTA 2QQ9A 3PQKA 2DJNA 2YR2A 3DBHB 2R7DA 2Z2SB 4IOCF 2C78A 2XNCA 1HQCA 2LREA 2EFPA 3F8BA 4GCVA 2JIZA 4RB3C 3ZC3A 4AIHA 4UUTA 4LG0B 2ZJRF 1P6RA 5B66C 3OOUA 1A36A 3Q3AA 2KJCA 2L4AA 5AONA 3OYAA 3HPHA 2R7VA 3LWFA 1EFTA 2Z9OA 1R5BA 2JJ7A 2OU2A 4UV9A 3WU0A 5E3MA 1WOSA 1ZAOA 4U7DA 1RRJA 1RUNA 1EFCA 2PFBA 2O1DA 2YX4A 1BI1A 1JTXA 1QZZA 2XB5A 3H3ZA 3ABTA 3CPWB 1BN8A 2VASA 5CVUA 1K4SA 1DPUA 4TV7A 1IDKA 1OYWA 1SD4A 3BJ6A 1WORA 1TP4A 2Q6KA 4HA8A 1J9ZA 2IOUG 5FLXK 4AF6A 2ZITA 4P2NA 3HGGA 1T08B 3S3MA 5IYRA 1FMVA 1RR7A 2PQ8A 2ZFUA 4A3LJ 1IDYA 1RZ4A 1MBJA 3E5UA 3EUKL 5A89A 1JUSA 2XPVA 3JRHA 1WDTA 5CKTA 2INVA 4AU7A 4F93B 4OIPF 1VQNI 2BW3B 5FKMA 3JU4A 4A5MA 5IYWA 1N25A 4BY7J 2G0YA 2CQ7A 1EFRA 4JQFA 1XS9A 3G1OA 2OZUA 2M2EA 4EW9A 4A3FJ 1YIJI 3ML3A 2VFQA 1WFXA 1R4NB 4JP0A 4EM2A 2IS4A 3H9GA 3OJXA 4LITA 4R1HA 4BUPA 1G59A 2VT3A 4C3HJ 1MBGA 4DYCA 5HXBA 3ZPPA 3H36A 4P12A 1ZELA 4P96A 4C2UA 1N8RD 4TN1A 3HSRA 4AUXA 3DEEA 1S5LC 4AYBN 4UUSA 4I98B 1LB2A 1Z77A 1I7PA 3BQJA 2JA7J 4DZJA 5LEKA 4CSWA 2IVMA 2ETHA 2JUCA 2G7UA 2JMWA 3U21A 1YG2A 1CLWA 3N6ZA 3BG9A 2NVXJ 4TKOB 1JUPA 2HOEA 2X1EA 2GM4A 2HYGD 2MSYA 5FKLA 3PNVA 3I0TA 2XGXA 1CGPA 3HOYJ 4Y9UA 3V7AA 3DKWA 3K4LA 3SXYA 2DDAA 5DNSA 3HOZJ 1OLTA 1YIOA 2IP2A 3DBRB 3T8TA 1S7AA 2XIGA 2NS0A 5TGTA 3E97A 5LGTA 2RC6A 3F6OA 2DYRH 3IUOA 2BVLA 3HPGA 2YWGA 1YOVB 2K3PA 1DG1G 1WJAA 1YLOA 5EZHA 1E2XA 4OIRF 2R3SA 3HKZN 4ESFA 5DV5A 3FXRA 4XKBA 2AQFA 2NXNB 2EILH 3MQ0A 2LH9A 3LSHA 3H5RA 1W4MA 3VB2A 4RS8A 1EH7A 3ULQB 4NUBA 3ZR8X 1I3QJ 2E5ZA 4CCOA 3QYFA 4ZJZA 3I55I 2ZCWA 3VPRA 2C2WA 2WPDA 2Z6BD 2D5VA 3SUCA 5CJ9A 3PA2A 4UZFA 4Y9RA 5AMVA 5D4RA 2M3AA 1FPQA 1T6SA 1B8IB 3ZMTA 1YJWI 3BROA 9ANTA 2CK3A 2NAZA 1SD6A 2OCCH 4J0QA 4HNTA 4X0GA 4PGHA 1IXSB 2MA3A 4M4SA 2AS5F 1GVJA 2GZWA 2L02A 2BN4A 3CC2I 2WADA 3PIOF 4IRIA 5FO1A 4B3GA 1BM9A 1WPKA 2DT6A 2QVOA 4EJUA 1IRGA 5J35A 1U9OA 2ZKZA 3HYIA 3JQQA 3OPOA 2E60A 4G8XA 1HKTA 3PFYA 3VNVA 3GQ8A 1B4AA 2LBFA 2LFBA 1BQEA 5L3DA 3GTJJ 4W8TA 4EVIA 4WF2A 3N05A 2BM7A 2FNPA 2QA4I 2GQFA 3WNBA 5K7FA 5GADJ 1QVTA 5JLWA 3RKYA 1K79A 3MD2A 4KNYA 1X2NA 1YW8A 5FB2A 2INUA 3CQZJ 3CW2A 1P92A 4IW3B 1KU9A 4NK8A 1MD0A 1YQAA 4PC6A 2WY8Q 4I7HA 4YFKF 2WZNA 3VMFA 3W2VA 3D26A 2ZFWA 3CCEB 2FBKA 1ZK8A 2M5SA 3JAMK 2OK8A 1QRYA 3NEUA 1W36C 1OFEA 3FBIB 4IX7A 3RPUA 4G6DA 2R0QC 1D0ZA 2V7FA 4E70A 2P81A 1IW7F 3WTZA 3DPTA 2K40A 3FMQA 2MABA 3K1NA 2BPOA 1WJ5A 2X3UA 5IY5H 3F8MA 2QMUA 2BBYA 2EQRA 1ZN2A 4LIUA 4RM2A 2XAJA 3SQNA 4I2OA 4N0BA 1JJ6C 1WI3A 1LNWA 4UNOA 4ZGNB 4X07A 3NQOA 4M0LA 2CUEA 4KT6A 3I4MJ 1IUYA 4PC2A 1PLUA 2YWEA 2DMQA 2VB6A 2XASA 5E20A 3ES9A 3CCJB 3CUQC 4IO9F 3LSIA 4KFCA 1VQPB 1EP2B 1KQSB 3KE2A 4BEHA 3K4JA 2HEOA 3V8JA 1Z7UA 3GTGJ 5LGUA 5JBQA 1D1NA 4Y17A 3GTLJ 1FZPB 1TUIA 4IRGA 3MKZA 5IOYA 3JRAA 2O6GE 4V02C 3ZPLA 3A3GA 2DA5A 4KUMA 1LKXA 3H3VK 5D5UB 3H3UA 1X3WB 2FNAA 3N97A 1IV6A 3W5HA 1UD4A 1N78A 1OISA 2PMZA 5B1BH 5LGNA 2X0LA 2VQGA 5L3BA 3AGQA 2P5VA 3F3XA 4WZEA 3N90A 1ODDA 3FKSA 1IC8A 5JI6A 1Y6IA 2QTZA 2R92J 3HOVJ 1F36A 1HC8A 3PNYA 1Z7LA 3ABLH 5LHGA 1D0XA 4UUVA 3LFKA 2NV4A 3RIQA 3WYAA 1VQ6I 1DGRM 3MKYB 1U0JA 4RDKA 3WQZA 1J0RA 2MFZA 3R4KA 2R5YB 3OE7A 4GO1A 2EBIA 3HSFA 2M30A 1LEAA 2H94A 3K7AJ 1A8PA 2Y0SN 1LUJB 2OCEA 3E1YE 4OJPA 2NTBA 2DOEA 3CCLB 1TZLA 3ECHA 4G7HF 3G6EI 2V7TA 3OIOA 1QVFB 5FFXA 2D3NA 5JHUA 3K1PA 2XSJC 5JHFA 3FPKA 1STZA 3BPVA 5AIQA 2LY9A 1P4XA 2Z5UA 4X06A 3P9CA 3OV8A 1FTZA 5J47A 1KZHA 3K10A 1LLWA 4Q48A 3ZMZA 2W1OA 4KMUX 2CWEA 4ENJA 2R7WA 3BJAA 3IC7A 3DXJF 2M0MA 3BC9A 3CMAB 3ASSA 1M1EB 1JHFA 3I4PA 4BXUA 1ZREA 1EZGA 2FJ1A 3CUQB 3L00A 1T95A 1FIAA 3IKTA 3B4NA 4RCYA 4I0AA 4G7WA 5C4JJ 5F4JA 3DU5A 2PX9A 1DBGA 3U6BA 4NC6A 3DKXA 3OYFA 2VI6A 1KK0A 1KTWA 2X1CA 3H9JA 3MCZA 3F23A 3PFIA 3DKYA 4GGGA 1SEUA 5IT9Z 1CNEA 3LMWA 1B72B 2EB7A 2F4NA 3ZMDA 2IA0A 1X58A 5J8FA 3WTVC 1RNLA 4OU0A 3AG3H 2ACJA 3QFTA 3M1CA 3GFJA 2HS5A 4DK1A 4XN3A 2IRFG 3BR2A 4R79A 3P26A 1XD7A 1ZGJA 2LY1A 2MLKA 3C7JA 1OGIA 1QH0A 1WSVA 2VNKA 5HNFA 1CQXA 1IA5A 1QPIA 1YIJB 3LSGA 3T1BA 1O3TA 3RIRA 2VNIA 3S1NJ 4M53A 2F5FA 3C2GA 2J7KA 1DBOA 1MJBA 1MMGA 2FRHA 2GXGA 1U8RA 5HDKA 2GXBA 4XQFA 1FOXA 1S0UA 2E5NA 3I59A 1ZH5A 1FEXA 2XDVA 1X1CA 3CLOA 3JR9A 3ECOA 4YC5A 3QYEA 4AIKA 2B0LA 3CTAA 1JT6A 1BI3A 2LNBA 2ZBKA 2XV4S 1QGZA 2BM1A 2ODLA 4D5FA 5EDNA 1FNNA 2KDOA 3LFUA 4D7MA 2PEXA 1QBJA 5F4OA 3H0GJ 2DTRA 1BW5A 3W2AA 4N3GA 1FBQA 4G5GA 4FWTA 2OF7A 2HU9A 1SFKA 1QHGA 2OTJB 3TDUC 1MBFA 2OZ6A 5TISC 2NOGA 3BOQA 4I99C 5DD8A 5CPRB 5E8IA 1F4KA 3Q9SA 4U49A 2CW7A 2BMWA 2DFEA 3TO9A 3GW2A 1T6XA 2BOLA 4A6EA 2P8TA 1K9MD 4KT5C 1MABA 3I1FA 4QVAA 1Z05A 3GZ5A 3BR1A 3KFWX 5K5QA 5E3OA 3ASRA 1LLZA 5M3MJ 3LQ6A 1SVLA 1BR4A 3CCMB 3FDYA 2LYCA 1ZUNB 1SAUA 4N4NB 3ZZUA 3GLXA 2O7OA 3WU1B 3LQQA 4I6ZA 5IPAA 5F4MA 5EEHA 1O8KA 1D5YA 1QU3A 1USSA 2VBUA 5GAGJ 4PMHA 5DD4A 2ISZA 2IS2A 1KU2A 3BT9A 3DV8A 4I0BA 4Y13A 1QFYA 3SEJA 3BP8A 1K6YA 2VBMA 3PL8A 2XUBA 4M3FA 5D5VB 2R6HA 2MGQA 2VBVA 4M3BA 3I55B 4NBQA 4GYIA 1LDJA 2K9LA 4MLOA 2K4BA 4KIBA 2L9NA 3CB4A 1VQKB 2V1XA 5KK1A 5FA6A 1Y39A 3SJPA 4P5OA 1LJ9A 2RNJA 4ENKA 1FX7A 2BV3A 4QVJA 4I84A 3K4MA 5CYVA 1YFHA 1H8HA 1FNMA 4ASNA 2W6JA 4HPQA 4S04A 1BA5A 5F27A 3E0JB 4RLZA 4RLFA 3QPLA 4ACAA 2QF7A 4M6VA 1KONA 3R0AA 4ZYAA 3TOBA 3AVXA 1CZFA 2VBKA 1YRNA 1R71A 1RKTA 1C0WA 2L7KA 4MR0A 4URRA 1TT5B 2QA4B 3WTXC 1M1KD 1IUFA 1VF9A 4RD4A 1VQ8I 5GPAA 3JTHA 2YWHA 2V7VA 1B6AA 1POGA 5DN6A 4UVAA 1ON2A 2JA2A 4CZZA 3QOPA 1BC7C 3FXQA 3RQIA 2VJ4A 5B1AH 3RKQA 3SHFA 3K4KA 3U1DA 3F72A 2OK7A 3MHPA 3AVVA 2GIZA 4DOZA 4BACA 2BHYA 5HKKA 2VE8A 1HKSA 3WE3A 1R9TJ 1GAWA 2EFGA 1T2KA 1R4MB 4CUGA 3ONYA 1R1UA 2BE5F 2ZXHA 3W2IA 1OYYA 1I50J 4LJZF 5J40A 5HLGA 3KP2A 4TMZA 1QO0D 3KCCA 3OR2C 1SFXA 1T0FA 3I54A 2O61A 1E62A 2DERA 4OAYA 2PYHA 4IQ4A 2R7RA 1MGTA 3DWLE 3KP3A 4DJAA 4OOVA 2O17A 3BY2A 3CD6B 2F6CA 3BTIA 1XB4A 2Y31A 3DF8A 3OL3A 3PNTA 2NSTA 1VHEA 5J1UA 1FNDA 1R7JA 2IQ7A 3BTLA 1IN8A 1SC7A 1QVGB 4XOPA 2PJRB 2V1UA 3J7AY 4JMQA 1RC9A 3GVKA 2MYSA 2OUMA 1S3JA 1CF7A 1K7AA 2VBEA 1LE8B 2WAEA 2HQ5A 5GV7A 4LK0F 5CLSA 3I9V2 3PUBA 4Z6YA 4KIFA 2ZBVA 5JLVC 4EV0A 5E18F 1X19A 1SKYB 2W85A 3GZ6A 4P26A 1ETYA 3FM3A 4EJWA 5ICGA 1X1PA 1HA3A 1KJZA 4D0PA 4Z4VA 1LQ1A 4KISA 1KTVA 3KEQA 4YZAA 1N0UA 2FBIA 1K8AD 1PKVA 1WKMA 2V4JC 1QZYA 4HSRA 1Q7YD 2OC6A 2FX0A 4W97A 4RAYA 5HLIA 1GHCA 1P4WA 1VQ6B 1WJBA 2K02A 2WAFA 3REOA 4BHBA 2QY1A 1EF4A 2HQNA 1IRZA 3GTPJ 3KEWA 5L46A 1U5TC 2RN7A 3LMMA 1JKQC 3H9QA 4FQGA 1E3PA 2ZSIB 2KZVA 1QPMA 3JURA 1IN7A 2DOGA 1O7LA 4E7LA 2W7ZA 4HBLA 3SFIA 3FHNA 3HC7A 1BPLA 4MQVA 3HJEA 3G6EB 1ACIA 4BNCA 5J8CA 2B63J 4PUSA 1GXQA 2ZZQA 5LRRA 1Y56A 1DP7P 2XF7A 4WK8F 4ZC3A 1FP2A 1BOBA 2IXSA 4MTEA 2BXYA 5LHHA 1H0MA 4RAZA 4YIIA 1XMXA 3K0LA 1YLFA 2P7CB 2YS9A 4Y52J 1H80A 2NNYA 3K70D 3RZOJ 4N9IA 4A3JJ 1XMAA 4C3IJ 4HF0A 1UD3A 1HF2A 1HG8A 3QPHA 2QQ8A 1AU7A 2D1VA 2FE3A 2VODA 4BE1A 2H1LA 2W57A 3FK6A 3MCAA 1H8EA 4IHTA 3NAWA 3L2CA 4M3DA 2Z99A 1WSUA 3LQEA 1FC3A 3MEXA 2ECBA 1O3QA 2EIMH 1PVEA 3SZGA 3BG3A 1G4DA 1JJ2B 4B3XA 4L9JA 2MLGA 3ISPA 1S29A 2QEXB 3HGYA 1K6OA 2CMPA 2VT2A 1A04A 1V3FA 3DBLB 2UXXA 4K1XA 2GA1A 2AHOA 5BPDA 2XTWA 4DQ2A 3ZP5A 3VYRB 5CDFA 2CW5A 3ERMA 3P9IA 5FLXZ 2VE9A 3HTSB 2VYQA 1FOWA 1KRHA 2V9KA 1TW2A 3M7GA 4X7DA 1H85A 2DA7A 3OYLA 2XHKA 2HYFA 3HUGA 4FN5A 1MKMA 1IJFA 3CCQB 2XRNA 2WWYA 1ETXA 3IH4A 4NB5A 2VFPA 5GTHC 2VBYA 3SDGA 1OB2A 3QFSA 4BQOA 1E43A 1EP1B 4YAWA 4QLCU 3HM5A 1BR1A 2KP6A 3C3WA 2ME6A 4RD0A 4KICA 1OPCA 1IF1A 4E7KA 4OM9A 2BY0A 3OS2A 3D5SC 3A8JA 5JVTA 2BSAA 4ENNA 1DDGA 1HLVA 4K2EA 1XN7A 1UMKA 2STWA 3QPTA 4Y7NJ 3KLOA 3HB9A 2Q6IA 1CQTA 2QSFX 1JXSA 1XPXA 2OQRA 2ZMEC 3CCEI 4NC7A 4XLEA 1XE1A 3U2QA 2W24A 3LJYA 5J3OA 3E5QA 1GUUA 1IV8A 3V7CA 4J00A 2HOTA 5E79C 1LDDA 2AHQA 4AWXB 5EG0A 3OZWA 4P55A 4RB1A 2AO9A 2CFOA 1O4XA 3E6MA 1R5ID 4D1QA 1G7CA 3LNNA 5DM6F 3OYBA 2XAFA 1VQ5B 4IVNA 1DQUA 4MO7A 4ABZA 5IP6A 3L2VA 1WCMJ 2F4IA 4D7NA 1E3OC 2EK5A 1NK2P 3PETA 3CCJI 3VMWA 1YE9A 1EE6A 4L18B 1VQPI 3P27A 4GQNA 4NQWA 1TWFJ 2W00A 3HKZA 3VR6A 2X48A 4QFMA 2GAUA 1K78A 2WSSA 1NRKA 1W0KA 4CGZA 5BSXA 2DMUA 3L7WA 3LNQA 3KETA 1USTA 1ZHFA 2PJPA 2MW8A 2A05A 2ESHA 4RGXA 3EQLF 4A3MJ 1IJWC 2XT4A 3RY8A 1Y0RA 3J7AO 4NBSA 3R6KA 1VZ0A 1G7RA 3TOAA 5FRNA 1OYIA 1MH3A 4NC8A 5H6RA 4ZGQB 1SFOJ 2VKDA 1Z0XA 4Y4RA 3PVDA 4H9GA 3VYUB 1AKHB 4OMYA 2ME0A 4PJLA 2NRAC 1V0EA 5D5WB 3HEFA 3W2EA 1ZARA 4LG0A 3OOPA 2R5ZB 2CUJA 3IHUA 2H27A 4LLGF 2V6EA 4B4DA 3K69A 2VKEA 4KKTA 1ETVA 2PI0A 1B1BA 2BV6A 1J7KA 2OA4A 4J19A 3ESWB 4OINF 2EWEA 2L2OA 4WWCA 1VQ8B 1OFLA 1U3EM 1DU6A 1QUEA 1YJNB 2D2WA 4L9NA 3CCLI 1MBHA 2O0VA 2ZNYA 1JKPC 4RCZA 4PSXA 1H89C 3ZPNA 1M90D 1FSEA 4MEYF 2GIVA 2OPTA 1V0FA 4U0WA 3G1MA 4V19K 1MIJA 1MBEA 3WODF 1ELOA 1D2EA 2NVYJ 3Q9VA 4HX8A 2FUG2 1Z67A 3ASQA 3B8YA 2G7HA 2F4OB 1B59A 5HZBA 1VQOI 2KIUA 4HRIA 1ZR2A 5HOOA 3CMAI 1QZEA 2BW3A 3BR3A 2E7WA 3HOUJ 5FL7A 4XKCA 2XB0X 3KYCB 3JAMZ 1ZM9A 2BY2A 4RD1A 1ZM2A 1XGSA 2QYOA 3QPSA 1Q1HA 4X7EA 3OYMA 3SZPA 1OCOH 3NARA 2BGJA 3CCUB 2CV1A 2R7ZJ 1LEBA 5IYCJ 1KK1A 3VWBA 3BY1A 1OB0A 1YW9A 2CSOA 2JT1A 4LBYA 5D8KB 4X1EA 2A61A 3EYIA 2KRCA 3BCFA 2MD0A 2IAIA 3LSKA 4UZUA 4S0HB 5K7HA 4HNUA 4U7BA 4GFBA 4XSXF 3PO3J 3I4NJ 2ID3A 3GEZA 2B7BA 1RWRA 4F7ZA 1JGGA 1MJ9A 3VEPA 3GVJA 3A1YA 2LG4A 1YYVA 2V1NA 3RKWA 3ROUA 1IB4A 2WC2A 2F4MB 3S3OA 3WTUC 3HHGA 5TY0A 1IJEA 1NHAA 2BEOA 4P3YA 3KYDB 3WTTC 3H0DA 1O3SA 3LQRA 1HVXA 2VONA 2CUZA 4CCNA 2WB1N 1ZYRF 1ZLJA 2BM5A 2XVCA 1Y1WJ 4TMVA 1JTAA 2TRTA 3S2WA 4PSWA 2X6WA 4G7XA 2PYGA 1KU7A 4U88A 2COMA 4G6QA 4UHTA 3R6SA 2V31A 4A3DJ 2P7VB 2UVFA 2FU4A 2HVRA 5DEQA 5HZAA 1SD7A 3NWSA 2HXIA 2JRTA 2AXTC 2YPRA 3A35A 2OTJI 2C5BA 5ILUA 2ZNZA 1ZM4A 1XDUA 2CW0F 4ASUA 5B3SH 2VC1A 4LG3A 2QBYB 1K28D 4QPQA 1QA3A 3GCMA 1NG6A 2XGJA 1VI0A 2NOJB 5L3GA 3LSPA 2R7XA 3FPPA 2XGDA 1VQMB 1ULYA 2A5YB 4CCJA 2Z33A 2V4DA 3HBLA 2DFIA 2BZTA 3VDXA 4E7JA 3T53B 3CCMI 2QSGX 4BL0B 3GFMA 4FETA 2L01A 5AIPA 1B8IA 4OIQF 2NVQJ 5FROA 3OP1A 2XC1A 2Q2EB 3LL7A 4C3JJ 4OPSA 2OV7A 2Y9YA 2HGCA 3FF5A 5IP7J 1VF7A 4H4KC 4A3GJ 1TNSA 3CF5F 1JKOC 2ZL6A 3BR0A 2BSPA 4YZXA 1NHCA 1EA0A 1BJAA 3GYHX 2M0CA 1WXRA 4NCNA 1D0YA 1OMIA 1BW6A 2ZC2A 4HLYA 4RJLA 2V7QA 3GZNB 2E19A 1UZCA 3V7SA 3KYLA 2GXAA 1GT0C 1VQKI 4Z1MA 1TBXA 2A5WA 1GAQA 3DEWA 3GTQJ 3OSFA 3AGPA 2JPCA 2JA5J 3TL4X 4B3AA 5A88A 1W36D 2DK8A 4PJJA 2PIAA 1MSFC 4YHBA 3ONQA 1OR7A 4MEXF 2EH3A 2NT9A 2VBZA 3QSYA 1S7OA 2QGGA 3N4MA 2XKOA 5DCFA 5FKOA 2JPBA 2KIMA 3KRGA 3KX2A 4IQJA 2W7NA 1KU3A 3TGNA 4OOSA 1UG2A 1WI9A 2QQAA 4U9UA 4KMFA 2VPRA 3V8LA 3SY2A 4DBQA 2VN2A 3O3KA 3B82A 2L0KA 3PO2J 3PUMA 2RV8A 3QOEA 3R60A 3JCUC 4ROXA 4RD6A 3TEDA 1PP8F 3BC8A 3BZCA 2E1NA 1Y0YA 3ZMVA 2V79A 3JW4A 2UZKA 1ZG1A 1R5HA 3I56B 3VNUA 1D8JA 3F8NA 1XGOA 2M7AA 2XAUA 4BJ6C 4ZYHA 3L2WA 3Q6QA 3LAJA 3OEHA 2F48A 1UFMA 4XN0A 2O5RA 3GLLA 4E4HA 4QSHA 2A6TA 1HA8A 1XSVA 1RQPA 1WH5A 2C5HA 1P2FA 4RM0A 2MBFA 4AF7A 1HW2A
chains in the Genus database with same CATH topology
3CMMA 3HXLA 1BR4A 2R7SA 3FDYA 4BQQA 2LYCA 4XL9A 1SAUA 4N4NB 3BCDA 2HPMA 1DP3A 4YXWA 2ZZFA 2LBFB 4F52A 1BMFA 1UD8A 2CS3A 3DU6A 4PFPA 4BS9A 1YX3A 2HQAA 1QU3A 2DCEA 4II2A 4PMHA 1KMHA 2HDWA 2IS2A 2VIXA 2X53S 2X51A 3ZRGA 1K6YA 2VQLA 2VBMA 4F3QA 3PL8A 3HOSA 1UG0A 2HPIA 1RMGA 1VBLA 2KHMA 3GQ7A 2W4SA 2K9LA 4MLOA 4KITB 2L9NA 3F9KA 1E1RA 2HVQA 4DIQA 2K5CA 5HLTA 1WP6A 4OJLA 4P5OA 3DDYA 4OAZA 1UD6A 4B43A 4OZYA 4I84A 3K4MA 2NTQA 3CZ6A 1H8HA 4BJ5C 2W82A 2W6JA 4HPQA 2O0WA 3VMVA 3VSVA 3E0JB 1LVKA 3EUAA 4OWRB 2V26A 1YX5A 4RLFA 1MNDA 3K70C 1KONA 4ZDOA 4CA0A 1E3XA 3BG6A 1MW7A 2NTPA 4ZYAA 1N77A 1CZFA 2VBKA 2IS6A 4Z03A 1BLIA 1KCDA 2Y0SA 2CW8A 2L7KA 4MR0A 4NK6A 4URRA 2DT7B 3SEQA 3TBIA 2XZOA 3OYEA 5DN6A 2JA2A 3AL0C 4TSFA 3E1SA 3GQAA 2F1MA 5C1CA 2KRHA 3MKWB 1P9QC 2VJ4A 4BE2A 5HVQC 3NWTA 3IAS2 5CQEA 3K4KA 2GK7A 3VSKA 2E1MC 2VJ5A 1O8FA 3EQNA 4DOZA 2R4GA 4BACA 5HKKA 4U4BA 2KQRA 3V42A 2GJKA 3OW7A 1MNEA 3HUGB 4CUGA 3SEZA 2NSPA 1K5CA 4BE0A 2ZXHA 2Z16A 4BU2A 4Y33A 4ITVA 3TMOA 4PJMA 3RPUD 1O8EA 1OR7C 1X1DA 3OR2C 1E0EA 1COWA 2CV0A 1WJCA 3OY9A 2KLOA 4OAYA 2PYHA 1D1AA 4IQ4A 1Z3YA 2R7RA 4DJAA 3DWLE 1EA3A 1E1QA 4E6KG 3S93A 4B48A 2O17A 3VSTA 4CCKA 3T51B 4OZZA 3OYIA 3A3BA 2F6CA 2NSTA 4RMNA 3OL3A 3PNTA 3EQOA 1UELB 1GLNA 1O8IA 1VJSA 4HSTA 1WTHD 2IQ7A 3DPLC 4XLFA 4C9YA 1O8LA 4F55A 4QPOA 1V5EA 3H5NA 4XOPA 2PJRB 3J7AY 3GQBA 4JMQA 4XKWA 3GVKA 2MYSA 2OUMA 3QYBA 3K4BA 4B44A 3OYGA 4ZDPA 1WJEA 2VBEA 4XNFA 2ELJA 1KCCA 4KJZA 4XMYA 2D3LA 2GK6A 4KKSA 2WAEA 4LIVA 1BHEA 3I9V2 3PUBA 3RTRA 4DBRA 1JRGA 4DGWB 1SKYB 1X19A 4YRVA 4AVZA 3BCBA 2NZMA 3T9GA 4KISA 4YZAA 3VSUA 2UWMA 1PKVA 2XZPA 1WPCA 2V4JC 4HSRA 4PK4A 2OC6A 2Q1ZB 3OAAA 3DTKA 3OYNA 2JDIA 4BDZA 1QHHD 3H94A 2DIEA 1S9HA 1GQ8A 4YZQA 1WJBA 1O8HA 2KPMA 2WAFA 3PSFA 3HL2A 2QY1A 4IKFA 2JUGA 2WA0A 2WAQA 3KEWA 2M7BA 4CH7A 3GQ9A 1Z3XA 3LMMA 4B3FX 2E1MB 3H9QA 1LFPA 2KZVA 2ZSIB 4F92B 3JURA 3DTEA 2QX3A 3H35A 4E7LA 5LD2C 4Z05A 4OJ5A 2LRDA 1NG7A 3BH4A 2VJJA 3FHNA 3HC7A 2RREA 2QKMB 1BPLA 3L2RA 2I8DA 3GVLA 3OYKA 1W0JA 3CP8A 4PUSA 4C30A 4CCLA 2ZZQA 1Y56A 2XF7A 2Z2SB 4ZC3A 2IXSA 1BOBA 1X0CA 2LREA 1OFMA 2JIZA 4W8RA 4W8TA 3IAM2 3OOUA 2JVHA 3OYAA 3K70D 2R7VA 3HPHA 1H80A 2P0WA 2UVEA 1UD3A 1HG8A 4E7SA 2LZJA 4XOTA 3OS0A 2JSPA 3BG7A 4BE1A 2O1DA 3M8JA 1ERDA 1H8EA 1BN8A 2VASA 4C2TA 2KMUA 3K4CA 2XNDA 1IDKA 1N75A 3SZGA 4DNTB 4B3XA 2GOXB 1WMRA 2CMPA 3S3MA 1FMVA 2ZFUA 1PXZA 1V5FA 4XORA 2L5QA 3VYRB 3EUKL 3GRHA 5CDFA 4P22A 3UR3C 5CKTA 3A2KA 2XF5A 2INVA 4AU7A 4F93B 2UUZA 2BW3B 3FBNB 3JU4A 3G05A 2V9KA 2GJRA 3SDBA 1EFRA 4JQFA 5HNHA 3OYLA 4EW9A 1V5GA 2QXZA 4HWVA 1OGOX 3W2WA 2ZZEA 3OYHA 1WFXA 2IS4A 3H9GA 3ZGKA 2L9SA 4LITA 1W9XA 4BQOA 4BUPA 1E43A 3HAGA 3UW0A 1G59A 3EUHC 1UD5A 1BR1A 2KP6A 4EATA 1X4PA 4XM3A 1E79A 3ZPPA 4E7KA 4BEHB 3OS2A 1MMNA 2R7TA 3D5SC 1ZELA 1WJDA 4C2UA 2JJ2A 2F5VA 2ZXIA 3AFHA 1LDKB 3DEEA 5LFAA 2DJIA 4NC7A 4XLEA 3CF2A 2XZLA 4U87A 4CSWA 1BR2A 3U21A 4BGDA 2PJRA 2KVOA 2IGMA 4XLHA 4J00A 4TKOB 2X1EA 1Z21A 4Z06A 2LC2A 3PNVA 5C1EA 2CFOA 3GBGA 1O8DA 3K4LA 4XR6A 4D1QA 2XC7A 3LNNA 1OLTA 3OYBA 2X85A 3OFNA 2M4GA 5TGTA 1NBMA 3NE5B 1DQUA 3K4NA 3IUOA 3OIPA 3L2VA 2F4IA 2BVLA 2X6XA 3HPGA 3HOTA 2K3PA 3I3LA 4HEA2 1X1AA 1J09A 2JJ1A 1AA7A 1WJAA 2X8KA 3VMWA 1YE9A 1DGWY 1EE6A 2IGNA 5KHDA 4GQNA 2W00A 3HKZA 3IP4B 3VR6A 4RM3A 4XKBA 3DLAA 2AQFA 2HVSA 2WSSA 1NRKA 2LH9A 4N4OB 4DNRB 3LSHA 3D5RC 3H5RA 1I8DA 1W0KA 3ZR8X 3L2UA 4II3A 4NUBA 2E5ZA 4CCOA 2Z6BD 3QYFA 4ZJZA 2WPDA 3ZXSA 2GJPA 1O88A 3SUCA 2IGKA 3OL4A 4PFOA 5AMVA 1FX0A 2M3AA 2CK3A 4XONA 1FMWA 1VZ0A 4HNTA 5FRNA 4NC8A 4X0GA 3VYTB 3OWTA 4E7HA 2VKDA 1G8XA 4Y4RA 2WADA 2WJVA 4B3GA 2O04A 1KZLA 3VYUB 2DT6A 2K9MA 4PJLA 1V0EA 4DK0A 4ZDLA 3BCAA 2CV2A 3AL0B 2R7OA 2CUJA 1XG2A 3OPOA 2V6EA 3GQ8A 2E60A 4KKTA 3PFYA 1IRXA 2LBFA 1PJRA 1JI8A 1MMDA 2RNGA 3N05A 2EWEA 2L2OA 3CJQB 4GRIA 4JOMA 3VSLA 1OFLA 5CQGA 1PE9A 3G2BA 3MD2A 5KCMA 3W3CA 2INUA 2O0VA 2VL8A 1WJFA 2IS1A 1RU4A 4PSXA 4G6TB 4ZTFA 1E3ZA 3ZPNA 2WZPP 1O8GA 1QJVA 3FY3A 4NK8A 1V0FA 2WY8Q 1AIRA 3W2VA 4E0FA 2Z8GA 2WBMA 4ZTJA 4BJTA 2M5SA 1VLYA 2FUG2 1OHHA 3B8YA 1W36C 3FBIB 4IX7A 4HRIA 1D0ZA 4ANJA 4C2LA 2V7FA 5HOOA 3OYDA 2BW3A 5FL7A 3DPTA 4XKCA 2E1BA 2MABA 1OGMX 2MC4A 1WJ5A 1PYVA 1UD2A 2DXIA 4RM2A 4LIUA 1O8MA 3FKJA 3OYMA 2CV1A 3MMYB 4KT6A 4NNJA 1PLUA 4W8QA 3ZCOA 2VB6A 3VWBA 1OB0A 3LSIA 1UAAA 1TT0A 4BEHA 3K4JA 2X3HA 2KRCA 3BCFA 2MD0A 3LSKA 4UZUA 3ZQQA 2R7UA 2BVMA 4XKVA 4E7ZA 4F91B 4HNUA 4U7BA 3MKZA 1RWRA 4MXNA 3A3GA 4CZCA 2AQEA 2KL4A 2VQCA 3GVJA 4OJOA 2LG4A 3A1YA 4Y3OA 2V1NA 3B90A 1IB4A 1LKXA 3S3OA 1OOCA 4PJNA 1UD4A 4P1WA 1N78A 2PMZA 3OEEA 2NT6A 4J01A 2VQGA 1R6RA 3H0DA 2VKHA 2ZTGA 1T0FC 2WB1A 2DOAA 2GOMA 2CUZA 4B47A 4CCNA 3S3NA 1HVXA 3FKSA 4YZ0A 4XLAA 1D1CA 1Y6IA 4E7IA 1JTAA 4XLCA 4KKUA 3CP2A 2VLAA 4PSWA 2X6WA 4G7XA 3PNYA 2PYGA 1Z7LA 1D0XA 2V31A 4D9JA 1DGRM 4AYBA 3MKYB 1U0JA 2X1DA 3WQZA 2UVFA 2HVRA 2MFZA 2CH0A 3OE7A 3NWSA 2ZZGA 2RQQA 3A35A 4ASUA 4OJPA 2NTBA 4LG3A 1K28D 2F43A 4RLQA 1TZLA 4QPQA 1NG6A 3A4CA 2NOJB 3HG9A 2R7XA 2WJYA 3FPPA 2XGJA 2D3NA 2QE7A 4HIZA 2XSJC 3OYCA 2QKLB 5JHFA 4CCJA 2WY7Q 3T56B 2V4DA 4E7JA 3VDXA 3T53B 1D1BA 4BL0B 4FETA 3H5AA 1IDJA 3QODA 5FRMA 3K10A 4YEJA 5FROA 2Q2EB 5IK2A 2W1OA 3LL7A 4FXUA 2W6IA 2R7WA 2OV7A 1X1BA 2VXDA 4BDYA 1VF7A 4OJ6A 4H4KC 2M0MA 3OIQA 2UV1A 3UNGC 3BC9A 3KEYA 2BSPA 1NHCA 3OOCA 4YZXA 2IGOA 2VJIA 4TT3A 1T95A 3WWGA 3LSMA 3B4NA 2R7QA 3VYSB 1D0YA 2XF6A 4FASD 4G7WA 2ZSHB 3BLYA 3DU5A 2V7QA 3RQ4A 3KYLA 3L2QA 4W8SA 1DBGA 2X6YA 3DPUA 2LOOA 2A5WA 3DKXA 3OYFA 3PJRA 2HNHA 1KTWA 2X1CA 3H9JA 3K6GA 3DKYA 3ZIAA 3LMWA 2VXZA 3EPZA 3TL4X 3DTIA 1O8KA 3OMYA 2ZTNA 1W36D 4PJJA 4BQNA 2M4KA 2Z1DA 3C2HA 3M1CA 3ONQA 3PSIA 3OS1A 3D5LA 4DK1A 4XN3A 1MMAA 4R79A 4Z1MA 2NT9A 2LY1A 4XD7A 3S8PA 5HNFA 1IA5A 2PECA 3CESA 3LSGA 2HZDA 1X4OA 3KX2A 5KNLA 4IQJA 4L8JA 4CCMA 2W7NA 3KRGA 3AKZA 3RSNA 3C2GA 1HZEA 4BXFA 1DBOA 1MMGA 4XQFA 2E5NA 4DBQA 2XDVA 1X1CA 3QYEA 1I18A 3RCOA 4YELA 4IZZA 3OYJA 2ODLA 3QOEA 3DQVC 4G6IA 4NQWB 1T5EA 2KDOA 3LFUA 3SYTA 2HLDA 3BC8A 4HG2A 3W2AA 2HU9A 1SFKA 2JVGA 3OR1C 1QHGA 2VQHA 2M7AA 2XAUA 4BJ6C 3L2WA 2VPLA 2XOKA 3CJRB 1O8JA 3OEHA 3ZSCA 3S32A 4XN0A 2O5RA 2R9VA 5CPRB 4E4HA 4U49A 2A6TA 2CW7A 1HA8A 1QCXA 2BOLA 1MABA 2LY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZA A;  4YZ0 A;  2X85 A;  3VSU A;  4XLA A;  1JTA A;  4XLC A;  4XL9 A;  2X6X A;  2X6W A;  2PYG A;  3VMW A;  4YZQ A;  1EE6 A;  1O8H A;  2UVF A;  2QY1 A;  4PMH A;  3GQ9 A;  2VBM A;  3GQ7 A;  1RMG A;  1VBL A;  2QX3 A;  3JUR A;  4OJP A;  4OJ5 A;  2NTB A;  4Z05 A;  1O88 A;  2VJJ A;  3SUC A;  5AMV A;  3T9G A;  4OJL A;  1X0C A;  4XON A;  4OZY A;  4I84 A;  1OFM A;  4W8R A;  2NTQ A;  4W8T A;  1IDJ A;  1H80 A;  2O04 A;  4YEJ A;  2O0W A;  3VMV A;  3VSV A;  2UVE A;  1HG8 A;  4OJ6 A;  4XOT A;  1XG2 A;  3GQ8 A;  2O1D A;  2NTP A;  2BSP A;  1NHC A;  1CZF A;  2VBK A;  4YZX A;  4Z03 A;  1KCD A;  2VJI A;  4MR0 A;  1BN8 A;  4NK6 A;  3WWG A;  3B4N A;  4URR A;  2EWE A;  1IDK A;  1OFL A;  1PE9 A;  4W8S A;  1DBG A;  2X6Y A;  2INU A;  1KTW A;  2O0V A;  3GQA A;  1WMR A;  5C1C A;  1RU4 A;  1PXZ A;  4NK8 A;  1QJV A;  3LMW A;  4XOR A;  1O8G A;  3FY3 A;  1O8F A;  3EQN A;  1O8K A;  3GRH A;  4U4B A;  1AIR A;  2Z8G A;  2INV A;  1K5C A;  3B8Y A;  2NSP A;  4XN3 A;  2NT9 A;  1IA5 A;  2PEC A;  4XR6 A;  4C2L A;  4EW9 A;  2QXZ A;  3KRG A;  1O8E A;  4HWV A;  1OGO X;  1OGM X;  1DBO A;  4XQF A;  2PYH A;  3UW0 A;  2O17 A;  3VST A;  1O8M A;  4OZZ A;  2NST A;  4YEL A;  4XM3 A;  2ODL A;  3ZPP A;  3EQO A;  1O8I A;  1PLU A;  4W8Q A;  2IQ7 A;  4XLF A;  1O8L A;  4XOP A;  2X3H A;  4XKW A;  4XLE A;  2VBE A;  4XKV A;  4XNF A;  1RWR A;  1KCC A;  4XMY A;  4MXN A;  1BHE A;  4OJO A;  4XLH A;  1O8J A;  3ZSC A;  3B90 A;  1IB4 A;  4XN0 A;  1JRG A;  1OOC A;  4U49 A;  4Z06 A;  5C1E A;  1QCX A;  4AVZ A;  2NT6 A;  1O8D A;  2NZM A;  1GQ8 A; 
#chains in the Genus database with same CATH topology
 3HHH A;  2EFQ A;  2E7X A;  1P7J A;  2KKO A;  3CD6 I;  2R7S A;  2E2J J;  5EYR A;  2XAQ A;  4XL9 A;  4RDU A;  4CXF A;  2HDN B;  2HKO A;  2HPM A;  2GQQ A;  4CDG A;  5THX A;  2LBF B;  1BMF A;  5JR3 A;  2LSO A;  2UXN A;  4BS9 A;  1RQR A;  4UXN A;  2HQA A;  2P6S A;  2M5W A;  3BPX A;  2DCE A;  3BR6 A;  1KMH A;  1ETW A;  4WXD A;  2VKV A;  1T38 A;  4BHP A;  2X51 A;  4CYC B;  1DU0 A;  1AOY A;  4P6V F;  3M8F A;  2HPI A;  5E1X A;  2R5Y A;  1RMG A;  1G3Y A;  3KZY A;  1RUO A;  5D6E A;  4KIT B;  3S15 J;  4AIJ A;  5LHI A;  1JNY A;  4HF2 A;  3FZV A;  3FHZ A;  5KSW B;  3J81 K;  2OBT A;  4Z4S A;  3LYC A;  4OJL A;  4IL6 C;  1DAB A;  5TJJ A;  3TO6 A;  1HDD C;  1XFO A;  2H8W A;  2LF8 A;  5BPI A;  2XNJ A;  3S2D J;  2HZT A;  1MBK A;  1U9N A;  3CZ6 A;  1A35 A;  1OFD A;  4BJ5 C;  2QYU A;  5BS6 A;  2NS7 A;  2LD5 A;  3VMV A;  2MD5 A;  3BQZ A;  1LVK A;  2HR3 A;  3M1E A;  4LD5 A;  3E6C C;  3Q39 A;  3VSV A;  1R1T A;  4LOC A;  1Z91 A;  1T6Z A;  4CA0 A;  1E3X A;  3BH7 B;  4X7F A;  3DP7 A;  1KQ5 A;  5F0C A;  1KK2 A;  4HDV A;  1N77 A;  4WZT A;  2D45 A;  2IS6 A;  1H9T A;  1BLI A;  5E6T A;  3W5U A;  4NK6 A;  1NDH A;  4HV6 A;  1EH6 A;  3Q0W A;  3WGH A;  1I6H J;  4BKX A;  2YWF A;  4BAY A;  2OTL B;  2XZO A;  3CUQ A;  3O8H A;  3AL0 C;  2IEK A;  3E1S A;  5ED4 A;  5JFR A;  2HOA A;  3QAH A;  4D5C A;  2KRH A;  2O0Y A;  1A31 A;  1S8N A;  1P9Q C;  2FF4 A;  1FP1 D;  4NHJ A;  1QFJ A;  3G73 A;  3R0J A;  1GVD A;  4G12 A;  1XC5 A;  2XRL A;  5FO5 A;  1W1W E;  2ECC A;  2O6W A;  1W7P D;  2XKP A;  2FQ4 A;  4PC3 A;  1B72 A;  1FRQ A;  2QGU A;  2NSP A;  2ELH A;  4BE0 A;  1QGY A;  4UV8 A;  2Z16 A;  4BU2 A;  4EQQ A;  1VQO B;  4Y33 A;  1J2X A;  3TMO A;  2PMD A;  4PJM A;  4IHW A;  2DLL A;  1O8E A;  1HBX G;  3EUH A;  4JX4 A;  1NH3 A;  1E0E A;  1COW A;  1N06 A;  4HOB A;  3IKV A;  4X8I A;  2KLO A;  2AXL A;  3UKG A;  5KVR A;  1TVC A;  3QE2 A;  2O9L A;  4RPB A;  1EA3 A;  4G1B A;  4E6K G;  4BH9 A;  4C0S A;  4B48 A;  2XT2 A;  3VST A;  3T51 B;  3A3B A;  2BYV E;  5J4V A;  2QEX I;  1VJS A;  1WTH D;  4YFN F;  4C9Y A;  3T0Y A;  1U6G A;  1U2R A;  4F55 A;  3S1R J;  4QPO A;  4IHV A;  1O8L A;  1PJ5 A;  1JTY A;  1FOK A;  2Y2Z A;  3QYB A;  3K4B A;  4B44 A;  2VC0 A;  3OYG A;  4JBA A;  1FSH A;  3ZZT A;  2YX7 A;  4AC0 A;  3JRE A;  4KJZ A;  5F04 A;  2D3L A;  1MDM B;  2GK6 A;  1S4M A;  4A3E J;  1W0U A;  4B4C A;  3CCQ I;  2DO7 A;  3W2H A;  4YRV A;  1O7F A;  1YW7 A;  2QUF A;  3BCB A;  5B5E C;  1K73 D;  2Y0M A;  2LKS A;  1DAR A;  3OJW A;  3Q38 A;  1KYZ A;  1XMK A;  2EZI A;  1FYK A;  3VSU A;  1GVH A;  4MFE A;  1WPC A;  4PK4 A;  2HDC A;  5FGM A;  4L0Y B;  3KLN A;  3OYN A;  3CO7 C;  3ABK H;  2FBH A;  3H94 A;  1Q1V A;  4EJT A;  1JGS A;  3WTY C;  2DIE A;  2M9H A;  1P4A A;  2J8K A;  1FT9 A;  2KPM A;  3ZZ0 A;  3HOW J;  4QWQ A;  3PSF A;  3CUO A;  1FYL A;  1TWC J;  2V9V A;  2WAQ A;  4CH7 A;  1VQ7 B;  1O8M A;  1Z3X A;  1FY7 A;  1EFU A;  2VBW A;  4B3F X;  1TLL A;  4KDP A;  2QTL A;  3LA3 A;  4YDT A;  4MYU A;  3DTE A;  3HTU A;  4DZP A;  2F5C A;  3Q0U A;  2HYJ A;  4Z05 A;  4A69 C;  1RI7 A;  4A12 A;  2I8D A;  4EJV A;  3OYK A;  4Q5S F;  3LA2 A;  1W0J A;  4WWV A;  3CP8 A;  4IOA F;  1PUF B;  3K2Z A;  4RAG A;  1X0C A;  1Y8Q B;  5J3L A;  4KYW A;  1VQ5 I;  1OFM A;  5GAE J;  3ZUG A;  2YUH A;  4FIS A;  3A0H C;  3C18 A;  2E71 A;  2P0W A;  4EGZ A;  2UVE A;  4FHT A;  4I02 A;  2G0E A;  3I71 A;  1ITY A;  5M5Y J;  2O3F A;  2OBS A;  2JSP A;  3W6V A;  3I59 B;  1ORK A;  4A0Z A;  2IBD A;  1EH8 A;  1ERD A;  2G9W A;  2EWN A;  2K7L A;  3FXO A;  4C2T A;  2KMU A;  1T33 A;  4HNV A;  1N75 A;  2F2E A;  4DNT B;  3SFZ A;  1W7P B;  5J1R A;  1W34 A;  4P1V A;  3LAP A;  2VBX A;  1WMR A;  3A8I A;  1ZR4 A;  1EP3 B;  1BL0 A;  1BJZ A;  1V5F A;  4XOR A;  3JRD A;  4G7O F;  1G3T A;  1ETK A;  4IRH A;  3OW2 B;  3CC7 I;  3B8H A;  3GRH A;  4P22 A;  2XF5 A;  1WU8 A;  4UB6 C;  4LLL A;  4IHX A;  3G05 A;  3SDB A;  3FJO A;  2QXZ A;  3ASP A;  5KAI C;  4EEF G;  2BHZ A;  2B7E A;  4BYY A;  1W0T A;  2I5U A;  1EKE A;  4O3M A;  1FLI A;  2B7C A;  4EM0 B;  3CME B;  3HRS A;  1FRN A;  1FNC A;  1BX1 A;  1VLO A;  4L5I A;  1W9X A;  3HAG A;  1ETQ A;  1XCV A;  2DI3 A;  4OPW A;  3PEN A;  2GBY A;  5HDN A;  1YJN I;  3FXJ A;  1PJ6 A;  4TMT A;  1X4P A;  3AST A;  1I5Z A;  4XM3 A;  2VFM A;  2RGV A;  2R7T A;  1B2R A;  1WJD A;  5FD5 A;  2JJ2 A;  1TYV A;  2F5V A;  3CCS I;  2NNN A;  3QU6 A;  3C1D A;  2XPW A;  2ZXI A;  4X0C A;  1ENH A;  1LDK B;  1MH4 A;  5FLV A;  3IH3 A;  2QN6 A;  1R22 A;  5F0H A;  1RR8 C;  4YEI A;  5DS9 A;  4U87 A;  5CVR A;  1BR2 A;  3CCY A;  2PJR A;  4XLH A;  2EFO A;  2E1C A;  1LE8 A;  1X3U A;  4FE7 A;  2EV6 A;  2O8K A;  1Z21 A;  2ADU A;  2BGI A;  1GV2 A;  3E7L A;  2F1L A;  5C1E A;  2RQP A;  1F1Z A;  1PDN C;  4RB0 A;  4FTH A;  5M5X J;  4XIC A;  1KD1 D;  3CCU I;  3OFN A;  2JN9 A;  3K4N A;  3OIP A;  4YAU A;  3HOT A;  3W2F A;  2X6X A;  3OKX A;  5FJ8 J;  4HEA 2;  3I3L A;  2QDX A;  1J09 A;  1AA7 A;  1JHH A;  4L9V A;  5E8G A;  2PBI A;  1YS7 A;  5KHD A;  4XRF A;  3PSS A;  2C4U A;  2H09 A;  1XQB A;  4RM3 A;  1Z6R A;  5A8A A;  3F8F A;  4RGS A;  2HVS A;  2IA2 A;  4R71 A;  4N4O B;  3S2H J;  3HZJ A;  3D5R C;  3G1L A;  1NB0 A;  3L2U A;  1Y0U A;  1XB2 A;  2DU9 A;  5GTI C;  4MFD A;  3NAU A;  1CNF A;  2GJP A;  1W35 A;  1OCR H;  1ON1 A;  1XG1 A;  2IGK A;  3PM1 A;  4CIC A;  3S14 J;  2VOP A;  5EZG A;  2LP0 A;  1AMO A;  3QFC A;  1Y1V J;  2DOD A;  4XK4 A;  3JRB A;  1QVU A;  4HAM A;  4XON A;  3VFZ A;  3MWM A;  3CDL A;  4ZYG A;  4LC0 A;  2E1O A;  2E35 A;  5HS8 A;  3VYT B;  4E7H A;  1G8X A;  4P9F A;  3A03 A;  3A01 B;  1OCT C;  4P9S A;  4CQJ A;  5IYN A;  2O04 A;  3LVB A;  1I1G A;  4DK0 A;  3CPX A;  2FEZ A;  1EJ9 A;  2LK2 A;  4ZDL A;  2XTX A;  1LFB A;  4PAB A;  1XG2 A;  3HRU A;  5BMZ A;  3R6J A;  1PJR A;  3H92 A;  1JI8 A;  3MN2 A;  1UCR A;  2DA3 A;  3CLQ A;  1L0O C;  2CFX A;  1DDN A;  3TQN A;  3TW6 A;  5H20 A;  3FXL A;  2DA4 A;  3CJQ B;  4UVC A;  4I09 A;  3WBJ A;  3MFK A;  3G2B A;  3KP4 A;  1Y0N A;  5KCM A;  3W3C A;  2YSR A;  1OGJ A;  2VL8 A;  1WJF A;  2IS1 A;  1OB5 A;  1ZKG A;  1VQM I;  1RU4 A;  2VFN A;  2IT0 A;  1E3Z A;  2WZP P;  1TYW A;  2CGP A;  5HS7 A;  1SKQ A;  3IWZ A;  5DSZ A;  1AIR A;  5EMN A;  2J8I A;  4FT8 A;  5A2Q K;  2Z8G A;  2GWR A;  4ZTJ A;  4FE4 A;  4M3E A;  1VLY A;  3O2P E;  1HKQ A;  4HV5 A;  4RA2 A;  1OHH A;  4G7Z F;  2C77 A;  1IN6 A;  5BNG A;  2VNJ A;  2L7M P;  3BTJ A;  5H2F C;  1J9I A;  3OYD A;  2OQG A;  4XRS A;  2V1D A;  4M72 A;  3HOX J;  3VOE A;  4M74 A;  2E1B A;  4QHY A;  1OGM X;  4P25 A;  1PYV A;  2XPU A;  3E6B A;  3GIR A;  2VZL A;  5H59 A;  2ZB9 A;  3FK7 A;  1TWA J;  1UD2 A;  1YHQ I;  3JRF A;  4DYQ A;  2H6B A;  3B6C A;  3FKJ A;  3IWF A;  4LFU A;  4JK1 X;  3NRV A;  2OBR A;  4YFO A;  3BG5 A;  3MMY B;  4NNJ A;  4W8Q A;  3ZCO A;  1HW1 A;  5HDG A;  5L3E A;  5FD6 A;  1UAA A;  4AVP A;  2JN6 A;  3FMR A;  2X3H A;  2DMT A;  3FX3 A;  1OCZ H;  3ZQQ A;  4X7C A;  3AK5 A;  3EET A;  4MXN A;  4CZC A;  3JQP A;  1QQI A;  2KL4 A;  2VQC A;  2F5D A;  1B9N A;  2DY1 A;  4OJO A;  3PUN A;  4HW0 A;  3B90 A;  2MC3 A;  3ZQ7 A;  4N3N A;  2JA6 J;  2E1R A;  1V4R A;  1AHD P;  4LBV A;  3BQY A;  2NT6 A;  2KRF A;  1R6R A;  4G94 A;  1KGS A;  2ZL5 A;  2VKH A;  4TMW A;  2WB1 A;  4B47 A;  4YZ0 A;  2GOM A;  2HTS A;  1ZRC A;  1U5T B;  2QQB A;  4BPR A;  4XLA A;  3F6V A;  1R1V A;  1KQ0 A;  3CCV B;  4E7I A;  2DW4 A;  3E20 A;  2JZY A;  1MJA A;  2LF7 A;  2QWW A;  3CRZ A;  1ZG5 A;  1D8T A;  2CBX A;  2GRE A;  4YIR X;  5BOX A;  4D9J A;  3OZV A;  4AYB A;  1B9M A;  2XGE A;  3GTM J;  1BIB A;  2CYY A;  2X1D A;  1KA8 A;  2CH0 A;  3HSE A;  3I56 I;  4OPV A;  3WND A;  5M5W J;  3IRR A;  2ZZG A;  3PSZ A;  2RQQ A;  3WHB A;  1XGN A;  2O8X A;  2KIQ A;  3FIW A;  5J1Y A;  1ZGW A;  2WV1 A;  4YAL A;  3QP6 A;  3A4C A;  4BHC A;  1QX4 A;  3HG9 A;  2WJY A;  3WTW C;  4IF4 A;  3OYC A;  4A3C J;  2ID6 A;  2WY7 Q;  3BTC A;  1F5T A;  3T56 B;  2QLZ A;  2FXA A;  3IH2 A;  1IDJ A;  5FRM A;  4YEJ A;  5IK2 A;  1VQL I;  5CVI A;  5DM7 F;  2K9Q A;  2W6I A;  4OJ6 A;  3PIP F;  2VFO A;  3P7N A;  1JJ8 C;  2UV1 A;  3UNG C;  1AKH A;  2IGO A;  3M8E A;  4TT3 A;  3WWG A;  2JSC A;  1W5T A;  3DEU A;  3LSM A;  2R5Z A;  2EV5 A;  2R7Q A;  3W6J B;  1T39 A;  3SJZ A;  3W5V A;  1E64 A;  2ZSH B;  3BLY A;  5LMZ A;  2NPF A;  3RQ4 A;  3L2Q A;  3LA7 A;  3U1K A;  4W8S A;  2HNH A;  3K2A A;  3ONU A;  1SMT A;  2EZK A;  3WTS C;  2QSH X;  3EPZ A;  3L09 A;  5ERI A;  3CC7 B;  3RPQ A;  3CDH A;  4M6X A;  4BQN A;  4OPO A;  3SYJ A;  4GXO A;  5GP9 A;  2M4K A;  2Z1D A;  3C2H A;  5EEG A;  3PSI A;  2D74 A;  2J5O A;  3D5L A;  2XGC A;  2V5I A;  1MMA A;  3QFR A;  1DPR A;  2BXZ A;  3Q5F A;  1Q9S A;  5TRD A;  2PN6 A;  2CQX A;  5KNL A;  1X4O A;  4L8J A;  4FX0 A;  3MVP A;  3JRC A;  3BNW A;  3TKY A;  1HZE A;  4OIO F;  4BXF A;  4Y15 A;  5KAF C;  1BN5 A;  2QZ8 A;  5IOZ A;  5K1Y A;  2F3L A;  2ZME B;  4KA4 A;  2OTL I;  2BVN A;  4JRA C;  3CJN A;  2RAE A;  5GAH J;  2A6H F;  3RCO A;  4NDL A;  4YEL A;  4DNC A;  3OYJ A;  4M71 A;  1I18 A;  1QA1 A;  2V9P A;  4ESB A;  4GDF A;  4WZL A;  4NQW B;  1T5E A;  3CCS B;  1GV5 A;  2HWV A;  2EA2 A;  2HLD A;  1VQ4 B;  1HST A;  4HG2 A;  5EGO B;  2FQ3 A;  2JVG A;  1ZGA A;  4DYR A;  2FVG A;  2K85 A;  2VQH A;  5FKK A;  2XOK A;  1BX0 A;  4G1V A;  3O8G A;  1SAX A;  2EFN A;  2H8R A;  3ZSC A;  3S32 A;  4P3I A;  3IRQ A;  3A8K A;  3Q0V A;  2JQ7 A;  1QCX A;  2RC5 A;  1OCC H;  2LY2 A;  3DLL F;  4Z4Z A;  5E17 F;  1GQ8 A;  5F1R A;  1W5C C;  2DA6 A;  1FYM A;  2ZXJ A;  3GFL A;  5IYP A;  1IHM A;  4X6A J;  3EYY A;  3CMM A;  3HXL A;  3CCR I;  1G7T A;  2L9R A;  4MNU A;  3G71 B;  1XX5 A;  1Q82 D;  3AVU A;  2CU7 A;  2E34 A;  4UVB A;  4YXW A;  5DCM B;  2ZZF A;  1J5Y A;  5ICE A;  4PGG A;  4F52 A;  1UD8 A;  4HZF A;  2CC2 A;  3AVY A;  4MGR A;  4PFP A;  1YX3 A;  2I10 A;  5HOD A;  4LBW A;  1TLH B;  4MIM A;  2R93 J;  1YO5 C;  3BR5 A;  5E3N A;  2VIX A;  2X53 S;  2VUM J;  1FBU A;  1G3S A;  3J80 K;  3HDD A;  2GPJ A;  3ZQL A;  2KIS A;  1UG0 A;  3AG2 H;  2FSW A;  3ABU A;  2KDZ A;  3F9K A;  4AM3 A;  1SVM A;  1IRF A;  1OCP A;  2FD5 A;  5H6Q A;  1WP6 A;  4O5V A;  4BBS J;  2LVS A;  3DDY A;  2QBY A;  5FIU A;  3M07 A;  4B43 A;  3QU3 A;  1E3H A;  5C44 J;  5J6X A;  1IO2 A;  2CF4 A;  1W87 A;  3VO1 A;  5JMC B;  1KQ9 A;  2W82 A;  2B9S A;  2JRM A;  2LLK A;  2LMD A;  3J81 Z;  4U0V A;  3AG4 H;  2V26 A;  3WGG A;  1MND A;  4ZDO A;  2LDU A;  1MW7 A;  2Q2E A;  4ZYD A;  2NTP A;  4RB2 C;  4QIW N;  2DCU A;  4AC9 A;  4Z03 A;  1VQ7 I;  3GTK J;  3ZBT A;  4HYE A;  1KCD A;  2Y0S A;  2CW8 A;  1AIP A;  4A3I J;  3D1N I;  1ONV A;  3SEQ A;  3TBI A;  4EGY A;  1FJL A;  5CVV A;  3AVT A;  1YI2 B;  2MH9 A;  3C2B A;  3V4G A;  1HF0 A;  4JYK A;  1WOO A;  4TSF A;  3CO6 C;  2F1M A;  4KH3 A;  2DAO A;  3MKW B;  4ZYE A;  4BE2 A;  1YJ9 I;  2GK7 A;  3SZE A;  3IAS 2;  5FFZ A;  3H09 A;  4GYG A;  5DS0 A;  3EQN A;  1S72 B;  2KQR A;  3V42 A;  2GJK A;  4U4B A;  3R61 A;  2P3M A;  4Z4Y A;  4UZE A;  5ILS A;  1TC3 C;  1K5C A;  2HXO A;  3SEZ A;  3Q6R A;  3VO2 A;  1NB9 A;  4ITV A;  1KQ8 A;  1K4T A;  3RPU D;  5IP9 J;  3FKI J;  1JA1 A;  1OR7 C;  3ELK A;  1MRZ A;  4RDJ A;  2CV0 A;  1XGM A;  3QRF F;  2EPF A;  4LB5 A;  5K7Z A;  2I1L A;  2LKP A;  5DUK A;  1WOP A;  1LFU P;  1YHQ B;  3B73 A;  2DDB A;  1E1Q A;  1O88 A;  1S7E A;  3B02 A;  3ZQI A;  4CCK A;  1JT0 A;  4RMN A;  4B1R A;  3EQO A;  3MKL A;  5JLX A;  3ZQG A;  4HST A;  4UUS B;  4XLF A;  1BOA A;  4IPA A;  2ICW G;  2BF4 A;  3J7Y J;  1SFE A;  1V5E A;  1TQP A;  1QG0 A;  3GQB A;  1A6Q A;  2C4T A;  1L3L A;  4ZDP A;  2L4M A;  1V5V A;  3K9T A;  1QGP A;  4XNF A;  2ELJ A;  4YIF A;  1KCC A;  1SMY F;  4V2G A;  4LIV A;  1VTN C;  1BI0 A;  1GO2 A;  2D9R A;  1JE8 A;  1X3Z B;  1JRG A;  4DGW B;  5C4X J;  2DN0 A;  3JX8 A;  3H9N A;  2O03 A;  3CME I;  3WNC A;  1U2W A;  2LR8 A;  5C3E J;  2IJL A;  3BDD A;  3I5U A;  2FA5 A;  4TMX A;  2UWM A;  1Q81 D;  5LBQ A;  1UHS A;  2Q1Z B;  3OAA A;  4M3G A;  1GXP A;  3GVA A;  4H0E A;  1B23 P;  4Q47 A;  4M6Y A;  3EDP A;  2K9N A;  1S9H A;  2VOO A;  4YAO A;  4ZH4 F;  2HDD A;  4YZQ A;  1JUM A;  4X05 A;  3HL2 A;  2XAG A;  4IKF A;  5H5J A;  2HQR A;  3MZ8 A;  1QFZ A;  5ICC A;  3I53 A;  1QRB A;  2VNH A;  2Y75 A;  1IN5 A;  1Z6T A;  2CRG A;  1K8F A;  1LFP A;  5GV8 A;  4MYT A;  2RDP A;  2EJR A;  1XSX A;  2FML A;  5LD2 C;  2QX3 A;  1I6X A;  1KYW A;  3BH4 A;  2Q6O A;  3V76 A;  2RRE A;  1U8B A;  4CYC A;  4LK1 F;  1V54 H;  1IDZ A;  2ZO4 A;  2PLY A;  4KIG A;  1XTA A;  4MQ9 F;  4C30 A;  4CCL A;  3JTG A;  4XRM A;  3M9A A;  1D8K A;  3ABM H;  1DUX C;  4W8R A;  3P9K A;  3IAM 2;  2JVH A;  1TL8 A;  1N05 A;  2OAZ A;  1VND A;  4PAA A;  1VQL B;  3PA1 A;  1QA6 A;  5EF6 A;  4E7S A;  2LZJ A;  2XEX A;  4ZZD A;  2LKX A;  2W48 A;  4XOT A;  3OS0 A;  2X0K A;  3BG7 A;  2WYR A;  2BY3 A;  1J59 A;  4A0X A;  2XRO A;  3M8J A;  5HLH A;  1JA0 A;  4YFX F;  2KZG A;  1I3A A;  1WGX A;  5L3C A;  2KIF A;  4HX7 A;  1UHW A;  4M2L A;  3K4C A;  1ZRD A;  3CC4 B;  2Q6L A;  3TDZ C;  1WH7 A;  1APL C;  1F9N A;  2Y69 H;  1BC8 C;  1UB9 A;  2HI3 A;  1SD5 A;  1H88 C;  2GOX B;  5BQT A;  2KFD A;  3GF2 A;  1YIT B;  5DDG A;  1PXZ A;  3KPH A;  3PQJ A;  5D6F A;  3FXK A;  4XBF A;  2L5Q A;  2L3D A;  3JSP A;  2CRV A;  3U2R A;  3UR3 C;  5IT3 A;  4FCY A;  4PC1 A;  3A2K A;  1OKR A;  1AWC A;  1MMS A;  2UUZ A;  3FBN B;  4RAF A;  3JRI A;  1K4Z A;  3TP3 A;  2DEU A;  4CHU A;  2GJR A;  1IZ1 A;  1R58 A;  2W84 A;  1R5O A;  2ZJQ F;  4WZK A;  5HNH A;  3L1P A;  1V5G A;  4MHG A;  4HWV A;  1OGO X;  3W2W A;  1X2M A;  2ZZE A;  3OYH A;  5JVG F;  2CQK A;  3ZGK A;  2L9S A;  1U78 A;  3ZN0 A;  2PG4 A;  5L3F A;  2ZL7 A;  3UW0 A;  2C6Y A;  3WG7 H;  3EUH C;  1UD5 A;  2BM4 A;  4EAT A;  2NVT J;  1E79 A;  2PMU A;  3FM5 A;  5B6I A;  3F0C A;  4BEH B;  1MMN A;  3MZY A;  3GUD A;  3E5X A;  3GXO A;  3KP7 A;  1FTT A;  4A0Y A;  3BH6 B;  3G4S B;  3AFH A;  2Z3Y A;  5LFA A;  2DJI A;  3BWG A;  3CF2 A;  2XZL A;  3J7Z I;  3TW7 A;  4B09 A;  2KVO A;  4BGD A;  2IGM A;  4I76 A;  4A2U A;  2OD5 A;  1H42 A;  3IV5 A;  2EIJ H;  4PZJ A;  2ZXW H;  5F64 A;  5BSY A;  1I27 A;  1V55 H;  4Z06 A;  3P5J A;  1TYX A;  2DMP A;  2LC2 A;  3K1M A;  1MDM A;  1Z1D A;  3GBG A;  1O8D A;  2CO5 A;  4XR6 A;  4Z4W A;  2TCT A;  4RGR A;  5EJC A;  2XC7 A;  2EZH A;  2WTE A;  2X85 A;  4DQK A;  3HRT A;  3CCR B;  1JB9 A;  4OOI A;  2M4G A;  3RKX A;  1NBM A;  3NE5 B;  3QWL A;  1T98 A;  2XND A;  4IHY A;  2KT0 A;  4B8X A;  3ISX A;  1X1A A;  2X8K A;  2JJ1 A;  4G9Y A;  1DGW Y;  4ZCL A;  2IGN A;  4XSZ F;  1QGA A;  5DYM A;  2ISY A;  3IP4 B;  1HDP A;  1N07 A;  3BZ6 A;  5F08 A;  3DLA A;  1TYU A;  4DNR B;  2ESN A;  1I8D A;  4PC7 A;  3AVW A;  4II3 A;  3GSI A;  1VQ9 I;  4IHS A;  4A93 J;  2Y30 A;  1WWX A;  3ZXS A;  3DCF A;  4Q4Z F;  1RPW A;  3OL4 A;  4PFO A;  1YX2 A;  4M1K A;  1FX0 A;  3B6A A;  1A6I A;  1R5G A;  5M3F J;  2VBS A;  4M9X A;  1FMW A;  5IYD J;  3HRM A;  3OWT A;  3CCV I;  1HCR A;  4JX6 A;  1PUF A;  2WJV A;  2PMH A;  4XLP F;  5EEA A;  1GDT A;  6PAX A;  1KZL A;  1WSR A;  1VQN B;  2K9M A;  3CXC B;  3BCA A;  1D3Y A;  2CV2 A;  3AL0 B;  2R7O A;  5HS9 A;  2QCO A;  5ICF A;  1TTT A;  4L9T A;  2DPD A;  2PE3 A;  1IRX A;  1WQ2 A;  5ILV A;  2VBT A;  2MG4 A;  3WGI A;  2XSD C;  5FNZ A;  1MMD A;  2A6E F;  3GO5 A;  3MAJ A;  3WE2 A;  1WZ2 A;  1MSE C;  2RNG A;  2DFF A;  4GRI A;  4JOM A;  3VSL A;  2ZBU A;  5CQG A;  3KL9 A;  1PE9 A;  4DW6 A;  4M9S A;  3QP5 A;  1O57 A;  2XAH A;  4C43 A;  5D4S A;  1YJ9 B;  4RDL A;  4G6T B;  3OSG A;  4ZTF A;  5IYQ A;  1O8G A;  1SFU A;  3KP5 A;  2P5L C;  1QJV A;  1W7P A;  3FY3 A;  3L9F A;  4E0F A;  2JWT A;  2WBM A;  3KZI C;  2X9D A;  4BJT A;  2TDX A;  4EM1 A;  2J5P A;  3GWZ A;  3ASN H;  3S1M J;  2EIK H;  5F6F A;  4ANJ A;  3WU2 C;  4C2L A;  1RES A;  2A3S A;  2E2H J;  5A2Q Z;  2Y48 A;  1R36 A;  2JK3 A;  5E1Z B;  2HKX A;  2COB A;  2MC4 A;  3JSO A;  5FO0 A;  5E1W A;  4OP7 A;  4Z4U A;  1S6L A;  2X4H A;  1WVR A;  2DXI A;  1Z9C A;  3U9G A;  2YU3 A;  3I64 A;  4R8H A;  2DBB A;  1XCB A;  4CYD A;  4WXH A;  1ZQ3 P;  1GJR A;  2BM0 A;  3WY9 A;  3LOC A;  4LMY A;  3P4G A;  1TT0 A;  4PJ0 C;  4HQE A;  1EWY A;  2M45 A;  1FWZ A;  1F20 A;  3RZD J;  2MH2 A;  3RDI A;  2FOK A;  2BVM A;  4XKV A;  4E7Z A;  4F91 B;  2YUS A;  1TNT A;  3S16 J;  2R7U A;  1KK3 A;  3CDI A;  1LM1 A;  2AQE A;  2CQN A;  1P4M A;  3VOD A;  3ZN1 A;  1UMQ A;  4ZZL A;  4Y3O A;  2W25 A;  1TWH J;  2BGC A;  1XSD A;  5FKN A;  1TSP A;  4XRS G;  1R00 A;  1OOC A;  4PJN A;  4YG2 F;  1L1I A;  4P1W A;  3ZQC A;  3OEE A;  4HE5 A;  4J01 A;  2PMZ N;  2FOW A;  2L54 A;  2M1B A;  1E17 A;  5GPC A;  1IG7 A;  1YJW B;  3WG9 A;  1K83 J;  2ZTG A;  1T0F C;  2DOA A;  3S3N A;  2EFW A;  1D1C A;  3FXU A;  4JX5 A;  1YS6 A;  4XLC A;  4KKU A;  3CC2 B;  3CP2 A;  2VLA A;  2HOS A;  1ZM3 A;  4FX4 A;  3Q3S A;  1E63 A;  1FBS A;  3SLN A;  3LST A;  1VQ4 I;  3S17 J;  2M8E A;  4KN4 X;  1UHM A;  5CVJ A;  3X2Q H;  3A1P A;  2L9V A;  3ERE D;  3F21 A;  1PUE E;  1TTY A;  1UJ8 A;  2V7U A;  1ZTR A;  2DPU A;  3F22 A;  4HX4 A;  1BI2 A;  2F43 A;  4RLQ A;  3RJP A;  4V2F A;  4L0Z B;  2QE7 A;  3M4O J;  4HIZ A;  4ACB A;  2QKL B;  4IJA A;  1IGN A;  4A6D A;  5D8L B;  4IXA A;  4LB6 B;  4EMS A;  2EIN H;  4IEJ A;  1D1B A;  2BM6 A;  1QA2 A;  3ASO H;  1RKW A;  3CJT B;  3H5A A;  3QOD A;  4I01 A;  3G71 I;  1MNM C;  3FMS A;  3AAF A;  4XLN F;  4A3K J;  1YRN B;  4FXU A;  4DQL A;  1X1B A;  2VXD A;  4BDY A;  3A01 A;  4LBZ A;  1H8A C;  3OIQ A;  1T6Y A;  3KEO A;  5TR9 A;  3KEY A;  3OOC A;  1WHU A;  2P6T A;  2XTY A;  2F5E A;  3AG1 H;  2X6O A;  2VJI A;  5IT9 K;  2B0R A;  2CG4 A;  3VYS B;  1RIO H;  2XF6 A;  4FAS D;  2X6Y A;  3DPU A;  3FWE A;  2LOO A;  3PJR A;  2RVC A;  5LRS A;  2CUF A;  2Y9Z A;  1GR1 A;  3K6G A;  3ZIA A;  2VXZ A;  4Z4T A;  3DTI A;  5D5X B;  2K4J A;  3A02 A;  2D1H A;  2DT5 A;  3OMY A;  4M9Z A;  5F1J A;  2ZTN A;  1OQY A;  3V8K A;  1SM4 A;  1F43 A;  3RYR A;  3OS1 A;  4QV2 A;  2N8G A;  4O6J A;  5F0F A;  3LSR A;  3SQV A;  1OJL A;  3W6K B;  4XD7 A;  3S8P A;  3F8C A;  3E6D A;  3PUF A;  4C2M J;  4YAF A;  2PEC A;  3CES A;  2HZD A;  3BJO A;  3RYP A;  3MZH A;  1N0V C;  4CCM A;  2K9S A;  3AKZ A;  4ZCI A;  2Q0O A;  3RSN A;  1ZG3 A;  4A5N A;  5LEJ A;  4MTD A;  1VFC A;  2K86 A;  1IXR C;  3GFI A;  2V7X A;  4HE6 A;  1YI2 I;  5DTD A;  1W2B B;  2WV0 A;  1FNB A;  4IZZ A;  3KZZ A;  1O3R A;  3DQV C;  5IYB J;  1WRJ A;  4G6I A;  1N08 A;  1BBY A;  1CF7 B;  4P6Y A;  3SYT A;  1KC8 D;  2GLO A;  2NVU B;  2DYS H;  3WBK A;  1S72 I;  2HTJ A;  1YTY A;  4L5J A;  3O6B B;  3DU1 X;  3LSJ A;  4N9H A;  3OR1 C;  2EIX A;  3NB2 A;  2WAQ N;  4BY1 J;  2STT A;  1H9G A;  1P7I A;  3G3Z A;  2IW5 A;  2VPL A;  1DDI A;  3CJR B;  1ZRF A;  1HOM A;  1O8J A;  2CQQ A;  2R9V A;  1REP C;  3ZBU A;  3OZU A;  3ZMU A;  4OMZ A;  1NK3 P;  4AD9 A;  2V6C A;  2P4W A;  3SJM A;  2HCJ B;  2OYN A;  3WXM A;  3BZK A;  5K5O A;  4WCG A;  2RKH A;  4FK8 A;  1OFC X;  2P5K A;  1SAN A;  2GA2 A;  3T5X A;  4BQQ A;  3BCD A;  2DA2 A;  2HFH A;  1DP3 A;  1U5T A;  3SKB A;  2CS3 A;  1FOY A;  2DA1 A;  3DU6 A;  4ZCM A;  3TP0 A;  3TO7 A;  4HLX A;  4HDU A;  1BIA A;  4II2 A;  5TV2 A;  2HDW A;  3U6K A;  1K61 A;  2DK5 A;  3FXM A;  3ZRG A;  2VQL A;  4F3Q A;  1XDS A;  5C1C A;  1IN4 A;  2OBP A;  2QM3 A;  3HOS A;  1FDR A;  2KJB A;  4BBR J;  3GQ7 A;  1VBL A;  2KHM A;  2W4S A;  1VQ9 B;  2QZA A;  1E1R A;  2Q8K A;  2HVQ A;  4DIQ A;  3RI4 A;  2WR8 A;  4F7D A;  2K5C A;  4RD3 A;  2EA4 A;  5HLT A;  3DFG A;  2DTZ A;  4LGW A;  3J80 Z;  3GTO J;  4ESJ A;  4WXC A;  4OAZ A;  3ZQH A;  1UD6 A;  3J81 k;  4OZY A;  2NTQ A;  3LO8 A;  2A68 F;  3ML6 A;  4PCQ A;  1NTC A;  2CJJ A;  4W1U A;  2O0W A;  4OWR B;  3EUA A;  1YX5 A;  2DYI A;  3BY6 A;  2A69 F;  4A3B J;  3K70 C;  1JKR C;  1HXD A;  4OOX A;  2EV0 A;  3BG6 A;  3E3V A;  2ELK A;  1EXM A;  1FIP A;  1G3W A;  1RET A;  2CND A;  5K5R A;  2IPQ X;  4ZV4 A;  2R7F A;  2IA1 A;  2YU9 J;  2DT7 B;  1G2H A;  4L5E A;  1TWG J;  4AID A;  1D5V A;  3OYE A;  3TH0 A;  1IAW A;  2V7W A;  2M8G X;  3GQA A;  3ZMS A;  1QQ1 A;  1TW3 A;  4LLN A;  2DFH A;  2RC4 A;  2HMA A;  5HVQ C;  3NWT A;  5CQE A;  4QUZ A;  3VSK A;  2E1M C;  2VJ5 A;  1G7S A;  1Q86 D;  1O8F A;  2R4G A;  1NJI D;  4Z2Y A;  2DMN A;  3OW7 A;  1TQM A;  2H6C A;  4PDK A;  1MNE A;  3HUG B;  5E3L A;  1R23 A;  4HF1 A;  3KIO A;  1IB0 A;  2DET A;  2ZJP F;  3I58 A;  3S1Q J;  4BQA A;  1G6N A;  4ON0 A;  1ETO A;  1LVA A;  4RGU A;  2H1K A;  2NS8 A;  1X1D A;  4Y7C A;  4UY8 I;  1PJ7 A;  4RBO A;  3A0B C;  2B5O A;  1WJC A;  3OY9 A;  3JQR A;  1D1A A;  2EZL A;  1F60 A;  1Z3Y A;  5DUI A;  3CC4 I;  2K3F A;  3S93 A;  2JA8 J;  2BX6 A;  4OZZ A;  3OYI A;  4Q7J B;  1HSJ A;  1UEL B;  1GLN A;  4KN7 X;  4QTR A;  1YIT I;  2E36 A;  2ZME A;  1O8I A;  4RPD A;  3FIS A;  3DPL C;  3M3Y J;  2M34 A;  3H5N A;  4ETS A;  5FLM J;  2L7Z A;  4XKW A;  5LLQ A;  4UB8 C;  3V7R A;  2FMY A;  1MZB A;  1WJE A;  3D0S A;  2A07 F;  3SLD A;  3H1C A;  4XID A;  5EG0 B;  1T56 A;  4XMY A;  1J75 A;  2FX3 A;  4P9U A;  4KKS A;  1BJK A;  1BHE A;  5EGO A;  1PP7 U;  4UAJ A;  3HIF A;  2K27 A;  4DBR A;  3RTR A;  2LTP A;  3JRG A;  1R49 A;  4PGO A;  3W2G A;  4EH1 A;  3ZQF A;  3COA C;  5KW9 A;  1HW5 A;  2L7F P;  4AVZ A;  2NZM A;  4WQM A;  3T9G A;  5J4Y A;  1T8I A;  3T8R A;  2NYX A;  4Z4R A;  2XZP A;  1W5S A;  2JTV A;  3GX4 X;  3WHC A;  3DTK A;  4YCQ A;  2JDI A;  2ZJ2 A;  4BDZ A;  1ZLK A;  1QHH D;  3KP6 A;  2DOF A;  1QRC A;  2DQR A;  1IXC A;  1K78 B;  4S05 A;  1VHO A;  3MMP A;  3ZOB A;  3G4S I;  1I1S A;  1O8H A;  4WX9 A;  2JUG A;  2M87 A;  2WA0 A;  5DCM A;  1QUF A;  2M7B A;  4M73 A;  4CO8 A;  4ENM A;  3CMY A;  2E2I J;  3GQ9 A;  2OJE D;  2BY1 A;  4HQM A;  3IL2 A;  5AN9 A;  2E1M B;  4BXX J;  3SZT A;  2DQL A;  1LPQ A;  4F92 B;  1Y8R B;  1A5J A;  4EJO A;  4U0Y A;  3H35 A;  4OJ5 A;  3QQA A;  2LRD A;  1NG7 A;  1SVO A;  1TQI A;  1I39 A;  2QEN A;  2VJJ A;  2QKM B;  1R5N A;  3L2R A;  2PLF A;  4RD2 A;  3GVL A;  1EV7 A;  3GME A;  3B78 A;  1QNT A;  2QQ9 A;  3PQK A;  2DJN A;  2YR2 A;  3DBH B;  2R7D A;  2Z2S B;  4IOC F;  2C78 A;  2XNC A;  1HQC A;  2LRE A;  2EFP A;  3F8B A;  4GCV A;  2JIZ A;  4RB3 C;  3ZC3 A;  4AIH A;  4UUT A;  4LG0 B;  2ZJR F;  1P6R A;  5B66 C;  3OOU A;  1A36 A;  3Q3A A;  2KJC A;  2L4A A;  5AON A;  3OYA A;  3HPH A;  2R7V A;  3LWF A;  1EFT A;  2Z9O A;  1R5B A;  2JJ7 A;  2OU2 A;  4UV9 A;  3WU0 A;  5E3M A;  1WOS A;  1ZAO A;  4U7D A;  1RRJ A;  1RUN A;  1EFC A;  2PFB A;  2O1D A;  2YX4 A;  1BI1 A;  1JTX A;  1QZZ A;  2XB5 A;  3H3Z A;  3ABT A;  3CPW B;  1BN8 A;  2VAS A;  5CVU A;  1K4S A;  1DPU A;  4TV7 A;  1IDK A;  1OYW A;  1SD4 A;  3BJ6 A;  1WOR A;  1TP4 A;  2Q6K A;  4HA8 A;  1J9Z A;  2IOU G;  5FLX K;  4AF6 A;  2ZIT A;  4P2N A;  3HGG A;  1T08 B;  3S3M A;  5IYR A;  1FMV A;  1RR7 A;  2PQ8 A;  2ZFU A;  4A3L J;  1IDY A;  1RZ4 A;  1MBJ A;  3E5U A;  3EUK L;  5A89 A;  1JUS A;  2XPV A;  3JRH A;  1WDT A;  5CKT A;  2INV A;  4AU7 A;  4F93 B;  4OIP F;  1VQN I;  2BW3 B;  5FKM A;  3JU4 A;  4A5M A;  5IYW A;  1N25 A;  4BY7 J;  2G0Y A;  2CQ7 A;  1EFR A;  4JQF A;  1XS9 A;  3G1O A;  2OZU A;  2M2E A;  4EW9 A;  4A3F J;  1YIJ I;  3ML3 A;  2VFQ A;  1WFX A;  1R4N B;  4JP0 A;  4EM2 A;  2IS4 A;  3H9G A;  3OJX A;  4LIT A;  4R1H A;  4BUP A;  1G59 A;  2VT3 A;  4C3H J;  1MBG A;  4DYC A;  5HXB A;  3ZPP A;  3H36 A;  4P12 A;  1ZEL A;  4P96 A;  4C2U A;  1N8R D;  4TN1 A;  3HSR A;  4AUX A;  3DEE A;  1S5L C;  4AYB N;  4UUS A;  4I98 B;  1LB2 A;  1Z77 A;  1I7P A;  3BQJ A;  2JA7 J;  4DZJ A;  5LEK A;  4CSW A;  2IVM A;  2ETH A;  2JUC A;  2G7U A;  2JMW A;  3U21 A;  1YG2 A;  1CLW A;  3N6Z A;  3BG9 A;  2NVX J;  4TKO B;  1JUP A;  2HOE A;  2X1E A;  2GM4 A;  2HYG D;  2MSY A;  5FKL A;  3PNV A;  3I0T A;  2XGX A;  1CGP A;  3HOY J;  4Y9U A;  3V7A A;  3DKW A;  3K4L A;  3SXY A;  2DDA A;  5DNS A;  3HOZ J;  1OLT A;  1YIO A;  2IP2 A;  3DBR B;  3T8T A;  1S7A A;  2XIG A;  2NS0 A;  5TGT A;  3E97 A;  5LGT A;  2RC6 A;  3F6O A;  2DYR H;  3IUO A;  2BVL A;  3HPG A;  2YWG A;  1YOV B;  2K3P A;  1DG1 G;  1WJA A;  1YLO A;  5EZH A;  1E2X A;  4OIR F;  2R3S A;  3HKZ N;  4ESF A;  5DV5 A;  3FXR A;  4XKB A;  2AQF A;  2NXN B;  2EIL H;  3MQ0 A;  2LH9 A;  3LSH A;  3H5R A;  1W4M A;  3VB2 A;  4RS8 A;  1EH7 A;  3ULQ B;  4NUB A;  3ZR8 X;  1I3Q J;  2E5Z A;  4CCO A;  3QYF A;  4ZJZ A;  3I55 I;  2ZCW A;  3VPR A;  2C2W A;  2WPD A;  2Z6B D;  2D5V A;  3SUC A;  5CJ9 A;  3PA2 A;  4UZF A;  4Y9R A;  5AMV A;  5D4R A;  2M3A A;  1FPQ A;  1T6S A;  1B8I B;  3ZMT A;  1YJW I;  3BRO A;  9ANT A;  2CK3 A;  2NAZ A;  1SD6 A;  2OCC H;  4J0Q A;  4HNT A;  4X0G A;  4PGH A;  1IXS B;  2MA3 A;  4M4S A;  2AS5 F;  1GVJ A;  2GZW A;  2L02 A;  2BN4 A;  3CC2 I;  2WAD A;  3PIO F;  4IRI A;  5FO1 A;  4B3G A;  1BM9 A;  1WPK A;  2DT6 A;  2QVO A;  4EJU A;  1IRG A;  5J35 A;  1U9O A;  2ZKZ A;  3HYI A;  3JQQ A;  3OPO A;  2E60 A;  4G8X A;  1HKT A;  3PFY A;  3VNV A;  3GQ8 A;  1B4A A;  2LBF A;  2LFB A;  1BQE A;  5L3D A;  3GTJ J;  4W8T A;  4EVI A;  4WF2 A;  3N05 A;  2BM7 A;  2FNP A;  2QA4 I;  2GQF A;  3WNB A;  5K7F A;  5GAD J;  1QVT A;  5JLW A;  3RKY A;  1K79 A;  3MD2 A;  4KNY A;  1X2N A;  1YW8 A;  5FB2 A;  2INU A;  3CQZ J;  3CW2 A;  1P92 A;  4IW3 B;  1KU9 A;  4NK8 A;  1MD0 A;  1YQA A;  4PC6 A;  2WY8 Q;  4I7H A;  4YFK F;  2WZN A;  3VMF A;  3W2V A;  3D26 A;  2ZFW A;  3CCE B;  2FBK A;  1ZK8 A;  2M5S A;  3JAM K;  2OK8 A;  1QRY A;  3NEU A;  1W36 C;  1OFE A;  3FBI B;  4IX7 A;  3RPU A;  4G6D A;  2R0Q C;  1D0Z A;  2V7F A;  4E70 A;  2P81 A;  1IW7 F;  3WTZ A;  3DPT A;  2K40 A;  3FMQ A;  2MAB A;  3K1N A;  2BPO A;  1WJ5 A;  2X3U A;  5IY5 H;  3F8M A;  2QMU A;  2BBY A;  2EQR A;  1ZN2 A;  4LIU A;  4RM2 A;  2XAJ A;  3SQN A;  4I2O A;  4N0B A;  1JJ6 C;  1WI3 A;  1LNW A;  4UNO A;  4ZGN B;  4X07 A;  3NQO A;  4M0L A;  2CUE A;  4KT6 A;  3I4M J;  1IUY A;  4PC2 A;  1PLU A;  2YWE A;  2DMQ A;  2VB6 A;  2XAS A;  5E20 A;  3ES9 A;  3CCJ B;  3CUQ C;  4IO9 F;  3LSI A;  4KFC A;  1VQP B;  1EP2 B;  1KQS B;  3KE2 A;  4BEH A;  3K4J A;  2HEO A;  3V8J A;  1Z7U A;  3GTG J;  5LGU A;  5JBQ A;  1D1N A;  4Y17 A;  3GTL J;  1FZP B;  1TUI A;  4IRG A;  3MKZ A;  5IOY A;  3JRA A;  2O6G E;  4V02 C;  3ZPL A;  3A3G A;  2DA5 A;  4KUM A;  1LKX A;  3H3V K;  5D5U B;  3H3U A;  1X3W B;  2FNA A;  3N97 A;  1IV6 A;  3W5H A;  1UD4 A;  1N78 A;  1OIS A;  2PMZ A;  5B1B H;  5LGN A;  2X0L A;  2VQG A;  5L3B A;  3AGQ A;  2P5V A;  3F3X A;  4WZE A;  3N90 A;  1ODD A;  3FKS A;  1IC8 A;  5JI6 A;  1Y6I A;  2QTZ A;  2R92 J;  3HOV J;  1F36 A;  1HC8 A;  3PNY A;  1Z7L A;  3ABL H;  5LHG A;  1D0X A;  4UUV A;  3LFK A;  2NV4 A;  3RIQ A;  3WYA A;  1VQ6 I;  1DGR M;  3MKY B;  1U0J A;  4RDK A;  3WQZ A;  1J0R A;  2MFZ A;  3R4K A;  2R5Y B;  3OE7 A;  4GO1 A;  2EBI A;  3HSF A;  2M30 A;  1LEA A;  2H94 A;  3K7A J;  1A8P A;  2Y0S N;  1LUJ B;  2OCE A;  3E1Y E;  4OJP A;  2NTB A;  2DOE A;  3CCL B;  1TZL A;  3ECH A;  4G7H F;  3G6E I;  2V7T A;  3OIO A;  1QVF B;  5FFX A;  2D3N A;  5JHU A;  3K1P A;  2XSJ C;  5JHF A;  3FPK A;  1STZ A;  3BPV A;  5AIQ A;  2LY9 A;  1P4X A;  2Z5U A;  4X06 A;  3P9C A;  3OV8 A;  1FTZ A;  5J47 A;  1KZH A;  3K10 A;  1LLW A;  4Q48 A;  3ZMZ A;  2W1O A;  4KMU X;  2CWE A;  4ENJ A;  2R7W A;  3BJA A;  3IC7 A;  3DXJ F;  2M0M A;  3BC9 A;  3CMA B;  3ASS A;  1M1E B;  1JHF A;  3I4P A;  4BXU A;  1ZRE A;  1EZG A;  2FJ1 A;  3CUQ B;  3L00 A;  1T95 A;  1FIA A;  3IKT A;  3B4N A;  4RCY A;  4I0A A;  4G7W A;  5C4J J;  5F4J A;  3DU5 A;  2PX9 A;  1DBG A;  3U6B A;  4NC6 A;  3DKX A;  3OYF A;  2VI6 A;  1KK0 A;  1KTW A;  2X1C A;  3H9J A;  3MCZ A;  3F23 A;  3PFI A;  3DKY A;  4GGG A;  1SEU A;  5IT9 Z;  1CNE A;  3LMW A;  1B72 B;  2EB7 A;  2F4N A;  3ZMD A;  2IA0 A;  1X58 A;  5J8F A;  3WTV C;  1RNL A;  4OU0 A;  3AG3 H;  2ACJ A;  3QFT A;  3M1C A;  3GFJ A;  2HS5 A;  4DK1 A;  4XN3 A;  2IRF G;  3BR2 A;  4R79 A;  3P26 A;  1XD7 A;  1ZGJ A;  2LY1 A;  2MLK A;  3C7J A;  1OGI A;  1QH0 A;  1WSV A;  2VNK A;  5HNF A;  1CQX A;  1IA5 A;  1QPI A;  1YIJ B;  3LSG A;  3T1B A;  1O3T A;  3RIR A;  2VNI A;  3S1N J;  4M53 A;  2F5F A;  3C2G A;  2J7K A;  1DBO A;  1MJB A;  1MMG A;  2FRH A;  2GXG A;  1U8R A;  5HDK A;  2GXB A;  4XQF A;  1FOX A;  1S0U A;  2E5N A;  3I59 A;  1ZH5 A;  1FEX A;  2XDV A;  1X1C A;  3CLO A;  3JR9 A;  3ECO A;  4YC5 A;  3QYE A;  4AIK A;  2B0L A;  3CTA A;  1JT6 A;  1BI3 A;  2LNB A;  2ZBK A;  2XV4 S;  1QGZ A;  2BM1 A;  2ODL A;  4D5F A;  5EDN A;  1FNN A;  2KDO A;  3LFU A;  4D7M A;  2PEX A;  1QBJ A;  5F4O A;  3H0G J;  2DTR A;  1BW5 A;  3W2A A;  4N3G A;  1FBQ A;  4G5G A;  4FWT A;  2OF7 A;  2HU9 A;  1SFK A;  1QHG A;  2OTJ B;  3TDU C;  1MBF A;  2OZ6 A;  5TIS C;  2NOG A;  3BOQ A;  4I99 C;  5DD8 A;  5CPR B;  5E8I A;  1F4K A;  3Q9S A;  4U49 A;  2CW7 A;  2BMW A;  2DFE A;  3TO9 A;  3GW2 A;  1T6X A;  2BOL A;  4A6E A;  2P8T A;  1K9M D;  4KT5 C;  1MAB A;  3I1F A;  4QVA A;  1Z05 A;  3GZ5 A;  3BR1 A;  3KFW X;  5K5Q A;  5E3O A;  3ASR A;  1LLZ A;  5M3M J;  3LQ6 A;  1SVL A;  1BR4 A;  3CCM B;  3FDY A;  2LYC A;  1ZUN B;  1SAU A;  4N4N B;  3ZZU A;  3GLX A;  2O7O A;  3WU1 B;  3LQQ A;  4I6Z A;  5IPA A;  5F4M A;  5EEH A;  1O8K A;  1D5Y A;  1QU3 A;  1USS A;  2VBU A;  5GAG J;  4PMH A;  5DD4 A;  2ISZ A;  2IS2 A;  1KU2 A;  3BT9 A;  3DV8 A;  4I0B A;  4Y13 A;  1QFY A;  3SEJ A;  3BP8 A;  1K6Y A;  2VBM A;  3PL8 A;  2XUB A;  4M3F A;  5D5V B;  2R6H A;  2MGQ A;  2VBV A;  4M3B A;  3I55 B;  4NBQ A;  4GYI A;  1LDJ A;  2K9L A;  4MLO A;  2K4B A;  4KIB A;  2L9N A;  3CB4 A;  1VQK B;  2V1X A;  5KK1 A;  5FA6 A;  1Y39 A;  3SJP A;  4P5O A;  1LJ9 A;  2RNJ A;  4ENK A;  1FX7 A;  2BV3 A;  4QVJ A;  4I84 A;  3K4M A;  5CYV A;  1YFH A;  1H8H A;  1FNM A;  4ASN A;  2W6J A;  4HPQ A;  4S04 A;  1BA5 A;  5F27 A;  3E0J B;  4RLZ A;  4RLF A;  3QPL A;  4ACA A;  2QF7 A;  4M6V A;  1KON A;  3R0A A;  4ZYA A;  3TOB A;  3AVX A;  1CZF A;  2VBK A;  1YRN A;  1R71 A;  1RKT A;  1C0W A;  2L7K A;  4MR0 A;  4URR A;  1TT5 B;  2QA4 B;  3WTX C;  1M1K D;  1IUF A;  1VF9 A;  4RD4 A;  1VQ8 I;  5GPA A;  3JTH A;  2YWH A;  2V7V A;  1B6A A;  1POG A;  5DN6 A;  4UVA A;  1ON2 A;  2JA2 A;  4CZZ A;  3QOP A;  1BC7 C;  3FXQ A;  3RQI A;  2VJ4 A;  5B1A H;  3RKQ A;  3SHF A;  3K4K A;  3U1D A;  3F72 A;  2OK7 A;  3MHP A;  3AVV A;  2GIZ A;  4DOZ A;  4BAC A;  2BHY A;  5HKK A;  2VE8 A;  1HKS A;  3WE3 A;  1R9T J;  1GAW A;  2EFG A;  1T2K A;  1R4M B;  4CUG A;  3ONY A;  1R1U A;  2BE5 F;  2ZXH A;  3W2I A;  1OYY A;  1I50 J;  4LJZ F;  5J40 A;  5HLG A;  3KP2 A;  4TMZ A;  1QO0 D;  3KCC A;  3OR2 C;  1SFX A;  1T0F A;  3I54 A;  2O61 A;  1E62 A;  2DER A;  4OAY A;  2PYH A;  4IQ4 A;  2R7R A;  1MGT A;  3DWL E;  3KP3 A;  4DJA A;  4OOV A;  2O17 A;  3BY2 A;  3CD6 B;  2F6C A;  3BTI A;  1XB4 A;  2Y31 A;  3DF8 A;  3OL3 A;  3PNT A;  2NST A;  1VHE A;  5J1U A;  1FND A;  1R7J A;  2IQ7 A;  3BTL A;  1IN8 A;  1SC7 A;  1QVG B;  4XOP A;  2PJR B;  2V1U A;  3J7A Y;  4JMQ A;  1RC9 A;  3GVK A;  2MYS A;  2OUM A;  1S3J A;  1CF7 A;  1K7A A;  2VBE A;  1LE8 B;  2WAE A;  2HQ5 A;  5GV7 A;  4LK0 F;  5CLS A;  3I9V 2;  3PUB A;  4Z6Y A;  4KIF A;  2ZBV A;  5JLV C;  4EV0 A;  5E18 F;  1X19 A;  1SKY B;  2W85 A;  3GZ6 A;  4P26 A;  1ETY A;  3FM3 A;  4EJW A;  5ICG A;  1X1P A;  1HA3 A;  1KJZ A;  4D0P A;  4Z4V A;  1LQ1 A;  4KIS A;  1KTV A;  3KEQ A;  4YZA A;  1N0U A;  2FBI A;  1K8A D;  1PKV A;  1WKM A;  2V4J C;  1QZY A;  4HSR A;  1Q7Y D;  2OC6 A;  2FX0 A;  4W97 A;  4RAY A;  5HLI A;  1GHC A;  1P4W A;  1VQ6 B;  1WJB A;  2K02 A;  2WAF A;  3REO A;  4BHB A;  2QY1 A;  1EF4 A;  2HQN A;  1IRZ A;  3GTP J;  3KEW A;  5L46 A;  1U5T C;  2RN7 A;  3LMM A;  1JKQ C;  3H9Q A;  4FQG A;  1E3P A;  2ZSI B;  2KZV A;  1QPM A;  3JUR A;  1IN7 A;  2DOG A;  1O7L A;  4E7L A;  2W7Z A;  4HBL A;  3SFI A;  3FHN A;  3HC7 A;  1BPL A;  4MQV A;  3HJE A;  3G6E B;  1ACI A;  4BNC A;  5J8C A;  2B63 J;  4PUS A;  1GXQ A;  2ZZQ A;  5LRR A;  1Y56 A;  1DP7 P;  2XF7 A;  4WK8 F;  4ZC3 A;  1FP2 A;  1BOB A;  2IXS A;  4MTE A;  2BXY A;  5LHH A;  1H0M A;  4RAZ A;  4YII A;  1XMX A;  3K0L A;  1YLF A;  2P7C B;  2YS9 A;  4Y52 J;  1H80 A;  2NNY A;  3K70 D;  3RZO J;  4N9I A;  4A3J J;  1XMA A;  4C3I J;  4HF0 A;  1UD3 A;  1HF2 A;  1HG8 A;  3QPH A;  2QQ8 A;  1AU7 A;  2D1V A;  2FE3 A;  2VOD A;  4BE1 A;  2H1L A;  2W57 A;  3FK6 A;  3MCA A;  1H8E A;  4IHT A;  3NAW A;  3L2C A;  4M3D A;  2Z99 A;  1WSU A;  3LQE A;  1FC3 A;  3MEX A;  2ECB A;  1O3Q A;  2EIM H;  1PVE A;  3SZG A;  3BG3 A;  1G4D A;  1JJ2 B;  4B3X A;  4L9J A;  2MLG A;  3ISP A;  1S29 A;  2QEX B;  3HGY A;  1K6O A;  2CMP A;  2VT2 A;  1A04 A;  1V3F A;  3DBL B;  2UXX A;  4K1X A;  2GA1 A;  2AHO A;  5BPD A;  2XTW A;  4DQ2 A;  3ZP5 A;  3VYR B;  5CDF A;  2CW5 A;  3ERM A;  3P9I A;  5FLX Z;  2VE9 A;  3HTS B;  2VYQ A;  1FOW A;  1KRH A;  2V9K A;  1TW2 A;  3M7G A;  4X7D A;  1H85 A;  2DA7 A;  3OYL A;  2XHK A;  2HYF A;  3HUG A;  4FN5 A;  1MKM A;  1IJF A;  3CCQ B;  2XRN A;  2WWY A;  1ETX A;  3IH4 A;  4NB5 A;  2VFP A;  5GTH C;  2VBY A;  3SDG A;  1OB2 A;  3QFS A;  4BQO A;  1E43 A;  1EP1 B;  4YAW A;  4QLC U;  3HM5 A;  1BR1 A;  2KP6 A;  3C3W A;  2ME6 A;  4RD0 A;  4KIC A;  1OPC A;  1IF1 A;  4E7K A;  4OM9 A;  2BY0 A;  3OS2 A;  3D5S C;  3A8J A;  5JVT A;  2BSA A;  4ENN A;  1DDG A;  1HLV A;  4K2E A;  1XN7 A;  1UMK A;  2STW A;  3QPT A;  4Y7N J;  3KLO A;  3HB9 A;  2Q6I A;  1CQT A;  2QSF X;  1JXS A;  1XPX A;  2OQR A;  2ZME C;  3CCE I;  4NC7 A;  4XLE A;  1XE1 A;  3U2Q A;  2W24 A;  3LJY A;  5J3O A;  3E5Q A;  1GUU A;  1IV8 A;  3V7C A;  4J00 A;  2HOT A;  5E79 C;  1LDD A;  2AHQ A;  4AWX B;  5EG0 A;  3OZW A;  4P55 A;  4RB1 A;  2AO9 A;  2CFO A;  1O4X A;  3E6M A;  1R5I D;  4D1Q A;  1G7C A;  3LNN A;  5DM6 F;  3OYB A;  2XAF A;  1VQ5 B;  4IVN A;  1DQU A;  4MO7 A;  4ABZ A;  5IP6 A;  3L2V A;  1WCM J;  2F4I A;  4D7N A;  1E3O C;  2EK5 A;  1NK2 P;  3PET A;  3CCJ I;  3VMW A;  1YE9 A;  1EE6 A;  4L18 B;  1VQP I;  3P27 A;  4GQN A;  4NQW A;  1TWF J;  2W00 A;  3HKZ A;  3VR6 A;  2X48 A;  4QFM A;  2GAU A;  1K78 A;  2WSS A;  1NRK A;  1W0K A;  4CGZ A;  5BSX A;  2DMU A;  3L7W A;  3LNQ A;  3KET A;  1UST A;  1ZHF A;  2PJP A;  2MW8 A;  2A05 A;  2ESH A;  4RGX A;  3EQL F;  4A3M J;  1IJW C;  2XT4 A;  3RY8 A;  1Y0R A;  3J7A O;  4NBS A;  3R6K A;  1VZ0 A;  1G7R A;  3TOA A;  5FRN A;  1OYI A;  1MH3 A;  4NC8 A;  5H6R A;  4ZGQ B;  1SFO J;  2VKD A;  1Z0X A;  4Y4R A;  3PVD A;  4H9G A;  3VYU B;  1AKH B;  4OMY A;  2ME0 A;  4PJL A;  2NRA C;  1V0E A;  5D5W B;  3HEF A;  3W2E A;  1ZAR A;  4LG0 A;  3OOP A;  2R5Z B;  2CUJ A;  3IHU A;  2H27 A;  4LLG F;  2V6E A;  4B4D A;  3K69 A;  2VKE A;  4KKT A;  1ETV A;  2PI0 A;  1B1B A;  2BV6 A;  1J7K A;  2OA4 A;  4J19 A;  3ESW B;  4OIN F;  2EWE A;  2L2O A;  4WWC A;  1VQ8 B;  1OFL A;  1U3E M;  1DU6 A;  1QUE A;  1YJN B;  2D2W A;  4L9N A;  3CCL I;  1MBH A;  2O0V A;  2ZNY A;  1JKP C;  4RCZ A;  4PSX A;  1H89 C;  3ZPN A;  1M90 D;  1FSE A;  4MEY F;  2GIV A;  2OPT A;  1V0F A;  4U0W A;  3G1M A;  4V19 K;  1MIJ A;  1MBE A;  3WOD F;  1ELO A;  1D2E A;  2NVY J;  3Q9V A;  4HX8 A;  2FUG 2;  1Z67 A;  3ASQ A;  3B8Y A;  2G7H A;  2F4O B;  1B59 A;  5HZB A;  1VQO I;  2KIU A;  4HRI A;  1ZR2 A;  5HOO A;  3CMA I;  1QZE A;  2BW3 A;  3BR3 A;  2E7W A;  3HOU J;  5FL7 A;  4XKC A;  2XB0 X;  3KYC B;  3JAM Z;  1ZM9 A;  2BY2 A;  4RD1 A;  1ZM2 A;  1XGS A;  2QYO A;  3QPS A;  1Q1H A;  4X7E A;  3OYM A;  3SZP A;  1OCO H;  3NAR A;  2BGJ A;  3CCU B;  2CV1 A;  2R7Z J;  1LEB A;  5IYC J;  1KK1 A;  3VWB A;  3BY1 A;  1OB0 A;  1YW9 A;  2CSO A;  2JT1 A;  4LBY A;  5D8K B;  4X1E A;  2A61 A;  3EYI A;  2KRC A;  3BCF A;  2MD0 A;  2IAI A;  3LSK A;  4UZU A;  4S0H B;  5K7H A;  4HNU A;  4U7B A;  4GFB A;  4XSX F;  3PO3 J;  3I4N J;  2ID3 A;  3GEZ A;  2B7B A;  1RWR A;  4F7Z A;  1JGG A;  1MJ9 A;  3VEP A;  3GVJ A;  3A1Y A;  2LG4 A;  1YYV A;  2V1N A;  3RKW A;  3ROU A;  1IB4 A;  2WC2 A;  2F4M B;  3S3O A;  3WTU C;  3HHG A;  5TY0 A;  1IJE A;  1NHA A;  2BEO A;  4P3Y A;  3KYD B;  3WTT C;  3H0D A;  1O3S A;  3LQR A;  1HVX A;  2VON A;  2CUZ A;  4CCN A;  2WB1 N;  1ZYR F;  1ZLJ A;  2BM5 A;  2XVC A;  1Y1W J;  4TMV A;  1JTA A;  2TRT A;  3S2W A;  4PSW A;  2X6W A;  4G7X A;  2PYG A;  1KU7 A;  4U88 A;  2COM A;  4G6Q A;  4UHT A;  3R6S A;  2V31 A;  4A3D J;  2P7V B;  2UVF A;  2FU4 A;  2HVR A;  5DEQ A;  5HZA A;  1SD7 A;  3NWS A;  2HXI A;  2JRT A;  2AXT C;  2YPR A;  3A35 A;  2OTJ I;  2C5B A;  5ILU A;  2ZNZ A;  1ZM4 A;  1XDU A;  2CW0 F;  4ASU A;  5B3S H;  2VC1 A;  4LG3 A;  2QBY B;  1K28 D;  4QPQ A;  1QA3 A;  3GCM A;  1NG6 A;  2XGJ A;  1VI0 A;  2NOJ B;  5L3G A;  3LSP A;  2R7X A;  3FPP A;  2XGD A;  1VQM B;  1ULY A;  2A5Y B;  4CCJ A;  2Z33 A;  2V4D A;  3HBL A;  2DFI A;  2BZT A;  3VDX A;  4E7J A;  3T53 B;  3CCM I;  2QSG X;  4BL0 B;  3GFM A;  4FET A;  2L01 A;  5AIP A;  1B8I A;  4OIQ F;  2NVQ J;  5FRO A;  3OP1 A;  2XC1 A;  2Q2E B;  3LL7 A;  4C3J J;  4OPS A;  2OV7 A;  2Y9Y A;  2HGC A;  3FF5 A;  5IP7 J;  1VF7 A;  4H4K C;  4A3G J;  1TNS A;  3CF5 F;  1JKO C;  2ZL6 A;  3BR0 A;  2BSP A;  4YZX A;  1NHC A;  1EA0 A;  1BJA A;  3GYH X;  2M0C A;  1WXR A;  4NCN A;  1D0Y A;  1OMI A;  1BW6 A;  2ZC2 A;  4HLY A;  4RJL A;  2V7Q A;  3GZN B;  2E19 A;  1UZC A;  3V7S A;  3KYL A;  2GXA A;  1GT0 C;  1VQK I;  4Z1M A;  1TBX A;  2A5W A;  1GAQ A;  3DEW A;  3GTQ J;  3OSF A;  3AGP A;  2JPC A;  2JA5 J;  3TL4 X;  4B3A A;  5A88 A;  1W36 D;  2DK8 A;  4PJJ A;  2PIA A;  1MSF C;  4YHB A;  3ONQ A;  1OR7 A;  4MEX F;  2EH3 A;  2NT9 A;  2VBZ A;  3QSY A;  1S7O A;  2QGG A;  3N4M A;  2XKO A;  5DCF A;  5FKO A;  2JPB A;  2KIM A;  3KRG A;  3KX2 A;  4IQJ A;  2W7N A;  1KU3 A;  3TGN A;  4OOS A;  1UG2 A;  1WI9 A;  2QQA A;  4U9U A;  4KMF A;  2VPR A;  3V8L A;  3SY2 A;  4DBQ A;  2VN2 A;  3O3K A;  3B82 A;  2L0K A;  3PO2 J;  3PUM A;  2RV8 A;  3QOE A;  3R60 A;  3JCU C;  4ROX A;  4RD6 A;  3TED A;  1PP8 F;  3BC8 A;  3BZC A;  2E1N A;  1Y0Y A;  3ZMV A;  2V79 A;  3JW4 A;  2UZK A;  1ZG1 A;  1R5H A;  3I56 B;  3VNU A;  1D8J A;  3F8N A;  1XGO A;  2M7A A;  2XAU A;  4BJ6 C;  4ZYH A;  3L2W A;  3Q6Q A;  3LAJ A;  3OEH A;  2F48 A;  1UFM A;  4XN0 A;  2O5R A;  3GLL A;  4E4H A;  4QSH A;  2A6T A;  1HA8 A;  1XSV A;  1RQP A;  1WH5 A;  2C5H A;  1P2F A;  4RM0 A;  2MBF A;  4AF7 A;  1HW2 A; 
#chains in the Genus database with same CATH homology
 3CMM A;  3HXL A;  1BR4 A;  2R7S A;  3FDY A;  4BQQ A;  2LYC A;  4XL9 A;  1SAU A;  4N4N B;  3BCD A;  2HPM A;  1DP3 A;  4YXW A;  2ZZF A;  2LBF B;  4F52 A;  1BMF A;  1UD8 A;  2CS3 A;  3DU6 A;  4PFP A;  4BS9 A;  1YX3 A;  2HQA A;  1QU3 A;  2DCE A;  4II2 A;  4PMH A;  1KMH A;  2HDW A;  2IS2 A;  2VIX A;  2X53 S;  2X51 A;  3ZRG A;  1K6Y A;  2VQL A;  2VBM A;  4F3Q A;  3PL8 A;  3HOS A;  1UG0 A;  2HPI A;  1RMG A;  1VBL A;  2KHM A;  3GQ7 A;  2W4S A;  2K9L A;  4MLO A;  4KIT B;  2L9N A;  3F9K A;  1E1R A;  2HVQ A;  4DIQ A;  2K5C A;  5HLT A;  1WP6 A;  4OJL A;  4P5O A;  3DDY A;  4OAZ A;  1UD6 A;  4B43 A;  4OZY A;  4I84 A;  3K4M A;  2NTQ A;  3CZ6 A;  1H8H A;  4BJ5 C;  2W82 A;  2W6J A;  4HPQ A;  2O0W A;  3VMV A;  3VSV A;  3E0J B;  1LVK A;  3EUA A;  4OWR B;  2V26 A;  1YX5 A;  4RLF A;  1MND A;  3K70 C;  1KON A;  4ZDO A;  4CA0 A;  1E3X A;  3BG6 A;  1MW7 A;  2NTP A;  4ZYA A;  1N77 A;  1CZF A;  2VBK A;  2IS6 A;  4Z03 A;  1BLI A;  1KCD A;  2Y0S A;  2CW8 A;  2L7K A;  4MR0 A;  4NK6 A;  4URR A;  2DT7 B;  3SEQ A;  3TBI A;  2XZO A;  3OYE A;  5DN6 A;  2JA2 A;  3AL0 C;  4TSF A;  3E1S A;  3GQA A;  2F1M A;  5C1C A;  2KRH A;  3MKW B;  1P9Q C;  2VJ4 A;  4BE2 A;  5HVQ C;  3NWT A;  3IAS 2;  5CQE A;  3K4K A;  2GK7 A;  3VSK A;  2E1M C;  2VJ5 A;  1O8F A;  3EQN A;  4DOZ A;  2R4G A;  4BAC A;  5HKK A;  4U4B A;  2KQR A;  3V42 A;  2GJK A;  3OW7 A;  1MNE A;  3HUG B;  4CUG A;  3SEZ A;  2NSP A;  1K5C A;  4BE0 A;  2ZXH A;  2Z16 A;  4BU2 A;  4Y33 A;  4ITV A;  3TMO A;  4PJM A;  3RPU D;  1O8E A;  1OR7 C;  1X1D A;  3OR2 C;  1E0E A;  1COW A;  2CV0 A;  1WJC A;  3OY9 A;  2KLO A;  4OAY A;  2PYH A;  1D1A A;  4IQ4 A;  1Z3Y A;  2R7R A;  4DJA A;  3DWL E;  1EA3 A;  1E1Q A;  4E6K G;  3S93 A;  4B48 A;  2O17 A;  3VST A;  4CCK A;  3T51 B;  4OZZ A;  3OYI A;  3A3B A;  2F6C A;  2NST A;  4RMN A;  3OL3 A;  3PNT A;  3EQO A;  1UEL B;  1GLN A;  1O8I A;  1VJS A;  4HST A;  1WTH D;  2IQ7 A;  3DPL C;  4XLF A;  4C9Y A;  1O8L A;  4F55 A;  4QPO A;  1V5E A;  3H5N A;  4XOP A;  2PJR B;  3J7A Y;  3GQB A;  4JMQ A;  4XKW A;  3GVK A;  2MYS A;  2OUM A;  3QYB A;  3K4B A;  4B44 A;  3OYG A;  4ZDP A;  1WJE A;  2VBE A;  4XNF A;  2ELJ A;  1KCC A;  4KJZ A;  4XMY A;  2D3L A;  2GK6 A;  4KKS A;  2WAE A;  4LIV A;  1BHE A;  3I9V 2;  3PUB A;  3RTR A;  4DBR A;  1JRG A;  4DGW B;  1SKY B;  1X19 A;  4YRV A;  4AVZ A;  3BCB A;  2NZM A;  3T9G A;  4KIS A;  4YZA A;  3VSU A;  2UWM A;  1PKV A;  2XZP A;  1WPC A;  2V4J C;  4HSR A;  4PK4 A;  2OC6 A;  2Q1Z B;  3OAA A;  3DTK A;  3OYN A;  2JDI A;  4BDZ A;  1QHH D;  3H94 A;  2DIE A;  1S9H A;  1GQ8 A;  4YZQ A;  1WJB A;  1O8H A;  2KPM A;  2WAF A;  3PSF A;  3HL2 A;  2QY1 A;  4IKF A;  2JUG A;  2WA0 A;  2WAQ A;  3KEW A;  2M7B A;  4CH7 A;  3GQ9 A;  1Z3X A;  3LMM A;  4B3F X;  2E1M B;  3H9Q A;  1LFP A;  2KZV A;  2ZSI B;  4F92 B;  3JUR A;  3DTE A;  2QX3 A;  3H35 A;  4E7L A;  5LD2 C;  4Z05 A;  4OJ5 A;  2LRD A;  1NG7 A;  3BH4 A;  2VJJ A;  3FHN A;  3HC7 A;  2RRE A;  2QKM B;  1BPL A;  3L2R A;  2I8D A;  3GVL A;  3OYK A;  1W0J A;  3CP8 A;  4PUS A;  4C30 A;  4CCL A;  2ZZQ A;  1Y56 A;  2XF7 A;  2Z2S B;  4ZC3 A;  2IXS A;  1BOB A;  1X0C A;  2LRE A;  1OFM A;  2JIZ A;  4W8R A;  4W8T A;  3IAM 2;  3OOU A;  2JVH A;  3OYA A;  3K70 D;  2R7V A;  3HPH A;  1H80 A;  2P0W A;  2UVE A;  1UD3 A;  1HG8 A;  4E7S A;  2LZJ A;  4XOT A;  3OS0 A;  2JSP A;  3BG7 A;  4BE1 A;  2O1D A;  3M8J A;  1ERD A;  1H8E A;  1BN8 A;  2VAS A;  4C2T A;  2KMU A;  3K4C A;  2XND A;  1IDK A;  1N75 A;  3SZG A;  4DNT B;  4B3X A;  2GOX B;  1WMR A;  2CMP A;  3S3M A;  1FMV A;  2ZFU A;  1PXZ A;  1V5F A;  4XOR A;  2L5Q A;  3VYR B;  3EUK L;  3GRH A;  5CDF A;  4P22 A;  3UR3 C;  5CKT A;  3A2K A;  2XF5 A;  2INV A;  4AU7 A;  4F93 B;  2UUZ A;  2BW3 B;  3FBN B;  3JU4 A;  3G05 A;  2V9K A;  2GJR A;  3SDB A;  1EFR A;  4JQF A;  5HNH A;  3OYL A;  4EW9 A;  1V5G A;  2QXZ A;  4HWV A;  1OGO X;  3W2W A;  2ZZE A;  3OYH A;  1WFX A;  2IS4 A;  3H9G A;  3ZGK A;  2L9S A;  4LIT A;  1W9X A;  4BQO A;  4BUP A;  1E43 A;  3HAG A;  3UW0 A;  1G59 A;  3EUH C;  1UD5 A;  1BR1 A;  2KP6 A;  4EAT A;  1X4P A;  4XM3 A;  1E79 A;  3ZPP A;  4E7K A;  4BEH B;  3OS2 A;  1MMN A;  2R7T A;  3D5S C;  1ZEL A;  1WJD A;  4C2U A;  2JJ2 A;  2F5V A;  2ZXI A;  3AFH A;  1LDK B;  3DEE A;  5LFA A;  2DJI A;  4NC7 A;  4XLE A;  3CF2 A;  2XZL A;  4U87 A;  4CSW A;  1BR2 A;  3U21 A;  4BGD A;  2PJR A;  2KVO A;  2IGM A;  4XLH A;  4J00 A;  4TKO B;  2X1E A;  1Z21 A;  4Z06 A;  2LC2 A;  3PNV A;  5C1E A;  2CFO A;  3GBG A;  1O8D A;  3K4L A;  4XR6 A;  4D1Q A;  2XC7 A;  3LNN A;  1OLT A;  3OYB A;  2X85 A;  3OFN A;  2M4G A;  5TGT A;  1NBM A;  3NE5 B;  1DQU A;  3K4N A;  3IUO A;  3OIP A;  3L2V A;  2F4I A;  2BVL A;  2X6X A;  3HPG A;  3HOT A;  2K3P A;  3I3L A;  4HEA 2;  1X1A A;  1J09 A;  2JJ1 A;  1AA7 A;  1WJA A;  2X8K A;  3VMW A;  1YE9 A;  1DGW Y;  1EE6 A;  2IGN A;  5KHD A;  4GQN A;  2W00 A;  3HKZ A;  3IP4 B;  3VR6 A;  4RM3 A;  4XKB A;  3DLA A;  2AQF A;  2HVS A;  2WSS A;  1NRK A;  2LH9 A;  4N4O B;  4DNR B;  3LSH A;  3D5R C;  3H5R A;  1I8D A;  1W0K A;  3ZR8 X;  3L2U A;  4II3 A;  4NUB A;  2E5Z A;  4CCO A;  2Z6B D;  3QYF A;  4ZJZ A;  2WPD A;  3ZXS A;  2GJP A;  1O88 A;  3SUC A;  2IGK A;  3OL4 A;  4PFO A;  5AMV A;  1FX0 A;  2M3A A;  2CK3 A;  4XON A;  1FMW A;  1VZ0 A;  4HNT A;  5FRN A;  4NC8 A;  4X0G A;  3VYT B;  3OWT A;  4E7H A;  2VKD A;  1G8X A;  4Y4R A;  2WAD A;  2WJV A;  4B3G A;  2O04 A;  1KZL A;  3VYU B;  2DT6 A;  2K9M A;  4PJL A;  1V0E A;  4DK0 A;  4ZDL A;  3BCA A;  2CV2 A;  3AL0 B;  2R7O A;  2CUJ A;  1XG2 A;  3OPO A;  2V6E A;  3GQ8 A;  2E60 A;  4KKT A;  3PFY A;  1IRX A;  2LBF A;  1PJR A;  1JI8 A;  1MMD A;  2RNG A;  3N05 A;  2EWE A;  2L2O A;  3CJQ B;  4GRI A;  4JOM A;  3VSL A;  1OFL A;  5CQG A;  1PE9 A;  3G2B A;  3MD2 A;  5KCM A;  3W3C A;  2INU A;  2O0V A;  2VL8 A;  1WJF A;  2IS1 A;  1RU4 A;  4PSX A;  4G6T B;  4ZTF A;  1E3Z A;  3ZPN A;  2WZP P;  1O8G A;  1QJV A;  3FY3 A;  4NK8 A;  1V0F A;  2WY8 Q;  1AIR A;  3W2V A;  4E0F A;  2Z8G A;  2WBM A;  4ZTJ A;  4BJT A;  2M5S A;  1VLY A;  2FUG 2;  1OHH A;  3B8Y A;  1W36 C;  3FBI B;  4IX7 A;  4HRI A;  1D0Z A;  4ANJ A;  4C2L A;  2V7F A;  5HOO A;  3OYD A;  2BW3 A;  5FL7 A;  3DPT A;  4XKC A;  2E1B A;  2MAB A;  1OGM X;  2MC4 A;  1WJ5 A;  1PYV A;  1UD2 A;  2DXI A;  4RM2 A;  4LIU A;  1O8M A;  3FKJ A;  3OYM A;  2CV1 A;  3MMY B;  4KT6 A;  4NNJ A;  1PLU A;  4W8Q A;  3ZCO A;  2VB6 A;  3VWB A;  1OB0 A;  3LSI A;  1UAA A;  1TT0 A;  4BEH A;  3K4J A;  2X3H A;  2KRC A;  3BCF A;  2MD0 A;  3LSK A;  4UZU A;  3ZQQ A;  2R7U A;  2BVM A;  4XKV A;  4E7Z A;  4F91 B;  4HNU A;  4U7B A;  3MKZ A;  1RWR A;  4MXN A;  3A3G A;  4CZC A;  2AQE A;  2KL4 A;  2VQC A;  3GVJ A;  4OJO A;  2LG4 A;  3A1Y A;  4Y3O A;  2V1N A;  3B90 A;  1IB4 A;  1LKX A;  3S3O A;  1OOC A;  4PJN A;  1UD4 A;  4P1W A;  1N78 A;  2PMZ A;  3OEE A;  2NT6 A;  4J01 A;  2VQG A;  1R6R A;  3H0D A;  2VKH A;  2ZTG A;  1T0F C;  2WB1 A;  2DOA A;  2GOM A;  2CUZ A;  4B47 A;  4CCN A;  3S3N A;  1HVX A;  3FKS A;  4YZ0 A;  4XLA A;  1D1C A;  1Y6I A;  4E7I A;  1JTA A;  4XLC A;  4KKU A;  3CP2 A;  2VLA A;  4PSW A;  2X6W A;  4G7X A;  3PNY A;  2PYG A;  1Z7L A;  1D0X A;  2V31 A;  4D9J A;  1DGR M;  4AYB A;  3MKY B;  1U0J A;  2X1D A;  3WQZ A;  2UVF A;  2HVR A;  2MFZ A;  2CH0 A;  3OE7 A;  3NWS A;  2ZZG A;  2RQQ A;  3A35 A;  4ASU A;  4OJP A;  2NTB A;  4LG3 A;  1K28 D;  2F43 A;  4RLQ A;  1TZL A;  4QPQ A;  1NG6 A;  3A4C A;  2NOJ B;  3HG9 A;  2R7X A;  2WJY A;  3FPP A;  2XGJ A;  2D3N A;  2QE7 A;  4HIZ A;  2XSJ C;  3OYC A;  2QKL B;  5JHF A;  4CCJ A;  2WY7 Q;  3T56 B;  2V4D A;  4E7J A;  3VDX A;  3T53 B;  1D1B A;  4BL0 B;  4FET A;  3H5A A;  1IDJ A;  3QOD A;  5FRM A;  3K10 A;  4YEJ A;  5FRO A;  2Q2E B;  5IK2 A;  2W1O A;  3LL7 A;  4FXU A;  2W6I A;  2R7W A;  2OV7 A;  1X1B A;  2VXD A;  4BDY A;  1VF7 A;  4OJ6 A;  4H4K C;  2M0M A;  3OIQ A;  2UV1 A;  3UNG C;  3BC9 A;  3KEY A;  2BSP A;  1NHC A;  3OOC A;  4YZX A;  2IGO A;  2VJI A;  4TT3 A;  1T95 A;  3WWG A;  3LSM A;  3B4N A;  2R7Q A;  3VYS B;  1D0Y A;  2XF6 A;  4FAS D;  4G7W A;  2ZSH B;  3BLY A;  3DU5 A;  2V7Q A;  3RQ4 A;  3KYL A;  3L2Q A;  4W8S A;  1DBG A;  2X6Y A;  3DPU A;  2LOO A;  2A5W A;  3DKX A;  3OYF A;  3PJR A;  2HNH A;  1KTW A;  2X1C A;  3H9J A;  3K6G A;  3DKY A;  3ZIA A;  3LMW A;  2VXZ A;  3EPZ A;  3TL4 X;  3DTI A;  1O8K A;  3OMY A;  2ZTN A;  1W36 D;  4PJJ A;  4BQN A;  2M4K A;  2Z1D A;  3C2H A;  3M1C A;  3ONQ A;  3PSI A;  3OS1 A;  3D5L A;  4DK1 A;  4XN3 A;  1MMA A;  4R79 A;  4Z1M A;  2NT9 A;  2LY1 A;  4XD7 A;  3S8P A;  5HNF A;  1IA5 A;  2PEC A;  3CES A;  3LSG A;  2HZD A;  1X4O A;  3KX2 A;  5KNL A;  4IQJ A;  4L8J A;  4CCM A;  2W7N A;  3KRG A;  3AKZ A;  3RSN A;  3C2G A;  1HZE A;  4BXF A;  1DBO A;  1MMG A;  4XQF A;  2E5N A;  4DBQ A;  2XDV A;  1X1C A;  3QYE A;  1I18 A;  3RCO A;  4YEL A;  4IZZ A;  3OYJ A;  2ODL A;  3QOE A;  3DQV C;  4G6I A;  4NQW B;  1T5E A;  2KDO A;  3LFU A;  3SYT A;  2HLD A;  3BC8 A;  4HG2 A;  3W2A A;  2HU9 A;  1SFK A;  2JVG A;  3OR1 C;  1QHG A;  2VQH A;  2M7A A;  2XAU A;  4BJ6 C;  3L2W A;  2VPL A;  2XOK A;  3CJR B;  1O8J A;  3OEH A;  3ZSC A;  3S32 A;  4XN0 A;  2O5R A;  2R9V A;  5CPR B;  4E4H A;  4U49 A;  2A6T A;  2CW7 A;  1HA8 A;  1QCX A;  2BOL A;  1MAB A;  2LY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...