3N90A

The 1.7 angstrom resolution crystal structure of at2g44920, a pentapeptide repeat protein from arabidopsis thaliana thylakoid lumen.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
145
structure length
145
Chain Sequence
AFKGGGPYGQGVTRGQDLSGKDFSGQTLIRQDFKTSILRQANFKGAKLLGASFFDADLTGADLSEADLRGADFSLANVTKVNLTNANLEGATMMGNTSFKGSNITGADFTDVPLRDDQRVYLCKVADGVNATTGNATRDTLLCNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Thylakoid lumenal 15 kDa protein 1, chloroplastic
publication title The 1.7 Angstrom resolution crystal structure of AT2G44920, a pentapeptide repeat protein from Arabidopsis thaliana thylakoid lumen.
rcsb
source organism Arabidopsis thaliana
total genus 67
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3n90A00
2BM5A 4JRAC 2W7ZA 5JLVC 2BM7A 2G0YA 2F3LA 3N90A 2BM4A 2J8IA 2BM6A 5JMCB
chains in the Genus database with same CATH superfamily
2X6XA 4U49A 2O17A 3SUCA 2IOUG 4YC5A 3GQ9A 1KTWA 2INUA 3VMWA 3VSVA 4U4BA 4YFOA 2QX3A 3VSUA 2V5IA 3EQNA 3TH0A 4W8QA 2O1DA 1O8EA 4MXNA 1BN8A 5DNSA 3GRHA 4XL9A 3SZEA 4EW9A 2BM7A 2NT6A 4YELA 1X0CA 3UW0A 1O8FA 3SYJA 4YDTA 4OPWA 2BM5A 1EZGA 1CLWA 2VBKA 1JTAA 4OJOA 1QQ1A 4YZXA 4XLHA 3LJYA 1EA0A 1IB4A 1OFEA 2QYUA 4OJ6A 4XM3A 3H09A 3GQ7A 4XQFA 1AIRA 4XLAA 1QA3A 1PLUA 2VJIA 2NSTA 1O8DA 1LM1A 2VFMA 4XKWA 4XORA 4V02C 1H80A 2XTXA 2Z8GA 1IDJA 1QJVA 1VBLA 4OJPA 2BSPA 1DABA 2BM4A 3NAWA 1L1IA 2XTYA 4OM9A 4KH3A 1GQ8A 3AK5A 2BX6A 1LLZA 4Z05A 2VBEA 5AMVA 1OGOX 1QCXA 3RIQA 1OFMA 1JRGA 2INVA 2XT2A 1DBGA 2J8IA 2IQ7A 1PE9A 2O0WA 1O8IA 4XKVA 4XMYA 3EQOA 3LMWA 1HG8A 1O8LA 4YCQA 4YEIA 5C1EA 3JX8A 2PYHA 1K5CA 1O8MA 1OFLA 3B4NA 1NHCA 2VFPA 2QY1A 1O8HA 1QRBA 2F3LA 2VFOA 4I84A 4OZYA 2VFNA 2BM6A 1QRCA 3PETA 4OJ5A 4XOTA 2X85A 1TYXA 2XC1A 1RWRA 2B0RA 2XT4A 3ZPPA 4XLCA 4YZQA 4Z06A 1CZFA 2PYGA 2NTPA 3B8YA 3BH7B 2XTWA 2NTQA 2VBMA 2NZMA 3VMVA 3JURA 1KCCA 2UVFA 4YEJA 1QA1A 1O88A 1K4ZA 4XONA 1TYUA 3ZSCA 2W7ZA 2X6WA 4NK6A 3VSTA 1K8FA 1O8JA 1IA5A 3DU1X 1PXZA 1TYVA 4W8SA 1IDKA 4XLEA 1OGMX 1RU4A 4PMHA 3BH6B 3P4GA 4OZZA 2X6YA 2J8KA 2G0YA 3B90A 2ODLA 5JMCB 4XN3A 3SQVA 3ML3A 1EE6A 1DBOA 3N6ZA 3WWGA 2PECA 2YUHA 3LYCA 1O8KA 4XLFA 1QA2A 4XOPA 1WXRA 1OFDA 2O0VA 4C2LA 4XN0A 2UVEA 4YZ0A 4W8TA 4YZAA 2O04A 3GQAA 4W8RA 1XG2A 5JLVC 2NTBA 3PSZA 2EWEA 2VFQA 3FY3A 4NK8A 3PSSA 4URRA 3NB2A 3N90A 1BHEA 2NSPA 2O6WA 4HWVA 1LLWA 4OJLA 2QZAA 1KQ5A 1HF2A 3KRGA 1WMRA 2VJJA 4JRAC 1O8GA 2NT9A 2X3HA 4MR0A 5C1CA 1RMGA 2QXZA 4XNFA 3SY2A 4XR6A 4Z03A 4AVZA 1OOCA 3GQ8A 3T9GA 1TYWA 1KCDA 1TSPA
chains in the Genus database with same CATH topology
1QRCA 3N6ZA 2IOUG 3PETA 2YUHA 4OJ5A 3LYCA 1TYXA 2XC1A 2B0RA 1QA2A 1WXRA 4OJPA 1DABA 2BM4A 2V5IA 4OM9A 3AK5A 4KH3A 3BH7B 2BX6A 3TH0A 2VFOA 3RIQA 5JLVC 2VFQA 3SZEA 2BM7A 1QA1A 2J8IA 3N90A 1K4ZA 3SYJA 5JMCB 4OPWA 2BM5A 1TYUA 4OJLA 1CLWA 1KQ5A 2W7ZA 1HF2A 4OJOA 1K8FA 1QQ1A 4V02C 3LJYA 1TYVA 4JRAC 3JX8A 3ML3A 4OJ6A 3BH6B 3H09A 3P4GA 2VFPA 1QA3A 1QRBA 2F3LA 2G0YA 2VFMA 1TYWA 2VFNA 2BM6A 1TSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM5 A;  4JRA C;  2W7Z A;  5JLV C;  2BM7 A;  2G0Y A;  2F3L A;  3N90 A;  2BM4 A;  2J8I A;  2BM6 A;  5JMC B; 
#chains in the Genus database with same CATH topology
 2X6X A;  4U49 A;  2O17 A;  3SUC A;  2IOU G;  4YC5 A;  3GQ9 A;  1KTW A;  2INU A;  3VMW A;  3VSV A;  4U4B A;  4YFO A;  2QX3 A;  3VSU A;  2V5I A;  3EQN A;  3TH0 A;  4W8Q A;  2O1D A;  1O8E A;  4MXN A;  1BN8 A;  5DNS A;  3GRH A;  4XL9 A;  3SZE A;  4EW9 A;  2BM7 A;  2NT6 A;  4YEL A;  1X0C A;  3UW0 A;  1O8F A;  3SYJ A;  4YDT A;  4OPW A;  2BM5 A;  1EZG A;  1CLW A;  2VBK A;  1JTA A;  4OJO A;  1QQ1 A;  4YZX A;  4XLH A;  3LJY A;  1EA0 A;  1IB4 A;  1OFE A;  2QYU A;  4OJ6 A;  4XM3 A;  3H09 A;  3GQ7 A;  4XQF A;  1AIR A;  4XLA A;  1QA3 A;  1PLU A;  2VJI A;  2NST A;  1O8D A;  1LM1 A;  2VFM A;  4XKW A;  4XOR A;  4V02 C;  1H80 A;  2XTX A;  2Z8G A;  1IDJ A;  1QJV A;  1VBL A;  4OJP A;  2BSP A;  1DAB A;  2BM4 A;  3NAW A;  1L1I A;  2XTY A;  4OM9 A;  4KH3 A;  1GQ8 A;  3AK5 A;  2BX6 A;  1LLZ A;  4Z05 A;  2VBE A;  5AMV A;  1OGO X;  1QCX A;  3RIQ A;  1OFM A;  1JRG A;  2INV A;  2XT2 A;  1DBG A;  2J8I A;  2IQ7 A;  1PE9 A;  2O0W A;  1O8I A;  4XKV A;  4XMY A;  3EQO A;  3LMW A;  1HG8 A;  1O8L A;  4YCQ A;  4YEI A;  5C1E A;  3JX8 A;  2PYH A;  1K5C A;  1O8M A;  1OFL A;  3B4N A;  1NHC A;  2VFP A;  2QY1 A;  1O8H A;  1QRB A;  2F3L A;  2VFO A;  4I84 A;  4OZY A;  2VFN A;  2BM6 A;  1QRC A;  3PET A;  4OJ5 A;  4XOT A;  2X85 A;  1TYX A;  2XC1 A;  1RWR A;  2B0R A;  2XT4 A;  3ZPP A;  4XLC A;  4YZQ A;  4Z06 A;  1CZF A;  2PYG A;  2NTP A;  3B8Y A;  3BH7 B;  2XTW A;  2NTQ A;  2VBM A;  2NZM A;  3VMV A;  3JUR A;  1KCC A;  2UVF A;  4YEJ A;  1QA1 A;  1O88 A;  1K4Z A;  4XON A;  1TYU A;  3ZSC A;  2W7Z A;  2X6W A;  4NK6 A;  3VST A;  1K8F A;  1O8J A;  1IA5 A;  3DU1 X;  1PXZ A;  1TYV A;  4W8S A;  1IDK A;  4XLE A;  1OGM X;  1RU4 A;  4PMH A;  3BH6 B;  3P4G A;  4OZZ A;  2X6Y A;  2J8K A;  2G0Y A;  3B90 A;  2ODL A;  5JMC B;  4XN3 A;  3SQV A;  3ML3 A;  1EE6 A;  1DBO A;  3N6Z A;  3WWG A;  2PEC A;  2YUH A;  3LYC A;  1O8K A;  4XLF A;  1QA2 A;  4XOP A;  1WXR A;  1OFD A;  2O0V A;  4C2L A;  4XN0 A;  2UVE A;  4YZ0 A;  4W8T A;  4YZA A;  2O04 A;  3GQA A;  4W8R A;  1XG2 A;  5JLV C;  2NTB A;  3PSZ A;  2EWE A;  2VFQ A;  3FY3 A;  4NK8 A;  3PSS A;  4URR A;  3NB2 A;  3N90 A;  1BHE A;  2NSP A;  2O6W A;  4HWV A;  1LLW A;  4OJL A;  2QZA A;  1KQ5 A;  1HF2 A;  3KRG A;  1WMR A;  2VJJ A;  4JRA C;  1O8G A;  2NT9 A;  2X3H A;  4MR0 A;  5C1C A;  1RMG A;  2QXZ A;  4XNF A;  3SY2 A;  4XR6 A;  4Z03 A;  4AVZ A;  1OOC A;  3GQ8 A;  3T9G A;  1TYW A;  1KCD A;  1TSP A; 
#chains in the Genus database with same CATH homology
 1QRC A;  3N6Z A;  2IOU G;  3PET A;  2YUH A;  4OJ5 A;  3LYC A;  1TYX A;  2XC1 A;  2B0R A;  1QA2 A;  1WXR A;  4OJP A;  1DAB A;  2BM4 A;  2V5I A;  4OM9 A;  3AK5 A;  4KH3 A;  3BH7 B;  2BX6 A;  3TH0 A;  2VFO A;  3RIQ A;  5JLV C;  2VFQ A;  3SZE A;  2BM7 A;  1QA1 A;  2J8I A;  3N90 A;  1K4Z A;  3SYJ A;  5JMC B;  4OPW A;  2BM5 A;  1TYU A;  4OJL A;  1CLW A;  1KQ5 A;  2W7Z A;  1HF2 A;  4OJO A;  1K8F A;  1QQ1 A;  4V02 C;  3LJY A;  1TYV A;  4JRA C;  3JX8 A;  3ML3 A;  4OJ6 A;  3BH6 B;  3H09 A;  3P4G A;  2VFP A;  1QA3 A;  1QRB A;  2F3L A;  2G0Y A;  2VFM A;  1TYW A;  2VFN A;  2BM6 A;  1TSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...