3N90A

The 1.7 angstrom resolution crystal structure of at2g44920, a pentapeptide repeat protein from arabidopsis thaliana thylakoid lumen.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
145
structure length
145
Chain Sequence
AFKGGGPYGQGVTRGQDLSGKDFSGQTLIRQDFKTSILRQANFKGAKLLGASFFDADLTGADLSEADLRGADFSLANVTKVNLTNANLEGATMMGNTSFKGSNITGADFTDVPLRDDQRVYLCKVADGVNATTGNATRDTLLCNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thylakoid lumenal 15 kDa protein 1, chloroplastic
publication title The 1.7 Angstrom resolution crystal structure of AT2G44920, a pentapeptide repeat protein from Arabidopsis thaliana thylakoid lumen.
rcsb
source organism Arabidopsis thaliana
molecule tags Unknown function
total genus 67
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3n90A00
5JMCB 5JLVC 2G0YA 3N90A 2J8IA 2F3LA 2BM5A 2BM6A 2BM7A 2BM4A 2W7ZA 4JRAC
chains in the Genus database with same CATH superfamily
1EA0A 1OGOX 2XC1A 5C1EA 5DNSA 1KCDA 1OFEA 2XTWA 4KH3A 3JURA 1O8LA 4YCQA 3ZSCA 1TYVA 1QRBA 2O17A 1DABA 1VBLA 4OJLA 3N6ZA 1TYUA 4YZXA 1O8MA 2NT9A 3KRGA 4HWVA 4YZAA 1IA5A 4URRA 4U4BA 2BM4A 2W7ZA 1X0CA 1XG2A 4XLFA 3VMVA 2VBMA 4XMYA 1OFMA 1AIRA 4W8SA 4YDTA 2G0YA 3PSSA 4Z06A 1HG8A 2O0VA 4XLEA 3VSVA 4XQFA 5JLVC 1QA1A 3PETA 1QA3A 1L1IA 5C1CA 3AK5A 1EZGA 1H80A 4XM3A 1KTWA 2NT6A 3ML3A 1K8FA 4V02C 1OFLA 4XL9A 3GQ8A 1JRGA 3SY2A 3VMWA 4YEIA 2PYGA 4MR0A 1K4ZA 2INUA 2VBKA 2X6WA 2PYHA 2BSPA 2XT2A 4YZQA 2NZMA 2UVFA 2X3HA 3SZEA 4AVZA 1O8GA 1CZFA 2QZAA 2EWEA 2O04A 4XKVA 4C2LA 2QX3A 2X85A 1QCXA 2INVA 4OJPA 4Z03A 2QY1A 1LLZA 3GQAA 4XOTA 4XORA 4EW9A 3FY3A 3SUCA 2PECA 1RMGA 3EQNA 3NB2A 4XONA 1DBOA 1K5CA 2F3LA 2ODLA 1QRCA 2NTBA 2X6YA 4XN3A 1WMRA 3H09A 2QXZA 2UVEA 1CLWA 2VFNA 3EQOA 4NK8A 2VFOA 1QJVA 2IOUG 2IQ7A 3NAWA 2NTQA 3BH7B 1O8IA 4XN0A 3SQVA 2VFQA 1HF2A 1TSPA 1DBGA 3B4NA 2J8IA 2VFMA 2VBEA 1OOCA 2NSPA 1EE6A 3GQ9A 4YELA 3P4GA 3LYCA 1TYWA 2X6XA 2BX6A 2VJJA 3LMWA 2XT4A 2J8KA 1O8KA 1RWRA 4XLCA 1OFDA 2VFPA 3PSZA 1OGMX 1RU4A 2O6WA 4XLAA 3UW0A 2B0RA 3B8YA 2NTPA 4I84A 4OZYA 4OM9A 3ZPPA 3WWGA 3JX8A 1BN8A 3LJYA 4YEJA 4YZ0A 2O1DA 1LM1A 4XNFA 4XLHA 4Z05A 1O8FA 4OZZA 1JTAA 3RIQA 1NHCA 4U49A 4OJOA 1LLWA 4XOPA 2O0WA 2XTXA 1IDJA 2NSTA 3T9GA 2BM7A 1O88A 2V5IA 5JMCB 1O8HA 4W8TA 4W8QA 1PXZA 3VSTA 2BM5A 1QQ1A 4MXNA 1TYXA 3VSUA 1QA2A 1IDKA 4OJ6A 3DU1X 1O8JA 3BH6B 4NK6A 4W8RA 4YFOA 2YUHA 1O8DA 3N90A 4YC5A 3B90A 4OJ5A 1GQ8A 2QYUA 4JRAC 4PMHA 1WXRA 5AMVA 3GRHA 4XR6A 4OPWA 3TH0A 4XKWA 3GQ7A 2Z8GA 1PLUA 1O8EA 2VJIA 1IB4A 2XTYA 1KQ5A 2BM6A 1KCCA 1BHEA 3SYJA 1PE9A
chains in the Genus database with same CATH topology
2XC1A 4OJOA 2VFQA 1HF2A 1TSPA 2J8IA 2VFMA 3SZEA 4KH3A 2BM7A 2V5IA 5JMCB 3P4GA 3SYJA 1TYVA 1QRBA 1TYWA 3LYCA 1DABA 4OJLA 3N6ZA 1TYUA 1QA2A 2BX6A 4OJPA 2BM5A 1QQ1A 1TYXA 2BM4A 2W7ZA 4OJ6A 3BH6B 5JLVC 2G0YA 2VFPA 2YUHA 3N90A 1QA1A 1QA3A 3PETA 2F3LA 2B0RA 1QRCA 4OJ5A 4OM9A 4JRAC 1WXRA 3AK5A 3JX8A 3H09A 3LJYA 1CLWA 2VFNA 3ML3A 4OPWA 3TH0A 2VFOA 1K8FA 4V02C 1KQ5A 2BM6A 2IOUG 3BH7B 3RIQA 1K4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JMC B;  5JLV C;  2G0Y A;  3N90 A;  2J8I A;  2F3L A;  2BM5 A;  2BM6 A;  2BM7 A;  2BM4 A;  2W7Z A;  4JRA C; 
#chains in the Genus database with same CATH topology
 1EA0 A;  1OGO X;  2XC1 A;  5C1E A;  5DNS A;  1KCD A;  1OFE A;  2XTW A;  4KH3 A;  3JUR A;  1O8L A;  4YCQ A;  3ZSC A;  1TYV A;  1QRB A;  2O17 A;  1DAB A;  1VBL A;  4OJL A;  3N6Z A;  1TYU A;  4YZX A;  1O8M A;  2NT9 A;  3KRG A;  4HWV A;  4YZA A;  1IA5 A;  4URR A;  4U4B A;  2BM4 A;  2W7Z A;  1X0C A;  1XG2 A;  4XLF A;  3VMV A;  2VBM A;  4XMY A;  1OFM A;  1AIR A;  4W8S A;  4YDT A;  2G0Y A;  3PSS A;  4Z06 A;  1HG8 A;  2O0V A;  4XLE A;  3VSV A;  4XQF A;  5JLV C;  1QA1 A;  3PET A;  1QA3 A;  1L1I A;  5C1C A;  3AK5 A;  1EZG A;  1H80 A;  4XM3 A;  1KTW A;  2NT6 A;  3ML3 A;  1K8F A;  4V02 C;  1OFL A;  4XL9 A;  3GQ8 A;  1JRG A;  3SY2 A;  3VMW A;  4YEI A;  2PYG A;  4MR0 A;  1K4Z A;  2INU A;  2VBK A;  2X6W A;  2PYH A;  2BSP A;  2XT2 A;  4YZQ A;  2NZM A;  2UVF A;  2X3H A;  3SZE A;  4AVZ A;  1O8G A;  1CZF A;  2QZA A;  2EWE A;  2O04 A;  4XKV A;  4C2L A;  2QX3 A;  2X85 A;  1QCX A;  2INV A;  4OJP A;  4Z03 A;  2QY1 A;  1LLZ A;  3GQA A;  4XOT A;  4XOR A;  4EW9 A;  3FY3 A;  3SUC A;  2PEC A;  1RMG A;  3EQN A;  3NB2 A;  4XON A;  1DBO A;  1K5C A;  2F3L A;  2ODL A;  1QRC A;  2NTB A;  2X6Y A;  4XN3 A;  1WMR A;  3H09 A;  2QXZ A;  2UVE A;  1CLW A;  2VFN A;  3EQO A;  4NK8 A;  2VFO A;  1QJV A;  2IOU G;  2IQ7 A;  3NAW A;  2NTQ A;  3BH7 B;  1O8I A;  4XN0 A;  3SQV A;  2VFQ A;  1HF2 A;  1TSP A;  1DBG A;  3B4N A;  2J8I A;  2VFM A;  2VBE A;  1OOC A;  2NSP A;  1EE6 A;  3GQ9 A;  4YEL A;  3P4G A;  3LYC A;  1TYW A;  2X6X A;  2BX6 A;  2VJJ A;  3LMW A;  2XT4 A;  2J8K A;  1O8K A;  1RWR A;  4XLC A;  1OFD A;  2VFP A;  3PSZ A;  1OGM X;  1RU4 A;  2O6W A;  4XLA A;  3UW0 A;  2B0R A;  3B8Y A;  2NTP A;  4I84 A;  4OZY A;  4OM9 A;  3ZPP A;  3WWG A;  3JX8 A;  1BN8 A;  3LJY A;  4YEJ A;  4YZ0 A;  2O1D A;  1LM1 A;  4XNF A;  4XLH A;  4Z05 A;  1O8F A;  4OZZ A;  1JTA A;  3RIQ A;  1NHC A;  4U49 A;  4OJO A;  1LLW A;  4XOP A;  2O0W A;  2XTX A;  1IDJ A;  2NST A;  3T9G A;  2BM7 A;  1O88 A;  2V5I A;  5JMC B;  1O8H A;  4W8T A;  4W8Q A;  1PXZ A;  3VST A;  2BM5 A;  1QQ1 A;  4MXN A;  1TYX A;  3VSU A;  1QA2 A;  1IDK A;  4OJ6 A;  3DU1 X;  1O8J A;  3BH6 B;  4NK6 A;  4W8R A;  4YFO A;  2YUH A;  1O8D A;  3N90 A;  4YC5 A;  3B90 A;  4OJ5 A;  1GQ8 A;  2QYU A;  4JRA C;  4PMH A;  1WXR A;  5AMV A;  3GRH A;  4XR6 A;  4OPW A;  3TH0 A;  4XKW A;  3GQ7 A;  2Z8G A;  1PLU A;  1O8E A;  2VJI A;  1IB4 A;  2XTY A;  1KQ5 A;  2BM6 A;  1KCC A;  1BHE A;  3SYJ A;  1PE9 A; 
#chains in the Genus database with same CATH homology
 2XC1 A;  4OJO A;  2VFQ A;  1HF2 A;  1TSP A;  2J8I A;  2VFM A;  3SZE A;  4KH3 A;  2BM7 A;  2V5I A;  5JMC B;  3P4G A;  3SYJ A;  1TYV A;  1QRB A;  1TYW A;  3LYC A;  1DAB A;  4OJL A;  3N6Z A;  1TYU A;  1QA2 A;  2BX6 A;  4OJP A;  2BM5 A;  1QQ1 A;  1TYX A;  2BM4 A;  2W7Z A;  4OJ6 A;  3BH6 B;  5JLV C;  2G0Y A;  2VFP A;  2YUH A;  3N90 A;  1QA1 A;  1QA3 A;  3PET A;  2F3L A;  2B0R A;  1QRC A;  4OJ5 A;  4OM9 A;  4JRA C;  1WXR A;  3AK5 A;  3JX8 A;  3H09 A;  3LJY A;  1CLW A;  2VFN A;  3ML3 A;  4OPW A;  3TH0 A;  2VFO A;  1K8F A;  4V02 C;  1KQ5 A;  2BM6 A;  2IOU G;  3BH7 B;  3RIQ A;  1K4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...