4XN3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 227
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn3A02
2X85A 1KCDA 4OJOA 3GRHA 1RWRA 1KCCA 2X6YA 2QX3A 4Z05A 4XLEA 3B90A 1JRGA 4OZYA 4XN3A 1O8GA 4YZAA 3FY3A 2NTBA 5C1EA 1JTAA 2QXZA 2PECA 1IA5A 2X6XA 3VSUA 4W8SA 4XN0A 2O04A 4Z06A 2BSPA 4XKWA 1IDKA 1K5CA 2NZMA 1RU4A 4XOPA 1OGOX 1O8DA 3VMWA 2O0VA 2X3HA 1BHEA 1PE9A 1WMRA 4EW9A 1EE6A 1O8FA 4YZ0A 3VMVA 3EQOA 3VSVA 1HG8A 2O17A 2INVA 3LMWA 1O8JA 3VSTA 4NK6A 1OFLA 4NK8A 1O8MA 2VJJA 1QJVA 4W8RA 4C2LA 3KRGA 1O8KA 3UW0A 2PYHA 2NT9A 4AVZA 3GQ9A 3B4NA 4OZZA 1PXZA 4XLAA 4XMYA 2O0WA 3T9GA 4MXNA 4YZXA 1AIRA 2NT6A 1O8LA 4U4BA 2X6WA 4XNFA 4W8QA 3ZSCA 1NHCA 4U49A 1O8IA 4OJPA 4PMHA 3GQ7A 4XR6A 2EWEA 2ODLA 1H80A 3B8YA 1QCXA 4OJLA 4MR0A 2IQ7A 2QY1A 4OJ6A 4YZQA 4XOTA 1VBLA 2UVEA 4XKVA 4XLFA 2PYGA 1RMGA 1OGMX 1CZFA 2VBKA 2NTPA 1XG2A 1O8EA 2NSPA 3ZPPA 1DBGA 1IDJA 4XM3A 2NSTA 3EQNA 5C1CA 1IB4A 2VJIA 4XONA 1OOCA 2Z8GA 4YEJA 2INUA 4HWVA 4Z03A 3SUCA 4XL9A 4XORA 4YELA 1X0CA 4I84A 1DBOA 1BN8A 1O88A 5AMVA 4URRA 2VBEA 2UVFA 1PLUA 1OFMA 4XLHA 4XLCA 2NTQA 1O8HA 3JURA 4OJ5A 2VBMA 2O1DA 4W8TA 3GQAA 3WWGA 1GQ8A 4XQFA 1KTWA 3GQ8A
chains in the Genus database with same CATH superfamily
3JRHA 4WXDA 4MEXF 2DT6A 1I27A 1NRKA 4YCQA 4A3BJ 4RS8A 2KIQA 2Y9YA 2M34A 5BQTA 3M3YJ 4B43A 2JUGA 3WTVC 2E1BA 4XLEA 2E1CA 1MRZA 3B90A 2HYJA 2O03A 3ZQIA 3IV5A 2BM1A 5L3GA 3M7GA 5E3LA 4F3QA 1ZRDA 2CYYA 3K4MA 4BQQA 3K4BA 4M6YA 4YDTA 4ZGNB 2O8XA 1ZTRA 3BR6A 1R71A 2R5YA 3M8JA 3BROA 5D4SA 4EQQA 2DODA 1FX7A 2IOUG 2NS8A 4TSFA 1VQMB 2J8KA 1D0ZA 1D1AA 3QPHA 1G3YA 4PSWA 1ZHFA 3CTAA 3DTIA 2DA4A 4ZZLA 3F8NA 2QYUA 3S15J 2ZL7A 3NAWA 3DBHB 1PJRA 3HUGA 1IC8A 4YEIA 1QGZA 4OIOF 1JKRC 2STTA 1S3JA 5CYVA 4L18B 2GLOA 3K6GA 2OK8A 2JJ7A 2E7WA 3F6OA 2K4JA 4ON0A 1S72I 2CV2A 1WOSA 2YWEA 4QUZA 1T56A 2PEXA 1MNMC 1EA0A 3COAC 1QRBA 4KN7X 1QZEA 5AONA 1UB9A 2VJJA 3ABMH 3K1NA 2C6YA 2BV6A 3VYUB 5DN6A 2JK3A 2DJIA 2XV4S 1ZM3A 3TEDA 2M2EA 4HX7A 4K2EA 5JHUA 5J47A 2GXBA 3LQ6A 2DEUA 1MSFC 4C43A 1PXZA 3P9KA 2MC4A 1K4ZA 1N0VC 5IYBJ 2BV3A 4RAYA 3OYBA 1ZG5A 2WY8Q 4IF4A 3EUKL 3G1MA 2BEOA 3GQ7A 2JQ7A 2EWEA 3CCUB 3JRIA 2EZHA 3PUMA 4ZYAA 3BQYA 3QPTA 4QWQA 3V7RA 4CCJA 3CMYA 4A3EJ 4KNYA 1FRNA 4OJ6A 2OAZA 4TV7A 2X1CA 1B59A 2L9RA 1QFYA 3AVXA 3DEEA 3N4MA 2HOTA 3IRQA 5EJCA 3HOWJ 2F3LA 2MBFA 2CUEA 1SEUA 4B3GA 2EBIA 3LFUA 3PM1A 1RUOA 1STZA 3DEUA 4EV0A 4B47A 1VQNI 3WY9A 3K4KA 1MSEC 1O8EA 2OCEA 5M5XJ 3FMRA 3ZXSA 2C4TA 3HXLA 3Q3AA 2LR8A 3PQJA 3J7YJ 4YXWA 5E6TA 4GCVA 1X4OA 2E5ZA 5BOXA 4AC0A 3GTKJ 3CW2A 1QPIA 1QVTA 1SVOA 1N08A 2NS0A 2ZZEA 1JUPA 2CW7A 2ECCA 3AL0C 2VBUA 1MDMB 2EV0A 2VBSA 1U3EM 4N9HA 2DETA 5LHIA 4OJ5A 2P6TA 2G9WA 4ZDLA 3HTSB 1ON2A 4HV6A 2ZL5A 3OZVA 1WORA 4RB0A 5DDGA 3PNYA 2VXDA 4X8IA 3FXKA 3ZQ7A 3K4NA 1RI7A 4YIFA 3GXOA 4BUPA 4LBZA 1S8NA 3LFKA 1KONA 4HLXA 1FRQA 1NBMA 5GP9A 4CUGA 5DUIA 3OSFA 5M5WJ 4P55A 1XMKA 2FEZA 3AL0B 2LLKA 2JSCA 5HLHA 3JREA 3AGPA 3FISA 1ETQA 5FRMA 4A3DJ 1RETA 2D9RA 3CJTB 2V5IA 2BXYA 3O6BB 4AVPA 1Y8RB 3ZMDA 1PP8F 2B9SA 3I56B 4QHYA 3ASSA 1IZ1A 2ZITA 2IPQX 4Z4TA 5E8IA 2JRMA 4KIFA 1BOAA 4JBAA 1FBUA 1QFJA 3EYYA 3Q38A 1VQMI 1XGSA 4O6JA 1FX0A 3I53A 1IN8A 4LIVA 1HKSA 2DN0A 3BJAA 2GXAA 4BAYA 3R6KA 2W84A 3KCCA 2H27A 4BY7J 2IGOA 3KLNA 3LQEA 5DEQA 1ETVA 4G94A 3QSYA 1HW5A 2FU4A 5JLXA 5LGNA 4UUSA 1YTYA 4C9YA 4Z4VA 2KQRA 1HF2A 2TCTA 2E19A 3ZCOA 1FT9A 4Y17A 2B63J 1V4RA 2QUFA 2D74A 4A3CJ 4XRSA 1I39A 1E3HA 1MGTA 1IHMA 2L9VA 3ASPA 2QENA 4M3EA 5H20A 2PLYA 1XPXA 3M07A 2KJBA 1JGGA 1UD8A 3BH7B 1RZ4A 5BS6A 2KIUA 2R93J 1NH3A 3D0SA 1MMSA 3NWSA 2PIAA 1WWXA 4C3JJ 4XLAA 2DLLA 5LBQA 1FSHA 3FK7A 2PJPA 1AIRA 3K69A 1U9OA 3AVVA 4E7SA 1KMHA 1FP1D 4W8QA 3OP1A 3BR1A 1R4MB 4S04A 3A01A 1ZKGA 2UUZA 3OJXA 2W82A 2P7CB 1EWYA 3L2QA 4FX4A 3GTQJ 3CCUI 2JVHA 2W25A 2XF6A 1VQLI 3Q9SA 5IYPA 3GVAA 3PIPF 3BG3A 5JVGF 4ENNA 2X4HA 3P27A 2ZJPF 2V9KA 2YWFA 3LAPA 1HVXA 2NTPA 2ZB9A 1TYVA 2B7EA 2F4IA 2V9VA 5FKOA 1BW6A 3TGNA 2K86A 3GLXA 4CO8A 4EEFG 1OMIA 3OWTA 2R7RA 1QRCA 1IDJA 1G7RA 3SYTA 1WHUA 3A2KA 1FSEA 4XKBA 3GVKA 3EQNA 5C1CA 1NHAA 4DBQA 4XONA 3SDBA 3ISXA 3CCRB 3UR3C 2VOOA 3CCJB 3OYJA 2O8KA 3FPPA 5DTDA 5IOYA 4EM0B 1P4AA 1YW7A 5H2FC 3OYNA 1WJCA 4RM0A 2Z3YA 1BN8A 2GJKA 1W5TA 2IAIA 3LA7A 1HA8A 4TMWA 4Y7NJ 1BJAA 1TUIA 3BG6A 3RY8A 1MBEA 1Q86D 3SQNA 3R0AA 5LGTA 2WV1A 1G3SA 2D3NA 3P26A 3GQAA 3ZN1A 2J5OA 2YX4A 4G7WA 3HRUA 4KKUA 2PE3A 5FO5A 4Z4SA 5C3EJ 3OYKA 1DDIA 1YHQB 2A07F 2MG4A 5L3CA 3Q0UA 5D6EA 2OTJB 1W4MA 3DBLB 1WVRA 1FOKA 3S3MA 2Z2SB 2CS3A 2VC0A 4XRSG 3JRAA 3R0JA 2WZNA 3RQIA 1IG7A 2KZGA 2ZFUA 1BI0A 4ETSA 1TT0A 3SFZA 5EGOA 4NHJA 2VZLA 1KK3A 1ERDA 3JAMK 3H5NA 3QFRA 2O04A 2BSPA 4H0EA 2XF5A 3P5JA 5FGMA 3TP3A 1GJRA 3HEFA 4BBSJ 1OB5A 2NOJB 3I56I 4L9JA 4EW9A 3VNVA 1Z91A 5JI6A 2BM5A 1LFUP 1MMGA 3FHNA 3FXMA 4I99C 5HS9A 2ECBA 5F1RA 4QSHA 4BY1J 3MHPA 3EQOA 1TP4A 4EGZA 4CSWA 1YO5C 2ZXJA 2D3LA 3VMFA 4FASD 2W48A 1OFLA 2MYSA 1K78B 1B8IA 3TO6A 2CUZA 1UD6A 3NE5B 1XS9A 5F0HA 4LB5A 3S14J 3HKZA 3ZBTA 2M4KA 1UHWA 5ICEA 4Y52J 3A8JA 4L0YB 5K5RA 1WU8A 4KN4X 2R7VA 3BH4A 3JQPA 2Z9OA 2BGJA 3ONUA 3R61A 3FKIJ 2KISA 2KVOA 2Z99A 2ICWG 2ZCWA 4R1HA 2W00A 2Q2EB 4X1EA 1UG0A 1T0FC 2DCEA 3WE2A 2EPFA 2ETHA 1J7KA 4UHTA 4X7EA 2HKXA 1A31A 4UZFA 2FX3A 3LAJA 3I1FA 3HRSA 1GQ8A 2LTPA 2FQ3A 2X9DA 3C2GA 3QWLA 5F0CA 5KAIC 3WHCA 1QCXA 4MR0A 1O7LA 5BNGA 4DW6A 5FRNA 3BPVA 4C2UA 1FIPA 1FOYA 2JN9A 4P3IA 5GPAA 1KK1A 4ZDPA 4JP0A 2Z6BD 3R6JA 3U1KA 2VB6A 2HI3A 1JNYA 4XLFA 2OYNA 2OV7A 3VPRA 1WDTA 2CQNA 1B4AA 5LLQA 5J1RA 5DS9A 3ASTA 1GXPA 1KGSA 3SDGA 1XGNA 1APLC 1J75A 1AWCA 5E18F 1B2RA 1P2FA 2UZKA 1K9MD 2XVCA 4KYWA 2MA3A 4E7ZA 3ERMA 1W0KA 2BVMA 1VQ4B 2V9PA 2L7KA 2CUFA 3SHFA 4JRAC 2ELJA 2LKPA 2JSPA 5L46A 3C2HA 3GO5A 3LJYA 3OKXA 3F23A 1Y0RA 5BMZA 1QO0D 2PMUA 4HYEA 5BSYA 4A69C 5AMVA 2XNJA 2JTVA 3BDDA 3HL2A 1EP3B 2GJPA 3FMSA 3CCRI 2G7UA 3CCJI 1IXRC 1OLTA 4CCKA 3IRRA 4PK4A 4LLLA 1JHFA 3PFIA 3L2VA 2LKXA 5F4JA 2OQRA 5KVRA 3W6JB 3QU3A 4OOXA 1T95A 4CCNA 1CNEA 1I1GA 1QFZA 2BW3A 2XKPA 2BF4A 2AO9A 2JRTA 5J8FA 4OPSA 3MCAA 4YC5A 4IOAF 4Q47A 1QA6A 3CPWB 1G7SA 3QAHA 2UXNA 2VJ4A 1JKQC 3ZPNA 2O9LA 2EJRA 2HXIA 3CCYA 1R6RA 2K5CA 5E17F 3CPXA 1YHQI 2CRGA 2V1NA 2JA7J 1I1SA 1MH3A 2HLDA 4UV9A 1J09A 4OMZA 2OTJI 5J35A 1H8EA 4KJZA 1S5LC 1F43A 1LDJA 4E7KA 4LLNA 1IA5A 2L4AA 4HQMA 4RA2A 1W35A 4W8SA 3U2QA 1EA3A 1E43A 3VYTB 3E97A 1DG1G 2D45A 3FBNB 3HRTA 4Q48A 4V2FA 5DM6F 1OCTC 1FDRA 3PSZA 2XGEA 3VMWA 1XCBA 2DK8A 1WSUA 4F55A 1SAXA 2VYQA 4TMXA 2XHKA 4HNTA 2X3HA 2M0CA 2A6HF 1JI8A 2XSDC 2DMNA 3BJOA 2VFMA 2HWVA 3H5AA 3I59B 3FZVA 2W4SA 1E3OC 1U78A 2ZJQF 3CDHA 2RQQA 4WXCA 2Z33A 1E3ZA 1IGNA 1XG1A 1O8MA 1X1PA 4J0QA 3HC7A 1TNSA 5DNSA 2X8KA 3HG9A 4IHTA 4E70A 5HXBA 3HOTA 4J01A 4ZDOA 1TQMA 1FY7A 2GAUA 4Z6YA 1V55H 5BSXA 3QYFA 1LLZA 3VFZA 1HDDC 2O3FA 3TP0A 3KETA 4CYCA 4U88A 1V5FA 2V26A 1U8BA 2DIEA 3GF2A 2J7KA 4DYCA 5DD8A 3WTTC 1MNDA 5FNZA 3QYBA 4AC9A 4M72A 1Y6IA 2XRNA 4GDFA 3JQRA 4WZEA 3BJ6A 1OCZH 4M71A 3PNTA 4BQOA 4Q5SF 1IUFA 2MH2A 2DCUA 4PUSA 4QVJA 5IYWA 3ZMVA 4JYKA 1Z05A 2R5YB 2JA8J 1G7CA 2FSWA 3VYSB 2PMZN 1R49A 1B9MA 5B1AH 2V4DA 2KKOA 4YHBA 1OGMX 5ILVA 2VPLA 4BL0B 1KTVA 2VBKA 1JKOC 2CW8A 3LYCA 1JA1A 3HUGB 2LNBA 2X6OA 2YX7A 3WTWC 1WP6A 4G5GA 3CESA 4P2NA 2R7SA 4GRIA 2DI3A 3FF5A 1JTXA 3KIOA 4Z4WA 1Z77A 2BY1A 1YIOA 1EP2B 3B6CA 2Y0SN 2PFBA 5LD2C 4KICA 1QUFA 2QEXB 4HWVA 5THXA 3GX4X 2VE8A 5EMNA 3E7LA 1VQ4I 4II2A 2HKOA 3J81Z 1UAAA 1R23A 1W0JA 1O88A 2OPTA 4Y15A 2ZJ2A 3H09A 1WFXA 2NTQA 3KX2A 1QHHD 4A3GJ 3AKZA 2E35A 1TQIA 2IA1A 4P96A 4I0AA 3JSPA 1YW9A 1MNEA 3EQLF 1Y1WJ 1R1TA 4HG2A 4AU7A 3BY2A 1Q7YD 2LBFA 5IP6A 4KIBA 1X2MA 1KU2A 3WU2C 2JJ2A 4LG3A 3TH0A 3FKSA 1KC8D 4PSXA 2VKDA 4I0BA 2COBA 3CCQI 1ZM2A 3WTXC 2LF7A 3EUAA 2KJCA 3ZBUA 2WB1A 3DCFA 3ONQA 3GFJA 4UUTA 3H3VK 2JPBA 1QPMA 1XN7A 5GAEJ 1VLOA 1FEXA 2P0WA 3AAFA 4BXFA 2X48A 3W2HA 2VPRA 2XPVA 2F1LA 1Q82D 1J9IA 3V76A 5EZGA 3E6DA 4HF0A 3T0YA 5JLVC 2VBWA 4XKWA 1F1ZA 3GUDA 3GFMA 4BHPA 1TTTA 3S2WA 2K4BA 4F92B 1S4MA 1X3WB 1BBYA 2E71A 2FOWA 2FBIA 2O0VA 1DDNA 4P9SA 3HGGA 3BG7A 3KP3A 4KFCA 1K4SA 2A3SA 3LSIA 3GTMJ 4YZ0A 2VFOA 3OS0A 1JT0A 2KRHA 3VO1A 3ES9A 2R7XA 3G05A 1FOXA 1MBHA 1ZLKA 1HG8A 2GA1A 1QA1A 1IXSB 3G71B 3ELKA 4JOMA 3TL4X 4F93B 4O3MA 4HZFA 1P4XA 2ELHA 2K7LA 4IHSA 1HW2A 1WPKA 1D2EA 4HSTA 4AF7A 3KP2A 4C2MJ 5FKKA 3V4GA 2JUCA 1L3LA 3LSTA 4Z4RA 3FIWA 1B6AA 4DZJA 1BPLA 3BQJA 3T9GA 4YZXA 2FBKA 2RV8A 3GIRA 1K61A 3JRBA 1TBXA 2XGJA 1XC5A 1BC7C 1S7AA 1RESA 4R8HA 2RC4A 4ZYEA 1QU3A 3MZYA 4M3GA 2DA5A 1S29A 2NOGA 1CGPA 2PI0A 3OFNA 4EJTA 3KEQA 2CU7A 4XR6A 2IS2A 1CQXA 4G1VA 3GEZA 4P1VA 1MH4A 2MH9A 3ISPA 4B09A 1SVMA 2FE3A 4CZZA 3A35A 1K8AD 2JMWA 2BVNA 4LLGF 1FNDA 4X7CA 5D5VB 2GIZA 3FKJA 3S1NJ 1WQ2A 5D5UB 3TO7A 1B72A 2BM7A 4BBRJ 1LM1A 5KCMA 2IP2A 1ZRCA 3ZZTA 3KE2A 5AN9A 1DARA 1MJ9A 1ACIA 4ZYDA 3H9NA 1R5NA 2V6CA 4A3IJ 1PVEA 2DERA 1FNCA 3SLNA 3ML3A 5LRSA 3GW2A 2RN7A 4HX8A 5CDFA 3T53B 3WNBA 1CF7A 3CCEB 3FWEA 4UUSB 3L7WA 1SAUA 4YELA 3LSJA 5HLIA 1DP7P 4IW3B 2LY1A 4I76A 1I50J 1V5EA 2DPDA 4Y7CA 3H0DA 4MTDA 1LFBA 2FF4A 3ZQFA 2QEXI 5FA6A 2QSFX 3ESWB 3L2RA 1OCRH 2BM0A 1WGXA 3I4NJ 4KKTA 3BY6A 3SZTA 2LRDA 1N8RD 4W8TA 3K0LA 4HDVA 3HJEA 2VFQA 5TISC 4WCGA 1UD2A 4X0CA 4KT6A 1VTNC 3PUBA 2DYSH 4EH1A 2TRTA 3SXYA 4LG0A 4BE2A 2E1NA 2KLOA 3VODA 2VNIA 1KQ0A 1MMAA 1MZBA 4ZV4A 2XASA 4IKFA 2QX3A 1EKEA 3GMEA 2IS1A 1F5TA 3SJZA 3N6ZA 1DGRM 1KRHA 5FD6A 1G2HA 4HRIA 4XKCA 1UELB 2L7FP 4I2OA 4M0LA 2BX6A 3K10A 4F91B 4MLOA 2VFPA 1HKQA 1O7FA 2BHYA 5A88A 2EWNA 3A3BA 3J7ZI 1HXDA 4RD3A 3JX8A 2MLKA 3C1DA 3IH4A 1K5CA 4ESBA 1KD1D 1COWA 2NZMA 1LB2A 1AA7A 2MW8A 5GAGJ 3MD2A 2HQ5A 2WAQN 2ELKA 2P8TA 2XUBA 2IA2A 5EZHA 1PUFA 5IT9Z 2V7UA 2ZL6A 1SFXA 4IOCF 3PA1A 1JJ6C 4UV8A 3WGHA 1IF1A 1Q81D 1IN7A 1R5GA 2QM3A 4BHBA 2FNPA 3SEZA 4RCYA 4LC0A 3RKYA 2X0LA 5K7ZA 2O7OA 4HF2A 4NK6A 3S1MJ 3OAAA 1EJ9A 4S0HB 3WG9A 4WWCA 1KA8A 4RM2A 3CCLB 1LE8B 2CQKA 3G71I 3WHBA 3B02A 2BMWA 4QV2A 1WTHD 3JU4A 1KQSB 4J00A 3O8HA 3BTCA 4CQJA 3AG3H 3E6MA 5D4RA 3W6VA 3WTZA 1BI3A 4NC6A 4ZH4F 1AKHA 3Q6RA 2BYVE 2ZFWA 2E7XA 2L4MA 5JMCB 3S2HJ 1XDSA 2D2WA 3K2ZA 2AQFA 2JDIA 2ADUA 4RD6A 2VFNA 3GFIA 1E79A 2JZYA 5EGOB 4QPOA 4XOTA 2Y31A 3IWFA 3QFTA 4WF2A 3TO9A 2NNNA 2JIZA 3IL2A 1G7TA 2X1EA 1K6YA 3HPHA 4B4CA 1Z3YA 2WZPP 3W5VA 2O0YA 3ONYA 2VI6A 4KISA 4OPWA 2V7WA 1D1BA 4V2GA 1YI2B 1W2BB 5DYMA 3DV8A 4HDUA 4TKOB 2CJJA 2LMDA 1IN5A 3C18A 1N78A 5FFZA 2ACJA 1QVFB 4CDGA 1B8IB 4Z03A 2IGKA 2V79A 2QSHX 1BX1A 2B0LA 4IX7A 2CV1A 4RPBA 1I6XA 1Y1VJ 1ZM9A 5F1JA 3H3UA 1J0RA 3WGIA 3CCEI 4URRA 1A5JA 1N25A 1ZELA 3N05A 5HKKA 1ETWA 3CC7B 4F7DA 2QGUA 3MCZA 1XMAA 1QNTA 5TRDA 3LWFA 3EPZA 4IPAA 3ZMZA 2QKMB 3G6EB 3HOVJ 1SKQA 3S8PA 3CF5F 4I01A 4NNJA 4HF1A 2X85A 1A04A 1RPWA 4BQAA 4UXNA 2BXZA 3QPSA 3HHHA 3A02A 3BTIA 2QCOA 3IKVA 4BJ6C 3GFLA 4RBOA 2XTYA 4MGRA 2EA4A 2V1XA 2JVGA 2LREA 4G12A 2QMUA 1B1BA 4P1WA 3FY3A 5ILSA 2A6EF 2QXZA 5JR3A 5K5QA 2V7XA 3RIQA 3ROUA 3JTGA 2H8RA 4RD4A 2BSAA 4CCOA 1G4DA 5CQEA 1NK3P 4BS9A 4AYBN 3DU1X 3E3VA 2AXTC 1OQYA 2F48A 4PFOA 1BHEA 4AWXB 4WWVA 2L9NA 4Y13A 2FMYA 1TWCJ 3CC2B 3IHUA 2XC1A 2H6BA 1F4KA 4YAWA 2V6EA 3O3KA 1EF4A 5GV8A 1Y56A 3R60A 3B82A 4NK8A 1FJLA 5EEGA 2M7BA 5DCMA 5HS7A 3FXLA 3H0GJ 4RAGA 1HZEA 1MMNA 2LF8A 2BW3B 1I3AA 5E20A 3HOUJ 1E17A 2ZZGA 2NT9A 4ENJA 5HZAA 5LFAA 5FD5A 1WH5A 2L01A 2P3MA 3CCLI 1KYWA 2KMUA 3ZQQA 1YITB 2XT2A 3R4KA 4RAZA 1B9NA 4LD5A 1NHCA 2ZMEA 5K1YA 3QFCA 4OJPA 3V8JA 2MABA 1FYKA 5IY5H 3M8FA 4C3HJ 5KNLA 3BZKA 5HNHA 1IN4A 1WRJA 5JHFA 1X3UA 4EJWA 1JKPC 4UNOA 2AQEA 2OBPA 4ZC3A 5IP7J 1LPQA 4FE4A 2R7ZJ 4ZCIA 2PX9A 3M1EA 1VQPB 3MWMA 2XKOA 2PYGA 2VL8A 1S7OA 2PLFA 1LNWA 3H1CA 5B6IA 2IJLA 1TYXA 3OIOA 4FETA 1KQ9A 5IK2A 1T8IA 1CZFA 1DABA 4KH3A 2L9SA 1X2NA 2L7ZA 2LVSA 3DTKA 2VQGA 1OISA 3MMYB 2WSSA 3OY9A 4B3FX 1LQ1A 2ZTNA 4ACBA 2WV0A 3VSLA 1TVCA 4OPVA 2LK2A 4HIZA 1OOCA 2STWA 1YI2I 2L5QA 2INUA 1J9ZA 2P7VB 2FMLA 4A3FJ 1E63A 1RKWA 3S93A 3MZ8A 3F22A 1IDZA 2UVFA 2WTEA 3R6SA 1X3ZB 1H8HA 1VJSA 3CQZJ 2HPIA 3HSEA 3S1RJ 2CRVA 2O1DA 4CYCB 1WSVA 4IHWA 2HYFA 4B8XA 3WWGA 3MQ0A 3NQOA 1GR1A 3CC7I 2W7ZA 1WI3A 2QYOA 2HCJB 1VQKB 1EH6A 1B23P 1Z7UA 4M73A 4HX4A 3LA2A 4HEA2 1U5TA 4CICA 4FXUA 3G6EI 1IRXA 4N3GA 2DOEA 2O17A 3DKYA 3RPUA 4OOVA 4FK8A 1E64A 4OINF 4DNCA 3OYMA 2C5BA 2QA4B 5C1EA 3A1YA 2GQFA 4PABA 3EDPA 2X6XA 1PUEE 1SFUA 4XN0A 4BH9A 5CVIA 1J59A 5D8LB 4RB2C 4BXXJ 4NDLA 3TOAA 1DPRA 2RREA 6PAXA 2EZKA 2IGMA 3E1SA 3PIOF 4HE5A 3RI4A 2W7NA 3W2IA 3WBKA 3ULQB 2YUSA 4HSRA 3W2AA 2QTLA 2V1DA 4EMSA 2EFWA 3VWBA 1REPC 1YRNA 4Y4RA 2PN6A 1I7PA 3RYRA 1EFUA 3F9KA 2B0RA 2F4OB 1QA3A 4RLZA 2YU3A 2ZXHA 3CC2I 2RC6A 5AIQA 4RD2A 3SZGA 3AG1H 2F5FA 5B5EC 2VIXA 3IKTA 1H9GA 1V5VA 2YSRA 3PNVA 4AF6A 2K9LA 4OAZA 2LBFB 3HSRA 3T8TA 2QZAA 1OYYA 1QA2A 1IRZA 1JT6A 1GV5A 4J19A 4KKSA 1HQCA 5JVTA 5FROA 4RM3A 3SY2A 1SM4A 2VKVA 4UAJA 4MFDA 1QH0A 2K02A 1E1QA 3MKZA 3GVJA 3HIFA 4U49A 2L02A 1FTZA 3IC7A 5DSZA 1X1DA 2DMUA 3V7CA 5CJ9A 4OMYA 1E3XA 5DS0A 2BY2A 4D9JA 1YITI 4Y9RA 3QOPA 1XE1A 5HDGA 5KHDA 3FXRA 1RQRA 1V5GA 4GFBA 3PETA 2C77A 3BCFA 1D0XA 1RNLA 5DV5A 1EP1B 2WR8A 1V3FA 2VXZA 2OZ6A 3L2UA 3LQQA 2VOPA 4H9GA 3DFGA 2COMA 1IJWC 2C78A 2MC3A 2BVLA 2ZNYA 5DCFA 5IPAA 1H9TA 1E0EA 1PDNC 3GCMA 4BU2A 1VQPI 2BY3A 1LEAA 4CGZA 3OYLA 2C2WA 3HOSA 2IS6A 1IN6A 3HTUA 1AHDP 3ZMUA 1HW1A 1M90D 4A3KJ 4XLNF 1CNFA 4RPDA 1D1CA 3IH3A 2ZBUA 3LNNA 3T8RA 1BJZA 1ULYA 4I84A 4U0VA 3TQNA 3Q6QA 4TMZA 3NAUA 1XD7A 2HDWA 3K9TA 3WU1B 4ESJA 1U8RA 4UUVA 1Z1DA 4DYQA 1RUNA 5FLVA 4PC3A 2KZVA 1DQUA 3HOXJ 1QGYA 4P3YA 4XLHA 2JPCA 5DM7F 2DJNA 4NBQA 3B73A 4PGGA 1XB2A 2YWHA 2DMTA 2E36A 4OOIA 4KA4A 1F20A 2WBMA 4I09A 2YU9J 2DFFA 1N75A 1KK0A 3WE3A 3SJPA 2CNDA 5BPDA 3OYCA 3A03A 2R4GA 1G3WA 3JRGA 5IYNA 1BI2A 3Q9VA 2D5VA 4HV5A 1BX0A 1ZRFA 4OJOA 4DNTB 3J80Z 1WH7A 4YFKF 2RNGA 3WTUC 2XAHA 1CQTA 2ZO4A 4M1KA 2W1OA 1GXQA 3LOCA 4L9TA 4HA8A 1VQKI 1XSXA 2XPUA 1B72B 4EJVA 3CB4A 3CLQA 2HDDA 2PBIA 2JA5J 4TMTA 5FL7A 3E5XA 5M5YJ 3QU6A 3DWLE 4FCYA 3JR9A 3KYCB 1E1RA 2QA4I 1OGOX 3HRMA 3I4PA 4G6IA 5TGTA 1HSJA 5E3OA 3VSKA 2GZWA 1CF7B 3SYJA 3F0CA 1IRFA 2A69F 1DP3A 1IAWA 2I8DA 2WAEA 2XZPA 5HZBA 4CZCA 3F6VA 2YPRA 3D5SC 3K4CA 2KIMA 4KMFA 3EUHA 1UD4A 1R58A 1UFMA 4H4KC 4A0XA 1SFKA 3ZQCA 1O3SA 2HQRA 1LKXA 4X7DA 2ID3A 5EEHA 1P7JA 3BNWA 3OW2B 4P9FA 2NVYJ 2DY1A 2EB7A 1KZHA 4DJAA 3JW4A 1GDTA 2Q8KA 2BBYA 2DBBA 2H1LA 4QPQA 1LDDA 3T5XA 3V42A 1W34A 5F27A 1W7PD 3LO8A 1O8KA 5ERIA 4M53A 2DYIA 1D8TA 4G7XA 1D0YA 4AVZA 3ABTA 4PJJA 2DOFA 3GYHX 1WPCA 5EG0A 4PC6A 1TC3C 4OZZA 4XMYA 2NYXA 3KEYA 4MQ9F 4LG0B 4YAUA 4UVAA 1ZK8A 2XGXA 4Z4ZA 1KU3A 4HQEA 3KP4A 1R1UA 1GV2A 2QLZA 3KEOA 4II3A 2QQAA 4Y33A 1D3YA 1MBGA 1ZYRF 1NG6A 1VQ7B 3CCMB 2QBYB 4QFMA 4HW0A 2R7TA 2OU2A 1JB9A 3CMMA 2A61A 1GUUA 2P4WA 2XROA 3T56B 1WXRA 4HAMA 3OYEA 2LSOA 1N07A 1TSPA 4JX4A 1Y0UA 2P6SA 2DFEA 3DLAA 1PUFB 1XFOA 1UHMA 1K6OA 3AVTA 3KZIC 2EIXA 2FUG2 4AIHA 4PAAA 3J7AO 4D5FA 3DKWA 2DFIA 3LMMA 1ZGWA 4EATA 1QZYA 1RKTA 3HPGA 3MVPA 1IDYA 1GT0C 2OC6A 3GLLA 4OP7A 2XRLA 5LEJA 1G3TA 1Z21A 4XORA 2IS4A 3WXMA 2M0MA 3ABLH 2M45A 1V0EA 1BI1A 1FNBA 2VBEA 1OCOH 1XMXA 3KP5A 1R5OA 1VHEA 2Q6LA 2LP0A 2W24A 4RD0A 4HNUA 3BY1A 3V7SA 2LOOA 2VBMA 1XQBA 2DXIA 2YWGA 3S17J 4X05A 1ZGAA 3O2PE 1ITYA 5IYRA 3JTHA 1NK2P 4IZZA 3H36A 5IYCJ 1IV6A 1TLHB 2P81A 2ZSIB 1AKHB 1YLOA 4N9IA 4XQFA 1ON1A 3HOZJ 1SKYB 4B4DA 1YOVB 5CQGA 2NPFA 2HOSA 4MQVA 3J81K 1FBQA 3G2BA 1LJ9A 2NNYA 1T6SA 1T33A 2X6YA 1SC7A 1XB4A 1DUXC 1JJ2B 2IEKA 3VO2A 1JRGA 2K27A 2OTLB 3OOPA 3Q3SA 3RIRA 4YIRX 2CV0A 1NB9A 4LBWA 4Y9UA 1BLIA 2EQRA 4IRHA 1OCPA 4RGRA 2QDXA 3SZEA 1Z6TA 2M5WA 3DLLF 2WA0A 2F4MB 4BDYA 4Z2YA 2R7FA 3K4LA 4X0GA 1JA0A 3GZ6A 1W36D 1RU4A 1HBXG 4DQLA 3MZHA 2A05A 2Q6OA 3RPUD 3E5UA 1A36A 4DBRA 1EE6A 3QQAA 5HODA 1T39A 1ZH5A 5LEKA 2EZLA 1PP7U 1LEBA 1P92A 1Z67A 5CVVA 3VSVA 3D5LA 3GTOJ 3DQVC 5K7HA 2DT7B 3F8CA 5CVRA 1YQAA 2INVA 3OZWA 4KITB 1Q1HA 4ZGQB 4ZCMA 3F8FA 1PJ5A 1ETXA 1F36A 1VNDA 1K4TA 4W8RA 2DMQA 3FK6A 5M3FJ 4C3IJ 2XZOA 4HNVA 1VQ8I 2VUMJ 4FE7A 1QVGB 3K2AA 4DGWB 4U7DA 1R4NB 1V54H 4JMQA 4MO7A 4X7FA 3W5UA 4C2TA 2QSGX 2OA4A 4WZKA 3W2GA 3M1CA 5J4VA 4NUBA 4KMUX 1TWFJ 4AD9A 2NT6A 4U4BA 2J5PA 2GIVA 3I3LA 3TW7A 5EF6A 1WOPA 2F43A 4MTEA 2EFQA 1D1NA 2Z16A 3AGQA 3F8BA 1QX4A 1QBJA 2FXAA 1X4PA 2FJ1A 1DDGA 3B8YA 2G7HA 2R9VA 4XRMA 3OJWA 4GXOA 1WKMA 1E62A 2RC5A 4XKVA 1VQ7I 3F3XA 1A6QA 1HC8A 3CCMI 1T6ZA 3IAM2 2O61A 5JFRA 1GAWA 4AM3A 4FWTA 3HSFA 1TYWA 3DEWA 2XB0X 2MFZA 4B48A 4I02A 4A2UA 3GTGJ 3CJNA 1WJBA 1UJ8A 1YX5A 3PQKA 3ZGKA 1K79A 1R22A 2B5OA 2NSPA 4WQMA 3U2RA 1EFCA 4K1XA 2DTZA 3M9AA 1GVDA 3LSKA 3VYRB 4XM3A 5GAHJ 5K5OA 2R7WA 4ACAA 2NSTA 4L0ZB 4RLFA 2ZMEC 4N4OB 4P26A 2B7CA 5IYQA 4YFOA 1XGOA 1X1AA 3ECHA 2GQQA 2ZBVA 4BYYA 4LBVA 5DCMB 4BE1A 3FHZA 4EM2A 1LUJB 1HSTA 1SMYF 3E6CC 3SEJA 3U21A 2JA6J 4R71A 3ABKH 4E7HA 1E2XA 2H1KA 4N3NA 5TJJA 4G7HF 4X06A 1TT5B 5D5XB 1OFMA 4WXHA 3X2QH 4E7JA 3GTPJ 4HOBA 4D0PA 4RD1A 1JTYA 2ZNZA 4NC8A 1TWGJ 3OYIA 1XDUA 4U0WA 3RPQA 4R79A 3QPLA 2HXOA 2IA0A 1T2KA 3FJOA 5F64A 4RB3C 1JJ8C 4PC2A 1YS6A 2ZMEB 1ETOA 1OHHA 2CSOA 3PFYA 2ZC2A 4ZTFA 3I0TA 1ZR2A 2E2JJ 1POGA 1YW8A 3WU0A 2NS7A 1N06A 2EFGA 3E20A 2NAZA 1KCCA 5HDNA 2VJ5A 4D5CA 1MJBA 1EV7A 3ASNH 1OB2A 2HPMA 3ZMSA 4W1UA 1FOWA 3CUQA 1XCVA 4OIRF 5C4JJ 3DTEA 1H88C 4DZPA 4ZYHA 4RLQA 2FD5A 3BLYA 1JUMA 2OTLI 2XEXA 5F4MA 2XNDA 4L8JA 5A89A 1QQIA 3WG7H 3K1MA 3AK5A 2QGGA 2KFDA 1I18A 1FYLA 2KP6A 2D1VA 1UD5A 2WPDA 3W5HA 2QVOA 4N0BA 2DDBA 2MD5A 3LSGA 4FHTA 5FB2A 2VE9A 1WMRA 1HOMA 3VB2A 4GYIA 2YR2A 5M3MJ 1ONVA 5HNFA 4BJ5C 3DF8A 3HB9A 3A01B 3B78A 1X1BA 3OW7A 1U5TC 2BOLA 1MMDA 1U2RA 2OK7A 1FLIA 3PO3J 2FVGA 4Z4YA 4GQNA 3QRFF 2I5UA 3RSNA 2XPWA 2OCCH 2IXSA 2GXGA 2LYCA 3PENA 2R6HA 3OIPA 2PYHA 5IT9K 1YX2A 3A4CA 4RDUA 4IHYA 3A8KA 3I9V2 3ZQGA 3B4NA 2X1DA 1J2XA 1U5TB 4LITA 1GO2A 2ZZQA 3BQZA 2W6IA 4XNFA 3FM5A 1Y0NA 2KT0A 3NEUA 2BGIA 3MEXA 3ZIAA 3GSIA 4A0YA 3I55B 2E2IJ 3OEHA 3I59A 2BE5F 1CLWA 3OR2C 1HDPA 4X6AJ 2VT3A 1VHOA 2PMZA 4ABZA 5E3NA 2CW5A 2Y48A 3BOQA 1T08B 1D5VA 2DQRA 2MLGA 3BR2A 2Q0OA 3FX3A 2PJRA 3BC8A 3DKXA 1KQ8A 2O6WA 4IXAA 2RKHA 1KZLA 2VN2A 3FM3A 4E0FA 2QQ8A 3UNGC 3ZOBA 2Y0SA 2H6CA 1QHGA 1DBGA 2UXXA 2WAFA 3ZQLA 1Z6RA 1BC8C 1YRNB 1KJZA 3BCDA 1L1IA 1A35A 5ICFA 4HLYA 1WJFA 2FOKA 5J4YA 4PJLA 3W2EA 2HTSA 3HZJA 3L9FA 3SUCA 3GTLJ 4M9SA 3M4OJ 5F0FA 3REOA 1T5EA 1AOYA 2ZBKA 4P25A 1UG2A 2VNHA 3G1OA 5A2QK 3CLOA 1QZZA 5ICGA 1N77A 4CHUA 2CK3A 3H3ZA 4XLPF 1O8HA 5LHHA 4ZYGA 2Z1DA 4XIDA 1YS7A 1NG7A 3OMYA 1R5HA 3S2DJ 4PGHA 2DOGA 4A0ZA 5A2QZ 3WGGA 2X0KA 4IQJA 5CPRB 1OCCH 2IRFG 5GTHC 5EDNA 1KCDA 2HEOA 2Z5UA 1Z9CA 5B1BH 3BT9A 4GGGA 1FYMA 5H5JA 2QQBA 2GOMA 4Q4ZF 3L2CA 1FWZA 5DD4A 5K7FA 4AIKA 2V7TA 2DW4A 2BN4A 1A8PA 2EIJH 3OOUA 1X19A 1O8GA 2E5NA 3IH2A 4MYTA 4UZEA 4C0SA 1AIPA 4ESFA 1Q9SA 3PA2A 5FIUA 2PECA 3H5RA 1YJ9B 2EINH 4BNCA 3DU6A 1VF9A 1I6HJ 3PVDA 4YAFA 3LSPA 3H35A 4ZCLA 1IDKA 3QP6A 2FA5A 2HQNA 4OOSA 5TY0A 2M7AA 1LFPA 1N0UA 1VFCA 1OGIA 2CH0A 4JK1X 4CXFA 2OBRA 2ISZA 3U9GA 4L5EA 1FMVA 2CUJA 5HLTA 1O8FA 4ZTJA 2DA2A 2K85A 3CP8A 1XGMA 3VMVA 5C44J 2IT0A 1D8JA 4KIGA 2VASA 1WJEA 2Y30A 3BG5A 9ANTA 5IYDJ 1VQLB 3SEQA 4A6EA 1IJFA 2FQ4A 5AIPA 1O8JA 3DBRB 5FKNA 1R5BA 1I8DA 4W97A 3RKWA 3K7AJ 1S0UA 4YALA 4MIMA 1WZ2A 1ORKA 3C7JA 3SZPA 1R36A 3GQBA 5F4OA 4QIWN 3WYAA 3BWGA 1ZARA 2R3SA 3HDDA 4BE0A 1Z0XA 2W6JA 3HKZN 2E34A 2LC2A 3GQ9A 2PMHA 1IJEA 3OZUA 3P4GA 3OOCA 2AS5F 2A6TA 2DDAA 2PG4A 4M3DA 2VNJA 5FO1A 1W7PA 2GA2A 4RDLA 2ID6A 2CO5A 4BEHA 5F04A 1O8IA 2XAJA 1Z3XA 3RJPA 5HVQC 2XZLA 3EUHC 2BPOA 2Q6IA 2CQXA 2KL4A 4WZTA 4LJZF 2O5RA 2QTZA 2M4GA 2OF7A 3PSFA 5CVUA 3I55I 1Y0YA 1BJKA 1JHHA 3BZ6A 4G9YA 4KT5C 4PCQA 1OFCX 1M1KD 3FXUA 3H9QA 4BPRA 2W85A 2GK7A 2HU9A 5E79C 3U6KA 4X07A 2XOKA 2R7OA 5IP9J 1NDHA 2LY2A 3BR3A 2L3DA 2HGCA 1F60A 1UZCA 2QE7A 3BZCA 2Y75A 3TW6A 1IW7F 4YG2F 2V7VA 1MBFA 2FX0A 3B8HA 4PDKA 3A1PA 2XTXA 3PUNA 3MFKA 1IB4A 4ROXA 4A93J 5FO0A 1ODDA 4OIPF 3ZZUA 1R7JA 3TDUC 3ZQHA 2Z8GA 1F9NA 3W3CA 1ZG3A 1ZUNB 1XSDA 2M8GX 1DBOA 5H6RA 1YLFA 2EV5A 3C2BA 1DU6A 2DT5A 1QUEA 2LZJA 2OBTA 3JCUC 1LLWA 3PJRA 4IHVA 1PLUA 1M1EB 4XLCA 3LMWA 2NXNB 2V7QA 1W87A 4D1QA 5EG0B 4P6VF 2G0EA 1VQ5B 2FNAA 5DUKA 5GV7A 1T38A 1O3QA 1P4WA 1VQOB 3G3ZA 2HOAA 3KZZA 4L9NA 1IV8A 2JWTA 5J3LA 2HDNB 2M30A 2A68F 4MNUA 3L1PA 2LH9A 1HA3A 1SD6A 5JLWA 1KU7A 1BR4A 5KAFC 3MKYB 1OR7A 3WTSC 4AIDA 4OZYA 1SD7A 1UMQA 1FP2A 2XB5A 1EFRA 1JTAA 1ZAOA 2ESNA 4HPQA 2VLAA 4B44A 3VR6A 4L5JA 2WAQA 4BACA 4XICA 1MW7A 3VSUA 1L0OC 2KHMA 2DA3A 3OS1A 2XF7A 1UCRA 4XOPA 3SLDA 3CCVB 3CMEB 3OIQA 1YG2A 1PKVA 4RCZA 1QRYA 1YJ9I 2DYRH 1PE9A 1WJ5A 3ASOH 2CC2A 1GVJA 4P5OA 2K9QA 1FNMA 3TMOA 1RR7A 4CH7A 4U9UA 3ZR8X 2BGCA 4EVIA 4UVCA 2GPJA 1BR2A 2M1BA 1I3QJ 1O3RA 2IBDA 4NQWA 4PFPA 2B7BA 4G7OF 2DAOA 3TDZC 4Z4UA 3G4SB 4JX6A 1RQPA 4NC7A 2R5ZA 1UD3A 1QJVA 4NBSA 3ZUGA 4C2LA 1R00A 4RGUA 1GLNA 3KP7A 1HF0A 2QZ8A 2XNCA 1N05A 5E3MA 1SD5A 2ESHA 3Q0WA 5J1UA 3AG4H 3ZPLA 3ASRA 3F72A 2FBHA 1NB0A 3WBJA 1MBJA 2EV6A 2H09A 2VQHA 3CP2A 4IQ4A 1MABA 3BR0A 4XD7A 4ASUA 2O0WA 4A6DA 4MXNA 3N90A 3A8IA 3L00A 3CO6C 5KW9A 3ZSCA 4CA0A 4A3JJ 3ERED 1RC9A 4HBLA 4TN1A 1MKMA 3GBGA 1IB0A 1C0WA 2RAEA 2L54A 5B66C 1TL8A 2O6GE 4DYRA 3A3GA 2XGDA 1BR1A 4AUXA 2R0QC 2NVTJ 3BH6B 2ZZFA 5J6XA 4UZUA 2HZDA 4LFUA 3DXJF 4JQFA 3GZNB 3FDYA 1ZM4A 5HLGA 2L2OA 4M9XA 1KU9A 3FMQA 4RB1A 2XAUA 4L9VA 4ZJZA 1LE8A 4MYUA 1QGPA 2HOEA 1VI0A 1U6GA 4WK8F 5HS8A 1XSVA 3GTJJ 4IO9F 3UKGA 5FKLA 2OJED 2RVCA 3P7NA 1XG2A 2D1HA 1BW5A 1TNTA 5BPIA 4LB6B 2JJ1A 3CC4B 2H94A 2DOAA 5TV2A 5D6FA 1ZR4A 2KDOA 3CF2A 4YEJA 2IGNA 2L7MP 5D5WB 3SKBA 3CMAB 4BGDA 2K9SA 4FQGA 5LRRA 2WJVA 2QN6A 2F1MA 3A0HC 3T1BA 1JUSA 1R1VA 3OL3A 1VQ8B 5L3DA 3S32A 4YAOA 1RIOH 1W9XA 5FFXA 2GOXB 4JX5A 5E8GA 2VQLA 1HLVA 5E1XA 3C3WA 4V19K 3V7AA 1BM9A 2W57A 1ZGJA 3IP4B 2EFPA 2K9NA 2VBVA 4DQKA 1VQ6B 2LY9A 2TDXA 5L3EA 1JGSA 2BY0A 1V0FA 1EH7A 1IUYA 3JAMZ 3CDIA 3D26A 2HDCA 1KTWA 2XAFA 4GO1A 3MKWB 5L3BA 1RRJA 3H9JA 2VQCA 4LOCA 1VQ5I 2LFBA 4XBFA 2CG4A 3RQ4A 1KQ5A 1RWRA 1VQOI 2ZTGA 2UWMA 1SFOJ 4C30A 2R7UA 3NB2A 2XAGA 3VNUA 2QF7A 2QQ9A 4XN3A 2QWWA 2IW5A 2XAQA 2RNJA 4I7HA 3G73A 2NTBA 4YZAA 3AVYA 2WB1N 3TBIA 1SANA 2VKEA 3PL8A 4AYBA 1W1WE 2DA7A 2F2EA 4Z06A 5EYRA 3HOYJ 2L0KA 2XIGA 1TW2A 1QQ1A 1P7IA 1A6IA 3W2VA 3J80K 1QVUA 3VDXA 3CJRB 4RJLA 3HBLA 2OBSA 2X51A 3K1PA 2Y9ZA 2P5LC 1K7AA 1BL0A 2EZIA 1DPUA 4OIQF 2ZXWH 4DK0A 2X3UA 5ED4A 3CCVI 2EK5A 3CMEI 1W0TA 2K3PA 5E1WA 3OSGA 1T6YA 4NB5A 3H94A 4ZZDA 4PC7A 3KYDB 4BJTA 4ENMA 2XC7A 2OZUA 2ZKZA 1YFHA 3I4MJ 5J3OA 1WJDA 2V1UA 4IRGA 4QTRA 3CUQC 3W2WA 3BPXA 3U1DA 5IOZA 4XSZF 4M6VA 1TYUA 3E0JB 1MDMA 1DGWY 3CRZA 3KRGA 3ECOA 3OS2A 3NARA 1Y8QB 4PZJA 4ENKA 3E1YE 1TZLA 3KLOA 1U9NA 1E3PA 2EFOA 3G4SI 2DU9A 2GREA 5IT3A 1EH8A 1WCMJ 3BTJA 2M87A 3F21A 4MHGA 3I5UA 3WODF 1MBKA 3IWZA 3P9IA 1FNNA 5GADJ 1FIAA 1I5ZA 2EFNA 4PMHA 4L5IA 2DFHA 3H9GA 3OL4A 4CYDA 3CD6B 3CUQB 1TWAJ 1BIAA 3BTLA 2VT2A 1S9HA 1VQ9B 2CW0F 2F5DA 2ODLA 2HFHA 2VBYA 4P6YA 3DPUA 2IQ7A 2QY1A 2FRHA 1BOBA 3ZN0A 3S3NA 1DU0A 1VBLA 1YIJB 1O4XA 2HVRA 3EYIA 2GWRA 4A3LJ 3L09A 2Q1ZB 5FJ8J 4F52A 4A5MA 2HVSA 3N97A 1P4MA 3CCQB 4G8XA 2XSJC 4N4NB 1ZG1A 2RGVA 2ZSHB 4OPOA 1QGAA 5JBQA 4DNRB 1G6NA 1LDKB 3HM5A 4E6KG 1JXSA 4KUMA 2F5VA 5LHGA 4PJNA 3Q0VA 2BZTA 1EXMA 4RGXA 4F7ZA 3PUFA 4QLCU 1OGJA 5HOOA 3A0BC 2JN6A 1PJ7A 1O3TA 3S1QJ 5CLSA 4Q7JB 4XL9A 2VBXA 1BQEA 3ZMTA 3CCSB 3SFIA 1W5CC 2H8WA 2KPMA 5B3SH 3CC4I 1K28D 3K4JA 4BHCA 4HE6A 3OYAA 1BA5A 4OM9A 3AG2H 2CQQA 2VBZA 2J8IA 3JURA 3CMAI 4BQNA 2R92J 2ZXIA 3HGYA 2M9HA 4YFXF 4BDZA 1PJ6A 4GYGA 4G7ZF 5J8CA 3S3OA 2MD0A 1SD4A 1U2WA 2M5SA 1UHSA 3LQRA 4MFEA 1K73D 2F6CA 1RR8C 4I6ZA 3ABUA 4UB8C 1VQ6I 4G1BA 4BKXA 3AVWA 1GHCA 2P5KA 2OQGA 2K3FA 4IL6C 1FC3A 2K40A 4EJUA 2AHOA 3KEWA 1ETKA 4Z05A 1Q1VA 4XSXF 2DQLA 3LA3A 4E7LA 1MJAA 2XGCA 1H8AC 1NJID 2GM4A 1D8KA 2PJRB 1K83J 2NVUB 2NRAC 2XT4A 3WQZA 2HS5A 3IUOA 3RKXA 2NV4A 1EZGA 2JT1A 2KRCA 1R5ID 1ZQ3P 1YJNB 1TW3A 4LK1F 1O8DA 1BMFA 4O5VA 1G59A 3OEEA 3KFWX 1P6RA 2WYRA 4B3AA 3K70D 3LNQA 3KP6A 1USSA 3CDLA 1WJAA 1HKTA 2HMAA 3B6AA 4TT3A 3RDIA 5GPCA 4PGOA 4M9ZA 4V02C 3SJMA 2KIFA 4UB6C 2WJYA 2QKLB 4LIUA 5TR9A 3CUOA 3V8LA 2E1OA 2R7DA 5FLXK 3W6KB 4DOZA 3UW0A 3ZP5A 3VEPA 5FLMJ 3ZC3A 1VZ0A 1J5YA 4S05A 1AU7A 1IRGA 3CJQB 2HYGD 1JE8A 2NVXJ 1P9QC 4FT8A 4U0YA 2F5CA 5FLXZ 5ILUA 4M6XA 1IO2A 2K9MA 3NWTA 1TQPA 3PSIA 3QFSA 3CXCB 2BM6A 2X6WA 3GVLA 3JRDA 3D1NI 3GWZA 3I58A 1FTTA 2CGPA 2E1MC 1U0JA 4AIJA 4YRVA 1XTAA 4OAYA 2V4JC 4ASNA 3RZDJ 3NRVA 2PMDA 1H80A 3BP8A 1IXCA 4OJLA 2V31A 1T6XA 4WZLA 2RQPA 1GAQA 4PC1A 2ZJRF 4G6TB 4KDPA 2LDUA 3J7AY 3WTYC 3SQVA 4M74A 4M3FA 3CD6I 3KZYA 2CQ7A 3OR1C 2KDZA 1XX5A 1VQ9I 1FBSA 2CFOA 1OYWA 1SMTA 2VC1A 3VOEA 2VODA 1UMKA 4NCNA 1RMGA 4CCMA 3BCAA 3OYGA 2DPUA 3PO2J 5CVJA 3KYLA 1KK2A 4B1RA 3MN2A 4IJAA 3OPOA 3LL7A 1FPQA 2Y0MA 3I64A 4RAFA 1YIJI 3S16J 2N8GA 1ELOA 4UVBA 2DK5A 1TLLA 3FPKA 2OD5A 3ZPPA 2E1MB 1H0MA 2WY7Q 1ZLJA 1HCRA 3QP5A 4FTHA 3BC9A 3HYIA 3OV8A 3DPTA 4PJMA 3P9CA 1ZN2A 2AXLA 5D8KB 2C5HA 2HTJA 1QG0A 1YJWB 1X0CA 2HZTA 3JRCA 2NVQJ 4U87A 5J1YA 1VF7A 2EIKH 3I71A 1K78A 4LGWA 1H85A 4M3BA 5J40A 3G1LA 2I1LA 4IHXA 2G0YA 3MKLA 4FISA 2Y69H 3CCSI 3ASQA 4DQ2A 1WOOA 2LD5A 4EJOA 1ETYA 4IEJA 3CO7C 5A8AA 5KK1A 3U6BA 2V7FA 3LVBA 3WNDA 2LG4A 1OB0A 1W7PB 4RGSA 1GVHA 3AFHA 4BEHB 3GQ8A 2PQ8A 4RDKA 3BG9A 3TOBA 2DA1A 2HR3A 3Q39A 4QVAA 2VKHA 2DMPA 2Y2ZA 2Q2EA 3RKQA 3GRHA 5ICCA 2CBXA 2EA2A 2EH3A 3EETA 3L2WA 2DO7A 1NTCA 4XK4A 1O57A 3RYPA 2VONA 1LVAA 2IVMA 4MEYF 4RDJA 1R9TJ 4FN5A 2UV1A 1OFEA 3FXJA 3MMPA 1T98A 1W5SA 4OU0A 3CZ6A 5F08A 3TKYA 1MD0A 4CCLA 3MAJA 1OFDA 3HHGA 2EILH 2CWEA 3F8MA 2DTRA 4YFNF 1SFEA 1W0UA 2F5EA 3OE7A 1BIBA 1BN5A 4EM1A 2GJRA 1KYZA 3BR5A 2HNHA 2E1RA 5KSWB 3PSSA 2ME0A 2MGQA 4U7BA 4Y3OA 3JRFA 4LK0F 1H89C 2VNKA 1ZREA 2WWYA 1Z7LA 1T0FA 1VLYA 4M2LA 1S72B 1S7EA 4ANJA 1YJNI 4IRIA 3HAGA 4BXUA 4DK1A 3LSMA 1OR7C 4RMNA 4UY8I 1WI9A 5LGUA 3VSTA 4D7MA 1OPCA 4PJ0C 1WSRA 2HQAA 1S6LA 3D5RC 3M8EA 4XRFA 3V8KA 3K70C 2BHZA 4E4HA 1OJLA 1Y39A 2YUHA 3GZ5A 4Z1MA 3QODA 5H59A 3O8GA 5E1ZB 4B3XA 2I10A 5GTIC 2AHQA 2LKSA 3I54A 2CFXA 4IVNA 4WX9A 2F4NA 4P12A 4LMYA 1FMWA 1YE9A 5C4XJ 2X53S 3FXOA 5CKTA 1TTYA 5FKMA 4TMVA 1O8LA 1OKRA 3WNCA 3FBIB 3OYHA 2GK6A 4I98B 1H42A 3KL9A 1USTA 1W36C 4YIIA 5LMZA 2RDPA 3DPLC 4A3MJ 4M4SA 1YX3A 4G6QA 4P22A 2WC2A 2BM4A 4OWRB 1AMOA 3OYDA 3AVUA 2HVQA 4YZQA 2GBYA 3QOEA 3DDYA 2UVEA 3RZOJ 4DIQA 1VQNB 3BCBA 3FXQA 1PYVA 1SVLA 1YYVA 2OUMA 1TWHJ 2E2HJ 1EFTA 3T51B 2WADA 4G6DA 3E6BA 4P9UA 2XDVA 5F6FA 2KRFA 4A12A 3OYFA 4ITVA 3ML6A 2P5VA 1OYIA 2EIMH 3DU5A 3J81k 2M8EA 2ISYA 5H6QA 2MSYA 2Q6KA 2VJIA 4EGYA 4D7NA 3ZZ0A 1K8FA 3IAS2 1LVKA 4NQWB 2DA6A 4FX0A 5L3FA 3JSOA 3E5QA 2ME6A 3H92A 5EEAA 2R5ZB 1X58A 2CMPA 2R7QA 2M3AA 2JA2A 3ZRGA 2QBYA 4LBYA 3LSHA 1FZPB 3RTRA 4A5NA 3W2FA 3Q5FA 2YS9A 2VBTA 1X1CA 1YJWI 5HDKA 3JQQA 3RCOA 1ENHA 1MIJA 3QYEA 1G8XA 2A5YB 2C4UA 3LSRA 2E60A 2CF4A 2XTWA 2A5WA 3KPHA 4E7IA 1D5YA 3QE2A 3DP7A
chains in the Genus database with same CATH topology
3FKSA 2DT6A 1NRKA 4PSXA 4OJOA 2VKDA 4DNTB 2LH9A 2RNGA 4B43A 2JUGA 2W1OA 1BR4A 2E1BA 4XLEA 3MKYB 2JJ2A 3EUAA 3B90A 2WB1A 3ONQA 4OZYA 4F3QA 3K4MA 2P0WA 5FL7A 4BQQA 3K4BA 4BXFA 1EFRA 1JTAA 3DWLE 4HPQA 2VLAA 4B44A 3VR6A 3M8JA 2WAQA 4BACA 3VSUA 1MW7A 4XKWA 2KHMA 1E1RA 4TSFA 3OS1A 2XF7A 1D0ZA 1D1AA 4XOPA 4F92B 1OGOX 3OIQA 4PSWA 1PKVA 4G6IA 3DTIA 5TGTA 2O0VA 3VSKA 1PE9A 1WJ5A 3BG7A 1PJRA 4P5OA 1DP3A 3LSIA 4YZ0A 2I8DA 2WAEA 2XZPA 3OS0A 2KRHA 3TMOA 4CH7A 4CZCA 2R7XA 3ZR8X 3G05A 3K6GA 3D5SC 3K4CA 1HG8A 1BR2A 1UD4A 4H4KC 2CV2A 3LMWA 1SFKA 4JOMA 1LKXA 4PFPA 3TL4X 4F93B 2VJJA 1UD3A 4NC7A 4DJAA 1QJVA 3VYUB 5DN6A 4C2LA 3V42A 2DJIA 4QPQA 1GLNA 1O8KA 4HSTA 4G7XA 1D0YA 4AVZA 1WPCA 4PJJA 4OZZA 1PXZA 4XMYA 2VQHA 3CP2A 2MC4A 3KEYA 4IQ4A 1BPLA 1MABA 4XD7A 4ASUA 2O0WA 4MXNA 4YZXA 3T9GA 2XGJA 3OYBA 1QU3A 4II3A 3ZSCA 2WY8Q 4CA0A 4Y33A 3EUKL 3OFNA 3GQ7A 4XR6A 2EWEA 1NG6A 3GBGA 3A3GA 1BR1A 2R7TA 3A35A 4ZYAA 3CMMA 4OJ6A 3T56B 4CCJA 2ZZFA 3FKJA 3OYEA 4UZUA 2X1CA 2HZDA 4JQFA 3FDYA 2L2OA 3DEEA 5KCMA 2XAUA 4ZJZA 3DLAA 4B3GA 3LFUA 2FUG2 4B47A 3K4KA 1XG2A 1O8EA 3LMMA 3ZXSA 4EATA 5CDFA 3HPGA 3HXLA 2OC6A 2JJ1A 3T53B 4YXWA 2DOAA 1X4OA 2E5ZA 2KDOA 3CF2A 2IGNA 4YEJA 1SAUA 1Z21A 4XORA 4YELA 4BGDA 2IS4A 2ZZEA 2M0MA 2CW7A 2LY1A 3AL0C 1V0EA 2WJVA 2F1MA 1V5EA 3H0DA 3OL3A 2VBEA 3S32A 1W9XA 2GOXB 4HNUA 3L2RA 4OJ5A 2LOOA 2VBMA 4ZDLA 2VQLA 2DXIA 4W8TA 4KKTA 3IP4B 2LRDA 2IS2A 3PNYA 4IZZA 1GQ8A 2VXDA 2ZSIB 1UD2A 4XQFA 3K4NA 1SKYB 1V0FA 4KT6A 5CQGA 1KTWA 3PUBA 4BUPA 3MKWB 1KONA 1NBMA 3H9JA 2VQCA 4CUGA 4BE2A 2KLOA 3RQ4A 1MMAA 1RWRA 3G2BA 2ZTGA 3AL0B 2UWMA 2X6YA 4IKFA 2QX3A 4C30A 5FRMA 2IS1A 2R7UA 1JRGA 1DGRM 2CV0A 4HRIA 4XKCA 4XN3A 1BLIA 1UELB 4YZAA 2NTBA 3K10A 4F91B 4MLOA 2WA0A 3TBIA 3PL8A 4AYBA 4BDYA 3A3BA 4X0GA 3K4LA 4Z06A 1W36D 2NZMA 1RU4A 1COWA 1K5CA 1AA7A 3W2VA 3MD2A 3VDXA 3CJRB 3RPUD 2X51A 4DBRA 4DK0A 1EE6A 1FX0A 2K3PA 4LIVA 3VSVA 3D5LA 3H94A 3SEZA 3DQVC 2DT7B 2IGOA 2INVA 4BJTA 2O17A 2XC7A 4KITB 1WJDA 4NK6A 4C9YA 2KQRA 3W2WA 3OAAA 3ZCOA 4W8RA 3E0JB 4RM2A 2XZOA 1DGWY 3KRGA 3OS2A 4DGWB 1WTHD 3JU4A 4J00A 1TZLA 4JMQA 1UD8A 4C2TA 3NWSA 3M1CA 4XLAA 4NUBA 1AIRA 2NT6A 4U4BA 4E7SA 3I3LA 1KMHA 4W8QA 2F43A 2Z16A 4PMHA 3H9GA 2AQFA 3OL4A 2JDIA 2ODLA 1S9HA 1X4PA 2UUZA 1E79A 3B8YA 2R9VA 2W82A 3DPUA 2IQ7A 4QPOA 2QY1A 3L2QA 4XOTA 1BOBA 3S3NA 1VBLA 4XKVA 2HVRA 2JVHA 2XF6A 3IAM2 2Q1ZB 2JIZA 2X1EA 1K6YA 4F52A 3HPHA 2WZPP 1Z3YA 2V9KA 2MFZA 4B48A 2HVSA 1HVXA 2NTPA 2XSJC 4N4NB 4KISA 2ZSHB 1WJBA 1D1BA 1YX5A 2F4IA 3ZGKA 2R7RA 4DNRB 4E6KG 1LDKB 3OWTA 2NSPA 1IDJA 3VYRB 2F5VA 3LSKA 4XM3A 3SYTA 4PJNA 2R7WA 4XKBA 3A2KA 3GVKA 4TKOB 2NSTA 3EQNA 4DBQA 5C1CA 4XONA 4RLFA 4N4OB 3SDBA 1N78A 5HOOA 1X1AA 3UR3C 3OYJA 4Z03A 4XL9A 4BE1A 2IGKA 3FPPA 4IX7A 3OYNA 2CV1A 1WJCA 1BN8A 2KPMA 3U21A 1K28D 2GJKA 3K4JA 4E7HA 4URRA 1HA8A 3OYAA 1ZELA 3N05A 5HKKA 3BG6A 1OFMA 3JURA 4E7JA 4BQNA 2ZXIA 2D3NA 4NC8A 4BDZA 3OYIA 3GQAA 4G7WA 4R79A 3EPZA 3S3OA 2MD0A 2QKMB 4KKUA 2M5SA 3S8PA 4NNJA 1OHHA 2X85A 3PFYA 4ZTFA 2F6CA 3OYKA 4BJ6C 3KEWA 1KCCA 4Z05A 2VJ5A 2JVGA 3S3MA 2Z2SB 2LREA 2CS3A 2HPMA 4E7LA 2ZFUA 4P1WA 3FY3A 3DTEA 1TT0A 2PJRB 2QXZA 3WQZA 1ERDA 3IUOA 4RLQA 3BLYA 2KRCA 3H5NA 2XNDA 4L8JA 2BSPA 2O04A 2XF5A 4CCOA 1I18A 5CQEA 2KP6A 1UD5A 4BS9A 2WPDA 2NOJB 1O8DA 1BMFA 3LSGA 4PFOA 1G59A 3OEEA 1BHEA 2L9NA 1WMRA 4EW9A 5HNFA 4BJ5C 1X1BA 3K70D 1MMGA 3FHNA 3OW7A 2BOLA 1MMDA 2V6EA 1WJAA 3EQOA 4GQNA 4CSWA 4TT3A 1Y56A 3RSNA 2D3LA 4FASD 1OFLA 4NK8A 2MYSA 2WJYA 2M7BA 2IXSA 2CUZA 2QKLB 2LYCA 4LIUA 1UD6A 3NE5B 3HKZA 4DOZA 2M4KA 1HZEA 3OIPA 1MMNA 2ZZGA 2BW3B 3A4CA 2PYHA 3UW0A 2NT9A 1VZ0A 5LFAA 2R7VA 3BH4A 3CJQB 1P9QC 2KVOA 3I9V2 3B4NA 2X1DA 2K9MA 3NWTA 3PSIA 2KMUA 2Q2EB 2W00A 4LITA 3ZQQA 1UG0A 1T0FC 2ZZQA 2DCEA 2X6WA 2W6IA 4XNFA 3GVLA 3ZIAA 1NHCA 4OJPA 2E1MC 1U0JA 2MABA 4YRVA 4OAYA 3OEHA 2V4JC 5KNLA 3C2GA 5HNHA 1H80A 3OR2C 1QCXA 4MR0A 4OJLA 2V31A 5FRNA 4C2UA 4G6TB 2PMZA 5JHFA 3J7AY 4ZDPA 2AQEA 4ZC3A 2Z6BD 2VB6A 4XLFA 2OV7A 3OR1C 2CFOA 2VL8A 2PYGA 2PJRA 1RMGA 4CCMA 3BCAA 3BC8A 3DKXA 3OYGA 4FETA 3KYLA 5IK2A 1CZFA 1KZLA 3OPOA 3LL7A 2L9SA 4E0FA 3DTKA 3UNGC 2VQGA 3ZPPA 2Y0SA 1QHGA 3MMYB 4E7ZA 1DBGA 2WSSA 2E1MB 2WAFA 3OY9A 2WY7Q 2BVMA 1W0KA 2ZTNA 3BCDA 3VSLA 2L7KA 4B3FX 2ELJA 4HIZA 1WJFA 1OOCA 2JSPA 2L5QA 3BC9A 4PJLA 3C2HA 2INUA 3SUCA 3DPTA 4PJMA 1X0CA 1T5EA 5AMVA 4U87A 1VF7A 3HL2A 3S93A 2GJPA 1N77A 2UVFA 2CK3A 1H8HA 1OLTA 1VJSA 4CCKA 1O8HA 2HPIA 4PK4A 2Z1DA 2O1DA 3L2VA 1NG7A 3OMYA 3WWGA 1T95A 4CCNA 2BW3A 4IQJA 2V7FA 5CPRB 2LG4A 1OB0A 3AFHA 4BEHB 3GQ8A 1KCDA 2VJ4A 2VKHA 4FXUA 4HEA2 3GRHA 1IRXA 2GOMA 3ZPNA 3DKYA 3L2WA 1R6RA 2K5CA 3OYMA 3OOUA 2UV1A 2V1NA 1X19A 1O8GA 2E5NA 3CZ6A 5C1EA 2HLDA 3A1YA 1J09A 4CCLA 1H8EA 4KJZA 2PECA 4E7KA 3H5RA 1IA5A 3OE7A 2X6XA 3DU6A 2GJRA 4XN0A 4W8SA 1EA3A 1E43A 2HNHA 3VYTB 3H35A 2RREA 1IDKA 3FBNB 2M7AA 2IGMA 3E1SA 1LFPA 4U7BA 3VMWA 2X3HA 2CH0A 4Y3OA 4F55A 4HNTA 2W7NA 1Z7LA 5HLTA 1FMVA 2CUJA 1JI8A 1VLYA 4ZTJA 4ANJA 1O8FA 3W2AA 3CP8A 4HSRA 3HAGA 3VMVA 3H5AA 3VWBA 4Y4RA 2W4SA 2VASA 1WJEA 3LSMA 4DK1A 3F9KA 1OR7C 4RMNA 2RQQA 3SEQA 1O8JA 1E3ZA 2ZXHA 3VSTA 1O8MA 1I8DA 3HC7A 2HQAA 3D5RC 3SZGA 3K70C 2X8KA 2VIXA 4E4HA 3HG9A 3HOTA 3GQBA 4Z1MA 4J01A 3PNVA 3QODA 4ZDOA 2K9LA 4OAZA 4B3XA 2LBFB 4BE0A 3QYFA 2W6JA 2LC2A 3GQ9A 4KKSA 3OOCA 1V5FA 2V26A 1FMWA 5FROA 4RM3A 1YE9A 2A6TA 2DIEA 5CKTA 2X53S 1O8LA 3FBIB 3OYHA 2GK6A 1MNDA 3QYBA 1E1QA 4BEHA 1Y6IA 3MKZA 3GVJA 1O8IA 4U49A 1Z3XA 1W36C 5HVQC 2XZLA 3DPLC 1X1DA 3EUHC 1YX3A 1E3XA 4D9JA 4P22A 2KL4A 4OWRB 3PNTA 2O5RA 4BQOA 2M4GA 5KHDA 4PUSA 2HVQA 3OYDA 4YZQA 1V5GA 3QOEA 3PSFA 3BCFA 3DDYA 1D0XA 2UVEA 4DIQA 2VXZA 3VYSB 3L2UA 3BCBA 2V4DA 3H9QA 1PYVA 2OUMA 2GK7A 2HU9A 1OGMX 2VPLA 2BVLA 2XOKA 4BL0B 2R7OA 3T51B 2VBKA 2CW8A 2WADA 1E0EA 2LY2A 3HUGB 4BU2A 2XDVA 1WP6A 3CESA 2QE7A 2R7SA 3OYFA 4ITVA 4GRIA 3OYLA 3DU5A 3HOSA 2IS6A 1IB4A 2VJIA 3IAS2 1LVKA 4NQWB 5LD2C 2Z8GA 1D1CA 3W3CA 4HWVA 3LNNA 2CMPA 4I84A 4II2A 1UAAA 2R7QA 1DBOA 2M3AA 2JA2A 3ZRGA 2HDWA 1W0JA 2LZJA 1O88A 3LSHA 3RTRA 2KZVA 1DQUA 3PJRA 1PLUA 1X1CA 1WFXA 4XLHA 4XLCA 3KX2A 1QHHD 2NTQA 2V7QA 4D1QA 3RCOA 3AKZA 3QYEA 1G8XA 2WBMA 2E60A 1MNEA 4HG2A 4AU7A 1N75A 2A5WA 2LBFA 4E7IA 3OYCA 2R4GA 4LG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X85 A;  1KCD A;  4OJO A;  3GRH A;  1RWR A;  1KCC A;  2X6Y A;  2QX3 A;  4Z05 A;  4XLE A;  3B90 A;  1JRG A;  4OZY A;  4XN3 A;  1O8G A;  4YZA A;  3FY3 A;  2NTB A;  5C1E A;  1JTA A;  2QXZ A;  2PEC A;  1IA5 A;  2X6X A;  3VSU A;  4W8S A;  4XN0 A;  2O04 A;  4Z06 A;  2BSP A;  4XKW A;  1IDK A;  1K5C A;  2NZM A;  1RU4 A;  4XOP A;  1OGO X;  1O8D A;  3VMW A;  2O0V A;  2X3H A;  1BHE A;  1PE9 A;  1WMR A;  4EW9 A;  1EE6 A;  1O8F A;  4YZ0 A;  3VMV A;  3EQO A;  3VSV A;  1HG8 A;  2O17 A;  2INV A;  3LMW A;  1O8J A;  3VST A;  4NK6 A;  1OFL A;  4NK8 A;  1O8M A;  2VJJ A;  1QJV A;  4W8R A;  4C2L A;  3KRG A;  1O8K A;  3UW0 A;  2PYH A;  2NT9 A;  4AVZ A;  3GQ9 A;  3B4N A;  4OZZ A;  1PXZ A;  4XLA A;  4XMY A;  2O0W A;  3T9G A;  4MXN A;  4YZX A;  1AIR A;  2NT6 A;  1O8L A;  4U4B A;  2X6W A;  4XNF A;  4W8Q A;  3ZSC A;  1NHC A;  4U49 A;  1O8I A;  4OJP A;  4PMH A;  3GQ7 A;  4XR6 A;  2EWE A;  2ODL A;  1H80 A;  3B8Y A;  1QCX A;  4OJL A;  4MR0 A;  2IQ7 A;  2QY1 A;  4OJ6 A;  4YZQ A;  4XOT A;  1VBL A;  2UVE A;  4XKV A;  4XLF A;  2PYG A;  1RMG A;  1OGM X;  1CZF A;  2VBK A;  2NTP A;  1XG2 A;  1O8E A;  2NSP A;  3ZPP A;  1DBG A;  1IDJ A;  4XM3 A;  2NST A;  3EQN A;  5C1C A;  1IB4 A;  2VJI A;  4XON A;  1OOC A;  2Z8G A;  4YEJ A;  2INU A;  4HWV A;  4Z03 A;  3SUC A;  4XL9 A;  4XOR A;  4YEL A;  1X0C A;  4I84 A;  1DBO A;  1BN8 A;  1O88 A;  5AMV A;  4URR A;  2VBE A;  2UVF A;  1PLU A;  1OFM A;  4XLH A;  4XLC A;  2NTQ A;  1O8H A;  3JUR A;  4OJ5 A;  2VBM A;  2O1D A;  4W8T A;  3GQA A;  3WWG A;  1GQ8 A;  4XQF A;  1KTW A;  3GQ8 A; 
#chains in the Genus database with same CATH topology
 3JRH A;  4WXD A;  4MEX F;  2DT6 A;  1I27 A;  1NRK A;  4YCQ A;  4A3B J;  4RS8 A;  2KIQ A;  2Y9Y A;  2M34 A;  5BQT A;  3M3Y J;  4B43 A;  2JUG A;  3WTV C;  2E1B A;  4XLE A;  2E1C A;  1MRZ A;  3B90 A;  2HYJ A;  2O03 A;  3ZQI A;  3IV5 A;  2BM1 A;  5L3G A;  3M7G A;  5E3L A;  4F3Q A;  1ZRD A;  2CYY A;  3K4M A;  4BQQ A;  3K4B A;  4M6Y A;  4YDT A;  4ZGN B;  2O8X A;  1ZTR A;  3BR6 A;  1R71 A;  2R5Y A;  3M8J A;  3BRO A;  5D4S A;  4EQQ A;  2DOD A;  1FX7 A;  2IOU G;  2NS8 A;  4TSF A;  1VQM B;  2J8K A;  1D0Z A;  1D1A A;  3QPH A;  1G3Y A;  4PSW A;  1ZHF A;  3CTA A;  3DTI A;  2DA4 A;  4ZZL A;  3F8N A;  2QYU A;  3S15 J;  2ZL7 A;  3NAW A;  3DBH B;  1PJR A;  3HUG A;  1IC8 A;  4YEI A;  1QGZ A;  4OIO F;  1JKR C;  2STT A;  1S3J A;  5CYV A;  4L18 B;  2GLO A;  3K6G A;  2OK8 A;  2JJ7 A;  2E7W A;  3F6O A;  2K4J A;  4ON0 A;  1S72 I;  2CV2 A;  1WOS A;  2YWE A;  4QUZ A;  1T56 A;  2PEX A;  1MNM C;  1EA0 A;  3COA C;  1QRB A;  4KN7 X;  1QZE A;  5AON A;  1UB9 A;  2VJJ A;  3ABM H;  3K1N A;  2C6Y A;  2BV6 A;  3VYU B;  5DN6 A;  2JK3 A;  2DJI A;  2XV4 S;  1ZM3 A;  3TED A;  2M2E A;  4HX7 A;  4K2E A;  5JHU A;  5J47 A;  2GXB A;  3LQ6 A;  2DEU A;  1MSF C;  4C43 A;  1PXZ A;  3P9K A;  2MC4 A;  1K4Z A;  1N0V C;  5IYB J;  2BV3 A;  4RAY A;  3OYB A;  1ZG5 A;  2WY8 Q;  4IF4 A;  3EUK L;  3G1M A;  2BEO A;  3GQ7 A;  2JQ7 A;  2EWE A;  3CCU B;  3JRI A;  2EZH A;  3PUM A;  4ZYA A;  3BQY A;  3QPT A;  4QWQ A;  3V7R A;  4CCJ A;  3CMY A;  4A3E J;  4KNY A;  1FRN A;  4OJ6 A;  2OAZ A;  4TV7 A;  2X1C A;  1B59 A;  2L9R A;  1QFY A;  3AVX A;  3DEE A;  3N4M A;  2HOT A;  3IRQ A;  5EJC A;  3HOW J;  2F3L A;  2MBF A;  2CUE A;  1SEU A;  4B3G A;  2EBI A;  3LFU A;  3PM1 A;  1RUO A;  1STZ A;  3DEU A;  4EV0 A;  4B47 A;  1VQN I;  3WY9 A;  3K4K A;  1MSE C;  1O8E A;  2OCE A;  5M5X J;  3FMR A;  3ZXS A;  2C4T A;  3HXL A;  3Q3A A;  2LR8 A;  3PQJ A;  3J7Y J;  4YXW A;  5E6T A;  4GCV A;  1X4O A;  2E5Z A;  5BOX A;  4AC0 A;  3GTK J;  3CW2 A;  1QPI A;  1QVT A;  1SVO A;  1N08 A;  2NS0 A;  2ZZE A;  1JUP A;  2CW7 A;  2ECC A;  3AL0 C;  2VBU A;  1MDM B;  2EV0 A;  2VBS A;  1U3E M;  4N9H A;  2DET A;  5LHI A;  4OJ5 A;  2P6T A;  2G9W A;  4ZDL A;  3HTS B;  1ON2 A;  4HV6 A;  2ZL5 A;  3OZV A;  1WOR A;  4RB0 A;  5DDG A;  3PNY A;  2VXD A;  4X8I A;  3FXK A;  3ZQ7 A;  3K4N A;  1RI7 A;  4YIF A;  3GXO A;  4BUP A;  4LBZ A;  1S8N A;  3LFK A;  1KON A;  4HLX A;  1FRQ A;  1NBM A;  5GP9 A;  4CUG A;  5DUI A;  3OSF A;  5M5W J;  4P55 A;  1XMK A;  2FEZ A;  3AL0 B;  2LLK A;  2JSC A;  5HLH A;  3JRE A;  3AGP A;  3FIS A;  1ETQ A;  5FRM A;  4A3D J;  1RET A;  2D9R A;  3CJT B;  2V5I A;  2BXY A;  3O6B B;  4AVP A;  1Y8R B;  3ZMD A;  1PP8 F;  2B9S A;  3I56 B;  4QHY A;  3ASS A;  1IZ1 A;  2ZIT A;  2IPQ X;  4Z4T A;  5E8I A;  2JRM A;  4KIF A;  1BOA A;  4JBA A;  1FBU A;  1QFJ A;  3EYY A;  3Q38 A;  1VQM I;  1XGS A;  4O6J A;  1FX0 A;  3I53 A;  1IN8 A;  4LIV A;  1HKS A;  2DN0 A;  3BJA A;  2GXA A;  4BAY A;  3R6K A;  2W84 A;  3KCC A;  2H27 A;  4BY7 J;  2IGO A;  3KLN A;  3LQE A;  5DEQ A;  1ETV A;  4G94 A;  3QSY A;  1HW5 A;  2FU4 A;  5JLX A;  5LGN A;  4UUS A;  1YTY A;  4C9Y A;  4Z4V A;  2KQR A;  1HF2 A;  2TCT A;  2E19 A;  3ZCO A;  1FT9 A;  4Y17 A;  2B63 J;  1V4R A;  2QUF A;  2D74 A;  4A3C J;  4XRS A;  1I39 A;  1E3H A;  1MGT A;  1IHM A;  2L9V A;  3ASP A;  2QEN A;  4M3E A;  5H20 A;  2PLY A;  1XPX A;  3M07 A;  2KJB A;  1JGG A;  1UD8 A;  3BH7 B;  1RZ4 A;  5BS6 A;  2KIU A;  2R93 J;  1NH3 A;  3D0S A;  1MMS A;  3NWS A;  2PIA A;  1WWX A;  4C3J J;  4XLA A;  2DLL A;  5LBQ A;  1FSH A;  3FK7 A;  2PJP A;  1AIR A;  3K69 A;  1U9O A;  3AVV A;  4E7S A;  1KMH A;  1FP1 D;  4W8Q A;  3OP1 A;  3BR1 A;  1R4M B;  4S04 A;  3A01 A;  1ZKG A;  2UUZ A;  3OJX A;  2W82 A;  2P7C B;  1EWY A;  3L2Q A;  4FX4 A;  3GTQ J;  3CCU I;  2JVH A;  2W25 A;  2XF6 A;  1VQL I;  3Q9S A;  5IYP A;  3GVA A;  3PIP F;  3BG3 A;  5JVG F;  4ENN A;  2X4H A;  3P27 A;  2ZJP F;  2V9K A;  2YWF A;  3LAP A;  1HVX A;  2NTP A;  2ZB9 A;  1TYV A;  2B7E A;  2F4I A;  2V9V A;  5FKO A;  1BW6 A;  3TGN A;  2K86 A;  3GLX A;  4CO8 A;  4EEF G;  1OMI A;  3OWT A;  2R7R A;  1QRC A;  1IDJ A;  1G7R A;  3SYT A;  1WHU A;  3A2K A;  1FSE A;  4XKB A;  3GVK A;  3EQN A;  5C1C A;  1NHA A;  4DBQ A;  4XON A;  3SDB A;  3ISX A;  3CCR B;  3UR3 C;  2VOO A;  3CCJ B;  3OYJ A;  2O8K A;  3FPP A;  5DTD A;  5IOY A;  4EM0 B;  1P4A A;  1YW7 A;  5H2F C;  3OYN A;  1WJC A;  4RM0 A;  2Z3Y A;  1BN8 A;  2GJK A;  1W5T A;  2IAI A;  3LA7 A;  1HA8 A;  4TMW A;  4Y7N J;  1BJA A;  1TUI A;  3BG6 A;  3RY8 A;  1MBE A;  1Q86 D;  3SQN A;  3R0A A;  5LGT A;  2WV1 A;  1G3S A;  2D3N A;  3P26 A;  3GQA A;  3ZN1 A;  2J5O A;  2YX4 A;  4G7W A;  3HRU A;  4KKU A;  2PE3 A;  5FO5 A;  4Z4S A;  5C3E J;  3OYK A;  1DDI A;  1YHQ B;  2A07 F;  2MG4 A;  5L3C A;  3Q0U A;  5D6E A;  2OTJ B;  1W4M A;  3DBL B;  1WVR A;  1FOK A;  3S3M A;  2Z2S B;  2CS3 A;  2VC0 A;  4XRS G;  3JRA A;  3R0J A;  2WZN A;  3RQI A;  1IG7 A;  2KZG A;  2ZFU A;  1BI0 A;  4ETS A;  1TT0 A;  3SFZ A;  5EGO A;  4NHJ A;  2VZL A;  1KK3 A;  1ERD A;  3JAM K;  3H5N A;  3QFR A;  2O04 A;  2BSP A;  4H0E A;  2XF5 A;  3P5J A;  5FGM A;  3TP3 A;  1GJR A;  3HEF A;  4BBS J;  1OB5 A;  2NOJ B;  3I56 I;  4L9J A;  4EW9 A;  3VNV A;  1Z91 A;  5JI6 A;  2BM5 A;  1LFU P;  1MMG A;  3FHN A;  3FXM A;  4I99 C;  5HS9 A;  2ECB A;  5F1R A;  4QSH A;  4BY1 J;  3MHP A;  3EQO A;  1TP4 A;  4EGZ A;  4CSW A;  1YO5 C;  2ZXJ A;  2D3L A;  3VMF A;  4FAS D;  2W48 A;  1OFL A;  2MYS A;  1K78 B;  1B8I A;  3TO6 A;  2CUZ A;  1UD6 A;  3NE5 B;  1XS9 A;  5F0H A;  4LB5 A;  3S14 J;  3HKZ A;  3ZBT A;  2M4K A;  1UHW A;  5ICE A;  4Y52 J;  3A8J A;  4L0Y B;  5K5R A;  1WU8 A;  4KN4 X;  2R7V A;  3BH4 A;  3JQP A;  2Z9O A;  2BGJ A;  3ONU A;  3R61 A;  3FKI J;  2KIS A;  2KVO A;  2Z99 A;  2ICW G;  2ZCW A;  4R1H A;  2W00 A;  2Q2E B;  4X1E A;  1UG0 A;  1T0F C;  2DCE A;  3WE2 A;  2EPF A;  2ETH A;  1J7K A;  4UHT A;  4X7E A;  2HKX A;  1A31 A;  4UZF A;  2FX3 A;  3LAJ A;  3I1F A;  3HRS A;  1GQ8 A;  2LTP A;  2FQ3 A;  2X9D A;  3C2G A;  3QWL A;  5F0C A;  5KAI C;  3WHC A;  1QCX A;  4MR0 A;  1O7L A;  5BNG A;  4DW6 A;  5FRN A;  3BPV A;  4C2U A;  1FIP A;  1FOY A;  2JN9 A;  4P3I A;  5GPA A;  1KK1 A;  4ZDP A;  4JP0 A;  2Z6B D;  3R6J A;  3U1K A;  2VB6 A;  2HI3 A;  1JNY A;  4XLF A;  2OYN A;  2OV7 A;  3VPR A;  1WDT A;  2CQN A;  1B4A A;  5LLQ A;  5J1R A;  5DS9 A;  3AST A;  1GXP A;  1KGS A;  3SDG A;  1XGN A;  1APL C;  1J75 A;  1AWC A;  5E18 F;  1B2R A;  1P2F A;  2UZK A;  1K9M D;  2XVC A;  4KYW A;  2MA3 A;  4E7Z A;  3ERM A;  1W0K A;  2BVM A;  1VQ4 B;  2V9P A;  2L7K A;  2CUF A;  3SHF A;  4JRA C;  2ELJ A;  2LKP A;  2JSP A;  5L46 A;  3C2H A;  3GO5 A;  3LJY A;  3OKX A;  3F23 A;  1Y0R A;  5BMZ A;  1QO0 D;  2PMU A;  4HYE A;  5BSY A;  4A69 C;  5AMV A;  2XNJ A;  2JTV A;  3BDD A;  3HL2 A;  1EP3 B;  2GJP A;  3FMS A;  3CCR I;  2G7U A;  3CCJ I;  1IXR C;  1OLT A;  4CCK A;  3IRR A;  4PK4 A;  4LLL A;  1JHF A;  3PFI A;  3L2V A;  2LKX A;  5F4J A;  2OQR A;  5KVR A;  3W6J B;  3QU3 A;  4OOX A;  1T95 A;  4CCN A;  1CNE A;  1I1G A;  1QFZ A;  2BW3 A;  2XKP A;  2BF4 A;  2AO9 A;  2JRT A;  5J8F A;  4OPS A;  3MCA A;  4YC5 A;  4IOA F;  4Q47 A;  1QA6 A;  3CPW B;  1G7S A;  3QAH A;  2UXN A;  2VJ4 A;  1JKQ C;  3ZPN A;  2O9L A;  2EJR A;  2HXI A;  3CCY A;  1R6R A;  2K5C A;  5E17 F;  3CPX A;  1YHQ I;  2CRG A;  2V1N A;  2JA7 J;  1I1S A;  1MH3 A;  2HLD A;  4UV9 A;  1J09 A;  4OMZ A;  2OTJ I;  5J35 A;  1H8E A;  4KJZ A;  1S5L C;  1F43 A;  1LDJ A;  4E7K A;  4LLN A;  1IA5 A;  2L4A A;  4HQM A;  4RA2 A;  1W35 A;  4W8S A;  3U2Q A;  1EA3 A;  1E43 A;  3VYT B;  3E97 A;  1DG1 G;  2D45 A;  3FBN B;  3HRT A;  4Q48 A;  4V2F A;  5DM6 F;  1OCT C;  1FDR A;  3PSZ A;  2XGE A;  3VMW A;  1XCB A;  2DK8 A;  1WSU A;  4F55 A;  1SAX A;  2VYQ A;  4TMX A;  2XHK A;  4HNT A;  2X3H A;  2M0C A;  2A6H F;  1JI8 A;  2XSD C;  2DMN A;  3BJO A;  2VFM A;  2HWV A;  3H5A A;  3I59 B;  3FZV A;  2W4S A;  1E3O C;  1U78 A;  2ZJQ F;  3CDH A;  2RQQ A;  4WXC A;  2Z33 A;  1E3Z A;  1IGN A;  1XG1 A;  1O8M A;  1X1P A;  4J0Q A;  3HC7 A;  1TNS A;  5DNS A;  2X8K A;  3HG9 A;  4IHT A;  4E70 A;  5HXB A;  3HOT A;  4J01 A;  4ZDO A;  1TQM A;  1FY7 A;  2GAU A;  4Z6Y A;  1V55 H;  5BSX A;  3QYF A;  1LLZ A;  3VFZ A;  1HDD C;  2O3F A;  3TP0 A;  3KET A;  4CYC A;  4U88 A;  1V5F A;  2V26 A;  1U8B A;  2DIE A;  3GF2 A;  2J7K A;  4DYC A;  5DD8 A;  3WTT C;  1MND A;  5FNZ A;  3QYB A;  4AC9 A;  4M72 A;  1Y6I A;  2XRN A;  4GDF A;  3JQR A;  4WZE A;  3BJ6 A;  1OCZ H;  4M71 A;  3PNT A;  4BQO A;  4Q5S F;  1IUF A;  2MH2 A;  2DCU A;  4PUS A;  4QVJ A;  5IYW A;  3ZMV A;  4JYK A;  1Z05 A;  2R5Y B;  2JA8 J;  1G7C A;  2FSW A;  3VYS B;  2PMZ N;  1R49 A;  1B9M A;  5B1A H;  2V4D A;  2KKO A;  4YHB A;  1OGM X;  5ILV A;  2VPL A;  4BL0 B;  1KTV A;  2VBK A;  1JKO C;  2CW8 A;  3LYC A;  1JA1 A;  3HUG B;  2LNB A;  2X6O A;  2YX7 A;  3WTW C;  1WP6 A;  4G5G A;  3CES A;  4P2N A;  2R7S A;  4GRI A;  2DI3 A;  3FF5 A;  1JTX A;  3KIO A;  4Z4W A;  1Z77 A;  2BY1 A;  1YIO A;  1EP2 B;  3B6C A;  2Y0S N;  2PFB A;  5LD2 C;  4KIC A;  1QUF A;  2QEX B;  4HWV A;  5THX A;  3GX4 X;  2VE8 A;  5EMN A;  3E7L A;  1VQ4 I;  4II2 A;  2HKO A;  3J81 Z;  1UAA A;  1R23 A;  1W0J A;  1O88 A;  2OPT A;  4Y15 A;  2ZJ2 A;  3H09 A;  1WFX A;  2NTQ A;  3KX2 A;  1QHH D;  4A3G J;  3AKZ A;  2E35 A;  1TQI A;  2IA1 A;  4P96 A;  4I0A A;  3JSP A;  1YW9 A;  1MNE A;  3EQL F;  1Y1W J;  1R1T A;  4HG2 A;  4AU7 A;  3BY2 A;  1Q7Y D;  2LBF A;  5IP6 A;  4KIB A;  1X2M A;  1KU2 A;  3WU2 C;  2JJ2 A;  4LG3 A;  3TH0 A;  3FKS A;  1KC8 D;  4PSX A;  2VKD A;  4I0B A;  2COB A;  3CCQ I;  1ZM2 A;  3WTX C;  2LF7 A;  3EUA A;  2KJC A;  3ZBU A;  2WB1 A;  3DCF A;  3ONQ A;  3GFJ A;  4UUT A;  3H3V K;  2JPB A;  1QPM A;  1XN7 A;  5GAE J;  1VLO A;  1FEX A;  2P0W A;  3AAF A;  4BXF A;  2X48 A;  3W2H A;  2VPR A;  2XPV A;  2F1L A;  1Q82 D;  1J9I A;  3V76 A;  5EZG A;  3E6D A;  4HF0 A;  3T0Y A;  5JLV C;  2VBW A;  4XKW A;  1F1Z A;  3GUD A;  3GFM A;  4BHP A;  1TTT A;  3S2W A;  2K4B A;  4F92 B;  1S4M A;  1X3W B;  1BBY A;  2E71 A;  2FOW A;  2FBI A;  2O0V A;  1DDN A;  4P9S A;  3HGG A;  3BG7 A;  3KP3 A;  4KFC A;  1K4S A;  2A3S A;  3LSI A;  3GTM J;  4YZ0 A;  2VFO A;  3OS0 A;  1JT0 A;  2KRH A;  3VO1 A;  3ES9 A;  2R7X A;  3G05 A;  1FOX A;  1MBH A;  1ZLK A;  1HG8 A;  2GA1 A;  1QA1 A;  1IXS B;  3G71 B;  3ELK A;  4JOM A;  3TL4 X;  4F93 B;  4O3M A;  4HZF A;  1P4X A;  2ELH A;  2K7L A;  4IHS A;  1HW2 A;  1WPK A;  1D2E A;  4HST A;  4AF7 A;  3KP2 A;  4C2M J;  5FKK A;  3V4G A;  2JUC A;  1L3L A;  3LST A;  4Z4R A;  3FIW A;  1B6A A;  4DZJ A;  1BPL A;  3BQJ A;  3T9G A;  4YZX A;  2FBK A;  2RV8 A;  3GIR A;  1K61 A;  3JRB A;  1TBX A;  2XGJ A;  1XC5 A;  1BC7 C;  1S7A A;  1RES A;  4R8H A;  2RC4 A;  4ZYE A;  1QU3 A;  3MZY A;  4M3G A;  2DA5 A;  1S29 A;  2NOG A;  1CGP A;  2PI0 A;  3OFN A;  4EJT A;  3KEQ A;  2CU7 A;  4XR6 A;  2IS2 A;  1CQX A;  4G1V A;  3GEZ A;  4P1V A;  1MH4 A;  2MH9 A;  3ISP A;  4B09 A;  1SVM A;  2FE3 A;  4CZZ A;  3A35 A;  1K8A D;  2JMW A;  2BVN A;  4LLG F;  1FND A;  4X7C A;  5D5V B;  2GIZ A;  3FKJ A;  3S1N J;  1WQ2 A;  5D5U B;  3TO7 A;  1B72 A;  2BM7 A;  4BBR J;  1LM1 A;  5KCM A;  2IP2 A;  1ZRC A;  3ZZT A;  3KE2 A;  5AN9 A;  1DAR A;  1MJ9 A;  1ACI A;  4ZYD A;  3H9N A;  1R5N A;  2V6C A;  4A3I J;  1PVE A;  2DER A;  1FNC A;  3SLN A;  3ML3 A;  5LRS A;  3GW2 A;  2RN7 A;  4HX8 A;  5CDF A;  3T53 B;  3WNB A;  1CF7 A;  3CCE B;  3FWE A;  4UUS B;  3L7W A;  1SAU A;  4YEL A;  3LSJ A;  5HLI A;  1DP7 P;  4IW3 B;  2LY1 A;  4I76 A;  1I50 J;  1V5E A;  2DPD A;  4Y7C A;  3H0D A;  4MTD A;  1LFB A;  2FF4 A;  3ZQF A;  2QEX I;  5FA6 A;  2QSF X;  3ESW B;  3L2R A;  1OCR H;  2BM0 A;  1WGX A;  3I4N J;  4KKT A;  3BY6 A;  3SZT A;  2LRD A;  1N8R D;  4W8T A;  3K0L A;  4HDV A;  3HJE A;  2VFQ A;  5TIS C;  4WCG A;  1UD2 A;  4X0C A;  4KT6 A;  1VTN C;  3PUB A;  2DYS H;  4EH1 A;  2TRT A;  3SXY A;  4LG0 A;  4BE2 A;  2E1N A;  2KLO A;  3VOD A;  2VNI A;  1KQ0 A;  1MMA A;  1MZB A;  4ZV4 A;  2XAS A;  4IKF A;  2QX3 A;  1EKE A;  3GME A;  2IS1 A;  1F5T A;  3SJZ A;  3N6Z A;  1DGR M;  1KRH A;  5FD6 A;  1G2H A;  4HRI A;  4XKC A;  1UEL B;  2L7F P;  4I2O A;  4M0L A;  2BX6 A;  3K10 A;  4F91 B;  4MLO A;  2VFP A;  1HKQ A;  1O7F A;  2BHY A;  5A88 A;  2EWN A;  3A3B A;  3J7Z I;  1HXD A;  4RD3 A;  3JX8 A;  2MLK A;  3C1D A;  3IH4 A;  1K5C A;  4ESB A;  1KD1 D;  1COW A;  2NZM A;  1LB2 A;  1AA7 A;  2MW8 A;  5GAG J;  3MD2 A;  2HQ5 A;  2WAQ N;  2ELK A;  2P8T A;  2XUB A;  2IA2 A;  5EZH A;  1PUF A;  5IT9 Z;  2V7U A;  2ZL6 A;  1SFX A;  4IOC F;  3PA1 A;  1JJ6 C;  4UV8 A;  3WGH A;  1IF1 A;  1Q81 D;  1IN7 A;  1R5G A;  2QM3 A;  4BHB A;  2FNP A;  3SEZ A;  4RCY A;  4LC0 A;  3RKY A;  2X0L A;  5K7Z A;  2O7O A;  4HF2 A;  4NK6 A;  3S1M J;  3OAA A;  1EJ9 A;  4S0H B;  3WG9 A;  4WWC A;  1KA8 A;  4RM2 A;  3CCL B;  1LE8 B;  2CQK A;  3G71 I;  3WHB A;  3B02 A;  2BMW A;  4QV2 A;  1WTH D;  3JU4 A;  1KQS B;  4J00 A;  3O8H A;  3BTC A;  4CQJ A;  3AG3 H;  3E6M A;  5D4R A;  3W6V A;  3WTZ A;  1BI3 A;  4NC6 A;  4ZH4 F;  1AKH A;  3Q6R A;  2BYV E;  2ZFW A;  2E7X A;  2L4M A;  5JMC B;  3S2H J;  1XDS A;  2D2W A;  3K2Z A;  2AQF A;  2JDI A;  2ADU A;  4RD6 A;  2VFN A;  3GFI A;  1E79 A;  2JZY A;  5EGO B;  4QPO A;  4XOT A;  2Y31 A;  3IWF A;  3QFT A;  4WF2 A;  3TO9 A;  2NNN A;  2JIZ A;  3IL2 A;  1G7T A;  2X1E A;  1K6Y A;  3HPH A;  4B4C A;  1Z3Y A;  2WZP P;  3W5V A;  2O0Y A;  3ONY A;  2VI6 A;  4KIS A;  4OPW A;  2V7W A;  1D1B A;  4V2G A;  1YI2 B;  1W2B B;  5DYM A;  3DV8 A;  4HDU A;  4TKO B;  2CJJ A;  2LMD A;  1IN5 A;  3C18 A;  1N78 A;  5FFZ A;  2ACJ A;  1QVF B;  4CDG A;  1B8I B;  4Z03 A;  2IGK A;  2V79 A;  2QSH X;  1BX1 A;  2B0L A;  4IX7 A;  2CV1 A;  4RPB A;  1I6X A;  1Y1V J;  1ZM9 A;  5F1J A;  3H3U A;  1J0R A;  3WGI A;  3CCE I;  4URR A;  1A5J A;  1N25 A;  1ZEL A;  3N05 A;  5HKK A;  1ETW A;  3CC7 B;  4F7D A;  2QGU A;  3MCZ A;  1XMA A;  1QNT A;  5TRD A;  3LWF A;  3EPZ A;  4IPA A;  3ZMZ A;  2QKM B;  3G6E B;  3HOV J;  1SKQ A;  3S8P A;  3CF5 F;  4I01 A;  4NNJ A;  4HF1 A;  2X85 A;  1A04 A;  1RPW A;  4BQA A;  4UXN A;  2BXZ A;  3QPS A;  3HHH A;  3A02 A;  3BTI A;  2QCO A;  3IKV A;  4BJ6 C;  3GFL A;  4RBO A;  2XTY A;  4MGR A;  2EA4 A;  2V1X A;  2JVG A;  2LRE A;  4G12 A;  2QMU A;  1B1B A;  4P1W A;  3FY3 A;  5ILS A;  2A6E F;  2QXZ A;  5JR3 A;  5K5Q A;  2V7X A;  3RIQ A;  3ROU A;  3JTG A;  2H8R A;  4RD4 A;  2BSA A;  4CCO A;  1G4D A;  5CQE A;  1NK3 P;  4BS9 A;  4AYB N;  3DU1 X;  3E3V A;  2AXT C;  1OQY A;  2F48 A;  4PFO A;  1BHE A;  4AWX B;  4WWV A;  2L9N A;  4Y13 A;  2FMY A;  1TWC J;  3CC2 B;  3IHU A;  2XC1 A;  2H6B A;  1F4K A;  4YAW A;  2V6E A;  3O3K A;  1EF4 A;  5GV8 A;  1Y56 A;  3R60 A;  3B82 A;  4NK8 A;  1FJL A;  5EEG A;  2M7B A;  5DCM A;  5HS7 A;  3FXL A;  3H0G J;  4RAG A;  1HZE A;  1MMN A;  2LF8 A;  2BW3 B;  1I3A A;  5E20 A;  3HOU J;  1E17 A;  2ZZG A;  2NT9 A;  4ENJ A;  5HZA A;  5LFA A;  5FD5 A;  1WH5 A;  2L01 A;  2P3M A;  3CCL I;  1KYW A;  2KMU A;  3ZQQ A;  1YIT B;  2XT2 A;  3R4K A;  4RAZ A;  1B9N A;  4LD5 A;  1NHC A;  2ZME A;  5K1Y A;  3QFC A;  4OJP A;  3V8J A;  2MAB A;  1FYK A;  5IY5 H;  3M8F A;  4C3H J;  5KNL A;  3BZK A;  5HNH A;  1IN4 A;  1WRJ A;  5JHF A;  1X3U A;  4EJW A;  1JKP C;  4UNO A;  2AQE A;  2OBP A;  4ZC3 A;  5IP7 J;  1LPQ A;  4FE4 A;  2R7Z J;  4ZCI A;  2PX9 A;  3M1E A;  1VQP B;  3MWM A;  2XKO A;  2PYG A;  2VL8 A;  1S7O A;  2PLF A;  1LNW A;  3H1C A;  5B6I A;  2IJL A;  1TYX A;  3OIO A;  4FET A;  1KQ9 A;  5IK2 A;  1T8I A;  1CZF A;  1DAB A;  4KH3 A;  2L9S A;  1X2N A;  2L7Z A;  2LVS A;  3DTK A;  2VQG A;  1OIS A;  3MMY B;  2WSS A;  3OY9 A;  4B3F X;  1LQ1 A;  2ZTN A;  4ACB A;  2WV0 A;  3VSL A;  1TVC A;  4OPV A;  2LK2 A;  4HIZ A;  1OOC A;  2STW A;  1YI2 I;  2L5Q A;  2INU A;  1J9Z A;  2P7V B;  2FML A;  4A3F J;  1E63 A;  1RKW A;  3S93 A;  3MZ8 A;  3F22 A;  1IDZ A;  2UVF A;  2WTE A;  3R6S A;  1X3Z B;  1H8H A;  1VJS A;  3CQZ J;  2HPI A;  3HSE A;  3S1R J;  2CRV A;  2O1D A;  4CYC B;  1WSV A;  4IHW A;  2HYF A;  4B8X A;  3WWG A;  3MQ0 A;  3NQO A;  1GR1 A;  3CC7 I;  2W7Z A;  1WI3 A;  2QYO A;  2HCJ B;  1VQK B;  1EH6 A;  1B23 P;  1Z7U A;  4M73 A;  4HX4 A;  3LA2 A;  4HEA 2;  1U5T A;  4CIC A;  4FXU A;  3G6E I;  1IRX A;  4N3G A;  2DOE A;  2O17 A;  3DKY A;  3RPU A;  4OOV A;  4FK8 A;  1E64 A;  4OIN F;  4DNC A;  3OYM A;  2C5B A;  2QA4 B;  5C1E A;  3A1Y A;  2GQF A;  4PAB A;  3EDP A;  2X6X A;  1PUE E;  1SFU A;  4XN0 A;  4BH9 A;  5CVI A;  1J59 A;  5D8L B;  4RB2 C;  4BXX J;  4NDL A;  3TOA A;  1DPR A;  2RRE A;  6PAX A;  2EZK A;  2IGM A;  3E1S A;  3PIO F;  4HE5 A;  3RI4 A;  2W7N A;  3W2I A;  3WBK A;  3ULQ B;  2YUS A;  4HSR A;  3W2A A;  2QTL A;  2V1D A;  4EMS A;  2EFW A;  3VWB A;  1REP C;  1YRN A;  4Y4R A;  2PN6 A;  1I7P A;  3RYR A;  1EFU A;  3F9K A;  2B0R A;  2F4O B;  1QA3 A;  4RLZ A;  2YU3 A;  2ZXH A;  3CC2 I;  2RC6 A;  5AIQ A;  4RD2 A;  3SZG A;  3AG1 H;  2F5F A;  5B5E C;  2VIX A;  3IKT A;  1H9G A;  1V5V A;  2YSR A;  3PNV A;  4AF6 A;  2K9L A;  4OAZ A;  2LBF B;  3HSR A;  3T8T A;  2QZA A;  1OYY A;  1QA2 A;  1IRZ A;  1JT6 A;  1GV5 A;  4J19 A;  4KKS A;  1HQC A;  5JVT A;  5FRO A;  4RM3 A;  3SY2 A;  1SM4 A;  2VKV A;  4UAJ A;  4MFD A;  1QH0 A;  2K02 A;  1E1Q A;  3MKZ A;  3GVJ A;  3HIF A;  4U49 A;  2L02 A;  1FTZ A;  3IC7 A;  5DSZ A;  1X1D A;  2DMU A;  3V7C A;  5CJ9 A;  4OMY A;  1E3X A;  5DS0 A;  2BY2 A;  4D9J A;  1YIT I;  4Y9R A;  3QOP A;  1XE1 A;  5HDG A;  5KHD A;  3FXR A;  1RQR A;  1V5G A;  4GFB A;  3PET A;  2C77 A;  3BCF A;  1D0X A;  1RNL A;  5DV5 A;  1EP1 B;  2WR8 A;  1V3F A;  2VXZ A;  2OZ6 A;  3L2U A;  3LQQ A;  2VOP A;  4H9G A;  3DFG A;  2COM A;  1IJW C;  2C78 A;  2MC3 A;  2BVL A;  2ZNY A;  5DCF A;  5IPA A;  1H9T A;  1E0E A;  1PDN C;  3GCM A;  4BU2 A;  1VQP I;  2BY3 A;  1LEA A;  4CGZ A;  3OYL A;  2C2W A;  3HOS A;  2IS6 A;  1IN6 A;  3HTU A;  1AHD P;  3ZMU A;  1HW1 A;  1M90 D;  4A3K J;  4XLN F;  1CNF A;  4RPD A;  1D1C A;  3IH3 A;  2ZBU A;  3LNN A;  3T8R A;  1BJZ A;  1ULY A;  4I84 A;  4U0V A;  3TQN A;  3Q6Q A;  4TMZ A;  3NAU A;  1XD7 A;  2HDW A;  3K9T A;  3WU1 B;  4ESJ A;  1U8R A;  4UUV A;  1Z1D A;  4DYQ A;  1RUN A;  5FLV A;  4PC3 A;  2KZV A;  1DQU A;  3HOX J;  1QGY A;  4P3Y A;  4XLH A;  2JPC A;  5DM7 F;  2DJN A;  4NBQ A;  3B73 A;  4PGG A;  1XB2 A;  2YWH A;  2DMT A;  2E36 A;  4OOI A;  4KA4 A;  1F20 A;  2WBM A;  4I09 A;  2YU9 J;  2DFF A;  1N75 A;  1KK0 A;  3WE3 A;  3SJP A;  2CND A;  5BPD A;  3OYC A;  3A03 A;  2R4G A;  1G3W A;  3JRG A;  5IYN A;  1BI2 A;  3Q9V A;  2D5V A;  4HV5 A;  1BX0 A;  1ZRF A;  4OJO A;  4DNT B;  3J80 Z;  1WH7 A;  4YFK F;  2RNG A;  3WTU C;  2XAH A;  1CQT A;  2ZO4 A;  4M1K A;  2W1O A;  1GXQ A;  3LOC A;  4L9T A;  4HA8 A;  1VQK I;  1XSX A;  2XPU A;  1B72 B;  4EJV A;  3CB4 A;  3CLQ A;  2HDD A;  2PBI A;  2JA5 J;  4TMT A;  5FL7 A;  3E5X A;  5M5Y J;  3QU6 A;  3DWL E;  4FCY A;  3JR9 A;  3KYC B;  1E1R A;  2QA4 I;  1OGO X;  3HRM A;  3I4P A;  4G6I A;  5TGT A;  1HSJ A;  5E3O A;  3VSK A;  2GZW A;  1CF7 B;  3SYJ A;  3F0C A;  1IRF A;  2A69 F;  1DP3 A;  1IAW A;  2I8D A;  2WAE A;  2XZP A;  5HZB A;  4CZC A;  3F6V A;  2YPR A;  3D5S C;  3K4C A;  2KIM A;  4KMF A;  3EUH A;  1UD4 A;  1R58 A;  1UFM A;  4H4K C;  4A0X A;  1SFK A;  3ZQC A;  1O3S A;  2HQR A;  1LKX A;  4X7D A;  2ID3 A;  5EEH A;  1P7J A;  3BNW A;  3OW2 B;  4P9F A;  2NVY J;  2DY1 A;  2EB7 A;  1KZH A;  4DJA A;  3JW4 A;  1GDT A;  2Q8K A;  2BBY A;  2DBB A;  2H1L A;  4QPQ A;  1LDD A;  3T5X A;  3V42 A;  1W34 A;  5F27 A;  1W7P D;  3LO8 A;  1O8K A;  5ERI A;  4M53 A;  2DYI A;  1D8T A;  4G7X A;  1D0Y A;  4AVZ A;  3ABT A;  4PJJ A;  2DOF A;  3GYH X;  1WPC A;  5EG0 A;  4PC6 A;  1TC3 C;  4OZZ A;  4XMY A;  2NYX A;  3KEY A;  4MQ9 F;  4LG0 B;  4YAU A;  4UVA A;  1ZK8 A;  2XGX A;  4Z4Z A;  1KU3 A;  4HQE A;  3KP4 A;  1R1U A;  1GV2 A;  2QLZ A;  3KEO A;  4II3 A;  2QQA A;  4Y33 A;  1D3Y A;  1MBG A;  1ZYR F;  1NG6 A;  1VQ7 B;  3CCM B;  2QBY B;  4QFM A;  4HW0 A;  2R7T A;  2OU2 A;  1JB9 A;  3CMM A;  2A61 A;  1GUU A;  2P4W A;  2XRO A;  3T56 B;  1WXR A;  4HAM A;  3OYE A;  2LSO A;  1N07 A;  1TSP A;  4JX4 A;  1Y0U A;  2P6S A;  2DFE A;  3DLA A;  1PUF B;  1XFO A;  1UHM A;  1K6O A;  3AVT A;  3KZI C;  2EIX A;  2FUG 2;  4AIH A;  4PAA A;  3J7A O;  4D5F A;  3DKW A;  2DFI A;  3LMM A;  1ZGW A;  4EAT A;  1QZY A;  1RKT A;  3HPG A;  3MVP A;  1IDY A;  1GT0 C;  2OC6 A;  3GLL A;  4OP7 A;  2XRL A;  5LEJ A;  1G3T A;  1Z21 A;  4XOR A;  2IS4 A;  3WXM A;  2M0M A;  3ABL H;  2M45 A;  1V0E A;  1BI1 A;  1FNB A;  2VBE A;  1OCO H;  1XMX A;  3KP5 A;  1R5O A;  1VHE A;  2Q6L A;  2LP0 A;  2W24 A;  4RD0 A;  4HNU A;  3BY1 A;  3V7S A;  2LOO A;  2VBM A;  1XQB A;  2DXI A;  2YWG A;  3S17 J;  4X05 A;  1ZGA A;  3O2P E;  1ITY A;  5IYR A;  3JTH A;  1NK2 P;  4IZZ A;  3H36 A;  5IYC J;  1IV6 A;  1TLH B;  2P81 A;  2ZSI B;  1AKH B;  1YLO A;  4N9I A;  4XQF A;  1ON1 A;  3HOZ J;  1SKY B;  4B4D A;  1YOV B;  5CQG A;  2NPF A;  2HOS A;  4MQV A;  3J81 K;  1FBQ A;  3G2B A;  1LJ9 A;  2NNY A;  1T6S A;  1T33 A;  2X6Y A;  1SC7 A;  1XB4 A;  1DUX C;  1JJ2 B;  2IEK A;  3VO2 A;  1JRG A;  2K27 A;  2OTL B;  3OOP A;  3Q3S A;  3RIR A;  4YIR X;  2CV0 A;  1NB9 A;  4LBW A;  4Y9U A;  1BLI A;  2EQR A;  4IRH A;  1OCP A;  4RGR A;  2QDX A;  3SZE A;  1Z6T A;  2M5W A;  3DLL F;  2WA0 A;  2F4M B;  4BDY A;  4Z2Y A;  2R7F A;  3K4L A;  4X0G A;  1JA0 A;  3GZ6 A;  1W36 D;  1RU4 A;  1HBX G;  4DQL A;  3MZH A;  2A05 A;  2Q6O A;  3RPU D;  3E5U A;  1A36 A;  4DBR A;  1EE6 A;  3QQA A;  5HOD A;  1T39 A;  1ZH5 A;  5LEK A;  2EZL A;  1PP7 U;  1LEB A;  1P92 A;  1Z67 A;  5CVV A;  3VSV A;  3D5L A;  3GTO J;  3DQV C;  5K7H A;  2DT7 B;  3F8C A;  5CVR A;  1YQA A;  2INV A;  3OZW A;  4KIT B;  1Q1H A;  4ZGQ B;  4ZCM A;  3F8F A;  1PJ5 A;  1ETX A;  1F36 A;  1VND A;  1K4T A;  4W8R A;  2DMQ A;  3FK6 A;  5M3F J;  4C3I J;  2XZO A;  4HNV A;  1VQ8 I;  2VUM J;  4FE7 A;  1QVG B;  3K2A A;  4DGW B;  4U7D A;  1R4N B;  1V54 H;  4JMQ A;  4MO7 A;  4X7F A;  3W5U A;  4C2T A;  2QSG X;  2OA4 A;  4WZK A;  3W2G A;  3M1C A;  5J4V A;  4NUB A;  4KMU X;  1TWF J;  4AD9 A;  2NT6 A;  4U4B A;  2J5P A;  2GIV A;  3I3L A;  3TW7 A;  5EF6 A;  1WOP A;  2F43 A;  4MTE A;  2EFQ A;  1D1N A;  2Z16 A;  3AGQ A;  3F8B A;  1QX4 A;  1QBJ A;  2FXA A;  1X4P A;  2FJ1 A;  1DDG A;  3B8Y A;  2G7H A;  2R9V A;  4XRM A;  3OJW A;  4GXO A;  1WKM A;  1E62 A;  2RC5 A;  4XKV A;  1VQ7 I;  3F3X A;  1A6Q A;  1HC8 A;  3CCM I;  1T6Z A;  3IAM 2;  2O61 A;  5JFR A;  1GAW A;  4AM3 A;  4FWT A;  3HSF A;  1TYW A;  3DEW A;  2XB0 X;  2MFZ A;  4B48 A;  4I02 A;  4A2U A;  3GTG J;  3CJN A;  1WJB A;  1UJ8 A;  1YX5 A;  3PQK A;  3ZGK A;  1K79 A;  1R22 A;  2B5O A;  2NSP A;  4WQM A;  3U2R A;  1EFC A;  4K1X A;  2DTZ A;  3M9A A;  1GVD A;  3LSK A;  3VYR B;  4XM3 A;  5GAH J;  5K5O A;  2R7W A;  4ACA A;  2NST A;  4L0Z B;  4RLF A;  2ZME C;  4N4O B;  4P26 A;  2B7C A;  5IYQ A;  4YFO A;  1XGO A;  1X1A A;  3ECH A;  2GQQ A;  2ZBV A;  4BYY A;  4LBV A;  5DCM B;  4BE1 A;  3FHZ A;  4EM2 A;  1LUJ B;  1HST A;  1SMY F;  3E6C C;  3SEJ A;  3U21 A;  2JA6 J;  4R71 A;  3ABK H;  4E7H A;  1E2X A;  2H1K A;  4N3N A;  5TJJ A;  4G7H F;  4X06 A;  1TT5 B;  5D5X B;  1OFM A;  4WXH A;  3X2Q H;  4E7J A;  3GTP J;  4HOB A;  4D0P A;  4RD1 A;  1JTY A;  2ZNZ A;  4NC8 A;  1TWG J;  3OYI A;  1XDU A;  4U0W A;  3RPQ A;  4R79 A;  3QPL A;  2HXO A;  2IA0 A;  1T2K A;  3FJO A;  5F64 A;  4RB3 C;  1JJ8 C;  4PC2 A;  1YS6 A;  2ZME B;  1ETO A;  1OHH A;  2CSO A;  3PFY A;  2ZC2 A;  4ZTF A;  3I0T A;  1ZR2 A;  2E2J J;  1POG A;  1YW8 A;  3WU0 A;  2NS7 A;  1N06 A;  2EFG A;  3E20 A;  2NAZ A;  1KCC A;  5HDN A;  2VJ5 A;  4D5C A;  1MJB A;  1EV7 A;  3ASN H;  1OB2 A;  2HPM A;  3ZMS A;  4W1U A;  1FOW A;  3CUQ A;  1XCV A;  4OIR F;  5C4J J;  3DTE A;  1H88 C;  4DZP A;  4ZYH A;  4RLQ A;  2FD5 A;  3BLY A;  1JUM A;  2OTL I;  2XEX A;  5F4M A;  2XND A;  4L8J A;  5A89 A;  1QQI A;  3WG7 H;  3K1M A;  3AK5 A;  2QGG A;  2KFD A;  1I18 A;  1FYL A;  2KP6 A;  2D1V A;  1UD5 A;  2WPD A;  3W5H A;  2QVO A;  4N0B A;  2DDB A;  2MD5 A;  3LSG A;  4FHT A;  5FB2 A;  2VE9 A;  1WMR A;  1HOM A;  3VB2 A;  4GYI A;  2YR2 A;  5M3M J;  1ONV A;  5HNF A;  4BJ5 C;  3DF8 A;  3HB9 A;  3A01 B;  3B78 A;  1X1B A;  3OW7 A;  1U5T C;  2BOL A;  1MMD A;  1U2R A;  2OK7 A;  1FLI A;  3PO3 J;  2FVG A;  4Z4Y A;  4GQN A;  3QRF F;  2I5U A;  3RSN A;  2XPW A;  2OCC H;  2IXS A;  2GXG A;  2LYC A;  3PEN A;  2R6H A;  3OIP A;  2PYH A;  5IT9 K;  1YX2 A;  3A4C A;  4RDU A;  4IHY A;  3A8K A;  3I9V 2;  3ZQG A;  3B4N A;  2X1D A;  1J2X A;  1U5T B;  4LIT A;  1GO2 A;  2ZZQ A;  3BQZ A;  2W6I A;  4XNF A;  3FM5 A;  1Y0N A;  2KT0 A;  3NEU A;  2BGI A;  3MEX A;  3ZIA A;  3GSI A;  4A0Y A;  3I55 B;  2E2I J;  3OEH A;  3I59 A;  2BE5 F;  1CLW A;  3OR2 C;  1HDP A;  4X6A J;  2VT3 A;  1VHO A;  2PMZ A;  4ABZ A;  5E3N A;  2CW5 A;  2Y48 A;  3BOQ A;  1T08 B;  1D5V A;  2DQR A;  2MLG A;  3BR2 A;  2Q0O A;  3FX3 A;  2PJR A;  3BC8 A;  3DKX A;  1KQ8 A;  2O6W A;  4IXA A;  2RKH A;  1KZL A;  2VN2 A;  3FM3 A;  4E0F A;  2QQ8 A;  3UNG C;  3ZOB A;  2Y0S A;  2H6C A;  1QHG A;  1DBG A;  2UXX A;  2WAF A;  3ZQL A;  1Z6R A;  1BC8 C;  1YRN B;  1KJZ A;  3BCD A;  1L1I A;  1A35 A;  5ICF A;  4HLY A;  1WJF A;  2FOK A;  5J4Y A;  4PJL A;  3W2E A;  2HTS A;  3HZJ A;  3L9F A;  3SUC A;  3GTL J;  4M9S A;  3M4O J;  5F0F A;  3REO A;  1T5E A;  1AOY A;  2ZBK A;  4P25 A;  1UG2 A;  2VNH A;  3G1O A;  5A2Q K;  3CLO A;  1QZZ A;  5ICG A;  1N77 A;  4CHU A;  2CK3 A;  3H3Z A;  4XLP F;  1O8H A;  5LHH A;  4ZYG A;  2Z1D A;  4XID A;  1YS7 A;  1NG7 A;  3OMY A;  1R5H A;  3S2D J;  4PGH A;  2DOG A;  4A0Z A;  5A2Q Z;  3WGG A;  2X0K A;  4IQJ A;  5CPR B;  1OCC H;  2IRF G;  5GTH C;  5EDN A;  1KCD A;  2HEO A;  2Z5U A;  1Z9C A;  5B1B H;  3BT9 A;  4GGG A;  1FYM A;  5H5J A;  2QQB A;  2GOM A;  4Q4Z F;  3L2C A;  1FWZ A;  5DD4 A;  5K7F A;  4AIK A;  2V7T A;  2DW4 A;  2BN4 A;  1A8P A;  2EIJ H;  3OOU A;  1X19 A;  1O8G A;  2E5N A;  3IH2 A;  4MYT A;  4UZE A;  4C0S A;  1AIP A;  4ESF A;  1Q9S A;  3PA2 A;  5FIU A;  2PEC A;  3H5R A;  1YJ9 B;  2EIN H;  4BNC A;  3DU6 A;  1VF9 A;  1I6H J;  3PVD A;  4YAF A;  3LSP A;  3H35 A;  4ZCL A;  1IDK A;  3QP6 A;  2FA5 A;  2HQN A;  4OOS A;  5TY0 A;  2M7A A;  1LFP A;  1N0U A;  1VFC A;  1OGI A;  2CH0 A;  4JK1 X;  4CXF A;  2OBR A;  2ISZ A;  3U9G A;  4L5E A;  1FMV A;  2CUJ A;  5HLT A;  1O8F A;  4ZTJ A;  2DA2 A;  2K85 A;  3CP8 A;  1XGM A;  3VMV A;  5C44 J;  2IT0 A;  1D8J A;  4KIG A;  2VAS A;  1WJE A;  2Y30 A;  3BG5 A;  9ANT A;  5IYD J;  1VQL B;  3SEQ A;  4A6E A;  1IJF A;  2FQ4 A;  5AIP A;  1O8J A;  3DBR B;  5FKN A;  1R5B A;  1I8D A;  4W97 A;  3RKW A;  3K7A J;  1S0U A;  4YAL A;  4MIM A;  1WZ2 A;  1ORK A;  3C7J A;  3SZP A;  1R36 A;  3GQB A;  5F4O A;  4QIW N;  3WYA A;  3BWG A;  1ZAR A;  2R3S A;  3HDD A;  4BE0 A;  1Z0X A;  2W6J A;  3HKZ N;  2E34 A;  2LC2 A;  3GQ9 A;  2PMH A;  1IJE A;  3OZU A;  3P4G A;  3OOC A;  2AS5 F;  2A6T A;  2DDA A;  2PG4 A;  4M3D A;  2VNJ A;  5FO1 A;  1W7P A;  2GA2 A;  4RDL A;  2ID6 A;  2CO5 A;  4BEH A;  5F04 A;  1O8I A;  2XAJ A;  1Z3X A;  3RJP A;  5HVQ C;  2XZL A;  3EUH C;  2BPO A;  2Q6I A;  2CQX A;  2KL4 A;  4WZT A;  4LJZ F;  2O5R A;  2QTZ A;  2M4G A;  2OF7 A;  3PSF A;  5CVU A;  3I55 I;  1Y0Y A;  1BJK A;  1JHH A;  3BZ6 A;  4G9Y A;  4KT5 C;  4PCQ A;  1OFC X;  1M1K D;  3FXU A;  3H9Q A;  4BPR A;  2W85 A;  2GK7 A;  2HU9 A;  5E79 C;  3U6K A;  4X07 A;  2XOK A;  2R7O A;  5IP9 J;  1NDH A;  2LY2 A;  3BR3 A;  2L3D A;  2HGC A;  1F60 A;  1UZC A;  2QE7 A;  3BZC A;  2Y75 A;  3TW6 A;  1IW7 F;  4YG2 F;  2V7V A;  1MBF A;  2FX0 A;  3B8H A;  4PDK A;  3A1P A;  2XTX A;  3PUN A;  3MFK A;  1IB4 A;  4ROX A;  4A93 J;  5FO0 A;  1ODD A;  4OIP F;  3ZZU A;  1R7J A;  3TDU C;  3ZQH A;  2Z8G A;  1F9N A;  3W3C A;  1ZG3 A;  1ZUN B;  1XSD A;  2M8G X;  1DBO A;  5H6R A;  1YLF A;  2EV5 A;  3C2B A;  1DU6 A;  2DT5 A;  1QUE A;  2LZJ A;  2OBT A;  3JCU C;  1LLW A;  3PJR A;  4IHV A;  1PLU A;  1M1E B;  4XLC A;  3LMW A;  2NXN B;  2V7Q A;  1W87 A;  4D1Q A;  5EG0 B;  4P6V F;  2G0E A;  1VQ5 B;  2FNA A;  5DUK A;  5GV7 A;  1T38 A;  1O3Q A;  1P4W A;  1VQO B;  3G3Z A;  2HOA A;  3KZZ A;  4L9N A;  1IV8 A;  2JWT A;  5J3L A;  2HDN B;  2M30 A;  2A68 F;  4MNU A;  3L1P A;  2LH9 A;  1HA3 A;  1SD6 A;  5JLW A;  1KU7 A;  1BR4 A;  5KAF C;  3MKY B;  1OR7 A;  3WTS C;  4AID A;  4OZY A;  1SD7 A;  1UMQ A;  1FP2 A;  2XB5 A;  1EFR A;  1JTA A;  1ZAO A;  2ESN A;  4HPQ A;  2VLA A;  4B44 A;  3VR6 A;  4L5J A;  2WAQ A;  4BAC A;  4XIC A;  1MW7 A;  3VSU A;  1L0O C;  2KHM A;  2DA3 A;  3OS1 A;  2XF7 A;  1UCR A;  4XOP A;  3SLD A;  3CCV B;  3CME B;  3OIQ A;  1YG2 A;  1PKV A;  4RCZ A;  1QRY A;  1YJ9 I;  2DYR H;  1PE9 A;  1WJ5 A;  3ASO H;  2CC2 A;  1GVJ A;  4P5O A;  2K9Q A;  1FNM A;  3TMO A;  1RR7 A;  4CH7 A;  4U9U A;  3ZR8 X;  2BGC A;  4EVI A;  4UVC A;  2GPJ A;  1BR2 A;  2M1B A;  1I3Q J;  1O3R A;  2IBD A;  4NQW A;  4PFP A;  2B7B A;  4G7O F;  2DAO A;  3TDZ C;  4Z4U A;  3G4S B;  4JX6 A;  1RQP A;  4NC7 A;  2R5Z A;  1UD3 A;  1QJV A;  4NBS A;  3ZUG A;  4C2L A;  1R00 A;  4RGU A;  1GLN A;  3KP7 A;  1HF0 A;  2QZ8 A;  2XNC A;  1N05 A;  5E3M A;  1SD5 A;  2ESH A;  3Q0W A;  5J1U A;  3AG4 H;  3ZPL A;  3ASR A;  3F72 A;  2FBH A;  1NB0 A;  3WBJ A;  1MBJ A;  2EV6 A;  2H09 A;  2VQH A;  3CP2 A;  4IQ4 A;  1MAB A;  3BR0 A;  4XD7 A;  4ASU A;  2O0W A;  4A6D A;  4MXN A;  3N90 A;  3A8I A;  3L00 A;  3CO6 C;  5KW9 A;  3ZSC A;  4CA0 A;  4A3J J;  3ERE D;  1RC9 A;  4HBL A;  4TN1 A;  1MKM A;  3GBG A;  1IB0 A;  1C0W A;  2RAE A;  2L54 A;  5B66 C;  1TL8 A;  2O6G E;  4DYR A;  3A3G A;  2XGD A;  1BR1 A;  4AUX A;  2R0Q C;  2NVT J;  3BH6 B;  2ZZF A;  5J6X A;  4UZU A;  2HZD A;  4LFU A;  3DXJ F;  4JQF A;  3GZN B;  3FDY A;  1ZM4 A;  5HLG A;  2L2O A;  4M9X A;  1KU9 A;  3FMQ A;  4RB1 A;  2XAU A;  4L9V A;  4ZJZ A;  1LE8 A;  4MYU A;  1QGP A;  2HOE A;  1VI0 A;  1U6G A;  4WK8 F;  5HS8 A;  1XSV A;  3GTJ J;  4IO9 F;  3UKG A;  5FKL A;  2OJE D;  2RVC A;  3P7N A;  1XG2 A;  2D1H A;  1BW5 A;  1TNT A;  5BPI A;  4LB6 B;  2JJ1 A;  3CC4 B;  2H94 A;  2DOA A;  5TV2 A;  5D6F A;  1ZR4 A;  2KDO A;  3CF2 A;  4YEJ A;  2IGN A;  2L7M P;  5D5W B;  3SKB A;  3CMA B;  4BGD A;  2K9S A;  4FQG A;  5LRR A;  2WJV A;  2QN6 A;  2F1M A;  3A0H C;  3T1B A;  1JUS A;  1R1V A;  3OL3 A;  1VQ8 B;  5L3D A;  3S32 A;  4YAO A;  1RIO H;  1W9X A;  5FFX A;  2GOX B;  4JX5 A;  5E8G A;  2VQL A;  1HLV A;  5E1X A;  3C3W A;  4V19 K;  3V7A A;  1BM9 A;  2W57 A;  1ZGJ A;  3IP4 B;  2EFP A;  2K9N A;  2VBV A;  4DQK A;  1VQ6 B;  2LY9 A;  2TDX A;  5L3E A;  1JGS A;  2BY0 A;  1V0F A;  1EH7 A;  1IUY A;  3JAM Z;  3CDI A;  3D26 A;  2HDC A;  1KTW A;  2XAF A;  4GO1 A;  3MKW B;  5L3B A;  1RRJ A;  3H9J A;  2VQC A;  4LOC A;  1VQ5 I;  2LFB A;  4XBF A;  2CG4 A;  3RQ4 A;  1KQ5 A;  1RWR A;  1VQO I;  2ZTG A;  2UWM A;  1SFO J;  4C30 A;  2R7U A;  3NB2 A;  2XAG A;  3VNU A;  2QF7 A;  2QQ9 A;  4XN3 A;  2QWW A;  2IW5 A;  2XAQ A;  2RNJ A;  4I7H A;  3G73 A;  2NTB A;  4YZA A;  3AVY A;  2WB1 N;  3TBI A;  1SAN A;  2VKE A;  3PL8 A;  4AYB A;  1W1W E;  2DA7 A;  2F2E A;  4Z06 A;  5EYR A;  3HOY J;  2L0K A;  2XIG A;  1TW2 A;  1QQ1 A;  1P7I A;  1A6I A;  3W2V A;  3J80 K;  1QVU A;  3VDX A;  3CJR B;  4RJL A;  3HBL A;  2OBS A;  2X51 A;  3K1P A;  2Y9Z A;  2P5L C;  1K7A A;  1BL0 A;  2EZI A;  1DPU A;  4OIQ F;  2ZXW H;  4DK0 A;  2X3U A;  5ED4 A;  3CCV I;  2EK5 A;  3CME I;  1W0T A;  2K3P A;  5E1W A;  3OSG A;  1T6Y A;  4NB5 A;  3H94 A;  4ZZD A;  4PC7 A;  3KYD B;  4BJT A;  4ENM A;  2XC7 A;  2OZU A;  2ZKZ A;  1YFH A;  3I4M J;  5J3O A;  1WJD A;  2V1U A;  4IRG A;  4QTR A;  3CUQ C;  3W2W A;  3BPX A;  3U1D A;  5IOZ A;  4XSZ F;  4M6V A;  1TYU A;  3E0J B;  1MDM A;  1DGW Y;  3CRZ A;  3KRG A;  3ECO A;  3OS2 A;  3NAR A;  1Y8Q B;  4PZJ A;  4ENK A;  3E1Y E;  1TZL A;  3KLO A;  1U9N A;  1E3P A;  2EFO A;  3G4S I;  2DU9 A;  2GRE A;  5IT3 A;  1EH8 A;  1WCM J;  3BTJ A;  2M87 A;  3F21 A;  4MHG A;  3I5U A;  3WOD F;  1MBK A;  3IWZ A;  3P9I A;  1FNN A;  5GAD J;  1FIA A;  1I5Z A;  2EFN A;  4PMH A;  4L5I A;  2DFH A;  3H9G A;  3OL4 A;  4CYD A;  3CD6 B;  3CUQ B;  1TWA J;  1BIA A;  3BTL A;  2VT2 A;  1S9H A;  1VQ9 B;  2CW0 F;  2F5D A;  2ODL A;  2HFH A;  2VBY A;  4P6Y A;  3DPU A;  2IQ7 A;  2QY1 A;  2FRH A;  1BOB A;  3ZN0 A;  3S3N A;  1DU0 A;  1VBL A;  1YIJ B;  1O4X A;  2HVR A;  3EYI A;  2GWR A;  4A3L J;  3L09 A;  2Q1Z B;  5FJ8 J;  4F52 A;  4A5M A;  2HVS A;  3N97 A;  1P4M A;  3CCQ B;  4G8X A;  2XSJ C;  4N4N B;  1ZG1 A;  2RGV A;  2ZSH B;  4OPO A;  1QGA A;  5JBQ A;  4DNR B;  1G6N A;  1LDK B;  3HM5 A;  4E6K G;  1JXS A;  4KUM A;  2F5V A;  5LHG A;  4PJN A;  3Q0V A;  2BZT A;  1EXM A;  4RGX A;  4F7Z A;  3PUF A;  4QLC U;  1OGJ A;  5HOO A;  3A0B C;  2JN6 A;  1PJ7 A;  1O3T A;  3S1Q J;  5CLS A;  4Q7J B;  4XL9 A;  2VBX A;  1BQE A;  3ZMT A;  3CCS B;  3SFI A;  1W5C C;  2H8W A;  2KPM A;  5B3S H;  3CC4 I;  1K28 D;  3K4J A;  4BHC A;  4HE6 A;  3OYA A;  1BA5 A;  4OM9 A;  3AG2 H;  2CQQ A;  2VBZ A;  2J8I A;  3JUR A;  3CMA I;  4BQN A;  2R92 J;  2ZXI A;  3HGY A;  2M9H A;  4YFX F;  4BDZ A;  1PJ6 A;  4GYG A;  4G7Z F;  5J8C A;  3S3O A;  2MD0 A;  1SD4 A;  1U2W A;  2M5S A;  1UHS A;  3LQR A;  4MFE A;  1K73 D;  2F6C A;  1RR8 C;  4I6Z A;  3ABU A;  4UB8 C;  1VQ6 I;  4G1B A;  4BKX A;  3AVW A;  1GHC A;  2P5K A;  2OQG A;  2K3F A;  4IL6 C;  1FC3 A;  2K40 A;  4EJU A;  2AHO A;  3KEW A;  1ETK A;  4Z05 A;  1Q1V A;  4XSX F;  2DQL A;  3LA3 A;  4E7L A;  1MJA A;  2XGC A;  1H8A C;  1NJI D;  2GM4 A;  1D8K A;  2PJR B;  1K83 J;  2NVU B;  2NRA C;  2XT4 A;  3WQZ A;  2HS5 A;  3IUO A;  3RKX A;  2NV4 A;  1EZG A;  2JT1 A;  2KRC A;  1R5I D;  1ZQ3 P;  1YJN B;  1TW3 A;  4LK1 F;  1O8D A;  1BMF A;  4O5V A;  1G59 A;  3OEE A;  3KFW X;  1P6R A;  2WYR A;  4B3A A;  3K70 D;  3LNQ A;  3KP6 A;  1USS A;  3CDL A;  1WJA A;  1HKT A;  2HMA A;  3B6A A;  4TT3 A;  3RDI A;  5GPC A;  4PGO A;  4M9Z A;  4V02 C;  3SJM A;  2KIF A;  4UB6 C;  2WJY A;  2QKL B;  4LIU A;  5TR9 A;  3CUO A;  3V8L A;  2E1O A;  2R7D A;  5FLX K;  3W6K B;  4DOZ A;  3UW0 A;  3ZP5 A;  3VEP A;  5FLM J;  3ZC3 A;  1VZ0 A;  1J5Y A;  4S05 A;  1AU7 A;  1IRG A;  3CJQ B;  2HYG D;  1JE8 A;  2NVX J;  1P9Q C;  4FT8 A;  4U0Y A;  2F5C A;  5FLX Z;  5ILU A;  4M6X A;  1IO2 A;  2K9M A;  3NWT A;  1TQP A;  3PSI A;  3QFS A;  3CXC B;  2BM6 A;  2X6W A;  3GVL A;  3JRD A;  3D1N I;  3GWZ A;  3I58 A;  1FTT A;  2CGP A;  2E1M C;  1U0J A;  4AIJ A;  4YRV A;  1XTA A;  4OAY A;  2V4J C;  4ASN A;  3RZD J;  3NRV A;  2PMD A;  1H80 A;  3BP8 A;  1IXC A;  4OJL A;  2V31 A;  1T6X A;  4WZL A;  2RQP A;  1GAQ A;  4PC1 A;  2ZJR F;  4G6T B;  4KDP A;  2LDU A;  3J7A Y;  3WTY C;  3SQV A;  4M74 A;  4M3F A;  3CD6 I;  3KZY A;  2CQ7 A;  3OR1 C;  2KDZ A;  1XX5 A;  1VQ9 I;  1FBS A;  2CFO A;  1OYW A;  1SMT A;  2VC1 A;  3VOE A;  2VOD A;  1UMK A;  4NCN A;  1RMG A;  4CCM A;  3BCA A;  3OYG A;  2DPU A;  3PO2 J;  5CVJ A;  3KYL A;  1KK2 A;  4B1R A;  3MN2 A;  4IJA A;  3OPO A;  3LL7 A;  1FPQ A;  2Y0M A;  3I64 A;  4RAF A;  1YIJ I;  3S16 J;  2N8G A;  1ELO A;  4UVB A;  2DK5 A;  1TLL A;  3FPK A;  2OD5 A;  3ZPP A;  2E1M B;  1H0M A;  2WY7 Q;  1ZLJ A;  1HCR A;  3QP5 A;  4FTH A;  3BC9 A;  3HYI A;  3OV8 A;  3DPT A;  4PJM A;  3P9C A;  1ZN2 A;  2AXL A;  5D8K B;  2C5H A;  2HTJ A;  1QG0 A;  1YJW B;  1X0C A;  2HZT A;  3JRC A;  2NVQ J;  4U87 A;  5J1Y A;  1VF7 A;  2EIK H;  3I71 A;  1K78 A;  4LGW A;  1H85 A;  4M3B A;  5J40 A;  3G1L A;  2I1L A;  4IHX A;  2G0Y A;  3MKL A;  4FIS A;  2Y69 H;  3CCS I;  3ASQ A;  4DQ2 A;  1WOO A;  2LD5 A;  4EJO A;  1ETY A;  4IEJ A;  3CO7 C;  5A8A A;  5KK1 A;  3U6B A;  2V7F A;  3LVB A;  3WND A;  2LG4 A;  1OB0 A;  1W7P B;  4RGS A;  1GVH A;  3AFH A;  4BEH B;  3GQ8 A;  2PQ8 A;  4RDK A;  3BG9 A;  3TOB A;  2DA1 A;  2HR3 A;  3Q39 A;  4QVA A;  2VKH A;  2DMP A;  2Y2Z A;  2Q2E A;  3RKQ A;  3GRH A;  5ICC A;  2CBX A;  2EA2 A;  2EH3 A;  3EET A;  3L2W A;  2DO7 A;  1NTC A;  4XK4 A;  1O57 A;  3RYP A;  2VON A;  1LVA A;  2IVM A;  4MEY F;  4RDJ A;  1R9T J;  4FN5 A;  2UV1 A;  1OFE A;  3FXJ A;  3MMP A;  1T98 A;  1W5S A;  4OU0 A;  3CZ6 A;  5F08 A;  3TKY A;  1MD0 A;  4CCL A;  3MAJ A;  1OFD A;  3HHG A;  2EIL H;  2CWE A;  3F8M A;  2DTR A;  4YFN F;  1SFE A;  1W0U A;  2F5E A;  3OE7 A;  1BIB A;  1BN5 A;  4EM1 A;  2GJR A;  1KYZ A;  3BR5 A;  2HNH A;  2E1R A;  5KSW B;  3PSS A;  2ME0 A;  2MGQ A;  4U7B A;  4Y3O A;  3JRF A;  4LK0 F;  1H89 C;  2VNK A;  1ZRE A;  2WWY A;  1Z7L A;  1T0F A;  1VLY A;  4M2L A;  1S72 B;  1S7E A;  4ANJ A;  1YJN I;  4IRI A;  3HAG A;  4BXU A;  4DK1 A;  3LSM A;  1OR7 C;  4RMN A;  4UY8 I;  1WI9 A;  5LGU A;  3VST A;  4D7M A;  1OPC A;  4PJ0 C;  1WSR A;  2HQA A;  1S6L A;  3D5R C;  3M8E A;  4XRF A;  3V8K A;  3K70 C;  2BHZ A;  4E4H A;  1OJL A;  1Y39 A;  2YUH A;  3GZ5 A;  4Z1M A;  3QOD A;  5H59 A;  3O8G A;  5E1Z B;  4B3X A;  2I10 A;  5GTI C;  2AHQ A;  2LKS A;  3I54 A;  2CFX A;  4IVN A;  4WX9 A;  2F4N A;  4P12 A;  4LMY A;  1FMW A;  1YE9 A;  5C4X J;  2X53 S;  3FXO A;  5CKT A;  1TTY A;  5FKM A;  4TMV A;  1O8L A;  1OKR A;  3WNC A;  3FBI B;  3OYH A;  2GK6 A;  4I98 B;  1H42 A;  3KL9 A;  1UST A;  1W36 C;  4YII A;  5LMZ A;  2RDP A;  3DPL C;  4A3M J;  4M4S A;  1YX3 A;  4G6Q A;  4P22 A;  2WC2 A;  2BM4 A;  4OWR B;  1AMO A;  3OYD A;  3AVU A;  2HVQ A;  4YZQ A;  2GBY A;  3QOE A;  3DDY A;  2UVE A;  3RZO J;  4DIQ A;  1VQN B;  3BCB A;  3FXQ A;  1PYV A;  1SVL A;  1YYV A;  2OUM A;  1TWH J;  2E2H J;  1EFT A;  3T51 B;  2WAD A;  4G6D A;  3E6B A;  4P9U A;  2XDV A;  5F6F A;  2KRF A;  4A12 A;  3OYF A;  4ITV A;  3ML6 A;  2P5V A;  1OYI A;  2EIM H;  3DU5 A;  3J81 k;  2M8E A;  2ISY A;  5H6Q A;  2MSY A;  2Q6K A;  2VJI A;  4EGY A;  4D7N A;  3ZZ0 A;  1K8F A;  3IAS 2;  1LVK A;  4NQW B;  2DA6 A;  4FX0 A;  5L3F A;  3JSO A;  3E5Q A;  2ME6 A;  3H92 A;  5EEA A;  2R5Z B;  1X58 A;  2CMP A;  2R7Q A;  2M3A A;  2JA2 A;  3ZRG A;  2QBY A;  4LBY A;  3LSH A;  1FZP B;  3RTR A;  4A5N A;  3W2F A;  3Q5F A;  2YS9 A;  2VBT A;  1X1C A;  1YJW I;  5HDK A;  3JQQ A;  3RCO A;  1ENH A;  1MIJ A;  3QYE A;  1G8X A;  2A5Y B;  2C4U A;  3LSR A;  2E60 A;  2CF4 A;  2XTW A;  2A5W A;  3KPH A;  4E7I A;  1D5Y A;  3QE2 A;  3DP7 A; 
#chains in the Genus database with same CATH homology
 3FKS A;  2DT6 A;  1NRK A;  4PSX A;  4OJO A;  2VKD A;  4DNT B;  2LH9 A;  2RNG A;  4B43 A;  2JUG A;  2W1O A;  1BR4 A;  2E1B A;  4XLE A;  3MKY B;  2JJ2 A;  3EUA A;  3B90 A;  2WB1 A;  3ONQ A;  4OZY A;  4F3Q A;  3K4M A;  2P0W A;  5FL7 A;  4BQQ A;  3K4B A;  4BXF A;  1EFR A;  1JTA A;  3DWL E;  4HPQ A;  2VLA A;  4B44 A;  3VR6 A;  3M8J A;  2WAQ A;  4BAC A;  3VSU A;  1MW7 A;  4XKW A;  2KHM A;  1E1R A;  4TSF A;  3OS1 A;  2XF7 A;  1D0Z A;  1D1A A;  4XOP A;  4F92 B;  1OGO X;  3OIQ A;  4PSW A;  1PKV A;  4G6I A;  3DTI A;  5TGT A;  2O0V A;  3VSK A;  1PE9 A;  1WJ5 A;  3BG7 A;  1PJR A;  4P5O A;  1DP3 A;  3LSI A;  4YZ0 A;  2I8D A;  2WAE A;  2XZP A;  3OS0 A;  2KRH A;  3TMO A;  4CH7 A;  4CZC A;  2R7X A;  3ZR8 X;  3G05 A;  3K6G A;  3D5S C;  3K4C A;  1HG8 A;  1BR2 A;  1UD4 A;  4H4K C;  2CV2 A;  3LMW A;  1SFK A;  4JOM A;  1LKX A;  4PFP A;  3TL4 X;  4F93 B;  2VJJ A;  1UD3 A;  4NC7 A;  4DJA A;  1QJV A;  3VYU B;  5DN6 A;  4C2L A;  3V42 A;  2DJI A;  4QPQ A;  1GLN A;  1O8K A;  4HST A;  4G7X A;  1D0Y A;  4AVZ A;  1WPC A;  4PJJ A;  4OZZ A;  1PXZ A;  4XMY A;  2VQH A;  3CP2 A;  2MC4 A;  3KEY A;  4IQ4 A;  1BPL A;  1MAB A;  4XD7 A;  4ASU A;  2O0W A;  4MXN A;  4YZX A;  3T9G A;  2XGJ A;  3OYB A;  1QU3 A;  4II3 A;  3ZSC A;  2WY8 Q;  4CA0 A;  4Y33 A;  3EUK L;  3OFN A;  3GQ7 A;  4XR6 A;  2EWE A;  1NG6 A;  3GBG A;  3A3G A;  1BR1 A;  2R7T A;  3A35 A;  4ZYA A;  3CMM A;  4OJ6 A;  3T56 B;  4CCJ A;  2ZZF A;  3FKJ A;  3OYE A;  4UZU A;  2X1C A;  2HZD A;  4JQF A;  3FDY A;  2L2O A;  3DEE A;  5KCM A;  2XAU A;  4ZJZ A;  3DLA A;  4B3G A;  3LFU A;  2FUG 2;  4B47 A;  3K4K A;  1XG2 A;  1O8E A;  3LMM A;  3ZXS A;  4EAT A;  5CDF A;  3HPG A;  3HXL A;  2OC6 A;  2JJ1 A;  3T53 B;  4YXW A;  2DOA A;  1X4O A;  2E5Z A;  2KDO A;  3CF2 A;  2IGN A;  4YEJ A;  1SAU A;  1Z21 A;  4XOR A;  4YEL A;  4BGD A;  2IS4 A;  2ZZE A;  2M0M A;  2CW7 A;  2LY1 A;  3AL0 C;  1V0E A;  2WJV A;  2F1M A;  1V5E A;  3H0D A;  3OL3 A;  2VBE A;  3S32 A;  1W9X A;  2GOX B;  4HNU A;  3L2R A;  4OJ5 A;  2LOO A;  2VBM A;  4ZDL A;  2VQL A;  2DXI A;  4W8T A;  4KKT A;  3IP4 B;  2LRD A;  2IS2 A;  3PNY A;  4IZZ A;  1GQ8 A;  2VXD A;  2ZSI B;  1UD2 A;  4XQF A;  3K4N A;  1SKY B;  1V0F A;  4KT6 A;  5CQG A;  1KTW A;  3PUB A;  4BUP A;  3MKW B;  1KON A;  1NBM A;  3H9J A;  2VQC A;  4CUG A;  4BE2 A;  2KLO A;  3RQ4 A;  1MMA A;  1RWR A;  3G2B A;  2ZTG A;  3AL0 B;  2UWM A;  2X6Y A;  4IKF A;  2QX3 A;  4C30 A;  5FRM A;  2IS1 A;  2R7U A;  1JRG A;  1DGR M;  2CV0 A;  4HRI A;  4XKC A;  4XN3 A;  1BLI A;  1UEL B;  4YZA A;  2NTB A;  3K10 A;  4F91 B;  4MLO A;  2WA0 A;  3TBI A;  3PL8 A;  4AYB A;  4BDY A;  3A3B A;  4X0G A;  3K4L A;  4Z06 A;  1W36 D;  2NZM A;  1RU4 A;  1COW A;  1K5C A;  1AA7 A;  3W2V A;  3MD2 A;  3VDX A;  3CJR B;  3RPU D;  2X51 A;  4DBR A;  4DK0 A;  1EE6 A;  1FX0 A;  2K3P A;  4LIV A;  3VSV A;  3D5L A;  3H94 A;  3SEZ A;  3DQV C;  2DT7 B;  2IGO A;  2INV A;  4BJT A;  2O17 A;  2XC7 A;  4KIT B;  1WJD A;  4NK6 A;  4C9Y A;  2KQR A;  3W2W A;  3OAA A;  3ZCO A;  4W8R A;  3E0J B;  4RM2 A;  2XZO A;  1DGW Y;  3KRG A;  3OS2 A;  4DGW B;  1WTH D;  3JU4 A;  4J00 A;  1TZL A;  4JMQ A;  1UD8 A;  4C2T A;  3NWS A;  3M1C A;  4XLA A;  4NUB A;  1AIR A;  2NT6 A;  4U4B A;  4E7S A;  3I3L A;  1KMH A;  4W8Q A;  2F43 A;  2Z16 A;  4PMH A;  3H9G A;  2AQF A;  3OL4 A;  2JDI A;  2ODL A;  1S9H A;  1X4P A;  2UUZ A;  1E79 A;  3B8Y A;  2R9V A;  2W82 A;  3DPU A;  2IQ7 A;  4QPO A;  2QY1 A;  3L2Q A;  4XOT A;  1BOB A;  3S3N A;  1VBL A;  4XKV A;  2HVR A;  2JVH A;  2XF6 A;  3IAM 2;  2Q1Z B;  2JIZ A;  2X1E A;  1K6Y A;  4F52 A;  3HPH A;  2WZP P;  1Z3Y A;  2V9K A;  2MFZ A;  4B48 A;  2HVS A;  1HVX A;  2NTP A;  2XSJ C;  4N4N B;  4KIS A;  2ZSH B;  1WJB A;  1D1B A;  1YX5 A;  2F4I A;  3ZGK A;  2R7R A;  4DNR B;  4E6K G;  1LDK B;  3OWT A;  2NSP A;  1IDJ A;  3VYR B;  2F5V A;  3LSK A;  4XM3 A;  3SYT A;  4PJN A;  2R7W A;  4XKB A;  3A2K A;  3GVK A;  4TKO B;  2NST A;  3EQN A;  4DBQ A;  5C1C A;  4XON A;  4RLF A;  4N4O B;  3SDB A;  1N78 A;  5HOO A;  1X1A A;  3UR3 C;  3OYJ A;  4Z03 A;  4XL9 A;  4BE1 A;  2IGK A;  3FPP A;  4IX7 A;  3OYN A;  2CV1 A;  1WJC A;  1BN8 A;  2KPM A;  3U21 A;  1K28 D;  2GJK A;  3K4J A;  4E7H A;  4URR A;  1HA8 A;  3OYA A;  1ZEL A;  3N05 A;  5HKK A;  3BG6 A;  1OFM A;  3JUR A;  4E7J A;  4BQN A;  2ZXI A;  2D3N A;  4NC8 A;  4BDZ A;  3OYI A;  3GQA A;  4G7W A;  4R79 A;  3EPZ A;  3S3O A;  2MD0 A;  2QKM B;  4KKU A;  2M5S A;  3S8P A;  4NNJ A;  1OHH A;  2X85 A;  3PFY A;  4ZTF A;  2F6C A;  3OYK A;  4BJ6 C;  3KEW A;  1KCC A;  4Z05 A;  2VJ5 A;  2JVG A;  3S3M A;  2Z2S B;  2LRE A;  2CS3 A;  2HPM A;  4E7L A;  2ZFU A;  4P1W A;  3FY3 A;  3DTE A;  1TT0 A;  2PJR B;  2QXZ A;  3WQZ A;  1ERD A;  3IUO A;  4RLQ A;  3BLY A;  2KRC A;  3H5N A;  2XND A;  4L8J A;  2BSP A;  2O04 A;  2XF5 A;  4CCO A;  1I18 A;  5CQE A;  2KP6 A;  1UD5 A;  4BS9 A;  2WPD A;  2NOJ B;  1O8D A;  1BMF A;  3LSG A;  4PFO A;  1G59 A;  3OEE A;  1BHE A;  2L9N A;  1WMR A;  4EW9 A;  5HNF A;  4BJ5 C;  1X1B A;  3K70 D;  1MMG A;  3FHN A;  3OW7 A;  2BOL A;  1MMD A;  2V6E A;  1WJA A;  3EQO A;  4GQN A;  4CSW A;  4TT3 A;  1Y56 A;  3RSN A;  2D3L A;  4FAS D;  1OFL A;  4NK8 A;  2MYS A;  2WJY A;  2M7B A;  2IXS A;  2CUZ A;  2QKL B;  2LYC A;  4LIU A;  1UD6 A;  3NE5 B;  3HKZ A;  4DOZ A;  2M4K A;  1HZE A;  3OIP A;  1MMN A;  2ZZG A;  2BW3 B;  3A4C A;  2PYH A;  3UW0 A;  2NT9 A;  1VZ0 A;  5LFA A;  2R7V A;  3BH4 A;  3CJQ B;  1P9Q C;  2KVO A;  3I9V 2;  3B4N A;  2X1D A;  2K9M A;  3NWT A;  3PSI A;  2KMU A;  2Q2E B;  2W00 A;  4LIT A;  3ZQQ A;  1UG0 A;  1T0F C;  2ZZQ A;  2DCE A;  2X6W A;  2W6I A;  4XNF A;  3GVL A;  3ZIA A;  1NHC A;  4OJP A;  2E1M C;  1U0J A;  2MAB A;  4YRV A;  4OAY A;  3OEH A;  2V4J C;  5KNL A;  3C2G A;  5HNH A;  1H80 A;  3OR2 C;  1QCX A;  4MR0 A;  4OJL A;  2V31 A;  5FRN A;  4C2U A;  4G6T B;  2PMZ A;  5JHF A;  3J7A Y;  4ZDP A;  2AQE A;  4ZC3 A;  2Z6B D;  2VB6 A;  4XLF A;  2OV7 A;  3OR1 C;  2CFO A;  2VL8 A;  2PYG A;  2PJR A;  1RMG A;  4CCM A;  3BCA A;  3BC8 A;  3DKX A;  3OYG A;  4FET A;  3KYL A;  5IK2 A;  1CZF A;  1KZL A;  3OPO A;  3LL7 A;  2L9S A;  4E0F A;  3DTK A;  3UNG C;  2VQG A;  3ZPP A;  2Y0S A;  1QHG A;  3MMY B;  4E7Z A;  1DBG A;  2WSS A;  2E1M B;  2WAF A;  3OY9 A;  2WY7 Q;  2BVM A;  1W0K A;  2ZTN A;  3BCD A;  3VSL A;  2L7K A;  4B3F X;  2ELJ A;  4HIZ A;  1WJF A;  1OOC A;  2JSP A;  2L5Q A;  3BC9 A;  4PJL A;  3C2H A;  2INU A;  3SUC A;  3DPT A;  4PJM A;  1X0C A;  1T5E A;  5AMV A;  4U87 A;  1VF7 A;  3HL2 A;  3S93 A;  2GJP A;  1N77 A;  2UVF A;  2CK3 A;  1H8H A;  1OLT A;  1VJS A;  4CCK A;  1O8H A;  2HPI A;  4PK4 A;  2Z1D A;  2O1D A;  3L2V A;  1NG7 A;  3OMY A;  3WWG A;  1T95 A;  4CCN A;  2BW3 A;  4IQJ A;  2V7F A;  5CPR B;  2LG4 A;  1OB0 A;  3AFH A;  4BEH B;  3GQ8 A;  1KCD A;  2VJ4 A;  2VKH A;  4FXU A;  4HEA 2;  3GRH A;  1IRX A;  2GOM A;  3ZPN A;  3DKY A;  3L2W A;  1R6R A;  2K5C A;  3OYM A;  3OOU A;  2UV1 A;  2V1N A;  1X19 A;  1O8G A;  2E5N A;  3CZ6 A;  5C1E A;  2HLD A;  3A1Y A;  1J09 A;  4CCL A;  1H8E A;  4KJZ A;  2PEC A;  4E7K A;  3H5R A;  1IA5 A;  3OE7 A;  2X6X A;  3DU6 A;  2GJR A;  4XN0 A;  4W8S A;  1EA3 A;  1E43 A;  2HNH A;  3VYT B;  3H35 A;  2RRE A;  1IDK A;  3FBN B;  2M7A A;  2IGM A;  3E1S A;  1LFP A;  4U7B A;  3VMW A;  2X3H A;  2CH0 A;  4Y3O A;  4F55 A;  4HNT A;  2W7N A;  1Z7L A;  5HLT A;  1FMV A;  2CUJ A;  1JI8 A;  1VLY A;  4ZTJ A;  4ANJ A;  1O8F A;  3W2A A;  3CP8 A;  4HSR A;  3HAG A;  3VMV A;  3H5A A;  3VWB A;  4Y4R A;  2W4S A;  2VAS A;  1WJE A;  3LSM A;  4DK1 A;  3F9K A;  1OR7 C;  4RMN A;  2RQQ A;  3SEQ A;  1O8J A;  1E3Z A;  2ZXH A;  3VST A;  1O8M A;  1I8D A;  3HC7 A;  2HQA A;  3D5R C;  3SZG A;  3K70 C;  2X8K A;  2VIX A;  4E4H A;  3HG9 A;  3HOT A;  3GQB A;  4Z1M A;  4J01 A;  3PNV A;  3QOD A;  4ZDO A;  2K9L A;  4OAZ A;  4B3X A;  2LBF B;  4BE0 A;  3QYF A;  2W6J A;  2LC2 A;  3GQ9 A;  4KKS A;  3OOC A;  1V5F A;  2V26 A;  1FMW A;  5FRO A;  4RM3 A;  1YE9 A;  2A6T A;  2DIE A;  5CKT A;  2X53 S;  1O8L A;  3FBI B;  3OYH A;  2GK6 A;  1MND A;  3QYB A;  1E1Q A;  4BEH A;  1Y6I A;  3MKZ A;  3GVJ A;  1O8I A;  4U49 A;  1Z3X A;  1W36 C;  5HVQ C;  2XZL A;  3DPL C;  1X1D A;  3EUH C;  1YX3 A;  1E3X A;  4D9J A;  4P22 A;  2KL4 A;  4OWR B;  3PNT A;  2O5R A;  4BQO A;  2M4G A;  5KHD A;  4PUS A;  2HVQ A;  3OYD A;  4YZQ A;  1V5G A;  3QOE A;  3PSF A;  3BCF A;  3DDY A;  1D0X A;  2UVE A;  4DIQ A;  2VXZ A;  3VYS B;  3L2U A;  3BCB A;  2V4D A;  3H9Q A;  1PYV A;  2OUM A;  2GK7 A;  2HU9 A;  1OGM X;  2VPL A;  2BVL A;  2XOK A;  4BL0 B;  2R7O A;  3T51 B;  2VBK A;  2CW8 A;  2WAD A;  1E0E A;  2LY2 A;  3HUG B;  4BU2 A;  2XDV A;  1WP6 A;  3CES A;  2QE7 A;  2R7S A;  3OYF A;  4ITV A;  4GRI A;  3OYL A;  3DU5 A;  3HOS A;  2IS6 A;  1IB4 A;  2VJI A;  3IAS 2;  1LVK A;  4NQW B;  5LD2 C;  2Z8G A;  1D1C A;  3W3C A;  4HWV A;  3LNN A;  2CMP A;  4I84 A;  4II2 A;  1UAA A;  2R7Q A;  1DBO A;  2M3A A;  2JA2 A;  3ZRG A;  2HDW A;  1W0J A;  2LZJ A;  1O88 A;  3LSH A;  3RTR A;  2KZV A;  1DQU A;  3PJR A;  1PLU A;  1X1C A;  1WFX A;  4XLH A;  4XLC A;  3KX2 A;  1QHH D;  2NTQ A;  2V7Q A;  4D1Q A;  3RCO A;  3AKZ A;  3QYE A;  1G8X A;  2WBM A;  2E60 A;  1MNE A;  4HG2 A;  4AU7 A;  1N75 A;  2A5W A;  2LBF A;  4E7I A;  3OYC A;  2R4G A;  4LG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...