3N90A

The 1.7 angstrom resolution crystal structure of at2g44920, a pentapeptide repeat protein from arabidopsis thaliana thylakoid lumen.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
145
structure length
145
Chain Sequence
b'AFKGGGPYGQGVTRGQDLSGKDFSGQTLIRQDFKTSILRQANFKGAKLLGASFFDADLTGADLSEADLRGADFSLANVTKVNLTNANLEGATMMGNTSFKGSNITGADFTDVPLRDDQRVYLCKVADGVNATTGNATRDTLLCNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thylakoid lumenal 15 kDa protein 1, chloroplastic
publication title The 1.7 Angstrom resolution crystal structure of AT2G44920, a pentapeptide repeat protein from Arabidopsis thaliana thylakoid lumen.
rcsb
source organism Arabidopsis thaliana
molecule tags Unknown function
total genus 67
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3n90A00
2BM4A 3N90A 2BM5A 5JLVC 5JMCB 2W7ZA 2G0YA 2J8IA 4JRAC 2BM6A 2F3LA 2BM7A
chains in the Genus database with same CATH superfamily
1HF2A 1O8LA 1KTWA 2X85A 4XKWA 1QRCA 4OJ6A 1QA3A 3SZEA 2O17A 4I84A 4XM3A 4YZQA 1OFLA 2V5IA 3VMVA 2XT4A 4OJLA 4OJ5A 2PECA 1OGMX 4OM9A 1GQ8A 4EW9A 1KCDA 2NSTA 2X6XA 3AK5A 1O8EA 2VFPA 3LMWA 1EE6A 2VFOA 5C1EA 3T9GA 2VJIA 4XR6A 2INUA 2QY1A 4OZYA 4W8TA 4XORA 2UVEA 1O88A 4XLHA 2Z8GA 1WXRA 1DBGA 1QA1A 2BM5A 1PLUA 4OJPA 1K5CA 1OGOX 4XOPA 2BSPA 2NT6A 1TYUA 4HWVA 3PSSA 3EQNA 2BM4A 3SUCA 1VBLA 1OFEA 2VBKA 1JRGA 1IB4A 2NZMA 2QYUA 1IDJA 2EWEA 4Z05A 4YC5A 1HG8A 2O0WA 1TYVA 2W7ZA 4W8QA 3UW0A 1OFMA 2VFQA 3SYJA 1O8GA 2VFNA 1CZFA 4C2LA 3GQ7A 4XQFA 4YELA 1LM1A 3GRHA 1BN8A 2XC1A 3VMWA 4YZAA 1QJVA 3BH7B 1OFDA 3NAWA 1XG2A 1EZGA 3JURA 4YDTA 3LYCA 4V02C 2VJJA 4XLEA 3N6ZA 3PETA 1O8MA 1LLWA 3BH6B 1RMGA 4MXNA 4XMYA 1QRBA 3B90A 4W8SA 4XKVA 4XN0A 2B0RA 3P4GA 2O0VA 2NTPA 4XN3A 4XOTA 4Z06A 5DNSA 2IOUG 3JX8A 4OJOA 1CLWA 2G0YA 3TH0A 1H80A 1KQ5A 1IA5A 1KCCA 1L1IA 1DBOA 1O8FA 3PSZA 1EA0A 2VBMA 4U4BA 1TYXA 1PXZA 4KH3A 2PYGA 2J8KA 4PMHA 1BHEA 4URRA 3ZSCA 1O8IA 2NT9A 3GQ9A 2UVFA 3ML3A 2X3HA 4YFOA 1RU4A 4XLAA 4YZXA 2NSPA 1PE9A 1X0CA 5C1CA 1OOCA 1QA2A 3B4NA 2QXZA 3VSTA 4XONA 3FY3A 4Z03A 3NB2A 4W8RA 4NK6A 1IDKA 2BX6A 3B8YA 3LJYA 4XL9A 5JLVC 2VBEA 1QCXA 2XTYA 3ZPPA 4YEIA 2F3LA 1O8KA 2BM6A 2O6WA 2QZAA 4YZ0A 5JMCB 1TYWA 2X6YA 4YCQA 3SQVA 4OZZA 3SY2A 3GQ8A 3KRGA 4JRAC 3RIQA 4AVZA 1QQ1A 1RWRA 1K8FA 4XLCA 3N90A 4XNFA 1K4ZA 1TSPA 1O8DA 2O1DA 4NK8A 2NTQA 2J8IA 2QX3A 2XTWA 2O04A 2XT2A 2BM7A 2ODLA 1WMRA 3EQOA 3H09A 2INVA 1NHCA 4XLFA 3VSVA 2XTXA 1JTAA 4U49A 1O8JA 4YEJA 5AMVA 2PYHA 1LLZA 1DABA 2NTBA 2IQ7A 2X6WA 1O8HA 4OPWA 3WWGA 2YUHA 2VFMA 3VSUA 4MR0A 3DU1X 1AIRA 3GQAA
chains in the Genus database with same CATH topology
2BM4A 1HF2A 3TH0A 5JMCB 1KQ5A 1TYWA 1QRCA 4OJ6A 1QA3A 3SZEA 1TYXA 4JRAC 2V5IA 4KH3A 3RIQA 1QQ1A 1TYVA 2W7ZA 1K8FA 4OJLA 3N90A 2VFQA 3SYJA 4OJ5A 4OM9A 1K4ZA 1TSPA 2VFNA 3ML3A 2J8IA 2XC1A 1QA2A 2BM7A 3AK5A 2VFPA 3BH7B 3H09A 2VFOA 3LYCA 4V02C 3N6ZA 3PETA 2BX6A 1DABA 3LJYA 1QA1A 1WXRA 2BM5A 3BH6B 4OPWA 4OJPA 1QRBA 5JLVC 2YUHA 2B0RA 2VFMA 3P4GA 2G0YA 1TYUA 2IOUG 3JX8A 4OJOA 2F3LA 1CLWA 2BM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM4 A;  3N90 A;  2BM5 A;  5JLV C;  5JMC B;  2W7Z A;  2G0Y A;  2J8I A;  4JRA C;  2BM6 A;  2F3L A;  2BM7 A; 
#chains in the Genus database with same CATH topology
 1HF2 A;  1O8L A;  1KTW A;  2X85 A;  4XKW A;  1QRC A;  4OJ6 A;  1QA3 A;  3SZE A;  2O17 A;  4I84 A;  4XM3 A;  4YZQ A;  1OFL A;  2V5I A;  3VMV A;  2XT4 A;  4OJL A;  4OJ5 A;  2PEC A;  1OGM X;  4OM9 A;  1GQ8 A;  4EW9 A;  1KCD A;  2NST A;  2X6X A;  3AK5 A;  1O8E A;  2VFP A;  3LMW A;  1EE6 A;  2VFO A;  5C1E A;  3T9G A;  2VJI A;  4XR6 A;  2INU A;  2QY1 A;  4OZY A;  4W8T A;  4XOR A;  2UVE A;  1O88 A;  4XLH A;  2Z8G A;  1WXR A;  1DBG A;  1QA1 A;  2BM5 A;  1PLU A;  4OJP A;  1K5C A;  1OGO X;  4XOP A;  2BSP A;  2NT6 A;  1TYU A;  4HWV A;  3PSS A;  3EQN A;  2BM4 A;  3SUC A;  1VBL A;  1OFE A;  2VBK A;  1JRG A;  1IB4 A;  2NZM A;  2QYU A;  1IDJ A;  2EWE A;  4Z05 A;  4YC5 A;  1HG8 A;  2O0W A;  1TYV A;  2W7Z A;  4W8Q A;  3UW0 A;  1OFM A;  2VFQ A;  3SYJ A;  1O8G A;  2VFN A;  1CZF A;  4C2L A;  3GQ7 A;  4XQF A;  4YEL A;  1LM1 A;  3GRH A;  1BN8 A;  2XC1 A;  3VMW A;  4YZA A;  1QJV A;  3BH7 B;  1OFD A;  3NAW A;  1XG2 A;  1EZG A;  3JUR A;  4YDT A;  3LYC A;  4V02 C;  2VJJ A;  4XLE A;  3N6Z A;  3PET A;  1O8M A;  1LLW A;  3BH6 B;  1RMG A;  4MXN A;  4XMY A;  1QRB A;  3B90 A;  4W8S A;  4XKV A;  4XN0 A;  2B0R A;  3P4G A;  2O0V A;  2NTP A;  4XN3 A;  4XOT A;  4Z06 A;  5DNS A;  2IOU G;  3JX8 A;  4OJO A;  1CLW A;  2G0Y A;  3TH0 A;  1H80 A;  1KQ5 A;  1IA5 A;  1KCC A;  1L1I A;  1DBO A;  1O8F A;  3PSZ A;  1EA0 A;  2VBM A;  4U4B A;  1TYX A;  1PXZ A;  4KH3 A;  2PYG A;  2J8K A;  4PMH A;  1BHE A;  4URR A;  3ZSC A;  1O8I A;  2NT9 A;  3GQ9 A;  2UVF A;  3ML3 A;  2X3H A;  4YFO A;  1RU4 A;  4XLA A;  4YZX A;  2NSP A;  1PE9 A;  1X0C A;  5C1C A;  1OOC A;  1QA2 A;  3B4N A;  2QXZ A;  3VST A;  4XON A;  3FY3 A;  4Z03 A;  3NB2 A;  4W8R A;  4NK6 A;  1IDK A;  2BX6 A;  3B8Y A;  3LJY A;  4XL9 A;  5JLV C;  2VBE A;  1QCX A;  2XTY A;  3ZPP A;  4YEI A;  2F3L A;  1O8K A;  2BM6 A;  2O6W A;  2QZA A;  4YZ0 A;  5JMC B;  1TYW A;  2X6Y A;  4YCQ A;  3SQV A;  4OZZ A;  3SY2 A;  3GQ8 A;  3KRG A;  4JRA C;  3RIQ A;  4AVZ A;  1QQ1 A;  1RWR A;  1K8F A;  4XLC A;  3N90 A;  4XNF A;  1K4Z A;  1TSP A;  1O8D A;  2O1D A;  4NK8 A;  2NTQ A;  2J8I A;  2QX3 A;  2XTW A;  2O04 A;  2XT2 A;  2BM7 A;  2ODL A;  1WMR A;  3EQO A;  3H09 A;  2INV A;  1NHC A;  4XLF A;  3VSV A;  2XTX A;  1JTA A;  4U49 A;  1O8J A;  4YEJ A;  5AMV A;  2PYH A;  1LLZ A;  1DAB A;  2NTB A;  2IQ7 A;  2X6W A;  1O8H A;  4OPW A;  3WWG A;  2YUH A;  2VFM A;  3VSU A;  4MR0 A;  3DU1 X;  1AIR A;  3GQA A; 
#chains in the Genus database with same CATH homology
 2BM4 A;  1HF2 A;  3TH0 A;  5JMC B;  1KQ5 A;  1TYW A;  1QRC A;  4OJ6 A;  1QA3 A;  3SZE A;  1TYX A;  4JRA C;  2V5I A;  4KH3 A;  3RIQ A;  1QQ1 A;  1TYV A;  2W7Z A;  1K8F A;  4OJL A;  3N90 A;  2VFQ A;  3SYJ A;  4OJ5 A;  4OM9 A;  1K4Z A;  1TSP A;  2VFN A;  3ML3 A;  2J8I A;  2XC1 A;  1QA2 A;  2BM7 A;  3AK5 A;  2VFP A;  3BH7 B;  3H09 A;  2VFO A;  3LYC A;  4V02 C;  3N6Z A;  3PET A;  2BX6 A;  1DAB A;  3LJY A;  1QA1 A;  1WXR A;  2BM5 A;  3BH6 B;  4OPW A;  4OJP A;  1QRB A;  5JLV C;  2YUH A;  2B0R A;  2VFM A;  3P4G A;  2G0Y A;  1TYU A;  2IOU G;  3JX8 A;  4OJO A;  2F3L A;  1CLW A;  2BM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...