4XN3A

Tailspike protein mutant e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 227
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn3A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn3A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn3A02
1RU4A 3SUCA 4HWVA 2PECA 4OJPA 4XM3A 4MXNA 1KTWA 2NSTA 1HG8A 2PYGA 1K5CA 4XL9A 1BN8A 3GRHA 1NHCA 3FY3A 2QY1A 2VJIA 2QX3A 2O0WA 1H80A 1QJVA 4YZQA 3GQAA 1PLUA 4YELA 1RWRA 2VBEA 4W8SA 4XN3A 1JTAA 4XR6A 3GQ9A 4YZAA 3T9GA 2VJJA 4XOPA 4C2LA 4XMYA 3B8YA 4OZYA 1VBLA 2VBMA 2VBKA 4MR0A 3JURA 4Z03A 4W8RA 4PMHA 2INUA 1JRGA 3B90A 2NTPA 1O8EA 2NTQA 5C1EA 4EW9A 4YZ0A 1OGMX 4XNFA 5AMVA 4OJLA 4OJ6A 1PXZA 4XLAA 1BHEA 1DBGA 2O04A 2X6XA 4Z06A 1XG2A 2NSPA 2EWEA 4W8QA 5C1CA 1IDJA 4OJOA 2BSPA 1IB4A 4XKVA 1IDKA 1OGOX 1CZFA 2NT9A 1O8JA 2INVA 4AVZA 4OJ5A 2O0VA 1IA5A 1O88A 1EE6A 3KRGA 4XLFA 3VMWA 3WWGA 4NK6A 2Z8GA 4OZZA 2X85A 1O8KA 1KCCA 1WMRA 1X0CA 1O8LA 3LMWA 3GQ7A 4XN0A 4XOTA 4URRA 2O17A 1DBOA 1QCXA 3EQOA 1AIRA 4U4BA 3GQ8A 3VSTA 1O8DA 4I84A 4XONA 2QXZA 2PYHA 3VSVA 2NT6A 4U49A 2UVFA 1PE9A 4XORA 2X6YA 1OOCA 3VSUA 3ZPPA 1KCDA 2ODLA 1O8GA 1RMGA 1OFLA 1O8HA 2UVEA 4XLEA 2O1DA 1O8FA 4XQFA 4XLHA 1O8IA 1OFMA 2NTBA 4YEJA 4YZXA 3ZSCA 4XKWA 2IQ7A 4Z05A 4W8TA 4NK8A 3UW0A 4XLCA 3B4NA 2X6WA 2X3HA 3VMVA 2NZMA 1GQ8A 1O8MA 3EQNA
chains in the Genus database with same CATH superfamily
5ILSA 1O7FA 4XLPF 1AIPA 3LSIA 1HDPA 3HG9A 3I4NJ 4FX4A 1VQ5B 3LL7A 1DU0A 1QFZA 2Z33A 3KFWX 3OYMA 2M2EA 4WF2A 1D2EA 1GVHA 3PQKA 4Z4YA 2M3AA 2VBZA 3W2IA 1JGSA 3JR9A 4L5EA 4BJ6C 1SEUA 1R6RA 2XNCA 4RM0A 4RMNA 2M4KA 2IGNA 3G1LA 3W3CA 1OCTC 2PG4A 2M0CA 2VJJA 4XMYA 3A2KA 2W7NA 1A6QA 2GJKA 4F7ZA 2KPMA 2QSGX 1N07A 1ENHA 4B3GA 5IT3A 4PC6A 2BV6A 4IOAF 2IBDA 3G6EB 2CUEA 1TLLA 2QQ9A 4G7XA 2H94A 1OB5A 3KL9A 4HIZA 1F1ZA 2NTQA 4YZ0A 4DBRA 2KRHA 3KX2A 1WPKA 3V7AA 4AD9A 4PJLA 5EGOA 4PGGA 3BY2A 1QGZA 1VJSA 2PJRB 1VQ4B 3GSIA 3L1PA 3IKVA 3PO3J 3I1FA 4NBSA 2QQAA 1JB9A 2JUGA 1B59A 4ACBA 3Q38A 1O57A 3Q6RA 1IV8A 4W8QA 1R4NB 3KEWA 4G1VA 1RIOH 3TL4X 4BNCA 4CCKA 1O3QA 2BSPA 2DYIA 1HKSA 3ZZ0A 3FXJA 2YU9J 3CLQA 2YSRA 1I3AA 1HDDC 3E3VA 3U2RA 4RCZA 4ZGQB 2JUCA 2O6WA 2ZZEA 4RAYA 3VSLA 4ZYGA 4M9ZA 1AHDP 3QPLA 3ZMTA 4PC2A 2WJYA 3HOXJ 3S1RJ 3HOVJ 3WWGA 4Q4ZF 2MH9A 3BTLA 5CQEA 2QENA 2JWTA 2P3MA 1APLC 2CV1A 3RKXA 2G0YA 1T33A 3LA7A 2O9LA 2KFDA 2Z99A 5JR3A 4AU7A 1GV5A 2ZJ2A 2FE3A 3CW2A 2VOPA 2QDXA 2PMUA 2Q2EB 3HKZA 2IVMA 2LY2A 5LEJA 4UUSB 4G5GA 4P2NA 2M1BA 1TTTA 4RM3A 1O8DA 5ICEA 1Q86D 4M6XA 3H5RA 4CH7A 2WY7Q 4KNYA 2PYHA 4AF6A 4F91B 1BI2A 3WTYC 3OYKA 3CPXA 5HDGA 2GXBA 3X2QH 2FEZA 2K9LA 3G2BA 4FT8A 1D5YA 2L7FP 1T6ZA 4KUMA 2QYUA 1G3SA 1T56A 4M53A 4IKFA 1XN7A 3D5SC 2HZTA 2O1DA 1PUFA 2WYRA 1WZ2A 2OA4A 4XQFA 1YW9A 3LSMA 3ASSA 1OFMA 2BN4A 1QNTA 5JMCB 4XRFA 1U9OA 1TVCA 4TMVA 3HHHA 3BZCA 4DYRA 2H27A 5E1WA 3E6BA 1KGSA 3PQJA 4E7KA 1IW7F 5KW9A 2ID3A 1XPXA 4BE1A 3H9GA 1T95A 3BG3A 3SEZA 5JLWA 5D4SA 1QGAA 3OZWA 1BI0A 4AYBA 4DGWB 3DEEA 2R7TA 3VO1A 2R7RA 1R1TA 1IAWA 3OYBA 3EQNA 1F9NA 1D0ZA 2LTPA 2ZJPF 2ZL6A 3CD6I 1DARA 1WFXA 4U9UA 1IXSB 3P27A 4WWCA 5GAEJ 4BPRA 3D5LA 2PMZA 4WXHA 3IKTA 4BBSJ 2D9RA 4H0EA 3KEOA 1B6AA 5DM6F 4FE7A 2COMA 3IH3A 3QSYA 4PJMA 1WORA 4GYGA 3MMPA 2VJIA 2DQLA 3E97A 1FNCA 1EH8A 2ZMEA 2K85A 3KLNA 2PLFA 3R61A 3L2UA 3GVJA 1BR2A 4C2LA 1YS6A 3MCAA 2EB7A 3DKWA 1R71A 2PE3A 4FASD 2GPJA 2XZPA 1QUEA 1E1RA 2V1XA 1XGNA 1UMKA 3K4CA 1CF7A 3JURA 2P4WA 4Z03A 3QODA 3B6AA 3M3YJ 4PMHA 3B02A 4E0FA 2KIUA 3ES9A 3LFUA 3BQZA 4RBOA 1K73D 3FISA 1XSDA 2X6OA 2R6HA 3ZZTA 1T2KA 1VHOA 4IEJA 4KJZA 2PX9A 1FIAA 2STWA 3JAMK 1EA3A 4EVIA 2VNIA 2HKXA 5GV7A 1POGA 3DPLC 2XTYA 1NDHA 2V7QA 3D0SA 1I7PA 1WP6A 2LD5A 3M8FA 5TJJA 3CCQI 3OEHA 4LBYA 1DGWY 1G6NA 2LY9A 3LNNA 2QF7A 2IS1A 2C5HA 2VODA 5AN9A 2F3LA 2CBXA 1OCZH 2AHQA 1VQ8I 4HE6A 4G9YA 2UVEA 1YLFA 4G8XA 4XKCA 4D0PA 5ICFA 4NNJA 1R5HA 1UD3A 3ISXA 4PABA 1B2RA 1T5EA 4M9XA 3QPSA 1ZG5A 1R9TJ 4LB5A 1VLOA 4M3GA 2BOLA 4II2A 3QP5A 4RA2A 4J00A 4EMSA 1WSRA 4QVAA 2EZIA 3KLOA 3FIWA 3H5NA 4Q47A 2LMDA 4XN0A 3ZQIA 1W4MA 4XOTA 2JN6A 3ABLH 1HW5A 4KITB 2OBTA 4ZDLA 4AC0A 5C44J 1Z91A 2HQ5A 4D7NA 1KZHA 1AIRA 2IS2A 2IA2A 1XB4A 2ZKZA 1Y0UA 5B3SH 2DERA 5LHGA 2PJRA 1MH3A 2HTSA 3HBLA 2F5EA 3RCOA 1UB9A 4UZFA 3BR3A 1E17A 1TTYA 4EH1A 1ZTRA 3OR2C 4G7OF 1PJ5A 1U2WA 3V8LA 1MZBA 4UV9A 1BJAA 3BPXA 4A3DJ 3PENA 2ZL7A 2WV0A 4C3HJ 3S2DJ 2JMWA 1FRQA 3DEWA 1S0UA 3CMAB 1SFXA 3OS2A 1P9QC 1Z3XA 1X1DA 1ZR4A 4A69C 1E2XA 5J47A 4DBQA 3V7CA 1XGMA 4BAYA 1LDKB 3CCYA 3K4MA 3SZTA 3ASOH 2WWYA 4RGRA 4HDVA 3H36A 1KQ0A 2MBFA 1HKQA 1VQ4I 3WY9A 1LPQA 1ETKA 4MHGA 3WTZA 1FJLA 1JKOC 3DU1X 3C2BA 1S8NA 2E2JJ 3K70C 3LSKA 5IT9Z 1FBUA 5D5WB 3ZQQA 1K4TA 2PECA 3W5UA 3CD6B 5LHHA 1T6XA 4PJ0C 3S1NJ 5LFAA 2EBIA 2RKHA 2WB1N 3C18A 1BOBA 4BL0B 2QX3A 3PSSA 1YJNB 2EH3A 2V7TA 2GA2A 3KPHA 1FTZA 1JKRC 3LAJA 1FEXA 4YAUA 2L9VA 1RWRA 1Q82D 4W8SA 2HXOA 3F6OA 5THXA 4IRIA 3GTLJ 3AAFA 3K70D 2E7WA 3Q9SA 5B66C 1N75A 2M7BA 4FK8A 4YALA 3CC7B 3JRIA 4OIPF 3BH6B 3Q39A 4A0XA 3ZP5A 4KMUX 1YTYA 3ZMSA 1WKMA 4F52A 2B5OA 2CQXA 3B90A 5M3FJ 3O3KA 2L2OA 2A5WA 3QFRA 1KC8D 2QUFA 2R5YB 4LJZF 3DPTA 1N77A 4BACA 2ZJRF 1JXSA 2QEXB 4AYBN 1RPWA 2VN2A 2F2EA 4AIJA 2CQNA 4QTRA 1VQMI 3OL4A 4RM2A 3I0TA 1D1NA 5FL7A 3CCVI 2ZZFA 2JSCA 2YX4A 1OKRA 3BTJA 4EV0A 1I6HJ 1PJ6A 3UR3C 1IB4A 3K1NA 1VZ0A 3K10A 1X1AA 2K40A 3WTTC 4Q48A 2BVMA 4KT5C 3L2QA 2NV4A 1HF2A 3CQZJ 2GA1A 2RAEA 1VQKI 2HQNA 4GQNA 4ZYAA 4IHSA 2CRVA 1WPCA 3DFGA 4Z4SA 1IGNA 3GCMA 3K4NA 4E4HA 5KAFC 3K0LA 3R60A 1G4DA 3EYIA 4BY1J 4CUGA 5BSXA 4I01A 1FPQA 2JSPA 1G3TA 1R49A 2IRFG 4G7WA 3KYCB 3VYTB 4OWRB 1R4MB 3HXLA 2DO7A 2YS9A 3BTCA 3VMFA 3KP2A 1Y0YA 1IDYA 4UUTA 3OFNA 2DA1A 2Y0SA 5HVQC 4P1VA 4AWXB 1NJID 2A61A 1WHUA 1FMVA 1K6OA 3CB4A 4YFXF 2FUG2 4OOSA 2MH2A 1KYWA 2R4GA 4XORA 3VOEA 3AVVA 5J1RA 3OYHA 2ZZQA 3U2QA 1T0FC 1SAXA 2BX6A 2YWHA 3RKWA 2WAQN 1W0KA 5HS7A 3E5QA 4HZFA 2MC4A 1G3YA 2GOMA 1RRJA 1LB2A 3HDDA 4H4KC 1QA6A 1KRHA 3LQEA 3V8KA 1WJBA 2V7WA 2JA6J 3E6MA 4I99C 4JK1X 4MEXF 3P5JA 2PMDA 1YHQI 4XRSG 1Z0XA 1EZGA 1K79A 3WTVC 3K69A 5HDKA 4A3IJ 5FLXZ 3B82A 1AA7A 3WBJA 3AL0C 1I39A 1ZM3A 1RNLA 1R5BA 2JDIA 1RU4A 4CA0A 3ZN0A 2ZFWA 5FLVA 3SEJA 2OD5A 3F23A 1USTA 4TV7A 5KSWB 2DBBA 3VODA 3WG7H 5KNLA 5E8IA 1WXRA 4BY7J 1DP3A 3Q0VA 5E20A 1ETWA 2DAOA 4KMFA 3JU4A 4YCQA 1KMHA 3BTIA 5IYWA 2R7OA 2KVOA 5IYQA 3FPKA 2BW3A 1JE8A 1H88C 3CCMB 4JYKA 2JT1A 1QHHD 2Q8KA 3T9GA 4M6YA 1W5SA 5FNZA 5E3NA 2QZAA 1IJWC 5TR9A 1D8TA 1YJ9I 2GAUA 3KP5A 3AVUA 2QTZA 2O8KA 3IP4B 2VI6A 1V3FA 3EPZA 3VWBA 2Q6IA 2XASA 2OCCH 3F72A 2XV4S 3HGGA 5HS9A 1B72B 3OEEA 2VFQA 5H59A 1S72B 1T39A 4Q7JB 1D1CA 3VNUA 2FNPA 1FT9A 1ZN2A 1K78B 2VYQA 2VFPA 4RDUA 2Y31A 3ABTA 5J35A 1GVJA 2BW3B 4ROXA 5CYVA 3K4KA 1Y0RA 2VJ4A 3OYIA 4U87A 4C9YA 1V0EA 1GUUA 1UHWA 4PGOA 3QOEA 5EMNA 3OMYA 1U5TA 2ESHA 1OB2A 4I0BA 1YQAA 1ZREA 2P81A 2WZPP 2A05A 3ZPLA 2WBMA 1GVDA 2LZJA 1CZFA 2HVRA 2L4AA 3PJRA 2KT0A 4F55A 4Y4RA 3HUGA 3QYEA 5H5JA 4OJ5A 2Y69H 2E1MC 2WY8Q 1TZLA 1VQPB 3S32A 4B48A 1YW7A 2VIXA 1B4AA 4OU0A 4EM1A 4RPDA 4ESFA 1FYLA 1E64A 3OV8A 2V1NA 1IN6A 1ZELA 1T08B 1OFDA 4LBVA 1XDSA 3QQAA 2R7FA 1KCCA 1WMRA 2HDCA 3SZPA 3D26A 4Y7NJ 3A8IA 3W6KB 5BS6A 5K5OA 3ABKH 1H9TA 1TC3C 5IYPA 2RV8A 4U4BA 4YIIA 1RESA 3E0JB 2VBYA 4GXOA 4ZC3A 1Y8RB 5HLIA 3KZYA 2VBTA 2O03A 1ZGAA 2VQGA 1Q9SA 2KZGA 3UKGA 3HSRA 3TO9A 1RR8C 4RGUA 3HC7A 2IW5A 2KIFA 1PP8F 4IQJA 5GADJ 2IEKA 4NBQA 3BQYA 1S3JA 4PC1A 2BXZA 2QGUA 5B1BH 2KP6A 1R5OA 1DABA 1E3PA 1UG2A 5CKTA 2EIXA 2PMHA 1Y0NA 3BQJA 1X3ZB 5F0FA 1IN5A 3EUAA 2Q6LA 3GTPJ 3LSPA 4KH3A 3U1KA 1O8IA 3AG4H 1AMOA 1PVEA 3RZOJ 2LC2A 2GJPA 2STTA 3R6SA 2P8TA 2KIQA 3SFIA 2X53S 2R7QA 1QRYA 5FB2A 4FXUA 4B09A 4HF0A 4ZYHA 2CWEA 5BQTA 4CCNA 3UW0A 1MKMA 1IUFA 1V54H 4RCYA 1YIJB 1FOKA 3K2ZA 1KQSB 1J5YA 5DD4A 1QFJA 2RC4A 2GQQA 4IQ4A 1ZM9A 3WU2C 4XM3A 1MMAA 2IOUG 5BOXA 1KK2A 3RDIA 1A35A 1IDZA 4N9HA 4LMYA 2QQBA 1W1WE 3V4GA 3AGPA 3GRHA 2ICWG 3O6BB 1DGRM 2L9SA 2K3FA 3KE2A 4XLNF 1W36D 3SLDA 3DKYA 1ETXA 5JBQA 5H6QA 2XT2A 5DCFA 2MW8A 4XN3A 4Z2YA 5EEAA 4LBZA 1FP1D 1U8RA 4A3EJ 4HOBA 4OZYA 2VBMA 5F4MA 1UFMA 3U6BA 2FQ3A 1QVTA 3H3ZA 4CXFA 1NB0A 2RN7A 2V9VA 2YUHA 4ZZLA 3ZQFA 2YR2A 4YRVA 2CQKA 3VYSB 1F43A 2JIZA 2WZNA 3PA2A 3B8HA 5E3OA 2FU4A 5M5YJ 1OJLA 4DW6A 4ZYDA 4CQJA 4TN1A 2DLLA 1KJZA 2VBVA 3ESWB 2WPDA 2R7VA 4D5FA 1QUFA 5F4JA 3VO2A 4PSWA 3PUBA 2OAZA 3KETA 1T38A 3R6KA 3C2GA 5B5EC 4L9JA 2R7ZJ 2O04A 2GQFA 5LGUA 4AM3A 1C0WA 2LK2A 2HU9A 1BI3A 1R1UA 2W57A 1SKYB 3OW2B 1TW2A 3NWTA 3JW4A 3HSFA 5TY0A 2M5WA 3ZC3A 4Z1MA 4ZCIA 1P7JA 3OYAA 4U7DA 4HE5A 2V1DA 3K4JA 1SD4A 4LLGF 4HX4A 3CCEI 5TRDA 3ZXSA 3IL2A 3T5XA 3SFZA 2M0MA 3SYTA 3CC2I 1K83J 2E1OA 2L02A 2F4NA 3BH4A 2O7OA 1KYZA 2DDAA 2HQAA 3I59A 4R1HA 2EQRA 2FRHA 3DLLF 3BC9A 3HL2A 3CZ6A 5EEGA 2DU9A 4P3YA 3WGIA 3Q3AA 4I7HA 4DQLA 4KA4A 3PFIA 3J7AY 1ERDA 2FD5A 2HDNB 4KFCA 1YG2A 1EFCA 3SQNA 2XGXA 4U0WA 4MYTA 4ENNA 3B6CA 3GQ8A 1O3SA 2KJCA 3PVDA 2HYJA 1Q1HA 2HKOA 4BXXJ 4HX8A 2M34A 6PAXA 4QWQA 1CQTA 1EP3B 4ZDOA 4U49A 1YE9A 1P7IA 4A3JJ 1ETVA 3JRAA 2H1LA 3M1EA 2P5LC 2OF7A 1YRNA 2V79A 2XPWA 2ODLA 1O8GA 1S29A 4ENJA 3SLNA 2DFIA 1RMGA 4GDFA 5CLSA 1O3TA 5BPIA 1JT6A 4U7BA 3G71I 3I56B 5DS0A 2E71A 3GZ6A 1BA5A 2JTVA 2W4SA 3IHUA 1A36A 1HC8A 5KVRA 3TP0A 1X3WB 2YWEA 2DMQA 3O8GA 2XTWA 4YZXA 1I8DA 3J80K 2P7CB 5EG0A 3VNVA 2DFEA 1LUJB 2DOFA 3M1CA 2EA2A 3GTJJ 3CCSB 1JUPA 2W1OA 1ZARA 2R7SA 1JHFA 3R4KA 3RYPA 3FJOA 5DEQA 4XLCA 1AOYA 1YJWI 2E36A 1G3WA 5DM7F 3N90A 3OYEA 2X0KA 1UHMA 4HX7A 3A02A 4Z4VA 3EUHC 3TEDA 1S5LC 3K6GA 3SJMA 1T6YA 3CXCB 2W25A 1XE1A 5FGMA 1VF9A 1PKVA 3M4OJ 3G6EI 3FY3A 2IXSA 1CNFA 2HOEA 3HAGA 2BGJA 4MEYF 2VFOA 2O6GE 2B0RA 3GFJA 2VL8A 2O0WA 3ZMUA 4HYEA 2M4GA 1PLUA 3SYJA 1GDTA 3JQRA 1W0TA 4XR6A 2CO5A 4LD5A 1UMQA 2J8KA 2OZUA 3A0HC 2NVTJ 1DUXC 3M9AA 1KD1D 2Z6BD 2M5SA 5LRRA 3HIFA 4RB1A 3CC7I 4II3A 4V19K 1ZLJA 4UV8A 4IHWA 2W6JA 4L9VA 2INUA 1HZEA 3REOA 1JTYA 2NTPA 2ELJA 4LG3A 3HPGA 4U0YA 1WCMJ 1D1BA 3P9CA 4E6KG 1E1QA 2CFOA 5AMVA 2OK7A 1JNYA 1SKQA 2ZXIA 1WI9A 2A68F 4OIOF 4JQFA 4WZEA 4XD7A 3ZQ7A 3RI4A 1RETA 2TRTA 2CW8A 2X6XA 4TMTA 2KRCA 2M87A 1UJ8A 2KDOA 4ENKA 5C1CA 1W5TA 2ECCA 1R5ID 1MBEA 2NS7A 1UG0A 3UNGC 5E6TA 4E7JA 5HLGA 4RD2A 4YEIA 2MD5A 4C3JJ 2YU3A 3CC4B 2Y0MA 1TYXA 2CV0A 2FBIA 5J4YA 3W2FA 1TP4A 5BSYA 4OP7A 3AVYA 1FNNA 3BJ6A 2DFHA 4MTEA 1VI0A 2DYRH 2PQ8A 4RLZA 2AXLA 4L5IA 4I2OA 2FMYA 3VFZA 3C3WA 4OZZA 4X05A 1Q81D 3KP7A 2ETHA 2Z2SB 2PI0A 2Q6KA 1HLVA 1QVGB 2Y0SN 2WR8A 3JSOA 3MKWB 1SFUA 1O4XA 3AGQA 2O17A 1W5CC 4HBLA 2XSJC 4I09A 4P9UA 2HOAA 4O5VA 1RQRA 4PUSA 3VSTA 2HPIA 4RGSA 3DXJF 3RPQA 4BU2A 1FOWA 2XGEA 4NB5A 2EIMH 1MNMC 1P2FA 4G6QA 2DA2A 2RC5A 3S3OA 3OW7A 4B3AA 2GIVA 1LNWA 3HOZJ 3HUGB 3HTSB 2AO9A 1SFEA 1GJRA 3BROA 3I59B 2W84A 4KIGA 4JMQA 1TYWA 1FMWA 1OLTA 5IP6A 3CMAI 2ZBKA 1FLIA 1WWXA 2UV1A 3AVWA 1YYVA 3WU0A 3BR5A 3I9V2 3RYRA 3WTXC 1BIAA 4JX4A 4JRAC 3W5HA 4KDPA 1KU2A 3DTEA 4XKWA 1IF1A 1NRKA 1W35A 1EV7A 3WHBA 1W36C 4Y9RA 1WH7A 3SDBA 2IJLA 2G0EA 4L5JA 2D3NA 1R00A 3DWLE 2AQFA 3NE5B 4NK8A 4EJOA 1A6IA 3U6KA 3LWFA 1P4XA 4OOIA 4UZEA 2DIEA 2BGIA 4X7DA 1GXQA 1KU3A 3BPVA 3VSKA 3CCJI 2PJPA 4M0LA 2MSYA 4TMXA 3IUOA 2OJED 2XIGA 1WQ2A 2BM5A 2L3DA 2WA0A 3OOCA 2R7XA 1O7LA 3W6JB 5FKNA 2P7VB 3I54A 3E6CC 3ZBUA 3SQVA 1TT0A 1X4OA 4UVAA 3L2WA 2K9QA 4BQNA 1EJ9A 5FO5A 2VB6A 3J7YJ 4LIUA 3BWGA 4BEHB 2HWVA 4M3BA 2FXAA 5FD5A 1NH3A 2K7LA 4DIQA 3MFKA 2EZKA 3HRUA 3QYFA 1JKPC 4LFUA 4QHYA 4HSRA 3CJNA 2L7ZA 1O8EA 4BHPA 5BMZA 2Z5UA 3KP4A 2CRGA 3PIOF 3LA3A 5J8CA 2LDUA 2EJRA 3Q9VA 1Y56A 2NXNB 3MD2A 3G05A 2HGCA 2HNHA 1P4MA 3OYLA 2E60A 1GR1A 4OJLA 4DYQA 2DY1A 3CC2B 5CJ9A 4M1KA 5E17F 2A69F 2W24A 3OSFA 2HXIA 1W34A 2NPFA 4UY8I 4Z06A 2WC2A 4I02A 1KQ8A 3U9GA 3OYDA 1FSHA 1D0YA 4Y7CA 3W2GA 1WI3A 2IS4A 2A3SA 1MIJA 4XKVA 2VOOA 2P5VA 3JRBA 4BS9A 1K28D 4BXFA 2L0KA 3LSRA 1OGOX 2INVA 2DA7A 5HOOA 2DTZA 3ZIAA 2O0VA 4EJUA 2V7XA 4RPBA 2JZYA 1MMSA 1EF4A 3MZYA 2BSAA 3J81Z 1JHHA 2DJNA 3CCUB 5AIPA 1KQ5A 4RS8A 2DK5A 3K4BA 3IAM2 1XG1A 4RLQA 1XGSA 1NB9A 4ESJA 2X85A 4HQEA 3IWZA 1L3LA 3OL3A 4RD1A 3BG5A 3SXYA 2MG4A 1FY7A 5LGNA 2DCEA 1KZLA 3OYFA 2CV2A 1G7TA 1QCXA 1ETYA 1QZZA 3CP8A 1VQLI 4C30A 3HOWJ 5DN6A 2CK3A 1MJAA 2K27A 4KICA 3NAUA 1WDTA 2ME6A 3E7LA 2CQQA 2PEXA 2HZDA 3FPPA 1ZGJA 3FK7A 2PMZN 1Z9CA 3ISPA 2D45A 3F8MA 1E63A 3LQ6A 2UVFA 2LKPA 5IYCJ 2V5IA 3LQQA 4W97A 3BDDA 1DU6A 4RD6A 4F93B 1EFRA 1F5TA 5D8LB 4ZV4A 3FXRA 3P26A 2QSFX 2ZL5A 4L9NA 2RVCA 4P5OA 2E19A 3H0GJ 2EFWA 1ON2A 4PC7A 4LB6B 2CQ7A 2VPRA 2F5CA 2BM4A 2NTBA 3V7RA 3BJAA 2A5YB 5BPDA 4LITA 3CC4I 1SD5A 2BVLA 2XUBA 3ASRA 1FX7A 1V5FA 3H9JA 3OE7A 1HBXG 4PJNA 5ICGA 5FFZA 4A12A 2ZTGA 1O8MA 4PFPA 4WK8F 3TDUC 3FM5A 5K7FA 2KL4A 1FWZA 2I5UA 4NDLA 3IRQA 3A03A 4LG0A 3H35A 5CPRB 1ZG3A 1UHSA 2YUSA 3H92A 2DYSH 4RD0A 3N05A 2Y9ZA 2DMNA 3JREA 2DT7B 4R71A 2K9SA 1TWGJ 5CQGA 4WWVA 3CJTB 4ZCLA 3DTKA 3PSFA 3L2RA 4YELA 4BJ5C 1SD7A 3CCQB 1VQ6B 2DXIA 1MBHA 2BY0A 1KU7A 1R1VA 2WSSA 3S1MJ 2F4MB 1K4ZA 2IA0A 4HRIA 1OCCH 4LG0B 3U1DA 5HODA 3ZR8X 4QLCU 3A4CA 3FMSA 3KP3A 3PNVA 5IPAA 4X0GA 1KTVA 2C4TA 2C77A 2VFNA 3ML3A 3S3MA 3DCFA 4E7IA 1YJNI 4DZJA 4J01A 1G7CA 4XNFA 2OYNA 3QP6A 3S14J 4WQMA 3B73A 4S05A 5FKOA 1TLHB 3RKQA 2QE7A 1VQ6I 2Z3YA 4A3GJ 4BEHA 4CCOA 2EILH 1EFUA 3LYCA 2CYYA 4DQKA 1ZLKA 4FTHA 2XF7A 4YXWA 1ZRFA 1EXMA 5EYRA 1ZG1A 2GK7A 1YJ9B 3LSGA 3A8JA 3DV8A 2UXXA 1BBYA 1X1BA 1YI2B 2LOOA 5E3LA 2HOTA 2FJ1A 4FQGA 4CCMA 1S7EA 2XRNA 4Y15A 1IC8A 1F4KA 1G8XA 2X0LA 1BR4A 1OCPA 1XDUA 3BY1A 1EWYA 2MGQA 1J7KA 3MKZA 1PP7U 4EEFG 4A5MA 3W2HA 4M3FA 2YPRA 1N05A 2CW7A 3PFYA 2FA5A 4OIQF 3GTKJ 3V76A 1DBOA 3GLXA 2IP2A 3V7SA 4Y17A 3ZQGA 2V6EA 2LR8A 3HRSA 3LSJA 4OOXA 2EA4A 1ETQA 2JN9A 4MFDA 4EM0B 1BC7C 1QBJA 1HSTA 1W0UA 1VQPI 1DPUA 3ONQA 1QGPA 4NC8A 4ZTFA 2X6YA 1HW1A 3PO2J 3CRZA 3NARA 2K9MA 3I58A 1OCOH 1OFLA 4LK0F 2H8RA 4G6TB 3RTRA 2VE8A 2MFZA 4UZUA 2XGJA 1IN7A 5AIQA 5EJCA 2BZTA 2FSWA 4XLHA 4A6DA 5ERIA 2JJ7A 2L7MP 4RAFA 3COAC 4AF7A 1MJBA 1CNEA 1OQYA 4PJJA 2HLDA 4D9JA 5C3EJ 4ZZDA 5KHDA 4EM2A 3TOBA 1MGTA 3VB2A 2GM4A 3QAHA 1R23A 2AQEA 1OFCX 2IA1A 2X3HA 3BH7B 4LBWA 3NEUA 2P6SA 3VMVA 3CCUI 3GYHX 1H89C 2E1BA 3HGYA 5JLVC 3SUCA 2X4HA 4E7SA 1JKQC 4HWVA 4OJPA 5K7HA 4MXNA 5D6FA 1VQMB 4OPWA 4BE0A 2D5VA 2F43A 4N0BA 2NOJB 3DU6A 2VXZA 3LA2A 1ZK8A 2M8GX 2QM3A 4UUVA 1U0JA 2CC2A 2DOGA 3MZHA 2IGKA 3CJQB 3MKYB 2VQHA 4XBFA 1SC7A 4HEA2 1XMKA 2ZB9A 1H80A 3QU6A 2XGDA 4F7DA 1JJ8C 1Q1VA 3I3LA 4RAZA 1AKHA 4HW0A 3KYDB 1G7RA 2Q0OA 5D8KB 5JVTA 2WJVA 2BBYA 2BVNA 5J1YA 2F4OB 3ASNH 2G7UA 4CYCB 2GZWA 1HCRA 2OV7A 2XAGA 3VR6A 2YWGA 5J3OA 3FXKA 1VHEA 5F1RA 2DW4A 2HVQA 1S72I 1H9GA 5BNGA 1ETOA 2NVQJ 3S17J 4X7EA 3AL0B 1W2BB 5C1EA 3J80Z 1OHHA 2X1DA 3TDZC 3A01A 2H1KA 3L7WA 3ZQCA 2R93J 4CSWA 3H3VK 2XC1A 4DK1A 1AKHB 4KISA 4A0ZA 1WOSA 1OR7A 2PFBA 2QBYA 3V42A 1VQNB 4OAZA 3G1MA 2VLAA 2J8IA 4PCQA 4MFEA 1PUFB 3ONYA 1M1KD 1Y6IA 4BUPA 2EFNA 2IGOA 5IP7J 1IG7A 2O5RA 3N97A 1N0UA 1ELOA 4BBRJ 2E1CA 3MAJA 3C2HA 1WTHD 4YAWA 3A3BA 1TWHJ 2JJ2A 3FF5A 1WGXA 3QPHA 1Q7YD 2XAHA 3FBIB 1IZ1A 2WAQA 2C4UA 1TQMA 1DDGA 2Z16A 2VC1A 1FP2A 4BHCA 2DA3A 5LGTA 1O88A 4DNCA 1EE6A 4OPSA 3RZDJ 2ZNZA 1R5GA 2E7XA 4P9FA 2QEXI 1YITB 1Z05A 4DJAA 2Z8GA 5J1UA 3FXQA 3FKIJ 4ACAA 3PM1A 4HV6A 3MEXA 3FBNB 2Y9YA 2ZMEB 3F9KA 4CDGA 1JJ2B 2GK6A 4OMYA 2QSHX 1N78A 4Z4WA 3I53A 4LOCA 1HVXA 4KIFA 1U5TC 2C5BA 2LSOA 2TCTA 2KQRA 2ZCWA 2CSOA 1G7SA 1V5GA 3OOUA 2BMWA 2NRAC 2KZVA 3BP8A 4HQMA 2R0QC 4OOVA 2EFOA 2QXZA 2XKOA 5GP9A 5JHUA 2FNAA 3BZKA 3HOYJ 2K86A 2IT0A 1HXDA 3G73A 1T6SA 3HEFA 3ASPA 1QX4A 1OOCA 4OIRF 4IHVA 3CMEI 3PL8A 5A2QK 1Z3YA 2LVSA 4CCJA 1IRZA 1HW2A 2EIKH 3H1CA 1IXRC 2C78A 3GIRA 3HHGA 3VEPA 3OIPA 4XLEA 1X2MA 1K8FA 4X7CA 1D8JA 2GXGA 4C0SA 1MBFA 4KT6A 4CZZA 3FK6A 5L3GA 2DK8A 4FISA 2ZJQF 4S0HB 2IQ7A 1U6GA 1XTAA 4Z05A 1XFOA 2NOGA 2OBRA 2V7VA 3P9KA 1LFPA 3A1YA 4HG2A 1L0OC 3WTSC 1FBQA 2X6WA 2XNDA 4D1QA 4XRSA 2HR3A 5H2FC 3NQOA 1WOOA 3TKYA 2HMAA 2ME0A 5L3CA 3M8JA 2BV3A 5HS8A 3MN2A 1ZKGA 4WXCA 3S2HJ 3ZGKA 1JA0A 4WZLA 3MWMA 3CF2A 5EDNA 3E5UA 3I56I 5DD8A 3PSZA 1TQPA 2BM1A 4TSFA 4WX9A 1H8HA 4JP0A 1GHCA 2E1RA 3KEYA 2R9VA 1BIBA 2W48A 2I1LA 2M7AA 2HOSA 3L09A 4G1BA 2VBEA 1MJ9A 3FMRA 2C2WA 3WBKA 2NVXJ 1R7JA 3GQ9A 3ELKA 1MBJA 2VQCA 1OYYA 1GAQA 2O8XA 3F8NA 5EEHA 3ZUGA 4YHBA 3TP3A 1ZHFA 5JFRA 3F22A 5HNHA 3GTOJ 4M2LA 1DG1G 4V2FA 2ZFUA 2X9DA 1EP2B 4X06A 2QLZA 4EATA 2ZITA 3CP2A 4LLLA 1IV6A 3SEQA 1CLWA 1OGMX 2MYSA 2VBWA 2L7KA 1I5ZA 1FNBA 1SFKA 3OIQA 4E7LA 4C2UA 1FOYA 5J8FA 1WSUA 4N3NA 4XLAA 4P12A 1STZA 2CS3A 2G9WA 4C2MJ 3S2WA 1W87A 2XAFA 2JRTA 1VFCA 4EJWA 3JRFA 3BCFA 5HXBA 1TSPA 2V4JC 1LLZA 4IRHA 4W1UA 2OPTA 1XMXA 3D1NI 1IDJA 4OJOA 1QHGA 1MW7A 3GFMA 3CUOA 1QO0D 4YFKF 2XOKA 2LFBA 1TL8A 4M74A 4HV5A 3CLOA 3TOAA 1FRNA 2RDPA 4P6YA 3AVXA 4GGGA 3A35A 3LMMA 4G94A 1XCVA 2EV6A 5AONA 1T0FA 1D1AA 2D3LA 2NNNA 2HYGD 3E1SA 3A3GA 2LLKA 1VF7A 2EZLA 1E3OC 1MMNA 1QVUA 1F36A 3ECOA 3EETA 3HOTA 2R7UA 1O8KA 2W82A 4F92B 3DBHB 4GRIA 4HA8A 4RB0A 1R36A 3MCZA 1LQ1A 1BC8C 2QBYB 4PAAA 2CUZA 2X1CA 1QPMA 5D5UB 4KN4X 3TH0A 3HJEA 2AHOA 2W6IA 2P6TA 5LHIA 1CGPA 2IS6A 1Z67A 1IUYA 1KU9A 4I84A 2DT6A 2A07F 1JA1A 1X4PA 2NT6A 3JCUC 4E7ZA 2HYFA 3MKLA 3HB9A 4NUBA 5LRSA 4QUZA 2DOEA 3CCSI 1U2RA 1PE9A 2CJJA 2VFMA 1Y1VJ 2Z1DA 3ZPPA 5DSZA 3BR0A 2DETA 2DTRA 3DEUA 2XGCA 1A8PA 2H6BA 1QQ1A 3I71A 2O61A 3EDPA 3G4SI 1QA2A 3BR2A 1YHQB 2LNBA 2NYXA 2QVOA 3CESA 1X19A 2ID6A 3FHZA 3HRTA 4AUXA 1VQ7I 2MA3A 5F1JA 2LH9A 3T8TA 1J59A 3HOUJ 3F3XA 1MSFC 3K9TA 4ZYEA 4A93J 3H9NA 4I98B 2B0LA 4QVJA 3FZVA 2W00A 5F27A 2XPUA 3HPHA 5HZAA 1SMYF 5LLQA 5IT9K 1K9MD 1GQ8A 2BHYA 2XB0X 1TW3A 5FKKA 4B8XA 2DFFA 3CUQB 1KTWA 3OJWA 4P9SA 3KCCA 1SANA 1XS9A 3TW7A 3S16J 2VE9A 1LKXA 1QJVA 2F5VA 2F6CA 1BI1A 3T0YA 3W2WA 1MDMB 5FIUA 2GREA 1HA3A 1QZEA 4J19A 1VQNI 4B1RA 1QA3A 2UXNA 2X1EA 4E70A 4LGWA 1LVKA 2BGCA 2EFQA 2VUMJ 4X8IA 3IRRA 4A3BJ 1BQEA 4C43A 4P55A 5GAGJ 1QFYA 3C7JA 3K2AA 3T1BA 1FNMA 3CMEB 2ZBVA 1ON1A 4QPQA 1OCRH 3EUHA 2M9HA 2L54A 3ABMH 3BR1A 1R5NA 3OAAA 1A04A 1WSVA 2ZO4A 4QV2A 3WNBA 1IJEA 1V4RA 1N08A 2ZZGA 4BHBA 5LEKA 3VDXA 4OJ6A 2E1MB 2QN6A 1DBGA 2VBXA 2NVYJ 3CCRB 3BG9A 1WRJA 2KHMA 3OIOA 1UD8A 1XG2A 1SVOA 2Y30A 4NQWB 5FKLA 1ZRDA 4BQOA 1IO2A 2VKVA 1X58A 5DYMA 4B4CA 5EGOB 4AIKA 1X3UA 1U8BA 4JBAA 3ERED 2CMPA 4GCVA 3DBRB 2KLOA 1JUSA 3E5XA 4M71A 4X0CA 1U9NA 2B7BA 2NT9A 3DKXA 4PDKA 1WVRA 1BPLA 5F64A 5EZHA 1J0RA 5L46A 4XLFA 1K4SA 3NB2A 4P22A 1FC3A 3GZ5A 3TBIA 2FF4A 3IV5A 2W7ZA 2ZC2A 4L8JA 1MBKA 1X2NA 4G12A 5LMZA 2VT2A 1J9IA 1T98A 1LJ9A 2L9NA 2XHKA 3LSTA 1VQLB 3IH4A 1SD6A 2V7UA 2D1HA 3HM5A 4PSXA 1QPIA 2OZ6A 2A6TA 4RJLA 4PFOA 3IC7A 1FOXA 2VBSA 5KAIC 3A01B 1VQOI 1QU3A 1HA8A 2Z9OA 4IHTA 3Q6QA 3FXOA 4KKUA 4XONA 4YIRX 3OYGA 2BY3A 1B72A 2F1MA 4RDKA 1YFHA 4RAGA 1B8IB 1QZYA 1H8AC 1KONA 5JI6A 1G59A 1E79A 1K78A 1RR7A 4TKOB 2P5KA 1KCDA 5DCMB 2XVCA 1P4AA 3BCAA 4U88A 4UB6C 2MLGA 1N0VC 2XAQA 3R6JA 1K8AD 1HOMA 2CF4A 1UZCA 5K5RA 1MNEA 4D7MA 1N06A 1O8FA 3QFCA 3K4LA 2F4IA 3FWEA 1TNTA 4L9TA 3PNYA 5HDNA 3AG1H 4HPQA 3FKJA 4MIMA 3CCRI 1K6YA 4JOMA 4RLFA 1XSVA 4B44A 1FX0A 3CDLA 4M72A 5FLXK 3CPWB 5J3LA 2RQPA 3V8JA 3A8KA 3CJRB 2ZXWH 1XB2A 2FBKA 2O0YA 1ODDA 1KK0A 4FWTA 2DPDA 5DS9A 4YAOA 3I4MJ 5GPAA 4G7ZF 3JQQA 5E1ZB 3F8BA 3SKBA 5HNFA 1K5CA 2Y48A 2JVGA 4DNTB 3FDYA 2Q6OA 1XSXA 4PZJA 2LBFB 1AWCA 3HTUA 4HF1A 1YOVB 4AIDA 3W2EA 5M5XJ 3P7NA 3QWLA 3N4MA 3GQAA 5HLHA 3BG7A 1OR7C 1XGOA 2L9RA 2OTLI 4B4DA 3I55B 1ACIA 5ILVA 1ZAOA 1VTNC 1FYKA 4YZAA 4PK4A 2H09A 2EV5A 1SMTA 2EK5A 3QE2A 2J5PA 1B9MA 5ICCA 3GFIA 2VBUA 3AVTA 2CU7A 2OCEA 2V9PA 2E34A 2GOXB 4W8RA 1S6LA 2OQGA 4ZH4F 3C1DA 2D74A 4A6EA 1QQIA 5HKKA 3VYUB 3ZBTA 3IH2A 2ELHA 2JA8J 2LKSA 4EW9A 3HKZN 2XC7A 2YWFA 2XROA 2B63J 2KMUA 4Y33A 3GZNB 4IO9F 1ZR2A 1KK1A 4BJTA 5L3BA 1Z6TA 1KK3A 1IRXA 3PIPF 1J9ZA 3PETA 2BXYA 2HDDA 1OFEA 2O3FA 2QKMB 3RJPA 2NSPA 3R0AA 2RQQA 4NC6A 2M45A 2NVUB 2XZOA 3J7AO 1VQ9I 2HDWA 2HQRA 2GXAA 1ZYRF 3ECHA 3BOQA 3J81K 2DMTA 3W6VA 1MMGA 1IDKA 1RKWA 2XAJA 2DJIA 3GWZA 5CVRA 5GTHC 3OOPA 5FROA 3I55I 3ZOBA 2OC6A 1IA5A 2ISZA 2FQ4A 1VQKB 3KRGA 5F08A 3JTGA 5M3MJ 2VT3A 4BDYA 4AVPA 2K5CA 2DMUA 4QPOA 4IOCF 3PUNA 2DEUA 3BJOA 3U21A 4B3XA 3H94A 4IX7A 5DV5A 2IGMA 1YS7A 4URRA 1JTXA 1TYUA 1AU7A 3WG9A 3GX4X 1Z6RA 3BCBA 4NQWA 4BQQA 3TO7A 1IRGA 5K7ZA 2RC6A 1RUOA 1MH4A 4K1XA 3AG3H 1JT0A 2J7KA 1ZM2A 1WJEA 3DDYA 1V5VA 1RC9A 3QPTA 4B43A 2OU2A 4GO1A 9ANTA 2B7EA 3K7AJ 2R92J 2XB5A 3FM3A 4L0ZB 3JSPA 4ENMA 3DLAA 3GTQJ 1F60A 1D3YA 2CUJA 3A0BC 1UAAA 2OUMA 3ROUA 1NK2P 5GAHJ 4RGXA 1PJ7A 4AC9A 4DK0A 3CCLB 2OBPA 1P92A 2VC0A 2VXDA 3CTAA 4A3KJ 2E2IJ 1VQ7B 3LFKA 2MLKA 2F5DA 4Z4RA 3CCVB 2VKHA 2M8EA 4YEJA 2K4BA 3CMMA 4G6DA 5KCMA 3WTWC 3GXOA 2KDZA 4EGZA 2X48A 4EJTA 4Z4ZA 1YW8A 3AG2H 4IVNA 2R5YA 4ZCMA 1TNSA 3BY6A 4DYCA 3WU1B 1WJDA 2NZMA 3GO5A 4RD4A 1QVFB 3OWTA 2LRDA 4Y3OA 3LNQA 1LEBA 2V1UA 1VQ9B 3ZMVA 1BX1A 2COBA 5HLTA 3S8PA 1OGJA 2QKLB 4XL9A 1BN8A 2DA5A 4WXDA 3WODF 3CMYA 4X6AJ 3OJXA 3R0JA 2EZHA 4P96A 4EQQA 2QY1A 2L01A 2MC3A 5IYRA 1ITYA 1B8IA 3QFSA 5C4JJ 4XKBA 3OYCA 1WOPA 1V5EA 2EV0A 1R58A 1YX5A 2VASA 1F20A 1A31A 4TT3A 1FIPA 4UHTA 1MABA 5A2QZ 4HSTA 2DOAA 4B47A 3SHFA 3OPOA 1N8RD 1LM1A 3EYYA 2DODA 4I0AA 1K61A 2PLYA 3KZIC 1E3HA 3TMOA 1BR1A 5TGTA 3ZRGA 3F8FA 2DA4A 4UVBA 1O3RA 2CGPA 2JJ1A 2QA4B 1IRFA 4IRGA 2BY1A 1YO5C 2JA7J 1IB0A 1OYIA 4A5NA 1YI2I 3PUFA 1H0MA 1W7PA 2FMLA 3ASQA 1Z1DA 1E3XA 3GEZA 4DNRB 3I5UA 3DQVC 2LY1A 3M7GA 2LKXA 3H09A 2K4JA 3PA1A 3AKZA 2QWWA 4G6IA 3DTIA 2EWEA 1KQ9A 2KJBA 2LF7A 3JAMZ 3N6ZA 1QA1A 5EZGA 4EGYA 3RSNA 4Z4UA 5GPCA 1MRZA 4RD3A 3I4PA 3J81k 2NNYA 4BGDA 2QA4I 3NAWA 1WU8A 3WGGA 2LP0A 3W5VA 1REPC 4BQAA 4P6VF 4LLNA 2EINH 4ZTJA 3VMWA 1BOAA 1OYWA 4FETA 1MSEC 4IJAA 2K3PA 2XAUA 3ONUA 2ZXJA 2WADA 4N4OB 5E3MA 2RNGA 4LIVA 3DP7A 3BC8A 1E43A 1ZUNB 5A8AA 2VNJA 2QMUA 2KIMA 4M73A 1X0CA 3BZ6A 1LDJA 3WE2A 4A3LJ 4V2GA 1OB0A 3L9FA 1WJAA 5F6FA 2YX7A 1PDNC 3S3NA 1N25A 5H20A 5A88A 3GUDA 1DQUA 2JVHA 4RDJA 3EQOA 3CDIA 1EA0A 4OINF 2VPLA 3CF5F 4IL6C 3RPUA 3L2VA 1XC5A 3W2VA 2ZBUA 4X1EA 1NTCA 4XIDA 2H6CA 2K02A 4L0YB 2QGGA 3P4GA 1FBSA 1P6RA 2BEOA 3FXUA 2FX0A 5L3DA 4OPOA 3VSUA 5FO1A 1W0JA 3I64A 2XNJA 1K7AA 2XEXA 2DPUA 3MVPA 3JTHA 1DDNA 2DI3A 2VKDA 3H3UA 2GJRA 1B23P 4S04A 4KIBA 3LAPA 3PSIA 3IAS2 1LFUP 1OMIA 2A6EF 2ZMEC 5IYDJ 3OYNA 3T51B 3OZUA 3ABUA 5LD2C 5A89A 2R7DA 1HSJA 4HLYA 4A2UA 1ORKA 1WJCA 1MBGA 3ZQLA 3GF2A 2DDBA 2IAIA 1GAWA 3B4NA 1YITI 1M90D 4UAJA 4UB8C 2VZLA 3GBGA 5IK2A 3T56B 3ZPNA 3RPUD 4TMZA 2Y2ZA 2QTLA 2JA2A 1RZ4A 2LG4A 2BM0A 3OKXA 4M6VA 4CHUA 1FTTA 1J75A 3WQZA 3KYLA 3LQRA 3WHCA 5DUIA 1Z7LA 5B1AH 3BNWA 1XD7A 2JQ7A 4M9SA 3GTGJ 1JI8A 5CVVA 2QZ8A 4HNUA 2HVSA 1QRBA 3VPRA 5GTIC 1ONVA 3CO7C 3L00A 2C6YA 3OSGA 1JJ6C 2BPOA 2QQ8A 2FX3A 3RIQA 3GVKA 2JPCA 4CYDA 3LVBA 2MD0A 4FN5A 1VBLA 1D0XA 1BL0A 5DDGA 3FKSA 3JQPA 3GTMJ 2VONA 2E35A 5CDFA 1UCRA 1RUNA 4N9IA 1TBXA 1BJKA 3OP1A 2E5ZA 1XCBA 4OAYA 1USSA 1YRNB 1W9XA 4E7HA 2AXTC 1YJWB 3FHNA 2R7WA 5TV2A 5EG0B 2FOWA 2I8DA 1BHEA 1TWCJ 4P1WA 2B7CA 2XTXA 4A0YA 1YLOA 4Q5SF 1S7OA 5FLMJ 2GWRA 4M3DA 5K1YA 1YIOA 2M30A 4Y13A 1ZRCA 1OGIA 1QH0A 4ASUA 1EKEA 1DPRA 3P9IA 2NAZA 3F21A 4P3IA 5FD6A 3H9QA 5D6EA 5F0CA 3OY9A 4YFOA 4DOZA 2OK8A 1TT5B 3E6DA 2E2HJ 1IN8A 2I10A 3LSHA 1SVLA 3OS1A 1A5JA 5TISC 3F8CA 3MMYB 3O2PE 4MQ9F 1CQXA 2HTJA 1J2XA 2CG4A 1YIJI 5KK1A 3T53B 1ZH5A 1DDIA 3RQIA 4M3EA 4MLOA 3L2CA 3SJZA 1MNDA 4FCYA 2HFHA 1PUEE 2JA5J 3DU5A 1COWA 3CCJB 2FBHA 5GV8A 1XQBA 2RREA 4XICA 3NRVA 2RNJA 3AK5A 2HEOA 5FRNA 2VNKA 5F04A 3OR1C 4HAMA 3TQNA 4BKXA 1VQ8B 4ON0A 1BN5A 4MGRA 2ZNYA 4CGZA 2BHZA 3FMQA 5E79C 4RDLA 3GMEA 5FA6A 4MYUA 4K2EA 2VKEA 1HF0A 4Y9UA 4I6ZA 1VLYA 4IHXA 3FX3A 1WJFA 3CDHA 4DZPA 2ZSHB 3KP6A 1I6XA 2ACJA 3JRDA 2JPBA 1UD4A 4Z4TA 1ZGWA 1LLWA 3KZZA 2DMPA 1EH7A 2HI3A 3ASTA 4X7FA 2F48A 4MO7A 1V0FA 5F0HA 4M4SA 4UXNA 1QRCA 4N4NB 3ML6A 4U0VA 5JVGF 2AS5F 3CUQA 1EFTA 5C4XJ 5FO0A 1R22A 1YX3A 1X1PA 1LFBA 4JX6A 3TO6A 2L4MA 2R5ZB 3VYRB 5E1XA 3H0DA 1Y1WJ 1X1CA 5ED4A 1M1EB 2PYGA 3OYJA 1V55H 4RB2C 1Z7UA 1NHCA 3EUKL 3WGHA 2D1VA 3TGNA 4AIHA 1B1BA 5J40A 2XSDC 1BW6A 1MMDA 5DNSA 3OS0A 4CYCA 2IPQX 2NS0A 5IOZA 2OTJI 1BLIA 4YZQA 5L3EA 3GLLA 3BCDA 3G3ZA 4I76A 2VNHA 3K1MA 2GBYA 3CCMI 1SFOJ 1EH6A 2BE5F 3Q5FA 2V6CA 4KKTA 3KEQA 4YAFA 2F5FA 3ZMDA 2D2WA 3O8HA 4J0QA 4MR0A 2XF5A 3RKYA 3F6VA 4HF2A 2DN0A 2V9KA 4WZKA 2QCOA 1QG0A 3HYIA 4Z6YA 2Q1ZB 2WB1A 3WTUC 1VQ5I 5FRMA 1LVAA 4CO8A 3ZN1A 3HRMA 2ISYA 1E0EA 4IPAA 4C3IJ 1GT0C 3CUQC 3SJPA 3CCEB 1HQCA 2BM6A 1NK3P 4NC7A 5EF6A 2ZTNA 1KA8A 4UNOA 2A6HF 1U78A 3M07A 3SY2A 3GVAA 1D8KA 1PXZA 1ZQ3P 2DQRA 3Q3SA 2BYVE 1FYMA 1SM4A 4MQVA 5J4VA 4ITVA 3ZQHA 4B3FX 3EQLF 1P4WA 1WH5A 3F0CA 4LC0A 3ZZUA 2KKOA 1TWFJ 3D5RC 3LJYA 1U5TB 3DF8A 1NG6A 4L18B 2F1LA 3FXLA 1NHAA 5IP9J 3ZMZA 2CNDA 4IW3B 2EWNA 2HCJB 4QFMA 1O8JA 4ZGNB 4F3QA 4OM9A 2OBSA 5IOYA 5DTDA 5K5QA 5FKMA 4XRMA 3KIOA 4KKSA 4BYYA 4BXUA 2XRLA 3TW6A 2UZKA 4NK6A 2CFXA 5FFXA 4DQ2A 2HPMA 3T8RA 3S93A 3CO6C 1O8LA 4ANJA 3GQ7A 4WZTA 5E8GA 4EJVA 2XT4A 1Z21A 4YC5A 1TQIA 3BR6A 1BW5A 4IXAA 4CCLA 3LO8A 1Z77A 3BG6A 4D5CA 4R79A 3G4SB 4ETSA 1LEAA 2ZSIB 3VSVA 3DBLB 4JX5A 5H6RA 1VQOB 1B9NA 4YDTA 1UD2A 2V31A 2CH0A 1FZPB 3WNCA 1NBMA 3QRFF 2GIZA 4BH9A 5FJ8J 1JGGA 4NHJA 5JLXA 4HDUA 2EPFA 4GYIA 2KRFA 1O8HA 1H42A 3CCLI 2WTEA 1YX2A 2DT5A 4IF4A 1XMAA 1CF7B 3RY8A 2B9SA 4R8HA 5CVUA 3OZVA 4ZDPA 5F4OA 3Q0WA 5J6XA 3PNTA 4W8TA 3WE3A 4WCGA 1ZM4A 3SDGA 1I27A 2XDVA 2BF4A 3QFTA 4PGHA 2XF6A 3GQBA 2ZXHA 3DPUA 4P26A 3S15J 3JRCA 4FE4A 3WNDA 5L3FA 1BX0A 1Y8QB 2DCUA 1I50J 2BY2A 2LREA 2EFGA 4NCNA 1HG8A 2NSTA 2XPVA 2E5NA 1GLNA 1H85A 2FOKA 4LK1F 2HS5A 1FNDA 3PUMA 1D5VA 4G7HF 2BM7A 2LF8A 3ERMA 5IY5H 1E62A 2X8KA 3K1PA 1JUMA 3E1YE 1I18A 1GO2A 2DA6A 2ELKA 3M8EA 4PC3A 2XZLA 1MDMA 1E3ZA 2UWMA 4A3CJ 2X51A 1UELB 2J5OA 2N8GA 1H8EA 1TWAJ 1I1SA 1JTAA 4OMZA 2UUZA 2E1NA 3MQ0A 4XOPA 3B8YA 3HZJA 4HLXA 4KN7X 4YFNF 1FSEA 3JRGA 2VBKA 3G71B 4QSHA 5IYBJ 5JHFA 5D4RA 1BJZA 4BDZA 2V4DA 2WV1A 3B78A 2W85A 4HNTA 1SVMA 1TUIA 1JRGA 4N3GA 1UD5A 1OPCA 3AFHA 2NS8A 3G1OA 1DP7P 3H5AA 3LOCA 1S7AA 2PIAA 1IXCA 2Y75A 1W7PD 2CUFA 1MD0A 3NWSA 1HKTA 2WAFA 3BT9A 2EFPA 1GV2A 4IHYA 1UD6A 3WXMA 2KISA 5LBQA 3SZEA 3BLYA 4UVCA 4A3FJ 1BMFA 2TDXA 2R5ZA 1WJ5A 5E18F 2CW5A 4RB3C 4GFBA 2EIJH 1GXPA 4Y52J 2OQRA 1ULYA 5B6IA 4O6JA 2Q2EA 4UUSA 5IYNA 1PJRA 2LYCA 2PBIA 4X07A 2X3UA 4BE2A 1LE8B 3MZ8A 1IHMA 1VNDA 3MHPA 4CICA 4TMWA 4IZZA 4ASNA 4AVZA 1U3EM 2P0WA 3GFLA 1EP1B 1RI7A 3Q0UA 3RIRA 2VJ5A 2QYOA 2OTLB 1S4MA 4XSZF 5ILUA 4XK4A 2ECBA 2OTJB 5CVIA 5D5VB 1SAUA 4C2TA 2ESNA 1QGYA 3E20A 1IJFA 2JK3A 3LMWA 1I1GA 1XX5A 2K9NA 3RQ4A 4ESBA 1LE8A 2CW0F 3SZGA 5HZBA 2L5QA 5M5WJ 4YIFA 5CVJA 3A1PA 4A3MJ 3W2AA 3JX8A 3GW2A 2R3SA 4XSXF 3ZCOA 4HNVA 2JRMA 4V02C 2G7HA 2PN6A 4CZCA 1W7PB 4KYWA 3HOSA 2RGVA 3S1QJ 1RQPA 1NG7A 4FX0A 4O3MA 3GVLA 1Y39A 1TYVA 2H8WA 4FHTA 1BM9A 5DCMA 3JRHA 1T8IA 2ADUA 3QU3A 3QOPA 1S9HA 4H9GA 3FXMA 3IWFA 1OISA 4OPVA 4P25A 2WAEA 4MNUA 1IN4A 1PYVA 3WYAA 4YG2F 1L1IA 2LBFA 4ZJZA 1RKTA 3ULQB 3ZSCA 2V7FA 1LDDA 4ABZA 3HSEA 2GLOA 5D5XB 4MTDA 2FVGA 4QIWN 2MABA 2V26A 1FDRA 1I3QJ 3J7ZI 2XKPA 3QYBA 1G2HA 2VQLA 1J09A 5DUKA
chains in the Genus database with same CATH topology
3OWTA 2LRDA 4Y3OA 3SUCA 4IQ4A 4E7SA 4HWVA 4OJPA 4XM3A 1MMAA 3LSIA 4MXNA 3HG9A 4BE0A 3LL7A 5HLTA 2F43A 2NOJB 3S8PA 2QKLB 2VXZA 3DU6A 4XL9A 3OYMA 1BN8A 3GRHA 1U0JA 2IGKA 3CJQB 3MKYB 1DGRM 2L9SA 2VQHA 2QY1A 4HEA2 2M3AA 1H80A 1W36D 4XKBA 3OYCA 1V5EA 3DKYA 4BJ6C 3I3LA 1YX5A 1R6RA 2VASA 4RMNA 4XN3A 2M4KA 2IGNA 3W3CA 4TT3A 2VJJA 3A2KA 4XMYA 1MABA 2WJVA 4OZYA 2W7NA 2GJKA 2VBMA 4HSTA 2DOAA 4B47A 3OPOA 2KPMA 4B3GA 2OV7A 3TMOA 1BR1A 5TGTA 3ZRGA 4YRVA 4G7XA 3VR6A 3VYSB 2JIZA 2HVQA 4HIZA 2NTQA 2JJ1A 5C1EA 3AL0B 4YZ0A 4DBRA 1OHHA 2KRHA 3KX2A 2X1DA 4PJLA 2WPDA 4CSWA 2R7VA 4DK1A 4KISA 1E3XA 1VJSA 4DNRB 2PJRB 4PSWA 3DQVC 2LY1A 3PUBA 3V42A 3C2GA 2O04A 4OAZA 2VLAA 2JUGA 3AKZA 4G6IA 1Y6IA 2HU9A 3DTIA 2EWEA 4BUPA 1SKYB 3KEWA 4W8QA 2IGOA 3TL4X 1WTHD 2O5RA 3RSNA 4CCKA 2BSPA 3NWTA 3C2HA 3A3BA 2JJ2A 4Z1MA 4BGDA 3OYAA 3FBIB 3K4JA 2WAQA 2ZZEA 2Z16A 3VSLA 3ZXSA 4ZTJA 1EE6A 1O88A 4FETA 3VMWA 3WWGA 2K3PA 2M0MA 3SYTA 2WJYA 2XAUA 5CQEA 3BH4A 4N4OB 2HQAA 2WADA 4DJAA 3BC9A 2RNGA 4LIVA 1E43A 3BC8A 2Z8GA 3HL2A 3FBNB 3CZ6A 2CV1A 3F9KA 1X0CA 2GK6A 4AU7A 1N78A 1OB0A 1WJAA 3J7AY 1ERDA 1HVXA 3S3NA 2KQRA 1DQUA 2JVHA 2LY2A 2Q2EB 3HKZA 3EQOA 3GQ8A 2VPLA 1V5GA 3OOUA 4RM3A 1O8DA 2KZVA 3H5RA 3L2VA 4CH7A 2WY7Q 3W2VA 2PYHA 2QXZA 4F91B 3OYKA 4ZDOA 4U49A 1YE9A 2K9LA 3G2BA 1OOCA 3VSUA 2ODLA 1W0JA 1O8GA 3PL8A 1RMGA 1Z3YA 4CCJA 4IKFA 4U7BA 2GJRA 2VKDA 3D5SC 2UVEA 3OIPA 4XLEA 2O1DA 2W4SA 3PSIA 4XQFA 3IAS2 3LSMA 1OFMA 3OYNA 4KT6A 3T51B 4YZXA 1I8DA 5LD2C 4E7KA 2IQ7A 3M1CA 4Z05A 1WJCA 2W1OA 4BE1A 3H9GA 1T95A 2R7SA 3SEZA 1LFPA 3A1YA 4HG2A 4XLCA 3B4NA 4AYBA 2X6WA 4DGWB 3DEEA 4D1QA 2R7TA 3GBGA 2R7RA 2XNDA 5IK2A 3T56B 3OYBA 3ZPNA 3RPUD 3OYEA 1D0ZA 3EQNA 1WFXA 2JA2A 3EUHC 2LG4A 3K6GA 3M8JA 3D5LA 2PMZA 3ZGKA 1PKVA 3CF2A 3WQZA 3KYLA 4PJMA 3FY3A 2IXSA 3HAGA 1Z7LA 4TSFA 1H8HA 2VJIA 3KEYA 2VL8A 1JI8A 2R9VA 2O0WA 2HVSA 2M7AA 2M4GA 4HNUA 1PLUA 2VBEA 3GVJA 3GVKA 4XR6A 3L2UA 1BR2A 3GQ9A 4C2LA 2VQCA 2MD0A 4FASD 1VBLA 1D0XA 2XZPA 2Z6BD 1E1RA 2M5SA 3K4CA 3JURA 3FKSA 4II3A 3QODA 4Z03A 2W6JA 4PMHA 2INUA 1HZEA 5HNHA 4E0FA 2NTPA 2ELJA 3LFUA 3HPGA 4LG3A 5CDFA 2ZFUA 4EATA 1D1BA 3CP2A 1OGMX 2E5ZA 4KJZA 3SEQA 4E6KG 2MYSA 2CFOA 4OAYA 1E1QA 2L7KA 4E7HA 1W9XA 5AMVA 1EA3A 1SFKA 2ZXIA 3OIQA 4E7LA 3FHNA 2R7WA 4C2UA 2I8DA 4XLAA 1BHEA 2CS3A 4JQFA 3DPLC 4P1WA 2V7QA 4XD7A 1WP6A 2X6XA 2CW8A 3BCFA 2KRCA 2V4JC 3OEHA 2KDOA 4ASUA 5C1CA 1DGWY 1IDJA 4OJOA 3LNNA 1QHGA 1MW7A 1UG0A 3H9QA 3UNGC 4E7JA 2IS1A 2XOKA 3OY9A 4DOZA 4XKCA 3A35A 3LMMA 2CV0A 3LSHA 4NNJA 3OS1A 1UD3A 1D1AA 3MMYB 2D3LA 1T5EA 3E1SA 3A3GA 1VF7A 3T53B 1MMNA 2BOLA 4II2A 3HOTA 2R7UA 4OZZA 1O8KA 4MLOA 2W82A 4F92B 4J00A 4GRIA 1MNDA 2Z2SB 4DIQA 3H5NA 2CUZA 2X1CA 3DU5A 4XN0A 4XOTA 3MKWB 1COWA 4KITB 2O17A 4ZDLA 2RREA 2XSJC 2W6IA 4PUSA 1AIRA 2IS2A 3VSTA 2HPIA 2IS6A 5FRNA 4I84A 3OR1C 2DT6A 4BU2A 1X4PA 2NT6A 4E7ZA 2PJRA 3S3OA 3RCOA 3OW7A 4NUBA 3HUGB 1PE9A 4JMQA 3OR2C 2Z1DA 3ZPPA 1FMWA 1OLTA 1VLYA 1WJFA 2UV1A 2ZSHB 3I9V2 1UD4A 3OS2A 1P9QC 1Z3XA 1X1DA 3CESA 4DBQA 1X19A 1V0FA 3DTEA 4XKWA 1NRKA 1LDKB 3K4MA 1W36C 2LH9A 3SDBA 2D3NA 4N4NB 3NE5B 3DWLE 2AQFA 4NK8A 1YX3A 2DIEA 3K70C 3LSKA 2W00A 1GQ8A 3HPHA 3VYRB 3ZQQA 3H0DA 2PECA 3VSKA 1KTWA 1X1CA 2PYGA 3OYJA 5LFAA 1NHCA 3EUKL 3IUOA 2WA0A 3OOCA 1LKXA 1MMDA 2R7XA 1BOBA 4BL0B 3OS0A 2QX3A 1QJVA 2F5VA 1BLIA 4YZQA 1TT0A 2F6CA 3W2WA 1X4OA 3BCDA 1RWRA 3L2WA 4W8SA 4BQNA 2VB6A 2X1EA 4LIUA 3K70D 1LVKA 4KKTA 4BEHB 1N75A 2M7BA 4MR0A 2XF5A 2V9KA 2Q1ZB 2WB1A 3QYFA 4F52A 4QPQA 5FRMA 3B90A 4HSRA 3OAAA 1O8EA 2L2OA 1E0EA 2A5WA 1Y56A 3MD2A 3G05A 4NC7A 2ZTNA 2HNHA 2ZZGA 3OYLA 2E60A 3DPTA 4OJLA 3VDXA 1N77A 4OJ6A 2E1MB 4BACA 1PXZA 1DBGA 4Z06A 2KHMA 4ITVA 1UD8A 4B3FX 1XG2A 3OYDA 4NQWB 1D0YA 3OL4A 4RM2A 4BQOA 3D5RC 2IS4A 5FL7A 2ZZFA 1NG6A 1IB4A 4XKVA 2CMPA 3UR3C 1VZ0A 2KLOA 4BS9A 1K28D 4BXFA 1OGOX 3K10A 1X1AA 1O8JA 3DKXA 2INVA 2BVMA 3L2QA 2NT9A 5HOOA 2O0VA 4F3QA 3ZIAA 1BPLA 4GQNA 4ZYAA 1WPCA 4XLFA 4KKSA 4P22A 3K4BA 3IAM2 4NK6A 3K4NA 3TBIA 4E4HA 4RLQA 2HPMA 4L8JA 2X85A 3S93A 4CUGA 2JSPA 3OL3A 1O8LA 2L9NA 4ANJA 4G7WA 3GQ7A 3VYTB 4OWRB 1Z21A 4PSXA 3HXLA 2A6TA 2DCEA 4PFOA 1KZLA 3OYFA 2CV2A 4CCLA 1HA8A 1QU3A 3CP8A 3OFNA 1QCXA 4C30A 4R79A 3BG6A 2Y0SA 5HVQC 4KKUA 2CK3A 5DN6A 4XONA 2ZSIB 3OYGA 3VSVA 2F1MA 2HZDA 3FPPA 1FMVA 1UD2A 2V31A 2CH0A 1KONA 2FUG2 1G59A 1NBMA 1E79A 2UVFA 2R4GA 4XORA 4TKOB 3OYHA 2ZZQA 1KCDA 1T0FC 4F93B 1EFRA 3BCAA 1O8HA 1W0KA 2MC4A 4P5OA 2GOMA 1MNEA 4H4KC 1O8FA 1WJBA 3K4LA 2F4IA 2NTBA 4ZDPA 3PNYA 4LITA 4HPQA 3FKJA 2BVLA 3PNTA 1K6YA 4JOMA 4RLFA 4B44A 1FX0A 4W8TA 1V5FA 2XDVA 3H9JA 1AA7A 3AL0C 3OE7A 2XF6A 3GQBA 2ZXHA 3DPUA 4PJNA 2JDIA 2ZTGA 1O8MA 3CJRB 4PFPA 1RU4A 4CA0A 2KL4A 3H35A 2LREA 5CPRB 1HG8A 2NSTA 1K5CA 3N05A 5HNFA 2E5NA 1GLNA 2JVGA 5KNLA 4DNTB 3FDYA 2DT7B 1DP3A 3JU4A 2LBFB 1KMHA 2X8KA 5CQGA 1I18A 2R7OA 3DTKA 3PSFA 2KVOA 3GQAA 3L2RA 2XZLA 1E3ZA 2UWMA 4YELA 3BG7A 1OR7C 2BW3A 1UELB 2X51A 4BJ5C 1H8EA 1JTAA 2DXIA 1QHHD 2UUZA 4YZAA 4XOPA 3T9GA 2WSSA 4PK4A 3B8YA 2VBKA 4BDZA 5JHFA 4HRIA 2V4DA 3IP4B 4W8RA 2GOXB 4HNTA 3ZR8X 3A4CA 3PNVA 4X0GA 1JRGA 5HKKA 3EPZA 3VYUB 3VWBA 3S3MA 1UD5A 3OEEA 3AFHA 4E7IA 4EW9A 3H5AA 1D1CA 4J01A 2XC7A 4XNFA 3NWSA 2WAFA 1UD6A 2KMUA 4Y33A 2BW3B 4BJTA 3BLYA 2QE7A 1IRXA 3K4KA 1BMFA 2VJ4A 1WJ5A 3OYIA 4BEHA 4U87A 4C9YA 4CCOA 2QKMB 1V0EA 2NSPA 2RQQA 3QOEA 1PJRA 2LYCA 2XZOA 3OMYA 4BE2A 2XF7A 2HDWA 4YXWA 2GK7A 2WZPP 3LSGA 4IZZA 1MMGA 1IDKA 2WBMA 2DJIA 2LZJA 1CZFA 2HVRA 1X1BA 3PJRA 2LOOA 4AVZA 4F55A 4Y4RA 2P0WA 3QYEA 5FROA 4OJ5A 2E1MC 2WY8Q 1TZLA 3S32A 4B48A 2OC6A 2VJ5A 2VIXA 4CCMA 1IA5A 3KRGA 1G8XA 1BR4A 1SAUA 4C2TA 1ZELA 2V1NA 4BDYA 2K5CA 1KCCA 4QPOA 3MKZA 1WMRA 3U21A 4B3XA 3LMWA 3H94A 4IX7A 2IGMA 3RQ4A 4URRA 3SZGA 2L5QA 2CW7A 3PFYA 3BCBA 4BQQA 1DBOA 4U4BA 3E0JB 3W2AA 2V6EA 4ZC3A 3ZCOA 1WJEA 2VQGA 3DDYA 4CZCA 3HOSA 3HC7A 3ONQA 1NG7A 4B43A 4NC8A 4ZTFA 2X6YA 4IQJA 3GVLA 2K9MA 3DLAA 2CUJA 1UAAA 1OFLA 2OUMA 2KP6A 4G6TB 4DK0A 2NZMA 5CKTA 3RTRA 1S9HA 2MFZA 4UZUA 2XGJA 2VXDA 3EUAA 4XLHA 1O8IA 2VKHA 2WAEA 4YEJA 1PYVA 2LC2A 5KCMA 3CMMA 4PJJA 2GJPA 2LBFA 4D9JA 4ZJZA 2HLDA 2X53S 2R7QA 2V7FA 4FXUA 3ZSCA 5KHDA 4CCNA 2MABA 3UW0A 2AQEA 2V26A 2X3HA 3QYBA 1WJDA 3VMVA 2VQLA 1J09A 2E1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU4 A;  3SUC A;  4HWV A;  2PEC A;  4OJP A;  4XM3 A;  4MXN A;  1KTW A;  2NST A;  1HG8 A;  2PYG A;  1K5C A;  4XL9 A;  1BN8 A;  3GRH A;  1NHC A;  3FY3 A;  2QY1 A;  2VJI A;  2QX3 A;  2O0W A;  1H80 A;  1QJV A;  4YZQ A;  3GQA A;  1PLU A;  4YEL A;  1RWR A;  2VBE A;  4W8S A;  4XN3 A;  1JTA A;  4XR6 A;  3GQ9 A;  4YZA A;  3T9G A;  2VJJ A;  4XOP A;  4C2L A;  4XMY A;  3B8Y A;  4OZY A;  1VBL A;  2VBM A;  2VBK A;  4MR0 A;  3JUR A;  4Z03 A;  4W8R A;  4PMH A;  2INU A;  1JRG A;  3B90 A;  2NTP A;  1O8E A;  2NTQ A;  5C1E A;  4EW9 A;  4YZ0 A;  1OGM X;  4XNF A;  5AMV A;  4OJL A;  4OJ6 A;  1PXZ A;  4XLA A;  1BHE A;  1DBG A;  2O04 A;  2X6X A;  4Z06 A;  1XG2 A;  2NSP A;  2EWE A;  4W8Q A;  5C1C A;  1IDJ A;  4OJO A;  2BSP A;  1IB4 A;  4XKV A;  1IDK A;  1OGO X;  1CZF A;  2NT9 A;  1O8J A;  2INV A;  4AVZ A;  4OJ5 A;  2O0V A;  1IA5 A;  1O88 A;  1EE6 A;  3KRG A;  4XLF A;  3VMW A;  3WWG A;  4NK6 A;  2Z8G A;  4OZZ A;  2X85 A;  1O8K A;  1KCC A;  1WMR A;  1X0C A;  1O8L A;  3LMW A;  3GQ7 A;  4XN0 A;  4XOT A;  4URR A;  2O17 A;  1DBO A;  1QCX A;  3EQO A;  1AIR A;  4U4B A;  3GQ8 A;  3VST A;  1O8D A;  4I84 A;  4XON A;  2QXZ A;  2PYH A;  3VSV A;  2NT6 A;  4U49 A;  2UVF A;  1PE9 A;  4XOR A;  2X6Y A;  1OOC A;  3VSU A;  3ZPP A;  1KCD A;  2ODL A;  1O8G A;  1RMG A;  1OFL A;  1O8H A;  2UVE A;  4XLE A;  2O1D A;  1O8F A;  4XQF A;  4XLH A;  1O8I A;  1OFM A;  2NTB A;  4YEJ A;  4YZX A;  3ZSC A;  4XKW A;  2IQ7 A;  4Z05 A;  4W8T A;  4NK8 A;  3UW0 A;  4XLC A;  3B4N A;  2X6W A;  2X3H A;  3VMV A;  2NZM A;  1GQ8 A;  1O8M A;  3EQN A; 
#chains in the Genus database with same CATH topology
 5ILS A;  1O7F A;  4XLP F;  1AIP A;  3LSI A;  1HDP A;  3HG9 A;  3I4N J;  4FX4 A;  1VQ5 B;  3LL7 A;  1DU0 A;  1QFZ A;  2Z33 A;  3KFW X;  3OYM A;  2M2E A;  4WF2 A;  1D2E A;  1GVH A;  3PQK A;  4Z4Y A;  2M3A A;  2VBZ A;  3W2I A;  1JGS A;  3JR9 A;  4L5E A;  4BJ6 C;  1SEU A;  1R6R A;  2XNC A;  4RM0 A;  4RMN A;  2M4K A;  2IGN A;  3G1L A;  3W3C A;  1OCT C;  2PG4 A;  2M0C A;  2VJJ A;  4XMY A;  3A2K A;  2W7N A;  1A6Q A;  2GJK A;  4F7Z A;  2KPM A;  2QSG X;  1N07 A;  1ENH A;  4B3G A;  5IT3 A;  4PC6 A;  2BV6 A;  4IOA F;  2IBD A;  3G6E B;  2CUE A;  1TLL A;  2QQ9 A;  4G7X A;  2H94 A;  1OB5 A;  3KL9 A;  4HIZ A;  1F1Z A;  2NTQ A;  4YZ0 A;  4DBR A;  2KRH A;  3KX2 A;  1WPK A;  3V7A A;  4AD9 A;  4PJL A;  5EGO A;  4PGG A;  3BY2 A;  1QGZ A;  1VJS A;  2PJR B;  1VQ4 B;  3GSI A;  3L1P A;  3IKV A;  3PO3 J;  3I1F A;  4NBS A;  2QQA A;  1JB9 A;  2JUG A;  1B59 A;  4ACB A;  3Q38 A;  1O57 A;  3Q6R A;  1IV8 A;  4W8Q A;  1R4N B;  3KEW A;  4G1V A;  1RIO H;  3TL4 X;  4BNC A;  4CCK A;  1O3Q A;  2BSP A;  2DYI A;  1HKS A;  3ZZ0 A;  3FXJ A;  2YU9 J;  3CLQ A;  2YSR A;  1I3A A;  1HDD C;  3E3V A;  3U2R A;  4RCZ A;  4ZGQ B;  2JUC A;  2O6W A;  2ZZE A;  4RAY A;  3VSL A;  4ZYG A;  4M9Z A;  1AHD P;  3QPL A;  3ZMT A;  4PC2 A;  2WJY A;  3HOX J;  3S1R J;  3HOV J;  3WWG A;  4Q4Z F;  2MH9 A;  3BTL A;  5CQE A;  2QEN A;  2JWT A;  2P3M A;  1APL C;  2CV1 A;  3RKX A;  2G0Y A;  1T33 A;  3LA7 A;  2O9L A;  2KFD A;  2Z99 A;  5JR3 A;  4AU7 A;  1GV5 A;  2ZJ2 A;  2FE3 A;  3CW2 A;  2VOP A;  2QDX A;  2PMU A;  2Q2E B;  3HKZ A;  2IVM A;  2LY2 A;  5LEJ A;  4UUS B;  4G5G A;  4P2N A;  2M1B A;  1TTT A;  4RM3 A;  1O8D A;  5ICE A;  1Q86 D;  4M6X A;  3H5R A;  4CH7 A;  2WY7 Q;  4KNY A;  2PYH A;  4AF6 A;  4F91 B;  1BI2 A;  3WTY C;  3OYK A;  3CPX A;  5HDG A;  2GXB A;  3X2Q H;  2FEZ A;  2K9L A;  3G2B A;  4FT8 A;  1D5Y A;  2L7F P;  1T6Z A;  4KUM A;  2QYU A;  1G3S A;  1T56 A;  4M53 A;  4IKF A;  1XN7 A;  3D5S C;  2HZT A;  2O1D A;  1PUF A;  2WYR A;  1WZ2 A;  2OA4 A;  4XQF A;  1YW9 A;  3LSM A;  3ASS A;  1OFM A;  2BN4 A;  1QNT A;  5JMC B;  4XRF A;  1U9O A;  1TVC A;  4TMV A;  3HHH A;  3BZC A;  4DYR A;  2H27 A;  5E1W A;  3E6B A;  1KGS A;  3PQJ A;  4E7K A;  1IW7 F;  5KW9 A;  2ID3 A;  1XPX A;  4BE1 A;  3H9G A;  1T95 A;  3BG3 A;  3SEZ A;  5JLW A;  5D4S A;  1QGA A;  3OZW A;  1BI0 A;  4AYB A;  4DGW B;  3DEE A;  2R7T A;  3VO1 A;  2R7R A;  1R1T A;  1IAW A;  3OYB A;  3EQN A;  1F9N A;  1D0Z A;  2LTP A;  2ZJP F;  2ZL6 A;  3CD6 I;  1DAR A;  1WFX A;  4U9U A;  1IXS B;  3P27 A;  4WWC A;  5GAE J;  4BPR A;  3D5L A;  2PMZ A;  4WXH A;  3IKT A;  4BBS J;  2D9R A;  4H0E A;  3KEO A;  1B6A A;  5DM6 F;  4FE7 A;  2COM A;  3IH3 A;  3QSY A;  4PJM A;  1WOR A;  4GYG A;  3MMP A;  2VJI A;  2DQL A;  3E97 A;  1FNC A;  1EH8 A;  2ZME A;  2K85 A;  3KLN A;  2PLF A;  3R61 A;  3L2U A;  3GVJ A;  1BR2 A;  4C2L A;  1YS6 A;  3MCA A;  2EB7 A;  3DKW A;  1R71 A;  2PE3 A;  4FAS D;  2GPJ A;  2XZP A;  1QUE A;  1E1R A;  2V1X A;  1XGN A;  1UMK A;  3K4C A;  1CF7 A;  3JUR A;  2P4W A;  4Z03 A;  3QOD A;  3B6A A;  3M3Y J;  4PMH A;  3B02 A;  4E0F A;  2KIU A;  3ES9 A;  3LFU A;  3BQZ A;  4RBO A;  1K73 D;  3FIS A;  1XSD A;  2X6O A;  2R6H A;  3ZZT A;  1T2K A;  1VHO A;  4IEJ A;  4KJZ A;  2PX9 A;  1FIA A;  2STW A;  3JAM K;  1EA3 A;  4EVI A;  2VNI A;  2HKX A;  5GV7 A;  1POG A;  3DPL C;  2XTY A;  1NDH A;  2V7Q A;  3D0S A;  1I7P A;  1WP6 A;  2LD5 A;  3M8F A;  5TJJ A;  3CCQ I;  3OEH A;  4LBY A;  1DGW Y;  1G6N A;  2LY9 A;  3LNN A;  2QF7 A;  2IS1 A;  2C5H A;  2VOD A;  5AN9 A;  2F3L A;  2CBX A;  1OCZ H;  2AHQ A;  1VQ8 I;  4HE6 A;  4G9Y A;  2UVE A;  1YLF A;  4G8X A;  4XKC A;  4D0P A;  5ICF A;  4NNJ A;  1R5H A;  1UD3 A;  3ISX A;  4PAB A;  1B2R A;  1T5E A;  4M9X A;  3QPS A;  1ZG5 A;  1R9T J;  4LB5 A;  1VLO A;  4M3G A;  2BOL A;  4II2 A;  3QP5 A;  4RA2 A;  4J00 A;  4EMS A;  1WSR A;  4QVA A;  2EZI A;  3KLO A;  3FIW A;  3H5N A;  4Q47 A;  2LMD A;  4XN0 A;  3ZQI A;  1W4M A;  4XOT A;  2JN6 A;  3ABL H;  1HW5 A;  4KIT B;  2OBT A;  4ZDL A;  4AC0 A;  5C44 J;  1Z91 A;  2HQ5 A;  4D7N A;  1KZH A;  1AIR A;  2IS2 A;  2IA2 A;  1XB4 A;  2ZKZ A;  1Y0U A;  5B3S H;  2DER A;  5LHG A;  2PJR A;  1MH3 A;  2HTS A;  3HBL A;  2F5E A;  3RCO A;  1UB9 A;  4UZF A;  3BR3 A;  1E17 A;  1TTY A;  4EH1 A;  1ZTR A;  3OR2 C;  4G7O F;  1PJ5 A;  1U2W A;  3V8L A;  1MZB A;  4UV9 A;  1BJA A;  3BPX A;  4A3D J;  3PEN A;  2ZL7 A;  2WV0 A;  4C3H J;  3S2D J;  2JMW A;  1FRQ A;  3DEW A;  1S0U A;  3CMA B;  1SFX A;  3OS2 A;  1P9Q C;  1Z3X A;  1X1D A;  1ZR4 A;  4A69 C;  1E2X A;  5J47 A;  4DBQ A;  3V7C A;  1XGM A;  4BAY A;  1LDK B;  3CCY A;  3K4M A;  3SZT A;  3ASO H;  2WWY A;  4RGR A;  4HDV A;  3H36 A;  1KQ0 A;  2MBF A;  1HKQ A;  1VQ4 I;  3WY9 A;  1LPQ A;  1ETK A;  4MHG A;  3WTZ A;  1FJL A;  1JKO C;  3DU1 X;  3C2B A;  1S8N A;  2E2J J;  3K70 C;  3LSK A;  5IT9 Z;  1FBU A;  5D5W B;  3ZQQ A;  1K4T A;  2PEC A;  3W5U A;  3CD6 B;  5LHH A;  1T6X A;  4PJ0 C;  3S1N J;  5LFA A;  2EBI A;  2RKH A;  2WB1 N;  3C18 A;  1BOB A;  4BL0 B;  2QX3 A;  3PSS A;  1YJN B;  2EH3 A;  2V7T A;  2GA2 A;  3KPH A;  1FTZ A;  1JKR C;  3LAJ A;  1FEX A;  4YAU A;  2L9V A;  1RWR A;  1Q82 D;  4W8S A;  2HXO A;  3F6O A;  5THX A;  4IRI A;  3GTL J;  3AAF A;  3K70 D;  2E7W A;  3Q9S A;  5B66 C;  1N75 A;  2M7B A;  4FK8 A;  4YAL A;  3CC7 B;  3JRI A;  4OIP F;  3BH6 B;  3Q39 A;  4A0X A;  3ZP5 A;  4KMU X;  1YTY A;  3ZMS A;  1WKM A;  4F52 A;  2B5O A;  2CQX A;  3B90 A;  5M3F J;  3O3K A;  2L2O A;  2A5W A;  3QFR A;  1KC8 D;  2QUF A;  2R5Y B;  4LJZ F;  3DPT A;  1N77 A;  4BAC A;  2ZJR F;  1JXS A;  2QEX B;  4AYB N;  1RPW A;  2VN2 A;  2F2E A;  4AIJ A;  2CQN A;  4QTR A;  1VQM I;  3OL4 A;  4RM2 A;  3I0T A;  1D1N A;  5FL7 A;  3CCV I;  2ZZF A;  2JSC A;  2YX4 A;  1OKR A;  3BTJ A;  4EV0 A;  1I6H J;  1PJ6 A;  3UR3 C;  1IB4 A;  3K1N A;  1VZ0 A;  3K10 A;  1X1A A;  2K40 A;  3WTT C;  4Q48 A;  2BVM A;  4KT5 C;  3L2Q A;  2NV4 A;  1HF2 A;  3CQZ J;  2GA1 A;  2RAE A;  1VQK I;  2HQN A;  4GQN A;  4ZYA A;  4IHS A;  2CRV A;  1WPC A;  3DFG A;  4Z4S A;  1IGN A;  3GCM A;  3K4N A;  4E4H A;  5KAF C;  3K0L A;  3R60 A;  1G4D A;  3EYI A;  4BY1 J;  4CUG A;  5BSX A;  4I01 A;  1FPQ A;  2JSP A;  1G3T A;  1R49 A;  2IRF G;  4G7W A;  3KYC B;  3VYT B;  4OWR B;  1R4M B;  3HXL A;  2DO7 A;  2YS9 A;  3BTC A;  3VMF A;  3KP2 A;  1Y0Y A;  1IDY A;  4UUT A;  3OFN A;  2DA1 A;  2Y0S A;  5HVQ C;  4P1V A;  4AWX B;  1NJI D;  2A61 A;  1WHU A;  1FMV A;  1K6O A;  3CB4 A;  4YFX F;  2FUG 2;  4OOS A;  2MH2 A;  1KYW A;  2R4G A;  4XOR A;  3VOE A;  3AVV A;  5J1R A;  3OYH A;  2ZZQ A;  3U2Q A;  1T0F C;  1SAX A;  2BX6 A;  2YWH A;  3RKW A;  2WAQ N;  1W0K A;  5HS7 A;  3E5Q A;  4HZF A;  2MC4 A;  1G3Y A;  2GOM A;  1RRJ A;  1LB2 A;  3HDD A;  4H4K C;  1QA6 A;  1KRH A;  3LQE A;  3V8K A;  1WJB A;  2V7W A;  2JA6 J;  3E6M A;  4I99 C;  4JK1 X;  4MEX F;  3P5J A;  2PMD A;  1YHQ I;  4XRS G;  1Z0X A;  1EZG A;  1K79 A;  3WTV C;  3K69 A;  5HDK A;  4A3I J;  5FLX Z;  3B82 A;  1AA7 A;  3WBJ A;  3AL0 C;  1I39 A;  1ZM3 A;  1RNL A;  1R5B A;  2JDI A;  1RU4 A;  4CA0 A;  3ZN0 A;  2ZFW A;  5FLV A;  3SEJ A;  2OD5 A;  3F23 A;  1UST A;  4TV7 A;  5KSW B;  2DBB A;  3VOD A;  3WG7 H;  5KNL A;  5E8I A;  1WXR A;  4BY7 J;  1DP3 A;  3Q0V A;  5E20 A;  1ETW A;  2DAO A;  4KMF A;  3JU4 A;  4YCQ A;  1KMH A;  3BTI A;  5IYW A;  2R7O A;  2KVO A;  5IYQ A;  3FPK A;  2BW3 A;  1JE8 A;  1H88 C;  3CCM B;  4JYK A;  2JT1 A;  1QHH D;  2Q8K A;  3T9G A;  4M6Y A;  1W5S A;  5FNZ A;  5E3N A;  2QZA A;  1IJW C;  5TR9 A;  1D8T A;  1YJ9 I;  2GAU A;  3KP5 A;  3AVU A;  2QTZ A;  2O8K A;  3IP4 B;  2VI6 A;  1V3F A;  3EPZ A;  3VWB A;  2Q6I A;  2XAS A;  2OCC H;  3F72 A;  2XV4 S;  3HGG A;  5HS9 A;  1B72 B;  3OEE A;  2VFQ A;  5H59 A;  1S72 B;  1T39 A;  4Q7J B;  1D1C A;  3VNU A;  2FNP A;  1FT9 A;  1ZN2 A;  1K78 B;  2VYQ A;  2VFP A;  4RDU A;  2Y31 A;  3ABT A;  5J35 A;  1GVJ A;  2BW3 B;  4ROX A;  5CYV A;  3K4K A;  1Y0R A;  2VJ4 A;  3OYI A;  4U87 A;  4C9Y A;  1V0E A;  1GUU A;  1UHW A;  4PGO A;  3QOE A;  5EMN A;  3OMY A;  1U5T A;  2ESH A;  1OB2 A;  4I0B A;  1YQA A;  1ZRE A;  2P81 A;  2WZP P;  2A05 A;  3ZPL A;  2WBM A;  1GVD A;  2LZJ A;  1CZF A;  2HVR A;  2L4A A;  3PJR A;  2KT0 A;  4F55 A;  4Y4R A;  3HUG A;  3QYE A;  5H5J A;  4OJ5 A;  2Y69 H;  2E1M C;  2WY8 Q;  1TZL A;  1VQP B;  3S32 A;  4B48 A;  1YW7 A;  2VIX A;  1B4A A;  4OU0 A;  4EM1 A;  4RPD A;  4ESF A;  1FYL A;  1E64 A;  3OV8 A;  2V1N A;  1IN6 A;  1ZEL A;  1T08 B;  1OFD A;  4LBV A;  1XDS A;  3QQA A;  2R7F A;  1KCC A;  1WMR A;  2HDC A;  3SZP A;  3D26 A;  4Y7N J;  3A8I A;  3W6K B;  5BS6 A;  5K5O A;  3ABK H;  1H9T A;  1TC3 C;  5IYP A;  2RV8 A;  4U4B A;  4YII A;  1RES A;  3E0J B;  2VBY A;  4GXO A;  4ZC3 A;  1Y8R B;  5HLI A;  3KZY A;  2VBT A;  2O03 A;  1ZGA A;  2VQG A;  1Q9S A;  2KZG A;  3UKG A;  3HSR A;  3TO9 A;  1RR8 C;  4RGU A;  3HC7 A;  2IW5 A;  2KIF A;  1PP8 F;  4IQJ A;  5GAD J;  2IEK A;  4NBQ A;  3BQY A;  1S3J A;  4PC1 A;  2BXZ A;  2QGU A;  5B1B H;  2KP6 A;  1R5O A;  1DAB A;  1E3P A;  1UG2 A;  5CKT A;  2EIX A;  2PMH A;  1Y0N A;  3BQJ A;  1X3Z B;  5F0F A;  1IN5 A;  3EUA A;  2Q6L A;  3GTP J;  3LSP A;  4KH3 A;  3U1K A;  1O8I A;  3AG4 H;  1AMO A;  1PVE A;  3RZO J;  2LC2 A;  2GJP A;  2STT A;  3R6S A;  2P8T A;  2KIQ A;  3SFI A;  2X53 S;  2R7Q A;  1QRY A;  5FB2 A;  4FXU A;  4B09 A;  4HF0 A;  4ZYH A;  2CWE A;  5BQT A;  4CCN A;  3UW0 A;  1MKM A;  1IUF A;  1V54 H;  4RCY A;  1YIJ B;  1FOK A;  3K2Z A;  1KQS B;  1J5Y A;  5DD4 A;  1QFJ A;  2RC4 A;  2GQQ A;  4IQ4 A;  1ZM9 A;  3WU2 C;  4XM3 A;  1MMA A;  2IOU G;  5BOX A;  1KK2 A;  3RDI A;  1A35 A;  1IDZ A;  4N9H A;  4LMY A;  2QQB A;  1W1W E;  3V4G A;  3AGP A;  3GRH A;  2ICW G;  3O6B B;  1DGR M;  2L9S A;  2K3F A;  3KE2 A;  4XLN F;  1W36 D;  3SLD A;  3DKY A;  1ETX A;  5JBQ A;  5H6Q A;  2XT2 A;  5DCF A;  2MW8 A;  4XN3 A;  4Z2Y A;  5EEA A;  4LBZ A;  1FP1 D;  1U8R A;  4A3E J;  4HOB A;  4OZY A;  2VBM A;  5F4M A;  1UFM A;  3U6B A;  2FQ3 A;  1QVT A;  3H3Z A;  4CXF A;  1NB0 A;  2RN7 A;  2V9V A;  2YUH A;  4ZZL A;  3ZQF A;  2YR2 A;  4YRV A;  2CQK A;  3VYS B;  1F43 A;  2JIZ A;  2WZN A;  3PA2 A;  3B8H A;  5E3O A;  2FU4 A;  5M5Y J;  1OJL A;  4DW6 A;  4ZYD A;  4CQJ A;  4TN1 A;  2DLL A;  1KJZ A;  2VBV A;  3ESW B;  2WPD A;  2R7V A;  4D5F A;  1QUF A;  5F4J A;  3VO2 A;  4PSW A;  3PUB A;  2OAZ A;  3KET A;  1T38 A;  3R6K A;  3C2G A;  5B5E C;  4L9J A;  2R7Z J;  2O04 A;  2GQF A;  5LGU A;  4AM3 A;  1C0W A;  2LK2 A;  2HU9 A;  1BI3 A;  1R1U A;  2W57 A;  1SKY B;  3OW2 B;  1TW2 A;  3NWT A;  3JW4 A;  3HSF A;  5TY0 A;  2M5W A;  3ZC3 A;  4Z1M A;  4ZCI A;  1P7J A;  3OYA A;  4U7D A;  4HE5 A;  2V1D A;  3K4J A;  1SD4 A;  4LLG F;  4HX4 A;  3CCE I;  5TRD A;  3ZXS A;  3IL2 A;  3T5X A;  3SFZ A;  2M0M A;  3SYT A;  3CC2 I;  1K83 J;  2E1O A;  2L02 A;  2F4N A;  3BH4 A;  2O7O A;  1KYZ A;  2DDA A;  2HQA A;  3I59 A;  4R1H A;  2EQR A;  2FRH A;  3DLL F;  3BC9 A;  3HL2 A;  3CZ6 A;  5EEG A;  2DU9 A;  4P3Y A;  3WGI A;  3Q3A A;  4I7H A;  4DQL A;  4KA4 A;  3PFI A;  3J7A Y;  1ERD A;  2FD5 A;  2HDN B;  4KFC A;  1YG2 A;  1EFC A;  3SQN A;  2XGX A;  4U0W A;  4MYT A;  4ENN A;  3B6C A;  3GQ8 A;  1O3S A;  2KJC A;  3PVD A;  2HYJ A;  1Q1H A;  2HKO A;  4BXX J;  4HX8 A;  2M34 A;  6PAX A;  4QWQ A;  1CQT A;  1EP3 B;  4ZDO A;  4U49 A;  1YE9 A;  1P7I A;  4A3J J;  1ETV A;  3JRA A;  2H1L A;  3M1E A;  2P5L C;  2OF7 A;  1YRN A;  2V79 A;  2XPW A;  2ODL A;  1O8G A;  1S29 A;  4ENJ A;  3SLN A;  2DFI A;  1RMG A;  4GDF A;  5CLS A;  1O3T A;  5BPI A;  1JT6 A;  4U7B A;  3G71 I;  3I56 B;  5DS0 A;  2E71 A;  3GZ6 A;  1BA5 A;  2JTV A;  2W4S A;  3IHU A;  1A36 A;  1HC8 A;  5KVR A;  3TP0 A;  1X3W B;  2YWE A;  2DMQ A;  3O8G A;  2XTW A;  4YZX A;  1I8D A;  3J80 K;  2P7C B;  5EG0 A;  3VNV A;  2DFE A;  1LUJ B;  2DOF A;  3M1C A;  2EA2 A;  3GTJ J;  3CCS B;  1JUP A;  2W1O A;  1ZAR A;  2R7S A;  1JHF A;  3R4K A;  3RYP A;  3FJO A;  5DEQ A;  4XLC A;  1AOY A;  1YJW I;  2E36 A;  1G3W A;  5DM7 F;  3N90 A;  3OYE A;  2X0K A;  1UHM A;  4HX7 A;  3A02 A;  4Z4V A;  3EUH C;  3TED A;  1S5L C;  3K6G A;  3SJM A;  1T6Y A;  3CXC B;  2W25 A;  1XE1 A;  5FGM A;  1VF9 A;  1PKV A;  3M4O J;  3G6E I;  3FY3 A;  2IXS A;  1CNF A;  2HOE A;  3HAG A;  2BGJ A;  4MEY F;  2VFO A;  2O6G E;  2B0R A;  3GFJ A;  2VL8 A;  2O0W A;  3ZMU A;  4HYE A;  2M4G A;  1PLU A;  3SYJ A;  1GDT A;  3JQR A;  1W0T A;  4XR6 A;  2CO5 A;  4LD5 A;  1UMQ A;  2J8K A;  2OZU A;  3A0H C;  2NVT J;  1DUX C;  3M9A A;  1KD1 D;  2Z6B D;  2M5S A;  5LRR A;  3HIF A;  4RB1 A;  3CC7 I;  4II3 A;  4V19 K;  1ZLJ A;  4UV8 A;  4IHW A;  2W6J A;  4L9V A;  2INU A;  1HZE A;  3REO A;  1JTY A;  2NTP A;  2ELJ A;  4LG3 A;  3HPG A;  4U0Y A;  1WCM J;  1D1B A;  3P9C A;  4E6K G;  1E1Q A;  2CFO A;  5AMV A;  2OK7 A;  1JNY A;  1SKQ A;  2ZXI A;  1WI9 A;  2A68 F;  4OIO F;  4JQF A;  4WZE A;  4XD7 A;  3ZQ7 A;  3RI4 A;  1RET A;  2TRT A;  2CW8 A;  2X6X A;  4TMT A;  2KRC A;  2M87 A;  1UJ8 A;  2KDO A;  4ENK A;  5C1C A;  1W5T A;  2ECC A;  1R5I D;  1MBE A;  2NS7 A;  1UG0 A;  3UNG C;  5E6T A;  4E7J A;  5HLG A;  4RD2 A;  4YEI A;  2MD5 A;  4C3J J;  2YU3 A;  3CC4 B;  2Y0M A;  1TYX A;  2CV0 A;  2FBI A;  5J4Y A;  3W2F A;  1TP4 A;  5BSY A;  4OP7 A;  3AVY A;  1FNN A;  3BJ6 A;  2DFH A;  4MTE A;  1VI0 A;  2DYR H;  2PQ8 A;  4RLZ A;  2AXL A;  4L5I A;  4I2O A;  2FMY A;  3VFZ A;  3C3W A;  4OZZ A;  4X05 A;  1Q81 D;  3KP7 A;  2ETH A;  2Z2S B;  2PI0 A;  2Q6K A;  1HLV A;  1QVG B;  2Y0S N;  2WR8 A;  3JSO A;  3MKW B;  1SFU A;  1O4X A;  3AGQ A;  2O17 A;  1W5C C;  4HBL A;  2XSJ C;  4I09 A;  4P9U A;  2HOA A;  4O5V A;  1RQR A;  4PUS A;  3VST A;  2HPI A;  4RGS A;  3DXJ F;  3RPQ A;  4BU2 A;  1FOW A;  2XGE A;  4NB5 A;  2EIM H;  1MNM C;  1P2F A;  4G6Q A;  2DA2 A;  2RC5 A;  3S3O A;  3OW7 A;  4B3A A;  2GIV A;  1LNW A;  3HOZ J;  3HUG B;  3HTS B;  2AO9 A;  1SFE A;  1GJR A;  3BRO A;  3I59 B;  2W84 A;  4KIG A;  4JMQ A;  1TYW A;  1FMW A;  1OLT A;  5IP6 A;  3CMA I;  2ZBK A;  1FLI A;  1WWX A;  2UV1 A;  3AVW A;  1YYV A;  3WU0 A;  3BR5 A;  3I9V 2;  3RYR A;  3WTX C;  1BIA A;  4JX4 A;  4JRA C;  3W5H A;  4KDP A;  1KU2 A;  3DTE A;  4XKW A;  1IF1 A;  1NRK A;  1W35 A;  1EV7 A;  3WHB A;  1W36 C;  4Y9R A;  1WH7 A;  3SDB A;  2IJL A;  2G0E A;  4L5J A;  2D3N A;  1R00 A;  3DWL E;  2AQF A;  3NE5 B;  4NK8 A;  4EJO A;  1A6I A;  3U6K A;  3LWF A;  1P4X A;  4OOI A;  4UZE A;  2DIE A;  2BGI A;  4X7D A;  1GXQ A;  1KU3 A;  3BPV A;  3VSK A;  3CCJ I;  2PJP A;  4M0L A;  2MSY A;  4TMX A;  3IUO A;  2OJE D;  2XIG A;  1WQ2 A;  2BM5 A;  2L3D A;  2WA0 A;  3OOC A;  2R7X A;  1O7L A;  3W6J B;  5FKN A;  2P7V B;  3I54 A;  3E6C C;  3ZBU A;  3SQV A;  1TT0 A;  1X4O A;  4UVA A;  3L2W A;  2K9Q A;  4BQN A;  1EJ9 A;  5FO5 A;  2VB6 A;  3J7Y J;  4LIU A;  3BWG A;  4BEH B;  2HWV A;  4M3B A;  2FXA A;  5FD5 A;  1NH3 A;  2K7L A;  4DIQ A;  3MFK A;  2EZK A;  3HRU A;  3QYF A;  1JKP C;  4LFU A;  4QHY A;  4HSR A;  3CJN A;  2L7Z A;  1O8E A;  4BHP A;  5BMZ A;  2Z5U A;  3KP4 A;  2CRG A;  3PIO F;  3LA3 A;  5J8C A;  2LDU A;  2EJR A;  3Q9V A;  1Y56 A;  2NXN B;  3MD2 A;  3G05 A;  2HGC A;  2HNH A;  1P4M A;  3OYL A;  2E60 A;  1GR1 A;  4OJL A;  4DYQ A;  2DY1 A;  3CC2 B;  5CJ9 A;  4M1K A;  5E17 F;  2A69 F;  2W24 A;  3OSF A;  2HXI A;  1W34 A;  2NPF A;  4UY8 I;  4Z06 A;  2WC2 A;  4I02 A;  1KQ8 A;  3U9G A;  3OYD A;  1FSH A;  1D0Y A;  4Y7C A;  3W2G A;  1WI3 A;  2IS4 A;  2A3S A;  1MIJ A;  4XKV A;  2VOO A;  2P5V A;  3JRB A;  4BS9 A;  1K28 D;  4BXF A;  2L0K A;  3LSR A;  1OGO X;  2INV A;  2DA7 A;  5HOO A;  2DTZ A;  3ZIA A;  2O0V A;  4EJU A;  2V7X A;  4RPB A;  2JZY A;  1MMS A;  1EF4 A;  3MZY A;  2BSA A;  3J81 Z;  1JHH A;  2DJN A;  3CCU B;  5AIP A;  1KQ5 A;  4RS8 A;  2DK5 A;  3K4B A;  3IAM 2;  1XG1 A;  4RLQ A;  1XGS A;  1NB9 A;  4ESJ A;  2X85 A;  4HQE A;  3IWZ A;  1L3L A;  3OL3 A;  4RD1 A;  3BG5 A;  3SXY A;  2MG4 A;  1FY7 A;  5LGN A;  2DCE A;  1KZL A;  3OYF A;  2CV2 A;  1G7T A;  1QCX A;  1ETY A;  1QZZ A;  3CP8 A;  1VQL I;  4C30 A;  3HOW J;  5DN6 A;  2CK3 A;  1MJA A;  2K27 A;  4KIC A;  3NAU A;  1WDT A;  2ME6 A;  3E7L A;  2CQQ A;  2PEX A;  2HZD A;  3FPP A;  1ZGJ A;  3FK7 A;  2PMZ N;  1Z9C A;  3ISP A;  2D45 A;  3F8M A;  1E63 A;  3LQ6 A;  2UVF A;  2LKP A;  5IYC J;  2V5I A;  3LQQ A;  4W97 A;  3BDD A;  1DU6 A;  4RD6 A;  4F93 B;  1EFR A;  1F5T A;  5D8L B;  4ZV4 A;  3FXR A;  3P26 A;  2QSF X;  2ZL5 A;  4L9N A;  2RVC A;  4P5O A;  2E19 A;  3H0G J;  2EFW A;  1ON2 A;  4PC7 A;  4LB6 B;  2CQ7 A;  2VPR A;  2F5C A;  2BM4 A;  2NTB A;  3V7R A;  3BJA A;  2A5Y B;  5BPD A;  4LIT A;  3CC4 I;  1SD5 A;  2BVL A;  2XUB A;  3ASR A;  1FX7 A;  1V5F A;  3H9J A;  3OE7 A;  1HBX G;  4PJN A;  5ICG A;  5FFZ A;  4A12 A;  2ZTG A;  1O8M A;  4PFP A;  4WK8 F;  3TDU C;  3FM5 A;  5K7F A;  2KL4 A;  1FWZ A;  2I5U A;  4NDL A;  3IRQ A;  3A03 A;  4LG0 A;  3H35 A;  5CPR B;  1ZG3 A;  1UHS A;  2YUS A;  3H92 A;  2DYS H;  4RD0 A;  3N05 A;  2Y9Z A;  2DMN A;  3JRE A;  2DT7 B;  4R71 A;  2K9S A;  1TWG J;  5CQG A;  4WWV A;  3CJT B;  4ZCL A;  3DTK A;  3PSF A;  3L2R A;  4YEL A;  4BJ5 C;  1SD7 A;  3CCQ B;  1VQ6 B;  2DXI A;  1MBH A;  2BY0 A;  1KU7 A;  1R1V A;  2WSS A;  3S1M J;  2F4M B;  1K4Z A;  2IA0 A;  4HRI A;  1OCC H;  4LG0 B;  3U1D A;  5HOD A;  3ZR8 X;  4QLC U;  3A4C A;  3FMS A;  3KP3 A;  3PNV A;  5IPA A;  4X0G A;  1KTV A;  2C4T A;  2C77 A;  2VFN A;  3ML3 A;  3S3M A;  3DCF A;  4E7I A;  1YJN I;  4DZJ A;  4J01 A;  1G7C A;  4XNF A;  2OYN A;  3QP6 A;  3S14 J;  4WQM A;  3B73 A;  4S05 A;  5FKO A;  1TLH B;  3RKQ A;  2QE7 A;  1VQ6 I;  2Z3Y A;  4A3G J;  4BEH A;  4CCO A;  2EIL H;  1EFU A;  3LYC A;  2CYY A;  4DQK A;  1ZLK A;  4FTH A;  2XF7 A;  4YXW A;  1ZRF A;  1EXM A;  5EYR A;  1ZG1 A;  2GK7 A;  1YJ9 B;  3LSG A;  3A8J A;  3DV8 A;  2UXX A;  1BBY A;  1X1B A;  1YI2 B;  2LOO A;  5E3L A;  2HOT A;  2FJ1 A;  4FQG A;  4CCM A;  1S7E A;  2XRN A;  4Y15 A;  1IC8 A;  1F4K A;  1G8X A;  2X0L A;  1BR4 A;  1OCP A;  1XDU A;  3BY1 A;  1EWY A;  2MGQ A;  1J7K A;  3MKZ A;  1PP7 U;  4EEF G;  4A5M A;  3W2H A;  4M3F A;  2YPR A;  1N05 A;  2CW7 A;  3PFY A;  2FA5 A;  4OIQ F;  3GTK J;  3V76 A;  1DBO A;  3GLX A;  2IP2 A;  3V7S A;  4Y17 A;  3ZQG A;  2V6E A;  2LR8 A;  3HRS A;  3LSJ A;  4OOX A;  2EA4 A;  1ETQ A;  2JN9 A;  4MFD A;  4EM0 B;  1BC7 C;  1QBJ A;  1HST A;  1W0U A;  1VQP I;  1DPU A;  3ONQ A;  1QGP A;  4NC8 A;  4ZTF A;  2X6Y A;  1HW1 A;  3PO2 J;  3CRZ A;  3NAR A;  2K9M A;  3I58 A;  1OCO H;  1OFL A;  4LK0 F;  2H8R A;  4G6T B;  3RTR A;  2VE8 A;  2MFZ A;  4UZU A;  2XGJ A;  1IN7 A;  5AIQ A;  5EJC A;  2BZT A;  2FSW A;  4XLH A;  4A6D A;  5ERI A;  2JJ7 A;  2L7M P;  4RAF A;  3COA C;  4AF7 A;  1MJB A;  1CNE A;  1OQY A;  4PJJ A;  2HLD A;  4D9J A;  5C3E J;  4ZZD A;  5KHD A;  4EM2 A;  3TOB A;  1MGT A;  3VB2 A;  2GM4 A;  3QAH A;  1R23 A;  2AQE A;  1OFC X;  2IA1 A;  2X3H A;  3BH7 B;  4LBW A;  3NEU A;  2P6S A;  3VMV A;  3CCU I;  3GYH X;  1H89 C;  2E1B A;  3HGY A;  5JLV C;  3SUC A;  2X4H A;  4E7S A;  1JKQ C;  4HWV A;  4OJP A;  5K7H A;  4MXN A;  5D6F A;  1VQM B;  4OPW A;  4BE0 A;  2D5V A;  2F43 A;  4N0B A;  2NOJ B;  3DU6 A;  2VXZ A;  3LA2 A;  1ZK8 A;  2M8G X;  2QM3 A;  4UUV A;  1U0J A;  2CC2 A;  2DOG A;  3MZH A;  2IGK A;  3CJQ B;  3MKY B;  2VQH A;  4XBF A;  1SC7 A;  4HEA 2;  1XMK A;  2ZB9 A;  1H80 A;  3QU6 A;  2XGD A;  4F7D A;  1JJ8 C;  1Q1V A;  3I3L A;  4RAZ A;  1AKH A;  4HW0 A;  3KYD B;  1G7R A;  2Q0O A;  5D8K B;  5JVT A;  2WJV A;  2BBY A;  2BVN A;  5J1Y A;  2F4O B;  3ASN H;  2G7U A;  4CYC B;  2GZW A;  1HCR A;  2OV7 A;  2XAG A;  3VR6 A;  2YWG A;  5J3O A;  3FXK A;  1VHE A;  5F1R A;  2DW4 A;  2HVQ A;  1S72 I;  1H9G A;  5BNG A;  1ETO A;  2NVQ J;  3S17 J;  4X7E A;  3AL0 B;  1W2B B;  5C1E A;  3J80 Z;  1OHH A;  2X1D A;  3TDZ C;  3A01 A;  2H1K A;  3L7W A;  3ZQC A;  2R93 J;  4CSW A;  3H3V K;  2XC1 A;  4DK1 A;  1AKH B;  4KIS A;  4A0Z A;  1WOS A;  1OR7 A;  2PFB A;  2QBY A;  3V42 A;  1VQN B;  4OAZ A;  3G1M A;  2VLA A;  2J8I A;  4PCQ A;  4MFE A;  1PUF B;  3ONY A;  1M1K D;  1Y6I A;  4BUP A;  2EFN A;  2IGO A;  5IP7 J;  1IG7 A;  2O5R A;  3N97 A;  1N0U A;  1ELO A;  4BBR J;  2E1C A;  3MAJ A;  3C2H A;  1WTH D;  4YAW A;  3A3B A;  1TWH J;  2JJ2 A;  3FF5 A;  1WGX A;  3QPH A;  1Q7Y D;  2XAH A;  3FBI B;  1IZ1 A;  2WAQ A;  2C4U A;  1TQM A;  1DDG A;  2Z16 A;  2VC1 A;  1FP2 A;  4BHC A;  2DA3 A;  5LGT A;  1O88 A;  4DNC A;  1EE6 A;  4OPS A;  3RZD J;  2ZNZ A;  1R5G A;  2E7X A;  4P9F A;  2QEX I;  1YIT B;  1Z05 A;  4DJA A;  2Z8G A;  5J1U A;  3FXQ A;  3FKI J;  4ACA A;  3PM1 A;  4HV6 A;  3MEX A;  3FBN B;  2Y9Y A;  2ZME B;  3F9K A;  4CDG A;  1JJ2 B;  2GK6 A;  4OMY A;  2QSH X;  1N78 A;  4Z4W A;  3I53 A;  4LOC A;  1HVX A;  4KIF A;  1U5T C;  2C5B A;  2LSO A;  2TCT A;  2KQR A;  2ZCW A;  2CSO A;  1G7S A;  1V5G A;  3OOU A;  2BMW A;  2NRA C;  2KZV A;  3BP8 A;  4HQM A;  2R0Q C;  4OOV A;  2EFO A;  2QXZ A;  2XKO A;  5GP9 A;  5JHU A;  2FNA A;  3BZK A;  3HOY J;  2K86 A;  2IT0 A;  1HXD A;  3G73 A;  1T6S A;  3HEF A;  3ASP A;  1QX4 A;  1OOC A;  4OIR F;  4IHV A;  3CME I;  3PL8 A;  5A2Q K;  1Z3Y A;  2LVS A;  4CCJ A;  1IRZ A;  1HW2 A;  2EIK H;  3H1C A;  1IXR C;  2C78 A;  3GIR A;  3HHG A;  3VEP A;  3OIP A;  4XLE A;  1X2M A;  1K8F A;  4X7C A;  1D8J A;  2GXG A;  4C0S A;  1MBF A;  4KT6 A;  4CZZ A;  3FK6 A;  5L3G A;  2DK8 A;  4FIS A;  2ZJQ F;  4S0H B;  2IQ7 A;  1U6G A;  1XTA A;  4Z05 A;  1XFO A;  2NOG A;  2OBR A;  2V7V A;  3P9K A;  1LFP A;  3A1Y A;  4HG2 A;  1L0O C;  3WTS C;  1FBQ A;  2X6W A;  2XND A;  4D1Q A;  4XRS A;  2HR3 A;  5H2F C;  3NQO A;  1WOO A;  3TKY A;  2HMA A;  2ME0 A;  5L3C A;  3M8J A;  2BV3 A;  5HS8 A;  3MN2 A;  1ZKG A;  4WXC A;  3S2H J;  3ZGK A;  1JA0 A;  4WZL A;  3MWM A;  3CF2 A;  5EDN A;  3E5U A;  3I56 I;  5DD8 A;  3PSZ A;  1TQP A;  2BM1 A;  4TSF A;  4WX9 A;  1H8H A;  4JP0 A;  1GHC A;  2E1R A;  3KEY A;  2R9V A;  1BIB A;  2W48 A;  2I1L A;  2M7A A;  2HOS A;  3L09 A;  4G1B A;  2VBE A;  1MJ9 A;  3FMR A;  2C2W A;  3WBK A;  2NVX J;  1R7J A;  3GQ9 A;  3ELK A;  1MBJ A;  2VQC A;  1OYY A;  1GAQ A;  2O8X A;  3F8N A;  5EEH A;  3ZUG A;  4YHB A;  3TP3 A;  1ZHF A;  5JFR A;  3F22 A;  5HNH A;  3GTO J;  4M2L A;  1DG1 G;  4V2F A;  2ZFU A;  2X9D A;  1EP2 B;  4X06 A;  2QLZ A;  4EAT A;  2ZIT A;  3CP2 A;  4LLL A;  1IV6 A;  3SEQ A;  1CLW A;  1OGM X;  2MYS A;  2VBW A;  2L7K A;  1I5Z A;  1FNB A;  1SFK A;  3OIQ A;  4E7L A;  4C2U A;  1FOY A;  5J8F A;  1WSU A;  4N3N A;  4XLA A;  4P12 A;  1STZ A;  2CS3 A;  2G9W A;  4C2M J;  3S2W A;  1W87 A;  2XAF A;  2JRT A;  1VFC A;  4EJW A;  3JRF A;  3BCF A;  5HXB A;  1TSP A;  2V4J C;  1LLZ A;  4IRH A;  4W1U A;  2OPT A;  1XMX A;  3D1N I;  1IDJ A;  4OJO A;  1QHG A;  1MW7 A;  3GFM A;  3CUO A;  1QO0 D;  4YFK F;  2XOK A;  2LFB A;  1TL8 A;  4M74 A;  4HV5 A;  3CLO A;  3TOA A;  1FRN A;  2RDP A;  4P6Y A;  3AVX A;  4GGG A;  3A35 A;  3LMM A;  4G94 A;  1XCV A;  2EV6 A;  5AON A;  1T0F A;  1D1A A;  2D3L A;  2NNN A;  2HYG D;  3E1S A;  3A3G A;  2LLK A;  1VF7 A;  2EZL A;  1E3O C;  1MMN A;  1QVU A;  1F36 A;  3ECO A;  3EET A;  3HOT A;  2R7U A;  1O8K A;  2W82 A;  4F92 B;  3DBH B;  4GRI A;  4HA8 A;  4RB0 A;  1R36 A;  3MCZ A;  1LQ1 A;  1BC8 C;  2QBY B;  4PAA A;  2CUZ A;  2X1C A;  1QPM A;  5D5U B;  4KN4 X;  3TH0 A;  3HJE A;  2AHO A;  2W6I A;  2P6T A;  5LHI A;  1CGP A;  2IS6 A;  1Z67 A;  1IUY A;  1KU9 A;  4I84 A;  2DT6 A;  2A07 F;  1JA1 A;  1X4P A;  2NT6 A;  3JCU C;  4E7Z A;  2HYF A;  3MKL A;  3HB9 A;  4NUB A;  5LRS A;  4QUZ A;  2DOE A;  3CCS I;  1U2R A;  1PE9 A;  2CJJ A;  2VFM A;  1Y1V J;  2Z1D A;  3ZPP A;  5DSZ A;  3BR0 A;  2DET A;  2DTR A;  3DEU A;  2XGC A;  1A8P A;  2H6B A;  1QQ1 A;  3I71 A;  2O61 A;  3EDP A;  3G4S I;  1QA2 A;  3BR2 A;  1YHQ B;  2LNB A;  2NYX A;  2QVO A;  3CES A;  1X19 A;  2ID6 A;  3FHZ A;  3HRT A;  4AUX A;  1VQ7 I;  2MA3 A;  5F1J A;  2LH9 A;  3T8T A;  1J59 A;  3HOU J;  3F3X A;  1MSF C;  3K9T A;  4ZYE A;  4A93 J;  3H9N A;  4I98 B;  2B0L A;  4QVJ A;  3FZV A;  2W00 A;  5F27 A;  2XPU A;  3HPH A;  5HZA A;  1SMY F;  5LLQ A;  5IT9 K;  1K9M D;  1GQ8 A;  2BHY A;  2XB0 X;  1TW3 A;  5FKK A;  4B8X A;  2DFF A;  3CUQ B;  1KTW A;  3OJW A;  4P9S A;  3KCC A;  1SAN A;  1XS9 A;  3TW7 A;  3S16 J;  2VE9 A;  1LKX A;  1QJV A;  2F5V A;  2F6C A;  1BI1 A;  3T0Y A;  3W2W A;  1MDM B;  5FIU A;  2GRE A;  1HA3 A;  1QZE A;  4J19 A;  1VQN I;  4B1R A;  1QA3 A;  2UXN A;  2X1E A;  4E70 A;  4LGW A;  1LVK A;  2BGC A;  2EFQ A;  2VUM J;  4X8I A;  3IRR A;  4A3B J;  1BQE A;  4C43 A;  4P55 A;  5GAG J;  1QFY A;  3C7J A;  3K2A A;  3T1B A;  1FNM A;  3CME B;  2ZBV A;  1ON1 A;  4QPQ A;  1OCR H;  3EUH A;  2M9H A;  2L54 A;  3ABM H;  3BR1 A;  1R5N A;  3OAA A;  1A04 A;  1WSV A;  2ZO4 A;  4QV2 A;  3WNB A;  1IJE A;  1V4R A;  1N08 A;  2ZZG A;  4BHB A;  5LEK A;  3VDX A;  4OJ6 A;  2E1M B;  2QN6 A;  1DBG A;  2VBX A;  2NVY J;  3CCR B;  3BG9 A;  1WRJ A;  2KHM A;  3OIO A;  1UD8 A;  1XG2 A;  1SVO A;  2Y30 A;  4NQW B;  5FKL A;  1ZRD A;  4BQO A;  1IO2 A;  2VKV A;  1X58 A;  5DYM A;  4B4C A;  5EGO B;  4AIK A;  1X3U A;  1U8B A;  4JBA A;  3ERE D;  2CMP A;  4GCV A;  3DBR B;  2KLO A;  1JUS A;  3E5X A;  4M71 A;  4X0C A;  1U9N A;  2B7B A;  2NT9 A;  3DKX A;  4PDK A;  1WVR A;  1BPL A;  5F64 A;  5EZH A;  1J0R A;  5L46 A;  4XLF A;  1K4S A;  3NB2 A;  4P22 A;  1FC3 A;  3GZ5 A;  3TBI A;  2FF4 A;  3IV5 A;  2W7Z A;  2ZC2 A;  4L8J A;  1MBK A;  1X2N A;  4G12 A;  5LMZ A;  2VT2 A;  1J9I A;  1T98 A;  1LJ9 A;  2L9N A;  2XHK A;  3LST A;  1VQL B;  3IH4 A;  1SD6 A;  2V7U A;  2D1H A;  3HM5 A;  4PSX A;  1QPI A;  2OZ6 A;  2A6T A;  4RJL A;  4PFO A;  3IC7 A;  1FOX A;  2VBS A;  5KAI C;  3A01 B;  1VQO I;  1QU3 A;  1HA8 A;  2Z9O A;  4IHT A;  3Q6Q A;  3FXO A;  4KKU A;  4XON A;  4YIR X;  3OYG A;  2BY3 A;  1B72 A;  2F1M A;  4RDK A;  1YFH A;  4RAG A;  1B8I B;  1QZY A;  1H8A C;  1KON A;  5JI6 A;  1G59 A;  1E79 A;  1K78 A;  1RR7 A;  4TKO B;  2P5K A;  1KCD A;  5DCM B;  2XVC A;  1P4A A;  3BCA A;  4U88 A;  4UB6 C;  2MLG A;  1N0V C;  2XAQ A;  3R6J A;  1K8A D;  1HOM A;  2CF4 A;  1UZC A;  5K5R A;  1MNE A;  4D7M A;  1N06 A;  1O8F A;  3QFC A;  3K4L A;  2F4I A;  3FWE A;  1TNT A;  4L9T A;  3PNY A;  5HDN A;  3AG1 H;  4HPQ A;  3FKJ A;  4MIM A;  3CCR I;  1K6Y A;  4JOM A;  4RLF A;  1XSV A;  4B44 A;  1FX0 A;  3CDL A;  4M72 A;  5FLX K;  3CPW B;  5J3L A;  2RQP A;  3V8J A;  3A8K A;  3CJR B;  2ZXW H;  1XB2 A;  2FBK A;  2O0Y A;  1ODD A;  1KK0 A;  4FWT A;  2DPD A;  5DS9 A;  4YAO A;  3I4M J;  5GPA A;  4G7Z F;  3JQQ A;  5E1Z B;  3F8B A;  3SKB A;  5HNF A;  1K5C A;  2Y48 A;  2JVG A;  4DNT B;  3FDY A;  2Q6O A;  1XSX A;  4PZJ A;  2LBF B;  1AWC A;  3HTU A;  4HF1 A;  1YOV B;  4AID A;  3W2E A;  5M5X J;  3P7N A;  3QWL A;  3N4M A;  3GQA A;  5HLH A;  3BG7 A;  1OR7 C;  1XGO A;  2L9R A;  2OTL I;  4B4D A;  3I55 B;  1ACI A;  5ILV A;  1ZAO A;  1VTN C;  1FYK A;  4YZA A;  4PK4 A;  2H09 A;  2EV5 A;  1SMT A;  2EK5 A;  3QE2 A;  2J5P A;  1B9M A;  5ICC A;  3GFI A;  2VBU A;  3AVT A;  2CU7 A;  2OCE A;  2V9P A;  2E34 A;  2GOX B;  4W8R A;  1S6L A;  2OQG A;  4ZH4 F;  3C1D A;  2D74 A;  4A6E A;  1QQI A;  5HKK A;  3VYU B;  3ZBT A;  3IH2 A;  2ELH A;  2JA8 J;  2LKS A;  4EW9 A;  3HKZ N;  2XC7 A;  2YWF A;  2XRO A;  2B63 J;  2KMU A;  4Y33 A;  3GZN B;  4IO9 F;  1ZR2 A;  1KK1 A;  4BJT A;  5L3B A;  1Z6T A;  1KK3 A;  1IRX A;  3PIP F;  1J9Z A;  3PET A;  2BXY A;  2HDD A;  1OFE A;  2O3F A;  2QKM B;  3RJP A;  2NSP A;  3R0A A;  2RQQ A;  4NC6 A;  2M45 A;  2NVU B;  2XZO A;  3J7A O;  1VQ9 I;  2HDW A;  2HQR A;  2GXA A;  1ZYR F;  3ECH A;  3BOQ A;  3J81 K;  2DMT A;  3W6V A;  1MMG A;  1IDK A;  1RKW A;  2XAJ A;  2DJI A;  3GWZ A;  5CVR A;  5GTH C;  3OOP A;  5FRO A;  3I55 I;  3ZOB A;  2OC6 A;  1IA5 A;  2ISZ A;  2FQ4 A;  1VQK B;  3KRG A;  5F08 A;  3JTG A;  5M3M J;  2VT3 A;  4BDY A;  4AVP A;  2K5C A;  2DMU A;  4QPO A;  4IOC F;  3PUN A;  2DEU A;  3BJO A;  3U21 A;  4B3X A;  3H94 A;  4IX7 A;  5DV5 A;  2IGM A;  1YS7 A;  4URR A;  1JTX A;  1TYU A;  1AU7 A;  3WG9 A;  3GX4 X;  1Z6R A;  3BCB A;  4NQW A;  4BQQ A;  3TO7 A;  1IRG A;  5K7Z A;  2RC6 A;  1RUO A;  1MH4 A;  4K1X A;  3AG3 H;  1JT0 A;  2J7K A;  1ZM2 A;  1WJE A;  3DDY A;  1V5V A;  1RC9 A;  3QPT A;  4B43 A;  2OU2 A;  4GO1 A;  9ANT A;  2B7E A;  3K7A J;  2R92 J;  2XB5 A;  3FM3 A;  4L0Z B;  3JSP A;  4ENM A;  3DLA A;  3GTQ J;  1F60 A;  1D3Y A;  2CUJ A;  3A0B C;  1UAA A;  2OUM A;  3ROU A;  1NK2 P;  5GAH J;  4RGX A;  1PJ7 A;  4AC9 A;  4DK0 A;  3CCL B;  2OBP A;  1P92 A;  2VC0 A;  2VXD A;  3CTA A;  4A3K J;  2E2I J;  1VQ7 B;  3LFK A;  2MLK A;  2F5D A;  4Z4R A;  3CCV B;  2VKH A;  2M8E A;  4YEJ A;  2K4B A;  3CMM A;  4G6D A;  5KCM A;  3WTW C;  3GXO A;  2KDZ A;  4EGZ A;  2X48 A;  4EJT A;  4Z4Z A;  1YW8 A;  3AG2 H;  4IVN A;  2R5Y A;  4ZCM A;  1TNS A;  3BY6 A;  4DYC A;  3WU1 B;  1WJD A;  2NZM A;  3GO5 A;  4RD4 A;  1QVF B;  3OWT A;  2LRD A;  4Y3O A;  3LNQ A;  1LEB A;  2V1U A;  1VQ9 B;  3ZMV A;  1BX1 A;  2COB A;  5HLT A;  3S8P A;  1OGJ A;  2QKL B;  4XL9 A;  1BN8 A;  2DA5 A;  4WXD A;  3WOD F;  3CMY A;  4X6A J;  3OJX A;  3R0J A;  2EZH A;  4P96 A;  4EQQ A;  2QY1 A;  2L01 A;  2MC3 A;  5IYR A;  1ITY A;  1B8I A;  3QFS A;  5C4J J;  4XKB A;  3OYC A;  1WOP A;  1V5E A;  2EV0 A;  1R58 A;  1YX5 A;  2VAS A;  1F20 A;  1A31 A;  4TT3 A;  1FIP A;  4UHT A;  1MAB A;  5A2Q Z;  4HST A;  2DOA A;  4B47 A;  3SHF A;  3OPO A;  1N8R D;  1LM1 A;  3EYY A;  2DOD A;  4I0A A;  1K61 A;  2PLY A;  3KZI C;  1E3H A;  3TMO A;  1BR1 A;  5TGT A;  3ZRG A;  3F8F A;  2DA4 A;  4UVB A;  1O3R A;  2CGP A;  2JJ1 A;  2QA4 B;  1IRF A;  4IRG A;  2BY1 A;  1YO5 C;  2JA7 J;  1IB0 A;  1OYI A;  4A5N A;  1YI2 I;  3PUF A;  1H0M A;  1W7P A;  2FML A;  3ASQ A;  1Z1D A;  1E3X A;  3GEZ A;  4DNR B;  3I5U A;  3DQV C;  2LY1 A;  3M7G A;  2LKX A;  3H09 A;  2K4J A;  3PA1 A;  3AKZ A;  2QWW A;  4G6I A;  3DTI A;  2EWE A;  1KQ9 A;  2KJB A;  2LF7 A;  3JAM Z;  3N6Z A;  1QA1 A;  5EZG A;  4EGY A;  3RSN A;  4Z4U A;  5GPC A;  1MRZ A;  4RD3 A;  3I4P A;  3J81 k;  2NNY A;  4BGD A;  2QA4 I;  3NAW A;  1WU8 A;  3WGG A;  2LP0 A;  3W5V A;  1REP C;  4BQA A;  4P6V F;  4LLN A;  2EIN H;  4ZTJ A;  3VMW A;  1BOA A;  1OYW A;  4FET A;  1MSE C;  4IJA A;  2K3P A;  2XAU A;  3ONU A;  2ZXJ A;  2WAD A;  4N4O B;  5E3M A;  2RNG A;  4LIV A;  3DP7 A;  3BC8 A;  1E43 A;  1ZUN B;  5A8A A;  2VNJ A;  2QMU A;  2KIM A;  4M73 A;  1X0C A;  3BZ6 A;  1LDJ A;  3WE2 A;  4A3L J;  4V2G A;  1OB0 A;  3L9F A;  1WJA A;  5F6F A;  2YX7 A;  1PDN C;  3S3N A;  1N25 A;  5H20 A;  5A88 A;  3GUD A;  1DQU A;  2JVH A;  4RDJ A;  3EQO A;  3CDI A;  1EA0 A;  4OIN F;  2VPL A;  3CF5 F;  4IL6 C;  3RPU A;  3L2V A;  1XC5 A;  3W2V A;  2ZBU A;  4X1E A;  1NTC A;  4XID A;  2H6C A;  2K02 A;  4L0Y B;  2QGG A;  3P4G A;  1FBS A;  1P6R A;  2BEO A;  3FXU A;  2FX0 A;  5L3D A;  4OPO A;  3VSU A;  5FO1 A;  1W0J A;  3I64 A;  2XNJ A;  1K7A A;  2XEX A;  2DPU A;  3MVP A;  3JTH A;  1DDN A;  2DI3 A;  2VKD A;  3H3U A;  2GJR A;  1B23 P;  4S04 A;  4KIB A;  3LAP A;  3PSI A;  3IAS 2;  1LFU P;  1OMI A;  2A6E F;  2ZME C;  5IYD J;  3OYN A;  3T51 B;  3OZU A;  3ABU A;  5LD2 C;  5A89 A;  2R7D A;  1HSJ A;  4HLY A;  4A2U A;  1ORK A;  1WJC A;  1MBG A;  3ZQL A;  3GF2 A;  2DDB A;  2IAI A;  1GAW A;  3B4N A;  1YIT I;  1M90 D;  4UAJ A;  4UB8 C;  2VZL A;  3GBG A;  5IK2 A;  3T56 B;  3ZPN A;  3RPU D;  4TMZ A;  2Y2Z A;  2QTL A;  2JA2 A;  1RZ4 A;  2LG4 A;  2BM0 A;  3OKX A;  4M6V A;  4CHU A;  1FTT A;  1J75 A;  3WQZ A;  3KYL A;  3LQR A;  3WHC A;  5DUI A;  1Z7L A;  5B1A H;  3BNW A;  1XD7 A;  2JQ7 A;  4M9S A;  3GTG J;  1JI8 A;  5CVV A;  2QZ8 A;  4HNU A;  2HVS A;  1QRB A;  3VPR A;  5GTI C;  1ONV A;  3CO7 C;  3L00 A;  2C6Y A;  3OSG A;  1JJ6 C;  2BPO A;  2QQ8 A;  2FX3 A;  3RIQ A;  3GVK A;  2JPC A;  4CYD A;  3LVB A;  2MD0 A;  4FN5 A;  1VBL A;  1D0X A;  1BL0 A;  5DDG A;  3FKS A;  3JQP A;  3GTM J;  2VON A;  2E35 A;  5CDF A;  1UCR A;  1RUN A;  4N9I A;  1TBX A;  1BJK A;  3OP1 A;  2E5Z A;  1XCB A;  4OAY A;  1USS A;  1YRN B;  1W9X A;  4E7H A;  2AXT C;  1YJW B;  3FHN A;  2R7W A;  5TV2 A;  5EG0 B;  2FOW A;  2I8D A;  1BHE A;  1TWC J;  4P1W A;  2B7C A;  2XTX A;  4A0Y A;  1YLO A;  4Q5S F;  1S7O A;  5FLM J;  2GWR A;  4M3D A;  5K1Y A;  1YIO A;  2M30 A;  4Y13 A;  1ZRC A;  1OGI A;  1QH0 A;  4ASU A;  1EKE A;  1DPR A;  3P9I A;  2NAZ A;  3F21 A;  4P3I A;  5FD6 A;  3H9Q A;  5D6E A;  5F0C A;  3OY9 A;  4YFO A;  4DOZ A;  2OK8 A;  1TT5 B;  3E6D A;  2E2H J;  1IN8 A;  2I10 A;  3LSH A;  1SVL A;  3OS1 A;  1A5J A;  5TIS C;  3F8C A;  3MMY B;  3O2P E;  4MQ9 F;  1CQX A;  2HTJ A;  1J2X A;  2CG4 A;  1YIJ I;  5KK1 A;  3T53 B;  1ZH5 A;  1DDI A;  3RQI A;  4M3E A;  4MLO A;  3L2C A;  3SJZ A;  1MND A;  4FCY A;  2HFH A;  1PUE E;  2JA5 J;  3DU5 A;  1COW A;  3CCJ B;  2FBH A;  5GV8 A;  1XQB A;  2RRE A;  4XIC A;  3NRV A;  2RNJ A;  3AK5 A;  2HEO A;  5FRN A;  2VNK A;  5F04 A;  3OR1 C;  4HAM A;  3TQN A;  4BKX A;  1VQ8 B;  4ON0 A;  1BN5 A;  4MGR A;  2ZNY A;  4CGZ A;  2BHZ A;  3FMQ A;  5E79 C;  4RDL A;  3GME A;  5FA6 A;  4MYU A;  4K2E A;  2VKE A;  1HF0 A;  4Y9U A;  4I6Z A;  1VLY A;  4IHX A;  3FX3 A;  1WJF A;  3CDH A;  4DZP A;  2ZSH B;  3KP6 A;  1I6X A;  2ACJ A;  3JRD A;  2JPB A;  1UD4 A;  4Z4T A;  1ZGW A;  1LLW A;  3KZZ A;  2DMP A;  1EH7 A;  2HI3 A;  3AST A;  4X7F A;  2F48 A;  4MO7 A;  1V0F A;  5F0H A;  4M4S A;  4UXN A;  1QRC A;  4N4N B;  3ML6 A;  4U0V A;  5JVG F;  2AS5 F;  3CUQ A;  1EFT A;  5C4X J;  5FO0 A;  1R22 A;  1YX3 A;  1X1P A;  1LFB A;  4JX6 A;  3TO6 A;  2L4M A;  2R5Z B;  3VYR B;  5E1X A;  3H0D A;  1Y1W J;  1X1C A;  5ED4 A;  1M1E B;  2PYG A;  3OYJ A;  1V55 H;  4RB2 C;  1Z7U A;  1NHC A;  3EUK L;  3WGH A;  2D1V A;  3TGN A;  4AIH A;  1B1B A;  5J40 A;  2XSD C;  1BW6 A;  1MMD A;  5DNS A;  3OS0 A;  4CYC A;  2IPQ X;  2NS0 A;  5IOZ A;  2OTJ I;  1BLI A;  4YZQ A;  5L3E A;  3GLL A;  3BCD A;  3G3Z A;  4I76 A;  2VNH A;  3K1M A;  2GBY A;  3CCM I;  1SFO J;  1EH6 A;  2BE5 F;  3Q5F A;  2V6C A;  4KKT A;  3KEQ A;  4YAF A;  2F5F A;  3ZMD A;  2D2W A;  3O8H A;  4J0Q A;  4MR0 A;  2XF5 A;  3RKY A;  3F6V A;  4HF2 A;  2DN0 A;  2V9K A;  4WZK A;  2QCO A;  1QG0 A;  3HYI A;  4Z6Y A;  2Q1Z B;  2WB1 A;  3WTU C;  1VQ5 I;  5FRM A;  1LVA A;  4CO8 A;  3ZN1 A;  3HRM A;  2ISY A;  1E0E A;  4IPA A;  4C3I J;  1GT0 C;  3CUQ C;  3SJP A;  3CCE B;  1HQC A;  2BM6 A;  1NK3 P;  4NC7 A;  5EF6 A;  2ZTN A;  1KA8 A;  4UNO A;  2A6H F;  1U78 A;  3M07 A;  3SY2 A;  3GVA A;  1D8K A;  1PXZ A;  1ZQ3 P;  2DQR A;  3Q3S A;  2BYV E;  1FYM A;  1SM4 A;  4MQV A;  5J4V A;  4ITV A;  3ZQH A;  4B3F X;  3EQL F;  1P4W A;  1WH5 A;  3F0C A;  4LC0 A;  3ZZU A;  2KKO A;  1TWF J;  3D5R C;  3LJY A;  1U5T B;  3DF8 A;  1NG6 A;  4L18 B;  2F1L A;  3FXL A;  1NHA A;  5IP9 J;  3ZMZ A;  2CND A;  4IW3 B;  2EWN A;  2HCJ B;  4QFM A;  1O8J A;  4ZGN B;  4F3Q A;  4OM9 A;  2OBS A;  5IOY A;  5DTD A;  5K5Q A;  5FKM A;  4XRM A;  3KIO A;  4KKS A;  4BYY A;  4BXU A;  2XRL A;  3TW6 A;  2UZK A;  4NK6 A;  2CFX A;  5FFX A;  4DQ2 A;  2HPM A;  3T8R A;  3S93 A;  3CO6 C;  1O8L A;  4ANJ A;  3GQ7 A;  4WZT A;  5E8G A;  4EJV A;  2XT4 A;  1Z21 A;  4YC5 A;  1TQI A;  3BR6 A;  1BW5 A;  4IXA A;  4CCL A;  3LO8 A;  1Z77 A;  3BG6 A;  4D5C A;  4R79 A;  3G4S B;  4ETS A;  1LEA A;  2ZSI B;  3VSV A;  3DBL B;  4JX5 A;  5H6R A;  1VQO B;  1B9N A;  4YDT A;  1UD2 A;  2V31 A;  2CH0 A;  1FZP B;  3WNC A;  1NBM A;  3QRF F;  2GIZ A;  4BH9 A;  5FJ8 J;  1JGG A;  4NHJ A;  5JLX A;  4HDU A;  2EPF A;  4GYI A;  2KRF A;  1O8H A;  1H42 A;  3CCL I;  2WTE A;  1YX2 A;  2DT5 A;  4IF4 A;  1XMA A;  1CF7 B;  3RY8 A;  2B9S A;  4R8H A;  5CVU A;  3OZV A;  4ZDP A;  5F4O A;  3Q0W A;  5J6X A;  3PNT A;  4W8T A;  3WE3 A;  4WCG A;  1ZM4 A;  3SDG A;  1I27 A;  2XDV A;  2BF4 A;  3QFT A;  4PGH A;  2XF6 A;  3GQB A;  2ZXH A;  3DPU A;  4P26 A;  3S15 J;  3JRC A;  4FE4 A;  3WND A;  5L3F A;  1BX0 A;  1Y8Q B;  2DCU A;  1I50 J;  2BY2 A;  2LRE A;  2EFG A;  4NCN A;  1HG8 A;  2NST A;  2XPV A;  2E5N A;  1GLN A;  1H85 A;  2FOK A;  4LK1 F;  2HS5 A;  1FND A;  3PUM A;  1D5V A;  4G7H F;  2BM7 A;  2LF8 A;  3ERM A;  5IY5 H;  1E62 A;  2X8K A;  3K1P A;  1JUM A;  3E1Y E;  1I18 A;  1GO2 A;  2DA6 A;  2ELK A;  3M8E A;  4PC3 A;  2XZL A;  1MDM A;  1E3Z A;  2UWM A;  4A3C J;  2X51 A;  1UEL B;  2J5O A;  2N8G A;  1H8E A;  1TWA J;  1I1S A;  1JTA A;  4OMZ A;  2UUZ A;  2E1N A;  3MQ0 A;  4XOP A;  3B8Y A;  3HZJ A;  4HLX A;  4KN7 X;  4YFN F;  1FSE A;  3JRG A;  2VBK A;  3G71 B;  4QSH A;  5IYB J;  5JHF A;  5D4R A;  1BJZ A;  4BDZ A;  2V4D A;  2WV1 A;  3B78 A;  2W85 A;  4HNT A;  1SVM A;  1TUI A;  1JRG A;  4N3G A;  1UD5 A;  1OPC A;  3AFH A;  2NS8 A;  3G1O A;  1DP7 P;  3H5A A;  3LOC A;  1S7A A;  2PIA A;  1IXC A;  2Y75 A;  1W7P D;  2CUF A;  1MD0 A;  3NWS A;  1HKT A;  2WAF A;  3BT9 A;  2EFP A;  1GV2 A;  4IHY A;  1UD6 A;  3WXM A;  2KIS A;  5LBQ A;  3SZE A;  3BLY A;  4UVC A;  4A3F J;  1BMF A;  2TDX A;  2R5Z A;  1WJ5 A;  5E18 F;  2CW5 A;  4RB3 C;  4GFB A;  2EIJ H;  1GXP A;  4Y52 J;  2OQR A;  1ULY A;  5B6I A;  4O6J A;  2Q2E A;  4UUS A;  5IYN A;  1PJR A;  2LYC A;  2PBI A;  4X07 A;  2X3U A;  4BE2 A;  1LE8 B;  3MZ8 A;  1IHM A;  1VND A;  3MHP A;  4CIC A;  4TMW A;  4IZZ A;  4ASN A;  4AVZ A;  1U3E M;  2P0W A;  3GFL A;  1EP1 B;  1RI7 A;  3Q0U A;  3RIR A;  2VJ5 A;  2QYO A;  2OTL B;  1S4M A;  4XSZ F;  5ILU A;  4XK4 A;  2ECB A;  2OTJ B;  5CVI A;  5D5V B;  1SAU A;  4C2T A;  2ESN A;  1QGY A;  3E20 A;  1IJF A;  2JK3 A;  3LMW A;  1I1G A;  1XX5 A;  2K9N A;  3RQ4 A;  4ESB A;  1LE8 A;  2CW0 F;  3SZG A;  5HZB A;  2L5Q A;  5M5W J;  4YIF A;  5CVJ A;  3A1P A;  4A3M J;  3W2A A;  3JX8 A;  3GW2 A;  2R3S A;  4XSX F;  3ZCO A;  4HNV A;  2JRM A;  4V02 C;  2G7H A;  2PN6 A;  4CZC A;  1W7P B;  4KYW A;  3HOS A;  2RGV A;  3S1Q J;  1RQP A;  1NG7 A;  4FX0 A;  4O3M A;  3GVL A;  1Y39 A;  1TYV A;  2H8W A;  4FHT A;  1BM9 A;  5DCM A;  3JRH A;  1T8I A;  2ADU A;  3QU3 A;  3QOP A;  1S9H A;  4H9G A;  3FXM A;  3IWF A;  1OIS A;  4OPV A;  4P25 A;  2WAE A;  4MNU A;  1IN4 A;  1PYV A;  3WYA A;  4YG2 F;  1L1I A;  2LBF A;  4ZJZ A;  1RKT A;  3ULQ B;  3ZSC A;  2V7F A;  1LDD A;  4ABZ A;  3HSE A;  2GLO A;  5D5X B;  4MTD A;  2FVG A;  4QIW N;  2MAB A;  2V26 A;  1FDR A;  1I3Q J;  3J7Z I;  2XKP A;  3QYB A;  1G2H A;  2VQL A;  1J09 A;  5DUK A; 
#chains in the Genus database with same CATH homology
 3OWT A;  2LRD A;  4Y3O A;  3SUC A;  4IQ4 A;  4E7S A;  4HWV A;  4OJP A;  4XM3 A;  1MMA A;  3LSI A;  4MXN A;  3HG9 A;  4BE0 A;  3LL7 A;  5HLT A;  2F43 A;  2NOJ B;  3S8P A;  2QKL B;  2VXZ A;  3DU6 A;  4XL9 A;  3OYM A;  1BN8 A;  3GRH A;  1U0J A;  2IGK A;  3CJQ B;  3MKY B;  1DGR M;  2L9S A;  2VQH A;  2QY1 A;  4HEA 2;  2M3A A;  1H80 A;  1W36 D;  4XKB A;  3OYC A;  1V5E A;  3DKY A;  4BJ6 C;  3I3L A;  1YX5 A;  1R6R A;  2VAS A;  4RMN A;  4XN3 A;  2M4K A;  2IGN A;  3W3C A;  4TT3 A;  2VJJ A;  3A2K A;  4XMY A;  1MAB A;  2WJV A;  4OZY A;  2W7N A;  2GJK A;  2VBM A;  4HST A;  2DOA A;  4B47 A;  3OPO A;  2KPM A;  4B3G A;  2OV7 A;  3TMO A;  1BR1 A;  5TGT A;  3ZRG A;  4YRV A;  4G7X A;  3VR6 A;  3VYS B;  2JIZ A;  2HVQ A;  4HIZ A;  2NTQ A;  2JJ1 A;  5C1E A;  3AL0 B;  4YZ0 A;  4DBR A;  1OHH A;  2KRH A;  3KX2 A;  2X1D A;  4PJL A;  2WPD A;  4CSW A;  2R7V A;  4DK1 A;  4KIS A;  1E3X A;  1VJS A;  4DNR B;  2PJR B;  4PSW A;  3DQV C;  2LY1 A;  3PUB A;  3V42 A;  3C2G A;  2O04 A;  4OAZ A;  2VLA A;  2JUG A;  3AKZ A;  4G6I A;  1Y6I A;  2HU9 A;  3DTI A;  2EWE A;  4BUP A;  1SKY B;  3KEW A;  4W8Q A;  2IGO A;  3TL4 X;  1WTH D;  2O5R A;  3RSN A;  4CCK A;  2BSP A;  3NWT A;  3C2H A;  3A3B A;  2JJ2 A;  4Z1M A;  4BGD A;  3OYA A;  3FBI B;  3K4J A;  2WAQ A;  2ZZE A;  2Z16 A;  3VSL A;  3ZXS A;  4ZTJ A;  1EE6 A;  1O88 A;  4FET A;  3VMW A;  3WWG A;  2K3P A;  2M0M A;  3SYT A;  2WJY A;  2XAU A;  5CQE A;  3BH4 A;  4N4O B;  2HQA A;  2WAD A;  4DJA A;  3BC9 A;  2RNG A;  4LIV A;  1E43 A;  3BC8 A;  2Z8G A;  3HL2 A;  3FBN B;  3CZ6 A;  2CV1 A;  3F9K A;  1X0C A;  2GK6 A;  4AU7 A;  1N78 A;  1OB0 A;  1WJA A;  3J7A Y;  1ERD A;  1HVX A;  3S3N A;  2KQR A;  1DQU A;  2JVH A;  2LY2 A;  2Q2E B;  3HKZ A;  3EQO A;  3GQ8 A;  2VPL A;  1V5G A;  3OOU A;  4RM3 A;  1O8D A;  2KZV A;  3H5R A;  3L2V A;  4CH7 A;  2WY7 Q;  3W2V A;  2PYH A;  2QXZ A;  4F91 B;  3OYK A;  4ZDO A;  4U49 A;  1YE9 A;  2K9L A;  3G2B A;  1OOC A;  3VSU A;  2ODL A;  1W0J A;  1O8G A;  3PL8 A;  1RMG A;  1Z3Y A;  4CCJ A;  4IKF A;  4U7B A;  2GJR A;  2VKD A;  3D5S C;  2UVE A;  3OIP A;  4XLE A;  2O1D A;  2W4S A;  3PSI A;  4XQF A;  3IAS 2;  3LSM A;  1OFM A;  3OYN A;  4KT6 A;  3T51 B;  4YZX A;  1I8D A;  5LD2 C;  4E7K A;  2IQ7 A;  3M1C A;  4Z05 A;  1WJC A;  2W1O A;  4BE1 A;  3H9G A;  1T95 A;  2R7S A;  3SEZ A;  1LFP A;  3A1Y A;  4HG2 A;  4XLC A;  3B4N A;  4AYB A;  2X6W A;  4DGW B;  3DEE A;  4D1Q A;  2R7T A;  3GBG A;  2R7R A;  2XND A;  5IK2 A;  3T56 B;  3OYB A;  3ZPN A;  3RPU D;  3OYE A;  1D0Z A;  3EQN A;  1WFX A;  2JA2 A;  3EUH C;  2LG4 A;  3K6G A;  3M8J A;  3D5L A;  2PMZ A;  3ZGK A;  1PKV A;  3CF2 A;  3WQZ A;  3KYL A;  4PJM A;  3FY3 A;  2IXS A;  3HAG A;  1Z7L A;  4TSF A;  1H8H A;  2VJI A;  3KEY A;  2VL8 A;  1JI8 A;  2R9V A;  2O0W A;  2HVS A;  2M7A A;  2M4G A;  4HNU A;  1PLU A;  2VBE A;  3GVJ A;  3GVK A;  4XR6 A;  3L2U A;  1BR2 A;  3GQ9 A;  4C2L A;  2VQC A;  2MD0 A;  4FAS D;  1VBL A;  1D0X A;  2XZP A;  2Z6B D;  1E1R A;  2M5S A;  3K4C A;  3JUR A;  3FKS A;  4II3 A;  3QOD A;  4Z03 A;  2W6J A;  4PMH A;  2INU A;  1HZE A;  5HNH A;  4E0F A;  2NTP A;  2ELJ A;  3LFU A;  3HPG A;  4LG3 A;  5CDF A;  2ZFU A;  4EAT A;  1D1B A;  3CP2 A;  1OGM X;  2E5Z A;  4KJZ A;  3SEQ A;  4E6K G;  2MYS A;  2CFO A;  4OAY A;  1E1Q A;  2L7K A;  4E7H A;  1W9X A;  5AMV A;  1EA3 A;  1SFK A;  2ZXI A;  3OIQ A;  4E7L A;  3FHN A;  2R7W A;  4C2U A;  2I8D A;  4XLA A;  1BHE A;  2CS3 A;  4JQF A;  3DPL C;  4P1W A;  2V7Q A;  4XD7 A;  1WP6 A;  2X6X A;  2CW8 A;  3BCF A;  2KRC A;  2V4J C;  3OEH A;  2KDO A;  4ASU A;  5C1C A;  1DGW Y;  1IDJ A;  4OJO A;  3LNN A;  1QHG A;  1MW7 A;  1UG0 A;  3H9Q A;  3UNG C;  4E7J A;  2IS1 A;  2XOK A;  3OY9 A;  4DOZ A;  4XKC A;  3A35 A;  3LMM A;  2CV0 A;  3LSH A;  4NNJ A;  3OS1 A;  1UD3 A;  1D1A A;  3MMY B;  2D3L A;  1T5E A;  3E1S A;  3A3G A;  1VF7 A;  3T53 B;  1MMN A;  2BOL A;  4II2 A;  3HOT A;  2R7U A;  4OZZ A;  1O8K A;  4MLO A;  2W82 A;  4F92 B;  4J00 A;  4GRI A;  1MND A;  2Z2S B;  4DIQ A;  3H5N A;  2CUZ A;  2X1C A;  3DU5 A;  4XN0 A;  4XOT A;  3MKW B;  1COW A;  4KIT B;  2O17 A;  4ZDL A;  2RRE A;  2XSJ C;  2W6I A;  4PUS A;  1AIR A;  2IS2 A;  3VST A;  2HPI A;  2IS6 A;  5FRN A;  4I84 A;  3OR1 C;  2DT6 A;  4BU2 A;  1X4P A;  2NT6 A;  4E7Z A;  2PJR A;  3S3O A;  3RCO A;  3OW7 A;  4NUB A;  3HUG B;  1PE9 A;  4JMQ A;  3OR2 C;  2Z1D A;  3ZPP A;  1FMW A;  1OLT A;  1VLY A;  1WJF A;  2UV1 A;  2ZSH B;  3I9V 2;  1UD4 A;  3OS2 A;  1P9Q C;  1Z3X A;  1X1D A;  3CES A;  4DBQ A;  1X19 A;  1V0F A;  3DTE A;  4XKW A;  1NRK A;  1LDK B;  3K4M A;  1W36 C;  2LH9 A;  3SDB A;  2D3N A;  4N4N B;  3NE5 B;  3DWL E;  2AQF A;  4NK8 A;  1YX3 A;  2DIE A;  3K70 C;  3LSK A;  2W00 A;  1GQ8 A;  3HPH A;  3VYR B;  3ZQQ A;  3H0D A;  2PEC A;  3VSK A;  1KTW A;  1X1C A;  2PYG A;  3OYJ A;  5LFA A;  1NHC A;  3EUK L;  3IUO A;  2WA0 A;  3OOC A;  1LKX A;  1MMD A;  2R7X A;  1BOB A;  4BL0 B;  3OS0 A;  2QX3 A;  1QJV A;  2F5V A;  1BLI A;  4YZQ A;  1TT0 A;  2F6C A;  3W2W A;  1X4O A;  3BCD A;  1RWR A;  3L2W A;  4W8S A;  4BQN A;  2VB6 A;  2X1E A;  4LIU A;  3K70 D;  1LVK A;  4KKT A;  4BEH B;  1N75 A;  2M7B A;  4MR0 A;  2XF5 A;  2V9K A;  2Q1Z B;  2WB1 A;  3QYF A;  4F52 A;  4QPQ A;  5FRM A;  3B90 A;  4HSR A;  3OAA A;  1O8E A;  2L2O A;  1E0E A;  2A5W A;  1Y56 A;  3MD2 A;  3G05 A;  4NC7 A;  2ZTN A;  2HNH A;  2ZZG A;  3OYL A;  2E60 A;  3DPT A;  4OJL A;  3VDX A;  1N77 A;  4OJ6 A;  2E1M B;  4BAC A;  1PXZ A;  1DBG A;  4Z06 A;  2KHM A;  4ITV A;  1UD8 A;  4B3F X;  1XG2 A;  3OYD A;  4NQW B;  1D0Y A;  3OL4 A;  4RM2 A;  4BQO A;  3D5R C;  2IS4 A;  5FL7 A;  2ZZF A;  1NG6 A;  1IB4 A;  4XKV A;  2CMP A;  3UR3 C;  1VZ0 A;  2KLO A;  4BS9 A;  1K28 D;  4BXF A;  1OGO X;  3K10 A;  1X1A A;  1O8J A;  3DKX A;  2INV A;  2BVM A;  3L2Q A;  2NT9 A;  5HOO A;  2O0V A;  4F3Q A;  3ZIA A;  1BPL A;  4GQN A;  4ZYA A;  1WPC A;  4XLF A;  4KKS A;  4P22 A;  3K4B A;  3IAM 2;  4NK6 A;  3K4N A;  3TBI A;  4E4H A;  4RLQ A;  2HPM A;  4L8J A;  2X85 A;  3S93 A;  4CUG A;  2JSP A;  3OL3 A;  1O8L A;  2L9N A;  4ANJ A;  4G7W A;  3GQ7 A;  3VYT B;  4OWR B;  1Z21 A;  4PSX A;  3HXL A;  2A6T A;  2DCE A;  4PFO A;  1KZL A;  3OYF A;  2CV2 A;  4CCL A;  1HA8 A;  1QU3 A;  3CP8 A;  3OFN A;  1QCX A;  4C30 A;  4R79 A;  3BG6 A;  2Y0S A;  5HVQ C;  4KKU A;  2CK3 A;  5DN6 A;  4XON A;  2ZSI B;  3OYG A;  3VSV A;  2F1M A;  2HZD A;  3FPP A;  1FMV A;  1UD2 A;  2V31 A;  2CH0 A;  1KON A;  2FUG 2;  1G59 A;  1NBM A;  1E79 A;  2UVF A;  2R4G A;  4XOR A;  4TKO B;  3OYH A;  2ZZQ A;  1KCD A;  1T0F C;  4F93 B;  1EFR A;  3BCA A;  1O8H A;  1W0K A;  2MC4 A;  4P5O A;  2GOM A;  1MNE A;  4H4K C;  1O8F A;  1WJB A;  3K4L A;  2F4I A;  2NTB A;  4ZDP A;  3PNY A;  4LIT A;  4HPQ A;  3FKJ A;  2BVL A;  3PNT A;  1K6Y A;  4JOM A;  4RLF A;  4B44 A;  1FX0 A;  4W8T A;  1V5F A;  2XDV A;  3H9J A;  1AA7 A;  3AL0 C;  3OE7 A;  2XF6 A;  3GQB A;  2ZXH A;  3DPU A;  4PJN A;  2JDI A;  2ZTG A;  1O8M A;  3CJR B;  4PFP A;  1RU4 A;  4CA0 A;  2KL4 A;  3H35 A;  2LRE A;  5CPR B;  1HG8 A;  2NST A;  1K5C A;  3N05 A;  5HNF A;  2E5N A;  1GLN A;  2JVG A;  5KNL A;  4DNT B;  3FDY A;  2DT7 B;  1DP3 A;  3JU4 A;  2LBF B;  1KMH A;  2X8K A;  5CQG A;  1I18 A;  2R7O A;  3DTK A;  3PSF A;  2KVO A;  3GQA A;  3L2R A;  2XZL A;  1E3Z A;  2UWM A;  4YEL A;  3BG7 A;  1OR7 C;  2BW3 A;  1UEL B;  2X51 A;  4BJ5 C;  1H8E A;  1JTA A;  2DXI A;  1QHH D;  2UUZ A;  4YZA A;  4XOP A;  3T9G A;  2WSS A;  4PK4 A;  3B8Y A;  2VBK A;  4BDZ A;  5JHF A;  4HRI A;  2V4D A;  3IP4 B;  4W8R A;  2GOX B;  4HNT A;  3ZR8 X;  3A4C A;  3PNV A;  4X0G A;  1JRG A;  5HKK A;  3EPZ A;  3VYU B;  3VWB A;  3S3M A;  1UD5 A;  3OEE A;  3AFH A;  4E7I A;  4EW9 A;  3H5A A;  1D1C A;  4J01 A;  2XC7 A;  4XNF A;  3NWS A;  2WAF A;  1UD6 A;  2KMU A;  4Y33 A;  2BW3 B;  4BJT A;  3BLY A;  2QE7 A;  1IRX A;  3K4K A;  1BMF A;  2VJ4 A;  1WJ5 A;  3OYI A;  4BEH A;  4U87 A;  4C9Y A;  4CCO A;  2QKM B;  1V0E A;  2NSP A;  2RQQ A;  3QOE A;  1PJR A;  2LYC A;  2XZO A;  3OMY A;  4BE2 A;  2XF7 A;  2HDW A;  4YXW A;  2GK7 A;  2WZP P;  3LSG A;  4IZZ A;  1MMG A;  1IDK A;  2WBM A;  2DJI A;  2LZJ A;  1CZF A;  2HVR A;  1X1B A;  3PJR A;  2LOO A;  4AVZ A;  4F55 A;  4Y4R A;  2P0W A;  3QYE A;  5FRO A;  4OJ5 A;  2E1M C;  2WY8 Q;  1TZL A;  3S32 A;  4B48 A;  2OC6 A;  2VJ5 A;  2VIX A;  4CCM A;  1IA5 A;  3KRG A;  1G8X A;  1BR4 A;  1SAU A;  4C2T A;  1ZEL A;  2V1N A;  4BDY A;  2K5C A;  1KCC A;  4QPO A;  3MKZ A;  1WMR A;  3U21 A;  4B3X A;  3LMW A;  3H94 A;  4IX7 A;  2IGM A;  3RQ4 A;  4URR A;  3SZG A;  2L5Q A;  2CW7 A;  3PFY A;  3BCB A;  4BQQ A;  1DBO A;  4U4B A;  3E0J B;  3W2A A;  2V6E A;  4ZC3 A;  3ZCO A;  1WJE A;  2VQG A;  3DDY A;  4CZC A;  3HOS A;  3HC7 A;  3ONQ A;  1NG7 A;  4B43 A;  4NC8 A;  4ZTF A;  2X6Y A;  4IQJ A;  3GVL A;  2K9M A;  3DLA A;  2CUJ A;  1UAA A;  1OFL A;  2OUM A;  2KP6 A;  4G6T B;  4DK0 A;  2NZM A;  5CKT A;  3RTR A;  1S9H A;  2MFZ A;  4UZU A;  2XGJ A;  2VXD A;  3EUA A;  4XLH A;  1O8I A;  2VKH A;  2WAE A;  4YEJ A;  1PYV A;  2LC2 A;  5KCM A;  3CMM A;  4PJJ A;  2GJP A;  2LBF A;  4D9J A;  4ZJZ A;  2HLD A;  2X53 S;  2R7Q A;  2V7F A;  4FXU A;  3ZSC A;  5KHD A;  4CCN A;  2MAB A;  3UW0 A;  2AQE A;  2V26 A;  2X3H A;  3QYB A;  1WJD A;  3VMV A;  2VQL A;  1J09 A;  2E1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...