1O8JA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 30mm ca2+
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 137
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8jA00
4XMYA 4XKVA 1O88A 2X6YA 4PMHA 4XN0A 1OGMX 2X3HA 4YZXA 1IDKA 1X0CA 2VBKA 4XLFA 2BSPA 1IA5A 4YEJA 1JRGA 4I84A 1BN8A 4XR6A 1KTWA 4XKWA 4MXNA 2O04A 2PECA 3GQ9A 1O8GA 2NTBA 4XQFA 4MR0A 2NTPA 4OJPA 3VMWA 3WWGA 1RMGA 2UVFA 4XOTA 4OJLA 4U4BA 3VMVA 1DBOA 4XLEA 1VBLA 4Z05A 4XOPA 1OFMA 2VBEA 4NK8A 3JURA 1DBGA 2NZMA 4W8QA 1HG8A 1IB4A 2ODLA 4EW9A 2O17A 1WMRA 2X6XA 4OJ6A 3B4NA 4Z06A 4XM3A 2NT6A 1O8EA 1O8DA 4XONA 4NK6A 2VBMA 4OJOA 1PE9A 1O8LA 2NSTA 4OZYA 3GQ7A 4XNFA 4OJ5A 3B8YA 1H80A 3GQ8A 4YELA 2Z8GA 1O8MA 3VSUA 4W8TA 3UW0A 1OGOX 1GQ8A 1RWRA 1NHCA 1XG2A 2PYGA 5C1EA 3EQNA 1QCXA 2QX3A 3KRGA 2QXZA 1QJVA 1AIRA 1BHEA 4XLHA 1O8IA 3GQAA 4HWVA 4OZZA 2NT9A 4W8RA 2NSPA 2IQ7A 2QY1A 1CZFA 3SUCA 1EE6A 2X85A 2INVA 3EQOA 4U49A 4Z03A 2PYHA 2EWEA 3VSVA 1IDJA 3LMWA 4XLCA 5AMVA 3ZSCA 4URRA 4C2LA 1PLUA 4XLAA 1O8JA 3B90A 4YZAA 3FY3A 2O0VA 4AVZA 2O1DA 4XORA 1KCDA 2NTQA 4XL9A 4XN3A 1O8HA 1JTAA 1OFLA 1O8FA 1O8KA 1RU4A 4W8SA 4YZ0A 2VJIA 2VJJA 1K5CA 1PXZA 2X6WA 3GRHA 2O0WA 4YZQA 3ZPPA 3T9GA 1KCCA 2UVEA 3VSTA 1OOCA 2INUA 5C1CA
chains in the Genus database with same CATH superfamily
4XMYA 1OFEA 4XKVA 1O88A 2BM6A 2X6YA 4PMHA 4XN0A 1OGMX 2XTWA 2X3HA 4YZXA 1LM1A 2G0YA 1IDKA 1X0CA 2VBKA 4XLFA 2BSPA 5JMCB 1QA1A 2B0RA 3N6ZA 4YEJA 1IA5A 1JRGA 2BX6A 4I84A 1BN8A 3NAWA 4XR6A 4KH3A 1KTWA 4XKWA 4MXNA 1OFDA 2O04A 2PECA 3GQ9A 1O8GA 2NTBA 4YEIA 4XQFA 2BM5A 2XT2A 4MR0A 2NTPA 4OJPA 3VMWA 3WWGA 1RMGA 2QYUA 2UVFA 1QRBA 4XOTA 4OJLA 2XTXA 4U4BA 2YUHA 3VMVA 4V02C 1DBOA 2J8KA 2XT4A 4XLEA 1QQ1A 1VBLA 4Z05A 4XOPA 1TSPA 1OFMA 2BM4A 2VBEA 4NK8A 2VFNA 2W7ZA 3JURA 3SYJA 1QA3A 1DBGA 2NZMA 4W8QA 1HG8A 1IB4A 4YCQA 2ODLA 3ML3A 4EW9A 1TYUA 1WMRA 2IOUG 2O17A 2X6XA 4OJ6A 3B4NA 2XC1A 4Z06A 4XM3A 2NT6A 1O8EA 1O8DA 4XONA 4NK6A 2VBMA 1LLZA 2J8IA 4OJOA 1PE9A 1O8LA 2NSTA 3LYCA 3GQ7A 4OZYA 4OJ5A 3B8YA 4XNFA 1H80A 3GQ8A 4YELA 2Z8GA 5DNSA 1O8MA 3VSUA 4W8TA 3AK5A 3UW0A 1OGOX 1KQ5A 1GQ8A 1RWRA 1NHCA 1XG2A 2VFPA 2PYGA 3H09A 3EQNA 5C1EA 2XTYA 1L1IA 3N90A 1QCXA 2QX3A 3RIQA 3KRGA 2QXZA 1QJVA 1AIRA 1BHEA 4XLHA 1O8IA 3GQAA 3NB2A 4HWVA 4OZZA 2NT9A 4W8RA 2NSPA 2IQ7A 2QY1A 1K8FA 4JRAC 1CZFA 4YDTA 1WXRA 3SUCA 1EE6A 1LLWA 2INVA 2X85A 3EQOA 4U49A 4Z03A 2O6WA 3BH7B 3PSZA 3TH0A 1DABA 1CLWA 4YFOA 1EZGA 2PYHA 2EWEA 3BH6B 3VSVA 1IDJA 2VFMA 1TYXA 3LMWA 4XLCA 5AMVA 5JLVC 3ZSCA 2VFOA 3LJYA 4URRA 1PLUA 4XLAA 4C2LA 2V5IA 3JX8A 1O8JA 3B90A 4YZAA 3FY3A 3SQVA 3PSSA 3SY2A 2O0VA 4AVZA 2O1DA 4OM9A 4XORA 1KCDA 2NTQA 4XL9A 4XN3A 3P4GA 2BM7A 1O8HA 1JTAA 3PETA 1OFLA 1O8FA 1TYVA 1TYWA 1O8KA 1EA0A 2VFQA 4OPWA 1RU4A 1K4ZA 4W8SA 1HF2A 4YZ0A 2VJIA 2VJJA 1K5CA 1PXZA 2X6WA 1QA2A 1QRCA 3GRHA 4YC5A 2QZAA 2O0WA 4YZQA 3ZPPA 3T9GA 1KCCA 2F3LA 2UVEA 3VSTA 3DU1X 1OOCA 3SZEA 2INUA 5C1CA
chains in the Genus database with same CATH topology
4XMYA 4XKVA 1O88A 2X6YA 4PMHA 4XN0A 1OGMX 2X3HA 4YZXA 1IDKA 1X0CA 2VBKA 4XLFA 2BSPA 1IA5A 4YEJA 1JRGA 4I84A 1BN8A 4XR6A 1KTWA 4XKWA 4MXNA 2O04A 2PECA 3GQ9A 1O8GA 2NTBA 4XQFA 4MR0A 2NTPA 4OJPA 3VMWA 3WWGA 1RMGA 2UVFA 4XOTA 4OJLA 4U4BA 3VMVA 1DBOA 4XLEA 1VBLA 4Z05A 4XOPA 1OFMA 2VBEA 4NK8A 3JURA 1DBGA 2NZMA 4W8QA 1HG8A 1IB4A 2ODLA 4EW9A 2O17A 1WMRA 2X6XA 4OJ6A 3B4NA 4Z06A 4XM3A 2NT6A 1O8EA 1O8DA 4XONA 4NK6A 2VBMA 4OJOA 1PE9A 1O8LA 2NSTA 4OZYA 3GQ7A 4XNFA 4OJ5A 3B8YA 1H80A 3GQ8A 4YELA 2Z8GA 1O8MA 3VSUA 4W8TA 3UW0A 1OGOX 1GQ8A 1RWRA 1NHCA 1XG2A 2PYGA 5C1EA 3EQNA 1QCXA 2QX3A 3KRGA 2QXZA 1QJVA 1AIRA 1BHEA 4XLHA 1O8IA 3GQAA 4HWVA 4OZZA 2NT9A 4W8RA 2NSPA 2IQ7A 2QY1A 1CZFA 3SUCA 1EE6A 2X85A 2INVA 3EQOA 4U49A 4Z03A 2PYHA 2EWEA 3VSVA 1IDJA 3LMWA 4XLCA 5AMVA 3ZSCA 4URRA 4C2LA 1PLUA 4XLAA 1O8JA 3B90A 4YZAA 3FY3A 2O0VA 4AVZA 2O1DA 4XORA 1KCDA 2NTQA 4XL9A 4XN3A 1O8HA 1JTAA 1OFLA 1O8FA 1O8KA 1RU4A 4W8SA 4YZ0A 2VJIA 2VJJA 1K5CA 1PXZA 2X6WA 3GRHA 2O0WA 4YZQA 3ZPPA 3T9GA 1KCCA 2UVEA 3VSTA 1OOCA 2INUA 5C1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XMY A;  4XKV A;  1O88 A;  2X6Y A;  4PMH A;  4XN0 A;  1OGM X;  2X3H A;  4YZX A;  1IDK A;  1X0C A;  2VBK A;  4XLF A;  2BSP A;  1IA5 A;  4YEJ A;  1JRG A;  4I84 A;  1BN8 A;  4XR6 A;  1KTW A;  4XKW A;  4MXN A;  2O04 A;  2PEC A;  3GQ9 A;  1O8G A;  2NTB A;  4XQF A;  4MR0 A;  2NTP A;  4OJP A;  3VMW A;  3WWG A;  1RMG A;  2UVF A;  4XOT A;  4OJL A;  4U4B A;  3VMV A;  1DBO A;  4XLE A;  1VBL A;  4Z05 A;  4XOP A;  1OFM A;  2VBE A;  4NK8 A;  3JUR A;  1DBG A;  2NZM A;  4W8Q A;  1HG8 A;  1IB4 A;  2ODL A;  4EW9 A;  2O17 A;  1WMR A;  2X6X A;  4OJ6 A;  3B4N A;  4Z06 A;  4XM3 A;  2NT6 A;  1O8E A;  1O8D A;  4XON A;  4NK6 A;  2VBM A;  4OJO A;  1PE9 A;  1O8L A;  2NST A;  4OZY A;  3GQ7 A;  4XNF A;  4OJ5 A;  3B8Y A;  1H80 A;  3GQ8 A;  4YEL A;  2Z8G A;  1O8M A;  3VSU A;  4W8T A;  3UW0 A;  1OGO X;  1GQ8 A;  1RWR A;  1NHC A;  1XG2 A;  2PYG A;  5C1E A;  3EQN A;  1QCX A;  2QX3 A;  3KRG A;  2QXZ A;  1QJV A;  1AIR A;  1BHE A;  4XLH A;  1O8I A;  3GQA A;  4HWV A;  4OZZ A;  2NT9 A;  4W8R A;  2NSP A;  2IQ7 A;  2QY1 A;  1CZF A;  3SUC A;  1EE6 A;  2X85 A;  2INV A;  3EQO A;  4U49 A;  4Z03 A;  2PYH A;  2EWE A;  3VSV A;  1IDJ A;  3LMW A;  4XLC A;  5AMV A;  3ZSC A;  4URR A;  4C2L A;  1PLU A;  4XLA A;  1O8J A;  3B90 A;  4YZA A;  3FY3 A;  2O0V A;  4AVZ A;  2O1D A;  4XOR A;  1KCD A;  2NTQ A;  4XL9 A;  4XN3 A;  1O8H A;  1JTA A;  1OFL A;  1O8F A;  1O8K A;  1RU4 A;  4W8S A;  4YZ0 A;  2VJI A;  2VJJ A;  1K5C A;  1PXZ A;  2X6W A;  3GRH A;  2O0W A;  4YZQ A;  3ZPP A;  3T9G A;  1KCC A;  2UVE A;  3VST A;  1OOC A;  2INU A;  5C1C A; 
#chains in the Genus database with same CATH topology
 4XMY A;  1OFE A;  4XKV A;  1O88 A;  2BM6 A;  2X6Y A;  4PMH A;  4XN0 A;  1OGM X;  2XTW A;  2X3H A;  4YZX A;  1LM1 A;  2G0Y A;  1IDK A;  1X0C A;  2VBK A;  4XLF A;  2BSP A;  5JMC B;  1QA1 A;  2B0R A;  3N6Z A;  4YEJ A;  1IA5 A;  1JRG A;  2BX6 A;  4I84 A;  1BN8 A;  3NAW A;  4XR6 A;  4KH3 A;  1KTW A;  4XKW A;  4MXN A;  1OFD A;  2O04 A;  2PEC A;  3GQ9 A;  1O8G A;  2NTB A;  4YEI A;  4XQF A;  2BM5 A;  2XT2 A;  4MR0 A;  2NTP A;  4OJP A;  3VMW A;  3WWG A;  1RMG A;  2QYU A;  2UVF A;  1QRB A;  4XOT A;  4OJL A;  2XTX A;  4U4B A;  2YUH A;  3VMV A;  4V02 C;  1DBO A;  2J8K A;  2XT4 A;  4XLE A;  1QQ1 A;  1VBL A;  4Z05 A;  4XOP A;  1TSP A;  1OFM A;  2BM4 A;  2VBE A;  4NK8 A;  2VFN A;  2W7Z A;  3JUR A;  3SYJ A;  1QA3 A;  1DBG A;  2NZM A;  4W8Q A;  1HG8 A;  1IB4 A;  4YCQ A;  2ODL A;  3ML3 A;  4EW9 A;  1TYU A;  1WMR A;  2IOU G;  2O17 A;  2X6X A;  4OJ6 A;  3B4N A;  2XC1 A;  4Z06 A;  4XM3 A;  2NT6 A;  1O8E A;  1O8D A;  4XON A;  4NK6 A;  2VBM A;  1LLZ A;  2J8I A;  4OJO A;  1PE9 A;  1O8L A;  2NST A;  3LYC A;  3GQ7 A;  4OZY A;  4OJ5 A;  3B8Y A;  4XNF A;  1H80 A;  3GQ8 A;  4YEL A;  2Z8G A;  5DNS A;  1O8M A;  3VSU A;  4W8T A;  3AK5 A;  3UW0 A;  1OGO X;  1KQ5 A;  1GQ8 A;  1RWR A;  1NHC A;  1XG2 A;  2VFP A;  2PYG A;  3H09 A;  3EQN A;  5C1E A;  2XTY A;  1L1I A;  3N90 A;  1QCX A;  2QX3 A;  3RIQ A;  3KRG A;  2QXZ A;  1QJV A;  1AIR A;  1BHE A;  4XLH A;  1O8I A;  3GQA A;  3NB2 A;  4HWV A;  4OZZ A;  2NT9 A;  4W8R A;  2NSP A;  2IQ7 A;  2QY1 A;  1K8F A;  4JRA C;  1CZF A;  4YDT A;  1WXR A;  3SUC A;  1EE6 A;  1LLW A;  2INV A;  2X85 A;  3EQO A;  4U49 A;  4Z03 A;  2O6W A;  3BH7 B;  3PSZ A;  3TH0 A;  1DAB A;  1CLW A;  4YFO A;  1EZG A;  2PYH A;  2EWE A;  3BH6 B;  3VSV A;  1IDJ A;  2VFM A;  1TYX A;  3LMW A;  4XLC A;  5AMV A;  5JLV C;  3ZSC A;  2VFO A;  3LJY A;  4URR A;  1PLU A;  4XLA A;  4C2L A;  2V5I A;  3JX8 A;  1O8J A;  3B90 A;  4YZA A;  3FY3 A;  3SQV A;  3PSS A;  3SY2 A;  2O0V A;  4AVZ A;  2O1D A;  4OM9 A;  4XOR A;  1KCD A;  2NTQ A;  4XL9 A;  4XN3 A;  3P4G A;  2BM7 A;  1O8H A;  1JTA A;  3PET A;  1OFL A;  1O8F A;  1TYV A;  1TYW A;  1O8K A;  1EA0 A;  2VFQ A;  4OPW A;  1RU4 A;  1K4Z A;  4W8S A;  1HF2 A;  4YZ0 A;  2VJI A;  2VJJ A;  1K5C A;  1PXZ A;  2X6W A;  1QA2 A;  1QRC A;  3GRH A;  4YC5 A;  2QZA A;  2O0W A;  4YZQ A;  3ZPP A;  3T9G A;  1KCC A;  2F3L A;  2UVE A;  3VST A;  3DU1 X;  1OOC A;  3SZE A;  2INU A;  5C1C A; 
#chains in the Genus database with same CATH homology
 4XMY A;  4XKV A;  1O88 A;  2X6Y A;  4PMH A;  4XN0 A;  1OGM X;  2X3H A;  4YZX A;  1IDK A;  1X0C A;  2VBK A;  4XLF A;  2BSP A;  1IA5 A;  4YEJ A;  1JRG A;  4I84 A;  1BN8 A;  4XR6 A;  1KTW A;  4XKW A;  4MXN A;  2O04 A;  2PEC A;  3GQ9 A;  1O8G A;  2NTB A;  4XQF A;  4MR0 A;  2NTP A;  4OJP A;  3VMW A;  3WWG A;  1RMG A;  2UVF A;  4XOT A;  4OJL A;  4U4B A;  3VMV A;  1DBO A;  4XLE A;  1VBL A;  4Z05 A;  4XOP A;  1OFM A;  2VBE A;  4NK8 A;  3JUR A;  1DBG A;  2NZM A;  4W8Q A;  1HG8 A;  1IB4 A;  2ODL A;  4EW9 A;  2O17 A;  1WMR A;  2X6X A;  4OJ6 A;  3B4N A;  4Z06 A;  4XM3 A;  2NT6 A;  1O8E A;  1O8D A;  4XON A;  4NK6 A;  2VBM A;  4OJO A;  1PE9 A;  1O8L A;  2NST A;  4OZY A;  3GQ7 A;  4XNF A;  4OJ5 A;  3B8Y A;  1H80 A;  3GQ8 A;  4YEL A;  2Z8G A;  1O8M A;  3VSU A;  4W8T A;  3UW0 A;  1OGO X;  1GQ8 A;  1RWR A;  1NHC A;  1XG2 A;  2PYG A;  5C1E A;  3EQN A;  1QCX A;  2QX3 A;  3KRG A;  2QXZ A;  1QJV A;  1AIR A;  1BHE A;  4XLH A;  1O8I A;  3GQA A;  4HWV A;  4OZZ A;  2NT9 A;  4W8R A;  2NSP A;  2IQ7 A;  2QY1 A;  1CZF A;  3SUC A;  1EE6 A;  2X85 A;  2INV A;  3EQO A;  4U49 A;  4Z03 A;  2PYH A;  2EWE A;  3VSV A;  1IDJ A;  3LMW A;  4XLC A;  5AMV A;  3ZSC A;  4URR A;  4C2L A;  1PLU A;  4XLA A;  1O8J A;  3B90 A;  4YZA A;  3FY3 A;  2O0V A;  4AVZ A;  2O1D A;  4XOR A;  1KCD A;  2NTQ A;  4XL9 A;  4XN3 A;  1O8H A;  1JTA A;  1OFL A;  1O8F A;  1O8K A;  1RU4 A;  4W8S A;  4YZ0 A;  2VJI A;  2VJJ A;  1K5C A;  1PXZ A;  2X6W A;  3GRH A;  2O0W A;  4YZQ A;  3ZPP A;  3T9G A;  1KCC A;  2UVE A;  3VST A;  1OOC A;  2INU A;  5C1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...