3N90A

The 1.7 angstrom resolution crystal structure of at2g44920, a pentapeptide repeat protein from arabidopsis thaliana thylakoid lumen.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
145
structure length
145
Chain Sequence
AFKGGGPYGQGVTRGQDLSGKDFSGQTLIRQDFKTSILRQANFKGAKLLGASFFDADLTGADLSEADLRGADFSLANVTKVNLTNANLEGATMMGNTSFKGSNITGADFTDVPLRDDQRVYLCKVADGVNATTGNATRDTLLCNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.7 Angstrom resolution crystal structure of AT2G44920, a pentapeptide repeat protein from Arabidopsis thaliana thylakoid lumen.
rcsb
source organism Arabidopsis thaliana
molecule tags Unknown function
molecule keywords Thylakoid lumenal 15 kDa protein 1, chloroplastic
total genus 67
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3n90A00
2G0YA 2F3LA 2BM7A 2BM6A 5JMCB 2W7ZA 2J8IA 2BM5A 4JRAC 5JLVC 2BM4A 3N90A
chains in the Genus database with same CATH superfamily
2PYGA 4Z05A 1OGOX 3VSVA 4C2LA 4YCQA 2XTXA 3GQ7A 3BH6B 4XLCA 2J8IA 2NT9A 4U49A 4U4BA 1RU4A 2O0VA 3VMWA 5JLVC 3LYCA 4YZQA 1KTWA 3EQNA 1X0CA 4NK8A 2NTPA 4Z03A 1OFMA 3VSUA 3WWGA 4XLHA 1O8KA 4OJOA 1QQ1A 1OGMX 2NTQA 3VSTA 4AVZA 2G0YA 4XL9A 2ODLA 4V02C 3LMWA 3SQVA 4OJ5A 4XN0A 3NAWA 2Z8GA 3KRGA 1QRBA 2INVA 3EQOA 1JRGA 1DABA 3PSSA 2VBMA 3PSZA 4Z06A 3GQ8A 1QA2A 3T9GA 2NSTA 1CZFA 1RWRA 4W8RA 1NHCA 1BN8A 4YEJA 3SZEA 1QRCA 2VBEA 4I84A 2VFNA 3NB2A 1IA5A 1XG2A 1BHEA 4MR0A 2BM4A 2O17A 1IDJA 4YEIA 2XT4A 5C1EA 1TSPA 1OFEA 3RIQA 2BM7A 2BM6A 3N6ZA 1QCXA 2QX3A 3SY2A 3SYJA 1KCCA 2BX6A 1PXZA 1CLWA 1OFDA 3JX8A 5C1CA 2NT6A 1O8JA 4XOPA 2PYHA 4EW9A 4W8SA 4XM3A 2XC1A 1DBOA 1DBGA 2QYUA 2PECA 2VJIA 1O8LA 2EWEA 1LM1A 2X6XA 3P4GA 4OJ6A 1JTAA 3ZPPA 2B0RA 3LJYA 4XONA 4YELA 4XQFA 4OJPA 4NK6A 2BSPA 4XOTA 3GRHA 3UW0A 1O8EA 3GQAA 2XTYA 1H80A 4OZZA 1OFLA 4OZYA 1HG8A 1LLZA 1KCDA 1OOCA 1QJVA 3H09A 5DNSA 1QA1A 1WMRA 4OPWA 2O0WA 2UVFA 2F3LA 1RMGA 2O6WA 3ML3A 4XLEA 1HF2A 2W7ZA 3BH7B 2X3HA 3ZSCA 2QXZA 3B8YA 4KH3A 2O04A 1O8HA 1IB4A 2INUA 3VMVA 2IQ7A 4YZXA 4XLFA 4W8QA 5JMCB 2BM5A 1O8GA 2VFPA 1VBLA 1AIRA 3N90A 1O8DA 3AK5A 2X6WA 1PLUA 2QY1A 4HWVA 1QA3A 4XN3A 2NSPA 1TYWA 1GQ8A 1EE6A 2VFMA 3GQ9A 4PMHA 4YDTA 1LLWA 2X6YA 4XMYA 1PE9A 2XT2A 1EA0A 2QZAA 2IOUG 1K4ZA 4XLAA 1O8FA 3PETA 4XORA 2X85A 2VFQA 2VJJA 4XKWA 4URRA 1WXRA 1L1IA 4MXNA 4YZ0A 1O8MA 1K5CA 1EZGA 4XR6A 2V5IA 4JRAC 4YZAA 2O1DA 2VBKA 2XTWA 1KQ5A 3DU1X 4YFOA 1O8IA 3B4NA 1O88A 1K8FA 3SUCA 4OJLA 2NTBA 4W8TA 3TH0A 4XKVA 2UVEA 1TYUA 1IDKA 1TYVA 2VFOA 3JURA 4OM9A 1TYXA 2YUHA 2NZMA 3FY3A 5AMVA 3B90A 4YC5A 2J8KA 4XNFA
chains in the Genus database with same CATH topology
3SZEA 1QRCA 2VFNA 2IOUG 3BH6B 5JMCB 2J8IA 3H09A 5JLVC 1K4ZA 1QA1A 3PETA 2BM4A 2VFQA 3LYCA 4OPWA 1WXRA 1TSPA 2F3LA 3RIQA 2BM7A 2BM6A 3ML3A 3N6ZA 3SYJA 1HF2A 2BX6A 2W7ZA 1CLWA 2V5IA 3BH7B 1QQ1A 3JX8A 4JRAC 4OJOA 1KQ5A 2G0YA 4KH3A 4V02C 2XC1A 4OJ5A 4OJ6A 1K8FA 3P4GA 2BM5A 2VFPA 4OJLA 3TH0A 1QRBA 2B0RA 3LJYA 3N90A 1TYUA 3AK5A 1TYVA 2VFOA 4OJPA 4OM9A 1TYXA 1DABA 2YUHA 1QA3A 1TYWA 1QA2A 2VFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0Y A;  2F3L A;  2BM7 A;  2BM6 A;  5JMC B;  2W7Z A;  2J8I A;  2BM5 A;  4JRA C;  5JLV C;  2BM4 A;  3N90 A; 
#chains in the Genus database with same CATH topology
 2PYG A;  4Z05 A;  1OGO X;  3VSV A;  4C2L A;  4YCQ A;  2XTX A;  3GQ7 A;  3BH6 B;  4XLC A;  2J8I A;  2NT9 A;  4U49 A;  4U4B A;  1RU4 A;  2O0V A;  3VMW A;  5JLV C;  3LYC A;  4YZQ A;  1KTW A;  3EQN A;  1X0C A;  4NK8 A;  2NTP A;  4Z03 A;  1OFM A;  3VSU A;  3WWG A;  4XLH A;  1O8K A;  4OJO A;  1QQ1 A;  1OGM X;  2NTQ A;  3VST A;  4AVZ A;  2G0Y A;  4XL9 A;  2ODL A;  4V02 C;  3LMW A;  3SQV A;  4OJ5 A;  4XN0 A;  3NAW A;  2Z8G A;  3KRG A;  1QRB A;  2INV A;  3EQO A;  1JRG A;  1DAB A;  3PSS A;  2VBM A;  3PSZ A;  4Z06 A;  3GQ8 A;  1QA2 A;  3T9G A;  2NST A;  1CZF A;  1RWR A;  4W8R A;  1NHC A;  1BN8 A;  4YEJ A;  3SZE A;  1QRC A;  2VBE A;  4I84 A;  2VFN A;  3NB2 A;  1IA5 A;  1XG2 A;  1BHE A;  4MR0 A;  2BM4 A;  2O17 A;  1IDJ A;  4YEI A;  2XT4 A;  5C1E A;  1TSP A;  1OFE A;  3RIQ A;  2BM7 A;  2BM6 A;  3N6Z A;  1QCX A;  2QX3 A;  3SY2 A;  3SYJ A;  1KCC A;  2BX6 A;  1PXZ A;  1CLW A;  1OFD A;  3JX8 A;  5C1C A;  2NT6 A;  1O8J A;  4XOP A;  2PYH A;  4EW9 A;  4W8S A;  4XM3 A;  2XC1 A;  1DBO A;  1DBG A;  2QYU A;  2PEC A;  2VJI A;  1O8L A;  2EWE A;  1LM1 A;  2X6X A;  3P4G A;  4OJ6 A;  1JTA A;  3ZPP A;  2B0R A;  3LJY A;  4XON A;  4YEL A;  4XQF A;  4OJP A;  4NK6 A;  2BSP A;  4XOT A;  3GRH A;  3UW0 A;  1O8E A;  3GQA A;  2XTY A;  1H80 A;  4OZZ A;  1OFL A;  4OZY A;  1HG8 A;  1LLZ A;  1KCD A;  1OOC A;  1QJV A;  3H09 A;  5DNS A;  1QA1 A;  1WMR A;  4OPW A;  2O0W A;  2UVF A;  2F3L A;  1RMG A;  2O6W A;  3ML3 A;  4XLE A;  1HF2 A;  2W7Z A;  3BH7 B;  2X3H A;  3ZSC A;  2QXZ A;  3B8Y A;  4KH3 A;  2O04 A;  1O8H A;  1IB4 A;  2INU A;  3VMV A;  2IQ7 A;  4YZX A;  4XLF A;  4W8Q A;  5JMC B;  2BM5 A;  1O8G A;  2VFP A;  1VBL A;  1AIR A;  3N90 A;  1O8D A;  3AK5 A;  2X6W A;  1PLU A;  2QY1 A;  4HWV A;  1QA3 A;  4XN3 A;  2NSP A;  1TYW A;  1GQ8 A;  1EE6 A;  2VFM A;  3GQ9 A;  4PMH A;  4YDT A;  1LLW A;  2X6Y A;  4XMY A;  1PE9 A;  2XT2 A;  1EA0 A;  2QZA A;  2IOU G;  1K4Z A;  4XLA A;  1O8F A;  3PET A;  4XOR A;  2X85 A;  2VFQ A;  2VJJ A;  4XKW A;  4URR A;  1WXR A;  1L1I A;  4MXN A;  4YZ0 A;  1O8M A;  1K5C A;  1EZG A;  4XR6 A;  2V5I A;  4JRA C;  4YZA A;  2O1D A;  2VBK A;  2XTW A;  1KQ5 A;  3DU1 X;  4YFO A;  1O8I A;  3B4N A;  1O88 A;  1K8F A;  3SUC A;  4OJL A;  2NTB A;  4W8T A;  3TH0 A;  4XKV A;  2UVE A;  1TYU A;  1IDK A;  1TYV A;  2VFO A;  3JUR A;  4OM9 A;  1TYX A;  2YUH A;  2NZM A;  3FY3 A;  5AMV A;  3B90 A;  4YC5 A;  2J8K A;  4XNF A; 
#chains in the Genus database with same CATH homology
 3SZE A;  1QRC A;  2VFN A;  2IOU G;  3BH6 B;  5JMC B;  2J8I A;  3H09 A;  5JLV C;  1K4Z A;  1QA1 A;  3PET A;  2BM4 A;  2VFQ A;  3LYC A;  4OPW A;  1WXR A;  1TSP A;  2F3L A;  3RIQ A;  2BM7 A;  2BM6 A;  3ML3 A;  3N6Z A;  3SYJ A;  1HF2 A;  2BX6 A;  2W7Z A;  1CLW A;  2V5I A;  3BH7 B;  1QQ1 A;  3JX8 A;  4JRA C;  4OJO A;  1KQ5 A;  2G0Y A;  4KH3 A;  4V02 C;  2XC1 A;  4OJ5 A;  4OJ6 A;  1K8F A;  3P4G A;  2BM5 A;  2VFP A;  4OJL A;  3TH0 A;  1QRB A;  2B0R A;  3LJY A;  3N90 A;  1TYU A;  3AK5 A;  1TYV A;  2VFO A;  4OJP A;  4OM9 A;  1TYX A;  1DAB A;  2YUH A;  1QA3 A;  1TYW A;  1QA2 A;  2VFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...