1O8JA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 30mm ca2+
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
352
structure length
352
Chain Sequence
b'ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
molecule tags Hydrolase
source organism Erwinia chrysanthemi
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
total genus 137
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8jA00
4XLAA 1RWRA 4MXNA 4XLFA 4XOTA 2VJIA 1KTWA 4YZ0A 4U4BA 3GQ9A 2VBMA 4W8TA 1WMRA 1O8GA 2NTBA 2PYGA 4OJ5A 4XLCA 1O8HA 1PLUA 4OJ6A 2Z8GA 4XN0A 1BN8A 4U49A 1KCCA 3VMWA 1OGMX 3VSVA 1IB4A 2X6YA 1OGOX 4XM3A 4XNFA 4NK8A 2X6WA 5C1CA 2UVFA 4XLHA 2NSPA 4AVZA 4YELA 2X3HA 4URRA 4XKWA 4YZQA 1IDJA 2VJJA 2PYHA 3GQ8A 4XOPA 4W8QA 1KCDA 1HG8A 4OZYA 4OJOA 1PE9A 1O8EA 1CZFA 1AIRA 1O8FA 1QJVA 3VSUA 1NHCA 1X0CA 3SUCA 3GQAA 5AMVA 3GQ7A 1JRGA 2O17A 2BSPA 2NTPA 1QCXA 2VBKA 1JTAA 2X6XA 4MR0A 3WWGA 4Z06A 1OFMA 3EQOA 2QXZA 5C1EA 3ZSCA 4PMHA 4YZXA 4C2LA 1H80A 2O0WA 2IQ7A 2INVA 1OFLA 2NT9A 4HWVA 3EQNA 1VBLA 4Z05A 4XQFA 2QY1A 3GRHA 4XONA 1PXZA 3T9GA 4YZAA 4I84A 2O0VA 4XORA 4OJPA 4W8SA 2NT6A 2NTQA 4XMYA 1OOCA 4OZZA 3JURA 1O8JA 2VBEA 1BHEA 1RMGA 2ODLA 1IDKA 3B8YA 4XR6A 3ZPPA 2O1DA 1O8KA 3UW0A 2QX3A 4OJLA 3FY3A 3B90A 1GQ8A 1O8LA 1XG2A 4XKVA 4NK6A 4YEJA 2NSTA 1O8DA 1EE6A 2NZMA 2INUA 1O88A 4W8RA 4XN3A 1DBGA 1O8IA 4EW9A 4XLEA 1K5CA 2UVEA 3LMWA 3KRGA 4Z03A 2EWEA 4XL9A 1DBOA 2X85A 1RU4A 3VSTA 2PECA 1IA5A 3VMVA 2O04A 3B4NA 1O8MA
chains in the Genus database with same CATH superfamily
3PSZA 4XLAA 1RWRA 4MXNA 4XLFA 4XOTA 2VJIA 1KTWA 1TYVA 3SY2A 4YZ0A 4U4BA 2J8IA 3GQ9A 2VBMA 2W7ZA 2QYUA 4W8TA 3DU1X 1WMRA 1O8GA 2XTXA 2NTBA 1DABA 1QA2A 2PYGA 4OJ5A 2VFQA 4XLCA 1O8HA 1PLUA 2VFNA 4OJ6A 3RIQA 2Z8GA 4XN0A 1BN8A 3TH0A 4U49A 3NB2A 1KCCA 3VMWA 1OGMX 3VSVA 4YEIA 1IB4A 2VFMA 2X6YA 1OGOX 2BM7A 2F3LA 4OM9A 4XM3A 4XNFA 1OFDA 4NK8A 2X6WA 1LM1A 5C1CA 2IOUG 1EZGA 3SZEA 1CLWA 2UVFA 4XLHA 2NSPA 4AVZA 4YELA 2X3HA 4URRA 4XKWA 2V5IA 4YZQA 2VFPA 3N90A 1IDJA 1TYWA 2PYHA 2VJJA 3GQ8A 4W8QA 4XOPA 3BH7B 1KCDA 1HG8A 2G0YA 4OZYA 4OJOA 1PE9A 1O8EA 1QA1A 1CZFA 1AIRA 1O8FA 1QJVA 3ML3A 3H09A 1X0CA 2XT4A 3N6ZA 3SUCA 3GQAA 3VSUA 1NHCA 1QA3A 5AMVA 3GQ7A 1JRGA 1QQ1A 2O17A 2BSPA 2NTPA 1QCXA 1OFEA 3JX8A 2VBKA 1JTAA 2X6XA 1EA0A 4JRAC 2O6WA 4MR0A 3WWGA 2XT2A 1OFMA 4Z06A 2QXZA 3EQOA 3PSSA 4YCQA 5C1EA 3ZSCA 3AK5A 4PMHA 4YZXA 4C2LA 1H80A 1K4ZA 2O0WA 1TSPA 4V02C 2IQ7A 2INVA 1OFLA 2NT9A 1WXRA 3PETA 4HWVA 3EQNA 3SYJA 1VBLA 4Z05A 4OPWA 2QY1A 4XQFA 3GRHA 1KQ5A 1PXZA 4XONA 3T9GA 2XTWA 3P4GA 4YZAA 4I84A 4KH3A 2O0VA 4XORA 4OJPA 4W8SA 2NT6A 2NTQA 2BM5A 4XMYA 1OOCA 4OZZA 3JURA 1O8JA 2VBEA 3SQVA 1BHEA 2YUHA 1RMGA 2ODLA 1IDKA 1LLWA 3B8YA 4XR6A 3ZPPA 1HF2A 2O1DA 1O8KA 3UW0A 1TYUA 2BM4A 2J8KA 2QX3A 4OJLA 3FY3A 3B90A 2BM6A 5DNSA 1GQ8A 1O8LA 2BX6A 1XG2A 4XKVA 4NK6A 4YEJA 2NSTA 2XTYA 1O8DA 1EE6A 5JLVC 2NZMA 2INUA 5JMCB 4YC5A 1O88A 1QRCA 4W8RA 4XN3A 1K8FA 1DBGA 1O8IA 2B0RA 1TYXA 1QRBA 4EW9A 4XLEA 4YFOA 3BH6B 3LJYA 2VFOA 1K5CA 2UVEA 2QZAA 3LMWA 2XC1A 3KRGA 4YDTA 1L1IA 4Z03A 2EWEA 4XL9A 1DBOA 2X85A 1RU4A 3VSTA 2PECA 1IA5A 3NAWA 3LYCA 2O04A 3VMVA 1LLZA 3B4NA 1O8MA
chains in the Genus database with same CATH topology
4XLAA 1RWRA 4MXNA 4XLFA 4XOTA 2VJIA 1KTWA 4YZ0A 4U4BA 3GQ9A 2VBMA 4W8TA 1WMRA 1O8GA 2NTBA 2PYGA 4OJ5A 4XLCA 1O8HA 1PLUA 4OJ6A 2Z8GA 4XN0A 1BN8A 4U49A 1KCCA 3VMWA 1OGMX 3VSVA 1IB4A 2X6YA 1OGOX 4XM3A 4XNFA 4NK8A 2X6WA 5C1CA 2UVFA 4XLHA 2NSPA 4AVZA 4YELA 2X3HA 4URRA 4XKWA 4YZQA 1IDJA 2VJJA 2PYHA 3GQ8A 4XOPA 4W8QA 1KCDA 1HG8A 4OZYA 4OJOA 1PE9A 1O8EA 1CZFA 1AIRA 1O8FA 1QJVA 3VSUA 1NHCA 1X0CA 3SUCA 3GQAA 5AMVA 3GQ7A 1JRGA 2O17A 2BSPA 2NTPA 1QCXA 2VBKA 1JTAA 2X6XA 4MR0A 3WWGA 4Z06A 1OFMA 3EQOA 2QXZA 5C1EA 3ZSCA 4PMHA 4YZXA 4C2LA 1H80A 2O0WA 2IQ7A 2INVA 1OFLA 2NT9A 4HWVA 3EQNA 1VBLA 4Z05A 4XQFA 2QY1A 3GRHA 4XONA 1PXZA 3T9GA 4YZAA 4I84A 2O0VA 4XORA 4OJPA 4W8SA 2NT6A 2NTQA 4XMYA 1OOCA 4OZZA 3JURA 1O8JA 2VBEA 1BHEA 1RMGA 2ODLA 1IDKA 3B8YA 4XR6A 3ZPPA 2O1DA 1O8KA 3UW0A 2QX3A 4OJLA 3FY3A 3B90A 1GQ8A 1O8LA 1XG2A 4XKVA 4NK6A 4YEJA 2NSTA 1O8DA 1EE6A 2NZMA 2INUA 1O88A 4W8RA 4XN3A 1DBGA 1O8IA 4EW9A 4XLEA 1K5CA 2UVEA 3LMWA 3KRGA 4Z03A 2EWEA 4XL9A 1DBOA 2X85A 1RU4A 3VSTA 2PECA 1IA5A 3VMVA 2O04A 3B4NA 1O8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLA A;  1RWR A;  4MXN A;  4XLF A;  4XOT A;  2VJI A;  1KTW A;  4YZ0 A;  4U4B A;  3GQ9 A;  2VBM A;  4W8T A;  1WMR A;  1O8G A;  2NTB A;  2PYG A;  4OJ5 A;  4XLC A;  1O8H A;  1PLU A;  4OJ6 A;  2Z8G A;  4XN0 A;  1BN8 A;  4U49 A;  1KCC A;  3VMW A;  1OGM X;  3VSV A;  1IB4 A;  2X6Y A;  1OGO X;  4XM3 A;  4XNF A;  4NK8 A;  2X6W A;  5C1C A;  2UVF A;  4XLH A;  2NSP A;  4AVZ A;  4YEL A;  2X3H A;  4URR A;  4XKW A;  4YZQ A;  1IDJ A;  2VJJ A;  2PYH A;  3GQ8 A;  4XOP A;  4W8Q A;  1KCD A;  1HG8 A;  4OZY A;  4OJO A;  1PE9 A;  1O8E A;  1CZF A;  1AIR A;  1O8F A;  1QJV A;  3VSU A;  1NHC A;  1X0C A;  3SUC A;  3GQA A;  5AMV A;  3GQ7 A;  1JRG A;  2O17 A;  2BSP A;  2NTP A;  1QCX A;  2VBK A;  1JTA A;  2X6X A;  4MR0 A;  3WWG A;  4Z06 A;  1OFM A;  3EQO A;  2QXZ A;  5C1E A;  3ZSC A;  4PMH A;  4YZX A;  4C2L A;  1H80 A;  2O0W A;  2IQ7 A;  2INV A;  1OFL A;  2NT9 A;  4HWV A;  3EQN A;  1VBL A;  4Z05 A;  4XQF A;  2QY1 A;  3GRH A;  4XON A;  1PXZ A;  3T9G A;  4YZA A;  4I84 A;  2O0V A;  4XOR A;  4OJP A;  4W8S A;  2NT6 A;  2NTQ A;  4XMY A;  1OOC A;  4OZZ A;  3JUR A;  1O8J A;  2VBE A;  1BHE A;  1RMG A;  2ODL A;  1IDK A;  3B8Y A;  4XR6 A;  3ZPP A;  2O1D A;  1O8K A;  3UW0 A;  2QX3 A;  4OJL A;  3FY3 A;  3B90 A;  1GQ8 A;  1O8L A;  1XG2 A;  4XKV A;  4NK6 A;  4YEJ A;  2NST A;  1O8D A;  1EE6 A;  2NZM A;  2INU A;  1O88 A;  4W8R A;  4XN3 A;  1DBG A;  1O8I A;  4EW9 A;  4XLE A;  1K5C A;  2UVE A;  3LMW A;  3KRG A;  4Z03 A;  2EWE A;  4XL9 A;  1DBO A;  2X85 A;  1RU4 A;  3VST A;  2PEC A;  1IA5 A;  3VMV A;  2O04 A;  3B4N A;  1O8M A; 
#chains in the Genus database with same CATH topology
 3PSZ A;  4XLA A;  1RWR A;  4MXN A;  4XLF A;  4XOT A;  2VJI A;  1KTW A;  1TYV A;  3SY2 A;  4YZ0 A;  4U4B A;  2J8I A;  3GQ9 A;  2VBM A;  2W7Z A;  2QYU A;  4W8T A;  3DU1 X;  1WMR A;  1O8G A;  2XTX A;  2NTB A;  1DAB A;  1QA2 A;  2PYG A;  4OJ5 A;  2VFQ A;  4XLC A;  1O8H A;  1PLU A;  2VFN A;  4OJ6 A;  3RIQ A;  2Z8G A;  4XN0 A;  1BN8 A;  3TH0 A;  4U49 A;  3NB2 A;  1KCC A;  3VMW A;  1OGM X;  3VSV A;  4YEI A;  1IB4 A;  2VFM A;  2X6Y A;  1OGO X;  2BM7 A;  2F3L A;  4OM9 A;  4XM3 A;  4XNF A;  1OFD A;  4NK8 A;  2X6W A;  1LM1 A;  5C1C A;  2IOU G;  1EZG A;  3SZE A;  1CLW A;  2UVF A;  4XLH A;  2NSP A;  4AVZ A;  4YEL A;  2X3H A;  4URR A;  4XKW A;  2V5I A;  4YZQ A;  2VFP A;  3N90 A;  1IDJ A;  1TYW A;  2PYH A;  2VJJ A;  3GQ8 A;  4W8Q A;  4XOP A;  3BH7 B;  1KCD A;  1HG8 A;  2G0Y A;  4OZY A;  4OJO A;  1PE9 A;  1O8E A;  1QA1 A;  1CZF A;  1AIR A;  1O8F A;  1QJV A;  3ML3 A;  3H09 A;  1X0C A;  2XT4 A;  3N6Z A;  3SUC A;  3GQA A;  3VSU A;  1NHC A;  1QA3 A;  5AMV A;  3GQ7 A;  1JRG A;  1QQ1 A;  2O17 A;  2BSP A;  2NTP A;  1QCX A;  1OFE A;  3JX8 A;  2VBK A;  1JTA A;  2X6X A;  1EA0 A;  4JRA C;  2O6W A;  4MR0 A;  3WWG A;  2XT2 A;  1OFM A;  4Z06 A;  2QXZ A;  3EQO A;  3PSS A;  4YCQ A;  5C1E A;  3ZSC A;  3AK5 A;  4PMH A;  4YZX A;  4C2L A;  1H80 A;  1K4Z A;  2O0W A;  1TSP A;  4V02 C;  2IQ7 A;  2INV A;  1OFL A;  2NT9 A;  1WXR A;  3PET A;  4HWV A;  3EQN A;  3SYJ A;  1VBL A;  4Z05 A;  4OPW A;  2QY1 A;  4XQF A;  3GRH A;  1KQ5 A;  1PXZ A;  4XON A;  3T9G A;  2XTW A;  3P4G A;  4YZA A;  4I84 A;  4KH3 A;  2O0V A;  4XOR A;  4OJP A;  4W8S A;  2NT6 A;  2NTQ A;  2BM5 A;  4XMY A;  1OOC A;  4OZZ A;  3JUR A;  1O8J A;  2VBE A;  3SQV A;  1BHE A;  2YUH A;  1RMG A;  2ODL A;  1IDK A;  1LLW A;  3B8Y A;  4XR6 A;  3ZPP A;  1HF2 A;  2O1D A;  1O8K A;  3UW0 A;  1TYU A;  2BM4 A;  2J8K A;  2QX3 A;  4OJL A;  3FY3 A;  3B90 A;  2BM6 A;  5DNS A;  1GQ8 A;  1O8L A;  2BX6 A;  1XG2 A;  4XKV A;  4NK6 A;  4YEJ A;  2NST A;  2XTY A;  1O8D A;  1EE6 A;  5JLV C;  2NZM A;  2INU A;  5JMC B;  4YC5 A;  1O88 A;  1QRC A;  4W8R A;  4XN3 A;  1K8F A;  1DBG A;  1O8I A;  2B0R A;  1TYX A;  1QRB A;  4EW9 A;  4XLE A;  4YFO A;  3BH6 B;  3LJY A;  2VFO A;  1K5C A;  2UVE A;  2QZA A;  3LMW A;  2XC1 A;  3KRG A;  4YDT A;  1L1I A;  4Z03 A;  2EWE A;  4XL9 A;  1DBO A;  2X85 A;  1RU4 A;  3VST A;  2PEC A;  1IA5 A;  3NAW A;  3LYC A;  2O04 A;  3VMV A;  1LLZ A;  3B4N A;  1O8M A; 
#chains in the Genus database with same CATH homology
 4XLA A;  1RWR A;  4MXN A;  4XLF A;  4XOT A;  2VJI A;  1KTW A;  4YZ0 A;  4U4B A;  3GQ9 A;  2VBM A;  4W8T A;  1WMR A;  1O8G A;  2NTB A;  2PYG A;  4OJ5 A;  4XLC A;  1O8H A;  1PLU A;  4OJ6 A;  2Z8G A;  4XN0 A;  1BN8 A;  4U49 A;  1KCC A;  3VMW A;  1OGM X;  3VSV A;  1IB4 A;  2X6Y A;  1OGO X;  4XM3 A;  4XNF A;  4NK8 A;  2X6W A;  5C1C A;  2UVF A;  4XLH A;  2NSP A;  4AVZ A;  4YEL A;  2X3H A;  4URR A;  4XKW A;  4YZQ A;  1IDJ A;  2VJJ A;  2PYH A;  3GQ8 A;  4XOP A;  4W8Q A;  1KCD A;  1HG8 A;  4OZY A;  4OJO A;  1PE9 A;  1O8E A;  1CZF A;  1AIR A;  1O8F A;  1QJV A;  3VSU A;  1NHC A;  1X0C A;  3SUC A;  3GQA A;  5AMV A;  3GQ7 A;  1JRG A;  2O17 A;  2BSP A;  2NTP A;  1QCX A;  2VBK A;  1JTA A;  2X6X A;  4MR0 A;  3WWG A;  4Z06 A;  1OFM A;  3EQO A;  2QXZ A;  5C1E A;  3ZSC A;  4PMH A;  4YZX A;  4C2L A;  1H80 A;  2O0W A;  2IQ7 A;  2INV A;  1OFL A;  2NT9 A;  4HWV A;  3EQN A;  1VBL A;  4Z05 A;  4XQF A;  2QY1 A;  3GRH A;  4XON A;  1PXZ A;  3T9G A;  4YZA A;  4I84 A;  2O0V A;  4XOR A;  4OJP A;  4W8S A;  2NT6 A;  2NTQ A;  4XMY A;  1OOC A;  4OZZ A;  3JUR A;  1O8J A;  2VBE A;  1BHE A;  1RMG A;  2ODL A;  1IDK A;  3B8Y A;  4XR6 A;  3ZPP A;  2O1D A;  1O8K A;  3UW0 A;  2QX3 A;  4OJL A;  3FY3 A;  3B90 A;  1GQ8 A;  1O8L A;  1XG2 A;  4XKV A;  4NK6 A;  4YEJ A;  2NST A;  1O8D A;  1EE6 A;  2NZM A;  2INU A;  1O88 A;  4W8R A;  4XN3 A;  1DBG A;  1O8I A;  4EW9 A;  4XLE A;  1K5C A;  2UVE A;  3LMW A;  3KRG A;  4Z03 A;  2EWE A;  4XL9 A;  1DBO A;  2X85 A;  1RU4 A;  3VST A;  2PEC A;  1IA5 A;  3VMV A;  2O04 A;  3B4N A;  1O8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...