1O8JA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 30mm ca2+
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 137
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8jA00
4U4BA 2INUA 1OGOX 2X6YA 3ZSCA 2NT6A 1RU4A 4YZAA 4W8TA 4XORA 2VBMA 3EQOA 2X85A 4XLFA 4YEJA 1IA5A 1O8DA 1PE9A 2ODLA 3GQAA 3WWGA 2QXZA 4EW9A 2PECA 2O0WA 2O17A 4MXNA 1O8LA 3B90A 3VMWA 1JTAA 4XKWA 1KTWA 4Z05A 3GQ9A 1O8EA 1OGMX 3GRHA 4YZXA 4NK6A 3ZPPA 4XOTA 2QX3A 4XLEA 1O8FA 4W8QA 2INVA 3GQ7A 2EWEA 1QCXA 1OOCA 3B8YA 4U49A 1CZFA 4XLHA 3VSTA 2VJIA 3EQNA 4XM3A 4MR0A 1O8KA 1X0CA 4YZ0A 1PXZA 4AVZA 1PLUA 2VBKA 1JRGA 2VBEA 4OJ6A 1VBLA 4URRA 3T9GA 1O8HA 4PMHA 1DBGA 3SUCA 2NTQA 4NK8A 4XOPA 5C1CA 3FY3A 2O1DA 2NSPA 1NHCA 2NT9A 3VSVA 2IQ7A 3LMWA 1HG8A 1O88A 4XR6A 2O0VA 4YELA 1GQ8A 2NTBA 2PYHA 4XNFA 1EE6A 4XLAA 1WMRA 1BN8A 2PYGA 4W8RA 1IDKA 2Z8GA 4XMYA 5C1EA 4XONA 1AIRA 1K5CA 1KCDA 4OZYA 1KCCA 1IDJA 1RMGA 5AMVA 2O04A 4XL9A 2NZMA 4OJOA 1H80A 1QJVA 4XN0A 3JURA 1OFLA 4OJ5A 2X6XA 3B4NA 2UVEA 2UVFA 1DBOA 2BSPA 4YZQA 2NSTA 4XLCA 3KRGA 4XKVA 2X6WA 1XG2A 1OFMA 4HWVA 1O8JA 1O8MA 4C2LA 3VMVA 2QY1A 4XN3A 4XQFA 1O8IA 4OZZA 3GQ8A 4Z06A 2VJJA 1O8GA 4Z03A 4OJLA 4W8SA 2X3HA 4I84A 1RWRA 4OJPA 3UW0A 2NTPA 1BHEA 1IB4A 3VSUA
chains in the Genus database with same CATH superfamily
4U4BA 2XT2A 1QA3A 2INUA 1OGOX 2XT4A 1QA2A 2X6YA 3ZSCA 2NT6A 3P4GA 1RU4A 4YZAA 4W8TA 4XORA 3N90A 2BM4A 4YEIA 2B0RA 2VBMA 3EQOA 3BH6B 2X85A 4XLFA 4YEJA 4YFOA 1IA5A 1O8DA 1PE9A 2ODLA 3GQAA 3LYCA 3N6ZA 2QXZA 3TH0A 3WWGA 2G0YA 2PECA 4EW9A 2O0WA 2O17A 4MXNA 2BM5A 1L1IA 1O8LA 3B90A 3VMWA 1KQ5A 3AK5A 1JTAA 4XKWA 1KTWA 2XTYA 4Z05A 1QRBA 3GQ9A 1O8EA 1OGMX 3SYJA 2J8KA 3GRHA 4YZXA 4NK6A 3ZPPA 4XOTA 2QX3A 4JRAC 3NAWA 4XLEA 1OFEA 1O8FA 2XTXA 4W8QA 2INVA 3GQ7A 2EWEA 4YDTA 1QCXA 1K4ZA 1OOCA 1TYUA 3B8YA 4U49A 3SY2A 1CZFA 4XLHA 3VSTA 2VJIA 3EQNA 2O6WA 3ML3A 4MR0A 4XM3A 1O8KA 1X0CA 4YZ0A 4KH3A 1WXRA 2YUHA 1PXZA 4AVZA 2F3LA 1PLUA 2VBKA 1JRGA 2VBEA 4OJ6A 1CLWA 1VBLA 4URRA 3T9GA 1EZGA 2QZAA 1O8HA 5DNSA 4PMHA 2VFPA 2QYUA 3H09A 3RIQA 1DBGA 3SUCA 3SZEA 2NTQA 4NK8A 4XOPA 5C1CA 1K8FA 3FY3A 2NSPA 2O1DA 1NHCA 2NT9A 3VSVA 1QA1A 2VFQA 2IQ7A 3LMWA 4V02C 1HG8A 1O88A 4XR6A 2O0VA 3DU1X 4YELA 5JMCB 1GQ8A 1TSPA 2NTBA 3PETA 2PYHA 4XNFA 1EE6A 4XLAA 1WMRA 1BN8A 2PYGA 4W8RA 4OM9A 1IDKA 2Z8GA 4XMYA 3BH7B 1QQ1A 2IOUG 1LLWA 5C1EA 4XONA 1AIRA 1TYWA 1K5CA 3PSSA 4YC5A 1KCDA 4OZYA 1KCCA 1TYVA 1IDJA 1RMGA 4OPWA 5AMVA 2O04A 4XL9A 2NZMA 3LJYA 4OJOA 1H80A 1QJVA 2BM7A 4XN0A 2J8IA 2XC1A 3JURA 1OFLA 4OJ5A 1TYXA 2X6XA 3B4NA 2UVEA 2UVFA 1DBOA 2BSPA 2VFNA 4YZQA 1OFDA 2NSTA 4XLCA 3KRGA 4XKVA 2X6WA 1XG2A 5JLVC 1OFMA 4HWVA 1O8JA 1O8MA 4C2LA 3VMVA 1HF2A 2XTWA 1DABA 1QRCA 2QY1A 4XN3A 4XQFA 1O8IA 4OZZA 1LLZA 3GQ8A 4Z06A 2VJJA 3PSZA 3SQVA 1O8GA 4Z03A 2BX6A 4OJLA 4W8SA 1LM1A 3NB2A 1EA0A 4YCQA 2W7ZA 2X3HA 4I84A 2BM6A 2VFMA 1RWRA 2VFOA 3JX8A 4OJPA 3UW0A 2NTPA 1BHEA 2V5IA 1IB4A 3VSUA
chains in the Genus database with same CATH topology
4U4BA 2INUA 1OGOX 2X6YA 3ZSCA 2NT6A 1RU4A 4YZAA 4W8TA 4XORA 2VBMA 3EQOA 2X85A 4XLFA 4YEJA 1IA5A 1O8DA 1PE9A 2ODLA 3GQAA 3WWGA 2QXZA 4EW9A 2PECA 2O0WA 2O17A 4MXNA 1O8LA 3B90A 3VMWA 1JTAA 4XKWA 1KTWA 4Z05A 3GQ9A 1O8EA 1OGMX 3GRHA 4YZXA 4NK6A 3ZPPA 4XOTA 2QX3A 4XLEA 1O8FA 4W8QA 2INVA 3GQ7A 2EWEA 1QCXA 1OOCA 3B8YA 4U49A 1CZFA 4XLHA 3VSTA 2VJIA 3EQNA 4XM3A 4MR0A 1O8KA 1X0CA 4YZ0A 1PXZA 4AVZA 1PLUA 2VBKA 1JRGA 2VBEA 4OJ6A 1VBLA 4URRA 3T9GA 1O8HA 4PMHA 1DBGA 3SUCA 2NTQA 4NK8A 4XOPA 5C1CA 3FY3A 2O1DA 2NSPA 1NHCA 2NT9A 3VSVA 2IQ7A 3LMWA 1HG8A 1O88A 4XR6A 2O0VA 4YELA 1GQ8A 2NTBA 2PYHA 4XNFA 1EE6A 4XLAA 1WMRA 1BN8A 2PYGA 4W8RA 1IDKA 2Z8GA 4XMYA 5C1EA 4XONA 1AIRA 1K5CA 1KCDA 4OZYA 1KCCA 1IDJA 1RMGA 5AMVA 2O04A 4XL9A 2NZMA 4OJOA 1H80A 1QJVA 4XN0A 3JURA 1OFLA 4OJ5A 2X6XA 3B4NA 2UVEA 2UVFA 1DBOA 2BSPA 4YZQA 2NSTA 4XLCA 3KRGA 4XKVA 2X6WA 1XG2A 1OFMA 4HWVA 1O8JA 1O8MA 4C2LA 3VMVA 2QY1A 4XN3A 4XQFA 1O8IA 4OZZA 3GQ8A 4Z06A 2VJJA 1O8GA 4Z03A 4OJLA 4W8SA 2X3HA 4I84A 1RWRA 4OJPA 3UW0A 2NTPA 1BHEA 1IB4A 3VSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U4B A;  2INU A;  1OGO X;  2X6Y A;  3ZSC A;  2NT6 A;  1RU4 A;  4YZA A;  4W8T A;  4XOR A;  2VBM A;  3EQO A;  2X85 A;  4XLF A;  4YEJ A;  1IA5 A;  1O8D A;  1PE9 A;  2ODL A;  3GQA A;  3WWG A;  2QXZ A;  4EW9 A;  2PEC A;  2O0W A;  2O17 A;  4MXN A;  1O8L A;  3B90 A;  3VMW A;  1JTA A;  4XKW A;  1KTW A;  4Z05 A;  3GQ9 A;  1O8E A;  1OGM X;  3GRH A;  4YZX A;  4NK6 A;  3ZPP A;  4XOT A;  2QX3 A;  4XLE A;  1O8F A;  4W8Q A;  2INV A;  3GQ7 A;  2EWE A;  1QCX A;  1OOC A;  3B8Y A;  4U49 A;  1CZF A;  4XLH A;  3VST A;  2VJI A;  3EQN A;  4XM3 A;  4MR0 A;  1O8K A;  1X0C A;  4YZ0 A;  1PXZ A;  4AVZ A;  1PLU A;  2VBK A;  1JRG A;  2VBE A;  4OJ6 A;  1VBL A;  4URR A;  3T9G A;  1O8H A;  4PMH A;  1DBG A;  3SUC A;  2NTQ A;  4NK8 A;  4XOP A;  5C1C A;  3FY3 A;  2O1D A;  2NSP A;  1NHC A;  2NT9 A;  3VSV A;  2IQ7 A;  3LMW A;  1HG8 A;  1O88 A;  4XR6 A;  2O0V A;  4YEL A;  1GQ8 A;  2NTB A;  2PYH A;  4XNF A;  1EE6 A;  4XLA A;  1WMR A;  1BN8 A;  2PYG A;  4W8R A;  1IDK A;  2Z8G A;  4XMY A;  5C1E A;  4XON A;  1AIR A;  1K5C A;  1KCD A;  4OZY A;  1KCC A;  1IDJ A;  1RMG A;  5AMV A;  2O04 A;  4XL9 A;  2NZM A;  4OJO A;  1H80 A;  1QJV A;  4XN0 A;  3JUR A;  1OFL A;  4OJ5 A;  2X6X A;  3B4N A;  2UVE A;  2UVF A;  1DBO A;  2BSP A;  4YZQ A;  2NST A;  4XLC A;  3KRG A;  4XKV A;  2X6W A;  1XG2 A;  1OFM A;  4HWV A;  1O8J A;  1O8M A;  4C2L A;  3VMV A;  2QY1 A;  4XN3 A;  4XQF A;  1O8I A;  4OZZ A;  3GQ8 A;  4Z06 A;  2VJJ A;  1O8G A;  4Z03 A;  4OJL A;  4W8S A;  2X3H A;  4I84 A;  1RWR A;  4OJP A;  3UW0 A;  2NTP A;  1BHE A;  1IB4 A;  3VSU A; 
#chains in the Genus database with same CATH topology
 4U4B A;  2XT2 A;  1QA3 A;  2INU A;  1OGO X;  2XT4 A;  1QA2 A;  2X6Y A;  3ZSC A;  2NT6 A;  3P4G A;  1RU4 A;  4YZA A;  4W8T A;  4XOR A;  3N90 A;  2BM4 A;  4YEI A;  2B0R A;  2VBM A;  3EQO A;  3BH6 B;  2X85 A;  4XLF A;  4YEJ A;  4YFO A;  1IA5 A;  1O8D A;  1PE9 A;  2ODL A;  3GQA A;  3LYC A;  3N6Z A;  2QXZ A;  3TH0 A;  3WWG A;  2G0Y A;  2PEC A;  4EW9 A;  2O0W A;  2O17 A;  4MXN A;  2BM5 A;  1L1I A;  1O8L A;  3B90 A;  3VMW A;  1KQ5 A;  3AK5 A;  1JTA A;  4XKW A;  1KTW A;  2XTY A;  4Z05 A;  1QRB A;  3GQ9 A;  1O8E A;  1OGM X;  3SYJ A;  2J8K A;  3GRH A;  4YZX A;  4NK6 A;  3ZPP A;  4XOT A;  2QX3 A;  4JRA C;  3NAW A;  4XLE A;  1OFE A;  1O8F A;  2XTX A;  4W8Q A;  2INV A;  3GQ7 A;  2EWE A;  4YDT A;  1QCX A;  1K4Z A;  1OOC A;  1TYU A;  3B8Y A;  4U49 A;  3SY2 A;  1CZF A;  4XLH A;  3VST A;  2VJI A;  3EQN A;  2O6W A;  3ML3 A;  4MR0 A;  4XM3 A;  1O8K A;  1X0C A;  4YZ0 A;  4KH3 A;  1WXR A;  2YUH A;  1PXZ A;  4AVZ A;  2F3L A;  1PLU A;  2VBK A;  1JRG A;  2VBE A;  4OJ6 A;  1CLW A;  1VBL A;  4URR A;  3T9G A;  1EZG A;  2QZA A;  1O8H A;  5DNS A;  4PMH A;  2VFP A;  2QYU A;  3H09 A;  3RIQ A;  1DBG A;  3SUC A;  3SZE A;  2NTQ A;  4NK8 A;  4XOP A;  5C1C A;  1K8F A;  3FY3 A;  2NSP A;  2O1D A;  1NHC A;  2NT9 A;  3VSV A;  1QA1 A;  2VFQ A;  2IQ7 A;  3LMW A;  4V02 C;  1HG8 A;  1O88 A;  4XR6 A;  2O0V A;  3DU1 X;  4YEL A;  5JMC B;  1GQ8 A;  1TSP A;  2NTB A;  3PET A;  2PYH A;  4XNF A;  1EE6 A;  4XLA A;  1WMR A;  1BN8 A;  2PYG A;  4W8R A;  4OM9 A;  1IDK A;  2Z8G A;  4XMY A;  3BH7 B;  1QQ1 A;  2IOU G;  1LLW A;  5C1E A;  4XON A;  1AIR A;  1TYW A;  1K5C A;  3PSS A;  4YC5 A;  1KCD A;  4OZY A;  1KCC A;  1TYV A;  1IDJ A;  1RMG A;  4OPW A;  5AMV A;  2O04 A;  4XL9 A;  2NZM A;  3LJY A;  4OJO A;  1H80 A;  1QJV A;  2BM7 A;  4XN0 A;  2J8I A;  2XC1 A;  3JUR A;  1OFL A;  4OJ5 A;  1TYX A;  2X6X A;  3B4N A;  2UVE A;  2UVF A;  1DBO A;  2BSP A;  2VFN A;  4YZQ A;  1OFD A;  2NST A;  4XLC A;  3KRG A;  4XKV A;  2X6W A;  1XG2 A;  5JLV C;  1OFM A;  4HWV A;  1O8J A;  1O8M A;  4C2L A;  3VMV A;  1HF2 A;  2XTW A;  1DAB A;  1QRC A;  2QY1 A;  4XN3 A;  4XQF A;  1O8I A;  4OZZ A;  1LLZ A;  3GQ8 A;  4Z06 A;  2VJJ A;  3PSZ A;  3SQV A;  1O8G A;  4Z03 A;  2BX6 A;  4OJL A;  4W8S A;  1LM1 A;  3NB2 A;  1EA0 A;  4YCQ A;  2W7Z A;  2X3H A;  4I84 A;  2BM6 A;  2VFM A;  1RWR A;  2VFO A;  3JX8 A;  4OJP A;  3UW0 A;  2NTP A;  1BHE A;  2V5I A;  1IB4 A;  3VSU A; 
#chains in the Genus database with same CATH homology
 4U4B A;  2INU A;  1OGO X;  2X6Y A;  3ZSC A;  2NT6 A;  1RU4 A;  4YZA A;  4W8T A;  4XOR A;  2VBM A;  3EQO A;  2X85 A;  4XLF A;  4YEJ A;  1IA5 A;  1O8D A;  1PE9 A;  2ODL A;  3GQA A;  3WWG A;  2QXZ A;  4EW9 A;  2PEC A;  2O0W A;  2O17 A;  4MXN A;  1O8L A;  3B90 A;  3VMW A;  1JTA A;  4XKW A;  1KTW A;  4Z05 A;  3GQ9 A;  1O8E A;  1OGM X;  3GRH A;  4YZX A;  4NK6 A;  3ZPP A;  4XOT A;  2QX3 A;  4XLE A;  1O8F A;  4W8Q A;  2INV A;  3GQ7 A;  2EWE A;  1QCX A;  1OOC A;  3B8Y A;  4U49 A;  1CZF A;  4XLH A;  3VST A;  2VJI A;  3EQN A;  4XM3 A;  4MR0 A;  1O8K A;  1X0C A;  4YZ0 A;  1PXZ A;  4AVZ A;  1PLU A;  2VBK A;  1JRG A;  2VBE A;  4OJ6 A;  1VBL A;  4URR A;  3T9G A;  1O8H A;  4PMH A;  1DBG A;  3SUC A;  2NTQ A;  4NK8 A;  4XOP A;  5C1C A;  3FY3 A;  2O1D A;  2NSP A;  1NHC A;  2NT9 A;  3VSV A;  2IQ7 A;  3LMW A;  1HG8 A;  1O88 A;  4XR6 A;  2O0V A;  4YEL A;  1GQ8 A;  2NTB A;  2PYH A;  4XNF A;  1EE6 A;  4XLA A;  1WMR A;  1BN8 A;  2PYG A;  4W8R A;  1IDK A;  2Z8G A;  4XMY A;  5C1E A;  4XON A;  1AIR A;  1K5C A;  1KCD A;  4OZY A;  1KCC A;  1IDJ A;  1RMG A;  5AMV A;  2O04 A;  4XL9 A;  2NZM A;  4OJO A;  1H80 A;  1QJV A;  4XN0 A;  3JUR A;  1OFL A;  4OJ5 A;  2X6X A;  3B4N A;  2UVE A;  2UVF A;  1DBO A;  2BSP A;  4YZQ A;  2NST A;  4XLC A;  3KRG A;  4XKV A;  2X6W A;  1XG2 A;  1OFM A;  4HWV A;  1O8J A;  1O8M A;  4C2L A;  3VMV A;  2QY1 A;  4XN3 A;  4XQF A;  1O8I A;  4OZZ A;  3GQ8 A;  4Z06 A;  2VJJ A;  1O8G A;  4Z03 A;  4OJL A;  4W8S A;  2X3H A;  4I84 A;  1RWR A;  4OJP A;  3UW0 A;  2NTP A;  1BHE A;  1IB4 A;  3VSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...