1O8JA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 30mm ca2+
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 137
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8jA00
1O8KA 3VSUA 4XONA 1O8HA 2Z8GA 1OOCA 2NT6A 3SUCA 3LMWA 2NTQA 3EQOA 3GQ7A 1QCXA 3JURA 4NK8A 4XLHA 1K5CA 3UW0A 4XLEA 4XORA 1O8GA 4XKWA 4XN0A 4W8TA 1HG8A 2NT9A 3VSVA 1KCDA 1O8IA 3FY3A 3VSTA 4AVZA 5AMVA 2O1DA 4XR6A 3KRGA 3ZPPA 1OFMA 4W8RA 4YZQA 4PMHA 2X3HA 2X6YA 1EE6A 1RMGA 1IA5A 3GRHA 3GQ8A 3EQNA 2QXZA 4MR0A 4XLFA 2VJJA 3ZSCA 4YZXA 2EWEA 3B4NA 2O0VA 4Z05A 2X6XA 4YELA 1RU4A 1NHCA 1PLUA 1OGOX 4XQFA 2PYGA 1KCCA 2VBKA 1IB4A 1H80A 5C1EA 4XLAA 4W8QA 1JTAA 1O8JA 1BHEA 1JRGA 4XN3A 4HWVA 4NK6A 3T9GA 1O8LA 2BSPA 4OZYA 4XOPA 2VBMA 1VBLA 3GQ9A 1O8MA 2NSTA 2NTBA 4XOTA 1PE9A 4W8SA 3GQAA 4OJ5A 4OJ6A 2X6WA 4EW9A 4OJOA 4URRA 1QJVA 3VMWA 2VBEA 4C2LA 1GQ8A 2UVEA 1DBOA 2NTPA 1O88A 2QY1A 4XKVA 4XM3A 4I84A 4XNFA 4YZAA 4Z06A 2X85A 1BN8A 1O8EA 4OZZA 5C1CA 1OGMX 1X0CA 2INVA 4Z03A 1CZFA 4U4BA 2ODLA 3VMVA 1IDKA 1AIRA 2IQ7A 3B8YA 4OJLA 1KTWA 3B90A 1RWRA 2O04A 2INUA 4U49A 3WWGA 4XLCA 1IDJA 4YEJA 1OFLA 2O17A 2PYHA 4XMYA 1DBGA 4MXNA 2NSPA 2VJIA 1PXZA 2NZMA 1O8FA 1XG2A 2O0WA 2PECA 1WMRA 2UVFA 4YZ0A 4XL9A 2QX3A 1O8DA 4OJPA
chains in the Genus database with same CATH superfamily
1O8KA 3VSUA 4XONA 1O8HA 1OOCA 2NT6A 2Z8GA 3SUCA 3LMWA 2NTQA 3EQOA 3GQ7A 1QCXA 3JURA 4NK8A 4XLHA 1LLZA 3UW0A 1K5CA 4KH3A 4XLEA 2XTWA 4XORA 3PSSA 3PETA 1O8GA 4XKWA 4XN0A 4W8TA 3BH6B 1OFDA 1HG8A 2NT9A 5DNSA 3VSVA 2VFOA 2BM6A 1KCDA 1O8IA 3NAWA 1K4ZA 3FY3A 1HF2A 3VSTA 4AVZA 5AMVA 2O1DA 2BM5A 3KRGA 3P4GA 4XR6A 3ZPPA 2YUHA 1OFMA 4OPWA 3SYJA 4W8RA 4YZQA 1DABA 4PMHA 2VFMA 2X3HA 2X6YA 1EE6A 1RMGA 2BX6A 3H09A 3GRHA 1QRBA 3GQ8A 4JRAC 1IA5A 3EQNA 2QXZA 4MR0A 4XLFA 1TYWA 2VJJA 4YZXA 2EWEA 3B4NA 3ZSCA 2O0VA 4Z05A 3N6ZA 2X6XA 1LLWA 1RU4A 4YELA 1NHCA 1WXRA 1QQ1A 1PLUA 1OGOX 2VFQA 5JLVC 1TYXA 3LJYA 4XQFA 2PYGA 1KCCA 2VBKA 1IB4A 1H80A 5C1EA 4XLAA 1TYVA 2IOUG 2QZAA 4W8QA 3RIQA 3SY2A 1JTAA 1O8JA 1BHEA 1JRGA 1TYUA 4YDTA 4XN3A 4HWVA 4NK6A 2BM7A 3T9GA 3NB2A 1O8LA 2XT2A 4YC5A 2BSPA 3JX8A 1CLWA 4OZYA 3LYCA 4XOPA 2VBMA 1VBLA 2VFNA 3GQ9A 1O8MA 2NSTA 2J8IA 2BM4A 2NTBA 4XOTA 1PE9A 4W8SA 1EA0A 3N90A 3BH7B 3GQAA 1KQ5A 4YCQA 2XTYA 3PSZA 4OJ5A 4OJ6A 2X6WA 4EW9A 4OJOA 4URRA 1QJVA 2G0YA 3VMWA 2W7ZA 2VBEA 1QA1A 1L1IA 4C2LA 1GQ8A 1OFEA 2UVEA 2VFPA 1DBOA 2NTPA 1O88A 2QY1A 3ML3A 2XTXA 4XKVA 4XM3A 4I84A 4YFOA 4XNFA 4YZAA 3AK5A 4Z06A 2X85A 1BN8A 1O8EA 4OZZA 5C1CA 1OGMX 1X0CA 2INVA 4Z03A 1QA2A 1CZFA 4U4BA 2ODLA 3VMVA 1IDKA 2B0RA 1EZGA 1AIRA 1TSPA 2XT4A 2IQ7A 3B8YA 3DU1X 4OJLA 2F3LA 1KTWA 3B90A 2XC1A 1RWRA 3TH0A 2O04A 2INUA 3SQVA 4YEIA 4OM9A 1LM1A 2O6WA 4U49A 2QYUA 3WWGA 4XLCA 1IDJA 4YEJA 1OFLA 2O17A 2PYHA 4XMYA 1DBGA 4MXNA 5JMCB 2NSPA 2VJIA 1PXZA 2NZMA 1O8FA 1XG2A 2O0WA 2PECA 3SZEA 1QRCA 1WMRA 2UVFA 4YZ0A 4V02C 4XL9A 2QX3A 2V5IA 1O8DA 1K8FA 2J8KA 4OJPA 1QA3A
chains in the Genus database with same CATH topology
1O8KA 3VSUA 4XONA 1O8HA 2Z8GA 1OOCA 2NT6A 3SUCA 3LMWA 2NTQA 3EQOA 3GQ7A 1QCXA 3JURA 4NK8A 4XLHA 1K5CA 3UW0A 4XLEA 4XORA 1O8GA 4XKWA 4XN0A 4W8TA 1HG8A 2NT9A 3VSVA 1KCDA 1O8IA 3FY3A 3VSTA 4AVZA 5AMVA 2O1DA 4XR6A 3KRGA 3ZPPA 1OFMA 4W8RA 4YZQA 4PMHA 2X3HA 2X6YA 1EE6A 1RMGA 1IA5A 3GRHA 3GQ8A 3EQNA 2QXZA 4MR0A 4XLFA 2VJJA 3ZSCA 4YZXA 2EWEA 3B4NA 2O0VA 4Z05A 2X6XA 4YELA 1RU4A 1NHCA 1PLUA 1OGOX 4XQFA 2PYGA 1KCCA 2VBKA 1IB4A 1H80A 5C1EA 4XLAA 4W8QA 1JTAA 1O8JA 1BHEA 1JRGA 4XN3A 4HWVA 4NK6A 3T9GA 1O8LA 2BSPA 4OZYA 4XOPA 2VBMA 1VBLA 3GQ9A 1O8MA 2NSTA 2NTBA 4XOTA 1PE9A 4W8SA 3GQAA 4OJ5A 4OJ6A 2X6WA 4EW9A 4OJOA 4URRA 1QJVA 3VMWA 2VBEA 4C2LA 1GQ8A 2UVEA 1DBOA 2NTPA 1O88A 2QY1A 4XKVA 4XM3A 4I84A 4XNFA 4YZAA 4Z06A 2X85A 1BN8A 1O8EA 4OZZA 5C1CA 1OGMX 1X0CA 2INVA 4Z03A 1CZFA 4U4BA 2ODLA 3VMVA 1IDKA 1AIRA 2IQ7A 3B8YA 4OJLA 1KTWA 3B90A 1RWRA 2O04A 2INUA 4U49A 3WWGA 4XLCA 1IDJA 4YEJA 1OFLA 2O17A 2PYHA 4XMYA 1DBGA 4MXNA 2NSPA 2VJIA 1PXZA 2NZMA 1O8FA 1XG2A 2O0WA 2PECA 1WMRA 2UVFA 4YZ0A 4XL9A 2QX3A 1O8DA 4OJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8K A;  3VSU A;  4XON A;  1O8H A;  2Z8G A;  1OOC A;  2NT6 A;  3SUC A;  3LMW A;  2NTQ A;  3EQO A;  3GQ7 A;  1QCX A;  3JUR A;  4NK8 A;  4XLH A;  1K5C A;  3UW0 A;  4XLE A;  4XOR A;  1O8G A;  4XKW A;  4XN0 A;  4W8T A;  1HG8 A;  2NT9 A;  3VSV A;  1KCD A;  1O8I A;  3FY3 A;  3VST A;  4AVZ A;  5AMV A;  2O1D A;  4XR6 A;  3KRG A;  3ZPP A;  1OFM A;  4W8R A;  4YZQ A;  4PMH A;  2X3H A;  2X6Y A;  1EE6 A;  1RMG A;  1IA5 A;  3GRH A;  3GQ8 A;  3EQN A;  2QXZ A;  4MR0 A;  4XLF A;  2VJJ A;  3ZSC A;  4YZX A;  2EWE A;  3B4N A;  2O0V A;  4Z05 A;  2X6X A;  4YEL A;  1RU4 A;  1NHC A;  1PLU A;  1OGO X;  4XQF A;  2PYG A;  1KCC A;  2VBK A;  1IB4 A;  1H80 A;  5C1E A;  4XLA A;  4W8Q A;  1JTA A;  1O8J A;  1BHE A;  1JRG A;  4XN3 A;  4HWV A;  4NK6 A;  3T9G A;  1O8L A;  2BSP A;  4OZY A;  4XOP A;  2VBM A;  1VBL A;  3GQ9 A;  1O8M A;  2NST A;  2NTB A;  4XOT A;  1PE9 A;  4W8S A;  3GQA A;  4OJ5 A;  4OJ6 A;  2X6W A;  4EW9 A;  4OJO A;  4URR A;  1QJV A;  3VMW A;  2VBE A;  4C2L A;  1GQ8 A;  2UVE A;  1DBO A;  2NTP A;  1O88 A;  2QY1 A;  4XKV A;  4XM3 A;  4I84 A;  4XNF A;  4YZA A;  4Z06 A;  2X85 A;  1BN8 A;  1O8E A;  4OZZ A;  5C1C A;  1OGM X;  1X0C A;  2INV A;  4Z03 A;  1CZF A;  4U4B A;  2ODL A;  3VMV A;  1IDK A;  1AIR A;  2IQ7 A;  3B8Y A;  4OJL A;  1KTW A;  3B90 A;  1RWR A;  2O04 A;  2INU A;  4U49 A;  3WWG A;  4XLC A;  1IDJ A;  4YEJ A;  1OFL A;  2O17 A;  2PYH A;  4XMY A;  1DBG A;  4MXN A;  2NSP A;  2VJI A;  1PXZ A;  2NZM A;  1O8F A;  1XG2 A;  2O0W A;  2PEC A;  1WMR A;  2UVF A;  4YZ0 A;  4XL9 A;  2QX3 A;  1O8D A;  4OJP A; 
#chains in the Genus database with same CATH topology
 1O8K A;  3VSU A;  4XON A;  1O8H A;  1OOC A;  2NT6 A;  2Z8G A;  3SUC A;  3LMW A;  2NTQ A;  3EQO A;  3GQ7 A;  1QCX A;  3JUR A;  4NK8 A;  4XLH A;  1LLZ A;  3UW0 A;  1K5C A;  4KH3 A;  4XLE A;  2XTW A;  4XOR A;  3PSS A;  3PET A;  1O8G A;  4XKW A;  4XN0 A;  4W8T A;  3BH6 B;  1OFD A;  1HG8 A;  2NT9 A;  5DNS A;  3VSV A;  2VFO A;  2BM6 A;  1KCD A;  1O8I A;  3NAW A;  1K4Z A;  3FY3 A;  1HF2 A;  3VST A;  4AVZ A;  5AMV A;  2O1D A;  2BM5 A;  3KRG A;  3P4G A;  4XR6 A;  3ZPP A;  2YUH A;  1OFM A;  4OPW A;  3SYJ A;  4W8R A;  4YZQ A;  1DAB A;  4PMH A;  2VFM A;  2X3H A;  2X6Y A;  1EE6 A;  1RMG A;  2BX6 A;  3H09 A;  3GRH A;  1QRB A;  3GQ8 A;  4JRA C;  1IA5 A;  3EQN A;  2QXZ A;  4MR0 A;  4XLF A;  1TYW A;  2VJJ A;  4YZX A;  2EWE A;  3B4N A;  3ZSC A;  2O0V A;  4Z05 A;  3N6Z A;  2X6X A;  1LLW A;  1RU4 A;  4YEL A;  1NHC A;  1WXR A;  1QQ1 A;  1PLU A;  1OGO X;  2VFQ A;  5JLV C;  1TYX A;  3LJY A;  4XQF A;  2PYG A;  1KCC A;  2VBK A;  1IB4 A;  1H80 A;  5C1E A;  4XLA A;  1TYV A;  2IOU G;  2QZA A;  4W8Q A;  3RIQ A;  3SY2 A;  1JTA A;  1O8J A;  1BHE A;  1JRG A;  1TYU A;  4YDT A;  4XN3 A;  4HWV A;  4NK6 A;  2BM7 A;  3T9G A;  3NB2 A;  1O8L A;  2XT2 A;  4YC5 A;  2BSP A;  3JX8 A;  1CLW A;  4OZY A;  3LYC A;  4XOP A;  2VBM A;  1VBL A;  2VFN A;  3GQ9 A;  1O8M A;  2NST A;  2J8I A;  2BM4 A;  2NTB A;  4XOT A;  1PE9 A;  4W8S A;  1EA0 A;  3N90 A;  3BH7 B;  3GQA A;  1KQ5 A;  4YCQ A;  2XTY A;  3PSZ A;  4OJ5 A;  4OJ6 A;  2X6W A;  4EW9 A;  4OJO A;  4URR A;  1QJV A;  2G0Y A;  3VMW A;  2W7Z A;  2VBE A;  1QA1 A;  1L1I A;  4C2L A;  1GQ8 A;  1OFE A;  2UVE A;  2VFP A;  1DBO A;  2NTP A;  1O88 A;  2QY1 A;  3ML3 A;  2XTX A;  4XKV A;  4XM3 A;  4I84 A;  4YFO A;  4XNF A;  4YZA A;  3AK5 A;  4Z06 A;  2X85 A;  1BN8 A;  1O8E A;  4OZZ A;  5C1C A;  1OGM X;  1X0C A;  2INV A;  4Z03 A;  1QA2 A;  1CZF A;  4U4B A;  2ODL A;  3VMV A;  1IDK A;  2B0R A;  1EZG A;  1AIR A;  1TSP A;  2XT4 A;  2IQ7 A;  3B8Y A;  3DU1 X;  4OJL A;  2F3L A;  1KTW A;  3B90 A;  2XC1 A;  1RWR A;  3TH0 A;  2O04 A;  2INU A;  3SQV A;  4YEI A;  4OM9 A;  1LM1 A;  2O6W A;  4U49 A;  2QYU A;  3WWG A;  4XLC A;  1IDJ A;  4YEJ A;  1OFL A;  2O17 A;  2PYH A;  4XMY A;  1DBG A;  4MXN A;  5JMC B;  2NSP A;  2VJI A;  1PXZ A;  2NZM A;  1O8F A;  1XG2 A;  2O0W A;  2PEC A;  3SZE A;  1QRC A;  1WMR A;  2UVF A;  4YZ0 A;  4V02 C;  4XL9 A;  2QX3 A;  2V5I A;  1O8D A;  1K8F A;  2J8K A;  4OJP A;  1QA3 A; 
#chains in the Genus database with same CATH homology
 1O8K A;  3VSU A;  4XON A;  1O8H A;  2Z8G A;  1OOC A;  2NT6 A;  3SUC A;  3LMW A;  2NTQ A;  3EQO A;  3GQ7 A;  1QCX A;  3JUR A;  4NK8 A;  4XLH A;  1K5C A;  3UW0 A;  4XLE A;  4XOR A;  1O8G A;  4XKW A;  4XN0 A;  4W8T A;  1HG8 A;  2NT9 A;  3VSV A;  1KCD A;  1O8I A;  3FY3 A;  3VST A;  4AVZ A;  5AMV A;  2O1D A;  4XR6 A;  3KRG A;  3ZPP A;  1OFM A;  4W8R A;  4YZQ A;  4PMH A;  2X3H A;  2X6Y A;  1EE6 A;  1RMG A;  1IA5 A;  3GRH A;  3GQ8 A;  3EQN A;  2QXZ A;  4MR0 A;  4XLF A;  2VJJ A;  3ZSC A;  4YZX A;  2EWE A;  3B4N A;  2O0V A;  4Z05 A;  2X6X A;  4YEL A;  1RU4 A;  1NHC A;  1PLU A;  1OGO X;  4XQF A;  2PYG A;  1KCC A;  2VBK A;  1IB4 A;  1H80 A;  5C1E A;  4XLA A;  4W8Q A;  1JTA A;  1O8J A;  1BHE A;  1JRG A;  4XN3 A;  4HWV A;  4NK6 A;  3T9G A;  1O8L A;  2BSP A;  4OZY A;  4XOP A;  2VBM A;  1VBL A;  3GQ9 A;  1O8M A;  2NST A;  2NTB A;  4XOT A;  1PE9 A;  4W8S A;  3GQA A;  4OJ5 A;  4OJ6 A;  2X6W A;  4EW9 A;  4OJO A;  4URR A;  1QJV A;  3VMW A;  2VBE A;  4C2L A;  1GQ8 A;  2UVE A;  1DBO A;  2NTP A;  1O88 A;  2QY1 A;  4XKV A;  4XM3 A;  4I84 A;  4XNF A;  4YZA A;  4Z06 A;  2X85 A;  1BN8 A;  1O8E A;  4OZZ A;  5C1C A;  1OGM X;  1X0C A;  2INV A;  4Z03 A;  1CZF A;  4U4B A;  2ODL A;  3VMV A;  1IDK A;  1AIR A;  2IQ7 A;  3B8Y A;  4OJL A;  1KTW A;  3B90 A;  1RWR A;  2O04 A;  2INU A;  4U49 A;  3WWG A;  4XLC A;  1IDJ A;  4YEJ A;  1OFL A;  2O17 A;  2PYH A;  4XMY A;  1DBG A;  4MXN A;  2NSP A;  2VJI A;  1PXZ A;  2NZM A;  1O8F A;  1XG2 A;  2O0W A;  2PEC A;  1WMR A;  2UVF A;  4YZ0 A;  4XL9 A;  2QX3 A;  1O8D A;  4OJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...