4XN3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 227
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn3A02
2NSTA 3VMVA 1OGOX 4Z05A 4OJLA 1AIRA 2O1DA 4XR6A 1PE9A 4OZZA 1PLUA 4HWVA 2X6YA 4W8SA 5C1EA 1JTAA 4EW9A 1IB4A 2X6WA 1IDKA 1DBOA 4YZ0A 2PECA 2INVA 3SUCA 1PXZA 2NT6A 5C1CA 1KCCA 4OJ6A 4YZQA 1RWRA 4XLHA 2NSPA 4XLEA 2Z8GA 1OGMX 4XLAA 3T9GA 1JRGA 4OZYA 2QX3A 4YZXA 1NHCA 4XLCA 4OJ5A 1CZFA 4OJPA 3B90A 3VSUA 1GQ8A 1WMRA 2INUA 4OJOA 2PYHA 1O8JA 4U4BA 1K5CA 1H80A 4NK8A 4XMYA 3EQOA 1QJVA 2QY1A 3ZPPA 4I84A 1OFMA 4U49A 4MXNA 1KTWA 3GQAA 4AVZA 2VJIA 4C2LA 1IDJA 1O8DA 1XG2A 1O8IA 2NTBA 2EWEA 2O0WA 3VSTA 3LMWA 4URRA 1O8MA 4Z06A 4XNFA 4YEJA 2QXZA 2VBKA 4XL9A 4XM3A 1O8FA 1O8KA 2NTQA 2NTPA 1IA5A 3JURA 4W8TA 3VSVA 1VBLA 1X0CA 3B4NA 4MR0A 1HG8A 4XOPA 1O8GA 2UVFA 1OOCA 3UW0A 3ZSCA 3WWGA 4XKWA 1O88A 2PYGA 4XONA 2UVEA 2VBMA 2O04A 4XN3A 2X6XA 3GQ9A 2NT9A 3EQNA 4W8QA 1RMGA 3VMWA 4XN0A 4YELA 1RU4A 3B8YA 4XORA 3FY3A 2O0VA 1O8HA 1DBGA 5AMVA 1EE6A 2NZMA 4XLFA 2O17A 3KRGA 2VJJA 3GQ8A 2X85A 4NK6A 1KCDA 3GQ7A 1O8EA 4PMHA 1OFLA 4W8RA 1BHEA 4Z03A 3GRHA 4XKVA 1BN8A 2BSPA 2X3HA 1O8LA 2ODLA 4XQFA 4XOTA 4YZAA 2VBEA 1QCXA 2IQ7A
chains in the Genus database with same CATH superfamily
1FBUA 2NOJB 4UZEA 1ETWA 1G3SA 1SANA 4B3XA 2C6YA 2LYCA 4I7HA 2R7UA 1NB0A 3A03A 2YUSA 1I7PA 3FBIB 2ELJA 2HGCA 1OCCH 5M5XJ 3QP6A 4CA0A 4I01A 3TW6A 2CQNA 3PSSA 1QGPA 5IT3A 4M3FA 1WOOA 2VNIA 1P92A 3OMYA 3ASSA 3CCUI 2IA1A 1YX5A 3K6GA 4LB5A 3ASPA 1V5VA 2ADUA 2WJVA 3G4SB 1WJBA 5IOZA 3HC7A 5GAGJ 2B0LA 2ID6A 3BZ6A 1YX2A 5EGOA 4BGDA 3OS1A 1VQKI 1RWRA 1TLLA 3E20A 3ISXA 2KRHA 1ETYA 1HF0A 1HW5A 4YC5A 2V4JC 3JRDA 2L4MA 4C2UA 4I02A 1SKYB 1HSJA 3LQQA 1V54H 2CMPA 3Q39A 3QWLA 2OV7A 1TW2A 2X9DA 3WGGA 1W0UA 4CCKA 2R92J 4DIQA 1R49A 1B6AA 3P26A 4I98B 3R6KA 4LBVA 3W2IA 2CWEA 2W6IA 3VSLA 1OB2A 1MBGA 2RN7A 2VB6A 2XF6A 1VQOI 1P4MA 5FD6A 2CFOA 3OYAA 2LKSA 5DCMB 3V42A 4NK8A 2ISYA 3OYMA 4IHWA 3SJPA 3BG7A 3RQIA 1ZM4A 1XFOA 2PQ8A 3ZPPA 2KZGA 2Z16A 2ISZA 2VKVA 3BQYA 2WZPP 4Y33A 3OW7A 4IX7A 4RPDA 1OFMA 4KN4X 1ORKA 1O4XA 1OCTC 4HOBA 5H6QA 1S7EA 3FMRA 1LFUP 3N6ZA 4C2LA 5F1RA 1RKWA 2X6OA 4UB6C 2VQGA 3QPTA 5DD8A 5BPDA 4DK1A 1G59A 1O8MA 2Q1ZB 2W82A 2LP0A 3T56B 4TMWA 3NAUA 4A6DA 3NQOA 1VQ6B 2FNPA 2L3DA 4XKCA 4CCNA 4OOIA 2H8WA 4MIMA 1PP7U 4MR0A 5TR9A 1VNDA 5TV2A 5J3OA 3CCEB 4HQMA 4M74A 3ZCOA 2OCCH 4YALA 2JA8J 1SVOA 2ZO4A 1T6ZA 1B4AA 3RQ4A 5HLTA 4RPBA 4RAZA 1EP2B 2IS2A 1FP2A 3AVXA 3E1YE 2O04A 5A2QK 5L3GA 1CF7B 2JSCA 4NC6A 4DNCA 4MFEA 4PSWA 4HF2A 5J8CA 5FD5A 1P7JA 5CQGA 2DDBA 2BXYA 3S16J 3PQKA 1KMHA 1S72B 3FY3A 2K3FA 1WPCA 1VHEA 3BQZA 2RC4A 1H9GA 1TVCA 1ETQA 1UMQA 3CPXA 2JUCA 3GVLA 1FOKA 2AS5F 1EH6A 1R5ID 2MYSA 3HOVJ 3WYAA 1SVLA 3PM1A 2R7FA 2PMZA 2VC1A 5E3MA 4MTEA 1UD3A 1SFXA 2VT3A 3W6JB 1HW2A 2W7NA 1MMNA 2A05A 2LKPA 2QKMB 4I0BA 1VQ9B 4RS8A 4RDJA 1ELOA 2FX3A 4ESJA 2QQ9A 3LSIA 3MKWB 4G5GA 2XGJA 4M72A 4RB1A 2O7OA 3BDDA 2VOOA 4XRMA 1OHHA 3SJMA 3CB4A 2JMWA 3LFKA 4B4DA 4Z05A 1MMDA 4Y3OA 2O1DA 1WJDA 2F5VA 3BTIA 4B48A 3ONQA 3RIRA 3WGHA 1DU6A 1W36C 4F52A 2BF4A 2CW5A 2P8TA 4O5VA 1S7OA 4QPOA 3AG4H 4HWVA 5FKLA 4P55A 1QRYA 3BZCA 2DQLA 3AKZA 1IB4A 2Y0MA 1YJWB 3HB9A 1KYWA 2EA2A 3B6CA 2CYYA 3D5LA 5HDGA 5IYCJ 2P4WA 1SMTA 4LLNA 3G6EB 4CCOA 5J47A 2BM0A 4IEJA 2FNAA 2VJ4A 1OCRH 1JT0A 3QSYA 2ZBUA 3DWLE 5DEQA 3TEDA 2B9SA 2Z3YA 4OWRB 3FKJA 1EFUA 1NK2P 3KYLA 1RQRA 2WADA 3RKQA 4AWXB 3JU4A 3CMMA 1SD5A 3QAHA 2C77A 2QA4B 4M3GA 5AONA 3NAWA 3CC2I 2XAFA 3CCRB 3ZGKA 2BN4A 1TYWA 2K5CA 3UNGC 4AC0A 1IUFA 5D6FA 5EG0B 4BAYA 2CBXA 5B66C 4CXFA 1I6HJ 3SZEA 1U5TA 4F7DA 3BJAA 1U8BA 1H80A 4FASD 4HSRA 3VYTB 3SFIA 1FTZA 1I6XA 3LJYA 1IN4A 4LFUA 1ZUNB 2R5YB 2CUEA 4ON0A 3K70D 4DOZA 2O6WA 1A6IA 3KE2A 4NB5A 4A0XA 4YIRX 3CMEI 1N8RD 2ZJQF 2AXTC 4G6DA 4DYQA 1UD5A 3HRTA 3JRFA 4MYTA 3RIQA 2NVYJ 3OYCA 3HL2A 2VODA 3HBLA 2EA4A 3QODA 4MQ9F 4BQNA 3MZHA 3M3YJ 2HPMA 1I39A 4OU0A 4C2MJ 4Y7NJ 3NRVA 4BNCA 2XTXA 1KQ0A 4IRGA 2PMHA 3BJOA 1O8GA 1Z9CA 3LA3A 4P2NA 3RPUD 3V7CA 2VASA 3X2QH 1ZR2A 1VQNI 2KJCA 3WTYC 2YWFA 3FKIJ 1WXRA 2DMQA 5JLWA 1HVXA 2LOOA 4A3GJ 1ON2A 1KQ5A 2IOUG 1JI8A 2K7LA 3TOAA 3ZZTA 5FLVA 4U87A 4U0WA 3LO8A 4ESFA 3OYNA 3MZYA 1BJKA 2KP6A 3ZQFA 3H36A 2PMUA 2JIZA 2E1BA 1Q86D 3GXOA 1IRFA 2HKOA 1IC8A 4J01A 2TRTA 5BMZA 2XAUA 4ZYAA 4R1HA 1VQ6I 1G3TA 4LJZF 4IZZA 2P81A 2NYXA 1N0UA 2VFMA 1BI0A 2VQCA 3ZPNA 2K9NA 1ZK8A 2EFQA 1U5TC 4N9IA 5HS8A 3CZ6A 3GTGJ 2KZVA 3E1SA 3JW4A 1AA7A 4P22A 3U6BA 1MMSA 1YI2B 3FHZA 4PC3A 4Z4TA 2ZJ2A 4G1VA 3ZBUA 1L1IA 2RQQA 4OAYA 3CC7I 1DQUA 2NSTA 1DPUA 3W5HA 5DYMA 4FXUA 3PUBA 2WYRA 1BR2A 4N3GA 4F3QA 5EDNA 2BMWA 2XNDA 5F64A 3HM5A 2K27A 2LNBA 3E3VA 3I71A 3ZXSA 5FLXZ 3J7YJ 4WZLA 5CDFA 3QFTA 1O3QA 4Z6YA 2R7VA 2ECCA 1H85A 3ZQGA 5THXA 3OEEA 1WRJA 5C1EA 5FRMA 1OR7A 1OCZH 5D5WB 3LSKA 2CK3A 1RUNA 3WNBA 2JPCA 4Q47A 1T38A 5LHIA 1OMIA 2IVMA 2BY1A 4P26A 2XHKA 4EVIA 2JJ1A 9ANTA 4OPWA 1KCCA 5C44J 3ZUGA 4RBOA 2X3UA 1FX7A 4CYCA 1JUSA 2F5FA 4AVPA 1WSRA 3Q9SA 1STZA 5DUKA 1J09A 4X7EA 1HF2A 3V4GA 2EQRA 1BC7C 4RAYA 2XB5A 4YZXA 2QX3A 4NC7A 1S72I 4I76A 1HXDA 4LK0F 3B90A 2K85A 5AIQA 5B6IA 5LFAA 4CGZA 1WVRA 5DV5A 3JQQA 5BQTA 1BW5A 2ZCWA 1EWYA 2VKHA 1YS6A 4ZYEA 3K1PA 3SKBA 2OTJB 1JKRC 1OFDA 3M1EA 1P2FA 3Q3SA 4E4HA 1ZRFA 3K2ZA 2CH0A 4W97A 3PUNA 2XT2A 1ZGAA 1FYMA 4IHYA 1FRNA 4OM9A 3FBNB 1TWFJ 1Z0XA 1IN7A 1N25A 2LY9A 2V7WA 2M3AA 1WDTA 4J19A 2K4BA 2BSAA 1QA3A 1CF7A 4X7FA 2PG4A 1NRKA 4RAGA 1BLIA 2BM1A 4ETSA 3PL8A 3AVUA 4M9ZA 2GWRA 2M8GX 1S29A 3LQEA 1ZLJA 2M5SA 2C78A 1YOVB 5F0CA 5DM7F 1Y39A 3VSVA 1VBLA 4LBZA 2WR8A 2DODA 1X0CA 1J59A 1LE8B 1X4PA 4LITA 1U9OA 4MGRA 1OOCA 1XC5A 5M5YJ 4BJ6C 1IUYA 3T0YA 1USSA 1ZTRA 2CO5A 2M5WA 3TP3A 5JHFA 1FPQA 1KJZA 2FU4A 1QFZA 3ZIAA 2PYGA 1ONVA 3I0TA 2C5BA 1WWXA 4YAWA 1VQKB 2OTLB 1MBJA 3R6SA 5H20A 3OR2C 5TJJA 1KK0A 2DJIA 2W1OA 5FO1A 1RMGA 4W8QA 5L3DA 3AG3H 3HSRA 1YHQI 4Z1MA 2FQ3A 3HPHA 4AIDA 2I10A 2VUMJ 1W34A 3D26A 3H3UA 2CNDA 3CMYA 2DMPA 1F9NA 1GVHA 4H9GA 3PIOF 1CQXA 1G7CA 1R22A 1I18A 1T33A 2UZKA 3M1CA 2QENA 1P4XA 2F4MB 2DMTA 3K4MA 3TO9A 2XROA 3VMFA 3F9KA 3BCBA 2R7DA 1S3JA 1J5YA 2O5RA 5FIUA 2LTPA 4TSFA 2R7SA 2X4HA 1K4TA 3MN2A 4HEA2 1MNMC 1VQ7I 3GTOJ 2OK8A 2JN9A 2OZ6A 2RNGA 3UR3C 2PBIA 5HNFA 5FA6A 4ENKA 3CJNA 2XASA 3P4GA 1F4KA 1ZKGA 1LDJA 2OBPA 3S1QJ 5ICEA 1M1KD 1V3FA 3CCLB 2DA2A 4KT5C 2ZITA 2QQ8A 1XN7A 1J7KA 3WTUC 1WH5A 4BBSJ 2FXAA 2KIFA 2YWEA 4EJVA 4TV7A 1QFYA 3ZZUA 2VFNA 3DU1X 2JRMA 2HS5A 2YPRA 3VEPA 1PE9A 2MH2A 1LEAA 2DO7A 2R4GA 3K4JA 4BEHB 1MDMB 1YJ9B 2BVLA 3OJWA 3IHUA 1MZBA 5EZGA 2FUG2 2F43A 3OAAA 2QGGA 4TMTA 2LG4A 2WB1A 3ZPLA 5IT9Z 3EYIA 3Q0WA 1K61A 1BN5A 5F6FA 2PIAA 3A35A 1DPRA 2LSOA 1T39A 2E2JJ 2HFHA 2KJBA 5HKKA 1QA1A 2MD0A 2KMUA 2XKPA 3LSPA 1QPMA 2DAOA 2XRLA 1VI0A 4XD7A 3OYHA 3RPUA 1TBXA 3IL2A 2H6CA 1R4MB 4AYBN 4EEFG 1R5NA 3NEUA 4KYWA 4MTDA 2R7TA 4V02C 3A3BA 4RD1A 5CVVA 1QZZA 4HV5A 5TY0A 1JKQC 5ICCA 5HNHA 4RCYA 5BSXA 2GQQA 3OIOA 3PETA 2E1RA 3HDDA 3AVVA 2L9SA 2HXOA 2L7KA 3OYGA 1WTHD 2Y69H 2MLKA 3I55I 4FTHA 3MMPA 3OOPA 3I4MJ 1MW7A 1TZLA 3HOSA 2CC2A 1RUOA 2EJRA 2ZSIB 4PJ0C 3HPGA 1LNWA 1VQ5I 4Z4WA 4R71A 1WJFA 4JYKA 3I54A 3ZQHA 3GW2A 3QE2A 3CESA 2DA5A 3W2VA 3OZUA 3LSTA 5BNGA 3LMWA 1NH3A 2V5IA 1NG6A 2ZL7A 2VBKA 2H27A 1O8FA 2EINH 1W36D 3W5VA 4J00A 5FLMJ 1LLZA 4HLYA 4LBWA 1A04A 2O03A 2PX9A 2VBZA 4HF0A 2DBBA 3W6KB 3BPXA 3HOYJ 2M0CA 4KKSA 4HX8A 3VSKA 1IZ1A 5CLSA 2BE5F 4BUPA 1XTAA 3P5JA 3ZRGA 2DA7A 2OC6A 4ZGNB 3MKLA 2BV6A 4KIFA 5L3EA 4FCYA 1VQ4I 4HPQA 3L9FA 1OCPA 4PJJA 3Q9VA 1E1RA 5DN6A 1NDHA 4DYRA 3OY9A 2PJRA 4G6QA 4WZKA 2K9SA 5JVGF 2LY1A 1UD6A 2B7BA 3AL0B 2GQFA 1M90D 1WJEA 1Y56A 5B3SH 2NZMA 2PLYA 2ZKZA 3KRGA 1VQ7B 1EXMA 3GQ8A 2A68F 5D5UB 2GJPA 4ESBA 2Z6BD 1BBYA 4KKTA 3GVKA 1DGRM 4KIBA 1JUMA 2LDUA 3OOUA 3J7ZI 5F27A 3GO5A 1RNLA 2A6TA 1YITI 4P1WA 1B72A 2I5UA 3ISPA 2J8KA 2XTYA 1G2HA 4TN1A 1PJ5A 2MABA 3A0BC 2MBFA 3ES9A 1SMYF 3G1MA 3BH6B 3CF5F 4YHBA 2EZKA 3H9GA 1ZG5A 2Q6IA 5JLVC 4HE5A 5HZAA 1LFPA 2JTVA 1BW6A 3GTQJ 1AIRA 3OYFA 1PUFA 2Y30A 3FXLA 5L3BA 2F5CA 5IYDJ 2XOKA 3MZ8A 5KK1A 4K2EA 2HDCA 2R6HA 2R7WA 1UHWA 2DYRH 2QUFA 4DNTB 2CU7A 5IP7J 5E79C 2XEXA 2IGOA 3R0JA 4M6XA 1E63A 3CO6C 1CQTA 2J7KA 3E6CC 2XC7A 3S3OA 1YRNB 5C4JJ 3K4KA 4Y9RA 1D1AA 1DDNA 1GLNA 1KZLA 2KDZA 1QGYA 4BJ5C 2KIUA 2ZXWH 5E3OA 4RM0A 1BR1A 1XE1A 3H92A 2YR2A 1XD7A 4GCVA 4XLPF 2V6EA 1YFHA 4IRHA 3I55B 1H8EA 4W1UA 1U2WA 2Q2EA 4IOAF 1PDNC 2E2IJ 1UFMA 1PUFB 4IQJA 3BTLA 2EZHA 4RD6A 1R4NB 4HNVA 3OS0A 3CC4B 4MHGA 1ETVA 2KISA 1FDRA 3AL0C 1N78A 2MD5A 3ULQB 2YS9A 3WHCA 3K4NA 1AMOA 1Y1VJ 2DTRA 3FWEA 3Q0VA 4EMSA 3RKYA 3S14J 5IK2A 3JREA 4BXFA 4JP0A 3T53B 1KTWA 1LB2A 3BQJA 2ZL5A 3LSMA 3BR1A 2ZC2A 4DGWB 3FM5A 1E3PA 2K9MA 4HDVA 1RZ4A 2PN6A 3GZNB 2D9RA 4LG0B 2GJKA 4WXCA 2KIQA 1XMAA 2EFNA 2QQBA 2M0MA 3SHFA 5GV8A 3QFSA 2EZLA 1IA5A 2CS3A 1A36A 5F0FA 2JK3A 2WB1N 3H5RA 3JURA 5BS6A 2OTLI 2Z1DA 1VF7A 2DMUA 4RM2A 4CZCA 4ZYDA 1YJNI 2P5VA 2F6CA 2PJPA 3GTKJ 4DNRB 3K7AJ 3VYSB 3WXMA 3PIPF 2VPLA 3IWFA 3S2WA 4RGXA 4O6JA 1XSXA 1JT6A 4YIIA 3OJXA 3I59A 1E3ZA 5FLXK 1HC8A 2PEXA 4EGZA 4KJZA 5HS9A 4KDPA 1T6SA 5J8FA 1KU7A 3GTMJ 1GUUA 1GV2A 2L7ZA 2VBXA 1QUEA 2BHYA 2Y9YA 3K2AA 3P27A 2WY7Q 3RYPA 2LC2A 4DQ2A 3GYHX 4E7IA 4MQVA 2CQXA 4NBQA 2XGEA 4U88A 3L2WA 3JR9A 4WXDA 5FL7A 1CLWA 3CRZA 4H0EA 4ROXA 5IYRA 3S8PA 4C3JJ 2IA2A 4JX5A 2MSYA 4B8XA 2HVQA 4A3EJ 1O8EA 3CO7C 4W8RA 1J75A 1R5HA 2W4SA 4DQKA 1X19A 4XKVA 3NWTA 3WNDA 1GVJA 3BC9A 3IH4A 1JTXA 3OZVA 3FXJA 1ETOA 3DEUA 4V2GA 3VR6A 1POGA 1QCXA 1RPWA 1KK3A 2XPUA 4RGUA 2STTA 2ZJRF 4OIQF 3GFMA 3VDXA 3I64A 3ABLH 4YAOA 3F21A 3V8JA 2C4TA 1KC8D 3WODF 3VWBA 3ECOA 3GX4X 4XR6A 1CGPA 3M9AA 1W4MA 2X1CA 2KHMA 1XG1A 3SDBA 1OQYA 4KMUX 4EW9A 3HGGA 2BBYA 4GYIA 3K9TA 5M3FJ 5K7FA 2ZZQA 4X0CA 1DBOA 4UXNA 3SQNA 4QPQA 1VQMB 2DI3A 2A07F 1R00A 3J80K 4CSWA 1B59A 2BEOA 2VI6A 4FX4A 5BOXA 1Y0RA 1UAAA 5ERIA 3CCQB 3PO3J 2WBMA 1W35A 4RLQA 1IF1A 5L3FA 1JRGA 3G05A 4OZYA 1M1EB 1S5LC 3F6OA 4BL0B 1OYWA 2K86A 1TWHJ 2EFOA 1QX4A 4OJ5A 3BR3A 3HJEA 4OJPA 1ZELA 2PI0A 4KNYA 2COMA 4QSHA 3L2UA 1FYKA 1MBFA 2G7UA 3JSOA 1V55H 1XSVA 1IG7A 1EJ9A 4HF1A 4IHXA 1QUFA 3LA2A 2EIXA 2BM6A 2F3LA 3H35A 2R3SA 2X0LA 5ICGA 1WOSA 3E5QA 3O8GA 2V31A 1YIJB 2WTEA 1MH4A 4AF7A 2X1EA 1CNFA 3EQOA 1S6LA 1MMGA 1X2NA 3FXUA 1JXSA 3BJ6A 3JAMK 3MAJA 2X51A 2W57A 3PSZA 3N90A 4U49A 2GPJA 1YTYA 3JRCA 4ZZLA 3KCCA 4BHCA 3W2HA 2V6CA 2L01A 4BDYA 1FZPB 3VSTA 2YU3A 3P9CA 2JA5J 1SM4A 2BM7A 3RZDJ 1IRXA 1IDYA 4TMZA 2HDNB 3KP2A 3CCJB 2W25A 2G0YA 5L3CA 4E7SA 4PK4A 4N3NA 3CLOA 1Z91A 5HDNA 1AU7A 2JSPA 3H5NA 2VFQA 2Z9OA 2NRAC 2K40A 2JN6A 2MW8A 1KD1D 3SJZA 2M4KA 2IGMA 3O8HA 2ESHA 2M2EA 1N07A 2M7AA 1IXSB 3ABTA 1QVGB 2Y9ZA 3CCVB 4A12A 3SEJA 2ZSHB 1ZLKA 2VBUA 4G94A 1O3RA 2DK5A 3UKGA 1EH8A 3S32A 2OAZA 4OOVA 4L9TA 2E5ZA 1G6NA 2HYJA 1XGSA 3VMWA 3CUOA 1QG0A 3JTHA 3WTTC 4HNTA 5LBQA 1OR7C 3HTSB 1A6QA 2P6SA 1ZGWA 3C2GA 3S2HJ 2H8RA 4BE2A 2VONA 1QA2A 1TTYA 3PFIA 3GTPJ 1BA5A 2ESNA 4RLFA 4ENJA 4V19K 4X05A 1JJ8C 1WJ5A 1JKOC 2BGIA 1OFLA 1FBSA 2UV1A 2VQHA 2BYVE 4HYEA 2TDXA 2XF7A 1ERDA 2JVGA 2E1MB 4QWQA 4BXUA 2FRHA 2BW3B 4X7DA 1W7PB 4RD2A 3HUGB 3HEFA 1MH3A 1COWA 4MEXF 1I3QJ 3ZP5A 4YZAA 5LGTA 2OCEA 4M3DA 2DW4A 2V26A 2EIJH 4YFOA 3DLAA 5FNZA 3CP2A 4QIWN 1IN5A 2A5WA 2A6EF 1BJAA 4IHSA 3AK5A 3D0SA 3WBJA 1F60A 1WI3A 4XRSG 1FNNA 4KISA 3GFIA 1IRZA 3CCQI 3BPVA 3KX2A 4P6YA 3OW2B 2WA0A 3FPKA 2QVOA 3HRUA 1WU8A 3ZR8X 2D5VA 3MVPA 3BR6A 1QGAA 3HTUA 2ZMEC 1Q1VA 3BR5A 2OA4A 2IAIA 2W24A 3HHGA 4ABZA 2OD5A 3HSFA 2XZPA 1TNTA 3OP1A 1IXCA 2IS4A 3M8FA 1UG0A 4RD3A 4BH9A 2DCEA 3C1DA 1NTCA 5LHGA 5FRNA 1GHCA 3JRGA 3DBLB 3FKSA 2AQEA 5GAEJ 2EFGA 3KEYA 2F1MA 3NARA 2WJYA 1YS7A 2KFDA 1D3YA 1EF4A 5KNLA 2X53S 4B47A 2QSHX 3WQZA 3CMEB 3I1FA 3E0JB 1K5CA 2BM5A 3CUQB 4E7HA 3ASNH 4F91B 1JGGA 2G9WA 1VQLI 1Z77A 2BVNA 2HDDA 4L9NA 4XBFA 4ZV4A 5IYWA 1E43A 2AO9A 1JUPA 2GA2A 2CF4A 3CCMB 2ZJPF 3N4MA 3EYYA 1T98A 1TP4A 2V9PA 1V4RA 4AVZA 4DK0A 1WH7A 4XSXF 4M6YA 4I09A 1K8AD 1JNYA 3HYIA 3F0CA 1AHDP 4M4SA 4RCZA 2Y75A 2NV4A 2DFFA 3GFJA 2ZBKA 1YE9A 5FFXA 3W6VA 4YEIA 4G7WA 1U0JA 4UY8I 3H3VK 1UHMA 3SDGA 2MGQA 3HKZN 2BGCA 3C3WA 1LJ9A 2F1LA 2UVFA 1B8IB 1QQ1A 5HLHA 3VYRB 4KITB 2F5EA 2IP2A 4ANJA 2QEXI 5ICFA 3RZOJ 4UUSA 5B5EC 1HDPA 1ZM2A 4II2A 1GR1A 2Z2SB 1VTNC 3U2QA 3WTXC 5BSYA 3FHNA 1E64A 1D1BA 1W5TA 4FETA 3J7AY 3EQNA 4XRSA 2EFWA 4PGHA 2CUZA 2JJ7A 4U7BA 3JRHA 3F22A 4HNUA 3W2AA 4HAMA 2IBDA 4B3GA 2GAUA 4EJOA 4KN7X 2XB0X 5E1WA 5CJ9A 1ON1A 3FIWA 2HCJB 2EIKH 2NNYA 4AM3A 4HX4A 3HOZJ 4BU2A 1KCDA 4Q4ZF 1YLFA 3G1OA 2FX0A 4E7JA 2VBTA 2W84A 1OISA 5JHUA 4ZCMA 1T8IA 2VE8A 1K4SA 2F4NA 2D74A 5DNSA 4HZFA 4M71A 2P0WA 3H9JA 3TMOA 5GTHC 2LRDA 2QKLB 5DDGA 2KLOA 4TMVA 1JHHA 4EV0A 4BHBA 2IJLA 2M34A 2FSWA 2DT6A 2P5KA 1E62A 2KVOA 1EFRA 4A0YA 3MQ0A 5A8AA 4OJLA 1MNDA 1IRGA 3L2CA 1VQ9I 1T0FA 1SD7A 5K7ZA 1B1BA 2M1BA 4RDKA 2DTZA 4WXHA 2RQPA 5DD4A 1Y0NA 4AU7A 5IPAA 1K79A 4ZZDA 1BX0A 2GK6A 1GDTA 1TWCJ 5HDKA 1R5GA 3PNTA 3DLLF 3PA1A 4ASUA 4NC8A 5LGUA 1FBQA 3CTAA 1D1NA 5H2FC 2PECA 3GTLJ 1E3XA 4DJAA 3LSJA 3I3LA 4QFMA 3HSEA 1FMWA 1YIOA 2QQAA 2H1LA 4X0GA 3VO1A 3VNUA 3V7AA 3AVYA 4L9VA 5HLIA 3OPOA 4S0HB 2CW7A 1OGMX 1LVAA 3BP8A 1TYVA 3A01B 4GYGA 2KQRA 4L5JA 4UAJA 1W0KA 4N0BA 4L0ZB 3CMAB 1G8XA 5ED4A 3ASRA 4MNUA 2MA3A 1ZG1A 2STWA 2J8IA 1PUEE 3V8KA 2BGJA 1IJFA 1W0JA 4UV8A 4OPSA 3R0AA 1PYVA 3M4OJ 1ULYA 2P7VB 4HIZA 3FDYA 3R60A 3T51B 4XIDA 2CW8A 1AIPA 3QOPA 4Y17A 3KIOA 2B0RA 5F0HA 4EATA 1ZARA 2R5ZA 1HLVA 1CNEA 2D3NA 1O57A 3J80Z 3OS2A 2QLZA 4Z4UA 4RD4A 2L4AA 1MD0A 2O8XA 2V4DA 4RMNA 2O6GE 2OZUA 3RPQA 3ROUA 1R5OA 1K73D 2NTBA 1L0OC 1RC9A 1YW7A 2ID3A 2MC4A 1FMVA 2V1XA 4ZH4F 4WK8F 1QH0A 3FXOA 3BH7B 1IW7F 2EV0A 1SFUA 5CPRB 3F6VA 3CJTB 4XRFA 2DA1A 2KPMA 4XM3A 4R79A 4WF2A 4RDUA 3MCZA 1U5TB 3ML3A 3B4NA 3SYJA 1VQPI 4BYYA 1REPC 3H09A 1TL8A 3ZMTA 4RD0A 2EH3A 3ZMZA 1RESA 3FMSA 3CCSI 1BR4A 2O9LA 2VT2A 3KEQA 2MH9A 3TKYA 4XLNF 1EP1B 2KDOA 1R23A 1FIPA 1OB5A 5DCFA 1VQ8B 3K0LA 2DYSH 3LL7A 2EILH 3GZ5A 3FXRA 5KVRA 2FVGA 1U3EM 4NBSA 3G1LA 3O6BB 1TLHB 1GVDA 4GGGA 2ZXJA 4UZFA 1W7PA 3F8NA 3EETA 4FX0A 1EE6A 5IYQA 3FX3A 4Y4RA 3LSGA 2QYUA 1AKHA 4QUZA 3I5UA 3LQ6A 1SKQA 3ZMUA 4DZPA 2CFXA 1HKSA 3FPPA 2ICWG 4B44A 5ILVA 3CC7B 3VNVA 4IO9F 1OJLA 3I56B 3A02A 1W5CC 2QEXB 1L3LA 3A01A 3W2EA 4PGOA 2RAEA 3DV8A 4MLOA 3FK7A 2M9HA 1QZYA 3LSRA 1HBXG 5E18F 5IY5H 1Z3YA 4CYCB 2HVRA 2XPWA 3LAPA 1HOMA 5DSZA 2F4OB 2ZFUA 1D1CA 1N06A 1SEUA 2NS7A 3LAJA 1EH7A 3Q3AA 4Y7CA 1JA1A 3HRMA 2DY1A 3BWGA 3IRRA 2WY8Q 2BXZA 4BXXJ 2V7TA 2VE9A 1VZ0A 3MFKA 1Z1DA 1TWAJ 2CGPA 4HW0A 4YFKF 3C18A 1EA3A 4L5IA 3C2HA 4LLGF 5TRDA 5L46A 3S3MA 3SUCA 1WP6A 5EZHA 4A2UA 2ZTGA 2NSPA 1IN6A 2IPQX 3R61A 4YRVA 2C5HA 5H5JA 2CRVA 5HXBA 4P12A 3DP7A 4R8HA 1UHSA 1QHGA 1PJ6A 3DKWA 2DFHA 3DTIA 3U1DA 1QU3A 3KP4A 3DBHB 4Z4YA 4C3IJ 2IA0A 3OR1C 1WJCA 2QBYB 5E3NA 4GDFA 5EEGA 3MD2A 1CZFA 1Z21A 3VSUA 4OJOA 1FNCA 2CUJA 3ELKA 3M8EA 4LD5A 1O8JA 2XTWA 2B7EA 1OB0A 4LG3A 5M3MJ 3BOQA 3K4CA 3SXYA 1NHAA 4D5CA 1ACIA 1VQNB 3IP4B 1IAWA 1X4OA 2XAGA 3HGYA 3IAS2 2PJRB 1V5EA 2ME0A 3AFHA 3WTVC 2BX6A 4I84A 1N05A 1T08B 1XGNA 2LBFA 4ZDLA 3TQNA 2B7CA 1MRZA 2VNJA 3IKTA 4OIRF 3GVJA 3F8MA 5E8IA 1WOPA 5LD2C 1R71A 1ZQ3P 1TYXA 3AGQA 3BY6A 2V7XA 1Q1HA 4Z4RA 4YAUA 5F1JA 2Y31A 4E6KG 3ZMDA 2MC3A 2QXZA 1UJ8A 3OYKA 4WWVA 2EV5A 4C30A 1PVEA 4DQLA 2NTQA 3CP8A 1X1DA 2HQAA 3S15J 5HLGA 1W7PD 1SFEA 2Q2EB 3WTWC 3J7AO 1YHQB 2HZDA 3LOCA 1R58A 4F55A 2XC1A 4ZJZA 4HSTA 2LFBA 2HVSA 1WGXA 1XDSA 2HWVA 1ZG3A 5ILUA 1BC8C 1D8TA 4XONA 1XB2A 1O3SA 2UVEA 3OYJA 5CYVA 2XRNA 5FO5A 2PLFA 3MCAA 4A3FJ 2E2HJ 2VLAA 3TDUC 1PKVA 4DBQA 3B8YA 3K4LA 3KFWX 1LE8A 1JHFA 1TNSA 1BPLA 1T95A 4AUXA 4A3KJ 2OBSA 2O17A 1KGSA 1HW1A 3G71B 4AIHA 1I1SA 4G7HF 5DTDA 1C0WA 3U1KA 3DBRB 4WX9A 2FE3A 1GAWA 4JX4A 4PMHA 1UD8A 2ZZFA 5GP9A 3ZOBA 4CZZA 1FTTA 3BT9A 1XMXA 4OMZA 5EEAA 4KICA 1OFEA 1WI9A 4M9SA 4XICA 2IW5A 3WE3A 1QQIA 5HZBA 4LIVA 1ZREA 5CVUA 3A3GA 3VMVA 3ML6A 3COAC 4C9YA 3E7LA 3L09A 5DUIA 4KA4A 4BE1A 3A8KA 4ZGQB 3DKXA 3DCFA 4L9JA 4PSXA 1I5ZA 1VLOA 1JJ6C 3ASQA 3CDHA 2QSGX 3GF2A 1QGZA 4BKXA 1Z6TA 3H0GJ 3K10A 3PA2A 1YG2A 4TKOB 1UG2A 2I8DA 1X1PA 5HVQC 3DF8A 4BY7J 1U78A 1XDUA 3RKWA 3Q5FA 1IN8A 1DP7P 4IRIA 1K78B 1MGTA 4ENMA 3I4NJ 1LUJB 4RGRA 1PXZA 3CDIA 2DA6A 2F48A 3IRQA 1G7TA 3JX8A 2LK2A 1H42A 5A89A 1BI2A 4A93J 4OJ6A 2RVCA 4A3BJ 3WE2A 3CPWB 2W85A 3S1RJ 5GADJ 1R1UA 2E34A 1Q9SA 2JJ2A 3DEEA 2ZXHA 5GPCA 3QOEA 5LEJA 3I59B 4P6VF 1IO2A 3BCAA 2NAZA 2IRFG 3DPUA 2HOEA 2M8EA 3JRIA 4LC0A 5IT9K 3HZJA 2FMLA 2XNCA 5CVRA 1X3UA 3KEOA 3K4BA 4G8XA 3REOA 5FGMA 4M3EA 5IP9J 3W2WA 1K78A 2FQ4A 3GQBA 3H5AA 5F4MA 1YJNB 1X3WB 3GLLA 3N97A 5IYBJ 1F20A 4BHPA 1YLOA 1QRBA 2L7MP 3R6JA 4YAFA 3B73A 3RSNA 4HV6A 2QSFX 3IAM2 5LEKA 1O8KA 4CYDA 1B9MA 4FE4A 1SD6A 5IP6A 1XCVA 3FXMA 1QO0D 1JB9A 2CG4A 2NS0A 1WCMJ 5BPIA 4FK8A 2DT7B 2W48A 4A5NA 1VF9A 3O3KA 4D7MA 4PUSA 1I3AA 3F23A 2Q6OA 3LNNA 3PQJA 2DK8A 1IV6A 2V9KA 2GJRA 1B9NA 3L1PA 3JRAA 4C43A 3GQ9A 1TUIA 4J0QA 5IYPA 1E3HA 1K9MD 1EFTA 1T0FC 5DS9A 4K1XA 4HG2A 3OOCA 5AMVA 3JQPA 2FD5A 1MABA 3L2RA 4Q7JB 1JE8A 1VQ8I 1YJ9I 2V7QA 2UUZA 5D8LB 3A8IA 1FOWA 1W9XA 4LIUA 4EM2A 3FISA 4QLCU 2Z33A 3D5SC 3LWFA 3T8RA 2OPTA 1G7RA 1PP8F 2X3HA 4XQFA 3EQLF 1W0TA 5F4OA 2VBSA 2LMDA 3I53A 5EJCA 2Q0OA 1VFCA 2X1DA 1BL0A 3OIQA 4U9UA 2CQKA 5KHDA 1OGOX 1I27A 4XKBA 3HOTA 1LPQA 1H8HA 3WY9A 5EGOB 3RI4A 1IB0A 2Q6LA 1AKHB 5KW9A 1EV7A 2D3LA 2XSJC 2L9VA 2BOLA 1ZM9A 3GMEA 3BCDA 2M4GA 3ZQLA 1MSFC 3GIRA 1XMKA 2PMZN 2VBYA 2ACJA 3N05A 4L5EA 1ODDA 1IJWC 2IS6A 1T6YA 4EM1A 2NOGA 2EIMH 2RV8A 4M53A 4G12A 4D7NA 3ZZ0A 2VXZA 2EBIA 4P1VA 3KLOA 1MIJA 3M07A 5AN9A 3CLQA 3HAGA 4P9SA 4XLEA 2CRGA 1RKTA 4RJLA 1XB4A 1MMAA 3FK6A 3KP6A 4ITVA 3U9GA 2G7HA 3T9GA 4YDTA 3BH4A 1G3YA 1FY7A 2M45A 3BG6A 4ZCLA 3A2KA 3DEWA 4IQ4A 3OFNA 4UB8C 4PC1A 3HOUJ 4FT8A 3QPLA 3T1BA 4HLXA 2EFPA 3PJRA 2L0KA 3Q6QA 3SZTA 5K7HA 2DMNA 4NUBA 5EMNA 1A8PA 2L02A 4CCLA 2CV2A 2I1LA 1LQ1A 1O7LA 3I56I 2NVTJ 2FBHA 4ACBA 4XMYA 2F2EA 3ZN1A 3H94A 3B8HA 2W7ZA 1P9QC 3RTRA 1Z05A 3WGIA 2WWYA 2PE3A 3VB2A 2HLDA 3OYEA 3G6EI 4YCQA 2COBA 1QVTA 2BZTA 1IDJA 3CC4I 1MBHA 1O8IA 2D1HA 2R0QC 4PC6A 3G3ZA 3KPHA 3BR0A 5HS7A 2L5QA 2J5PA 2V7VA 2VNHA 3KZIC 3PNYA 1DARA 1W2BB 1GXPA 4RDLA 4X7CA 1BIAA 3ABUA 3LYCA 1WFXA 3U21A 3PSFA 4M2LA 2GBYA 2EPFA 2XIGA 1LVKA 2L9RA 4DYCA 2O0YA 4OAZA 4UUTA 4E7LA 2CQQA 3GBGA 3ZQQA 5J1RA 4XOPA 3HUGA 2JVHA 2K3PA 2Z99A 5C4XJ 3FM3A 2JWTA 3QPHA 2BVMA 1F36A 1QHHD 4CCMA 3E6DA 4NQWA 1YIJI 2LBFB 2WAEA 4IF4A 3CUQA 1FNDA 1Y8RB 3SLDA 3AVWA 2V79A 3T8TA 2Y0SA 1WPKA 3AVTA 1IDZA 4OINF 1EP3B 3VOEA 4IKFA 5D5VB 2NT9A 2GA1A 3KP3A 3I4PA 4XN0A 1OKRA 5EEHA 3S1MJ 5EF6A 2DETA 1ZYRF 5KSWB 1DBGA 2KIMA 2F4IA 4N4OB 2ME6A 3GZ6A 3OYLA 5ILSA 2EK5A 2OQGA 3BZKA 3L2VA 4ZYHA 4HQEA 3QU3A 4OOXA 3A1YA 3CD6B 5J1UA 3KLNA 4ZTFA 2HXIA 3QYFA 1S8NA 1JTYA 4S05A 1HA3A 3VYUB 3GRHA 4TMXA 4G6TB 3KP5A 1EA0A 1TQPA 5K5OA 1B8IA 1T6XA 5FJ8J 2BV3A 2ZL6A 1BIBA 2FOKA 2XAHA 4P3YA 3HOWJ 3QYBA 5H59A 1K4ZA 4UVCA 3TGNA 1HZEA 4JK1X 2DN0A 4X1EA 3IKVA 1FRQA 3I9V2 2V7FA 2P3MA 3ZN0A 1P6RA 4CHUA 3A4CA 3CCJI 3J81Z 5E17F 1V0EA 3BY1A 1TSPA 2JQ7A 5GPAA 3TL4X 2X6WA 1RQPA 4EJWA 1YW8A 4Y9UA 4YZ0A 1BMFA 2INVA 1FNBA 4X06A 1K6OA 4Q5SF 3E97A 5C1CA 1RR8C 2LH9A 3K70C 3QFCA 4WZEA 4YZQA 5B1AH 2YSRA 4XLHA 4Z4VA 1OYIA 4KKUA 3BLYA 1TQMA 1UCRA 3LFUA 1I50J 1GJRA 1OYYA 1T56A 2QN6A 5TISC 3HRSA 3ZC3A 3G4SI 2C2WA 1NHCA 1QVFB 4XLCA 2ZMEA 4D0PA 4WCGA 2LF8A 1RI7A 2X8KA 3A8JA 4A3JJ 4NQWB 2M7BA 4PABA 1DP3A 3GEZA 3DU5A 2BPOA 4A69C 4E7KA 3OKXA 2P6TA 2DOGA 2IGNA 2DCUA 2DERA 3TO6A 3OZWA 4CQJA 4P25A 5H6RA 2QCOA 2WV0A 4HE6A 2HTJA 2XAQA 3PNVA 3CCRI 3RYRA 3CC2B 2OJED 3DQVC 1Y8QB 2ELKA 4RLZA 2VIXA 2DXIA 2DLLA 2HZTA 3WU1B 1HCRA 3GQAA 1BJZA 4B43A 2XKOA 4EM0B 2DYIA 1D5VA 3I58A 4BACA 3H1CA 4U7DA 4UVAA 4MYUA 1JA0A 5FFZA 1FOYA 4XL9A 4X07A 1SAUA 4PC7A 1GAQA 4UNOA 4Z2YA 4W8TA 1EFCA 3A0HC 4CDGA 2V1DA 4WQMA 4Y15A 1Y6IA 4O3MA 4II3A 2RGVA 4BPRA 1H8AC 2X0KA 4S04A 1W87A 1TTTA 2LR8A 1KK2A 4AYBA 5IOYA 5F04A 3WWGA 4EQQA 1X1CA 1YW9A 3HXLA 2BY2A 1S7AA 3W2FA 3ZMVA 3ONYA 2X6XA 3ZQ7A 2KRCA 3BG3A 3DTKA 1JGSA 1FOXA 3MEXA 1MSEC 5GAHJ 1BI3A 2OU2A 4XORA 1E0EA 3F3XA 3TW7A 5CQEA 4YIFA 1D0XA 2O0VA 1O8HA 1XGOA 2EZIA 2DQRA 5DS0A 3BG5A 2ZB9A 2VJJA 3SQVA 1TYUA 2X85A 4ZTJA 1Z67A 1BI1A 2GIVA 2O8KA 1TW3A 3ABKH 1S4MA 3OIPA 1FWZA 2E1OA 2JZYA 3EPZA 4UHTA 4A0ZA 2PMDA 4EH1A 3ASTA 3QPSA 1MJAA 3C7JA 4BQAA 1Q81D 6PAXA 3WBKA 5FB2A 5LRRA 2GOXB 1QPIA 2JA2A 2DOEA 4QHYA 1E1QA 2XNJA 1N77A 2GLOA 2JPBA 1JKPC 1FP1D 5EYRA 3KZZA 4D1QA 1VHOA 2QZAA 2QA4I 2RKHA 2VXDA 3ERED 4I99C 1Z6RA 4CO8A 2K9LA 4QVJA 4E70A 3V7SA 2K4JA 4C3HJ 2GK7A 2VKDA 1LDDA 3F8CA 3F72A 4IPAA 4W8SA 2GZWA 2HOTA 1P4AA 2DPUA 4Y52J 3M8JA 4KIGA 4BQQA 2HNHA 2DU9A 4AD9A 2QE7A 4CICA 2BW3A 5FROA 1NBMA 4LBYA 4I6ZA 5D4RA 2NVUB 4IVNA 3TO7A 2QF7A 1YX3A 3ZQIA 1QA6A 2YUHA 3L2QA 3T5XA 4XLAA 1DG1G 1X58A 3ESWB 1NK3P 4OP7A 4PFPA 4A3MJ 4GFBA 3LMMA 1B2RA 3DFGA 5FKOA 1TT0A 1W5SA 1GQ8A 2Y2ZA 1WMRA 4FN5A 1UB9A 4U0YA 1IHMA 1F5TA 1IGNA 1VQ5B 3JSPA 4IW3B 3QFRA 2VC0A 1NB9A 2EWNA 2ETHA 4N4NB 5FKMA 2H6BA 5E3LA 1F43A 2ZNZA 1QJVA 3J81K 3DDYA 1MBEA 2ZXIA 2A5YB 4IXAA 3AG2H 1YO5C 3BCFA 3L7WA 2OBRA 3RY8A 2VBWA 4E7ZA 4OPVA 2R7ZJ 3CCLI 3V7RA 1A35A 1VQPB 2HQNA 3DPTA 2C4UA 4Z06A 1OGIA 1VQLB 3FJOA 3CCSB 1B23P 1XS9A 3RDIA 3K69A 3CMAI 1KQ9A 1TQIA 3OV8A 1R9TJ 4G6IA 3BTJA 3BR2A 4RB2C 2FBIA 4BDZA 4X8IA 4C0SA 1D0YA 2LKXA 4F93B 3Q6RA 3ONUA 3BY2A 5K1YA 2WPDA 1SFKA 5EG0A 1KA8A 1EKEA 3EUKL 2JUGA 2L2OA 4XN3A 1Y0YA 3OL3A 1IXRC 4PFOA 1BM9A 4LLLA 1QNTA 1WZ2A 1FSEA 4YELA 4GQNA 3D1NI 5FO0A 1RU4A 1E79A 3HHHA 3WG9A 3E5UA 2DOAA 4JOMA 4MO7A 3PFYA 2CW0F 3Q0UA 2R5YA 1PJ7A 4BQOA 1D2EA 1U2RA 2XF5A 4UUSB 4PAAA 4OIPF 3BC8A 3DXJF 2AXLA 2YU9J 3M7GA 2OTJI 3V76A 1MBKA 3A1PA 2QDXA 1E2XA 4A3IJ 1LLWA 3JCUC 1HA8A 2Y48A 1BN8A 2JRTA 2E1CA 2WSSA 1FT9A 3GFLA 4P9UA 1DDIA 1LDKB 4P9FA 2FA5A 3PVDA 2XVCA 4MFDA 3B6AA 4XOTA 1UELB 3B02A 1MNEA 3F8FA 4KUMA 2AHQA 3H0DA 1WSVA 4OPOA 4AIJA 2RNJA 1ZGJA 2OUMA 4L8JA 2MFZA 3S93A 4Y13A 1VJSA 4KH3A 3ZBTA 2BY3A 2NNNA 1ZM3A 4ACAA 1Z7UA 4WWCA 2LLKA 2DA3A 3FXKA 3FF5A 4P3IA 2ZNYA 2ZFWA 3EUHA 4F7ZA 2HPIA 1H9TA 2HU9A 1D8KA 4OZZA 2EB7A 1HQCA 2X6YA 5K5QA 1JTAA 2VFPA 2VOPA 3B82A 2WAQN 2BHZA 4D9JA 3MKZA 2NS8A 4BJTA 3Q38A 3E6BA 2P5LC 1GO2A 3WTZA 3GLXA 4RGSA 3J81k 1FJLA 2HR3A 1G3WA 2UXNA 1SC7A 4KMFA 1R6RA 4B4CA 5LRSA 4I0AA 4UUVA 3QYEA 2NVQJ 2JA6J 1KU2A 4PGGA 1H89C 2ZTNA 1BQEA 3OYDA 3WU0A 2HYGD 2R5ZB 3K1MA 4DW6A 2XSDC 2H94A 4JQFA 1G4DA 4KFCA 4G7OF 4TT3A 5JMCB 3OL4A 1SAXA 4AC9A 2EV6A 4ZDOA 1X2MA 5KCMA 4B3AA 2ZZGA 2A69F 4GO1A 3FZVA 4RAFA 2UXXA 1R1TA 5GTIC 2LD5A 1U6GA 5C3EJ 2VBVA 3LA7A 3QRFF 2VYQA 4U4BA 2VPRA 1TC3C 4EJUA 2XZLA 1R1VA 5J4VA 2XGDA 2Q8KA 1YITB 3TOBA 2DA4A 2IT0A 3PO2J 3IH2A 1APLC 2RC5A 4QV2A 2QY1A 1DDGA 2AQFA 2VJ5A 1FLIA 3GSIA 1V5GA 5J35A 4MXNA 3SZPA 1H88C 4HX7A 2MLGA 3SZGA 3KZYA 1BX1A 1XQBA 2HMAA 5F4JA 2CUFA 2QTLA 2HKXA 1WQ2A 2L54A 3HG9A 3MMYB 2Q6KA 3CCMI 4ZYGA 4U0VA 3KYCB 4IHTA 4YFXF 3DPLC 4YG2F 4OMYA 4WZTA 4I2OA 4DBRA 3ZMSA 1FSHA 2K02A 3KYDB 1R36A 2MG4A 2WC2A 2LF7A 5JLXA 4DZJA 5LLQA 1RIOH 1ZAOA 1HG8A 2HQ5A 3MHPA 4PDKA 1VLYA 1VQOB 1WHUA 2OQRA 4MEYF 5J1YA 4UZUA 1K8FA 2XUBA 3AAFA 3MKYB 4M6VA 4HDUA 1X3ZB 2JDIA 1G7SA 1WSUA 4LK1F 3DTEA 2XDVA 2JT1A 1OGJA 4P5OA 1D8JA 2HDWA 2XZOA 1Y1WJ 2HTSA 4ENNA 2YX7A 1SFOJ 3BTCA 1KONA 2YX4A 1KQ8A 3EUHC 2DOFA 3P7NA 4XLFA 2DEUA 1Z7LA 2IGKA 1I1GA 3OE7A 4RB3C 4PZJA 1ZRCA 1GV5A 1DABA 4M9XA 3KEWA 2OYNA 4JMQA 5TGTA 1N75A 2GXBA 4LB6B 4Z03A 3AGPA 1I8DA 2BSPA 1HSTA 2FBKA 2QYOA 4M73A 1O8LA 2LREA 2GIZA 4N9HA 1OLTA 3CD6I 2HQRA 3FMQA 2OK7A 3GUDA 2E35A 4HA8A 4AIKA 3OSGA 2W6JA 3NE5B 1YRNA 4AF6A 1PJRA 3CCUB 3OYIA 2DT5A 5J3LA 2Z5UA 1UD4A 2OBTA 1X1AA 3CJQB 5E1XA 1F1ZA 5J40A 3WG7H 3SEQA 3BROA 3VFZA 5JR3A 3JTGA 3SYTA 5M5WJ 3QP5A 5KAIC 1AWCA 2HEOA 1UD2A 1OFCX 3OYBA 2VKEA 4XSZF 1UMKA 2DFIA 1J9ZA 1PLUA 2IS1A 3LSHA 4ZC3A 1K7AA 2QBYA 4C2TA 2LVSA 3W2GA 2J5OA 4Q48A 4B1RA 1IDKA 1HDDC 4A3LJ 1HKQA 3D5RC 2QGUA 5AIPA 3V8LA 3LNQA 3LVBA 3PENA 3G2BA 4OIOF 1N08A 2BY0A 2XGCA 2A6HF 4B09A 1ZR4A 4L0YB 1ETKA 3KETA 3TH0A 4ASNA 2YWGA 4BS9A 3HKZA 2AHOA 2E5NA 2Z8GA 3JRBA 1V5FA 4F92B 1H0MA 1NG7A 2VQLA 1NJID 4G1BA 2R7RA 2B63J 1D5YA 2E7XA 3EUAA 1IV8A 4EJTA 5HOOA 3HIFA 2XAJA 2E36A 2INUA 4UVBA 1SVMA 2GREA 3WU2C 3S17J 2QMUA 2HI3A 4ZCIA 2PYHA 4RB0A 2F5DA 4IOCF 2GXAA 1R7JA 4NDLA 2CSOA 2FEZA 3DU6A 3C2BA 2R93J 5KAFC 1J0RA 2YWHA 2IXSA 5CVJA 1GT0C 4BEHA 3PSIA 1WJAA 3GWZA 4A6EA 1ETXA 1XPXA 2P7CB 2VJIA 2FMYA 2WAQA 5CVIA 4Z4ZA 2ELHA 3RCOA 1HKTA 1ZH5A 2Y0SN 5IYNA 1AOYA 3IWZA 4A3DJ 2X48A 2DDAA 4FISA 4XNFA 2VZLA 4EGYA 4OOSA 5J4YA 2ZZEA 4YEJA 1XCBA 2NTPA 1WKMA 1ENHA 2L7FP 4V2FA 5F08A 1USTA 3OEHA 1QBJA 3ZQCA 5E20A 1ITYA 3BNWA 2KRFA 3VO2A 1A31A 2RREA 3E5XA 4GXOA 4FQGA 2ZMEB 2D2WA 4LMYA 2GXGA 2QM3A 3JQRA 1O7FA 2HOAA 2O3FA 1YJWI 1XX5A 3UW0A 1YYVA 1K6YA 5HODA 4PCQA 2D45A 4XKWA 1O88A 4LG0A 4CH7A 1KQSB 4LOCA 2VBMA 4H4KC 1MJBA 1QVUA 3CUQC 5K5RA 1FNMA 3RJPA 3VPRA 4D5FA 4BY1J 1DGWY 2G0EA 1XSDA 1DU0A 1YQAA 1FX0A 2VFOA 4CCJA 2R7XA 3U6KA 1KU3A 3K1NA 3SEZA 4JRAC 1ZHFA 3CJRB 4JBAA 1U9NA 1MDMA 1VQ4B 3G73A 2NVXJ 2H09A 2D1VA 3B78A 3TBIA 5GV7A 1KK1A 2R7OA 3GQ7A 3R4KA 3LQRA 5FKNA 1TWGJ 3VODA 5JVTA 1LKXA 1BHEA 3P9KA 3WNCA 1OCOH 2W00A 4KT6A 4FWTA 4M3BA 5LGNA 2HOSA 1Q82D 1JJ2B 1LM1A 1KTVA 4FE7A 1KZHA 1U8RA 1N0VC 1EZGA 3NB2A 3CW2A 2KL4A 2VBEA 1KYZA 3H9NA 2IQ7A 2NPFA 5E6TA 1S9HA 3H9QA 3CDLA 3HOXJ 2QZ8A 2CV1A 3S2DJ 3W5UA 1KU9A 1RR7A 1P4WA 2WV1A 1VQMI 2E1NA 4BBRJ 4G7XA 4PJMA 3IC7A 2XV4S 3P9IA 1FIAA 2UWMA 2RC6A 2QWWA 1S0UA 2DJNA 2FOWA 3SLNA 3AG1H 3TDZC 2XGXA 4P96A 1IJEA 2ZBVA 2VL8A 3F8BA 5JFRA 4Z4SA 5LHHA 4YFNF 5D4SA 3CXCB 1Q7YD 2E71A 5B1BH 3JAMZ 3KL9A 3OWTA 3CCVI 2NT6A 3PUFA 5CKTA 2M87A 1ZRDA 5FKKA 1GXQA 4PC2A 4HBLA 2KKOA 3EDPA 2QTZA 3L00A 1B72B 1QFJA 3O2PE 4PJNA 2FF4A 4LGWA 2A61A 4M1KA 2L9NA 1XGMA 3IUOA 3PUMA 1DUXC 4RA2A 3IH3A 3KP7A 3TP0A 2V1UA 4G9YA 5E1ZB 3G71I 4QVAA 2DIEA 4CUGA 5A88A 2PFBA 3SY2A 2WAFA 3FXQA 5A2QZ 1T2KA 3U2RA 3S1NJ 2NXNB 3QQAA 1RRJA 2V9VA 2BM4A 2RDPA 1V0FA 4YXWA 1WORA 2K9QA 1FC3A 1RETA 1OPCA 4ZDPA 2E19A 1J2XA 2V7UA 2GOMA 1SD4A 1W1WE 3GVAA 1E3OC 3CQZJ 1YI2I 2R9VA 3DKYA 2N8GA 2GM4A 4A5MA 1D0ZA 1O8DA 2E60A 1XG2A 5DM6F 2H1KA 4GRIA 3GCMA 2EWEA 2O0WA 1K28D 4JX6A 1MKMA 5D5XB 4URRA 2A3SA 2XPVA 1TT5B 4HRIA 1O3TA 2E1MC 1A5JA 2R7QA 2FJ1A 4G7ZF 3S3NA 2TCTA 2LY2A 2CJJA 2CQ7A 3QU6A 1LEBA 4X6AJ 2ECBA 3ASOH 5E8GA 4IL6C 2E7WA 4NNJA 3W3CA 1MJ9A 4UV9A 5J6XA 2VN2A 4E0FA 3ZSCA 1J9IA 3BG9A 2KT0A 3E6MA 1LFBA 2IEKA 1BOBA 2OF7A 4A3CJ 1KRHA 3OSFA 5D8KB 5DCMA 3CCEI 2LZJA 2DFEA 2O61A 2WZNA 4IJAA 1QRCA 3NWSA 3CF2A 1X1BA 4RM3A 2HYFA 4QTRA 4M0LA 1ZN2A 3MWMA 3RKXA 1Z3XA 1K83J 1FYLA 4L18B 2DPDA 4B3FX 2M30A 1T5EA 3CCYA 1QZEA 4NK6A 1FEXA 2VNKA 1R5BA 4XK4A 4NHJA 2XT4A 3WTSC 1E17A 4PJLA 1UZCA 3H3ZA 4FHTA 2V1NA 4BE0A 5JI6A 4NCNA 5D6EA 3ERMA 3GTJJ 4IHVA 2JA7J 3ECHA 2CV0A 5LMZA 3SFZA 2ODLA 1P7IA 3IV5A 3WHBA 5JBQA 1Y0UA 1BOAA 3ABMH 2B5OA
chains in the Genus database with same CATH topology
2NOJB 1E1QA 1N77A 1Z3YA 3H9GA 2HVRA 4B3XA 2R7UA 2LYCA 1LFPA 2ZFUA 1D1CA 1AIRA 4D1QA 3OYFA 2VXDA 3FBIB 2ELJA 2K9LA 2XOKA 4CA0A 2R7WA 2GK7A 2VKDA 2WY8Q 4W8SA 4DNTB 1VZ0A 3OMYA 3M8JA 4BQQA 2HNHA 1YX5A 3K6GA 1EA3A 2IGOA 2QE7A 2BW3A 5FROA 3C2HA 2WJVA 1WJBA 3S3MA 1NBMA 3SUCA 3HC7A 1WP6A 4BGDA 3OS1A 2XC7A 3S3OA 3K4KA 2ZTGA 1D1AA 1RWRA 2NSPA 4YRVA 1YX3A 1GLNA 1KZLA 2KRHA 4BJ5C 3L2QA 1QHGA 4XLAA 2V4JC 3DTIA 1QU3A 1BR1A 4C2UA 3OR1C 1WJCA 4PFPA 2V6EA 1SKYB 3MD2A 3LMMA 1CZFA 2CMPA 1H8EA 2OV7A 1Z21A 4CCKA 1TT0A 4DIQA 1GQ8A 1WMRA 4OJOA 2CUJA 3VSUA 4IQJA 2W6IA 3VSLA 1O8JA 2XF6A 2VB6A 3OS0A 1OB0A 4LG3A 3K4CA 2CFOA 3OYAA 3V42A 4N4NB 3IP4B 4NK8A 3OYMA 1X4OA 3AL0C 1N78A 3BG7A 1QJVA 3K4NA 3DDYA 3IAS2 3ZPPA 2PJRB 1V5EA 3AFHA 2ZXIA 4I84A 2Z16A 5IK2A 4ZDLA 2LBFA 3BCFA 4Y33A 3GVJA 4IX7A 3OW7A 2WZPP 4BXFA 3T53B 1KTWA 1OFMA 4C2LA 3LSMA 4E7ZA 4DGWB 5LD2C 2VQGA 2K9MA 4DK1A 1G59A 3DPTA 1O8MA 2Q1ZB 2W82A 4Z06A 2GJKA 3T56B 4E6KG 2M0MA 2QXZA 3OYKA 4C30A 2NTQA 1IA5A 2CS3A 3CP8A 4XKCA 1X1DA 3H5RA 2HQAA 4CCNA 4G6IA 3JURA 2Z1DA 1VF7A 4MR0A 4BDZA 4CZCA 2Q2EB 4RM2A 4DNRB 2F6CA 1D0YA 3VYSB 2HZDA 4F55A 4F93B 3ZCOA 2VPLA 4ZJZA 2WPDA 4HSTA 2HVSA 3RQ4A 1SFKA 5HLTA 1E3ZA 2IS2A 3EUKL 4XONA 2UVEA 2JUGA 3OYJA 2L2OA 2O04A 4XN3A 4KJZA 3OL3A 4PSWA 2VLAA 4PFOA 1PKVA 4DBQA 4YELA 4GQNA 1RU4A 3B8YA 5CQGA 2WY7Q 3K4LA 1E79A 1KMHA 2LC2A 4E7IA 1BPLA 3FY3A 1T95A 2DOAA 4JOMA 1WPCA 3PFYA 3L2WA 4BQOA 5FL7A 2O17A 2XF5A 3GVLA 3BC8A 2MYSA 3S8PA 2PMZA 1UD3A 2HVQA 1O8EA 4PMHA 1UD8A 2ZZFA 4W8RA 2W4SA 1X19A 4XKVA 3NWTA 2W7NA 1MMNA 1HA8A 2QKMB 1BN8A 2WSSA 1LDKB 3BC9A 3LSIA 3MKWB 2XGJA 4XOTA 1UELB 1OHHA 1MNEA 3H0DA 3VR6A 4LIVA 1QCXA 2OUMA 3A3GA 3VMVA 4Z05A 4L8JA 2MFZA 3S93A 3VDXA 4C9YA 4BE1A 1VJSA 3DKXA 1MMDA 4PSXA 4Y3OA 2O1DA 3VWBA 1WJDA 2F5VA 4B48A 3ONQA 4XR6A 1W36C 4F52A 2HPIA 2X1CA 2HU9A 2KHMA 3K10A 4QPOA 4OZZA 3SDBA 4TKOB 2X6YA 4HWVA 1JTAA 4EW9A 2I8DA 4D9JA 1IB4A 3AKZA 3MKZA 5HVQC 2ZZQA 1DBOA 4BJTA 4QPQA 3D5LA 1PXZA 4CCOA 4CSWA 4OJ6A 2VJ4A 1UAAA 3DWLE 1R6RA 4OWRB 2WBMA 3FKJA 3QYEA 4RLQA 2ZTNA 3KYLA 3G05A 1JRGA 4OZYA 3OYDA 2WADA 4BL0B 3JU4A 4OJ5A 4TT3A 3CMMA 3DEEA 4JQFA 1ZELA 2JJ2A 4OJPA 2ZXHA 3OL4A 3QOEA 4ZDOA 3ZGKA 5KCMA 2ZZGA 3L2UA 2K5CA 3UNGC 3H35A 4U4BA 2XZLA 3BCAA 1H80A 4FASD 3DPUA 2V31A 3EQOA 4HSRA 2X1EA 3VYTB 1MMGA 2QY1A 2AQFA 2X51A 2VJ5A 4U49A 1V5GA 3K4BA 4MXNA 3K70D 4DOZA 3W2WA 1UD5A 3GQBA 3H5AA 3SZGA 4BDYA 3VSTA 1IRXA 3OYCA 3HL2A 3QODA 3HG9A 4BQNA 3MMYB 3RSNA 2HPMA 4E7SA 3IAM2 4PK4A 1O8KA 3DPLC 2JSPA 3H5NA 4DBRA 1HG8A 2M4KA 1O8GA 2IGMA 2DT7B 1VLYA 2M7AA 3RPUD 2VASA 4PUSA 4UZUA 3LNNA 3MKYB 1HVXA 2LOOA 2JDIA 2V9KA 2ZSHB 2GJRA 1JI8A 3S32A 3GQ9A 3DTEA 2XDVA 4U87A 3VMWA 2E5ZA 4P5OA 2HDWA 2XZOA 3OYNA 2KP6A 4HNTA 1T0FC 1OR7C 2JIZA 2E1BA 4HG2A 3OOCA 3C2GA 5AMVA 1KONA 4BE2A 3EUHC 4XLFA 1MABA 3L2RA 4J01A 1Z7LA 2IGKA 2XAUA 4ZYAA 3OE7A 4IZZA 2V7QA 4RLFA 1WJ5A 2UUZA 2VQCA 3ZPNA 1OFLA 3KEWA 4JMQA 2UV1A 1N75A 5TGTA 4Z03A 1W9XA 2VQHA 4LIUA 3CZ6A 3D5SC 2XF7A 1ERDA 1I8DA 2JVGA 2E1MB 2BSPA 2KZVA 1O8LA 2X3HA 3E1SA 2LREA 1AA7A 2BW3B 4XQFA 4P22A 1OLTA 3HUGB 1COWA 4YZAA 3NE5B 2X1DA 3OIQA 2RQQA 2W6JA 4OAYA 1DQUA 2NSTA 5KHDA 1OGOX 1PJRA 4XKBA 3HOTA 1H8HA 2V26A 3OYIA 4FXUA 3PUBA 1BR2A 1UD4A 3DLAA 1X1AA 3CJQB 4F3QA 2XNDA 3CP2A 3SEQA 3ZXSA 2A5WA 5FRNA 1UD2A 3SYTA 2XSJC 2D3LA 5CDFA 2BOLA 2R7VA 3BCDA 3OYBA 2M4GA 3OEEA 5C1EA 1PLUA 5FRMA 2IS1A 3LSHA 3N05A 4KISA 3LSKA 4ZC3A 2CK3A 4C2TA 2IS6A 3KX2A 2WA0A 1IDKA 3D5RC 3ZR8X 2VXZA 3G2BA 2JJ1A 1KCCA 2XZPA 3HAGA 4XLEA 1J09A 3HKZA 2E5NA 4BS9A 2IS4A 2Z8GA 1MMAA 4ITVA 1UG0A 1V5FA 2DCEA 4F92B 3T9GA 1NG7A 2VQLA 3BH4A 2QX3A 4YZXA 4NC7A 2R7RA 3BG6A 3EUAA 3A2KA 3B90A 4IQ4A 3OFNA 3FKSA 5HOOA 2AQEA 2INUA 3PJRA 5LFAA 3KEYA 2F1MA 2PYHA 4NUBA 2WJYA 4CCLA 2CV2A 2VKHA 5KNLA 2X53S 4B47A 3WQZA 3E0JB 1K5CA 4E7HA 4E4HA 3DU6A 4XMYA 2CH0A 4F91B 3H94A 1P9QC 3RTRA 3FBNB 2IXSA 4BEHA 1E43A 3PSIA 1WJAA 2HLDA 3OYEA 2M3AA 4AVZA 2VJIA 4DK0A 1IDJA 1O8IA 2WAQA 3RCOA 1NRKA 1BLIA 2L5QA 3PL8A 4XNFA 3PNYA 2ZZEA 4YEJA 1WFXA 1YE9A 3PSFA 3U21A 2NTPA 2M5SA 1LVKA 4G7WA 1U0JA 3VSVA 3OEHA 1VBLA 4OAZA 4E7LA 1X0CA 3GBGA 3ZQQA 2RREA 1X4PA 4XOPA 4LITA 2JVHA 2K3PA 2UVFA 1OOCA 4BJ6C 2BVMA 3VYRB 1QHHD 4ANJA 4CCMA 4KITB 3UW0A 2LBFB 4II2A 1K6YA 2WAEA 2Z2SB 5JHFA 4XKWA 3FHNA 4CH7A 3ZIAA 1O88A 2PYGA 2Y0SA 2VBMA 1D1BA 4H4KC 4IKFA 4FETA 3OR2C 3J7AY 2NT9A 2DJIA 2W1OA 3EQNA 1RMGA 4W8QA 1DGWY 4Z1MA 4XN0A 3HPHA 1FX0A 2CUZA 4CCJA 4U7BA 2R7XA 3SEZA 4HNUA 3W2AA 3CJRB 1DBGA 4B3GA 1I18A 2F4IA 4N4OB 3OYLA 3M1CA 3L2VA 3TBIA 4BU2A 1KCDA 3A1YA 2R7OA 3K4MA 3GQ7A 4E7JA 4ZTFA 3QYFA 3F9KA 1LKXA 1BHEA 3BCBA 3VYUB 3GRHA 2O5RA 2W00A 4G6TB 4KT6A 3TMOA 2P0WA 3H9JA 2R7SA 4TSFA 4HEA2 2LRDA 2QKLB 2RNGA 3UR3C 2KLOA 5HNFA 2KL4A 3QYBA 1XG2A 2VBEA 1HZEA 2IQ7A 1S9HA 3H9QA 2DT6A 2KVOA 3I9V2 2V7FA 1EFRA 4OJLA 1MNDA 2CV1A 3A4CA 4G7XA 4PJMA 1PE9A 2UWMA 4AU7A 1V0EA 2R4GA 3K4JA 4BEHB 2BVLA 2GK6A 2FUG2 2F43A 3OAAA 2VL8A 2LG4A 2WB1A 3PNTA 3TL4X 2X6WA 4ASUA 4NC8A 4YZ0A 2PECA 1BMFA 2INVA 1E3XA 3OWTA 4DJAA 3A35A 3I3LA 2NT6A 5CKTA 5C1CA 1FMWA 2LH9A 3K70C 5HKKA 4YZQA 4X0GA 2MD0A 4XLHA 2KMUA 4KKUA 3BLYA 3LFUA 3OPOA 2CW7A 1OGMX 4PJNA 4XD7A 2KQRA 3OYHA 2L9NA 3IUOA 1NHCA 1W0KA 4XLCA 1G8XA 2X8KA 4NQWB 2M7BA 2R7TA 1DP3A 3DU5A 3A3BA 2DIEA 4CUGA 1W0JA 2WAFA 1PYVA 4E7KA 5HNHA 4HIZA 2IGNA 3FDYA 3T51B 1V0FA 2L9SA 4YXWA 2CW8A 2L7KA 3OYGA 1WTHD 4ZDPA 1MW7A 1TZLA 3HOSA 2GOMA 3PNVA 4EATA 3DQVC 2ZSIB 2D3NA 3HPGA 2R9VA 3OS2A 2VIXA 3DKYA 1WJFA 2DXIA 3GQAA 1D0ZA 3CESA 2E60A 4RMNA 4B43A 2V4DA 4BACA 3W2VA 4GRIA 1O8DA 2EWEA 2NTBA 2O0WA 3LMWA 1K28D 2MC4A 4URRA 1FMVA 1NG6A 4HRIA 5CPRB 4R79A 2VBKA 4XL9A 4XM3A 2E1MC 2KPMA 1W36D 1SAUA 2R7QA 4J00A 1O8FA 3S3NA 2LY2A 4W8TA 3B4NA 4KKSA 1Y6IA 4II3A 3VSKA 4NNJA 3W3CA 1BR4A 4BUPA 4E0FA 3ZSCA 3ZRGA 4AYBA 2OC6A 3WWGA 2KDOA 1X1CA 3HXLA 1BOBA 4HPQA 4PJJA 2X6XA 3LL7A 2LZJA 2KRCA 3DTKA 1E1RA 5DN6A 3NWSA 4XORA 3CF2A 3OY9A 1X1BA 2PJRA 1E0EA 5CQEA 4RM3A 1D0XA 2O0VA 1O8HA 2LY1A 1UD6A 3AL0B 1EE6A 1WJEA 1Y56A 4Y4RA 1Z3XA 3LSGA 2NZMA 4B3FX 3KRGA 2VJJA 3GQ8A 1T5EA 2X85A 4NK6A 2GJPA 4ZTJA 2Z6BD 4KKTA 3GVKA 1DGRM 4B44A 3FPPA 3OIPA 3OOUA 4PJLA 4BE0A 2V1NA 3EPZA 2A6TA 4P1WA 2CV0A 2ODLA 4MLOA 2MABA 2GOXB 2JA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NST A;  3VMV A;  1OGO X;  4Z05 A;  4OJL A;  1AIR A;  2O1D A;  4XR6 A;  1PE9 A;  4OZZ A;  1PLU A;  4HWV A;  2X6Y A;  4W8S A;  5C1E A;  1JTA A;  4EW9 A;  1IB4 A;  2X6W A;  1IDK A;  1DBO A;  4YZ0 A;  2PEC A;  2INV A;  3SUC A;  1PXZ A;  2NT6 A;  5C1C A;  1KCC A;  4OJ6 A;  4YZQ A;  1RWR A;  4XLH A;  2NSP A;  4XLE A;  2Z8G A;  1OGM X;  4XLA A;  3T9G A;  1JRG A;  4OZY A;  2QX3 A;  4YZX A;  1NHC A;  4XLC A;  4OJ5 A;  1CZF A;  4OJP A;  3B90 A;  3VSU A;  1GQ8 A;  1WMR A;  2INU A;  4OJO A;  2PYH A;  1O8J A;  4U4B A;  1K5C A;  1H80 A;  4NK8 A;  4XMY A;  3EQO A;  1QJV A;  2QY1 A;  3ZPP A;  4I84 A;  1OFM A;  4U49 A;  4MXN A;  1KTW A;  3GQA A;  4AVZ A;  2VJI A;  4C2L A;  1IDJ A;  1O8D A;  1XG2 A;  1O8I A;  2NTB A;  2EWE A;  2O0W A;  3VST A;  3LMW A;  4URR A;  1O8M A;  4Z06 A;  4XNF A;  4YEJ A;  2QXZ A;  2VBK A;  4XL9 A;  4XM3 A;  1O8F A;  1O8K A;  2NTQ A;  2NTP A;  1IA5 A;  3JUR A;  4W8T A;  3VSV A;  1VBL A;  1X0C A;  3B4N A;  4MR0 A;  1HG8 A;  4XOP A;  1O8G A;  2UVF A;  1OOC A;  3UW0 A;  3ZSC A;  3WWG A;  4XKW A;  1O88 A;  2PYG A;  4XON A;  2UVE A;  2VBM A;  2O04 A;  4XN3 A;  2X6X A;  3GQ9 A;  2NT9 A;  3EQN A;  4W8Q A;  1RMG A;  3VMW A;  4XN0 A;  4YEL A;  1RU4 A;  3B8Y A;  4XOR A;  3FY3 A;  2O0V A;  1O8H A;  1DBG A;  5AMV A;  1EE6 A;  2NZM A;  4XLF A;  2O17 A;  3KRG A;  2VJJ A;  3GQ8 A;  2X85 A;  4NK6 A;  1KCD A;  3GQ7 A;  1O8E A;  4PMH A;  1OFL A;  4W8R A;  1BHE A;  4Z03 A;  3GRH A;  4XKV A;  1BN8 A;  2BSP A;  2X3H A;  1O8L A;  2ODL A;  4XQF A;  4XOT A;  4YZA A;  2VBE A;  1QCX A;  2IQ7 A; 
#chains in the Genus database with same CATH topology
 1FBU A;  2NOJ B;  4UZE A;  1ETW A;  1G3S A;  1SAN A;  4B3X A;  2C6Y A;  2LYC A;  4I7H A;  2R7U A;  1NB0 A;  3A03 A;  2YUS A;  1I7P A;  3FBI B;  2ELJ A;  2HGC A;  1OCC H;  5M5X J;  3QP6 A;  4CA0 A;  4I01 A;  3TW6 A;  2CQN A;  3PSS A;  1QGP A;  5IT3 A;  4M3F A;  1WOO A;  2VNI A;  1P92 A;  3OMY A;  3ASS A;  3CCU I;  2IA1 A;  1YX5 A;  3K6G A;  4LB5 A;  3ASP A;  1V5V A;  2ADU A;  2WJV A;  3G4S B;  1WJB A;  5IOZ A;  3HC7 A;  5GAG J;  2B0L A;  2ID6 A;  3BZ6 A;  1YX2 A;  5EGO A;  4BGD A;  3OS1 A;  1VQK I;  1RWR A;  1TLL A;  3E20 A;  3ISX A;  2KRH A;  1ETY A;  1HF0 A;  1HW5 A;  4YC5 A;  2V4J C;  3JRD A;  2L4M A;  4C2U A;  4I02 A;  1SKY B;  1HSJ A;  3LQQ A;  1V54 H;  2CMP A;  3Q39 A;  3QWL A;  2OV7 A;  1TW2 A;  2X9D A;  3WGG A;  1W0U A;  4CCK A;  2R92 J;  4DIQ A;  1R49 A;  1B6A A;  3P26 A;  4I98 B;  3R6K A;  4LBV A;  3W2I A;  2CWE A;  2W6I A;  3VSL A;  1OB2 A;  1MBG A;  2RN7 A;  2VB6 A;  2XF6 A;  1VQO I;  1P4M A;  5FD6 A;  2CFO A;  3OYA A;  2LKS A;  5DCM B;  3V42 A;  4NK8 A;  2ISY A;  3OYM A;  4IHW A;  3SJP A;  3BG7 A;  3RQI A;  1ZM4 A;  1XFO A;  2PQ8 A;  3ZPP A;  2KZG A;  2Z16 A;  2ISZ A;  2VKV A;  3BQY A;  2WZP P;  4Y33 A;  3OW7 A;  4IX7 A;  4RPD A;  1OFM A;  4KN4 X;  1ORK A;  1O4X A;  1OCT C;  4HOB A;  5H6Q A;  1S7E A;  3FMR A;  1LFU P;  3N6Z A;  4C2L A;  5F1R A;  1RKW A;  2X6O A;  4UB6 C;  2VQG A;  3QPT A;  5DD8 A;  5BPD A;  4DK1 A;  1G59 A;  1O8M A;  2Q1Z B;  2W82 A;  2LP0 A;  3T56 B;  4TMW A;  3NAU A;  4A6D A;  3NQO A;  1VQ6 B;  2FNP A;  2L3D A;  4XKC A;  4CCN A;  4OOI A;  2H8W A;  4MIM A;  1PP7 U;  4MR0 A;  5TR9 A;  1VND A;  5TV2 A;  5J3O A;  3CCE B;  4HQM A;  4M74 A;  3ZCO A;  2OCC H;  4YAL A;  2JA8 J;  1SVO A;  2ZO4 A;  1T6Z A;  1B4A A;  3RQ4 A;  5HLT A;  4RPB A;  4RAZ A;  1EP2 B;  2IS2 A;  1FP2 A;  3AVX A;  3E1Y E;  2O04 A;  5A2Q K;  5L3G A;  1CF7 B;  2JSC A;  4NC6 A;  4DNC A;  4MFE A;  4PSW A;  4HF2 A;  5J8C A;  5FD5 A;  1P7J A;  5CQG A;  2DDB A;  2BXY A;  3S16 J;  3PQK A;  1KMH A;  1S72 B;  3FY3 A;  2K3F A;  1WPC A;  1VHE A;  3BQZ A;  2RC4 A;  1H9G A;  1TVC A;  1ETQ A;  1UMQ A;  3CPX A;  2JUC A;  3GVL A;  1FOK A;  2AS5 F;  1EH6 A;  1R5I D;  2MYS A;  3HOV J;  3WYA A;  1SVL A;  3PM1 A;  2R7F A;  2PMZ A;  2VC1 A;  5E3M A;  4MTE A;  1UD3 A;  1SFX A;  2VT3 A;  3W6J B;  1HW2 A;  2W7N A;  1MMN A;  2A05 A;  2LKP A;  2QKM B;  4I0B A;  1VQ9 B;  4RS8 A;  4RDJ A;  1ELO A;  2FX3 A;  4ESJ A;  2QQ9 A;  3LSI A;  3MKW B;  4G5G A;  2XGJ A;  4M72 A;  4RB1 A;  2O7O A;  3BDD A;  2VOO A;  4XRM A;  1OHH A;  3SJM A;  3CB4 A;  2JMW A;  3LFK A;  4B4D A;  4Z05 A;  1MMD A;  4Y3O A;  2O1D A;  1WJD A;  2F5V A;  3BTI A;  4B48 A;  3ONQ A;  3RIR A;  3WGH A;  1DU6 A;  1W36 C;  4F52 A;  2BF4 A;  2CW5 A;  2P8T A;  4O5V A;  1S7O A;  4QPO A;  3AG4 H;  4HWV A;  5FKL A;  4P55 A;  1QRY A;  3BZC A;  2DQL A;  3AKZ A;  1IB4 A;  2Y0M A;  1YJW B;  3HB9 A;  1KYW A;  2EA2 A;  3B6C A;  2CYY A;  3D5L A;  5HDG A;  5IYC J;  2P4W A;  1SMT A;  4LLN A;  3G6E B;  4CCO A;  5J47 A;  2BM0 A;  4IEJ A;  2FNA A;  2VJ4 A;  1OCR H;  1JT0 A;  3QSY A;  2ZBU A;  3DWL E;  5DEQ A;  3TED A;  2B9S A;  2Z3Y A;  4OWR B;  3FKJ A;  1EFU A;  1NK2 P;  3KYL A;  1RQR A;  2WAD A;  3RKQ A;  4AWX B;  3JU4 A;  3CMM A;  1SD5 A;  3QAH A;  2C77 A;  2QA4 B;  4M3G A;  5AON A;  3NAW A;  3CC2 I;  2XAF A;  3CCR B;  3ZGK A;  2BN4 A;  1TYW A;  2K5C A;  3UNG C;  4AC0 A;  1IUF A;  5D6F A;  5EG0 B;  4BAY A;  2CBX A;  5B66 C;  4CXF A;  1I6H J;  3SZE A;  1U5T A;  4F7D A;  3BJA A;  1U8B A;  1H80 A;  4FAS D;  4HSR A;  3VYT B;  3SFI A;  1FTZ A;  1I6X A;  3LJY A;  1IN4 A;  4LFU A;  1ZUN B;  2R5Y B;  2CUE A;  4ON0 A;  3K70 D;  4DOZ A;  2O6W A;  1A6I A;  3KE2 A;  4NB5 A;  4A0X A;  4YIR X;  3CME I;  1N8R D;  2ZJQ F;  2AXT C;  4G6D A;  4DYQ A;  1UD5 A;  3HRT A;  3JRF A;  4MYT A;  3RIQ A;  2NVY J;  3OYC A;  3HL2 A;  2VOD A;  3HBL A;  2EA4 A;  3QOD A;  4MQ9 F;  4BQN A;  3MZH A;  3M3Y J;  2HPM A;  1I39 A;  4OU0 A;  4C2M J;  4Y7N J;  3NRV A;  4BNC A;  2XTX A;  1KQ0 A;  4IRG A;  2PMH A;  3BJO A;  1O8G A;  1Z9C A;  3LA3 A;  4P2N A;  3RPU D;  3V7C A;  2VAS A;  3X2Q H;  1ZR2 A;  1VQN I;  2KJC A;  3WTY C;  2YWF A;  3FKI J;  1WXR A;  2DMQ A;  5JLW A;  1HVX A;  2LOO A;  4A3G J;  1ON2 A;  1KQ5 A;  2IOU G;  1JI8 A;  2K7L A;  3TOA A;  3ZZT A;  5FLV A;  4U87 A;  4U0W A;  3LO8 A;  4ESF A;  3OYN A;  3MZY A;  1BJK A;  2KP6 A;  3ZQF A;  3H36 A;  2PMU A;  2JIZ A;  2E1B A;  1Q86 D;  3GXO A;  1IRF A;  2HKO A;  1IC8 A;  4J01 A;  2TRT A;  5BMZ A;  2XAU A;  4ZYA A;  4R1H A;  1VQ6 I;  1G3T A;  4LJZ F;  4IZZ A;  2P81 A;  2NYX A;  1N0U A;  2VFM A;  1BI0 A;  2VQC A;  3ZPN A;  2K9N A;  1ZK8 A;  2EFQ A;  1U5T C;  4N9I A;  5HS8 A;  3CZ6 A;  3GTG J;  2KZV A;  3E1S A;  3JW4 A;  1AA7 A;  4P22 A;  3U6B A;  1MMS A;  1YI2 B;  3FHZ A;  4PC3 A;  4Z4T A;  2ZJ2 A;  4G1V A;  3ZBU A;  1L1I A;  2RQQ A;  4OAY A;  3CC7 I;  1DQU A;  2NST A;  1DPU A;  3W5H A;  5DYM A;  4FXU A;  3PUB A;  2WYR A;  1BR2 A;  4N3G A;  4F3Q A;  5EDN A;  2BMW A;  2XND A;  5F64 A;  3HM5 A;  2K27 A;  2LNB A;  3E3V A;  3I71 A;  3ZXS A;  5FLX Z;  3J7Y J;  4WZL A;  5CDF A;  3QFT A;  1O3Q A;  4Z6Y A;  2R7V A;  2ECC A;  1H85 A;  3ZQG A;  5THX A;  3OEE A;  1WRJ A;  5C1E A;  5FRM A;  1OR7 A;  1OCZ H;  5D5W B;  3LSK A;  2CK3 A;  1RUN A;  3WNB A;  2JPC A;  4Q47 A;  1T38 A;  5LHI A;  1OMI A;  2IVM A;  2BY1 A;  4P26 A;  2XHK A;  4EVI A;  2JJ1 A;  9ANT A;  4OPW A;  1KCC A;  5C44 J;  3ZUG A;  4RBO A;  2X3U A;  1FX7 A;  4CYC A;  1JUS A;  2F5F A;  4AVP A;  1WSR A;  3Q9S A;  1STZ A;  5DUK A;  1J09 A;  4X7E A;  1HF2 A;  3V4G A;  2EQR A;  1BC7 C;  4RAY A;  2XB5 A;  4YZX A;  2QX3 A;  4NC7 A;  1S72 I;  4I76 A;  1HXD A;  4LK0 F;  3B90 A;  2K85 A;  5AIQ A;  5B6I A;  5LFA A;  4CGZ A;  1WVR A;  5DV5 A;  3JQQ A;  5BQT A;  1BW5 A;  2ZCW A;  1EWY A;  2VKH A;  1YS6 A;  4ZYE A;  3K1P A;  3SKB A;  2OTJ B;  1JKR C;  1OFD A;  3M1E A;  1P2F A;  3Q3S A;  4E4H A;  1ZRF A;  3K2Z A;  2CH0 A;  4W97 A;  3PUN A;  2XT2 A;  1ZGA A;  1FYM A;  4IHY A;  1FRN A;  4OM9 A;  3FBN B;  1TWF J;  1Z0X A;  1IN7 A;  1N25 A;  2LY9 A;  2V7W A;  2M3A A;  1WDT A;  4J19 A;  2K4B A;  2BSA A;  1QA3 A;  1CF7 A;  4X7F A;  2PG4 A;  1NRK A;  4RAG A;  1BLI A;  2BM1 A;  4ETS A;  3PL8 A;  3AVU A;  4M9Z A;  2GWR A;  2M8G X;  1S29 A;  3LQE A;  1ZLJ A;  2M5S A;  2C78 A;  1YOV B;  5F0C A;  5DM7 F;  1Y39 A;  3VSV A;  1VBL A;  4LBZ A;  2WR8 A;  2DOD A;  1X0C A;  1J59 A;  1LE8 B;  1X4P A;  4LIT A;  1U9O A;  4MGR A;  1OOC A;  1XC5 A;  5M5Y J;  4BJ6 C;  1IUY A;  3T0Y A;  1USS A;  1ZTR A;  2CO5 A;  2M5W A;  3TP3 A;  5JHF A;  1FPQ A;  1KJZ A;  2FU4 A;  1QFZ A;  3ZIA A;  2PYG A;  1ONV A;  3I0T A;  2C5B A;  1WWX A;  4YAW A;  1VQK B;  2OTL B;  1MBJ A;  3R6S A;  5H20 A;  3OR2 C;  5TJJ A;  1KK0 A;  2DJI A;  2W1O A;  5FO1 A;  1RMG A;  4W8Q A;  5L3D A;  3AG3 H;  3HSR A;  1YHQ I;  4Z1M A;  2FQ3 A;  3HPH A;  4AID A;  2I10 A;  2VUM J;  1W34 A;  3D26 A;  3H3U A;  2CND A;  3CMY A;  2DMP A;  1F9N A;  1GVH A;  4H9G A;  3PIO F;  1CQX A;  1G7C A;  1R22 A;  1I18 A;  1T33 A;  2UZK A;  3M1C A;  2QEN A;  1P4X A;  2F4M B;  2DMT A;  3K4M A;  3TO9 A;  2XRO A;  3VMF A;  3F9K A;  3BCB A;  2R7D A;  1S3J A;  1J5Y A;  2O5R A;  5FIU A;  2LTP A;  4TSF A;  2R7S A;  2X4H A;  1K4T A;  3MN2 A;  4HEA 2;  1MNM C;  1VQ7 I;  3GTO J;  2OK8 A;  2JN9 A;  2OZ6 A;  2RNG A;  3UR3 C;  2PBI A;  5HNF A;  5FA6 A;  4ENK A;  3CJN A;  2XAS A;  3P4G A;  1F4K A;  1ZKG A;  1LDJ A;  2OBP A;  3S1Q J;  5ICE A;  1M1K D;  1V3F A;  3CCL B;  2DA2 A;  4KT5 C;  2ZIT A;  2QQ8 A;  1XN7 A;  1J7K A;  3WTU C;  1WH5 A;  4BBS J;  2FXA A;  2KIF A;  2YWE A;  4EJV A;  4TV7 A;  1QFY A;  3ZZU A;  2VFN A;  3DU1 X;  2JRM A;  2HS5 A;  2YPR A;  3VEP A;  1PE9 A;  2MH2 A;  1LEA A;  2DO7 A;  2R4G A;  3K4J A;  4BEH B;  1MDM B;  1YJ9 B;  2BVL A;  3OJW A;  3IHU A;  1MZB A;  5EZG A;  2FUG 2;  2F43 A;  3OAA A;  2QGG A;  4TMT A;  2LG4 A;  2WB1 A;  3ZPL A;  5IT9 Z;  3EYI A;  3Q0W A;  1K61 A;  1BN5 A;  5F6F A;  2PIA A;  3A35 A;  1DPR A;  2LSO A;  1T39 A;  2E2J J;  2HFH A;  2KJB A;  5HKK A;  1QA1 A;  2MD0 A;  2KMU A;  2XKP A;  3LSP A;  1QPM A;  2DAO A;  2XRL A;  1VI0 A;  4XD7 A;  3OYH A;  3RPU A;  1TBX A;  3IL2 A;  2H6C A;  1R4M B;  4AYB N;  4EEF G;  1R5N A;  3NEU A;  4KYW A;  4MTD A;  2R7T A;  4V02 C;  3A3B A;  4RD1 A;  5CVV A;  1QZZ A;  4HV5 A;  5TY0 A;  1JKQ C;  5ICC A;  5HNH A;  4RCY A;  5BSX A;  2GQQ A;  3OIO A;  3PET A;  2E1R A;  3HDD A;  3AVV A;  2L9S A;  2HXO A;  2L7K A;  3OYG A;  1WTH D;  2Y69 H;  2MLK A;  3I55 I;  4FTH A;  3MMP A;  3OOP A;  3I4M J;  1MW7 A;  1TZL A;  3HOS A;  2CC2 A;  1RUO A;  2EJR A;  2ZSI B;  4PJ0 C;  3HPG A;  1LNW A;  1VQ5 I;  4Z4W A;  4R71 A;  1WJF A;  4JYK A;  3I54 A;  3ZQH A;  3GW2 A;  3QE2 A;  3CES A;  2DA5 A;  3W2V A;  3OZU A;  3LST A;  5BNG A;  3LMW A;  1NH3 A;  2V5I A;  1NG6 A;  2ZL7 A;  2VBK A;  2H27 A;  1O8F A;  2EIN H;  1W36 D;  3W5V A;  4J00 A;  5FLM J;  1LLZ A;  4HLY A;  4LBW A;  1A04 A;  2O03 A;  2PX9 A;  2VBZ A;  4HF0 A;  2DBB A;  3W6K B;  3BPX A;  3HOY J;  2M0C A;  4KKS A;  4HX8 A;  3VSK A;  1IZ1 A;  5CLS A;  2BE5 F;  4BUP A;  1XTA A;  3P5J A;  3ZRG A;  2DA7 A;  2OC6 A;  4ZGN B;  3MKL A;  2BV6 A;  4KIF A;  5L3E A;  4FCY A;  1VQ4 I;  4HPQ A;  3L9F A;  1OCP A;  4PJJ A;  3Q9V A;  1E1R A;  5DN6 A;  1NDH A;  4DYR A;  3OY9 A;  2PJR A;  4G6Q A;  4WZK A;  2K9S A;  5JVG F;  2LY1 A;  1UD6 A;  2B7B A;  3AL0 B;  2GQF A;  1M90 D;  1WJE A;  1Y56 A;  5B3S H;  2NZM A;  2PLY A;  2ZKZ A;  3KRG A;  1VQ7 B;  1EXM A;  3GQ8 A;  2A68 F;  5D5U B;  2GJP A;  4ESB A;  2Z6B D;  1BBY A;  4KKT A;  3GVK A;  1DGR M;  4KIB A;  1JUM A;  2LDU A;  3OOU A;  3J7Z I;  5F27 A;  3GO5 A;  1RNL A;  2A6T A;  1YIT I;  4P1W A;  1B72 A;  2I5U A;  3ISP A;  2J8K A;  2XTY A;  1G2H A;  4TN1 A;  1PJ5 A;  2MAB A;  3A0B C;  2MBF A;  3ES9 A;  1SMY F;  3G1M A;  3BH6 B;  3CF5 F;  4YHB A;  2EZK A;  3H9G A;  1ZG5 A;  2Q6I A;  5JLV C;  4HE5 A;  5HZA A;  1LFP A;  2JTV A;  1BW6 A;  3GTQ J;  1AIR A;  3OYF A;  1PUF A;  2Y30 A;  3FXL A;  5L3B A;  2F5C A;  5IYD J;  2XOK A;  3MZ8 A;  5KK1 A;  4K2E A;  2HDC A;  2R6H A;  2R7W A;  1UHW A;  2DYR H;  2QUF A;  4DNT B;  2CU7 A;  5IP7 J;  5E79 C;  2XEX A;  2IGO A;  3R0J A;  4M6X A;  1E63 A;  3CO6 C;  1CQT A;  2J7K A;  3E6C C;  2XC7 A;  3S3O A;  1YRN B;  5C4J J;  3K4K A;  4Y9R A;  1D1A A;  1DDN A;  1GLN A;  1KZL A;  2KDZ A;  1QGY A;  4BJ5 C;  2KIU A;  2ZXW H;  5E3O A;  4RM0 A;  1BR1 A;  1XE1 A;  3H92 A;  2YR2 A;  1XD7 A;  4GCV A;  4XLP F;  2V6E A;  1YFH A;  4IRH A;  3I55 B;  1H8E A;  4W1U A;  1U2W A;  2Q2E A;  4IOA F;  1PDN C;  2E2I J;  1UFM A;  1PUF B;  4IQJ A;  3BTL A;  2EZH A;  4RD6 A;  1R4N B;  4HNV A;  3OS0 A;  3CC4 B;  4MHG A;  1ETV A;  2KIS A;  1FDR A;  3AL0 C;  1N78 A;  2MD5 A;  3ULQ B;  2YS9 A;  3WHC A;  3K4N A;  1AMO A;  1Y1V J;  2DTR A;  3FWE A;  3Q0V A;  4EMS A;  3RKY A;  3S14 J;  5IK2 A;  3JRE A;  4BXF A;  4JP0 A;  3T53 B;  1KTW A;  1LB2 A;  3BQJ A;  2ZL5 A;  3LSM A;  3BR1 A;  2ZC2 A;  4DGW B;  3FM5 A;  1E3P A;  2K9M A;  4HDV A;  1RZ4 A;  2PN6 A;  3GZN B;  2D9R A;  4LG0 B;  2GJK A;  4WXC A;  2KIQ A;  1XMA A;  2EFN A;  2QQB A;  2M0M A;  3SHF A;  5GV8 A;  3QFS A;  2EZL A;  1IA5 A;  2CS3 A;  1A36 A;  5F0F A;  2JK3 A;  2WB1 N;  3H5R A;  3JUR A;  5BS6 A;  2OTL I;  2Z1D A;  1VF7 A;  2DMU A;  4RM2 A;  4CZC A;  4ZYD A;  1YJN I;  2P5V A;  2F6C A;  2PJP A;  3GTK J;  4DNR B;  3K7A J;  3VYS B;  3WXM A;  3PIP F;  2VPL A;  3IWF A;  3S2W A;  4RGX A;  4O6J A;  1XSX A;  1JT6 A;  4YII A;  3OJX A;  3I59 A;  1E3Z A;  5FLX K;  1HC8 A;  2PEX A;  4EGZ A;  4KJZ A;  5HS9 A;  4KDP A;  1T6S A;  5J8F A;  1KU7 A;  3GTM J;  1GUU A;  1GV2 A;  2L7Z A;  2VBX A;  1QUE A;  2BHY A;  2Y9Y A;  3K2A A;  3P27 A;  2WY7 Q;  3RYP A;  2LC2 A;  4DQ2 A;  3GYH X;  4E7I A;  4MQV A;  2CQX A;  4NBQ A;  2XGE A;  4U88 A;  3L2W A;  3JR9 A;  4WXD A;  5FL7 A;  1CLW A;  3CRZ A;  4H0E A;  4ROX A;  5IYR A;  3S8P A;  4C3J J;  2IA2 A;  4JX5 A;  2MSY A;  4B8X A;  2HVQ A;  4A3E J;  1O8E A;  3CO7 C;  4W8R A;  1J75 A;  1R5H A;  2W4S A;  4DQK A;  1X19 A;  4XKV A;  3NWT A;  3WND A;  1GVJ A;  3BC9 A;  3IH4 A;  1JTX A;  3OZV A;  3FXJ A;  1ETO A;  3DEU A;  4V2G A;  3VR6 A;  1POG A;  1QCX A;  1RPW A;  1KK3 A;  2XPU A;  4RGU A;  2STT A;  2ZJR F;  4OIQ F;  3GFM A;  3VDX A;  3I64 A;  3ABL H;  4YAO A;  3F21 A;  3V8J A;  2C4T A;  1KC8 D;  3WOD F;  3VWB A;  3ECO A;  3GX4 X;  4XR6 A;  1CGP A;  3M9A A;  1W4M A;  2X1C A;  2KHM A;  1XG1 A;  3SDB A;  1OQY A;  4KMU X;  4EW9 A;  3HGG A;  2BBY A;  4GYI A;  3K9T A;  5M3F J;  5K7F A;  2ZZQ A;  4X0C A;  1DBO A;  4UXN A;  3SQN A;  4QPQ A;  1VQM B;  2DI3 A;  2A07 F;  1R00 A;  3J80 K;  4CSW A;  1B59 A;  2BEO A;  2VI6 A;  4FX4 A;  5BOX A;  1Y0R A;  1UAA A;  5ERI A;  3CCQ B;  3PO3 J;  2WBM A;  1W35 A;  4RLQ A;  1IF1 A;  5L3F A;  1JRG A;  3G05 A;  4OZY A;  1M1E B;  1S5L C;  3F6O A;  4BL0 B;  1OYW A;  2K86 A;  1TWH J;  2EFO A;  1QX4 A;  4OJ5 A;  3BR3 A;  3HJE A;  4OJP A;  1ZEL A;  2PI0 A;  4KNY A;  2COM A;  4QSH A;  3L2U A;  1FYK A;  1MBF A;  2G7U A;  3JSO A;  1V55 H;  1XSV A;  1IG7 A;  1EJ9 A;  4HF1 A;  4IHX A;  1QUF A;  3LA2 A;  2EIX A;  2BM6 A;  2F3L A;  3H35 A;  2R3S A;  2X0L A;  5ICG A;  1WOS A;  3E5Q A;  3O8G A;  2V31 A;  1YIJ B;  2WTE A;  1MH4 A;  4AF7 A;  2X1E A;  1CNF A;  3EQO A;  1S6L A;  1MMG A;  1X2N A;  3FXU A;  1JXS A;  3BJ6 A;  3JAM K;  3MAJ A;  2X51 A;  2W57 A;  3PSZ A;  3N90 A;  4U49 A;  2GPJ A;  1YTY A;  3JRC A;  4ZZL A;  3KCC A;  4BHC A;  3W2H A;  2V6C A;  2L01 A;  4BDY A;  1FZP B;  3VST A;  2YU3 A;  3P9C A;  2JA5 J;  1SM4 A;  2BM7 A;  3RZD J;  1IRX A;  1IDY A;  4TMZ A;  2HDN B;  3KP2 A;  3CCJ B;  2W25 A;  2G0Y A;  5L3C A;  4E7S A;  4PK4 A;  4N3N A;  3CLO A;  1Z91 A;  5HDN A;  1AU7 A;  2JSP A;  3H5N A;  2VFQ A;  2Z9O A;  2NRA C;  2K40 A;  2JN6 A;  2MW8 A;  1KD1 D;  3SJZ A;  2M4K A;  2IGM A;  3O8H A;  2ESH A;  2M2E A;  1N07 A;  2M7A A;  1IXS B;  3ABT A;  1QVG B;  2Y9Z A;  3CCV B;  4A12 A;  3SEJ A;  2ZSH B;  1ZLK A;  2VBU A;  4G94 A;  1O3R A;  2DK5 A;  3UKG A;  1EH8 A;  3S32 A;  2OAZ A;  4OOV A;  4L9T A;  2E5Z A;  1G6N A;  2HYJ A;  1XGS A;  3VMW A;  3CUO A;  1QG0 A;  3JTH A;  3WTT C;  4HNT A;  5LBQ A;  1OR7 C;  3HTS B;  1A6Q A;  2P6S A;  1ZGW A;  3C2G A;  3S2H J;  2H8R A;  4BE2 A;  2VON A;  1QA2 A;  1TTY A;  3PFI A;  3GTP J;  1BA5 A;  2ESN A;  4RLF A;  4ENJ A;  4V19 K;  4X05 A;  1JJ8 C;  1WJ5 A;  1JKO C;  2BGI A;  1OFL A;  1FBS A;  2UV1 A;  2VQH A;  2BYV E;  4HYE A;  2TDX A;  2XF7 A;  1ERD A;  2JVG A;  2E1M B;  4QWQ A;  4BXU A;  2FRH A;  2BW3 B;  4X7D A;  1W7P B;  4RD2 A;  3HUG B;  3HEF A;  1MH3 A;  1COW A;  4MEX F;  1I3Q J;  3ZP5 A;  4YZA A;  5LGT A;  2OCE A;  4M3D A;  2DW4 A;  2V26 A;  2EIJ H;  4YFO A;  3DLA A;  5FNZ A;  3CP2 A;  4QIW N;  1IN5 A;  2A5W A;  2A6E F;  1BJA A;  4IHS A;  3AK5 A;  3D0S A;  3WBJ A;  1F60 A;  1WI3 A;  4XRS G;  1FNN A;  4KIS A;  3GFI A;  1IRZ A;  3CCQ I;  3BPV A;  3KX2 A;  4P6Y A;  3OW2 B;  2WA0 A;  3FPK A;  2QVO A;  3HRU A;  1WU8 A;  3ZR8 X;  2D5V A;  3MVP A;  3BR6 A;  1QGA A;  3HTU A;  2ZME C;  1Q1V A;  3BR5 A;  2OA4 A;  2IAI A;  2W24 A;  3HHG A;  4ABZ A;  2OD5 A;  3HSF A;  2XZP A;  1TNT A;  3OP1 A;  1IXC A;  2IS4 A;  3M8F A;  1UG0 A;  4RD3 A;  4BH9 A;  2DCE A;  3C1D A;  1NTC A;  5LHG A;  5FRN A;  1GHC A;  3JRG A;  3DBL B;  3FKS A;  2AQE A;  5GAE J;  2EFG A;  3KEY A;  2F1M A;  3NAR A;  2WJY A;  1YS7 A;  2KFD A;  1D3Y A;  1EF4 A;  5KNL A;  2X53 S;  4B47 A;  2QSH X;  3WQZ A;  3CME B;  3I1F A;  3E0J B;  1K5C A;  2BM5 A;  3CUQ B;  4E7H A;  3ASN H;  4F91 B;  1JGG A;  2G9W A;  1VQL I;  1Z77 A;  2BVN A;  2HDD A;  4L9N A;  4XBF A;  4ZV4 A;  5IYW A;  1E43 A;  2AO9 A;  1JUP A;  2GA2 A;  2CF4 A;  3CCM B;  2ZJP F;  3N4M A;  3EYY A;  1T98 A;  1TP4 A;  2V9P A;  1V4R A;  4AVZ A;  4DK0 A;  1WH7 A;  4XSX F;  4M6Y A;  4I09 A;  1K8A D;  1JNY A;  3HYI A;  3F0C A;  1AHD P;  4M4S A;  4RCZ A;  2Y75 A;  2NV4 A;  2DFF A;  3GFJ A;  2ZBK A;  1YE9 A;  5FFX A;  3W6V A;  4YEI A;  4G7W A;  1U0J A;  4UY8 I;  3H3V K;  1UHM A;  3SDG A;  2MGQ A;  3HKZ N;  2BGC A;  3C3W A;  1LJ9 A;  2F1L A;  2UVF A;  1B8I B;  1QQ1 A;  5HLH A;  3VYR B;  4KIT B;  2F5E A;  2IP2 A;  4ANJ A;  2QEX I;  5ICF A;  3RZO J;  4UUS A;  5B5E C;  1HDP A;  1ZM2 A;  4II2 A;  1GR1 A;  2Z2S B;  1VTN C;  3U2Q A;  3WTX C;  5BSY A;  3FHN A;  1E64 A;  1D1B A;  1W5T A;  4FET A;  3J7A Y;  3EQN A;  4XRS A;  2EFW A;  4PGH A;  2CUZ A;  2JJ7 A;  4U7B A;  3JRH A;  3F22 A;  4HNU A;  3W2A A;  4HAM A;  2IBD A;  4B3G A;  2GAU A;  4EJO A;  4KN7 X;  2XB0 X;  5E1W A;  5CJ9 A;  1ON1 A;  3FIW A;  2HCJ B;  2EIK H;  2NNY A;  4AM3 A;  4HX4 A;  3HOZ J;  4BU2 A;  1KCD A;  4Q4Z F;  1YLF A;  3G1O A;  2FX0 A;  4E7J A;  2VBT A;  2W84 A;  1OIS A;  5JHU A;  4ZCM A;  1T8I A;  2VE8 A;  1K4S A;  2F4N A;  2D74 A;  5DNS A;  4HZF A;  4M71 A;  2P0W A;  3H9J A;  3TMO A;  5GTH C;  2LRD A;  2QKL B;  5DDG A;  2KLO A;  4TMV A;  1JHH A;  4EV0 A;  4BHB A;  2IJL A;  2M34 A;  2FSW A;  2DT6 A;  2P5K A;  1E62 A;  2KVO A;  1EFR A;  4A0Y A;  3MQ0 A;  5A8A A;  4OJL A;  1MND A;  1IRG A;  3L2C A;  1VQ9 I;  1T0F A;  1SD7 A;  5K7Z A;  1B1B A;  2M1B A;  4RDK A;  2DTZ A;  4WXH A;  2RQP A;  5DD4 A;  1Y0N A;  4AU7 A;  5IPA A;  1K79 A;  4ZZD A;  1BX0 A;  2GK6 A;  1GDT A;  1TWC J;  5HDK A;  1R5G A;  3PNT A;  3DLL F;  3PA1 A;  4ASU A;  4NC8 A;  5LGU A;  1FBQ A;  3CTA A;  1D1N A;  5H2F C;  2PEC A;  3GTL J;  1E3X A;  4DJA A;  3LSJ A;  3I3L A;  4QFM A;  3HSE A;  1FMW A;  1YIO A;  2QQA A;  2H1L A;  4X0G A;  3VO1 A;  3VNU A;  3V7A A;  3AVY A;  4L9V A;  5HLI A;  3OPO A;  4S0H B;  2CW7 A;  1OGM X;  1LVA A;  3BP8 A;  1TYV A;  3A01 B;  4GYG A;  2KQR A;  4L5J A;  4UAJ A;  1W0K A;  4N0B A;  4L0Z B;  3CMA B;  1G8X A;  5ED4 A;  3ASR A;  4MNU A;  2MA3 A;  1ZG1 A;  2STW A;  2J8I A;  1PUE E;  3V8K A;  2BGJ A;  1IJF A;  1W0J A;  4UV8 A;  4OPS A;  3R0A A;  1PYV A;  3M4O J;  1ULY A;  2P7V B;  4HIZ A;  3FDY A;  3R60 A;  3T51 B;  4XID A;  2CW8 A;  1AIP A;  3QOP A;  4Y17 A;  3KIO A;  2B0R A;  5F0H A;  4EAT A;  1ZAR A;  2R5Z A;  1HLV A;  1CNE A;  2D3N A;  1O57 A;  3J80 Z;  3OS2 A;  2QLZ A;  4Z4U A;  4RD4 A;  2L4A A;  1MD0 A;  2O8X A;  2V4D A;  4RMN A;  2O6G E;  2OZU A;  3RPQ A;  3ROU A;  1R5O A;  1K73 D;  2NTB A;  1L0O C;  1RC9 A;  1YW7 A;  2ID3 A;  2MC4 A;  1FMV A;  2V1X A;  4ZH4 F;  4WK8 F;  1QH0 A;  3FXO A;  3BH7 B;  1IW7 F;  2EV0 A;  1SFU A;  5CPR B;  3F6V A;  3CJT B;  4XRF A;  2DA1 A;  2KPM A;  4XM3 A;  4R79 A;  4WF2 A;  4RDU A;  3MCZ A;  1U5T B;  3ML3 A;  3B4N A;  3SYJ A;  1VQP I;  4BYY A;  1REP C;  3H09 A;  1TL8 A;  3ZMT A;  4RD0 A;  2EH3 A;  3ZMZ A;  1RES A;  3FMS A;  3CCS I;  1BR4 A;  2O9L A;  2VT2 A;  3KEQ A;  2MH9 A;  3TKY A;  4XLN F;  1EP1 B;  2KDO A;  1R23 A;  1FIP A;  1OB5 A;  5DCF A;  1VQ8 B;  3K0L A;  2DYS H;  3LL7 A;  2EIL H;  3GZ5 A;  3FXR A;  5KVR A;  2FVG A;  1U3E M;  4NBS A;  3G1L A;  3O6B B;  1TLH B;  1GVD A;  4GGG A;  2ZXJ A;  4UZF A;  1W7P A;  3F8N A;  3EET A;  4FX0 A;  1EE6 A;  5IYQ A;  3FX3 A;  4Y4R A;  3LSG A;  2QYU A;  1AKH A;  4QUZ A;  3I5U A;  3LQ6 A;  1SKQ A;  3ZMU A;  4DZP A;  2CFX A;  1HKS A;  3FPP A;  2ICW G;  4B44 A;  5ILV A;  3CC7 B;  3VNV A;  4IO9 F;  1OJL A;  3I56 B;  3A02 A;  1W5C C;  2QEX B;  1L3L A;  3A01 A;  3W2E A;  4PGO A;  2RAE A;  3DV8 A;  4MLO A;  3FK7 A;  2M9H A;  1QZY A;  3LSR A;  1HBX G;  5E18 F;  5IY5 H;  1Z3Y A;  4CYC B;  2HVR A;  2XPW A;  3LAP A;  1HOM A;  5DSZ A;  2F4O B;  2ZFU A;  1D1C A;  1N06 A;  1SEU A;  2NS7 A;  3LAJ A;  1EH7 A;  3Q3A A;  4Y7C A;  1JA1 A;  3HRM A;  2DY1 A;  3BWG A;  3IRR A;  2WY8 Q;  2BXZ A;  4BXX J;  2V7T A;  2VE9 A;  1VZ0 A;  3MFK A;  1Z1D A;  1TWA J;  2CGP A;  4HW0 A;  4YFK F;  3C18 A;  1EA3 A;  4L5I A;  3C2H A;  4LLG F;  5TRD A;  5L46 A;  3S3M A;  3SUC A;  1WP6 A;  5EZH A;  4A2U A;  2ZTG A;  2NSP A;  1IN6 A;  2IPQ X;  3R61 A;  4YRV A;  2C5H A;  5H5J A;  2CRV A;  5HXB A;  4P12 A;  3DP7 A;  4R8H A;  1UHS A;  1QHG A;  1PJ6 A;  3DKW A;  2DFH A;  3DTI A;  3U1D A;  1QU3 A;  3KP4 A;  3DBH B;  4Z4Y A;  4C3I J;  2IA0 A;  3OR1 C;  1WJC A;  2QBY B;  5E3N A;  4GDF A;  5EEG A;  3MD2 A;  1CZF A;  1Z21 A;  3VSU A;  4OJO A;  1FNC A;  2CUJ A;  3ELK A;  3M8E A;  4LD5 A;  1O8J A;  2XTW A;  2B7E A;  1OB0 A;  4LG3 A;  5M3M J;  3BOQ A;  3K4C A;  3SXY A;  1NHA A;  4D5C A;  1ACI A;  1VQN B;  3IP4 B;  1IAW A;  1X4O A;  2XAG A;  3HGY A;  3IAS 2;  2PJR B;  1V5E A;  2ME0 A;  3AFH A;  3WTV C;  2BX6 A;  4I84 A;  1N05 A;  1T08 B;  1XGN A;  2LBF A;  4ZDL A;  3TQN A;  2B7C A;  1MRZ A;  2VNJ A;  3IKT A;  4OIR F;  3GVJ A;  3F8M A;  5E8I A;  1WOP A;  5LD2 C;  1R71 A;  1ZQ3 P;  1TYX A;  3AGQ A;  3BY6 A;  2V7X A;  1Q1H A;  4Z4R A;  4YAU A;  5F1J A;  2Y31 A;  4E6K G;  3ZMD A;  2MC3 A;  2QXZ A;  1UJ8 A;  3OYK A;  4WWV A;  2EV5 A;  4C30 A;  1PVE A;  4DQL A;  2NTQ A;  3CP8 A;  1X1D A;  2HQA A;  3S15 J;  5HLG A;  1W7P D;  1SFE A;  2Q2E B;  3WTW C;  3J7A O;  1YHQ B;  2HZD A;  3LOC A;  1R58 A;  4F55 A;  2XC1 A;  4ZJZ A;  4HST A;  2LFB A;  2HVS A;  1WGX A;  1XDS A;  2HWV A;  1ZG3 A;  5ILU A;  1BC8 C;  1D8T A;  4XON A;  1XB2 A;  1O3S A;  2UVE A;  3OYJ A;  5CYV A;  2XRN A;  5FO5 A;  2PLF A;  3MCA A;  4A3F J;  2E2H J;  2VLA A;  3TDU C;  1PKV A;  4DBQ A;  3B8Y A;  3K4L A;  3KFW X;  1LE8 A;  1JHF A;  1TNS A;  1BPL A;  1T95 A;  4AUX A;  4A3K J;  2OBS A;  2O17 A;  1KGS A;  1HW1 A;  3G71 B;  4AIH A;  1I1S A;  4G7H F;  5DTD A;  1C0W A;  3U1K A;  3DBR B;  4WX9 A;  2FE3 A;  1GAW A;  4JX4 A;  4PMH A;  1UD8 A;  2ZZF A;  5GP9 A;  3ZOB A;  4CZZ A;  1FTT A;  3BT9 A;  1XMX A;  4OMZ A;  5EEA A;  4KIC A;  1OFE A;  1WI9 A;  4M9S A;  4XIC A;  2IW5 A;  3WE3 A;  1QQI A;  5HZB A;  4LIV A;  1ZRE A;  5CVU A;  3A3G A;  3VMV A;  3ML6 A;  3COA C;  4C9Y A;  3E7L A;  3L09 A;  5DUI A;  4KA4 A;  4BE1 A;  3A8K A;  4ZGQ B;  3DKX A;  3DCF A;  4L9J A;  4PSX A;  1I5Z A;  1VLO A;  1JJ6 C;  3ASQ A;  3CDH A;  2QSG X;  3GF2 A;  1QGZ A;  4BKX A;  1Z6T A;  3H0G J;  3K10 A;  3PA2 A;  1YG2 A;  4TKO B;  1UG2 A;  2I8D A;  1X1P A;  5HVQ C;  3DF8 A;  4BY7 J;  1U78 A;  1XDU A;  3RKW A;  3Q5F A;  1IN8 A;  1DP7 P;  4IRI A;  1K78 B;  1MGT A;  4ENM A;  3I4N J;  1LUJ B;  4RGR A;  1PXZ A;  3CDI A;  2DA6 A;  2F48 A;  3IRQ A;  1G7T A;  3JX8 A;  2LK2 A;  1H42 A;  5A89 A;  1BI2 A;  4A93 J;  4OJ6 A;  2RVC A;  4A3B J;  3WE2 A;  3CPW B;  2W85 A;  3S1R J;  5GAD J;  1R1U A;  2E34 A;  1Q9S A;  2JJ2 A;  3DEE A;  2ZXH A;  5GPC A;  3QOE A;  5LEJ A;  3I59 B;  4P6V F;  1IO2 A;  3BCA A;  2NAZ A;  2IRF G;  3DPU A;  2HOE A;  2M8E A;  3JRI A;  4LC0 A;  5IT9 K;  3HZJ A;  2FML A;  2XNC A;  5CVR A;  1X3U A;  3KEO A;  3K4B A;  4G8X A;  3REO A;  5FGM A;  4M3E A;  5IP9 J;  3W2W A;  1K78 A;  2FQ4 A;  3GQB A;  3H5A A;  5F4M A;  1YJN B;  1X3W B;  3GLL A;  3N97 A;  5IYB J;  1F20 A;  4BHP A;  1YLO A;  1QRB A;  2L7M P;  3R6J A;  4YAF A;  3B73 A;  3RSN A;  4HV6 A;  2QSF X;  3IAM 2;  5LEK A;  1O8K A;  4CYD A;  1B9M A;  4FE4 A;  1SD6 A;  5IP6 A;  1XCV A;  3FXM A;  1QO0 D;  1JB9 A;  2CG4 A;  2NS0 A;  1WCM J;  5BPI A;  4FK8 A;  2DT7 B;  2W48 A;  4A5N A;  1VF9 A;  3O3K A;  4D7M A;  4PUS A;  1I3A A;  3F23 A;  2Q6O A;  3LNN A;  3PQJ A;  2DK8 A;  1IV6 A;  2V9K A;  2GJR A;  1B9N A;  3L1P A;  3JRA A;  4C43 A;  3GQ9 A;  1TUI A;  4J0Q A;  5IYP A;  1E3H A;  1K9M D;  1EFT A;  1T0F C;  5DS9 A;  4K1X A;  4HG2 A;  3OOC A;  5AMV A;  3JQP A;  2FD5 A;  1MAB A;  3L2R A;  4Q7J B;  1JE8 A;  1VQ8 I;  1YJ9 I;  2V7Q A;  2UUZ A;  5D8L B;  3A8I A;  1FOW A;  1W9X A;  4LIU A;  4EM2 A;  3FIS A;  4QLC U;  2Z33 A;  3D5S C;  3LWF A;  3T8R A;  2OPT A;  1G7R A;  1PP8 F;  2X3H A;  4XQF A;  3EQL F;  1W0T A;  5F4O A;  2VBS A;  2LMD A;  3I53 A;  5EJC A;  2Q0O A;  1VFC A;  2X1D A;  1BL0 A;  3OIQ A;  4U9U A;  2CQK A;  5KHD A;  1OGO X;  1I27 A;  4XKB A;  3HOT A;  1LPQ A;  1H8H A;  3WY9 A;  5EGO B;  3RI4 A;  1IB0 A;  2Q6L A;  1AKH B;  5KW9 A;  1EV7 A;  2D3L A;  2XSJ C;  2L9V A;  2BOL A;  1ZM9 A;  3GME A;  3BCD A;  2M4G A;  3ZQL A;  1MSF C;  3GIR A;  1XMK A;  2PMZ N;  2VBY A;  2ACJ A;  3N05 A;  4L5E A;  1ODD A;  1IJW C;  2IS6 A;  1T6Y A;  4EM1 A;  2NOG A;  2EIM H;  2RV8 A;  4M53 A;  4G12 A;  4D7N A;  3ZZ0 A;  2VXZ A;  2EBI A;  4P1V A;  3KLO A;  1MIJ A;  3M07 A;  5AN9 A;  3CLQ A;  3HAG A;  4P9S A;  4XLE A;  2CRG A;  1RKT A;  4RJL A;  1XB4 A;  1MMA A;  3FK6 A;  3KP6 A;  4ITV A;  3U9G A;  2G7H A;  3T9G A;  4YDT A;  3BH4 A;  1G3Y A;  1FY7 A;  2M45 A;  3BG6 A;  4ZCL A;  3A2K A;  3DEW A;  4IQ4 A;  3OFN A;  4UB8 C;  4PC1 A;  3HOU J;  4FT8 A;  3QPL A;  3T1B A;  4HLX A;  2EFP A;  3PJR A;  2L0K A;  3Q6Q A;  3SZT A;  5K7H A;  2DMN A;  4NUB A;  5EMN A;  1A8P A;  2L02 A;  4CCL A;  2CV2 A;  2I1L A;  1LQ1 A;  1O7L A;  3I56 I;  2NVT J;  2FBH A;  4ACB A;  4XMY A;  2F2E A;  3ZN1 A;  3H94 A;  3B8H A;  2W7Z A;  1P9Q C;  3RTR A;  1Z05 A;  3WGI A;  2WWY A;  2PE3 A;  3VB2 A;  2HLD A;  3OYE A;  3G6E I;  4YCQ A;  2COB A;  1QVT A;  2BZT A;  1IDJ A;  3CC4 I;  1MBH A;  1O8I A;  2D1H A;  2R0Q C;  4PC6 A;  3G3Z A;  3KPH A;  3BR0 A;  5HS7 A;  2L5Q A;  2J5P A;  2V7V A;  2VNH A;  3KZI C;  3PNY A;  1DAR A;  1W2B B;  1GXP A;  4RDL A;  4X7C A;  1BIA A;  3ABU A;  3LYC A;  1WFX A;  3U21 A;  3PSF A;  4M2L A;  2GBY A;  2EPF A;  2XIG A;  1LVK A;  2L9R A;  4DYC A;  2O0Y A;  4OAZ A;  4UUT A;  4E7L A;  2CQQ A;  3GBG A;  3ZQQ A;  5J1R A;  4XOP A;  3HUG A;  2JVH A;  2K3P A;  2Z99 A;  5C4X J;  3FM3 A;  2JWT A;  3QPH A;  2BVM A;  1F36 A;  1QHH D;  4CCM A;  3E6D A;  4NQW A;  1YIJ I;  2LBF B;  2WAE A;  4IF4 A;  3CUQ A;  1FND A;  1Y8R B;  3SLD A;  3AVW A;  2V79 A;  3T8T A;  2Y0S A;  1WPK A;  3AVT A;  1IDZ A;  4OIN F;  1EP3 B;  3VOE A;  4IKF A;  5D5V B;  2NT9 A;  2GA1 A;  3KP3 A;  3I4P A;  4XN0 A;  1OKR A;  5EEH A;  3S1M J;  5EF6 A;  2DET A;  1ZYR F;  5KSW B;  1DBG A;  2KIM A;  2F4I A;  4N4O B;  2ME6 A;  3GZ6 A;  3OYL A;  5ILS A;  2EK5 A;  2OQG A;  3BZK A;  3L2V A;  4ZYH A;  4HQE A;  3QU3 A;  4OOX A;  3A1Y A;  3CD6 B;  5J1U A;  3KLN A;  4ZTF A;  2HXI A;  3QYF A;  1S8N A;  1JTY A;  4S05 A;  1HA3 A;  3VYU B;  3GRH A;  4TMX A;  4G6T B;  3KP5 A;  1EA0 A;  1TQP A;  5K5O A;  1B8I A;  1T6X A;  5FJ8 J;  2BV3 A;  2ZL6 A;  1BIB A;  2FOK A;  2XAH A;  4P3Y A;  3HOW J;  3QYB A;  5H59 A;  1K4Z A;  4UVC A;  3TGN A;  1HZE A;  4JK1 X;  2DN0 A;  4X1E A;  3IKV A;  1FRQ A;  3I9V 2;  2V7F A;  2P3M A;  3ZN0 A;  1P6R A;  4CHU A;  3A4C A;  3CCJ I;  3J81 Z;  5E17 F;  1V0E A;  3BY1 A;  1TSP A;  2JQ7 A;  5GPA A;  3TL4 X;  2X6W A;  1RQP A;  4EJW A;  1YW8 A;  4Y9U A;  4YZ0 A;  1BMF A;  2INV A;  1FNB A;  4X06 A;  1K6O A;  4Q5S F;  3E97 A;  5C1C A;  1RR8 C;  2LH9 A;  3K70 C;  3QFC A;  4WZE A;  4YZQ A;  5B1A H;  2YSR A;  4XLH A;  4Z4V A;  1OYI A;  4KKU A;  3BLY A;  1TQM A;  1UCR A;  3LFU A;  1I50 J;  1GJR A;  1OYY A;  1T56 A;  2QN6 A;  5TIS C;  3HRS A;  3ZC3 A;  3G4S I;  2C2W A;  1NHC A;  1QVF B;  4XLC A;  2ZME A;  4D0P A;  4WCG A;  2LF8 A;  1RI7 A;  2X8K A;  3A8J A;  4A3J J;  4NQW B;  2M7B A;  4PAB A;  1DP3 A;  3GEZ A;  3DU5 A;  2BPO A;  4A69 C;  4E7K A;  3OKX A;  2P6T A;  2DOG A;  2IGN A;  2DCU A;  2DER A;  3TO6 A;  3OZW A;  4CQJ A;  4P25 A;  5H6R A;  2QCO A;  2WV0 A;  4HE6 A;  2HTJ A;  2XAQ A;  3PNV A;  3CCR I;  3RYR A;  3CC2 B;  2OJE D;  3DQV C;  1Y8Q B;  2ELK A;  4RLZ A;  2VIX A;  2DXI A;  2DLL A;  2HZT A;  3WU1 B;  1HCR A;  3GQA A;  1BJZ A;  4B43 A;  2XKO A;  4EM0 B;  2DYI A;  1D5V A;  3I58 A;  4BAC A;  3H1C A;  4U7D A;  4UVA A;  4MYU A;  1JA0 A;  5FFZ A;  1FOY A;  4XL9 A;  4X07 A;  1SAU A;  4PC7 A;  1GAQ A;  4UNO A;  4Z2Y A;  4W8T A;  1EFC A;  3A0H C;  4CDG A;  2V1D A;  4WQM A;  4Y15 A;  1Y6I A;  4O3M A;  4II3 A;  2RGV A;  4BPR A;  1H8A C;  2X0K A;  4S04 A;  1W87 A;  1TTT A;  2LR8 A;  1KK2 A;  4AYB A;  5IOY A;  5F04 A;  3WWG A;  4EQQ A;  1X1C A;  1YW9 A;  3HXL A;  2BY2 A;  1S7A A;  3W2F A;  3ZMV A;  3ONY A;  2X6X A;  3ZQ7 A;  2KRC A;  3BG3 A;  3DTK A;  1JGS A;  1FOX A;  3MEX A;  1MSE C;  5GAH J;  1BI3 A;  2OU2 A;  4XOR A;  1E0E A;  3F3X A;  3TW7 A;  5CQE A;  4YIF A;  1D0X A;  2O0V A;  1O8H A;  1XGO A;  2EZI A;  2DQR A;  5DS0 A;  3BG5 A;  2ZB9 A;  2VJJ A;  3SQV A;  1TYU A;  2X85 A;  4ZTJ A;  1Z67 A;  1BI1 A;  2GIV A;  2O8K A;  1TW3 A;  3ABK H;  1S4M A;  3OIP A;  1FWZ A;  2E1O A;  2JZY A;  3EPZ A;  4UHT A;  4A0Z A;  2PMD A;  4EH1 A;  3AST A;  3QPS A;  1MJA A;  3C7J A;  4BQA A;  1Q81 D;  6PAX A;  3WBK A;  5FB2 A;  5LRR A;  2GOX B;  1QPI A;  2JA2 A;  2DOE A;  4QHY A;  1E1Q A;  2XNJ A;  1N77 A;  2GLO A;  2JPB A;  1JKP C;  1FP1 D;  5EYR A;  3KZZ A;  4D1Q A;  1VHO A;  2QZA A;  2QA4 I;  2RKH A;  2VXD A;  3ERE D;  4I99 C;  1Z6R A;  4CO8 A;  2K9L A;  4QVJ A;  4E70 A;  3V7S A;  2K4J A;  4C3H J;  2GK7 A;  2VKD A;  1LDD A;  3F8C A;  3F72 A;  4IPA A;  4W8S A;  2GZW A;  2HOT A;  1P4A A;  2DPU A;  4Y52 J;  3M8J A;  4KIG A;  4BQQ A;  2HNH A;  2DU9 A;  4AD9 A;  2QE7 A;  4CIC A;  2BW3 A;  5FRO A;  1NBM A;  4LBY A;  4I6Z A;  5D4R A;  2NVU B;  4IVN A;  3TO7 A;  2QF7 A;  1YX3 A;  3ZQI A;  1QA6 A;  2YUH A;  3L2Q A;  3T5X A;  4XLA A;  1DG1 G;  1X58 A;  3ESW B;  1NK3 P;  4OP7 A;  4PFP A;  4A3M J;  4GFB A;  3LMM A;  1B2R A;  3DFG A;  5FKO A;  1TT0 A;  1W5S A;  1GQ8 A;  2Y2Z A;  1WMR A;  4FN5 A;  1UB9 A;  4U0Y A;  1IHM A;  1F5T A;  1IGN A;  1VQ5 B;  3JSP A;  4IW3 B;  3QFR A;  2VC0 A;  1NB9 A;  2EWN A;  2ETH A;  4N4N B;  5FKM A;  2H6B A;  5E3L A;  1F43 A;  2ZNZ A;  1QJV A;  3J81 K;  3DDY A;  1MBE A;  2ZXI A;  2A5Y B;  4IXA A;  3AG2 H;  1YO5 C;  3BCF A;  3L7W A;  2OBR A;  3RY8 A;  2VBW A;  4E7Z A;  4OPV A;  2R7Z J;  3CCL I;  3V7R A;  1A35 A;  1VQP B;  2HQN A;  3DPT A;  2C4U A;  4Z06 A;  1OGI A;  1VQL B;  3FJO A;  3CCS B;  1B23 P;  1XS9 A;  3RDI A;  3K69 A;  3CMA I;  1KQ9 A;  1TQI A;  3OV8 A;  1R9T J;  4G6I A;  3BTJ A;  3BR2 A;  4RB2 C;  2FBI A;  4BDZ A;  4X8I A;  4C0S A;  1D0Y A;  2LKX A;  4F93 B;  3Q6R A;  3ONU A;  3BY2 A;  5K1Y A;  2WPD A;  1SFK A;  5EG0 A;  1KA8 A;  1EKE A;  3EUK L;  2JUG A;  2L2O A;  4XN3 A;  1Y0Y A;  3OL3 A;  1IXR C;  4PFO A;  1BM9 A;  4LLL A;  1QNT A;  1WZ2 A;  1FSE A;  4YEL A;  4GQN A;  3D1N I;  5FO0 A;  1RU4 A;  1E79 A;  3HHH A;  3WG9 A;  3E5U A;  2DOA A;  4JOM A;  4MO7 A;  3PFY A;  2CW0 F;  3Q0U A;  2R5Y A;  1PJ7 A;  4BQO A;  1D2E A;  1U2R A;  2XF5 A;  4UUS B;  4PAA A;  4OIP F;  3BC8 A;  3DXJ F;  2AXL A;  2YU9 J;  3M7G A;  2OTJ I;  3V76 A;  1MBK A;  3A1P A;  2QDX A;  1E2X A;  4A3I J;  1LLW A;  3JCU C;  1HA8 A;  2Y48 A;  1BN8 A;  2JRT A;  2E1C A;  2WSS A;  1FT9 A;  3GFL A;  4P9U A;  1DDI A;  1LDK B;  4P9F A;  2FA5 A;  3PVD A;  2XVC A;  4MFD A;  3B6A A;  4XOT A;  1UEL B;  3B02 A;  1MNE A;  3F8F A;  4KUM A;  2AHQ A;  3H0D A;  1WSV A;  4OPO A;  4AIJ A;  2RNJ A;  1ZGJ A;  2OUM A;  4L8J A;  2MFZ A;  3S93 A;  4Y13 A;  1VJS A;  4KH3 A;  3ZBT A;  2BY3 A;  2NNN A;  1ZM3 A;  4ACA A;  1Z7U A;  4WWC A;  2LLK A;  2DA3 A;  3FXK A;  3FF5 A;  4P3I A;  2ZNY A;  2ZFW A;  3EUH A;  4F7Z A;  2HPI A;  1H9T A;  2HU9 A;  1D8K A;  4OZZ A;  2EB7 A;  1HQC A;  2X6Y A;  5K5Q A;  1JTA A;  2VFP A;  2VOP A;  3B82 A;  2WAQ N;  2BHZ A;  4D9J A;  3MKZ A;  2NS8 A;  4BJT A;  3Q38 A;  3E6B A;  2P5L C;  1GO2 A;  3WTZ A;  3GLX A;  4RGS A;  3J81 k;  1FJL A;  2HR3 A;  1G3W A;  2UXN A;  1SC7 A;  4KMF A;  1R6R A;  4B4C A;  5LRS A;  4I0A A;  4UUV A;  3QYE A;  2NVQ J;  2JA6 J;  1KU2 A;  4PGG A;  1H89 C;  2ZTN A;  1BQE A;  3OYD A;  3WU0 A;  2HYG D;  2R5Z B;  3K1M A;  4DW6 A;  2XSD C;  2H94 A;  4JQF A;  1G4D A;  4KFC A;  4G7O F;  4TT3 A;  5JMC B;  3OL4 A;  1SAX A;  4AC9 A;  2EV6 A;  4ZDO A;  1X2M A;  5KCM A;  4B3A A;  2ZZG A;  2A69 F;  4GO1 A;  3FZV A;  4RAF A;  2UXX A;  1R1T A;  5GTI C;  2LD5 A;  1U6G A;  5C3E J;  2VBV A;  3LA7 A;  3QRF F;  2VYQ A;  4U4B A;  2VPR A;  1TC3 C;  4EJU A;  2XZL A;  1R1V A;  5J4V A;  2XGD A;  2Q8K A;  1YIT B;  3TOB A;  2DA4 A;  2IT0 A;  3PO2 J;  3IH2 A;  1APL C;  2RC5 A;  4QV2 A;  2QY1 A;  1DDG A;  2AQF A;  2VJ5 A;  1FLI A;  3GSI A;  1V5G A;  5J35 A;  4MXN A;  3SZP A;  1H88 C;  4HX7 A;  2MLG A;  3SZG A;  3KZY A;  1BX1 A;  1XQB A;  2HMA A;  5F4J A;  2CUF A;  2QTL A;  2HKX A;  1WQ2 A;  2L54 A;  3HG9 A;  3MMY B;  2Q6K A;  3CCM I;  4ZYG A;  4U0V A;  3KYC B;  4IHT A;  4YFX F;  3DPL C;  4YG2 F;  4OMY A;  4WZT A;  4I2O A;  4DBR A;  3ZMS A;  1FSH A;  2K02 A;  3KYD B;  1R36 A;  2MG4 A;  2WC2 A;  2LF7 A;  5JLX A;  4DZJ A;  5LLQ A;  1RIO H;  1ZAO A;  1HG8 A;  2HQ5 A;  3MHP A;  4PDK A;  1VLY A;  1VQO B;  1WHU A;  2OQR A;  4MEY F;  5J1Y A;  4UZU A;  1K8F A;  2XUB A;  3AAF A;  3MKY B;  4M6V A;  4HDU A;  1X3Z B;  2JDI A;  1G7S A;  1WSU A;  4LK1 F;  3DTE A;  2XDV A;  2JT1 A;  1OGJ A;  4P5O A;  1D8J A;  2HDW A;  2XZO A;  1Y1W J;  2HTS A;  4ENN A;  2YX7 A;  1SFO J;  3BTC A;  1KON A;  2YX4 A;  1KQ8 A;  3EUH C;  2DOF A;  3P7N A;  4XLF A;  2DEU A;  1Z7L A;  2IGK A;  1I1G A;  3OE7 A;  4RB3 C;  4PZJ A;  1ZRC A;  1GV5 A;  1DAB A;  4M9X A;  3KEW A;  2OYN A;  4JMQ A;  5TGT A;  1N75 A;  2GXB A;  4LB6 B;  4Z03 A;  3AGP A;  1I8D A;  2BSP A;  1HST A;  2FBK A;  2QYO A;  4M73 A;  1O8L A;  2LRE A;  2GIZ A;  4N9H A;  1OLT A;  3CD6 I;  2HQR A;  3FMQ A;  2OK7 A;  3GUD A;  2E35 A;  4HA8 A;  4AIK A;  3OSG A;  2W6J A;  3NE5 B;  1YRN A;  4AF6 A;  1PJR A;  3CCU B;  3OYI A;  2DT5 A;  5J3L A;  2Z5U A;  1UD4 A;  2OBT A;  1X1A A;  3CJQ B;  5E1X A;  1F1Z A;  5J40 A;  3WG7 H;  3SEQ A;  3BRO A;  3VFZ A;  5JR3 A;  3JTG A;  3SYT A;  5M5W J;  3QP5 A;  5KAI C;  1AWC A;  2HEO A;  1UD2 A;  1OFC X;  3OYB A;  2VKE A;  4XSZ F;  1UMK A;  2DFI A;  1J9Z A;  1PLU A;  2IS1 A;  3LSH A;  4ZC3 A;  1K7A A;  2QBY A;  4C2T A;  2LVS A;  3W2G A;  2J5O A;  4Q48 A;  4B1R A;  1IDK A;  1HDD C;  4A3L J;  1HKQ A;  3D5R C;  2QGU A;  5AIP A;  3V8L A;  3LNQ A;  3LVB A;  3PEN A;  3G2B A;  4OIO F;  1N08 A;  2BY0 A;  2XGC A;  2A6H F;  4B09 A;  1ZR4 A;  4L0Y B;  1ETK A;  3KET A;  3TH0 A;  4ASN A;  2YWG A;  4BS9 A;  3HKZ A;  2AHO A;  2E5N A;  2Z8G A;  3JRB A;  1V5F A;  4F92 B;  1H0M A;  1NG7 A;  2VQL A;  1NJI D;  4G1B A;  2R7R A;  2B63 J;  1D5Y A;  2E7X A;  3EUA A;  1IV8 A;  4EJT A;  5HOO A;  3HIF A;  2XAJ A;  2E36 A;  2INU A;  4UVB A;  1SVM A;  2GRE A;  3WU2 C;  3S17 J;  2QMU A;  2HI3 A;  4ZCI A;  2PYH A;  4RB0 A;  2F5D A;  4IOC F;  2GXA A;  1R7J A;  4NDL A;  2CSO A;  2FEZ A;  3DU6 A;  3C2B A;  2R93 J;  5KAF C;  1J0R A;  2YWH A;  2IXS A;  5CVJ A;  1GT0 C;  4BEH A;  3PSI A;  1WJA A;  3GWZ A;  4A6E A;  1ETX A;  1XPX A;  2P7C B;  2VJI A;  2FMY A;  2WAQ A;  5CVI A;  4Z4Z A;  2ELH A;  3RCO A;  1HKT A;  1ZH5 A;  2Y0S N;  5IYN A;  1AOY A;  3IWZ A;  4A3D J;  2X48 A;  2DDA A;  4FIS A;  4XNF A;  2VZL A;  4EGY A;  4OOS A;  5J4Y A;  2ZZE A;  4YEJ A;  1XCB A;  2NTP A;  1WKM A;  1ENH A;  2L7F P;  4V2F A;  5F08 A;  1UST A;  3OEH A;  1QBJ A;  3ZQC A;  5E20 A;  1ITY A;  3BNW A;  2KRF A;  3VO2 A;  1A31 A;  2RRE A;  3E5X A;  4GXO A;  4FQG A;  2ZME B;  2D2W A;  4LMY A;  2GXG A;  2QM3 A;  3JQR A;  1O7F A;  2HOA A;  2O3F A;  1YJW I;  1XX5 A;  3UW0 A;  1YYV A;  1K6Y A;  5HOD A;  4PCQ A;  2D45 A;  4XKW A;  1O88 A;  4LG0 A;  4CH7 A;  1KQS B;  4LOC A;  2VBM A;  4H4K C;  1MJB A;  1QVU A;  3CUQ C;  5K5R A;  1FNM A;  3RJP A;  3VPR A;  4D5F A;  4BY1 J;  1DGW Y;  2G0E A;  1XSD A;  1DU0 A;  1YQA A;  1FX0 A;  2VFO A;  4CCJ A;  2R7X A;  3U6K A;  1KU3 A;  3K1N A;  3SEZ A;  4JRA C;  1ZHF A;  3CJR B;  4JBA A;  1U9N A;  1MDM A;  1VQ4 B;  3G73 A;  2NVX J;  2H09 A;  2D1V A;  3B78 A;  3TBI A;  5GV7 A;  1KK1 A;  2R7O A;  3GQ7 A;  3R4K A;  3LQR A;  5FKN A;  1TWG J;  3VOD A;  5JVT A;  1LKX A;  1BHE A;  3P9K A;  3WNC A;  1OCO H;  2W00 A;  4KT6 A;  4FWT A;  4M3B A;  5LGN A;  2HOS A;  1Q82 D;  1JJ2 B;  1LM1 A;  1KTV A;  4FE7 A;  1KZH A;  1U8R A;  1N0V C;  1EZG A;  3NB2 A;  3CW2 A;  2KL4 A;  2VBE A;  1KYZ A;  3H9N A;  2IQ7 A;  2NPF A;  5E6T A;  1S9H A;  3H9Q A;  3CDL A;  3HOX J;  2QZ8 A;  2CV1 A;  3S2D J;  3W5U A;  1KU9 A;  1RR7 A;  1P4W A;  2WV1 A;  1VQM I;  2E1N A;  4BBR J;  4G7X A;  4PJM A;  3IC7 A;  2XV4 S;  3P9I A;  1FIA A;  2UWM A;  2RC6 A;  2QWW A;  1S0U A;  2DJN A;  2FOW A;  3SLN A;  3AG1 H;  3TDZ C;  2XGX A;  4P96 A;  1IJE A;  2ZBV A;  2VL8 A;  3F8B A;  5JFR A;  4Z4S A;  5LHH A;  4YFN F;  5D4S A;  3CXC B;  1Q7Y D;  2E71 A;  5B1B H;  3JAM Z;  3KL9 A;  3OWT A;  3CCV I;  2NT6 A;  3PUF A;  5CKT A;  2M87 A;  1ZRD A;  5FKK A;  1GXQ A;  4PC2 A;  4HBL A;  2KKO A;  3EDP A;  2QTZ A;  3L00 A;  1B72 B;  1QFJ A;  3O2P E;  4PJN A;  2FF4 A;  4LGW A;  2A61 A;  4M1K A;  2L9N A;  1XGM A;  3IUO A;  3PUM A;  1DUX C;  4RA2 A;  3IH3 A;  3KP7 A;  3TP0 A;  2V1U A;  4G9Y A;  5E1Z B;  3G71 I;  4QVA A;  2DIE A;  4CUG A;  5A88 A;  2PFB A;  3SY2 A;  2WAF A;  3FXQ A;  5A2Q Z;  1T2K A;  3U2R A;  3S1N J;  2NXN B;  3QQA A;  1RRJ A;  2V9V A;  2BM4 A;  2RDP A;  1V0F A;  4YXW A;  1WOR A;  2K9Q A;  1FC3 A;  1RET A;  1OPC A;  4ZDP A;  2E19 A;  1J2X A;  2V7U A;  2GOM A;  1SD4 A;  1W1W E;  3GVA A;  1E3O C;  3CQZ J;  1YI2 I;  2R9V A;  3DKY A;  2N8G A;  2GM4 A;  4A5M A;  1D0Z A;  1O8D A;  2E60 A;  1XG2 A;  5DM6 F;  2H1K A;  4GRI A;  3GCM A;  2EWE A;  2O0W A;  1K28 D;  4JX6 A;  1MKM A;  5D5X B;  4URR A;  2A3S A;  2XPV A;  1TT5 B;  4HRI A;  1O3T A;  2E1M C;  1A5J A;  2R7Q A;  2FJ1 A;  4G7Z F;  3S3N A;  2TCT A;  2LY2 A;  2CJJ A;  2CQ7 A;  3QU6 A;  1LEB A;  4X6A J;  2ECB A;  3ASO H;  5E8G A;  4IL6 C;  2E7W A;  4NNJ A;  3W3C A;  1MJ9 A;  4UV9 A;  5J6X A;  2VN2 A;  4E0F A;  3ZSC A;  1J9I A;  3BG9 A;  2KT0 A;  3E6M A;  1LFB A;  2IEK A;  1BOB A;  2OF7 A;  4A3C J;  1KRH A;  3OSF A;  5D8K B;  5DCM A;  3CCE I;  2LZJ A;  2DFE A;  2O61 A;  2WZN A;  4IJA A;  1QRC A;  3NWS A;  3CF2 A;  1X1B A;  4RM3 A;  2HYF A;  4QTR A;  4M0L A;  1ZN2 A;  3MWM A;  3RKX A;  1Z3X A;  1K83 J;  1FYL A;  4L18 B;  2DPD A;  4B3F X;  2M30 A;  1T5E A;  3CCY A;  1QZE A;  4NK6 A;  1FEX A;  2VNK A;  1R5B A;  4XK4 A;  4NHJ A;  2XT4 A;  3WTS C;  1E17 A;  4PJL A;  1UZC A;  3H3Z A;  4FHT A;  2V1N A;  4BE0 A;  5JI6 A;  4NCN A;  5D6E A;  3ERM A;  3GTJ J;  4IHV A;  2JA7 J;  3ECH A;  2CV0 A;  5LMZ A;  3SFZ A;  2ODL A;  1P7I A;  3IV5 A;  3WHB A;  5JBQ A;  1Y0U A;  1BOA A;  3ABM H;  2B5O A; 
#chains in the Genus database with same CATH homology
 2NOJ B;  1E1Q A;  1N77 A;  1Z3Y A;  3H9G A;  2HVR A;  4B3X A;  2R7U A;  2LYC A;  1LFP A;  2ZFU A;  1D1C A;  1AIR A;  4D1Q A;  3OYF A;  2VXD A;  3FBI B;  2ELJ A;  2K9L A;  2XOK A;  4CA0 A;  2R7W A;  2GK7 A;  2VKD A;  2WY8 Q;  4W8S A;  4DNT B;  1VZ0 A;  3OMY A;  3M8J A;  4BQQ A;  2HNH A;  1YX5 A;  3K6G A;  1EA3 A;  2IGO A;  2QE7 A;  2BW3 A;  5FRO A;  3C2H A;  2WJV A;  1WJB A;  3S3M A;  1NBM A;  3SUC A;  3HC7 A;  1WP6 A;  4BGD A;  3OS1 A;  2XC7 A;  3S3O A;  3K4K A;  2ZTG A;  1D1A A;  1RWR A;  2NSP A;  4YRV A;  1YX3 A;  1GLN A;  1KZL A;  2KRH A;  4BJ5 C;  3L2Q A;  1QHG A;  4XLA A;  2V4J C;  3DTI A;  1QU3 A;  1BR1 A;  4C2U A;  3OR1 C;  1WJC A;  4PFP A;  2V6E A;  1SKY B;  3MD2 A;  3LMM A;  1CZF A;  2CMP A;  1H8E A;  2OV7 A;  1Z21 A;  4CCK A;  1TT0 A;  4DIQ A;  1GQ8 A;  1WMR A;  4OJO A;  2CUJ A;  3VSU A;  4IQJ A;  2W6I A;  3VSL A;  1O8J A;  2XF6 A;  2VB6 A;  3OS0 A;  1OB0 A;  4LG3 A;  3K4C A;  2CFO A;  3OYA A;  3V42 A;  4N4N B;  3IP4 B;  4NK8 A;  3OYM A;  1X4O A;  3AL0 C;  1N78 A;  3BG7 A;  1QJV A;  3K4N A;  3DDY A;  3IAS 2;  3ZPP A;  2PJR B;  1V5E A;  3AFH A;  2ZXI A;  4I84 A;  2Z16 A;  5IK2 A;  4ZDL A;  2LBF A;  3BCF A;  4Y33 A;  3GVJ A;  4IX7 A;  3OW7 A;  2WZP P;  4BXF A;  3T53 B;  1KTW A;  1OFM A;  4C2L A;  3LSM A;  4E7Z A;  4DGW B;  5LD2 C;  2VQG A;  2K9M A;  4DK1 A;  1G59 A;  3DPT A;  1O8M A;  2Q1Z B;  2W82 A;  4Z06 A;  2GJK A;  3T56 B;  4E6K G;  2M0M A;  2QXZ A;  3OYK A;  4C30 A;  2NTQ A;  1IA5 A;  2CS3 A;  3CP8 A;  4XKC A;  1X1D A;  3H5R A;  2HQA A;  4CCN A;  4G6I A;  3JUR A;  2Z1D A;  1VF7 A;  4MR0 A;  4BDZ A;  4CZC A;  2Q2E B;  4RM2 A;  4DNR B;  2F6C A;  1D0Y A;  3VYS B;  2HZD A;  4F55 A;  4F93 B;  3ZCO A;  2VPL A;  4ZJZ A;  2WPD A;  4HST A;  2HVS A;  3RQ4 A;  1SFK A;  5HLT A;  1E3Z A;  2IS2 A;  3EUK L;  4XON A;  2UVE A;  2JUG A;  3OYJ A;  2L2O A;  2O04 A;  4XN3 A;  4KJZ A;  3OL3 A;  4PSW A;  2VLA A;  4PFO A;  1PKV A;  4DBQ A;  4YEL A;  4GQN A;  1RU4 A;  3B8Y A;  5CQG A;  2WY7 Q;  3K4L A;  1E79 A;  1KMH A;  2LC2 A;  4E7I A;  1BPL A;  3FY3 A;  1T95 A;  2DOA A;  4JOM A;  1WPC A;  3PFY A;  3L2W A;  4BQO A;  5FL7 A;  2O17 A;  2XF5 A;  3GVL A;  3BC8 A;  2MYS A;  3S8P A;  2PMZ A;  1UD3 A;  2HVQ A;  1O8E A;  4PMH A;  1UD8 A;  2ZZF A;  4W8R A;  2W4S A;  1X19 A;  4XKV A;  3NWT A;  2W7N A;  1MMN A;  1HA8 A;  2QKM B;  1BN8 A;  2WSS A;  1LDK B;  3BC9 A;  3LSI A;  3MKW B;  2XGJ A;  4XOT A;  1UEL B;  1OHH A;  1MNE A;  3H0D A;  3VR6 A;  4LIV A;  1QCX A;  2OUM A;  3A3G A;  3VMV A;  4Z05 A;  4L8J A;  2MFZ A;  3S93 A;  3VDX A;  4C9Y A;  4BE1 A;  1VJS A;  3DKX A;  1MMD A;  4PSX A;  4Y3O A;  2O1D A;  3VWB A;  1WJD A;  2F5V A;  4B48 A;  3ONQ A;  4XR6 A;  1W36 C;  4F52 A;  2HPI A;  2X1C A;  2HU9 A;  2KHM A;  3K10 A;  4QPO A;  4OZZ A;  3SDB A;  4TKO B;  2X6Y A;  4HWV A;  1JTA A;  4EW9 A;  2I8D A;  4D9J A;  1IB4 A;  3AKZ A;  3MKZ A;  5HVQ C;  2ZZQ A;  1DBO A;  4BJT A;  4QPQ A;  3D5L A;  1PXZ A;  4CCO A;  4CSW A;  4OJ6 A;  2VJ4 A;  1UAA A;  3DWL E;  1R6R A;  4OWR B;  2WBM A;  3FKJ A;  3QYE A;  4RLQ A;  2ZTN A;  3KYL A;  3G05 A;  1JRG A;  4OZY A;  3OYD A;  2WAD A;  4BL0 B;  3JU4 A;  4OJ5 A;  4TT3 A;  3CMM A;  3DEE A;  4JQF A;  1ZEL A;  2JJ2 A;  4OJP A;  2ZXH A;  3OL4 A;  3QOE A;  4ZDO A;  3ZGK A;  5KCM A;  2ZZG A;  3L2U A;  2K5C A;  3UNG C;  3H35 A;  4U4B A;  2XZL A;  3BCA A;  1H80 A;  4FAS D;  3DPU A;  2V31 A;  3EQO A;  4HSR A;  2X1E A;  3VYT B;  1MMG A;  2QY1 A;  2AQF A;  2X51 A;  2VJ5 A;  4U49 A;  1V5G A;  3K4B A;  4MXN A;  3K70 D;  4DOZ A;  3W2W A;  1UD5 A;  3GQB A;  3H5A A;  3SZG A;  4BDY A;  3VST A;  1IRX A;  3OYC A;  3HL2 A;  3QOD A;  3HG9 A;  4BQN A;  3MMY B;  3RSN A;  2HPM A;  4E7S A;  3IAM 2;  4PK4 A;  1O8K A;  3DPL C;  2JSP A;  3H5N A;  4DBR A;  1HG8 A;  2M4K A;  1O8G A;  2IGM A;  2DT7 B;  1VLY A;  2M7A A;  3RPU D;  2VAS A;  4PUS A;  4UZU A;  3LNN A;  3MKY B;  1HVX A;  2LOO A;  2JDI A;  2V9K A;  2ZSH B;  2GJR A;  1JI8 A;  3S32 A;  3GQ9 A;  3DTE A;  2XDV A;  4U87 A;  3VMW A;  2E5Z A;  4P5O A;  2HDW A;  2XZO A;  3OYN A;  2KP6 A;  4HNT A;  1T0F C;  1OR7 C;  2JIZ A;  2E1B A;  4HG2 A;  3OOC A;  3C2G A;  5AMV A;  1KON A;  4BE2 A;  3EUH C;  4XLF A;  1MAB A;  3L2R A;  4J01 A;  1Z7L A;  2IGK A;  2XAU A;  4ZYA A;  3OE7 A;  4IZZ A;  2V7Q A;  4RLF A;  1WJ5 A;  2UUZ A;  2VQC A;  3ZPN A;  1OFL A;  3KEW A;  4JMQ A;  2UV1 A;  1N75 A;  5TGT A;  4Z03 A;  1W9X A;  2VQH A;  4LIU A;  3CZ6 A;  3D5S C;  2XF7 A;  1ERD A;  1I8D A;  2JVG A;  2E1M B;  2BSP A;  2KZV A;  1O8L A;  2X3H A;  3E1S A;  2LRE A;  1AA7 A;  2BW3 B;  4XQF A;  4P22 A;  1OLT A;  3HUG B;  1COW A;  4YZA A;  3NE5 B;  2X1D A;  3OIQ A;  2RQQ A;  2W6J A;  4OAY A;  1DQU A;  2NST A;  5KHD A;  1OGO X;  1PJR A;  4XKB A;  3HOT A;  1H8H A;  2V26 A;  3OYI A;  4FXU A;  3PUB A;  1BR2 A;  1UD4 A;  3DLA A;  1X1A A;  3CJQ B;  4F3Q A;  2XND A;  3CP2 A;  3SEQ A;  3ZXS A;  2A5W A;  5FRN A;  1UD2 A;  3SYT A;  2XSJ C;  2D3L A;  5CDF A;  2BOL A;  2R7V A;  3BCD A;  3OYB A;  2M4G A;  3OEE A;  5C1E A;  1PLU A;  5FRM A;  2IS1 A;  3LSH A;  3N05 A;  4KIS A;  3LSK A;  4ZC3 A;  2CK3 A;  4C2T A;  2IS6 A;  3KX2 A;  2WA0 A;  1IDK A;  3D5R C;  3ZR8 X;  2VXZ A;  3G2B A;  2JJ1 A;  1KCC A;  2XZP A;  3HAG A;  4XLE A;  1J09 A;  3HKZ A;  2E5N A;  4BS9 A;  2IS4 A;  2Z8G A;  1MMA A;  4ITV A;  1UG0 A;  1V5F A;  2DCE A;  4F92 B;  3T9G A;  1NG7 A;  2VQL A;  3BH4 A;  2QX3 A;  4YZX A;  4NC7 A;  2R7R A;  3BG6 A;  3EUA A;  3A2K A;  3B90 A;  4IQ4 A;  3OFN A;  3FKS A;  5HOO A;  2AQE A;  2INU A;  3PJR A;  5LFA A;  3KEY A;  2F1M A;  2PYH A;  4NUB A;  2WJY A;  4CCL A;  2CV2 A;  2VKH A;  5KNL A;  2X53 S;  4B47 A;  3WQZ A;  3E0J B;  1K5C A;  4E7H A;  4E4H A;  3DU6 A;  4XMY A;  2CH0 A;  4F91 B;  3H94 A;  1P9Q C;  3RTR A;  3FBN B;  2IXS A;  4BEH A;  1E43 A;  3PSI A;  1WJA A;  2HLD A;  3OYE A;  2M3A A;  4AVZ A;  2VJI A;  4DK0 A;  1IDJ A;  1O8I A;  2WAQ A;  3RCO A;  1NRK A;  1BLI A;  2L5Q A;  3PL8 A;  4XNF A;  3PNY A;  2ZZE A;  4YEJ A;  1WFX A;  1YE9 A;  3PSF A;  3U21 A;  2NTP A;  2M5S A;  1LVK A;  4G7W A;  1U0J A;  3VSV A;  3OEH A;  1VBL A;  4OAZ A;  4E7L A;  1X0C A;  3GBG A;  3ZQQ A;  2RRE A;  1X4P A;  4XOP A;  4LIT A;  2JVH A;  2K3P A;  2UVF A;  1OOC A;  4BJ6 C;  2BVM A;  3VYR B;  1QHH D;  4ANJ A;  4CCM A;  4KIT B;  3UW0 A;  2LBF B;  4II2 A;  1K6Y A;  2WAE A;  2Z2S B;  5JHF A;  4XKW A;  3FHN A;  4CH7 A;  3ZIA A;  1O88 A;  2PYG A;  2Y0S A;  2VBM A;  1D1B A;  4H4K C;  4IKF A;  4FET A;  3OR2 C;  3J7A Y;  2NT9 A;  2DJI A;  2W1O A;  3EQN A;  1RMG A;  4W8Q A;  1DGW Y;  4Z1M A;  4XN0 A;  3HPH A;  1FX0 A;  2CUZ A;  4CCJ A;  4U7B A;  2R7X A;  3SEZ A;  4HNU A;  3W2A A;  3CJR B;  1DBG A;  4B3G A;  1I18 A;  2F4I A;  4N4O B;  3OYL A;  3M1C A;  3L2V A;  3TBI A;  4BU2 A;  1KCD A;  3A1Y A;  2R7O A;  3K4M A;  3GQ7 A;  4E7J A;  4ZTF A;  3QYF A;  3F9K A;  1LKX A;  1BHE A;  3BCB A;  3VYU B;  3GRH A;  2O5R A;  2W00 A;  4G6T B;  4KT6 A;  3TMO A;  2P0W A;  3H9J A;  2R7S A;  4TSF A;  4HEA 2;  2LRD A;  2QKL B;  2RNG A;  3UR3 C;  2KLO A;  5HNF A;  2KL4 A;  3QYB A;  1XG2 A;  2VBE A;  1HZE A;  2IQ7 A;  1S9H A;  3H9Q A;  2DT6 A;  2KVO A;  3I9V 2;  2V7F A;  1EFR A;  4OJL A;  1MND A;  2CV1 A;  3A4C A;  4G7X A;  4PJM A;  1PE9 A;  2UWM A;  4AU7 A;  1V0E A;  2R4G A;  3K4J A;  4BEH B;  2BVL A;  2GK6 A;  2FUG 2;  2F43 A;  3OAA A;  2VL8 A;  2LG4 A;  2WB1 A;  3PNT A;  3TL4 X;  2X6W A;  4ASU A;  4NC8 A;  4YZ0 A;  2PEC A;  1BMF A;  2INV A;  1E3X A;  3OWT A;  4DJA A;  3A35 A;  3I3L A;  2NT6 A;  5CKT A;  5C1C A;  1FMW A;  2LH9 A;  3K70 C;  5HKK A;  4YZQ A;  4X0G A;  2MD0 A;  4XLH A;  2KMU A;  4KKU A;  3BLY A;  3LFU A;  3OPO A;  2CW7 A;  1OGM X;  4PJN A;  4XD7 A;  2KQR A;  3OYH A;  2L9N A;  3IUO A;  1NHC A;  1W0K A;  4XLC A;  1G8X A;  2X8K A;  4NQW B;  2M7B A;  2R7T A;  1DP3 A;  3DU5 A;  3A3B A;  2DIE A;  4CUG A;  1W0J A;  2WAF A;  1PYV A;  4E7K A;  5HNH A;  4HIZ A;  2IGN A;  3FDY A;  3T51 B;  1V0F A;  2L9S A;  4YXW A;  2CW8 A;  2L7K A;  3OYG A;  1WTH D;  4ZDP A;  1MW7 A;  1TZL A;  3HOS A;  2GOM A;  3PNV A;  4EAT A;  3DQV C;  2ZSI B;  2D3N A;  3HPG A;  2R9V A;  3OS2 A;  2VIX A;  3DKY A;  1WJF A;  2DXI A;  3GQA A;  1D0Z A;  3CES A;  2E60 A;  4RMN A;  4B43 A;  2V4D A;  4BAC A;  3W2V A;  4GRI A;  1O8D A;  2EWE A;  2NTB A;  2O0W A;  3LMW A;  1K28 D;  2MC4 A;  4URR A;  1FMV A;  1NG6 A;  4HRI A;  5CPR B;  4R79 A;  2VBK A;  4XL9 A;  4XM3 A;  2E1M C;  2KPM A;  1W36 D;  1SAU A;  2R7Q A;  4J00 A;  1O8F A;  3S3N A;  2LY2 A;  4W8T A;  3B4N A;  4KKS A;  1Y6I A;  4II3 A;  3VSK A;  4NNJ A;  3W3C A;  1BR4 A;  4BUP A;  4E0F A;  3ZSC A;  3ZRG A;  4AYB A;  2OC6 A;  3WWG A;  2KDO A;  1X1C A;  3HXL A;  1BOB A;  4HPQ A;  4PJJ A;  2X6X A;  3LL7 A;  2LZJ A;  2KRC A;  3DTK A;  1E1R A;  5DN6 A;  3NWS A;  4XOR A;  3CF2 A;  3OY9 A;  1X1B A;  2PJR A;  1E0E A;  5CQE A;  4RM3 A;  1D0X A;  2O0V A;  1O8H A;  2LY1 A;  1UD6 A;  3AL0 B;  1EE6 A;  1WJE A;  1Y56 A;  4Y4R A;  1Z3X A;  3LSG A;  2NZM A;  4B3F X;  3KRG A;  2VJJ A;  3GQ8 A;  1T5E A;  2X85 A;  4NK6 A;  2GJP A;  4ZTJ A;  2Z6B D;  4KKT A;  3GVK A;  1DGR M;  4B44 A;  3FPP A;  3OIP A;  3OOU A;  4PJL A;  4BE0 A;  2V1N A;  3EPZ A;  2A6T A;  4P1W A;  2CV0 A;  2ODL A;  4MLO A;  2MAB A;  2GOX B;  2JA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...